data_3K9S
# 
_entry.id   3K9S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K9S         
RCSB  RCSB055725   
WWPDB D_1000055725 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K9S 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Porta, J.C.'       1 
'Vahedi-Faridi, A.' 2 
'Borgstahl, G.E.O.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Analysis of Peroxide-Soaked MnSOD Crystals Reveals Side-On Binding of Peroxide to Active-Site Manganese.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            399 
_citation.page_first                377 
_citation.page_last                 384 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20417642 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.04.031 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Porta, J.'         1 
primary 'Vahedi-Faridi, A.' 2 
primary 'Borgstahl, G.E.'   3 
# 
_cell.entry_id           3K9S 
_cell.length_a           100.849 
_cell.length_b           107.418 
_cell.length_c           180.044 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K9S 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase [Mn]' 22996.877 4   1.15.1.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'        54.938    4   ?        ? ? ? 
3 non-polymer syn 'HYDROGEN PEROXIDE'         34.015    3   ?        ? ? ? 
4 water       nat water                       18.015    478 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        MnSOD 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  PHE n 
1 19  ASP n 
1 20  LYS n 
1 21  GLN n 
1 22  THR n 
1 23  MET n 
1 24  GLU n 
1 25  ILE n 
1 26  HIS n 
1 27  HIS n 
1 28  THR n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  ALA n 
1 39  ASN n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  PRO n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  ASN n 
1 51  LEU n 
1 52  PRO n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  ILE n 
1 58  THR n 
1 59  LYS n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  PRO n 
1 65  ALA n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  ARG n 
1 73  ASN n 
1 74  ASN n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  HIS n 
1 79  ALA n 
1 80  ASN n 
1 81  HIS n 
1 82  SER n 
1 83  LEU n 
1 84  PHE n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  GLY n 
1 92  THR n 
1 93  THR n 
1 94  LEU n 
1 95  GLN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ILE n 
1 103 GLU n 
1 104 ARG n 
1 105 ASP n 
1 106 PHE n 
1 107 GLY n 
1 108 SER n 
1 109 VAL n 
1 110 ASP n 
1 111 ASN n 
1 112 PHE n 
1 113 LYS n 
1 114 ALA n 
1 115 GLU n 
1 116 PHE n 
1 117 GLU n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 SER n 
1 123 ARG n 
1 124 PHE n 
1 125 GLY n 
1 126 SER n 
1 127 GLY n 
1 128 TRP n 
1 129 ALA n 
1 130 TRP n 
1 131 LEU n 
1 132 VAL n 
1 133 LEU n 
1 134 LYS n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 VAL n 
1 142 SER n 
1 143 THR n 
1 144 ALA n 
1 145 ASN n 
1 146 GLN n 
1 147 ASP n 
1 148 SER n 
1 149 PRO n 
1 150 LEU n 
1 151 MET n 
1 152 GLY n 
1 153 GLU n 
1 154 ALA n 
1 155 ILE n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 PHE n 
1 162 PRO n 
1 163 ILE n 
1 164 MET n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 VAL n 
1 169 TRP n 
1 170 GLU n 
1 171 HIS n 
1 172 ALA n 
1 173 TYR n 
1 174 TYR n 
1 175 LEU n 
1 176 LYS n 
1 177 PHE n 
1 178 GLN n 
1 179 ASN n 
1 180 ARG n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 TYR n 
1 185 ILE n 
1 186 LYS n 
1 187 GLU n 
1 188 PHE n 
1 189 TRP n 
1 190 ASN n 
1 191 VAL n 
1 192 VAL n 
1 193 ASN n 
1 194 TRP n 
1 195 ASP n 
1 196 GLU n 
1 197 ALA n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 LYS n 
1 205 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'b3908, JW3879, sodA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               OX326A.1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTTQA10 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM_ECOLI 
_struct_ref.pdbx_db_accession          P00448 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3K9S A 1 ? 205 ? P00448 2 ? 206 ? 1 205 
2 1 3K9S B 1 ? 205 ? P00448 2 ? 206 ? 1 205 
3 1 3K9S C 1 ? 205 ? P00448 2 ? 206 ? 1 205 
4 1 3K9S D 1 ? 205 ? P00448 2 ? 206 ? 1 205 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PEO non-polymer         . 'HYDROGEN PEROXIDE'  ? 'H2 O2'          34.015  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3K9S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   53.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '50 mM Bicine pH 8.5, 25% PEG 6000, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2000-11-08 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
'Vertical focusing mirror single crystal (Si111) bent monochromator (horizontal focusing)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     3K9S 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             28.30 
_reflns.d_resolution_high            1.55 
_reflns.number_obs                   139669 
_reflns.number_all                   154389 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0822 
_reflns.pdbx_netI_over_sigmaI        10.4 
_reflns.B_iso_Wilson_estimate        13.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.61 
_reflns_shell.percent_possible_all   82 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3K9S 
_refine.ls_number_reflns_obs                     118082 
_refine.ls_number_reflns_all                     154389 
_refine.pdbx_ls_sigma_I                          2 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.30 
_refine.ls_d_res_high                            1.55 
_refine.ls_percent_reflns_obs                    88.23 
_refine.ls_R_factor_obs                          0.22926 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22711 
_refine.ls_R_factor_R_free                       0.26998 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6254 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.862 
_refine.correlation_coeff_Fo_to_Fc_free          0.830 
_refine.B_iso_mean                               6.295 
_refine.aniso_B[1][1]                            -0.05 
_refine.aniso_B[2][2]                            0.83 
_refine.aniso_B[3][3]                            -0.78 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1D5N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Anisotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.133 
_refine.pdbx_overall_ESU_R_Free                  0.108 
_refine.overall_SU_ML                            0.072 
_refine.overall_SU_B                             4.316 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6512 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             478 
_refine_hist.number_atoms_total               7000 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        28.30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.010  0.022  ? 6725 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.323  1.931  ? 9091 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.874  5.000  ? 818  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 34.302 24.568 ? 324  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 14.158 15.000 ? 1085 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 10.799 15.000 ? 24   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.089  0.200  ? 949  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.006  0.021  ? 5200 'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.783  1.500  ? 4089 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.110  2.000  ? 6510 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.809  3.000  ? 2636 'X-RAY DIFFRACTION' ? 
r_scangle_it           2.408  4.500  ? 2580 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr     1.106  3.000  ? 6725 'X-RAY DIFFRACTION' ? 
r_sphericity_free      4.733  3.000  ? 481  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded    2.264  3.000  ? 6523 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.551 
_refine_ls_shell.d_res_low                        1.591 
_refine_ls_shell.number_reflns_R_work             6479 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               66.27 
_refine_ls_shell.R_factor_R_free                  0.295 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             373 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K9S 
_struct.title                     'Crystal structure of the peroxide-bound manganese superoxide dismutase.' 
_struct.pdbx_descriptor           'Superoxide dismutase [Mn] (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K9S 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Manganese superoxide dismutase, peroxide-bound, Manganese, Metal-binding, Oxidoreductase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 3 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 19  ? LYS A 29  ? ASP A 19  LYS A 29  1 ? 11 
HELX_P HELX_P2  2  LYS A 29  ? GLU A 43  ? LYS A 29  GLU A 43  1 ? 15 
HELX_P HELX_P3  3  PRO A 52  ? ILE A 57  ? PRO A 52  ILE A 57  1 ? 6  
HELX_P HELX_P4  4  THR A 58  ? LEU A 63  ? THR A 58  LEU A 63  5 ? 6  
HELX_P HELX_P5  5  LYS A 67  ? GLY A 87  ? LYS A 67  GLY A 87  1 ? 21 
HELX_P HELX_P6  6  GLN A 95  ? GLY A 107 ? GLN A 95  GLY A 107 1 ? 13 
HELX_P HELX_P7  7  SER A 108 ? ARG A 123 ? SER A 108 ARG A 123 1 ? 16 
HELX_P HELX_P8  8  SER A 148 ? MET A 151 ? SER A 148 MET A 151 5 ? 4  
HELX_P HELX_P9  9  GLY A 152 ? GLY A 157 ? GLY A 152 GLY A 157 1 ? 6  
HELX_P HELX_P10 10 TRP A 169 ? ALA A 172 ? TRP A 169 ALA A 172 5 ? 4  
HELX_P HELX_P11 11 TYR A 173 ? GLN A 178 ? TYR A 173 GLN A 178 1 ? 6  
HELX_P HELX_P12 12 ARG A 180 ? TRP A 189 ? ARG A 180 TRP A 189 1 ? 10 
HELX_P HELX_P13 13 ASN A 193 ? LYS A 204 ? ASN A 193 LYS A 204 1 ? 12 
HELX_P HELX_P14 14 ASP B 19  ? LYS B 29  ? ASP B 19  LYS B 29  1 ? 11 
HELX_P HELX_P15 15 LYS B 29  ? GLU B 43  ? LYS B 29  GLU B 43  1 ? 15 
HELX_P HELX_P16 16 LEU B 45  ? ASN B 50  ? LEU B 45  ASN B 50  1 ? 6  
HELX_P HELX_P17 17 PRO B 52  ? ILE B 57  ? PRO B 52  ILE B 57  1 ? 6  
HELX_P HELX_P18 18 THR B 58  ? LEU B 63  ? THR B 58  LEU B 63  5 ? 6  
HELX_P HELX_P19 19 PRO B 64  ? ASP B 66  ? PRO B 64  ASP B 66  5 ? 3  
HELX_P HELX_P20 20 LYS B 67  ? GLY B 87  ? LYS B 67  GLY B 87  1 ? 21 
HELX_P HELX_P21 21 SER B 108 ? ARG B 123 ? SER B 108 ARG B 123 1 ? 16 
HELX_P HELX_P22 22 SER B 148 ? MET B 151 ? SER B 148 MET B 151 5 ? 4  
HELX_P HELX_P23 23 GLY B 152 ? GLY B 157 ? GLY B 152 GLY B 157 1 ? 6  
HELX_P HELX_P24 24 TRP B 169 ? ALA B 172 ? TRP B 169 ALA B 172 5 ? 4  
HELX_P HELX_P25 25 TYR B 173 ? GLN B 178 ? TYR B 173 GLN B 178 1 ? 6  
HELX_P HELX_P26 26 ARG B 180 ? VAL B 192 ? ARG B 180 VAL B 192 1 ? 13 
HELX_P HELX_P27 27 ASN B 193 ? LYS B 204 ? ASN B 193 LYS B 204 1 ? 12 
HELX_P HELX_P28 28 ASP C 19  ? LYS C 29  ? ASP C 19  LYS C 29  1 ? 11 
HELX_P HELX_P29 29 LYS C 29  ? GLU C 43  ? LYS C 29  GLU C 43  1 ? 15 
HELX_P HELX_P30 30 LEU C 45  ? ASN C 50  ? LEU C 45  ASN C 50  1 ? 6  
HELX_P HELX_P31 31 PRO C 52  ? ILE C 57  ? PRO C 52  ILE C 57  1 ? 6  
HELX_P HELX_P32 32 THR C 58  ? LEU C 63  ? THR C 58  LEU C 63  5 ? 6  
HELX_P HELX_P33 33 PRO C 64  ? ASP C 66  ? PRO C 64  ASP C 66  5 ? 3  
HELX_P HELX_P34 34 LYS C 67  ? GLY C 87  ? LYS C 67  GLY C 87  1 ? 21 
HELX_P HELX_P35 35 GLN C 95  ? GLY C 107 ? GLN C 95  GLY C 107 1 ? 13 
HELX_P HELX_P36 36 SER C 108 ? ARG C 123 ? SER C 108 ARG C 123 1 ? 16 
HELX_P HELX_P37 37 SER C 148 ? MET C 151 ? SER C 148 MET C 151 5 ? 4  
HELX_P HELX_P38 38 GLY C 152 ? GLY C 157 ? GLY C 152 GLY C 157 1 ? 6  
HELX_P HELX_P39 39 TRP C 169 ? ALA C 172 ? TRP C 169 ALA C 172 5 ? 4  
HELX_P HELX_P40 40 TYR C 173 ? GLN C 178 ? TYR C 173 GLN C 178 1 ? 6  
HELX_P HELX_P41 41 ARG C 180 ? VAL C 192 ? ARG C 180 VAL C 192 1 ? 13 
HELX_P HELX_P42 42 ASN C 193 ? LYS C 204 ? ASN C 193 LYS C 204 1 ? 12 
HELX_P HELX_P43 43 ASP D 19  ? LYS D 29  ? ASP D 19  LYS D 29  1 ? 11 
HELX_P HELX_P44 44 LYS D 29  ? GLU D 43  ? LYS D 29  GLU D 43  1 ? 15 
HELX_P HELX_P45 45 LEU D 45  ? ASN D 50  ? LEU D 45  ASN D 50  1 ? 6  
HELX_P HELX_P46 46 PRO D 52  ? ILE D 57  ? PRO D 52  ILE D 57  1 ? 6  
HELX_P HELX_P47 47 THR D 58  ? LEU D 63  ? THR D 58  LEU D 63  5 ? 6  
HELX_P HELX_P48 48 PRO D 64  ? ASP D 66  ? PRO D 64  ASP D 66  5 ? 3  
HELX_P HELX_P49 49 LYS D 67  ? GLY D 87  ? LYS D 67  GLY D 87  1 ? 21 
HELX_P HELX_P50 50 GLN D 95  ? GLY D 107 ? GLN D 95  GLY D 107 1 ? 13 
HELX_P HELX_P51 51 SER D 108 ? ARG D 123 ? SER D 108 ARG D 123 1 ? 16 
HELX_P HELX_P52 52 SER D 148 ? MET D 151 ? SER D 148 MET D 151 5 ? 4  
HELX_P HELX_P53 53 GLY D 152 ? GLY D 157 ? GLY D 152 GLY D 157 1 ? 6  
HELX_P HELX_P54 54 TRP D 169 ? ALA D 172 ? TRP D 169 ALA D 172 5 ? 4  
HELX_P HELX_P55 55 TYR D 173 ? GLN D 178 ? TYR D 173 GLN D 178 1 ? 6  
HELX_P HELX_P56 56 ARG D 180 ? TRP D 189 ? ARG D 180 TRP D 189 1 ? 10 
HELX_P HELX_P57 57 ASN D 193 ? LYS D 204 ? ASN D 193 LYS D 204 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 167 OD2 ? ? ? 1_555 E MN  . MN ? ? A ASP 167 A MN  206 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc2  metalc ? ? B ASP 167 OD2 ? ? ? 1_555 F MN  . MN ? ? B ASP 167 B MN  206 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc3  metalc ? ? C ASP 167 OD2 ? ? ? 1_555 H MN  . MN ? ? C ASP 167 C MN  206 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc4  metalc ? ? D ASP 167 OD2 ? ? ? 1_555 J MN  . MN ? ? D ASP 167 D MN  206 1_555 ? ? ? ? ? ? ? 1.946 ? 
metalc5  metalc ? ? F MN  .   MN  ? ? ? 1_555 G PEO . O1 ? ? B MN  206 B PEO 207 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc6  metalc ? ? H MN  .   MN  ? ? ? 1_555 I PEO . O2 ? ? C MN  206 C PEO 207 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc7  metalc ? ? H MN  .   MN  ? ? ? 1_555 I PEO . O1 ? ? C MN  206 C PEO 207 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc8  metalc ? ? J MN  .   MN  ? ? ? 1_555 K PEO . O2 ? ? D MN  206 D PEO 208 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc9  metalc ? ? J MN  .   MN  ? ? ? 1_555 K PEO . O1 ? ? D MN  206 D PEO 208 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc10 metalc ? ? E MN  .   MN  ? ? ? 1_555 L HOH . O  ? ? A MN  206 A HOH 207 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc11 metalc ? ? E MN  .   MN  ? ? ? 1_555 L HOH . O  ? ? A MN  206 A HOH 208 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc12 metalc ? ? F MN  .   MN  ? ? ? 1_555 M HOH . O  ? ? B MN  206 B HOH 208 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc13 metalc ? ? H MN  .   MN  ? ? ? 1_555 N HOH . O  ? ? C MN  206 C HOH 209 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc14 metalc ? ? H MN  .   MN  ? ? ? 1_555 N HOH . O  ? ? C MN  206 C HOH 208 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc15 metalc ? ? J MN  .   MN  ? ? ? 1_555 O HOH . O  ? ? D MN  206 D HOH 209 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc16 metalc ? ? D HIS 26  NE2 ? ? ? 1_555 J MN  . MN ? ? D HIS 26  D MN  206 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc17 metalc ? ? A HIS 26  NE2 ? ? ? 1_555 E MN  . MN ? ? A HIS 26  A MN  206 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc18 metalc ? ? D HIS 171 NE2 ? ? ? 1_555 J MN  . MN ? ? D HIS 171 D MN  206 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc19 metalc ? ? D HIS 81  NE2 ? ? ? 1_555 J MN  . MN ? ? D HIS 81  D MN  206 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc20 metalc ? ? B HIS 171 NE2 ? ? ? 1_555 F MN  . MN ? ? B HIS 171 B MN  206 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc21 metalc ? ? A HIS 81  NE2 ? ? ? 1_555 E MN  . MN ? ? A HIS 81  A MN  206 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc22 metalc ? ? B HIS 81  NE2 ? ? ? 1_555 F MN  . MN ? ? B HIS 81  B MN  206 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc23 metalc ? ? C HIS 171 NE2 ? ? ? 1_555 H MN  . MN ? ? C HIS 171 C MN  206 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc24 metalc ? ? C HIS 81  NE2 ? ? ? 1_555 H MN  . MN ? ? C HIS 81  C MN  206 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc25 metalc ? ? C HIS 26  NE2 ? ? ? 1_555 H MN  . MN ? ? C HIS 26  C MN  206 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc26 metalc ? ? B HIS 26  NE2 ? ? ? 1_555 F MN  . MN ? ? B HIS 26  B MN  206 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc27 metalc ? ? A HIS 171 NE2 ? ? ? 1_555 E MN  . MN ? ? A HIS 171 A MN  206 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc28 metalc ? ? F MN  .   MN  ? ? ? 1_555 G PEO . O2 ? ? B MN  206 B PEO 207 1_555 ? ? ? ? ? ? ? 2.582 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 3.78 
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 1.22 
3 GLU 15 C . ? GLU 15 C PRO 16 C ? PRO 16 C 1 4.27 
4 GLU 15 D . ? GLU 15 D PRO 16 D ? PRO 16 D 1 3.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 137 ? ALA A 144 ? LYS A 137 ALA A 144 
A 2 GLY A 127 ? LYS A 134 ? GLY A 127 LYS A 134 
A 3 PHE A 161 ? ASP A 167 ? PHE A 161 ASP A 167 
B 1 LEU B 138 ? ALA B 144 ? LEU B 138 ALA B 144 
B 2 GLY B 127 ? LEU B 133 ? GLY B 127 LEU B 133 
B 3 PHE B 161 ? ASP B 167 ? PHE B 161 ASP B 167 
C 1 LYS C 137 ? ALA C 144 ? LYS C 137 ALA C 144 
C 2 GLY C 127 ? LYS C 134 ? GLY C 127 LYS C 134 
C 3 PHE C 161 ? ASP C 167 ? PHE C 161 ASP C 167 
D 1 LYS D 137 ? ALA D 144 ? LYS D 137 ALA D 144 
D 2 GLY D 127 ? LYS D 134 ? GLY D 127 LYS D 134 
D 3 PHE D 161 ? ASP D 167 ? PHE D 161 ASP D 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 141 ? O VAL A 141 N TRP A 130 ? N TRP A 130 
A 2 3 N LEU A 131 ? N LEU A 131 O ILE A 163 ? O ILE A 163 
B 1 2 O VAL B 141 ? O VAL B 141 N TRP B 130 ? N TRP B 130 
B 2 3 N LEU B 131 ? N LEU B 131 O ILE B 163 ? O ILE B 163 
C 1 2 O ALA C 139 ? O ALA C 139 N VAL C 132 ? N VAL C 132 
C 2 3 N LEU C 131 ? N LEU C 131 O ILE C 163 ? O ILE C 163 
D 1 2 O VAL D 141 ? O VAL D 141 N TRP D 130 ? N TRP D 130 
D 2 3 N LEU D 131 ? N LEU D 131 O ILE D 163 ? O ILE D 163 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 206'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN B 206'  
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PEO B 207' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MN C 206'  
AC5 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PEO C 207' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN D 206'  
AC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PEO D 208' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HIS A 26  ? HIS A 26  . ? 1_555 ? 
2  AC1 6 HIS A 81  ? HIS A 81  . ? 1_555 ? 
3  AC1 6 ASP A 167 ? ASP A 167 . ? 1_555 ? 
4  AC1 6 HIS A 171 ? HIS A 171 . ? 1_555 ? 
5  AC1 6 HOH L .   ? HOH A 207 . ? 1_555 ? 
6  AC1 6 HOH L .   ? HOH A 208 . ? 1_555 ? 
7  AC2 6 HIS B 26  ? HIS B 26  . ? 1_555 ? 
8  AC2 6 HIS B 81  ? HIS B 81  . ? 1_555 ? 
9  AC2 6 ASP B 167 ? ASP B 167 . ? 1_555 ? 
10 AC2 6 HIS B 171 ? HIS B 171 . ? 1_555 ? 
11 AC2 6 PEO G .   ? PEO B 207 . ? 1_555 ? 
12 AC2 6 HOH M .   ? HOH B 208 . ? 1_555 ? 
13 AC3 8 TYR B 34  ? TYR B 34  . ? 1_555 ? 
14 AC3 8 HIS B 81  ? HIS B 81  . ? 1_555 ? 
15 AC3 8 GLN B 146 ? GLN B 146 . ? 1_555 ? 
16 AC3 8 ASP B 167 ? ASP B 167 . ? 1_555 ? 
17 AC3 8 TRP B 169 ? TRP B 169 . ? 1_555 ? 
18 AC3 8 HIS B 171 ? HIS B 171 . ? 1_555 ? 
19 AC3 8 MN  F .   ? MN  B 206 . ? 1_555 ? 
20 AC3 8 HOH M .   ? HOH B 208 . ? 1_555 ? 
21 AC4 7 HIS C 26  ? HIS C 26  . ? 1_555 ? 
22 AC4 7 HIS C 81  ? HIS C 81  . ? 1_555 ? 
23 AC4 7 ASP C 167 ? ASP C 167 . ? 1_555 ? 
24 AC4 7 HIS C 171 ? HIS C 171 . ? 1_555 ? 
25 AC4 7 PEO I .   ? PEO C 207 . ? 1_555 ? 
26 AC4 7 HOH N .   ? HOH C 208 . ? 1_555 ? 
27 AC4 7 HOH N .   ? HOH C 209 . ? 1_555 ? 
28 AC5 9 HIS C 81  ? HIS C 81  . ? 1_555 ? 
29 AC5 9 TRP C 128 ? TRP C 128 . ? 1_555 ? 
30 AC5 9 GLN C 146 ? GLN C 146 . ? 1_555 ? 
31 AC5 9 ASP C 167 ? ASP C 167 . ? 1_555 ? 
32 AC5 9 TRP C 169 ? TRP C 169 . ? 1_555 ? 
33 AC5 9 HIS C 171 ? HIS C 171 . ? 1_555 ? 
34 AC5 9 MN  H .   ? MN  C 206 . ? 1_555 ? 
35 AC5 9 HOH N .   ? HOH C 208 . ? 1_555 ? 
36 AC5 9 HOH N .   ? HOH C 209 . ? 1_555 ? 
37 AC6 6 HIS D 26  ? HIS D 26  . ? 1_555 ? 
38 AC6 6 HIS D 81  ? HIS D 81  . ? 1_555 ? 
39 AC6 6 ASP D 167 ? ASP D 167 . ? 1_555 ? 
40 AC6 6 HIS D 171 ? HIS D 171 . ? 1_555 ? 
41 AC6 6 PEO K .   ? PEO D 208 . ? 1_555 ? 
42 AC6 6 HOH O .   ? HOH D 209 . ? 1_555 ? 
43 AC7 8 TYR D 34  ? TYR D 34  . ? 1_555 ? 
44 AC7 8 HIS D 81  ? HIS D 81  . ? 1_555 ? 
45 AC7 8 GLN D 146 ? GLN D 146 . ? 1_555 ? 
46 AC7 8 ASP D 167 ? ASP D 167 . ? 1_555 ? 
47 AC7 8 TRP D 169 ? TRP D 169 . ? 1_555 ? 
48 AC7 8 HIS D 171 ? HIS D 171 . ? 1_555 ? 
49 AC7 8 MN  J .   ? MN  D 206 . ? 1_555 ? 
50 AC7 8 HOH O .   ? HOH D 209 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3K9S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K9S 
_atom_sites.fract_transf_matrix[1][1]   0.009916 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009309 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005554 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 42.603  21.085  -9.893  1.00 4.23  ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 41.381  21.081  -9.021  1.00 2.88  ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 41.525  20.007  -7.971  1.00 3.84  ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 42.205  19.022  -8.189  1.00 3.26  ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 40.153  20.777  -9.868  1.00 3.18  ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 40.124  21.646  -10.983 1.00 2.67  ? 1   SER A OG  1 
ATOM   7    N  N   . TYR A 1 2   ? 40.899  20.195  -6.821  1.00 3.41  ? 2   TYR A N   1 
ATOM   8    C  CA  . TYR A 1 2   ? 40.920  19.152  -5.804  1.00 3.50  ? 2   TYR A CA  1 
ATOM   9    C  C   . TYR A 1 2   ? 39.940  18.047  -6.174  1.00 3.91  ? 2   TYR A C   1 
ATOM   10   O  O   . TYR A 1 2   ? 38.920  18.314  -6.793  1.00 2.87  ? 2   TYR A O   1 
ATOM   11   C  CB  . TYR A 1 2   ? 40.467  19.704  -4.463  1.00 3.65  ? 2   TYR A CB  1 
ATOM   12   C  CG  . TYR A 1 2   ? 41.321  20.761  -3.813  1.00 3.10  ? 2   TYR A CG  1 
ATOM   13   C  CD1 . TYR A 1 2   ? 42.646  20.978  -4.178  1.00 3.64  ? 2   TYR A CD1 1 
ATOM   14   C  CD2 . TYR A 1 2   ? 40.779  21.542  -2.804  1.00 2.84  ? 2   TYR A CD2 1 
ATOM   15   C  CE1 . TYR A 1 2   ? 43.409  21.966  -3.538  1.00 3.22  ? 2   TYR A CE1 1 
ATOM   16   C  CE2 . TYR A 1 2   ? 41.495  22.488  -2.173  1.00 3.33  ? 2   TYR A CE2 1 
ATOM   17   C  CZ  . TYR A 1 2   ? 42.807  22.716  -2.539  1.00 3.29  ? 2   TYR A CZ  1 
ATOM   18   O  OH  . TYR A 1 2   ? 43.481  23.683  -1.831  1.00 4.24  ? 2   TYR A OH  1 
ATOM   19   N  N   . THR A 1 3   ? 40.229  16.811  -5.765  1.00 3.76  ? 3   THR A N   1 
ATOM   20   C  CA  . THR A 1 3   ? 39.271  15.736  -5.943  1.00 4.09  ? 3   THR A CA  1 
ATOM   21   C  C   . THR A 1 3   ? 39.187  14.931  -4.651  1.00 2.91  ? 3   THR A C   1 
ATOM   22   O  O   . THR A 1 3   ? 40.112  14.955  -3.832  1.00 2.71  ? 3   THR A O   1 
ATOM   23   C  CB  . THR A 1 3   ? 39.645  14.801  -7.101  1.00 4.17  ? 3   THR A CB  1 
ATOM   24   O  OG1 . THR A 1 3   ? 38.591  13.841  -7.297  1.00 10.41 ? 3   THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 3   ? 40.966  14.075  -6.792  1.00 2.12  ? 3   THR A CG2 1 
ATOM   26   N  N   . LEU A 1 4   ? 38.063  14.252  -4.460  1.00 2.75  ? 4   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 4   ? 37.891  13.366  -3.318  1.00 3.33  ? 4   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 4   ? 38.782  12.138  -3.515  1.00 3.90  ? 4   LEU A C   1 
ATOM   29   O  O   . LEU A 1 4   ? 38.655  11.453  -4.520  1.00 5.49  ? 4   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 4   ? 36.436  12.915  -3.226  1.00 3.13  ? 4   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 4   ? 36.143  11.994  -2.030  1.00 1.91  ? 4   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 4   ? 36.193  12.888  -0.791  1.00 2.27  ? 4   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 4   ? 34.786  11.379  -2.149  1.00 2.15  ? 4   LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 5   ? 39.686  11.867  -2.565  1.00 3.76  ? 5   PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 40.552  10.719  -2.783  1.00 4.34  ? 5   PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 39.784  9.432   -2.591  1.00 4.69  ? 5   PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 38.901  9.362   -1.722  1.00 5.58  ? 5   PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 41.631  10.886  -1.703  1.00 4.26  ? 5   PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 40.920  11.641  -0.582  1.00 2.83  ? 5   PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 39.964  12.568  -1.297  1.00 3.84  ? 5   PRO A CD  1 
ATOM   41   N  N   . SER A 1 6   ? 40.122  8.411   -3.377  1.00 5.36  ? 6   SER A N   1 
ATOM   42   C  CA  . SER A 1 6   ? 39.688  7.052   -3.082  1.00 5.92  ? 6   SER A CA  1 
ATOM   43   C  C   . SER A 1 6   ? 40.150  6.636   -1.677  1.00 5.87  ? 6   SER A C   1 
ATOM   44   O  O   . SER A 1 6   ? 41.250  6.957   -1.252  1.00 6.94  ? 6   SER A O   1 
ATOM   45   C  CB  . SER A 1 6   ? 40.241  6.072   -4.124  1.00 5.46  ? 6   SER A CB  1 
ATOM   46   O  OG  . SER A 1 6   ? 41.629  6.280   -4.348  1.00 5.55  ? 6   SER A OG  1 
ATOM   47   N  N   . LEU A 1 7   ? 39.292  5.930   -0.951  1.00 5.95  ? 7   LEU A N   1 
ATOM   48   C  CA  . LEU A 1 7   ? 39.686  5.335   0.321   1.00 5.70  ? 7   LEU A CA  1 
ATOM   49   C  C   . LEU A 1 7   ? 40.630  4.165   0.093   1.00 5.81  ? 7   LEU A C   1 
ATOM   50   O  O   . LEU A 1 7   ? 40.520  3.491   -0.922  1.00 5.75  ? 7   LEU A O   1 
ATOM   51   C  CB  . LEU A 1 7   ? 38.467  4.788   1.047   1.00 5.57  ? 7   LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 7   ? 37.504  5.765   1.705   1.00 5.56  ? 7   LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 7   ? 36.354  5.017   2.381   1.00 5.60  ? 7   LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 7   ? 38.256  6.665   2.692   1.00 5.78  ? 7   LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 8   ? 41.503  3.873   1.069   1.00 5.44  ? 8   PRO A N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 42.435  2.737   0.982   1.00 5.61  ? 8   PRO A CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 41.830  1.365   1.377   1.00 5.61  ? 8   PRO A C   1 
ATOM   58   O  O   . PRO A 1 8   ? 42.562  0.376   1.543   1.00 5.25  ? 8   PRO A O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 43.560  3.122   1.955   1.00 5.39  ? 8   PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 43.050  4.322   2.743   1.00 6.65  ? 8   PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 41.644  4.612   2.338   1.00 5.56  ? 8   PRO A CD  1 
ATOM   62   N  N   . TYR A 1 9   ? 40.514  1.315   1.508   1.00 5.34  ? 9   TYR A N   1 
ATOM   63   C  CA  . TYR A 1 9   ? 39.827  0.115   2.006   1.00 5.12  ? 9   TYR A CA  1 
ATOM   64   C  C   . TYR A 1 9   ? 38.350  0.337   1.769   1.00 5.27  ? 9   TYR A C   1 
ATOM   65   O  O   . TYR A 1 9   ? 37.944  1.448   1.366   1.00 5.24  ? 9   TYR A O   1 
ATOM   66   C  CB  . TYR A 1 9   ? 40.125  -0.111  3.508   1.00 5.12  ? 9   TYR A CB  1 
ATOM   67   C  CG  . TYR A 1 9   ? 40.162  1.184   4.278   1.00 4.01  ? 9   TYR A CG  1 
ATOM   68   C  CD1 . TYR A 1 9   ? 38.997  1.899   4.516   1.00 3.74  ? 9   TYR A CD1 1 
ATOM   69   C  CD2 . TYR A 1 9   ? 41.363  1.698   4.754   1.00 2.81  ? 9   TYR A CD2 1 
ATOM   70   C  CE1 . TYR A 1 9   ? 39.029  3.119   5.207   1.00 5.74  ? 9   TYR A CE1 1 
ATOM   71   C  CE2 . TYR A 1 9   ? 41.403  2.909   5.439   1.00 4.41  ? 9   TYR A CE2 1 
ATOM   72   C  CZ  . TYR A 1 9   ? 40.236  3.607   5.662   1.00 4.63  ? 9   TYR A CZ  1 
ATOM   73   O  OH  . TYR A 1 9   ? 40.278  4.818   6.340   1.00 5.20  ? 9   TYR A OH  1 
ATOM   74   N  N   . ALA A 1 10  ? 37.537  -0.694  2.002   1.00 4.50  ? 10  ALA A N   1 
ATOM   75   C  CA  . ALA A 1 10  ? 36.093  -0.580  1.850   1.00 4.76  ? 10  ALA A CA  1 
ATOM   76   C  C   . ALA A 1 10  ? 35.506  0.188   3.030   1.00 4.17  ? 10  ALA A C   1 
ATOM   77   O  O   . ALA A 1 10  ? 36.159  0.312   4.078   1.00 4.29  ? 10  ALA A O   1 
ATOM   78   C  CB  . ALA A 1 10  ? 35.473  -1.953  1.763   1.00 5.09  ? 10  ALA A CB  1 
ATOM   79   N  N   . TYR A 1 11  ? 34.265  0.659   2.882   1.00 4.09  ? 11  TYR A N   1 
ATOM   80   C  CA  . TYR A 1 11  ? 33.576  1.450   3.914   1.00 4.63  ? 11  TYR A CA  1 
ATOM   81   C  C   . TYR A 1 11  ? 33.345  0.658   5.208   1.00 5.33  ? 11  TYR A C   1 
ATOM   82   O  O   . TYR A 1 11  ? 33.114  1.243   6.273   1.00 4.89  ? 11  TYR A O   1 
ATOM   83   C  CB  . TYR A 1 11  ? 32.256  2.046   3.350   1.00 4.98  ? 11  TYR A CB  1 
ATOM   84   C  CG  . TYR A 1 11  ? 32.477  3.167   2.329   1.00 5.88  ? 11  TYR A CG  1 
ATOM   85   C  CD1 . TYR A 1 11  ? 33.121  4.343   2.697   1.00 7.23  ? 11  TYR A CD1 1 
ATOM   86   C  CD2 . TYR A 1 11  ? 32.073  3.040   0.995   1.00 7.67  ? 11  TYR A CD2 1 
ATOM   87   C  CE1 . TYR A 1 11  ? 33.358  5.358   1.765   1.00 6.59  ? 11  TYR A CE1 1 
ATOM   88   C  CE2 . TYR A 1 11  ? 32.297  4.045   0.076   1.00 7.10  ? 11  TYR A CE2 1 
ATOM   89   C  CZ  . TYR A 1 11  ? 32.938  5.207   0.466   1.00 7.45  ? 11  TYR A CZ  1 
ATOM   90   O  OH  . TYR A 1 11  ? 33.160  6.215   -0.466  1.00 8.85  ? 11  TYR A OH  1 
ATOM   91   N  N   . ASP A 1 12  ? 33.429  -0.675  5.123   1.00 5.53  ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 12  ? 33.242  -1.552  6.291   1.00 6.14  ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 12  ? 34.565  -2.111  6.852   1.00 6.04  ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 12  ? 34.585  -2.975  7.755   1.00 6.62  ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 12  ? 32.234  -2.677  5.973   1.00 6.55  ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 12  ? 32.845  -3.794  5.154   1.00 8.39  ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 12  ? 34.043  -3.698  4.810   1.00 12.12 ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 12  ? 32.127  -4.778  4.862   1.00 7.87  ? 12  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 13  ? 35.678  -1.585  6.356   1.00 5.45  ? 13  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 13  ? 37.008  -2.100  6.698   1.00 5.80  ? 13  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 13  ? 37.410  -1.884  8.153   1.00 5.89  ? 13  ALA A C   1 
ATOM   102  O  O   . ALA A 1 13  ? 38.327  -2.538  8.665   1.00 7.09  ? 13  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 13  ? 38.071  -1.488  5.761   1.00 6.03  ? 13  ALA A CB  1 
ATOM   104  N  N   . LEU A 1 14  ? 36.731  -0.964  8.826   1.00 5.74  ? 14  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 14  ? 37.106  -0.635  10.198  1.00 6.27  ? 14  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 14  ? 36.095  -1.163  11.201  1.00 6.48  ? 14  LEU A C   1 
ATOM   107  O  O   . LEU A 1 14  ? 36.154  -0.847  12.388  1.00 8.03  ? 14  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 14  ? 37.283  0.881   10.371  1.00 5.87  ? 14  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 14  ? 38.207  1.601   9.384   1.00 5.54  ? 14  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 14  ? 38.282  3.124   9.653   1.00 4.27  ? 14  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 14  ? 39.566  0.991   9.466   1.00 4.43  ? 14  LEU A CD2 1 
ATOM   112  N  N   . GLU A 1 15  ? 35.146  -1.941  10.715  1.00 6.08  ? 15  GLU A N   1 
ATOM   113  C  CA  . GLU A 1 15  ? 34.229  -2.630  11.622  1.00 5.92  ? 15  GLU A CA  1 
ATOM   114  C  C   . GLU A 1 15  ? 35.077  -3.621  12.433  1.00 5.61  ? 15  GLU A C   1 
ATOM   115  O  O   . GLU A 1 15  ? 36.099  -4.102  11.957  1.00 5.49  ? 15  GLU A O   1 
ATOM   116  C  CB  . GLU A 1 15  ? 33.141  -3.343  10.827  1.00 6.09  ? 15  GLU A CB  1 
ATOM   117  C  CG  . GLU A 1 15  ? 32.126  -2.419  10.141  1.00 5.63  ? 15  GLU A CG  1 
ATOM   118  C  CD  . GLU A 1 15  ? 31.016  -1.945  11.065  1.00 6.40  ? 15  GLU A CD  1 
ATOM   119  O  OE1 . GLU A 1 15  ? 31.053  -2.280  12.274  1.00 7.25  ? 15  GLU A OE1 1 
ATOM   120  O  OE2 . GLU A 1 15  ? 30.105  -1.233  10.581  1.00 7.33  ? 15  GLU A OE2 1 
ATOM   121  N  N   . PRO A 1 16  ? 34.665  -3.916  13.672  1.00 5.57  ? 16  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 16  ? 33.438  -3.444  14.306  1.00 5.72  ? 16  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 16  ? 33.659  -2.181  15.142  1.00 5.40  ? 16  PRO A C   1 
ATOM   124  O  O   . PRO A 1 16  ? 32.948  -1.956  16.122  1.00 5.63  ? 16  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 16  ? 33.115  -4.597  15.262  1.00 5.99  ? 16  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 16  ? 34.497  -5.002  15.744  1.00 5.68  ? 16  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 16  ? 35.433  -4.794  14.569  1.00 6.32  ? 16  PRO A CD  1 
ATOM   128  N  N   . HIS A 1 17  ? 34.638  -1.369  14.777  1.00 5.10  ? 17  HIS A N   1 
ATOM   129  C  CA  . HIS A 1 17  ? 35.028  -0.253  15.656  1.00 5.16  ? 17  HIS A CA  1 
ATOM   130  C  C   . HIS A 1 17  ? 34.427  1.074   15.211  1.00 4.93  ? 17  HIS A C   1 
ATOM   131  O  O   . HIS A 1 17  ? 33.697  1.730   15.967  1.00 5.36  ? 17  HIS A O   1 
ATOM   132  C  CB  . HIS A 1 17  ? 36.551  -0.161  15.770  1.00 5.32  ? 17  HIS A CB  1 
ATOM   133  C  CG  . HIS A 1 17  ? 37.206  -1.448  16.162  1.00 7.24  ? 17  HIS A CG  1 
ATOM   134  N  ND1 . HIS A 1 17  ? 37.065  -2.004  17.416  1.00 7.71  ? 17  HIS A ND1 1 
ATOM   135  C  CD2 . HIS A 1 17  ? 38.007  -2.290  15.465  1.00 8.14  ? 17  HIS A CD2 1 
ATOM   136  C  CE1 . HIS A 1 17  ? 37.746  -3.137  17.472  1.00 9.38  ? 17  HIS A CE1 1 
ATOM   137  N  NE2 . HIS A 1 17  ? 38.332  -3.331  16.303  1.00 10.39 ? 17  HIS A NE2 1 
ATOM   138  N  N   . PHE A 1 18  ? 34.748  1.486   13.983  1.00 5.29  ? 18  PHE A N   1 
ATOM   139  C  CA  . PHE A 1 18  ? 34.047  2.592   13.362  1.00 5.04  ? 18  PHE A CA  1 
ATOM   140  C  C   . PHE A 1 18  ? 33.022  1.984   12.413  1.00 5.33  ? 18  PHE A C   1 
ATOM   141  O  O   . PHE A 1 18  ? 33.356  1.047   11.677  1.00 6.50  ? 18  PHE A O   1 
ATOM   142  C  CB  . PHE A 1 18  ? 35.016  3.465   12.542  1.00 4.91  ? 18  PHE A CB  1 
ATOM   143  C  CG  . PHE A 1 18  ? 35.941  4.351   13.371  1.00 5.58  ? 18  PHE A CG  1 
ATOM   144  C  CD1 . PHE A 1 18  ? 35.841  4.440   14.752  1.00 6.14  ? 18  PHE A CD1 1 
ATOM   145  C  CD2 . PHE A 1 18  ? 36.891  5.130   12.730  1.00 5.26  ? 18  PHE A CD2 1 
ATOM   146  C  CE1 . PHE A 1 18  ? 36.706  5.270   15.479  1.00 6.76  ? 18  PHE A CE1 1 
ATOM   147  C  CE2 . PHE A 1 18  ? 37.748  5.960   13.439  1.00 5.69  ? 18  PHE A CE2 1 
ATOM   148  C  CZ  . PHE A 1 18  ? 37.651  6.035   14.821  1.00 6.47  ? 18  PHE A CZ  1 
ATOM   149  N  N   . ASP A 1 19  ? 31.795  2.513   12.418  1.00 4.86  ? 19  ASP A N   1 
ATOM   150  C  CA  . ASP A 1 19  ? 30.684  1.920   11.649  1.00 4.63  ? 19  ASP A CA  1 
ATOM   151  C  C   . ASP A 1 19  ? 30.716  2.267   10.158  1.00 4.77  ? 19  ASP A C   1 
ATOM   152  O  O   . ASP A 1 19  ? 31.008  3.398   9.773   1.00 4.50  ? 19  ASP A O   1 
ATOM   153  C  CB  . ASP A 1 19  ? 29.316  2.292   12.225  1.00 4.67  ? 19  ASP A CB  1 
ATOM   154  C  CG  . ASP A 1 19  ? 29.101  3.793   12.299  1.00 4.38  ? 19  ASP A CG  1 
ATOM   155  O  OD1 . ASP A 1 19  ? 29.898  4.420   13.021  1.00 4.43  ? 19  ASP A OD1 1 
ATOM   156  O  OD2 . ASP A 1 19  ? 28.167  4.343   11.662  1.00 3.25  ? 19  ASP A OD2 1 
ATOM   157  N  N   . LYS A 1 20  ? 30.309  1.304   9.339   1.00 4.89  ? 20  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 20  ? 30.313  1.469   7.879   1.00 5.10  ? 20  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 20  ? 29.388  2.579   7.353   1.00 4.91  ? 20  LYS A C   1 
ATOM   160  O  O   . LYS A 1 20  ? 29.759  3.292   6.418   1.00 5.24  ? 20  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 20  ? 30.060  0.128   7.176   1.00 5.52  ? 20  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 20  ? 28.781  -0.550  7.552   1.00 6.60  ? 20  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 20  ? 28.693  -1.930  6.924   1.00 9.05  ? 20  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 20  ? 27.407  -2.617  7.301   1.00 10.82 ? 20  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 20  ? 27.394  -2.887  8.769   1.00 12.73 ? 20  LYS A NZ  1 
ATOM   166  N  N   . GLN A 1 21  ? 28.211  2.755   7.954   1.00 4.87  ? 21  GLN A N   1 
ATOM   167  C  CA  . GLN A 1 21  ? 27.298  3.813   7.531   1.00 4.88  ? 21  GLN A CA  1 
ATOM   168  C  C   . GLN A 1 21  ? 27.974  5.185   7.654   1.00 5.16  ? 21  GLN A C   1 
ATOM   169  O  O   . GLN A 1 21  ? 27.977  5.979   6.717   1.00 5.05  ? 21  GLN A O   1 
ATOM   170  C  CB  . GLN A 1 21  ? 25.984  3.782   8.324   1.00 5.35  ? 21  GLN A CB  1 
ATOM   171  C  CG  . GLN A 1 21  ? 24.994  4.899   7.992   1.00 6.56  ? 21  GLN A CG  1 
ATOM   172  C  CD  . GLN A 1 21  ? 23.741  4.869   8.855   1.00 9.78  ? 21  GLN A CD  1 
ATOM   173  O  OE1 . GLN A 1 21  ? 22.739  5.492   8.525   1.00 13.19 ? 21  GLN A OE1 1 
ATOM   174  N  NE2 . GLN A 1 21  ? 23.804  4.161   9.972   1.00 11.16 ? 21  GLN A NE2 1 
ATOM   175  N  N   . THR A 1 22  ? 28.537  5.449   8.821   1.00 5.03  ? 22  THR A N   1 
ATOM   176  C  CA  . THR A 1 22  ? 29.308  6.663   9.031   1.00 4.95  ? 22  THR A CA  1 
ATOM   177  C  C   . THR A 1 22  ? 30.478  6.801   8.056   1.00 4.97  ? 22  THR A C   1 
ATOM   178  O  O   . THR A 1 22  ? 30.646  7.871   7.457   1.00 4.76  ? 22  THR A O   1 
ATOM   179  C  CB  . THR A 1 22  ? 29.828  6.733   10.475  1.00 5.27  ? 22  THR A CB  1 
ATOM   180  O  OG1 . THR A 1 22  ? 28.714  6.780   11.366  1.00 3.84  ? 22  THR A OG1 1 
ATOM   181  C  CG2 . THR A 1 22  ? 30.728  7.967   10.698  1.00 5.68  ? 22  THR A CG2 1 
ATOM   182  N  N   . MET A 1 23  ? 31.291  5.750   7.906   1.00 4.88  ? 23  MET A N   1 
ATOM   183  C  CA  . MET A 1 23  ? 32.448  5.834   7.025   1.00 5.02  ? 23  MET A CA  1 
ATOM   184  C  C   . MET A 1 23  ? 32.018  6.286   5.626   1.00 5.17  ? 23  MET A C   1 
ATOM   185  O  O   . MET A 1 23  ? 32.653  7.147   4.984   1.00 5.01  ? 23  MET A O   1 
ATOM   186  C  CB  . MET A 1 23  ? 33.168  4.483   6.934   1.00 5.40  ? 23  MET A CB  1 
ATOM   187  C  CG  . MET A 1 23  ? 33.931  4.062   8.184   1.00 3.93  ? 23  MET A CG  1 
ATOM   188  S  SD  . MET A 1 23  ? 35.270  5.177   8.660   1.00 4.16  ? 23  MET A SD  1 
ATOM   189  C  CE  . MET A 1 23  ? 36.307  5.097   7.205   1.00 4.26  ? 23  MET A CE  1 
ATOM   190  N  N   . GLU A 1 24  ? 30.920  5.725   5.158   1.00 4.65  ? 24  GLU A N   1 
ATOM   191  C  CA  . GLU A 1 24  ? 30.468  6.014   3.811   1.00 5.06  ? 24  GLU A CA  1 
ATOM   192  C  C   . GLU A 1 24  ? 29.932  7.425   3.676   1.00 4.59  ? 24  GLU A C   1 
ATOM   193  O  O   . GLU A 1 24  ? 30.257  8.112   2.705   1.00 4.63  ? 24  GLU A O   1 
ATOM   194  C  CB  . GLU A 1 24  ? 29.419  4.981   3.350   1.00 5.19  ? 24  GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 24  ? 28.954  5.178   1.927   1.00 6.53  ? 24  GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 24  ? 28.144  4.015   1.382   1.00 8.38  ? 24  GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 24  ? 27.979  2.991   2.084   1.00 9.36  ? 24  GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 24  ? 27.658  4.138   0.240   1.00 11.10 ? 24  GLU A OE2 1 
ATOM   199  N  N   . ILE A 1 25  ? 29.130  7.858   4.650   1.00 3.78  ? 25  ILE A N   1 
ATOM   200  C  CA  . ILE A 1 25  ? 28.550  9.209   4.653   1.00 3.44  ? 25  ILE A CA  1 
ATOM   201  C  C   . ILE A 1 25  ? 29.649  10.246  4.852   1.00 3.61  ? 25  ILE A C   1 
ATOM   202  O  O   . ILE A 1 25  ? 29.682  11.253  4.176   1.00 2.38  ? 25  ILE A O   1 
ATOM   203  C  CB  . ILE A 1 25  ? 27.467  9.356   5.763   1.00 3.89  ? 25  ILE A CB  1 
ATOM   204  C  CG1 . ILE A 1 25  ? 26.298  8.391   5.476   1.00 4.14  ? 25  ILE A CG1 1 
ATOM   205  C  CG2 . ILE A 1 25  ? 27.003  10.804  5.894   1.00 4.07  ? 25  ILE A CG2 1 
ATOM   206  C  CD1 . ILE A 1 25  ? 25.284  8.307   6.611   1.00 5.55  ? 25  ILE A CD1 1 
ATOM   207  N  N   . HIS A 1 26  ? 30.556  9.964   5.781   1.00 3.21  ? 26  HIS A N   1 
ATOM   208  C  CA  . HIS A 1 26  ? 31.621  10.892  6.127   1.00 3.74  ? 26  HIS A CA  1 
ATOM   209  C  C   . HIS A 1 26  ? 32.471  11.153  4.891   1.00 3.00  ? 26  HIS A C   1 
ATOM   210  O  O   . HIS A 1 26  ? 32.838  12.300  4.633   1.00 2.71  ? 26  HIS A O   1 
ATOM   211  C  CB  . HIS A 1 26  ? 32.476  10.278  7.232   1.00 3.66  ? 26  HIS A CB  1 
ATOM   212  C  CG  . HIS A 1 26  ? 33.281  11.265  8.023   1.00 3.35  ? 26  HIS A CG  1 
ATOM   213  N  ND1 . HIS A 1 26  ? 34.082  10.885  9.079   1.00 3.85  ? 26  HIS A ND1 1 
ATOM   214  C  CD2 . HIS A 1 26  ? 33.396  12.611  7.927   1.00 2.25  ? 26  HIS A CD2 1 
ATOM   215  C  CE1 . HIS A 1 26  ? 34.677  11.957  9.582   1.00 2.19  ? 26  HIS A CE1 1 
ATOM   216  N  NE2 . HIS A 1 26  ? 34.263  13.016  8.910   1.00 2.33  ? 26  HIS A NE2 1 
ATOM   217  N  N   . HIS A 1 27  ? 32.754  10.091  4.125   1.00 1.95  ? 27  HIS A N   1 
ATOM   218  C  CA  . HIS A 1 27  ? 33.623  10.199  2.928   1.00 1.27  ? 27  HIS A CA  1 
ATOM   219  C  C   . HIS A 1 27  ? 32.855  10.815  1.756   1.00 1.67  ? 27  HIS A C   1 
ATOM   220  O  O   . HIS A 1 27  ? 33.239  11.855  1.201   1.00 1.46  ? 27  HIS A O   1 
ATOM   221  C  CB  . HIS A 1 27  ? 34.188  8.824   2.521   1.00 1.07  ? 27  HIS A CB  1 
ATOM   222  C  CG  . HIS A 1 27  ? 35.133  8.863   1.350   1.00 1.18  ? 27  HIS A CG  1 
ATOM   223  N  ND1 . HIS A 1 27  ? 34.814  8.340   0.110   1.00 1.91  ? 27  HIS A ND1 1 
ATOM   224  C  CD2 . HIS A 1 27  ? 36.394  9.352   1.232   1.00 0.53  ? 27  HIS A CD2 1 
ATOM   225  C  CE1 . HIS A 1 27  ? 35.837  8.495   -0.710  1.00 1.36  ? 27  HIS A CE1 1 
ATOM   226  N  NE2 . HIS A 1 27  ? 36.804  9.114   -0.060  1.00 2.30  ? 27  HIS A NE2 1 
ATOM   227  N  N   . THR A 1 28  ? 31.741  10.187  1.390   1.00 1.37  ? 28  THR A N   1 
ATOM   228  C  CA  . THR A 1 28  ? 31.030  10.584  0.170   1.00 2.01  ? 28  THR A CA  1 
ATOM   229  C  C   . THR A 1 28  ? 30.189  11.852  0.286   1.00 2.12  ? 28  THR A C   1 
ATOM   230  O  O   . THR A 1 28  ? 29.810  12.444  -0.741  1.00 2.59  ? 28  THR A O   1 
ATOM   231  C  CB  . THR A 1 28  ? 30.097  9.478   -0.340  1.00 1.67  ? 28  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 28  ? 29.021  9.310   0.588   1.00 3.57  ? 28  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 28  ? 30.844  8.157   -0.532  1.00 3.42  ? 28  THR A CG2 1 
ATOM   234  N  N   . LYS A 1 29  ? 29.904  12.295  1.510   1.00 2.18  ? 29  LYS A N   1 
ATOM   235  C  CA  . LYS A 1 29  ? 29.146  13.532  1.698   1.00 2.37  ? 29  LYS A CA  1 
ATOM   236  C  C   . LYS A 1 29  ? 29.938  14.666  2.380   1.00 2.53  ? 29  LYS A C   1 
ATOM   237  O  O   . LYS A 1 29  ? 30.113  15.747  1.814   1.00 2.13  ? 29  LYS A O   1 
ATOM   238  C  CB  . LYS A 1 29  ? 27.866  13.248  2.494   1.00 3.09  ? 29  LYS A CB  1 
ATOM   239  C  CG  . LYS A 1 29  ? 27.080  12.060  1.994   1.00 3.32  ? 29  LYS A CG  1 
ATOM   240  C  CD  . LYS A 1 29  ? 26.393  12.385  0.677   1.00 6.21  ? 29  LYS A CD  1 
ATOM   241  C  CE  . LYS A 1 29  ? 25.442  11.295  0.269   1.00 7.43  ? 29  LYS A CE  1 
ATOM   242  N  NZ  . LYS A 1 29  ? 24.848  11.617  -1.046  1.00 11.62 ? 29  LYS A NZ  1 
ATOM   243  N  N   . HIS A 1 30  ? 30.429  14.433  3.587   1.00 1.86  ? 30  HIS A N   1 
ATOM   244  C  CA  . HIS A 1 30  ? 31.174  15.486  4.277   1.00 2.13  ? 30  HIS A CA  1 
ATOM   245  C  C   . HIS A 1 30  ? 32.450  15.855  3.531   1.00 2.51  ? 30  HIS A C   1 
ATOM   246  O  O   . HIS A 1 30  ? 32.638  17.018  3.152   1.00 2.01  ? 30  HIS A O   1 
ATOM   247  C  CB  . HIS A 1 30  ? 31.488  15.059  5.707   1.00 1.74  ? 30  HIS A CB  1 
ATOM   248  C  CG  . HIS A 1 30  ? 30.278  15.018  6.588   1.00 1.73  ? 30  HIS A CG  1 
ATOM   249  N  ND1 . HIS A 1 30  ? 29.857  16.106  7.325   1.00 1.65  ? 30  HIS A ND1 1 
ATOM   250  C  CD2 . HIS A 1 30  ? 29.409  14.021  6.855   1.00 1.66  ? 30  HIS A CD2 1 
ATOM   251  C  CE1 . HIS A 1 30  ? 28.775  15.775  8.008   1.00 1.85  ? 30  HIS A CE1 1 
ATOM   252  N  NE2 . HIS A 1 30  ? 28.464  14.524  7.716   1.00 1.29  ? 30  HIS A NE2 1 
ATOM   253  N  N   . HIS A 1 31  ? 33.327  14.873  3.333   1.00 1.82  ? 31  HIS A N   1 
ATOM   254  C  CA  . HIS A 1 31  ? 34.573  15.143  2.628   1.00 1.96  ? 31  HIS A CA  1 
ATOM   255  C  C   . HIS A 1 31  ? 34.338  15.670  1.201   1.00 1.95  ? 31  HIS A C   1 
ATOM   256  O  O   . HIS A 1 31  ? 34.957  16.643  0.806   1.00 1.44  ? 31  HIS A O   1 
ATOM   257  C  CB  . HIS A 1 31  ? 35.487  13.920  2.660   1.00 1.81  ? 31  HIS A CB  1 
ATOM   258  C  CG  . HIS A 1 31  ? 36.889  14.203  2.218   1.00 1.41  ? 31  HIS A CG  1 
ATOM   259  N  ND1 . HIS A 1 31  ? 37.893  13.262  2.272   1.00 1.47  ? 31  HIS A ND1 1 
ATOM   260  C  CD2 . HIS A 1 31  ? 37.450  15.331  1.718   1.00 1.42  ? 31  HIS A CD2 1 
ATOM   261  C  CE1 . HIS A 1 31  ? 39.013  13.793  1.811   1.00 1.72  ? 31  HIS A CE1 1 
ATOM   262  N  NE2 . HIS A 1 31  ? 38.772  15.050  1.473   1.00 0.93  ? 31  HIS A NE2 1 
ATOM   263  N  N   . GLN A 1 32  ? 33.443  15.035  0.443   1.00 1.16  ? 32  GLN A N   1 
ATOM   264  C  CA  . GLN A 1 32  ? 33.121  15.531  -0.894  1.00 0.81  ? 32  GLN A CA  1 
ATOM   265  C  C   . GLN A 1 32  ? 32.739  17.003  -0.856  1.00 1.19  ? 32  GLN A C   1 
ATOM   266  O  O   . GLN A 1 32  ? 33.103  17.775  -1.757  1.00 0.85  ? 32  GLN A O   1 
ATOM   267  C  CB  . GLN A 1 32  ? 31.950  14.715  -1.490  1.00 0.94  ? 32  GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 32  ? 31.567  15.082  -2.920  1.00 1.16  ? 32  GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 32  ? 32.656  14.722  -3.874  1.00 1.69  ? 32  GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 32  ? 32.897  13.543  -4.117  1.00 1.80  ? 32  GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 32  ? 33.388  15.726  -4.359  1.00 1.36  ? 32  GLN A NE2 1 
ATOM   272  N  N   . THR A 1 33  ? 31.960  17.390  0.150   1.00 1.23  ? 33  THR A N   1 
ATOM   273  C  CA  . THR A 1 33  ? 31.495  18.768  0.184   1.00 1.72  ? 33  THR A CA  1 
ATOM   274  C  C   . THR A 1 33  ? 32.634  19.783  0.412   1.00 1.53  ? 33  THR A C   1 
ATOM   275  O  O   . THR A 1 33  ? 32.608  20.868  -0.151  1.00 1.50  ? 33  THR A O   1 
ATOM   276  C  CB  . THR A 1 33  ? 30.366  18.964  1.228   1.00 1.80  ? 33  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 33  ? 29.184  18.278  0.785   1.00 2.87  ? 33  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 33  ? 30.049  20.436  1.390   1.00 2.49  ? 33  THR A CG2 1 
ATOM   279  N  N   . TYR A 1 34  ? 33.618  19.432  1.235   1.00 1.79  ? 34  TYR A N   1 
ATOM   280  C  CA  . TYR A 1 34  ? 34.796  20.286  1.435   1.00 1.95  ? 34  TYR A CA  1 
ATOM   281  C  C   . TYR A 1 34  ? 35.523  20.447  0.109   1.00 1.47  ? 34  TYR A C   1 
ATOM   282  O  O   . TYR A 1 34  ? 35.969  21.544  -0.233  1.00 1.05  ? 34  TYR A O   1 
ATOM   283  C  CB  . TYR A 1 34  ? 35.786  19.690  2.454   1.00 2.16  ? 34  TYR A CB  1 
ATOM   284  C  CG  . TYR A 1 34  ? 35.238  19.418  3.835   1.00 1.72  ? 34  TYR A CG  1 
ATOM   285  C  CD1 . TYR A 1 34  ? 34.491  20.376  4.526   1.00 1.88  ? 34  TYR A CD1 1 
ATOM   286  C  CD2 . TYR A 1 34  ? 35.489  18.201  4.455   1.00 2.58  ? 34  TYR A CD2 1 
ATOM   287  C  CE1 . TYR A 1 34  ? 33.994  20.109  5.801   1.00 3.93  ? 34  TYR A CE1 1 
ATOM   288  C  CE2 . TYR A 1 34  ? 34.988  17.924  5.717   1.00 3.68  ? 34  TYR A CE2 1 
ATOM   289  C  CZ  . TYR A 1 34  ? 34.246  18.876  6.378   1.00 3.30  ? 34  TYR A CZ  1 
ATOM   290  O  OH  . TYR A 1 34  ? 33.767  18.572  7.632   1.00 3.79  ? 34  TYR A OH  1 
ATOM   291  N  N   . VAL A 1 35  ? 35.676  19.341  -0.616  1.00 0.85  ? 35  VAL A N   1 
ATOM   292  C  CA  . VAL A 1 35  ? 36.281  19.415  -1.956  1.00 1.20  ? 35  VAL A CA  1 
ATOM   293  C  C   . VAL A 1 35  ? 35.519  20.413  -2.866  1.00 1.22  ? 35  VAL A C   1 
ATOM   294  O  O   . VAL A 1 35  ? 36.110  21.347  -3.479  1.00 1.34  ? 35  VAL A O   1 
ATOM   295  C  CB  . VAL A 1 35  ? 36.386  18.028  -2.603  1.00 0.82  ? 35  VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 35  ? 36.747  18.139  -4.106  1.00 1.82  ? 35  VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 35  ? 37.398  17.164  -1.824  1.00 1.08  ? 35  VAL A CG2 1 
ATOM   298  N  N   . ASN A 1 36  ? 34.207  20.224  -2.958  1.00 1.81  ? 36  ASN A N   1 
ATOM   299  C  CA  . ASN A 1 36  ? 33.388  21.048  -3.835  1.00 1.94  ? 36  ASN A CA  1 
ATOM   300  C  C   . ASN A 1 36  ? 33.482  22.533  -3.432  1.00 2.10  ? 36  ASN A C   1 
ATOM   301  O  O   . ASN A 1 36  ? 33.630  23.421  -4.278  1.00 1.96  ? 36  ASN A O   1 
ATOM   302  C  CB  . ASN A 1 36  ? 31.914  20.605  -3.780  1.00 1.72  ? 36  ASN A CB  1 
ATOM   303  C  CG  . ASN A 1 36  ? 31.670  19.178  -4.275  1.00 1.88  ? 36  ASN A CG  1 
ATOM   304  O  OD1 . ASN A 1 36  ? 32.543  18.528  -4.882  1.00 1.97  ? 36  ASN A OD1 1 
ATOM   305  N  ND2 . ASN A 1 36  ? 30.429  18.688  -4.050  1.00 0.50  ? 36  ASN A ND2 1 
ATOM   306  N  N   . ASN A 1 37  ? 33.372  22.812  -2.135  1.00 2.10  ? 37  ASN A N   1 
ATOM   307  C  CA  . ASN A 1 37  ? 33.369  24.193  -1.671  1.00 3.41  ? 37  ASN A CA  1 
ATOM   308  C  C   . ASN A 1 37  ? 34.718  24.849  -1.891  1.00 2.95  ? 37  ASN A C   1 
ATOM   309  O  O   . ASN A 1 37  ? 34.796  26.010  -2.251  1.00 3.13  ? 37  ASN A O   1 
ATOM   310  C  CB  . ASN A 1 37  ? 32.996  24.270  -0.189  1.00 4.06  ? 37  ASN A CB  1 
ATOM   311  C  CG  . ASN A 1 37  ? 31.543  24.002  0.051   1.00 5.70  ? 37  ASN A CG  1 
ATOM   312  O  OD1 . ASN A 1 37  ? 30.735  24.118  -0.854  1.00 6.66  ? 37  ASN A OD1 1 
ATOM   313  N  ND2 . ASN A 1 37  ? 31.197  23.666  1.278   1.00 7.24  ? 37  ASN A ND2 1 
ATOM   314  N  N   . ALA A 1 38  ? 35.790  24.098  -1.688  1.00 2.64  ? 38  ALA A N   1 
ATOM   315  C  CA  . ALA A 1 38  ? 37.109  24.672  -1.884  1.00 2.06  ? 38  ALA A CA  1 
ATOM   316  C  C   . ALA A 1 38  ? 37.356  24.959  -3.368  1.00 2.11  ? 38  ALA A C   1 
ATOM   317  O  O   . ALA A 1 38  ? 37.858  26.019  -3.728  1.00 1.92  ? 38  ALA A O   1 
ATOM   318  C  CB  . ALA A 1 38  ? 38.180  23.745  -1.297  1.00 1.85  ? 38  ALA A CB  1 
ATOM   319  N  N   . ASN A 1 39  ? 36.968  24.032  -4.236  1.00 2.06  ? 39  ASN A N   1 
ATOM   320  C  CA  . ASN A 1 39  ? 37.143  24.238  -5.679  1.00 1.80  ? 39  ASN A CA  1 
ATOM   321  C  C   . ASN A 1 39  ? 36.359  25.442  -6.151  1.00 1.82  ? 39  ASN A C   1 
ATOM   322  O  O   . ASN A 1 39  ? 36.812  26.239  -6.993  1.00 1.92  ? 39  ASN A O   1 
ATOM   323  C  CB  . ASN A 1 39  ? 36.674  23.006  -6.427  1.00 1.86  ? 39  ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 39  ? 37.728  21.934  -6.482  1.00 2.14  ? 39  ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 39  ? 38.903  22.212  -6.261  1.00 2.32  ? 39  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 39  ? 37.326  20.711  -6.772  1.00 1.02  ? 39  ASN A ND2 1 
ATOM   327  N  N   . ALA A 1 40  ? 35.166  25.591  -5.593  1.00 1.55  ? 40  ALA A N   1 
ATOM   328  C  CA  . ALA A 1 40  ? 34.337  26.725  -5.970  1.00 1.99  ? 40  ALA A CA  1 
ATOM   329  C  C   . ALA A 1 40  ? 35.019  28.024  -5.595  1.00 2.80  ? 40  ALA A C   1 
ATOM   330  O  O   . ALA A 1 40  ? 35.028  28.995  -6.364  1.00 2.26  ? 40  ALA A O   1 
ATOM   331  C  CB  . ALA A 1 40  ? 32.971  26.608  -5.280  1.00 1.92  ? 40  ALA A CB  1 
ATOM   332  N  N   . ALA A 1 41  ? 35.586  28.044  -4.391  1.00 3.03  ? 41  ALA A N   1 
ATOM   333  C  CA  . ALA A 1 41  ? 36.266  29.231  -3.908  1.00 3.48  ? 41  ALA A CA  1 
ATOM   334  C  C   . ALA A 1 41  ? 37.558  29.508  -4.688  1.00 4.11  ? 41  ALA A C   1 
ATOM   335  O  O   . ALA A 1 41  ? 37.928  30.668  -4.883  1.00 4.63  ? 41  ALA A O   1 
ATOM   336  C  CB  . ALA A 1 41  ? 36.516  29.124  -2.399  1.00 3.63  ? 41  ALA A CB  1 
ATOM   337  N  N   . LEU A 1 42  ? 38.216  28.457  -5.165  1.00 3.49  ? 42  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 42  ? 39.497  28.622  -5.877  1.00 4.13  ? 42  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 42  ? 39.387  28.865  -7.385  1.00 4.34  ? 42  LEU A C   1 
ATOM   340  O  O   . LEU A 1 42  ? 40.397  29.101  -8.043  1.00 3.47  ? 42  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 42  ? 40.395  27.420  -5.625  1.00 3.88  ? 42  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 42  ? 40.914  27.308  -4.199  1.00 3.27  ? 42  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 42  ? 41.290  25.868  -3.903  1.00 2.94  ? 42  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 42  ? 42.103  28.233  -3.947  1.00 4.86  ? 42  LEU A CD2 1 
ATOM   345  N  N   . GLU A 1 43  ? 38.178  28.829  -7.925  1.00 4.93  ? 43  GLU A N   1 
ATOM   346  C  CA  . GLU A 1 43  ? 37.985  29.054  -9.348  1.00 5.67  ? 43  GLU A CA  1 
ATOM   347  C  C   . GLU A 1 43  ? 38.564  30.393  -9.787  1.00 5.97  ? 43  GLU A C   1 
ATOM   348  O  O   . GLU A 1 43  ? 39.305  30.463  -10.783 1.00 5.72  ? 43  GLU A O   1 
ATOM   349  C  CB  . GLU A 1 43  ? 36.497  28.956  -9.707  1.00 5.63  ? 43  GLU A CB  1 
ATOM   350  C  CG  . GLU A 1 43  ? 36.174  29.360  -11.142 1.00 6.54  ? 43  GLU A CG  1 
ATOM   351  C  CD  . GLU A 1 43  ? 36.671  28.370  -12.189 1.00 6.27  ? 43  GLU A CD  1 
ATOM   352  O  OE1 . GLU A 1 43  ? 36.818  27.170  -11.893 1.00 4.46  ? 43  GLU A OE1 1 
ATOM   353  O  OE2 . GLU A 1 43  ? 36.905  28.790  -13.335 1.00 6.21  ? 43  GLU A OE2 1 
ATOM   354  N  N   . SER A 1 44  ? 38.235  31.439  -9.023  1.00 6.67  ? 44  SER A N   1 
ATOM   355  C  CA  . SER A 1 44  ? 38.694  32.806  -9.279  1.00 7.33  ? 44  SER A CA  1 
ATOM   356  C  C   . SER A 1 44  ? 40.144  33.103  -8.856  1.00 7.65  ? 44  SER A C   1 
ATOM   357  O  O   . SER A 1 44  ? 40.629  34.231  -9.043  1.00 9.07  ? 44  SER A O   1 
ATOM   358  C  CB  . SER A 1 44  ? 37.767  33.782  -8.568  1.00 7.00  ? 44  SER A CB  1 
ATOM   359  O  OG  . SER A 1 44  ? 38.013  33.746  -7.169  1.00 8.15  ? 44  SER A OG  1 
ATOM   360  N  N   . LEU A 1 45  ? 40.837  32.106  -8.308  1.00 7.82  ? 45  LEU A N   1 
ATOM   361  C  CA  . LEU A 1 45  ? 42.190  32.304  -7.806  1.00 7.64  ? 45  LEU A CA  1 
ATOM   362  C  C   . LEU A 1 45  ? 43.214  31.360  -8.438  1.00 7.94  ? 45  LEU A C   1 
ATOM   363  O  O   . LEU A 1 45  ? 43.797  30.515  -7.759  1.00 7.66  ? 45  LEU A O   1 
ATOM   364  C  CB  . LEU A 1 45  ? 42.223  32.143  -6.285  1.00 7.73  ? 45  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 45  ? 41.216  32.939  -5.445  1.00 8.04  ? 45  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 45  ? 41.226  32.398  -4.027  1.00 9.07  ? 45  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 45  ? 41.472  34.439  -5.435  1.00 10.02 ? 45  LEU A CD2 1 
ATOM   368  N  N   . PRO A 1 46  ? 43.469  31.526  -9.742  1.00 8.30  ? 46  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 46  ? 44.335  30.565  -10.425 1.00 8.60  ? 46  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 46  ? 45.724  30.414  -9.795  1.00 8.27  ? 46  PRO A C   1 
ATOM   371  O  O   . PRO A 1 46  ? 46.364  29.379  -9.955  1.00 9.00  ? 46  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 46  ? 44.422  31.110  -11.858 1.00 9.04  ? 46  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 46  ? 43.894  32.492  -11.805 1.00 8.93  ? 46  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 46  ? 43.020  32.622  -10.616 1.00 8.27  ? 46  PRO A CD  1 
ATOM   375  N  N   . GLU A 1 47  ? 46.209  31.413  -9.073  1.00 8.52  ? 47  GLU A N   1 
ATOM   376  C  CA  . GLU A 1 47  ? 47.533  31.260  -8.461  1.00 8.51  ? 47  GLU A CA  1 
ATOM   377  C  C   . GLU A 1 47  ? 47.554  30.324  -7.234  1.00 8.56  ? 47  GLU A C   1 
ATOM   378  O  O   . GLU A 1 47  ? 48.595  29.742  -6.891  1.00 10.12 ? 47  GLU A O   1 
ATOM   379  C  CB  . GLU A 1 47  ? 48.155  32.621  -8.140  1.00 9.44  ? 47  GLU A CB  1 
ATOM   380  C  CG  . GLU A 1 47  ? 47.502  33.369  -6.998  1.00 10.62 ? 47  GLU A CG  1 
ATOM   381  C  CD  . GLU A 1 47  ? 46.431  34.382  -7.434  1.00 12.81 ? 47  GLU A CD  1 
ATOM   382  O  OE1 . GLU A 1 47  ? 45.540  34.064  -8.271  1.00 13.61 ? 47  GLU A OE1 1 
ATOM   383  O  OE2 . GLU A 1 47  ? 46.473  35.514  -6.902  1.00 15.26 ? 47  GLU A OE2 1 
ATOM   384  N  N   . PHE A 1 48  ? 46.403  30.154  -6.588  1.00 8.18  ? 48  PHE A N   1 
ATOM   385  C  CA  . PHE A 1 48  ? 46.293  29.258  -5.447  1.00 7.51  ? 48  PHE A CA  1 
ATOM   386  C  C   . PHE A 1 48  ? 45.613  27.920  -5.794  1.00 7.22  ? 48  PHE A C   1 
ATOM   387  O  O   . PHE A 1 48  ? 45.838  26.911  -5.118  1.00 7.09  ? 48  PHE A O   1 
ATOM   388  C  CB  . PHE A 1 48  ? 45.535  29.949  -4.303  1.00 7.10  ? 48  PHE A CB  1 
ATOM   389  C  CG  . PHE A 1 48  ? 46.260  31.133  -3.695  1.00 8.47  ? 48  PHE A CG  1 
ATOM   390  C  CD1 . PHE A 1 48  ? 47.212  30.948  -2.701  1.00 9.38  ? 48  PHE A CD1 1 
ATOM   391  C  CD2 . PHE A 1 48  ? 45.961  32.436  -4.091  1.00 9.42  ? 48  PHE A CD2 1 
ATOM   392  C  CE1 . PHE A 1 48  ? 47.859  32.031  -2.119  1.00 10.90 ? 48  PHE A CE1 1 
ATOM   393  C  CE2 . PHE A 1 48  ? 46.614  33.530  -3.513  1.00 9.38  ? 48  PHE A CE2 1 
ATOM   394  C  CZ  . PHE A 1 48  ? 47.567  33.322  -2.532  1.00 9.81  ? 48  PHE A CZ  1 
ATOM   395  N  N   . ALA A 1 49  ? 44.780  27.915  -6.840  1.00 7.33  ? 49  ALA A N   1 
ATOM   396  C  CA  . ALA A 1 49  ? 43.907  26.757  -7.146  1.00 7.04  ? 49  ALA A CA  1 
ATOM   397  C  C   . ALA A 1 49  ? 44.642  25.421  -7.283  1.00 7.36  ? 49  ALA A C   1 
ATOM   398  O  O   . ALA A 1 49  ? 44.064  24.356  -7.039  1.00 7.62  ? 49  ALA A O   1 
ATOM   399  C  CB  . ALA A 1 49  ? 43.052  27.027  -8.397  1.00 6.93  ? 49  ALA A CB  1 
ATOM   400  N  N   . ASN A 1 50  ? 45.913  25.504  -7.684  1.00 7.51  ? 50  ASN A N   1 
ATOM   401  C  CA  . ASN A 1 50  ? 46.689  24.381  -8.198  1.00 8.13  ? 50  ASN A CA  1 
ATOM   402  C  C   . ASN A 1 50  ? 47.621  23.694  -7.212  1.00 7.35  ? 50  ASN A C   1 
ATOM   403  O  O   . ASN A 1 50  ? 48.111  22.601  -7.484  1.00 7.70  ? 50  ASN A O   1 
ATOM   404  C  CB  . ASN A 1 50  ? 47.554  24.872  -9.365  1.00 9.24  ? 50  ASN A CB  1 
ATOM   405  C  CG  . ASN A 1 50  ? 48.360  26.131  -8.996  1.00 11.39 ? 50  ASN A CG  1 
ATOM   406  O  OD1 . ASN A 1 50  ? 49.527  26.287  -9.380  1.00 15.01 ? 50  ASN A OD1 1 
ATOM   407  N  ND2 . ASN A 1 50  ? 47.734  27.024  -8.220  1.00 11.86 ? 50  ASN A ND2 1 
ATOM   408  N  N   . LEU A 1 51  ? 47.882  24.340  -6.087  1.00 6.27  ? 51  LEU A N   1 
ATOM   409  C  CA  . LEU A 1 51  ? 48.829  23.832  -5.119  1.00 5.98  ? 51  LEU A CA  1 
ATOM   410  C  C   . LEU A 1 51  ? 48.252  22.633  -4.400  1.00 5.68  ? 51  LEU A C   1 
ATOM   411  O  O   . LEU A 1 51  ? 47.033  22.521  -4.281  1.00 4.96  ? 51  LEU A O   1 
ATOM   412  C  CB  . LEU A 1 51  ? 49.107  24.902  -4.085  1.00 5.79  ? 51  LEU A CB  1 
ATOM   413  C  CG  . LEU A 1 51  ? 49.426  26.270  -4.683  1.00 6.84  ? 51  LEU A CG  1 
ATOM   414  C  CD1 . LEU A 1 51  ? 49.575  27.292  -3.587  1.00 5.05  ? 51  LEU A CD1 1 
ATOM   415  C  CD2 . LEU A 1 51  ? 50.676  26.134  -5.522  1.00 6.03  ? 51  LEU A CD2 1 
ATOM   416  N  N   . PRO A 1 52  ? 49.118  21.725  -3.915  1.00 5.48  ? 52  PRO A N   1 
ATOM   417  C  CA  . PRO A 1 52  ? 48.594  20.710  -3.012  1.00 5.01  ? 52  PRO A CA  1 
ATOM   418  C  C   . PRO A 1 52  ? 47.867  21.384  -1.850  1.00 4.07  ? 52  PRO A C   1 
ATOM   419  O  O   . PRO A 1 52  ? 48.263  22.457  -1.388  1.00 3.46  ? 52  PRO A O   1 
ATOM   420  C  CB  . PRO A 1 52  ? 49.854  19.972  -2.527  1.00 5.55  ? 52  PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 52  ? 50.900  20.274  -3.553  1.00 5.63  ? 52  PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 52  ? 50.581  21.621  -4.103  1.00 5.28  ? 52  PRO A CD  1 
ATOM   423  N  N   . VAL A 1 53  ? 46.815  20.741  -1.360  1.00 3.32  ? 53  VAL A N   1 
ATOM   424  C  CA  . VAL A 1 53  ? 46.023  21.346  -0.314  1.00 3.44  ? 53  VAL A CA  1 
ATOM   425  C  C   . VAL A 1 53  ? 46.854  21.525  0.966   1.00 3.08  ? 53  VAL A C   1 
ATOM   426  O  O   . VAL A 1 53  ? 46.653  22.494  1.701   1.00 2.96  ? 53  VAL A O   1 
ATOM   427  C  CB  . VAL A 1 53  ? 44.752  20.509  -0.054  1.00 2.79  ? 53  VAL A CB  1 
ATOM   428  C  CG1 . VAL A 1 53  ? 45.124  19.154  0.532   1.00 4.70  ? 53  VAL A CG1 1 
ATOM   429  C  CG2 . VAL A 1 53  ? 43.750  21.274  0.829   1.00 2.39  ? 53  VAL A CG2 1 
ATOM   430  N  N   . GLU A 1 54  ? 47.801  20.622  1.207   1.00 4.18  ? 54  GLU A N   1 
ATOM   431  C  CA  . GLU A 1 54  ? 48.665  20.721  2.381   1.00 4.65  ? 54  GLU A CA  1 
ATOM   432  C  C   . GLU A 1 54  ? 49.503  22.008  2.357   1.00 4.87  ? 54  GLU A C   1 
ATOM   433  O  O   . GLU A 1 54  ? 49.901  22.537  3.409   1.00 5.85  ? 54  GLU A O   1 
ATOM   434  C  CB  . GLU A 1 54  ? 49.544  19.477  2.514   0.50 4.00  ? 54  GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 54  ? 48.751  18.204  2.845   0.50 3.46  ? 54  GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 54  ? 48.100  17.558  1.617   0.50 2.83  ? 54  GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 54  ? 48.414  17.970  0.474   0.50 3.01  ? 54  GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 54  ? 47.270  16.631  1.793   0.50 3.89  ? 54  GLU A OE2 1 
ATOM   439  N  N   . GLU A 1 55  ? 49.730  22.524  1.148   1.00 5.46  ? 55  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 55  ? 50.447  23.788  0.956   1.00 5.29  ? 55  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 55  ? 49.528  24.999  1.067   1.00 5.40  ? 55  GLU A C   1 
ATOM   442  O  O   . GLU A 1 55  ? 49.873  26.004  1.669   1.00 4.18  ? 55  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 55  ? 51.136  23.821  -0.416  1.00 5.01  ? 55  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 55  ? 51.981  25.060  -0.667  1.00 7.36  ? 55  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 55  ? 52.664  25.025  -2.025  1.00 9.50  ? 55  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 55  ? 52.893  23.924  -2.553  1.00 10.90 ? 55  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 55  ? 52.979  26.096  -2.564  1.00 8.46  ? 55  GLU A OE2 1 
ATOM   448  N  N   . LEU A 1 56  ? 48.361  24.909  0.450   1.00 5.05  ? 56  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 56  ? 47.457  26.041  0.482   1.00 5.36  ? 56  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 56  ? 47.197  26.441  1.929   1.00 4.61  ? 56  LEU A C   1 
ATOM   451  O  O   . LEU A 1 56  ? 47.160  27.615  2.244   1.00 5.07  ? 56  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 56  ? 46.153  25.702  -0.246  1.00 5.44  ? 56  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 56  ? 45.081  26.793  -0.286  1.00 8.28  ? 56  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 56  ? 45.590  27.997  -1.033  1.00 8.46  ? 56  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 56  ? 43.845  26.261  -0.965  1.00 10.11 ? 56  LEU A CD2 1 
ATOM   456  N  N   . ILE A 1 57  ? 47.029  25.477  2.828   1.00 4.30  ? 57  ILE A N   1 
ATOM   457  C  CA  . ILE A 1 57  ? 46.626  25.838  4.195   1.00 3.52  ? 57  ILE A CA  1 
ATOM   458  C  C   . ILE A 1 57  ? 47.749  26.429  5.043   1.00 4.24  ? 57  ILE A C   1 
ATOM   459  O  O   . ILE A 1 57  ? 47.512  26.841  6.196   1.00 3.92  ? 57  ILE A O   1 
ATOM   460  C  CB  . ILE A 1 57  ? 45.986  24.658  4.975   1.00 2.86  ? 57  ILE A CB  1 
ATOM   461  C  CG1 . ILE A 1 57  ? 46.994  23.520  5.180   1.00 2.88  ? 57  ILE A CG1 1 
ATOM   462  C  CG2 . ILE A 1 57  ? 44.698  24.189  4.295   1.00 1.56  ? 57  ILE A CG2 1 
ATOM   463  C  CD1 . ILE A 1 57  ? 46.430  22.341  5.903   1.00 4.57  ? 57  ILE A CD1 1 
ATOM   464  N  N   . THR A 1 58  ? 48.960  26.481  4.485   1.00 5.17  ? 58  THR A N   1 
ATOM   465  C  CA  . THR A 1 58  ? 50.069  27.175  5.161   1.00 6.30  ? 58  THR A CA  1 
ATOM   466  C  C   . THR A 1 58  ? 50.162  28.613  4.675   1.00 6.57  ? 58  THR A C   1 
ATOM   467  O  O   . THR A 1 58  ? 51.000  29.384  5.163   1.00 7.62  ? 58  THR A O   1 
ATOM   468  C  CB  . THR A 1 58  ? 51.449  26.492  4.959   1.00 5.92  ? 58  THR A CB  1 
ATOM   469  O  OG1 . THR A 1 58  ? 51.880  26.652  3.600   1.00 7.96  ? 58  THR A OG1 1 
ATOM   470  C  CG2 . THR A 1 58  ? 51.420  25.020  5.346   1.00 6.75  ? 58  THR A CG2 1 
ATOM   471  N  N   . LYS A 1 59  ? 49.295  28.965  3.724   1.00 6.46  ? 59  LYS A N   1 
ATOM   472  C  CA  . LYS A 1 59  ? 49.347  30.272  3.052   1.00 6.49  ? 59  LYS A CA  1 
ATOM   473  C  C   . LYS A 1 59  ? 48.015  31.020  3.153   1.00 6.10  ? 59  LYS A C   1 
ATOM   474  O  O   . LYS A 1 59  ? 47.717  31.882  2.344   1.00 6.62  ? 59  LYS A O   1 
ATOM   475  C  CB  . LYS A 1 59  ? 49.785  30.083  1.591   1.00 7.11  ? 59  LYS A CB  1 
ATOM   476  C  CG  . LYS A 1 59  ? 50.991  29.130  1.453   1.00 7.60  ? 59  LYS A CG  1 
ATOM   477  C  CD  . LYS A 1 59  ? 51.495  29.014  0.015   1.00 7.99  ? 59  LYS A CD  1 
ATOM   478  C  CE  . LYS A 1 59  ? 52.922  28.503  0.009   1.00 8.72  ? 59  LYS A CE  1 
ATOM   479  N  NZ  . LYS A 1 59  ? 53.700  29.083  -1.109  1.00 8.24  ? 59  LYS A NZ  1 
ATOM   480  N  N   . LEU A 1 60  ? 47.217  30.721  4.173   1.00 6.05  ? 60  LEU A N   1 
ATOM   481  C  CA  . LEU A 1 60  ? 45.904  31.371  4.278   1.00 5.69  ? 60  LEU A CA  1 
ATOM   482  C  C   . LEU A 1 60  ? 45.994  32.888  4.382   1.00 6.23  ? 60  LEU A C   1 
ATOM   483  O  O   . LEU A 1 60  ? 45.144  33.598  3.833   1.00 5.58  ? 60  LEU A O   1 
ATOM   484  C  CB  . LEU A 1 60  ? 45.101  30.773  5.436   1.00 5.77  ? 60  LEU A CB  1 
ATOM   485  C  CG  . LEU A 1 60  ? 44.856  29.269  5.273   1.00 4.84  ? 60  LEU A CG  1 
ATOM   486  C  CD1 . LEU A 1 60  ? 44.488  28.632  6.613   1.00 4.62  ? 60  LEU A CD1 1 
ATOM   487  C  CD2 . LEU A 1 60  ? 43.766  29.013  4.215   1.00 3.01  ? 60  LEU A CD2 1 
ATOM   488  N  N   . ASP A 1 61  ? 47.024  33.376  5.074   1.00 6.59  ? 61  ASP A N   1 
ATOM   489  C  CA  . ASP A 1 61  ? 47.271  34.830  5.190   1.00 7.81  ? 61  ASP A CA  1 
ATOM   490  C  C   . ASP A 1 61  ? 47.540  35.546  3.856   1.00 7.97  ? 61  ASP A C   1 
ATOM   491  O  O   . ASP A 1 61  ? 47.443  36.775  3.790   1.00 8.90  ? 61  ASP A O   1 
ATOM   492  C  CB  . ASP A 1 61  ? 48.407  35.128  6.183   1.00 8.49  ? 61  ASP A CB  1 
ATOM   493  C  CG  . ASP A 1 61  ? 49.346  33.948  6.394   1.00 12.13 ? 61  ASP A CG  1 
ATOM   494  O  OD1 . ASP A 1 61  ? 49.540  33.540  7.576   1.00 16.50 ? 61  ASP A OD1 1 
ATOM   495  O  OD2 . ASP A 1 61  ? 49.893  33.421  5.394   1.00 14.30 ? 61  ASP A OD2 1 
ATOM   496  N  N   . GLN A 1 62  ? 47.894  34.790  2.819   1.00 8.01  ? 62  GLN A N   1 
ATOM   497  C  CA  . GLN A 1 62  ? 48.181  35.355  1.506   1.00 7.91  ? 62  GLN A CA  1 
ATOM   498  C  C   . GLN A 1 62  ? 46.908  35.502  0.655   1.00 8.20  ? 62  GLN A C   1 
ATOM   499  O  O   . GLN A 1 62  ? 46.916  36.196  -0.353  1.00 8.53  ? 62  GLN A O   1 
ATOM   500  C  CB  . GLN A 1 62  ? 49.231  34.513  0.752   1.00 8.39  ? 62  GLN A CB  1 
ATOM   501  C  CG  . GLN A 1 62  ? 50.557  34.248  1.497   1.00 7.98  ? 62  GLN A CG  1 
ATOM   502  C  CD  . GLN A 1 62  ? 51.546  33.438  0.653   1.00 10.71 ? 62  GLN A CD  1 
ATOM   503  O  OE1 . GLN A 1 62  ? 51.450  33.402  -0.583  1.00 14.04 ? 62  GLN A OE1 1 
ATOM   504  N  NE2 . GLN A 1 62  ? 52.508  32.795  1.316   1.00 11.96 ? 62  GLN A NE2 1 
ATOM   505  N  N   . LEU A 1 63  ? 45.817  34.841  1.045   1.00 7.71  ? 63  LEU A N   1 
ATOM   506  C  CA  . LEU A 1 63  ? 44.590  34.894  0.248   1.00 7.11  ? 63  LEU A CA  1 
ATOM   507  C  C   . LEU A 1 63  ? 43.934  36.254  0.386   1.00 7.50  ? 63  LEU A C   1 
ATOM   508  O  O   . LEU A 1 63  ? 44.156  36.952  1.370   1.00 7.42  ? 63  LEU A O   1 
ATOM   509  C  CB  . LEU A 1 63  ? 43.578  33.823  0.697   1.00 6.90  ? 63  LEU A CB  1 
ATOM   510  C  CG  . LEU A 1 63  ? 43.979  32.357  0.550   1.00 7.50  ? 63  LEU A CG  1 
ATOM   511  C  CD1 . LEU A 1 63  ? 43.200  31.527  1.581   1.00 6.97  ? 63  LEU A CD1 1 
ATOM   512  C  CD2 . LEU A 1 63  ? 43.763  31.823  -0.870  1.00 8.02  ? 63  LEU A CD2 1 
ATOM   513  N  N   . PRO A 1 64  ? 43.114  36.628  -0.604  1.00 8.03  ? 64  PRO A N   1 
ATOM   514  C  CA  . PRO A 1 64  ? 42.208  37.761  -0.434  1.00 8.04  ? 64  PRO A CA  1 
ATOM   515  C  C   . PRO A 1 64  ? 41.440  37.620  0.868   1.00 8.11  ? 64  PRO A C   1 
ATOM   516  O  O   . PRO A 1 64  ? 41.006  36.519  1.215   1.00 7.61  ? 64  PRO A O   1 
ATOM   517  C  CB  . PRO A 1 64  ? 41.225  37.586  -1.589  1.00 8.51  ? 64  PRO A CB  1 
ATOM   518  C  CG  . PRO A 1 64  ? 42.009  36.938  -2.645  1.00 8.25  ? 64  PRO A CG  1 
ATOM   519  C  CD  . PRO A 1 64  ? 42.987  36.010  -1.933  1.00 8.14  ? 64  PRO A CD  1 
ATOM   520  N  N   . ALA A 1 65  ? 41.201  38.720  1.564   1.00 8.20  ? 65  ALA A N   1 
ATOM   521  C  CA  . ALA A 1 65  ? 40.560  38.605  2.861   1.00 8.55  ? 65  ALA A CA  1 
ATOM   522  C  C   . ALA A 1 65  ? 39.183  37.941  2.773   1.00 8.34  ? 65  ALA A C   1 
ATOM   523  O  O   . ALA A 1 65  ? 38.760  37.278  3.714   1.00 8.80  ? 65  ALA A O   1 
ATOM   524  C  CB  . ALA A 1 65  ? 40.469  39.962  3.548   1.00 8.68  ? 65  ALA A CB  1 
ATOM   525  N  N   . ASP A 1 66  ? 38.482  38.116  1.653   1.00 8.05  ? 66  ASP A N   1 
ATOM   526  C  CA  . ASP A 1 66  ? 37.136  37.582  1.530   1.00 8.23  ? 66  ASP A CA  1 
ATOM   527  C  C   . ASP A 1 66  ? 37.140  36.104  1.154   1.00 7.02  ? 66  ASP A C   1 
ATOM   528  O  O   . ASP A 1 66  ? 36.087  35.486  1.063   1.00 7.46  ? 66  ASP A O   1 
ATOM   529  C  CB  . ASP A 1 66  ? 36.277  38.412  0.565   1.00 8.82  ? 66  ASP A CB  1 
ATOM   530  C  CG  . ASP A 1 66  ? 36.678  38.228  -0.897  1.00 10.50 ? 66  ASP A CG  1 
ATOM   531  O  OD1 . ASP A 1 66  ? 35.940  38.705  -1.782  1.00 12.77 ? 66  ASP A OD1 1 
ATOM   532  O  OD2 . ASP A 1 66  ? 37.728  37.618  -1.174  1.00 11.88 ? 66  ASP A OD2 1 
ATOM   533  N  N   . LYS A 1 67  ? 38.330  35.560  0.932   1.00 6.37  ? 67  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 67  ? 38.513  34.122  0.686   1.00 5.67  ? 67  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 67  ? 39.161  33.363  1.854   1.00 5.64  ? 67  LYS A C   1 
ATOM   536  O  O   . LYS A 1 67  ? 39.136  32.140  1.876   1.00 5.17  ? 67  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 67  ? 39.352  33.891  -0.565  1.00 5.98  ? 67  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 67  ? 38.772  34.483  -1.835  1.00 6.39  ? 67  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 67  ? 37.820  33.498  -2.508  1.00 7.17  ? 67  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 67  ? 37.476  33.972  -3.935  1.00 8.36  ? 67  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 67  ? 36.490  33.085  -4.608  1.00 8.83  ? 67  LYS A NZ  1 
ATOM   542  N  N   . LYS A 1 68  ? 39.751  34.076  2.809   1.00 5.59  ? 68  LYS A N   1 
ATOM   543  C  CA  . LYS A 1 68  ? 40.399  33.467  3.978   1.00 5.48  ? 68  LYS A CA  1 
ATOM   544  C  C   . LYS A 1 68  ? 39.591  32.357  4.678   1.00 4.83  ? 68  LYS A C   1 
ATOM   545  O  O   . LYS A 1 68  ? 40.066  31.238  4.890   1.00 5.43  ? 68  LYS A O   1 
ATOM   546  C  CB  . LYS A 1 68  ? 40.680  34.571  5.008   1.00 5.59  ? 68  LYS A CB  1 
ATOM   547  C  CG  . LYS A 1 68  ? 42.138  34.910  5.213   1.00 8.86  ? 68  LYS A CG  1 
ATOM   548  C  CD  . LYS A 1 68  ? 42.657  34.123  6.390   1.00 11.12 ? 68  LYS A CD  1 
ATOM   549  C  CE  . LYS A 1 68  ? 42.642  34.945  7.661   1.00 12.13 ? 68  LYS A CE  1 
ATOM   550  N  NZ  . LYS A 1 68  ? 44.025  35.248  8.076   1.00 13.10 ? 68  LYS A NZ  1 
ATOM   551  N  N   . THR A 1 69  ? 38.380  32.698  5.087   1.00 4.01  ? 69  THR A N   1 
ATOM   552  C  CA  . THR A 1 69  ? 37.599  31.816  5.934   1.00 3.25  ? 69  THR A CA  1 
ATOM   553  C  C   . THR A 1 69  ? 37.094  30.599  5.178   1.00 3.31  ? 69  THR A C   1 
ATOM   554  O  O   . THR A 1 69  ? 37.145  29.470  5.693   1.00 3.42  ? 69  THR A O   1 
ATOM   555  C  CB  . THR A 1 69  ? 36.430  32.561  6.565   0.50 2.98  ? 69  THR A CB  1 
ATOM   556  O  OG1 . THR A 1 69  ? 36.949  33.626  7.355   0.50 1.47  ? 69  THR A OG1 1 
ATOM   557  C  CG2 . THR A 1 69  ? 35.632  31.628  7.471   0.50 3.39  ? 69  THR A CG2 1 
ATOM   558  N  N   . VAL A 1 70  ? 36.599  30.819  3.968   1.00 3.47  ? 70  VAL A N   1 
ATOM   559  C  CA  . VAL A 1 70  ? 35.990  29.719  3.251   1.00 3.29  ? 70  VAL A CA  1 
ATOM   560  C  C   . VAL A 1 70  ? 37.051  28.661  2.936   1.00 2.80  ? 70  VAL A C   1 
ATOM   561  O  O   . VAL A 1 70  ? 36.771  27.472  2.979   1.00 2.22  ? 70  VAL A O   1 
ATOM   562  C  CB  . VAL A 1 70  ? 35.204  30.165  1.983   1.00 3.82  ? 70  VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 70  ? 36.128  30.748  0.935   1.00 4.66  ? 70  VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 70  ? 34.346  29.000  1.417   1.00 4.96  ? 70  VAL A CG2 1 
ATOM   565  N  N   . LEU A 1 71  ? 38.275  29.097  2.655   1.00 2.00  ? 71  LEU A N   1 
ATOM   566  C  CA  . LEU A 1 71  ? 39.330  28.152  2.356   1.00 1.82  ? 71  LEU A CA  1 
ATOM   567  C  C   . LEU A 1 71  ? 39.966  27.556  3.618   1.00 1.87  ? 71  LEU A C   1 
ATOM   568  O  O   . LEU A 1 71  ? 40.324  26.392  3.619   1.00 2.05  ? 71  LEU A O   1 
ATOM   569  C  CB  . LEU A 1 71  ? 40.366  28.767  1.409   1.00 1.32  ? 71  LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 71  ? 39.810  28.768  -0.027  1.00 1.14  ? 71  LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 71  ? 40.659  29.662  -0.928  1.00 2.37  ? 71  LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 71  ? 39.768  27.342  -0.576  1.00 2.30  ? 71  LEU A CD2 1 
ATOM   573  N  N   . ARG A 1 72  ? 40.088  28.337  4.691   1.00 1.57  ? 72  ARG A N   1 
ATOM   574  C  CA  . ARG A 1 72  ? 40.481  27.768  5.962   1.00 1.93  ? 72  ARG A CA  1 
ATOM   575  C  C   . ARG A 1 72  ? 39.569  26.575  6.250   1.00 2.01  ? 72  ARG A C   1 
ATOM   576  O  O   . ARG A 1 72  ? 40.039  25.480  6.559   1.00 2.02  ? 72  ARG A O   1 
ATOM   577  C  CB  . ARG A 1 72  ? 40.351  28.808  7.071   1.00 2.49  ? 72  ARG A CB  1 
ATOM   578  C  CG  . ARG A 1 72  ? 40.592  28.304  8.476   1.00 3.05  ? 72  ARG A CG  1 
ATOM   579  C  CD  . ARG A 1 72  ? 40.207  29.437  9.392   1.00 5.01  ? 72  ARG A CD  1 
ATOM   580  N  NE  . ARG A 1 72  ? 40.394  29.160  10.803  1.00 4.76  ? 72  ARG A NE  1 
ATOM   581  C  CZ  . ARG A 1 72  ? 40.495  30.123  11.714  1.00 4.89  ? 72  ARG A CZ  1 
ATOM   582  N  NH1 . ARG A 1 72  ? 40.461  31.406  11.328  1.00 5.90  ? 72  ARG A NH1 1 
ATOM   583  N  NH2 . ARG A 1 72  ? 40.646  29.813  12.983  1.00 2.32  ? 72  ARG A NH2 1 
ATOM   584  N  N   . ASN A 1 73  ? 38.262  26.795  6.135   1.00 1.88  ? 73  ASN A N   1 
ATOM   585  C  CA  . ASN A 1 73  ? 37.312  25.754  6.489   1.00 2.12  ? 73  ASN A CA  1 
ATOM   586  C  C   . ASN A 1 73  ? 37.343  24.585  5.536   1.00 1.80  ? 73  ASN A C   1 
ATOM   587  O  O   . ASN A 1 73  ? 37.386  23.448  5.964   1.00 2.11  ? 73  ASN A O   1 
ATOM   588  C  CB  . ASN A 1 73  ? 35.902  26.329  6.548   1.00 1.64  ? 73  ASN A CB  1 
ATOM   589  C  CG  . ASN A 1 73  ? 35.715  27.253  7.744   1.00 1.97  ? 73  ASN A CG  1 
ATOM   590  O  OD1 . ASN A 1 73  ? 36.507  27.222  8.692   1.00 1.60  ? 73  ASN A OD1 1 
ATOM   591  N  ND2 . ASN A 1 73  ? 34.666  28.078  7.705   1.00 2.36  ? 73  ASN A ND2 1 
ATOM   592  N  N   . ASN A 1 74  ? 37.340  24.867  4.242   1.00 1.89  ? 74  ASN A N   1 
ATOM   593  C  CA  . ASN A 1 74  ? 37.197  23.802  3.269   1.00 2.05  ? 74  ASN A CA  1 
ATOM   594  C  C   . ASN A 1 74  ? 38.465  23.159  2.780   1.00 2.21  ? 74  ASN A C   1 
ATOM   595  O  O   . ASN A 1 74  ? 38.506  21.932  2.581   1.00 2.58  ? 74  ASN A O   1 
ATOM   596  C  CB  . ASN A 1 74  ? 36.292  24.212  2.116   1.00 2.24  ? 74  ASN A CB  1 
ATOM   597  C  CG  . ASN A 1 74  ? 34.891  24.382  2.569   1.00 3.09  ? 74  ASN A CG  1 
ATOM   598  O  OD1 . ASN A 1 74  ? 34.187  23.394  2.837   1.00 3.22  ? 74  ASN A OD1 1 
ATOM   599  N  ND2 . ASN A 1 74  ? 34.474  25.630  2.721   1.00 4.20  ? 74  ASN A ND2 1 
ATOM   600  N  N   . ALA A 1 75  ? 39.510  23.961  2.604   1.00 2.61  ? 75  ALA A N   1 
ATOM   601  C  CA  . ALA A 1 75  ? 40.823  23.361  2.303   1.00 1.88  ? 75  ALA A CA  1 
ATOM   602  C  C   . ALA A 1 75  ? 41.348  22.664  3.566   1.00 1.89  ? 75  ALA A C   1 
ATOM   603  O  O   . ALA A 1 75  ? 41.949  21.586  3.505   1.00 1.70  ? 75  ALA A O   1 
ATOM   604  C  CB  . ALA A 1 75  ? 41.790  24.408  1.789   1.00 2.80  ? 75  ALA A CB  1 
ATOM   605  N  N   . GLY A 1 76  ? 41.062  23.249  4.720   1.00 1.59  ? 76  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 76  ? 41.344  22.565  5.995   1.00 1.27  ? 76  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 76  ? 40.647  21.205  6.038   1.00 2.26  ? 76  GLY A C   1 
ATOM   608  O  O   . GLY A 1 76  ? 41.259  20.176  6.333   1.00 1.79  ? 76  GLY A O   1 
ATOM   609  N  N   . GLY A 1 77  ? 39.362  21.191  5.707   1.00 2.04  ? 77  GLY A N   1 
ATOM   610  C  CA  . GLY A 1 77  ? 38.626  19.944  5.771   1.00 1.33  ? 77  GLY A CA  1 
ATOM   611  C  C   . GLY A 1 77  ? 39.178  18.923  4.797   1.00 1.85  ? 77  GLY A C   1 
ATOM   612  O  O   . GLY A 1 77  ? 39.256  17.745  5.109   1.00 0.72  ? 77  GLY A O   1 
ATOM   613  N  N   . HIS A 1 78  ? 39.592  19.377  3.611   1.00 1.36  ? 78  HIS A N   1 
ATOM   614  C  CA  . HIS A 1 78  ? 40.090  18.443  2.611   1.00 1.59  ? 78  HIS A CA  1 
ATOM   615  C  C   . HIS A 1 78  ? 41.442  17.855  3.091   1.00 1.64  ? 78  HIS A C   1 
ATOM   616  O  O   . HIS A 1 78  ? 41.685  16.656  3.028   1.00 1.56  ? 78  HIS A O   1 
ATOM   617  C  CB  . HIS A 1 78  ? 40.191  19.155  1.247   1.00 2.18  ? 78  HIS A CB  1 
ATOM   618  C  CG  . HIS A 1 78  ? 40.770  18.317  0.142   1.00 1.81  ? 78  HIS A CG  1 
ATOM   619  N  ND1 . HIS A 1 78  ? 40.556  16.959  0.037   1.00 0.98  ? 78  HIS A ND1 1 
ATOM   620  C  CD2 . HIS A 1 78  ? 41.510  18.662  -0.940  1.00 0.71  ? 78  HIS A CD2 1 
ATOM   621  C  CE1 . HIS A 1 78  ? 41.171  16.493  -1.038  1.00 1.95  ? 78  HIS A CE1 1 
ATOM   622  N  NE2 . HIS A 1 78  ? 41.756  17.506  -1.652  1.00 1.63  ? 78  HIS A NE2 1 
ATOM   623  N  N   . ALA A 1 79  ? 42.292  18.717  3.626   1.00 1.89  ? 79  ALA A N   1 
ATOM   624  C  CA  . ALA A 1 79  ? 43.566  18.289  4.182   1.00 1.56  ? 79  ALA A CA  1 
ATOM   625  C  C   . ALA A 1 79  ? 43.376  17.266  5.314   1.00 2.25  ? 79  ALA A C   1 
ATOM   626  O  O   . ALA A 1 79  ? 43.969  16.177  5.306   1.00 1.98  ? 79  ALA A O   1 
ATOM   627  C  CB  . ALA A 1 79  ? 44.366  19.501  4.664   1.00 1.41  ? 79  ALA A CB  1 
ATOM   628  N  N   . ASN A 1 80  ? 42.556  17.629  6.285   1.00 1.95  ? 80  ASN A N   1 
ATOM   629  C  CA  . ASN A 1 80  ? 42.417  16.813  7.482   1.00 1.85  ? 80  ASN A CA  1 
ATOM   630  C  C   . ASN A 1 80  ? 41.846  15.438  7.172   1.00 2.15  ? 80  ASN A C   1 
ATOM   631  O  O   . ASN A 1 80  ? 42.333  14.438  7.664   1.00 2.13  ? 80  ASN A O   1 
ATOM   632  C  CB  . ASN A 1 80  ? 41.536  17.547  8.484   1.00 1.55  ? 80  ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 80  ? 42.167  18.845  8.974   1.00 2.32  ? 80  ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 80  ? 43.377  19.055  8.850   1.00 1.34  ? 80  ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 80  ? 41.346  19.723  9.548   1.00 2.02  ? 80  ASN A ND2 1 
ATOM   636  N  N   . HIS A 1 81  ? 40.818  15.383  6.328   1.00 2.47  ? 81  HIS A N   1 
ATOM   637  C  CA  . HIS A 1 81  ? 40.180  14.089  6.057   1.00 2.60  ? 81  HIS A CA  1 
ATOM   638  C  C   . HIS A 1 81  ? 41.050  13.186  5.185   1.00 1.85  ? 81  HIS A C   1 
ATOM   639  O  O   . HIS A 1 81  ? 41.088  11.949  5.355   1.00 1.71  ? 81  HIS A O   1 
ATOM   640  C  CB  . HIS A 1 81  ? 38.742  14.270  5.533   1.00 2.12  ? 81  HIS A CB  1 
ATOM   641  C  CG  . HIS A 1 81  ? 37.804  14.796  6.579   1.00 2.24  ? 81  HIS A CG  1 
ATOM   642  N  ND1 . HIS A 1 81  ? 37.814  16.115  6.979   1.00 1.74  ? 81  HIS A ND1 1 
ATOM   643  C  CD2 . HIS A 1 81  ? 36.880  14.173  7.354   1.00 1.98  ? 81  HIS A CD2 1 
ATOM   644  C  CE1 . HIS A 1 81  ? 36.922  16.291  7.934   1.00 2.93  ? 81  HIS A CE1 1 
ATOM   645  N  NE2 . HIS A 1 81  ? 36.338  15.130  8.181   1.00 1.87  ? 81  HIS A NE2 1 
ATOM   646  N  N   . SER A 1 82  ? 41.770  13.798  4.257   1.00 1.78  ? 82  SER A N   1 
ATOM   647  C  CA  . SER A 1 82  ? 42.722  13.071  3.446   1.00 2.01  ? 82  SER A CA  1 
ATOM   648  C  C   . SER A 1 82  ? 43.726  12.352  4.345   1.00 2.06  ? 82  SER A C   1 
ATOM   649  O  O   . SER A 1 82  ? 44.020  11.172  4.134   1.00 1.79  ? 82  SER A O   1 
ATOM   650  C  CB  . SER A 1 82  ? 43.419  14.024  2.461   1.00 1.43  ? 82  SER A CB  1 
ATOM   651  O  OG  . SER A 1 82  ? 42.508  14.553  1.495   1.00 2.34  ? 82  SER A OG  1 
ATOM   652  N  N   . LEU A 1 83  ? 44.242  13.052  5.349   1.00 2.40  ? 83  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 83  ? 45.163  12.455  6.331   1.00 2.72  ? 83  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 83  ? 44.433  11.387  7.145   1.00 2.70  ? 83  LEU A C   1 
ATOM   655  O  O   . LEU A 1 83  ? 44.921  10.264  7.330   1.00 1.89  ? 83  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 83  ? 45.717  13.542  7.254   1.00 2.48  ? 83  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 83  ? 46.811  13.139  8.251   1.00 2.59  ? 83  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 83  ? 47.716  14.326  8.659   1.00 5.75  ? 83  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 83  ? 46.231  12.445  9.467   1.00 5.20  ? 83  LEU A CD2 1 
ATOM   660  N  N   . PHE A 1 84  ? 43.243  11.728  7.614   1.00 2.26  ? 84  PHE A N   1 
ATOM   661  C  CA  . PHE A 1 84  ? 42.452  10.805  8.429   1.00 3.54  ? 84  PHE A CA  1 
ATOM   662  C  C   . PHE A 1 84  ? 42.245  9.434   7.761   1.00 3.22  ? 84  PHE A C   1 
ATOM   663  O  O   . PHE A 1 84  ? 42.452  8.383   8.392   1.00 3.55  ? 84  PHE A O   1 
ATOM   664  C  CB  . PHE A 1 84  ? 41.107  11.452  8.706   1.00 3.85  ? 84  PHE A CB  1 
ATOM   665  C  CG  . PHE A 1 84  ? 40.297  10.786  9.777   1.00 3.20  ? 84  PHE A CG  1 
ATOM   666  C  CD1 . PHE A 1 84  ? 40.819  10.555  11.055  1.00 3.04  ? 84  PHE A CD1 1 
ATOM   667  C  CD2 . PHE A 1 84  ? 38.973  10.467  9.534   1.00 3.58  ? 84  PHE A CD2 1 
ATOM   668  C  CE1 . PHE A 1 84  ? 40.053  9.990   12.041  1.00 3.67  ? 84  PHE A CE1 1 
ATOM   669  C  CE2 . PHE A 1 84  ? 38.189  9.875   10.533  1.00 2.97  ? 84  PHE A CE2 1 
ATOM   670  C  CZ  . PHE A 1 84  ? 38.720  9.662   11.781  1.00 3.18  ? 84  PHE A CZ  1 
ATOM   671  N  N   . TRP A 1 85  ? 41.830  9.419   6.494   1.00 3.65  ? 85  TRP A N   1 
ATOM   672  C  CA  . TRP A 1 85  ? 41.570  8.113   5.864   1.00 3.04  ? 85  TRP A CA  1 
ATOM   673  C  C   . TRP A 1 85  ? 42.814  7.253   5.828   1.00 3.52  ? 85  TRP A C   1 
ATOM   674  O  O   . TRP A 1 85  ? 42.736  6.049   6.077   1.00 2.98  ? 85  TRP A O   1 
ATOM   675  C  CB  . TRP A 1 85  ? 41.001  8.220   4.435   1.00 2.20  ? 85  TRP A CB  1 
ATOM   676  C  CG  . TRP A 1 85  ? 39.872  9.181   4.326   1.00 2.07  ? 85  TRP A CG  1 
ATOM   677  C  CD1 . TRP A 1 85  ? 39.785  10.232  3.463   1.00 1.67  ? 85  TRP A CD1 1 
ATOM   678  C  CD2 . TRP A 1 85  ? 38.681  9.211   5.121   1.00 3.01  ? 85  TRP A CD2 1 
ATOM   679  N  NE1 . TRP A 1 85  ? 38.622  10.903  3.661   1.00 2.25  ? 85  TRP A NE1 1 
ATOM   680  C  CE2 . TRP A 1 85  ? 37.922  10.314  4.683   1.00 2.40  ? 85  TRP A CE2 1 
ATOM   681  C  CE3 . TRP A 1 85  ? 38.187  8.416   6.159   1.00 1.43  ? 85  TRP A CE3 1 
ATOM   682  C  CZ2 . TRP A 1 85  ? 36.677  10.640  5.234   1.00 3.49  ? 85  TRP A CZ2 1 
ATOM   683  C  CZ3 . TRP A 1 85  ? 36.964  8.757   6.730   1.00 3.28  ? 85  TRP A CZ3 1 
ATOM   684  C  CH2 . TRP A 1 85  ? 36.213  9.850   6.252   1.00 2.57  ? 85  TRP A CH2 1 
ATOM   685  N  N   . LYS A 1 86  ? 43.956  7.865   5.500   1.00 3.99  ? 86  LYS A N   1 
ATOM   686  C  CA  . LYS A 1 86  ? 45.225  7.121   5.390   1.00 4.34  ? 86  LYS A CA  1 
ATOM   687  C  C   . LYS A 1 86  ? 45.775  6.761   6.755   1.00 4.15  ? 86  LYS A C   1 
ATOM   688  O  O   . LYS A 1 86  ? 46.657  5.904   6.878   1.00 3.63  ? 86  LYS A O   1 
ATOM   689  C  CB  . LYS A 1 86  ? 46.266  7.924   4.613   1.00 4.75  ? 86  LYS A CB  1 
ATOM   690  C  CG  . LYS A 1 86  ? 45.927  8.012   3.112   1.00 5.82  ? 86  LYS A CG  1 
ATOM   691  C  CD  . LYS A 1 86  ? 46.739  9.074   2.412   1.00 7.21  ? 86  LYS A CD  1 
ATOM   692  C  CE  . LYS A 1 86  ? 48.187  8.688   2.266   1.00 8.75  ? 86  LYS A CE  1 
ATOM   693  N  NZ  . LYS A 1 86  ? 48.887  9.646   1.368   1.00 9.55  ? 86  LYS A NZ  1 
ATOM   694  N  N   . GLY A 1 87  ? 45.252  7.436   7.770   1.00 3.79  ? 87  GLY A N   1 
ATOM   695  C  CA  . GLY A 1 87  ? 45.675  7.248   9.143   1.00 3.82  ? 87  GLY A CA  1 
ATOM   696  C  C   . GLY A 1 87  ? 44.856  6.245   9.923   1.00 3.89  ? 87  GLY A C   1 
ATOM   697  O  O   . GLY A 1 87  ? 44.969  6.176   11.144  1.00 3.25  ? 87  GLY A O   1 
ATOM   698  N  N   . LEU A 1 88  ? 44.025  5.484   9.218   1.00 4.25  ? 88  LEU A N   1 
ATOM   699  C  CA  . LEU A 1 88  ? 43.235  4.423   9.827   1.00 4.39  ? 88  LEU A CA  1 
ATOM   700  C  C   . LEU A 1 88  ? 43.533  3.108   9.125   1.00 5.03  ? 88  LEU A C   1 
ATOM   701  O  O   . LEU A 1 88  ? 43.617  3.045   7.879   1.00 4.73  ? 88  LEU A O   1 
ATOM   702  C  CB  . LEU A 1 88  ? 41.744  4.727   9.712   1.00 3.88  ? 88  LEU A CB  1 
ATOM   703  C  CG  . LEU A 1 88  ? 41.230  6.039   10.310  1.00 4.15  ? 88  LEU A CG  1 
ATOM   704  C  CD1 . LEU A 1 88  ? 39.892  6.426   9.695   1.00 4.62  ? 88  LEU A CD1 1 
ATOM   705  C  CD2 . LEU A 1 88  ? 41.130  5.937   11.807  1.00 3.44  ? 88  LEU A CD2 1 
ATOM   706  N  N   . LYS A 1 89  ? 43.746  2.066   9.925   1.00 4.99  ? 89  LYS A N   1 
ATOM   707  C  CA  . LYS A 1 89  ? 43.991  0.706   9.417   1.00 5.96  ? 89  LYS A CA  1 
ATOM   708  C  C   . LYS A 1 89  ? 43.891  -0.254  10.593  1.00 5.83  ? 89  LYS A C   1 
ATOM   709  O  O   . LYS A 1 89  ? 44.378  0.054   11.675  1.00 6.69  ? 89  LYS A O   1 
ATOM   710  C  CB  . LYS A 1 89  ? 45.378  0.588   8.763   1.00 5.94  ? 89  LYS A CB  1 
ATOM   711  C  CG  . LYS A 1 89  ? 45.591  -0.706  7.934   1.00 6.27  ? 89  LYS A CG  1 
ATOM   712  C  CD  . LYS A 1 89  ? 46.872  -0.631  7.114   1.00 7.92  ? 89  LYS A CD  1 
ATOM   713  C  CE  . LYS A 1 89  ? 48.105  -0.515  8.013   1.00 8.57  ? 89  LYS A CE  1 
ATOM   714  N  NZ  . LYS A 1 89  ? 49.389  -0.623  7.248   1.00 9.69  ? 89  LYS A NZ  1 
ATOM   715  N  N   . LYS A 1 90  ? 43.236  -1.398  10.384  1.00 6.31  ? 90  LYS A N   1 
ATOM   716  C  CA  . LYS A 1 90  ? 43.145  -2.443  11.407  1.00 6.81  ? 90  LYS A CA  1 
ATOM   717  C  C   . LYS A 1 90  ? 44.400  -3.282  11.385  1.00 7.07  ? 90  LYS A C   1 
ATOM   718  O  O   . LYS A 1 90  ? 45.084  -3.363  10.358  1.00 7.53  ? 90  LYS A O   1 
ATOM   719  C  CB  . LYS A 1 90  ? 41.941  -3.361  11.140  1.00 7.10  ? 90  LYS A CB  1 
ATOM   720  C  CG  . LYS A 1 90  ? 40.645  -2.940  11.800  1.00 8.45  ? 90  LYS A CG  1 
ATOM   721  C  CD  . LYS A 1 90  ? 39.510  -3.952  11.514  1.00 10.14 ? 90  LYS A CD  1 
ATOM   722  C  CE  . LYS A 1 90  ? 39.542  -5.137  12.430  1.00 11.37 ? 90  LYS A CE  1 
ATOM   723  N  NZ  . LYS A 1 90  ? 38.281  -5.908  12.251  1.00 11.07 ? 90  LYS A NZ  1 
ATOM   724  N  N   . GLY A 1 91  ? 44.703  -3.927  12.512  1.00 7.28  ? 91  GLY A N   1 
ATOM   725  C  CA  . GLY A 1 91  ? 45.811  -4.874  12.572  1.00 7.57  ? 91  GLY A CA  1 
ATOM   726  C  C   . GLY A 1 91  ? 47.222  -4.335  12.719  1.00 7.59  ? 91  GLY A C   1 
ATOM   727  O  O   . GLY A 1 91  ? 48.188  -5.085  12.551  1.00 7.74  ? 91  GLY A O   1 
ATOM   728  N  N   . THR A 1 92  ? 47.380  -3.052  13.045  1.00 7.53  ? 92  THR A N   1 
ATOM   729  C  CA  . THR A 1 92  ? 48.719  -2.504  13.188  1.00 7.57  ? 92  THR A CA  1 
ATOM   730  C  C   . THR A 1 92  ? 49.188  -2.543  14.631  1.00 7.61  ? 92  THR A C   1 
ATOM   731  O  O   . THR A 1 92  ? 48.378  -2.620  15.555  1.00 7.95  ? 92  THR A O   1 
ATOM   732  C  CB  . THR A 1 92  ? 48.837  -1.052  12.685  1.00 7.79  ? 92  THR A CB  1 
ATOM   733  O  OG1 . THR A 1 92  ? 48.139  -0.163  13.569  1.00 9.18  ? 92  THR A OG1 1 
ATOM   734  C  CG2 . THR A 1 92  ? 48.313  -0.911  11.265  1.00 6.22  ? 92  THR A CG2 1 
ATOM   735  N  N   . THR A 1 93  ? 50.501  -2.498  14.816  1.00 7.70  ? 93  THR A N   1 
ATOM   736  C  CA  . THR A 1 93  ? 51.093  -2.496  16.141  1.00 7.54  ? 93  THR A CA  1 
ATOM   737  C  C   . THR A 1 93  ? 52.058  -1.311  16.342  1.00 7.08  ? 93  THR A C   1 
ATOM   738  O  O   . THR A 1 93  ? 52.986  -1.106  15.570  1.00 6.86  ? 93  THR A O   1 
ATOM   739  C  CB  . THR A 1 93  ? 51.846  -3.831  16.390  1.00 7.42  ? 93  THR A CB  1 
ATOM   740  O  OG1 . THR A 1 93  ? 50.977  -4.923  16.071  1.00 9.21  ? 93  THR A OG1 1 
ATOM   741  C  CG2 . THR A 1 93  ? 52.316  -3.957  17.828  1.00 8.16  ? 93  THR A CG2 1 
ATOM   742  N  N   . LEU A 1 94  ? 51.841  -0.550  17.407  1.00 8.06  ? 94  LEU A N   1 
ATOM   743  C  CA  . LEU A 1 94  ? 52.761  0.534   17.760  1.00 7.93  ? 94  LEU A CA  1 
ATOM   744  C  C   . LEU A 1 94  ? 54.088  -0.111  18.160  1.00 8.32  ? 94  LEU A C   1 
ATOM   745  O  O   . LEU A 1 94  ? 54.127  -1.009  19.007  1.00 8.50  ? 94  LEU A O   1 
ATOM   746  C  CB  . LEU A 1 94  ? 52.183  1.413   18.878  1.00 8.83  ? 94  LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 94  ? 53.019  2.547   19.502  1.00 9.35  ? 94  LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 94  ? 53.538  3.514   18.438  1.00 10.81 ? 94  LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 94  ? 52.249  3.295   20.600  1.00 8.94  ? 94  LEU A CD2 1 
ATOM   750  N  N   . GLN A 1 95  ? 55.158  0.301   17.503  1.00 8.87  ? 95  GLN A N   1 
ATOM   751  C  CA  . GLN A 1 95  ? 56.462  -0.352  17.671  1.00 9.63  ? 95  GLN A CA  1 
ATOM   752  C  C   . GLN A 1 95  ? 57.536  0.605   17.180  1.00 9.80  ? 95  GLN A C   1 
ATOM   753  O  O   . GLN A 1 95  ? 57.212  1.684   16.704  1.00 10.39 ? 95  GLN A O   1 
ATOM   754  C  CB  . GLN A 1 95  ? 56.492  -1.653  16.868  1.00 10.07 ? 95  GLN A CB  1 
ATOM   755  C  CG  . GLN A 1 95  ? 56.474  -1.462  15.354  1.00 10.98 ? 95  GLN A CG  1 
ATOM   756  C  CD  . GLN A 1 95  ? 56.185  -2.753  14.615  1.00 12.42 ? 95  GLN A CD  1 
ATOM   757  O  OE1 . GLN A 1 95  ? 55.045  -3.029  14.242  1.00 12.42 ? 95  GLN A OE1 1 
ATOM   758  N  NE2 . GLN A 1 95  ? 57.212  -3.568  14.428  1.00 14.15 ? 95  GLN A NE2 1 
ATOM   759  N  N   . GLY A 1 96  ? 58.803  0.220   17.313  1.00 9.89  ? 96  GLY A N   1 
ATOM   760  C  CA  . GLY A 1 96  ? 59.911  0.956   16.720  1.00 9.63  ? 96  GLY A CA  1 
ATOM   761  C  C   . GLY A 1 96  ? 60.193  2.343   17.269  1.00 9.13  ? 96  GLY A C   1 
ATOM   762  O  O   . GLY A 1 96  ? 59.976  2.628   18.458  1.00 9.72  ? 96  GLY A O   1 
ATOM   763  N  N   . ASP A 1 97  ? 60.702  3.199   16.391  1.00 9.39  ? 97  ASP A N   1 
ATOM   764  C  CA  . ASP A 1 97  ? 61.090  4.551   16.761  1.00 9.35  ? 97  ASP A CA  1 
ATOM   765  C  C   . ASP A 1 97  ? 59.918  5.340   17.305  1.00 8.76  ? 97  ASP A C   1 
ATOM   766  O  O   . ASP A 1 97  ? 60.052  6.012   18.312  1.00 9.16  ? 97  ASP A O   1 
ATOM   767  C  CB  . ASP A 1 97  ? 61.709  5.290   15.569  1.00 10.12 ? 97  ASP A CB  1 
ATOM   768  C  CG  . ASP A 1 97  ? 63.075  4.756   15.205  1.00 11.70 ? 97  ASP A CG  1 
ATOM   769  O  OD1 . ASP A 1 97  ? 63.592  5.122   14.133  1.00 13.74 ? 97  ASP A OD1 1 
ATOM   770  O  OD2 . ASP A 1 97  ? 63.643  3.965   15.994  1.00 13.86 ? 97  ASP A OD2 1 
ATOM   771  N  N   . LEU A 1 98  ? 58.766  5.270   16.642  1.00 8.48  ? 98  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 98  ? 57.602  6.000   17.132  1.00 7.63  ? 98  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 98  ? 57.253  5.601   18.560  1.00 7.71  ? 98  LEU A C   1 
ATOM   774  O  O   . LEU A 1 98  ? 56.933  6.451   19.392  1.00 7.94  ? 98  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 98  ? 56.382  5.791   16.221  1.00 7.36  ? 98  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 98  ? 55.159  6.650   16.591  1.00 7.28  ? 98  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 98  ? 55.571  8.112   16.761  1.00 6.72  ? 98  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 98  ? 54.102  6.509   15.511  1.00 6.25  ? 98  LEU A CD2 1 
ATOM   779  N  N   . LYS A 1 99  ? 57.318  4.306   18.852  1.00 7.74  ? 99  LYS A N   1 
ATOM   780  C  CA  . LYS A 1 99  ? 56.878  3.858   20.164  1.00 8.21  ? 99  LYS A CA  1 
ATOM   781  C  C   . LYS A 1 99  ? 57.854  4.399   21.186  1.00 8.28  ? 99  LYS A C   1 
ATOM   782  O  O   . LYS A 1 99  ? 57.463  4.914   22.241  1.00 8.88  ? 99  LYS A O   1 
ATOM   783  C  CB  . LYS A 1 99  ? 56.764  2.331   20.252  1.00 8.58  ? 99  LYS A CB  1 
ATOM   784  C  CG  . LYS A 1 99  ? 56.584  1.840   21.677  1.00 8.86  ? 99  LYS A CG  1 
ATOM   785  C  CD  . LYS A 1 99  ? 55.874  0.517   21.728  1.00 10.68 ? 99  LYS A CD  1 
ATOM   786  C  CE  . LYS A 1 99  ? 55.720  0.052   23.164  1.00 12.10 ? 99  LYS A CE  1 
ATOM   787  N  NZ  . LYS A 1 99  ? 55.562  -1.439  23.208  1.00 12.53 ? 99  LYS A NZ  1 
ATOM   788  N  N   . ALA A 1 100 ? 59.132  4.306   20.847  1.00 8.38  ? 100 ALA A N   1 
ATOM   789  C  CA  . ALA A 1 100 ? 60.170  4.758   21.761  1.00 8.80  ? 100 ALA A CA  1 
ATOM   790  C  C   . ALA A 1 100 ? 60.014  6.260   21.989  1.00 8.08  ? 100 ALA A C   1 
ATOM   791  O  O   . ALA A 1 100 ? 60.241  6.760   23.092  1.00 7.89  ? 100 ALA A O   1 
ATOM   792  C  CB  . ALA A 1 100 ? 61.541  4.419   21.215  1.00 8.89  ? 100 ALA A CB  1 
ATOM   793  N  N   . ALA A 1 101 ? 59.592  6.979   20.957  1.00 7.30  ? 101 ALA A N   1 
ATOM   794  C  CA  . ALA A 1 101 ? 59.413  8.430   21.083  1.00 7.17  ? 101 ALA A CA  1 
ATOM   795  C  C   . ALA A 1 101 ? 58.238  8.792   21.991  1.00 6.93  ? 101 ALA A C   1 
ATOM   796  O  O   . ALA A 1 101 ? 58.320  9.737   22.772  1.00 6.66  ? 101 ALA A O   1 
ATOM   797  C  CB  . ALA A 1 101 ? 59.261  9.094   19.699  1.00 6.39  ? 101 ALA A CB  1 
ATOM   798  N  N   . ILE A 1 102 ? 57.146  8.037   21.871  1.00 6.47  ? 102 ILE A N   1 
ATOM   799  C  CA  . ILE A 1 102 ? 55.964  8.241   22.689  1.00 6.84  ? 102 ILE A CA  1 
ATOM   800  C  C   . ILE A 1 102 ? 56.284  8.006   24.166  1.00 6.55  ? 102 ILE A C   1 
ATOM   801  O  O   . ILE A 1 102 ? 55.973  8.837   25.014  1.00 6.60  ? 102 ILE A O   1 
ATOM   802  C  CB  . ILE A 1 102 ? 54.805  7.350   22.193  1.00 6.79  ? 102 ILE A CB  1 
ATOM   803  C  CG1 . ILE A 1 102 ? 54.242  7.936   20.890  1.00 6.70  ? 102 ILE A CG1 1 
ATOM   804  C  CG2 . ILE A 1 102 ? 53.703  7.219   23.241  1.00 7.39  ? 102 ILE A CG2 1 
ATOM   805  C  CD1 . ILE A 1 102 ? 53.226  7.040   20.204  1.00 8.12  ? 102 ILE A CD1 1 
ATOM   806  N  N   . GLU A 1 103 ? 56.962  6.898   24.444  1.00 7.09  ? 103 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 103 ? 57.388  6.563   25.805  1.00 7.38  ? 103 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 103 ? 58.331  7.604   26.395  1.00 7.42  ? 103 GLU A C   1 
ATOM   809  O  O   . GLU A 1 103 ? 58.243  7.922   27.574  1.00 8.42  ? 103 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 103 ? 58.064  5.186   25.825  1.00 7.36  ? 103 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 103 ? 57.147  4.088   25.355  1.00 8.82  ? 103 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 103 ? 57.809  2.727   25.307  1.00 10.33 ? 103 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 103 ? 59.021  2.644   24.991  1.00 11.19 ? 103 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 103 ? 57.103  1.726   25.575  1.00 12.51 ? 103 GLU A OE2 1 
ATOM   815  N  N   . ARG A 1 104 ? 59.241  8.109   25.571  1.00 7.60  ? 104 ARG A N   1 
ATOM   816  C  CA  . ARG A 1 104 ? 60.189  9.148   25.989  1.00 8.50  ? 104 ARG A CA  1 
ATOM   817  C  C   . ARG A 1 104 ? 59.463  10.445  26.315  1.00 8.27  ? 104 ARG A C   1 
ATOM   818  O  O   . ARG A 1 104 ? 59.750  11.120  27.307  1.00 8.69  ? 104 ARG A O   1 
ATOM   819  C  CB  . ARG A 1 104 ? 61.185  9.412   24.863  1.00 9.36  ? 104 ARG A CB  1 
ATOM   820  C  CG  . ARG A 1 104 ? 61.982  10.701  24.979  1.00 11.08 ? 104 ARG A CG  1 
ATOM   821  C  CD  . ARG A 1 104 ? 63.129  10.761  23.944  1.00 12.46 ? 104 ARG A CD  1 
ATOM   822  N  NE  . ARG A 1 104 ? 62.686  10.961  22.554  1.00 14.37 ? 104 ARG A NE  1 
ATOM   823  C  CZ  . ARG A 1 104 ? 62.796  10.048  21.583  1.00 15.01 ? 104 ARG A CZ  1 
ATOM   824  N  NH1 . ARG A 1 104 ? 63.325  8.849   21.838  1.00 15.34 ? 104 ARG A NH1 1 
ATOM   825  N  NH2 . ARG A 1 104 ? 62.382  10.327  20.347  1.00 14.20 ? 104 ARG A NH2 1 
ATOM   826  N  N   . ASP A 1 105 ? 58.523  10.807  25.457  1.00 8.42  ? 105 ASP A N   1 
ATOM   827  C  CA  . ASP A 1 105 ? 57.872  12.091  25.622  1.00 7.72  ? 105 ASP A CA  1 
ATOM   828  C  C   . ASP A 1 105 ? 56.695  12.090  26.601  1.00 7.60  ? 105 ASP A C   1 
ATOM   829  O  O   . ASP A 1 105 ? 56.368  13.121  27.168  1.00 8.10  ? 105 ASP A O   1 
ATOM   830  C  CB  . ASP A 1 105 ? 57.502  12.690  24.253  1.00 8.05  ? 105 ASP A CB  1 
ATOM   831  C  CG  . ASP A 1 105 ? 58.729  13.141  23.465  1.00 8.84  ? 105 ASP A CG  1 
ATOM   832  O  OD1 . ASP A 1 105 ? 59.733  13.548  24.101  1.00 11.86 ? 105 ASP A OD1 1 
ATOM   833  O  OD2 . ASP A 1 105 ? 58.700  13.095  22.209  1.00 9.88  ? 105 ASP A OD2 1 
ATOM   834  N  N   . PHE A 1 106 ? 56.048  10.947  26.802  1.00 7.07  ? 106 PHE A N   1 
ATOM   835  C  CA  . PHE A 1 106 ? 54.885  10.915  27.669  1.00 7.63  ? 106 PHE A CA  1 
ATOM   836  C  C   . PHE A 1 106 ? 55.145  9.990   28.847  1.00 8.12  ? 106 PHE A C   1 
ATOM   837  O  O   . PHE A 1 106 ? 54.336  9.893   29.764  1.00 8.46  ? 106 PHE A O   1 
ATOM   838  C  CB  . PHE A 1 106 ? 53.634  10.476  26.894  1.00 7.21  ? 106 PHE A CB  1 
ATOM   839  C  CG  . PHE A 1 106 ? 53.275  11.387  25.727  1.00 7.53  ? 106 PHE A CG  1 
ATOM   840  C  CD1 . PHE A 1 106 ? 52.417  12.455  25.905  1.00 6.40  ? 106 PHE A CD1 1 
ATOM   841  C  CD2 . PHE A 1 106 ? 53.787  11.155  24.460  1.00 6.50  ? 106 PHE A CD2 1 
ATOM   842  C  CE1 . PHE A 1 106 ? 52.082  13.288  24.847  1.00 7.55  ? 106 PHE A CE1 1 
ATOM   843  C  CE2 . PHE A 1 106 ? 53.456  11.979  23.407  1.00 7.82  ? 106 PHE A CE2 1 
ATOM   844  C  CZ  . PHE A 1 106 ? 52.585  13.041  23.601  1.00 6.78  ? 106 PHE A CZ  1 
ATOM   845  N  N   . GLY A 1 107 ? 56.280  9.297   28.789  1.00 8.41  ? 107 GLY A N   1 
ATOM   846  C  CA  . GLY A 1 107 ? 56.737  8.442   29.878  1.00 9.39  ? 107 GLY A CA  1 
ATOM   847  C  C   . GLY A 1 107 ? 56.384  6.997   29.592  1.00 9.58  ? 107 GLY A C   1 
ATOM   848  O  O   . GLY A 1 107 ? 57.126  6.071   29.935  1.00 10.51 ? 107 GLY A O   1 
ATOM   849  N  N   . SER A 1 108 ? 55.252  6.816   28.928  1.00 9.87  ? 108 SER A N   1 
ATOM   850  C  CA  . SER A 1 108 ? 54.666  5.504   28.721  1.00 9.74  ? 108 SER A CA  1 
ATOM   851  C  C   . SER A 1 108 ? 53.596  5.603   27.644  1.00 9.37  ? 108 SER A C   1 
ATOM   852  O  O   . SER A 1 108 ? 53.098  6.687   27.353  1.00 9.66  ? 108 SER A O   1 
ATOM   853  C  CB  . SER A 1 108 ? 54.041  4.981   30.026  1.00 9.78  ? 108 SER A CB  1 
ATOM   854  O  OG  . SER A 1 108 ? 52.817  5.622   30.320  1.00 11.34 ? 108 SER A OG  1 
ATOM   855  N  N   . VAL A 1 109 ? 53.217  4.464   27.077  1.00 9.46  ? 109 VAL A N   1 
ATOM   856  C  CA  . VAL A 1 109 ? 52.185  4.461   26.055  1.00 8.83  ? 109 VAL A CA  1 
ATOM   857  C  C   . VAL A 1 109 ? 50.831  4.776   26.697  1.00 9.08  ? 109 VAL A C   1 
ATOM   858  O  O   . VAL A 1 109 ? 49.983  5.428   26.109  1.00 8.38  ? 109 VAL A O   1 
ATOM   859  C  CB  . VAL A 1 109 ? 52.171  3.135   25.247  1.00 8.87  ? 109 VAL A CB  1 
ATOM   860  C  CG1 . VAL A 1 109 ? 50.907  3.016   24.415  1.00 9.29  ? 109 VAL A CG1 1 
ATOM   861  C  CG2 . VAL A 1 109 ? 53.412  3.049   24.354  1.00 7.81  ? 109 VAL A CG2 1 
ATOM   862  N  N   . ASP A 1 110 ? 50.645  4.330   27.932  1.00 9.02  ? 110 ASP A N   1 
ATOM   863  C  CA  . ASP A 1 110 ? 49.377  4.531   28.597  1.00 9.54  ? 110 ASP A CA  1 
ATOM   864  C  C   . ASP A 1 110 ? 49.139  5.988   28.987  1.00 9.24  ? 110 ASP A C   1 
ATOM   865  O  O   . ASP A 1 110 ? 48.001  6.441   29.003  1.00 9.57  ? 110 ASP A O   1 
ATOM   866  C  CB  . ASP A 1 110 ? 49.275  3.614   29.815  1.00 10.34 ? 110 ASP A CB  1 
ATOM   867  C  CG  . ASP A 1 110 ? 49.186  2.154   29.430  1.00 12.76 ? 110 ASP A CG  1 
ATOM   868  O  OD1 . ASP A 1 110 ? 48.857  1.869   28.259  1.00 15.64 ? 110 ASP A OD1 1 
ATOM   869  O  OD2 . ASP A 1 110 ? 49.435  1.293   30.303  1.00 16.76 ? 110 ASP A OD2 1 
ATOM   870  N  N   . ASN A 1 111 ? 50.214  6.708   29.325  1.00 8.54  ? 111 ASN A N   1 
ATOM   871  C  CA  . ASN A 1 111 ? 50.103  8.122   29.674  1.00 8.46  ? 111 ASN A CA  1 
ATOM   872  C  C   . ASN A 1 111 ? 49.795  8.930   28.437  1.00 7.94  ? 111 ASN A C   1 
ATOM   873  O  O   . ASN A 1 111 ? 48.997  9.869   28.470  1.00 8.23  ? 111 ASN A O   1 
ATOM   874  C  CB  . ASN A 1 111 ? 51.398  8.649   30.269  1.00 8.93  ? 111 ASN A CB  1 
ATOM   875  C  CG  . ASN A 1 111 ? 51.745  7.979   31.560  1.00 10.41 ? 111 ASN A CG  1 
ATOM   876  O  OD1 . ASN A 1 111 ? 50.928  7.250   32.116  1.00 11.60 ? 111 ASN A OD1 1 
ATOM   877  N  ND2 . ASN A 1 111 ? 52.954  8.231   32.060  1.00 13.80 ? 111 ASN A ND2 1 
ATOM   878  N  N   . PHE A 1 112 ? 50.446  8.556   27.344  1.00 7.31  ? 112 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 112 ? 50.143  9.173   26.059  1.00 7.53  ? 112 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 112 ? 48.654  9.013   25.708  1.00 7.58  ? 112 PHE A C   1 
ATOM   881  O  O   . PHE A 1 112 ? 47.966  9.991   25.368  1.00 7.40  ? 112 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 112 ? 51.005  8.586   24.943  1.00 7.35  ? 112 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 112 ? 50.417  8.796   23.577  1.00 8.20  ? 112 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 112 ? 50.202  10.084  23.096  1.00 8.06  ? 112 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 112 ? 50.035  7.721   22.798  1.00 8.65  ? 112 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 112 ? 49.640  10.288  21.857  1.00 8.93  ? 112 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 112 ? 49.466  7.919   21.544  1.00 9.62  ? 112 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 112 ? 49.276  9.214   21.075  1.00 9.63  ? 112 PHE A CZ  1 
ATOM   889  N  N   . LYS A 1 113 ? 48.157  7.778   25.794  1.00 6.99  ? 113 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 113 ? 46.752  7.499   25.473  1.00 6.69  ? 113 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 113 ? 45.817  8.293   26.362  1.00 6.13  ? 113 LYS A C   1 
ATOM   892  O  O   . LYS A 1 113 ? 44.811  8.835   25.911  1.00 5.99  ? 113 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 113 ? 46.445  6.006   25.573  1.00 6.60  ? 113 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 113 ? 47.071  5.193   24.461  1.00 7.24  ? 113 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 113 ? 47.007  3.680   24.712  1.00 7.72  ? 113 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 113 ? 45.584  3.163   24.732  1.00 10.45 ? 113 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 113 ? 45.549  1.714   25.087  1.00 10.58 ? 113 LYS A NZ  1 
ATOM   898  N  N   . ALA A 1 114 ? 46.149  8.362   27.639  1.00 5.90  ? 114 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 114 ? 45.377  9.188   28.559  1.00 6.31  ? 114 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 114 ? 45.346  10.654  28.154  1.00 6.64  ? 114 ALA A C   1 
ATOM   901  O  O   . ALA A 1 114 ? 44.297  11.310  28.226  1.00 6.85  ? 114 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 114 ? 45.921  9.054   29.972  1.00 6.26  ? 114 ALA A CB  1 
ATOM   903  N  N   . GLU A 1 115 ? 46.505  11.178  27.767  1.00 6.46  ? 115 GLU A N   1 
ATOM   904  C  CA  . GLU A 1 115 ? 46.622  12.593  27.452  1.00 6.88  ? 115 GLU A CA  1 
ATOM   905  C  C   . GLU A 1 115 ? 45.894  12.924  26.143  1.00 5.80  ? 115 GLU A C   1 
ATOM   906  O  O   . GLU A 1 115 ? 45.233  13.952  26.045  1.00 5.63  ? 115 GLU A O   1 
ATOM   907  C  CB  . GLU A 1 115 ? 48.088  13.044  27.416  1.00 7.47  ? 115 GLU A CB  1 
ATOM   908  C  CG  . GLU A 1 115 ? 48.266  14.481  27.896  1.00 10.86 ? 115 GLU A CG  1 
ATOM   909  C  CD  . GLU A 1 115 ? 49.573  15.101  27.452  1.00 13.45 ? 115 GLU A CD  1 
ATOM   910  O  OE1 . GLU A 1 115 ? 49.521  16.121  26.741  1.00 14.93 ? 115 GLU A OE1 1 
ATOM   911  O  OE2 . GLU A 1 115 ? 50.647  14.562  27.782  1.00 16.52 ? 115 GLU A OE2 1 
ATOM   912  N  N   . PHE A 1 116 ? 45.969  12.019  25.170  1.00 5.89  ? 116 PHE A N   1 
ATOM   913  C  CA  . PHE A 1 116 ? 45.184  12.160  23.925  1.00 5.39  ? 116 PHE A CA  1 
ATOM   914  C  C   . PHE A 1 116 ? 43.664  12.038  24.164  1.00 4.89  ? 116 PHE A C   1 
ATOM   915  O  O   . PHE A 1 116 ? 42.881  12.811  23.593  1.00 4.70  ? 116 PHE A O   1 
ATOM   916  C  CB  . PHE A 1 116 ? 45.661  11.118  22.913  1.00 5.11  ? 116 PHE A CB  1 
ATOM   917  C  CG  . PHE A 1 116 ? 45.098  11.289  21.519  1.00 5.36  ? 116 PHE A CG  1 
ATOM   918  C  CD1 . PHE A 1 116 ? 45.817  11.973  20.552  1.00 4.35  ? 116 PHE A CD1 1 
ATOM   919  C  CD2 . PHE A 1 116 ? 43.881  10.718  21.178  1.00 6.24  ? 116 PHE A CD2 1 
ATOM   920  C  CE1 . PHE A 1 116 ? 45.314  12.105  19.254  1.00 4.21  ? 116 PHE A CE1 1 
ATOM   921  C  CE2 . PHE A 1 116 ? 43.359  10.845  19.885  1.00 3.25  ? 116 PHE A CE2 1 
ATOM   922  C  CZ  . PHE A 1 116 ? 44.090  11.549  18.923  1.00 3.46  ? 116 PHE A CZ  1 
ATOM   923  N  N   . GLU A 1 117 ? 43.238  11.089  25.004  1.00 4.77  ? 117 GLU A N   1 
ATOM   924  C  CA  . GLU A 1 117 ? 41.816  10.934  25.350  1.00 5.53  ? 117 GLU A CA  1 
ATOM   925  C  C   . GLU A 1 117 ? 41.238  12.200  25.989  1.00 5.13  ? 117 GLU A C   1 
ATOM   926  O  O   . GLU A 1 117 ? 40.128  12.617  25.681  1.00 5.41  ? 117 GLU A O   1 
ATOM   927  C  CB  . GLU A 1 117 ? 41.595  9.730   26.279  1.00 5.29  ? 117 GLU A CB  1 
ATOM   928  C  CG  . GLU A 1 117 ? 41.855  8.391   25.592  1.00 6.83  ? 117 GLU A CG  1 
ATOM   929  C  CD  . GLU A 1 117 ? 42.078  7.227   26.539  1.00 9.01  ? 117 GLU A CD  1 
ATOM   930  O  OE1 . GLU A 1 117 ? 41.990  7.404   27.770  1.00 12.18 ? 117 GLU A OE1 1 
ATOM   931  O  OE2 . GLU A 1 117 ? 42.365  6.118   26.045  1.00 8.91  ? 117 GLU A OE2 1 
ATOM   932  N  N   . LYS A 1 118 ? 42.003  12.801  26.891  1.00 5.32  ? 118 LYS A N   1 
ATOM   933  C  CA  . LYS A 1 118 ? 41.549  14.016  27.529  1.00 5.47  ? 118 LYS A CA  1 
ATOM   934  C  C   . LYS A 1 118 ? 41.465  15.182  26.551  1.00 5.07  ? 118 LYS A C   1 
ATOM   935  O  O   . LYS A 1 118 ? 40.492  15.937  26.572  1.00 5.29  ? 118 LYS A O   1 
ATOM   936  C  CB  . LYS A 1 118 ? 42.420  14.384  28.729  1.00 5.37  ? 118 LYS A CB  1 
ATOM   937  C  CG  . LYS A 1 118 ? 41.992  15.710  29.341  1.00 7.28  ? 118 LYS A CG  1 
ATOM   938  C  CD  . LYS A 1 118 ? 42.773  16.088  30.589  1.00 9.34  ? 118 LYS A CD  1 
ATOM   939  C  CE  . LYS A 1 118 ? 42.339  17.480  31.062  1.00 11.51 ? 118 LYS A CE  1 
ATOM   940  N  NZ  . LYS A 1 118 ? 41.054  17.945  30.429  1.00 12.14 ? 118 LYS A NZ  1 
ATOM   941  N  N   . ALA A 1 119 ? 42.489  15.347  25.711  1.00 5.50  ? 119 ALA A N   1 
ATOM   942  C  CA  . ALA A 1 119 ? 42.479  16.395  24.708  1.00 5.54  ? 119 ALA A CA  1 
ATOM   943  C  C   . ALA A 1 119 ? 41.279  16.179  23.781  1.00 5.62  ? 119 ALA A C   1 
ATOM   944  O  O   . ALA A 1 119 ? 40.553  17.109  23.466  1.00 6.12  ? 119 ALA A O   1 
ATOM   945  C  CB  . ALA A 1 119 ? 43.801  16.425  23.924  1.00 5.24  ? 119 ALA A CB  1 
ATOM   946  N  N   . ALA A 1 120 ? 41.043  14.937  23.384  1.00 5.65  ? 120 ALA A N   1 
ATOM   947  C  CA  . ALA A 1 120 ? 39.933  14.669  22.467  1.00 5.50  ? 120 ALA A CA  1 
ATOM   948  C  C   . ALA A 1 120 ? 38.585  14.984  23.112  1.00 5.76  ? 120 ALA A C   1 
ATOM   949  O  O   . ALA A 1 120 ? 37.690  15.515  22.483  1.00 5.37  ? 120 ALA A O   1 
ATOM   950  C  CB  . ALA A 1 120 ? 39.972  13.234  21.998  1.00 6.36  ? 120 ALA A CB  1 
ATOM   951  N  N   . ALA A 1 121 ? 38.459  14.636  24.385  1.00 5.28  ? 121 ALA A N   1 
ATOM   952  C  CA  . ALA A 1 121 ? 37.213  14.779  25.099  1.00 5.89  ? 121 ALA A CA  1 
ATOM   953  C  C   . ALA A 1 121 ? 36.906  16.247  25.382  1.00 5.39  ? 121 ALA A C   1 
ATOM   954  O  O   . ALA A 1 121 ? 35.764  16.684  25.255  1.00 6.55  ? 121 ALA A O   1 
ATOM   955  C  CB  . ALA A 1 121 ? 37.262  13.974  26.410  1.00 5.19  ? 121 ALA A CB  1 
ATOM   956  N  N   . SER A 1 122 ? 37.929  17.018  25.743  1.00 5.72  ? 122 SER A N   1 
ATOM   957  C  CA  . SER A 1 122 ? 37.690  18.408  26.119  1.00 6.33  ? 122 SER A CA  1 
ATOM   958  C  C   . SER A 1 122 ? 37.586  19.413  24.953  1.00 5.88  ? 122 SER A C   1 
ATOM   959  O  O   . SER A 1 122 ? 37.297  20.579  25.180  1.00 7.09  ? 122 SER A O   1 
ATOM   960  C  CB  . SER A 1 122 ? 38.720  18.878  27.150  1.00 6.19  ? 122 SER A CB  1 
ATOM   961  O  OG  . SER A 1 122 ? 39.997  18.952  26.551  1.00 7.61  ? 122 SER A OG  1 
ATOM   962  N  N   . ARG A 1 123 ? 37.811  18.986  23.712  1.00 3.84  ? 123 ARG A N   1 
ATOM   963  C  CA  . ARG A 1 123 ? 37.578  19.867  22.556  1.00 3.58  ? 123 ARG A CA  1 
ATOM   964  C  C   . ARG A 1 123 ? 36.082  20.166  22.485  1.00 3.33  ? 123 ARG A C   1 
ATOM   965  O  O   . ARG A 1 123 ? 35.264  19.280  22.177  1.00 3.18  ? 123 ARG A O   1 
ATOM   966  C  CB  . ARG A 1 123 ? 38.090  19.195  21.274  1.00 3.82  ? 123 ARG A CB  1 
ATOM   967  C  CG  . ARG A 1 123 ? 37.657  19.827  19.954  1.00 2.66  ? 123 ARG A CG  1 
ATOM   968  C  CD  . ARG A 1 123 ? 37.732  21.369  19.920  1.00 1.76  ? 123 ARG A CD  1 
ATOM   969  N  NE  . ARG A 1 123 ? 39.078  21.893  20.150  1.00 4.17  ? 123 ARG A NE  1 
ATOM   970  C  CZ  . ARG A 1 123 ? 39.399  23.189  20.146  1.00 3.48  ? 123 ARG A CZ  1 
ATOM   971  N  NH1 . ARG A 1 123 ? 38.475  24.105  19.897  1.00 4.14  ? 123 ARG A NH1 1 
ATOM   972  N  NH2 . ARG A 1 123 ? 40.653  23.570  20.376  1.00 4.39  ? 123 ARG A NH2 1 
ATOM   973  N  N   . PHE A 1 124 ? 35.715  21.397  22.819  1.00 2.47  ? 124 PHE A N   1 
ATOM   974  C  CA  . PHE A 1 124 ? 34.307  21.795  22.951  1.00 2.50  ? 124 PHE A CA  1 
ATOM   975  C  C   . PHE A 1 124 ? 33.776  22.284  21.614  1.00 2.34  ? 124 PHE A C   1 
ATOM   976  O  O   . PHE A 1 124 ? 34.353  23.177  20.992  1.00 2.23  ? 124 PHE A O   1 
ATOM   977  C  CB  . PHE A 1 124 ? 34.156  22.874  24.029  1.00 3.08  ? 124 PHE A CB  1 
ATOM   978  C  CG  . PHE A 1 124 ? 32.726  23.166  24.395  1.00 1.61  ? 124 PHE A CG  1 
ATOM   979  C  CD1 . PHE A 1 124 ? 32.048  22.352  25.314  1.00 1.83  ? 124 PHE A CD1 1 
ATOM   980  C  CD2 . PHE A 1 124 ? 32.041  24.222  23.814  1.00 1.58  ? 124 PHE A CD2 1 
ATOM   981  C  CE1 . PHE A 1 124 ? 30.718  22.608  25.654  1.00 1.73  ? 124 PHE A CE1 1 
ATOM   982  C  CE2 . PHE A 1 124 ? 30.717  24.506  24.149  1.00 1.80  ? 124 PHE A CE2 1 
ATOM   983  C  CZ  . PHE A 1 124 ? 30.039  23.691  25.072  1.00 1.81  ? 124 PHE A CZ  1 
ATOM   984  N  N   . GLY A 1 125 ? 32.705  21.655  21.146  1.00 1.31  ? 125 GLY A N   1 
ATOM   985  C  CA  . GLY A 1 125 ? 32.229  21.863  19.787  1.00 1.33  ? 125 GLY A CA  1 
ATOM   986  C  C   . GLY A 1 125 ? 32.931  20.950  18.800  1.00 1.23  ? 125 GLY A C   1 
ATOM   987  O  O   . GLY A 1 125 ? 33.329  19.853  19.150  1.00 1.84  ? 125 GLY A O   1 
ATOM   988  N  N   . SER A 1 126 ? 33.080  21.422  17.568  1.00 1.33  ? 126 SER A N   1 
ATOM   989  C  CA  . SER A 1 126 ? 33.643  20.633  16.476  1.00 1.64  ? 126 SER A CA  1 
ATOM   990  C  C   . SER A 1 126 ? 35.159  20.794  16.422  1.00 1.76  ? 126 SER A C   1 
ATOM   991  O  O   . SER A 1 126 ? 35.685  21.863  16.724  1.00 1.82  ? 126 SER A O   1 
ATOM   992  C  CB  . SER A 1 126 ? 33.026  21.072  15.136  1.00 2.44  ? 126 SER A CB  1 
ATOM   993  O  OG  . SER A 1 126 ? 31.633  20.909  15.118  1.00 1.65  ? 126 SER A OG  1 
ATOM   994  N  N   . GLY A 1 127 ? 35.874  19.739  16.060  1.00 1.97  ? 127 GLY A N   1 
ATOM   995  C  CA  . GLY A 1 127 ? 37.330  19.872  16.000  1.00 1.71  ? 127 GLY A CA  1 
ATOM   996  C  C   . GLY A 1 127 ? 38.077  18.584  15.816  1.00 1.86  ? 127 GLY A C   1 
ATOM   997  O  O   . GLY A 1 127 ? 37.489  17.568  15.466  1.00 1.00  ? 127 GLY A O   1 
ATOM   998  N  N   . TRP A 1 128 ? 39.381  18.647  16.084  1.00 1.90  ? 128 TRP A N   1 
ATOM   999  C  CA  . TRP A 1 128 ? 40.277  17.524  15.879  1.00 1.95  ? 128 TRP A CA  1 
ATOM   1000 C  C   . TRP A 1 128 ? 41.228  17.399  17.048  1.00 2.09  ? 128 TRP A C   1 
ATOM   1001 O  O   . TRP A 1 128 ? 41.636  18.407  17.628  1.00 2.25  ? 128 TRP A O   1 
ATOM   1002 C  CB  . TRP A 1 128 ? 41.124  17.713  14.608  1.00 1.45  ? 128 TRP A CB  1 
ATOM   1003 C  CG  . TRP A 1 128 ? 40.345  17.501  13.334  1.00 1.63  ? 128 TRP A CG  1 
ATOM   1004 C  CD1 . TRP A 1 128 ? 39.466  18.376  12.765  1.00 1.80  ? 128 TRP A CD1 1 
ATOM   1005 C  CD2 . TRP A 1 128 ? 40.363  16.348  12.483  1.00 1.13  ? 128 TRP A CD2 1 
ATOM   1006 N  NE1 . TRP A 1 128 ? 38.943  17.840  11.621  1.00 0.92  ? 128 TRP A NE1 1 
ATOM   1007 C  CE2 . TRP A 1 128 ? 39.483  16.602  11.425  1.00 0.84  ? 128 TRP A CE2 1 
ATOM   1008 C  CE3 . TRP A 1 128 ? 41.056  15.132  12.509  1.00 1.68  ? 128 TRP A CE3 1 
ATOM   1009 C  CZ2 . TRP A 1 128 ? 39.249  15.684  10.407  1.00 1.33  ? 128 TRP A CZ2 1 
ATOM   1010 C  CZ3 . TRP A 1 128 ? 40.826  14.210  11.492  1.00 2.40  ? 128 TRP A CZ3 1 
ATOM   1011 C  CH2 . TRP A 1 128 ? 39.928  14.503  10.454  1.00 1.01  ? 128 TRP A CH2 1 
ATOM   1012 N  N   . ALA A 1 129 ? 41.605  16.165  17.354  1.00 2.96  ? 129 ALA A N   1 
ATOM   1013 C  CA  . ALA A 1 129 ? 42.670  15.895  18.300  1.00 2.83  ? 129 ALA A CA  1 
ATOM   1014 C  C   . ALA A 1 129 ? 43.873  15.360  17.535  1.00 2.57  ? 129 ALA A C   1 
ATOM   1015 O  O   . ALA A 1 129 ? 43.743  14.498  16.665  1.00 1.80  ? 129 ALA A O   1 
ATOM   1016 C  CB  . ALA A 1 129 ? 42.212  14.883  19.348  1.00 3.40  ? 129 ALA A CB  1 
ATOM   1017 N  N   . TRP A 1 130 ? 45.052  15.878  17.848  1.00 1.77  ? 130 TRP A N   1 
ATOM   1018 C  CA  . TRP A 1 130 ? 46.247  15.525  17.081  1.00 2.39  ? 130 TRP A CA  1 
ATOM   1019 C  C   . TRP A 1 130 ? 47.401  15.023  17.928  1.00 2.52  ? 130 TRP A C   1 
ATOM   1020 O  O   . TRP A 1 130 ? 47.574  15.479  19.043  1.00 2.66  ? 130 TRP A O   1 
ATOM   1021 C  CB  . TRP A 1 130 ? 46.759  16.757  16.339  1.00 2.21  ? 130 TRP A CB  1 
ATOM   1022 C  CG  . TRP A 1 130 ? 45.738  17.499  15.500  1.00 1.34  ? 130 TRP A CG  1 
ATOM   1023 C  CD1 . TRP A 1 130 ? 44.990  18.556  15.882  1.00 1.15  ? 130 TRP A CD1 1 
ATOM   1024 C  CD2 . TRP A 1 130 ? 45.400  17.241  14.127  1.00 1.11  ? 130 TRP A CD2 1 
ATOM   1025 N  NE1 . TRP A 1 130 ? 44.196  18.992  14.836  1.00 1.54  ? 130 TRP A NE1 1 
ATOM   1026 C  CE2 . TRP A 1 130 ? 44.431  18.195  13.748  1.00 0.82  ? 130 TRP A CE2 1 
ATOM   1027 C  CE3 . TRP A 1 130 ? 45.829  16.300  13.186  1.00 1.99  ? 130 TRP A CE3 1 
ATOM   1028 C  CZ2 . TRP A 1 130 ? 43.869  18.233  12.465  1.00 2.15  ? 130 TRP A CZ2 1 
ATOM   1029 C  CZ3 . TRP A 1 130 ? 45.252  16.315  11.913  1.00 2.89  ? 130 TRP A CZ3 1 
ATOM   1030 C  CH2 . TRP A 1 130 ? 44.287  17.282  11.561  1.00 2.77  ? 130 TRP A CH2 1 
ATOM   1031 N  N   . LEU A 1 131 ? 48.188  14.102  17.377  1.00 3.66  ? 131 LEU A N   1 
ATOM   1032 C  CA  . LEU A 1 131 ? 49.546  13.852  17.861  1.00 4.22  ? 131 LEU A CA  1 
ATOM   1033 C  C   . LEU A 1 131 ? 50.438  14.627  16.878  1.00 4.57  ? 131 LEU A C   1 
ATOM   1034 O  O   . LEU A 1 131 ? 50.385  14.365  15.683  1.00 3.69  ? 131 LEU A O   1 
ATOM   1035 C  CB  . LEU A 1 131 ? 49.879  12.355  17.817  1.00 4.58  ? 131 LEU A CB  1 
ATOM   1036 C  CG  . LEU A 1 131 ? 51.325  11.993  18.207  1.00 5.07  ? 131 LEU A CG  1 
ATOM   1037 C  CD1 . LEU A 1 131 ? 51.638  12.468  19.593  1.00 4.11  ? 131 LEU A CD1 1 
ATOM   1038 C  CD2 . LEU A 1 131 ? 51.580  10.468  18.036  1.00 5.98  ? 131 LEU A CD2 1 
ATOM   1039 N  N   . VAL A 1 132 ? 51.226  15.583  17.365  1.00 4.14  ? 132 VAL A N   1 
ATOM   1040 C  CA  . VAL A 1 132 ? 52.031  16.464  16.505  1.00 4.36  ? 132 VAL A CA  1 
ATOM   1041 C  C   . VAL A 1 132 ? 53.497  16.382  16.916  1.00 4.64  ? 132 VAL A C   1 
ATOM   1042 O  O   . VAL A 1 132 ? 53.808  16.151  18.076  1.00 4.28  ? 132 VAL A O   1 
ATOM   1043 C  CB  . VAL A 1 132 ? 51.601  17.959  16.600  1.00 4.97  ? 132 VAL A CB  1 
ATOM   1044 C  CG1 . VAL A 1 132 ? 50.270  18.193  15.905  1.00 4.97  ? 132 VAL A CG1 1 
ATOM   1045 C  CG2 . VAL A 1 132 ? 51.563  18.432  18.052  1.00 5.13  ? 132 VAL A CG2 1 
ATOM   1046 N  N   . LEU A 1 133 ? 54.391  16.570  15.954  1.00 4.28  ? 133 LEU A N   1 
ATOM   1047 C  CA  . LEU A 1 133 ? 55.820  16.553  16.215  1.00 4.75  ? 133 LEU A CA  1 
ATOM   1048 C  C   . LEU A 1 133 ? 56.399  17.946  15.986  1.00 4.75  ? 133 LEU A C   1 
ATOM   1049 O  O   . LEU A 1 133 ? 56.161  18.560  14.954  1.00 4.99  ? 133 LEU A O   1 
ATOM   1050 C  CB  . LEU A 1 133 ? 56.495  15.554  15.285  1.00 5.14  ? 133 LEU A CB  1 
ATOM   1051 C  CG  . LEU A 1 133 ? 58.017  15.550  15.296  1.00 6.40  ? 133 LEU A CG  1 
ATOM   1052 C  CD1 . LEU A 1 133 ? 58.497  15.193  16.680  1.00 8.04  ? 133 LEU A CD1 1 
ATOM   1053 C  CD2 . LEU A 1 133 ? 58.494  14.530  14.297  1.00 7.08  ? 133 LEU A CD2 1 
ATOM   1054 N  N   . LYS A 1 134 ? 57.150  18.455  16.953  1.00 4.63  ? 134 LYS A N   1 
ATOM   1055 C  CA  . LYS A 1 134 ? 57.729  19.790  16.819  1.00 5.94  ? 134 LYS A CA  1 
ATOM   1056 C  C   . LYS A 1 134 ? 58.956  19.878  17.693  1.00 6.74  ? 134 LYS A C   1 
ATOM   1057 O  O   . LYS A 1 134 ? 58.868  19.674  18.908  1.00 6.81  ? 134 LYS A O   1 
ATOM   1058 C  CB  . LYS A 1 134 ? 56.714  20.854  17.234  1.00 6.14  ? 134 LYS A CB  1 
ATOM   1059 C  CG  . LYS A 1 134 ? 57.192  22.320  17.096  1.00 6.53  ? 134 LYS A CG  1 
ATOM   1060 C  CD  . LYS A 1 134 ? 56.136  23.263  17.622  1.00 8.54  ? 134 LYS A CD  1 
ATOM   1061 C  CE  . LYS A 1 134 ? 56.557  24.721  17.529  1.00 9.10  ? 134 LYS A CE  1 
ATOM   1062 N  NZ  . LYS A 1 134 ? 56.439  25.224  16.139  1.00 11.72 ? 134 LYS A NZ  1 
ATOM   1063 N  N   . GLY A 1 135 ? 60.088  20.199  17.068  1.00 6.84  ? 135 GLY A N   1 
ATOM   1064 C  CA  . GLY A 1 135 ? 61.349  20.331  17.782  1.00 7.97  ? 135 GLY A CA  1 
ATOM   1065 C  C   . GLY A 1 135 ? 61.864  19.030  18.367  1.00 7.97  ? 135 GLY A C   1 
ATOM   1066 O  O   . GLY A 1 135 ? 62.338  19.008  19.503  1.00 8.47  ? 135 GLY A O   1 
ATOM   1067 N  N   . ASP A 1 136 ? 61.782  17.954  17.591  1.00 8.71  ? 136 ASP A N   1 
ATOM   1068 C  CA  . ASP A 1 136 ? 62.209  16.638  18.045  1.00 9.33  ? 136 ASP A CA  1 
ATOM   1069 C  C   . ASP A 1 136 ? 61.248  15.948  19.027  1.00 9.09  ? 136 ASP A C   1 
ATOM   1070 O  O   . ASP A 1 136 ? 61.527  14.825  19.475  1.00 9.35  ? 136 ASP A O   1 
ATOM   1071 C  CB  . ASP A 1 136 ? 63.604  16.724  18.669  1.00 9.69  ? 136 ASP A CB  1 
ATOM   1072 C  CG  . ASP A 1 136 ? 64.652  17.273  17.704  1.00 11.09 ? 136 ASP A CG  1 
ATOM   1073 O  OD1 . ASP A 1 136 ? 65.495  18.078  18.152  1.00 12.01 ? 136 ASP A OD1 1 
ATOM   1074 O  OD2 . ASP A 1 136 ? 64.625  16.901  16.506  1.00 12.67 ? 136 ASP A OD2 1 
ATOM   1075 N  N   . LYS A 1 137 ? 60.116  16.587  19.348  1.00 8.24  ? 137 LYS A N   1 
ATOM   1076 C  CA  . LYS A 1 137 ? 59.234  16.067  20.398  1.00 8.61  ? 137 LYS A CA  1 
ATOM   1077 C  C   . LYS A 1 137 ? 57.761  15.957  20.069  1.00 7.92  ? 137 LYS A C   1 
ATOM   1078 O  O   . LYS A 1 137 ? 57.181  16.809  19.373  1.00 8.37  ? 137 LYS A O   1 
ATOM   1079 C  CB  . LYS A 1 137 ? 59.402  16.883  21.667  1.00 8.68  ? 137 LYS A CB  1 
ATOM   1080 C  CG  . LYS A 1 137 ? 60.748  16.629  22.281  1.00 9.65  ? 137 LYS A CG  1 
ATOM   1081 C  CD  . LYS A 1 137 ? 61.256  17.788  23.076  1.00 10.42 ? 137 LYS A CD  1 
ATOM   1082 C  CE  . LYS A 1 137 ? 62.620  17.424  23.632  1.00 10.22 ? 137 LYS A CE  1 
ATOM   1083 N  NZ  . LYS A 1 137 ? 63.205  18.523  24.436  1.00 10.53 ? 137 LYS A NZ  1 
ATOM   1084 N  N   . LEU A 1 138 ? 57.155  14.903  20.612  1.00 7.72  ? 138 LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 138 ? 55.731  14.682  20.450  1.00 6.53  ? 138 LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 138 ? 54.897  15.431  21.491  1.00 7.05  ? 138 LEU A C   1 
ATOM   1087 O  O   . LEU A 1 138 ? 55.302  15.588  22.651  1.00 7.28  ? 138 LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 138 ? 55.414  13.180  20.487  1.00 5.66  ? 138 LEU A CB  1 
ATOM   1089 C  CG  . LEU A 1 138 ? 56.111  12.336  19.421  1.00 5.12  ? 138 LEU A CG  1 
ATOM   1090 C  CD1 . LEU A 1 138 ? 56.049  10.825  19.751  1.00 4.93  ? 138 LEU A CD1 1 
ATOM   1091 C  CD2 . LEU A 1 138 ? 55.546  12.637  18.022  1.00 4.86  ? 138 LEU A CD2 1 
ATOM   1092 N  N   . ALA A 1 139 ? 53.734  15.898  21.048  1.00 6.33  ? 139 ALA A N   1 
ATOM   1093 C  CA  . ALA A 1 139 ? 52.749  16.485  21.928  1.00 6.04  ? 139 ALA A CA  1 
ATOM   1094 C  C   . ALA A 1 139 ? 51.332  16.252  21.405  1.00 5.57  ? 139 ALA A C   1 
ATOM   1095 O  O   . ALA A 1 139 ? 51.117  15.863  20.254  1.00 5.22  ? 139 ALA A O   1 
ATOM   1096 C  CB  . ALA A 1 139 ? 53.012  17.961  22.140  1.00 6.03  ? 139 ALA A CB  1 
ATOM   1097 N  N   . VAL A 1 140 ? 50.372  16.453  22.283  1.00 5.52  ? 140 VAL A N   1 
ATOM   1098 C  CA  . VAL A 1 140 ? 48.976  16.290  21.941  1.00 5.23  ? 140 VAL A CA  1 
ATOM   1099 C  C   . VAL A 1 140 ? 48.265  17.604  22.091  1.00 5.82  ? 140 VAL A C   1 
ATOM   1100 O  O   . VAL A 1 140 ? 48.410  18.276  23.106  1.00 5.33  ? 140 VAL A O   1 
ATOM   1101 C  CB  . VAL A 1 140 ? 48.281  15.292  22.856  1.00 5.79  ? 140 VAL A CB  1 
ATOM   1102 C  CG1 . VAL A 1 140 ? 46.785  15.377  22.627  1.00 6.01  ? 140 VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A 1 140 ? 48.765  13.905  22.533  1.00 6.88  ? 140 VAL A CG2 1 
ATOM   1104 N  N   . VAL A 1 141 ? 47.492  17.948  21.067  1.00 5.60  ? 141 VAL A N   1 
ATOM   1105 C  CA  . VAL A 1 141 ? 46.806  19.228  21.001  1.00 5.91  ? 141 VAL A CA  1 
ATOM   1106 C  C   . VAL A 1 141 ? 45.503  19.019  20.255  1.00 5.57  ? 141 VAL A C   1 
ATOM   1107 O  O   . VAL A 1 141 ? 45.318  17.983  19.621  1.00 6.11  ? 141 VAL A O   1 
ATOM   1108 C  CB  . VAL A 1 141 ? 47.660  20.287  20.270  1.00 5.57  ? 141 VAL A CB  1 
ATOM   1109 C  CG1 . VAL A 1 141 ? 47.917  19.890  18.803  1.00 8.10  ? 141 VAL A CG1 1 
ATOM   1110 C  CG2 . VAL A 1 141 ? 46.995  21.663  20.360  1.00 6.86  ? 141 VAL A CG2 1 
ATOM   1111 N  N   . SER A 1 142 ? 44.600  19.991  20.353  1.00 5.46  ? 142 SER A N   1 
ATOM   1112 C  CA  . SER A 1 142 ? 43.352  19.945  19.605  1.00 4.01  ? 142 SER A CA  1 
ATOM   1113 C  C   . SER A 1 142 ? 43.129  21.267  18.867  1.00 4.13  ? 142 SER A C   1 
ATOM   1114 O  O   . SER A 1 142 ? 43.722  22.277  19.208  1.00 4.04  ? 142 SER A O   1 
ATOM   1115 C  CB  . SER A 1 142 ? 42.164  19.548  20.513  1.00 4.37  ? 142 SER A CB  1 
ATOM   1116 O  OG  . SER A 1 142 ? 41.625  20.641  21.230  1.00 2.88  ? 142 SER A OG  1 
ATOM   1117 N  N   . THR A 1 143 ? 42.325  21.234  17.809  1.00 2.86  ? 143 THR A N   1 
ATOM   1118 C  CA  . THR A 1 143 ? 42.038  22.431  17.012  1.00 2.47  ? 143 THR A CA  1 
ATOM   1119 C  C   . THR A 1 143 ? 40.540  22.529  16.794  1.00 2.02  ? 143 THR A C   1 
ATOM   1120 O  O   . THR A 1 143 ? 39.820  21.546  16.990  1.00 1.84  ? 143 THR A O   1 
ATOM   1121 C  CB  . THR A 1 143 ? 42.730  22.379  15.628  1.00 2.28  ? 143 THR A CB  1 
ATOM   1122 O  OG1 . THR A 1 143 ? 42.333  21.189  14.928  1.00 2.43  ? 143 THR A OG1 1 
ATOM   1123 C  CG2 . THR A 1 143 ? 44.259  22.396  15.762  1.00 3.51  ? 143 THR A CG2 1 
ATOM   1124 N  N   . ALA A 1 144 ? 40.072  23.725  16.446  1.00 1.27  ? 144 ALA A N   1 
ATOM   1125 C  CA  . ALA A 1 144 ? 38.651  23.977  16.227  1.00 1.98  ? 144 ALA A CA  1 
ATOM   1126 C  C   . ALA A 1 144 ? 38.233  23.740  14.779  1.00 2.43  ? 144 ALA A C   1 
ATOM   1127 O  O   . ALA A 1 144 ? 38.984  24.026  13.845  1.00 2.85  ? 144 ALA A O   1 
ATOM   1128 C  CB  . ALA A 1 144 ? 38.302  25.400  16.654  1.00 2.45  ? 144 ALA A CB  1 
ATOM   1129 N  N   . ASN A 1 145 ? 37.049  23.178  14.588  1.00 1.63  ? 145 ASN A N   1 
ATOM   1130 C  CA  . ASN A 1 145 ? 36.465  23.076  13.262  1.00 1.80  ? 145 ASN A CA  1 
ATOM   1131 C  C   . ASN A 1 145 ? 37.361  22.321  12.274  1.00 1.58  ? 145 ASN A C   1 
ATOM   1132 O  O   . ASN A 1 145 ? 37.684  21.160  12.524  1.00 1.18  ? 145 ASN A O   1 
ATOM   1133 C  CB  . ASN A 1 145 ? 36.048  24.467  12.802  1.00 1.87  ? 145 ASN A CB  1 
ATOM   1134 C  CG  . ASN A 1 145 ? 35.097  25.122  13.794  1.00 1.77  ? 145 ASN A CG  1 
ATOM   1135 O  OD1 . ASN A 1 145 ? 34.165  24.479  14.289  1.00 1.87  ? 145 ASN A OD1 1 
ATOM   1136 N  ND2 . ASN A 1 145 ? 35.322  26.388  14.089  1.00 4.55  ? 145 ASN A ND2 1 
ATOM   1137 N  N   . GLN A 1 146 ? 37.787  22.936  11.167  1.00 1.49  ? 146 GLN A N   1 
ATOM   1138 C  CA  . GLN A 1 146 ? 38.755  22.217  10.326  1.00 1.47  ? 146 GLN A CA  1 
ATOM   1139 C  C   . GLN A 1 146 ? 40.165  22.776  10.398  1.00 1.11  ? 146 GLN A C   1 
ATOM   1140 O  O   . GLN A 1 146 ? 40.983  22.550  9.487   1.00 0.97  ? 146 GLN A O   1 
ATOM   1141 C  CB  . GLN A 1 146 ? 38.312  22.115  8.874   1.00 1.20  ? 146 GLN A CB  1 
ATOM   1142 C  CG  . GLN A 1 146 ? 37.059  21.340  8.675   1.00 1.23  ? 146 GLN A CG  1 
ATOM   1143 C  CD  . GLN A 1 146 ? 37.145  19.892  9.085   1.00 1.21  ? 146 GLN A CD  1 
ATOM   1144 O  OE1 . GLN A 1 146 ? 38.228  19.294  9.212   1.00 2.52  ? 146 GLN A OE1 1 
ATOM   1145 N  NE2 . GLN A 1 146 ? 35.968  19.298  9.288   1.00 2.26  ? 146 GLN A NE2 1 
ATOM   1146 N  N   . ASP A 1 147 ? 40.480  23.466  11.488  1.00 1.63  ? 147 ASP A N   1 
ATOM   1147 C  CA  . ASP A 1 147 ? 41.816  24.065  11.586  1.00 1.94  ? 147 ASP A CA  1 
ATOM   1148 C  C   . ASP A 1 147 ? 42.829  22.935  11.757  1.00 2.12  ? 147 ASP A C   1 
ATOM   1149 O  O   . ASP A 1 147 ? 42.532  21.913  12.367  1.00 2.06  ? 147 ASP A O   1 
ATOM   1150 C  CB  . ASP A 1 147 ? 41.921  25.031  12.764  1.00 2.36  ? 147 ASP A CB  1 
ATOM   1151 C  CG  . ASP A 1 147 ? 41.072  26.299  12.613  1.00 2.36  ? 147 ASP A CG  1 
ATOM   1152 O  OD1 . ASP A 1 147 ? 40.581  26.633  11.504  1.00 2.17  ? 147 ASP A OD1 1 
ATOM   1153 O  OD2 . ASP A 1 147 ? 40.900  26.980  13.649  1.00 1.40  ? 147 ASP A OD2 1 
ATOM   1154 N  N   . SER A 1 148 ? 44.031  23.111  11.224  1.00 2.47  ? 148 SER A N   1 
ATOM   1155 C  CA  . SER A 1 148 ? 45.090  22.103  11.361  1.00 2.77  ? 148 SER A CA  1 
ATOM   1156 C  C   . SER A 1 148 ? 46.346  22.758  11.932  1.00 3.28  ? 148 SER A C   1 
ATOM   1157 O  O   . SER A 1 148 ? 46.562  23.949  11.702  1.00 2.02  ? 148 SER A O   1 
ATOM   1158 C  CB  . SER A 1 148 ? 45.418  21.542  9.966   1.00 2.83  ? 148 SER A CB  1 
ATOM   1159 O  OG  . SER A 1 148 ? 46.721  20.998  9.905   1.00 3.13  ? 148 SER A OG  1 
ATOM   1160 N  N   . PRO A 1 149 ? 47.190  21.992  12.644  1.00 3.16  ? 149 PRO A N   1 
ATOM   1161 C  CA  . PRO A 1 149 ? 48.428  22.612  13.155  1.00 3.12  ? 149 PRO A CA  1 
ATOM   1162 C  C   . PRO A 1 149 ? 49.282  23.120  11.999  1.00 3.32  ? 149 PRO A C   1 
ATOM   1163 O  O   . PRO A 1 149 ? 50.117  24.013  12.174  1.00 2.90  ? 149 PRO A O   1 
ATOM   1164 C  CB  . PRO A 1 149 ? 49.162  21.451  13.857  1.00 3.76  ? 149 PRO A CB  1 
ATOM   1165 C  CG  . PRO A 1 149 ? 48.135  20.421  14.101  1.00 4.54  ? 149 PRO A CG  1 
ATOM   1166 C  CD  . PRO A 1 149 ? 47.093  20.570  13.029  1.00 3.12  ? 149 PRO A CD  1 
ATOM   1167 N  N   . LEU A 1 150 ? 49.081  22.554  10.816  1.00 2.99  ? 150 LEU A N   1 
ATOM   1168 C  CA  . LEU A 1 150 ? 49.863  22.986  9.663   1.00 2.92  ? 150 LEU A CA  1 
ATOM   1169 C  C   . LEU A 1 150 ? 49.545  24.433  9.325   1.00 3.44  ? 150 LEU A C   1 
ATOM   1170 O  O   . LEU A 1 150 ? 50.297  25.089  8.581   1.00 4.63  ? 150 LEU A O   1 
ATOM   1171 C  CB  . LEU A 1 150 ? 49.593  22.093  8.449   1.00 2.97  ? 150 LEU A CB  1 
ATOM   1172 C  CG  . LEU A 1 150 ? 50.070  20.642  8.540   1.00 2.58  ? 150 LEU A CG  1 
ATOM   1173 C  CD1 . LEU A 1 150 ? 49.644  19.884  7.302   1.00 2.42  ? 150 LEU A CD1 1 
ATOM   1174 C  CD2 . LEU A 1 150 ? 51.578  20.577  8.724   1.00 1.56  ? 150 LEU A CD2 1 
ATOM   1175 N  N   . MET A 1 151 ? 48.439  24.941  9.846   1.00 3.48  ? 151 MET A N   1 
ATOM   1176 C  CA  . MET A 1 151 ? 48.081  26.346  9.580   1.00 2.76  ? 151 MET A CA  1 
ATOM   1177 C  C   . MET A 1 151 ? 48.847  27.326  10.457  1.00 3.95  ? 151 MET A C   1 
ATOM   1178 O  O   . MET A 1 151 ? 48.780  28.534  10.230  1.00 3.07  ? 151 MET A O   1 
ATOM   1179 C  CB  . MET A 1 151 ? 46.588  26.576  9.767   1.00 3.85  ? 151 MET A CB  1 
ATOM   1180 C  CG  . MET A 1 151 ? 45.695  25.880  8.771   1.00 2.52  ? 151 MET A CG  1 
ATOM   1181 S  SD  . MET A 1 151 ? 43.978  26.018  9.329   1.00 2.33  ? 151 MET A SD  1 
ATOM   1182 C  CE  . MET A 1 151 ? 43.176  25.074  8.045   1.00 3.45  ? 151 MET A CE  1 
ATOM   1183 N  N   . GLY A 1 152 ? 49.551  26.815  11.460  1.00 3.95  ? 152 GLY A N   1 
ATOM   1184 C  CA  . GLY A 1 152 ? 50.283  27.680  12.388  1.00 4.17  ? 152 GLY A CA  1 
ATOM   1185 C  C   . GLY A 1 152 ? 49.498  28.151  13.600  1.00 4.76  ? 152 GLY A C   1 
ATOM   1186 O  O   . GLY A 1 152 ? 48.266  28.095  13.634  1.00 4.24  ? 152 GLY A O   1 
ATOM   1187 N  N   . GLU A 1 153 ? 50.216  28.634  14.607  1.00 5.35  ? 153 GLU A N   1 
ATOM   1188 C  CA  . GLU A 1 153 ? 49.581  29.021  15.857  1.00 6.38  ? 153 GLU A CA  1 
ATOM   1189 C  C   . GLU A 1 153 ? 48.668  30.219  15.686  1.00 6.64  ? 153 GLU A C   1 
ATOM   1190 O  O   . GLU A 1 153 ? 47.589  30.242  16.274  1.00 6.41  ? 153 GLU A O   1 
ATOM   1191 C  CB  . GLU A 1 153 ? 50.619  29.278  16.972  1.00 6.94  ? 153 GLU A CB  1 
ATOM   1192 C  CG  . GLU A 1 153 ? 49.993  29.380  18.374  1.00 8.68  ? 153 GLU A CG  1 
ATOM   1193 C  CD  . GLU A 1 153 ? 51.006  29.663  19.485  1.00 11.85 ? 153 GLU A CD  1 
ATOM   1194 O  OE1 . GLU A 1 153 ? 52.127  29.101  19.440  1.00 13.22 ? 153 GLU A OE1 1 
ATOM   1195 O  OE2 . GLU A 1 153 ? 50.659  30.440  20.407  1.00 15.26 ? 153 GLU A OE2 1 
ATOM   1196 N  N   . ALA A 1 154 ? 49.084  31.215  14.900  1.00 6.66  ? 154 ALA A N   1 
ATOM   1197 C  CA  . ALA A 1 154 ? 48.261  32.423  14.775  1.00 6.48  ? 154 ALA A CA  1 
ATOM   1198 C  C   . ALA A 1 154 ? 46.830  32.010  14.499  1.00 6.30  ? 154 ALA A C   1 
ATOM   1199 O  O   . ALA A 1 154 ? 45.900  32.500  15.127  1.00 7.02  ? 154 ALA A O   1 
ATOM   1200 C  CB  . ALA A 1 154 ? 48.772  33.331  13.634  1.00 6.60  ? 154 ALA A CB  1 
ATOM   1201 N  N   . ILE A 1 155 ? 46.666  31.096  13.550  1.00 6.17  ? 155 ILE A N   1 
ATOM   1202 C  CA  . ILE A 1 155 ? 45.333  30.733  13.053  1.00 5.47  ? 155 ILE A CA  1 
ATOM   1203 C  C   . ILE A 1 155 ? 44.682  29.618  13.875  1.00 5.49  ? 155 ILE A C   1 
ATOM   1204 O  O   . ILE A 1 155 ? 43.510  29.723  14.254  1.00 5.45  ? 155 ILE A O   1 
ATOM   1205 C  CB  . ILE A 1 155 ? 45.370  30.394  11.535  1.00 5.89  ? 155 ILE A CB  1 
ATOM   1206 C  CG1 . ILE A 1 155 ? 45.643  31.653  10.698  1.00 5.84  ? 155 ILE A CG1 1 
ATOM   1207 C  CG2 . ILE A 1 155 ? 44.038  29.815  11.084  1.00 5.63  ? 155 ILE A CG2 1 
ATOM   1208 C  CD1 . ILE A 1 155 ? 45.718  31.403  9.197   1.00 6.60  ? 155 ILE A CD1 1 
ATOM   1209 N  N   . SER A 1 156 ? 45.442  28.566  14.169  1.00 4.84  ? 156 SER A N   1 
ATOM   1210 C  CA  . SER A 1 156 ? 44.850  27.330  14.694  1.00 4.60  ? 156 SER A CA  1 
ATOM   1211 C  C   . SER A 1 156 ? 45.047  27.124  16.184  1.00 4.87  ? 156 SER A C   1 
ATOM   1212 O  O   . SER A 1 156 ? 44.415  26.270  16.761  1.00 3.81  ? 156 SER A O   1 
ATOM   1213 C  CB  . SER A 1 156 ? 45.419  26.110  13.975  1.00 4.84  ? 156 SER A CB  1 
ATOM   1214 O  OG  . SER A 1 156 ? 46.721  25.836  14.466  1.00 3.96  ? 156 SER A OG  1 
ATOM   1215 N  N   . GLY A 1 157 ? 45.938  27.887  16.804  1.00 5.28  ? 157 GLY A N   1 
ATOM   1216 C  CA  . GLY A 1 157 ? 46.173  27.714  18.226  1.00 6.12  ? 157 GLY A CA  1 
ATOM   1217 C  C   . GLY A 1 157 ? 47.156  26.581  18.465  1.00 6.10  ? 157 GLY A C   1 
ATOM   1218 O  O   . GLY A 1 157 ? 47.600  26.360  19.594  1.00 6.60  ? 157 GLY A O   1 
ATOM   1219 N  N   . ALA A 1 158 ? 47.518  25.885  17.391  1.00 6.30  ? 158 ALA A N   1 
ATOM   1220 C  CA  . ALA A 1 158 ? 48.429  24.732  17.454  1.00 5.94  ? 158 ALA A CA  1 
ATOM   1221 C  C   . ALA A 1 158 ? 49.490  24.864  16.383  1.00 5.52  ? 158 ALA A C   1 
ATOM   1222 O  O   . ALA A 1 158 ? 49.375  25.685  15.474  1.00 6.03  ? 158 ALA A O   1 
ATOM   1223 C  CB  . ALA A 1 158 ? 47.669  23.433  17.246  1.00 6.00  ? 158 ALA A CB  1 
ATOM   1224 N  N   . SER A 1 159 ? 50.503  24.020  16.459  1.00 5.11  ? 159 SER A N   1 
ATOM   1225 C  CA  . SER A 1 159 ? 51.541  24.031  15.459  1.00 5.11  ? 159 SER A CA  1 
ATOM   1226 C  C   . SER A 1 159 ? 52.267  22.717  15.571  1.00 5.47  ? 159 SER A C   1 
ATOM   1227 O  O   . SER A 1 159 ? 52.076  21.979  16.552  1.00 5.81  ? 159 SER A O   1 
ATOM   1228 C  CB  . SER A 1 159 ? 52.498  25.215  15.670  1.00 5.33  ? 159 SER A CB  1 
ATOM   1229 O  OG  . SER A 1 159 ? 53.198  25.105  16.896  1.00 4.48  ? 159 SER A OG  1 
ATOM   1230 N  N   . GLY A 1 160 ? 53.065  22.427  14.548  1.00 6.07  ? 160 GLY A N   1 
ATOM   1231 C  CA  . GLY A 1 160 ? 53.829  21.202  14.466  1.00 6.09  ? 160 GLY A CA  1 
ATOM   1232 C  C   . GLY A 1 160 ? 53.360  20.344  13.310  1.00 5.97  ? 160 GLY A C   1 
ATOM   1233 O  O   . GLY A 1 160 ? 52.367  20.660  12.647  1.00 7.22  ? 160 GLY A O   1 
ATOM   1234 N  N   . PHE A 1 161 ? 54.054  19.238  13.096  1.00 5.55  ? 161 PHE A N   1 
ATOM   1235 C  CA  . PHE A 1 161 ? 53.757  18.296  12.026  1.00 4.81  ? 161 PHE A CA  1 
ATOM   1236 C  C   . PHE A 1 161 ? 52.828  17.191  12.533  1.00 4.79  ? 161 PHE A C   1 
ATOM   1237 O  O   . PHE A 1 161 ? 53.187  16.435  13.431  1.00 4.03  ? 161 PHE A O   1 
ATOM   1238 C  CB  . PHE A 1 161 ? 55.077  17.680  11.525  1.00 5.25  ? 161 PHE A CB  1 
ATOM   1239 C  CG  . PHE A 1 161 ? 54.909  16.649  10.453  1.00 5.77  ? 161 PHE A CG  1 
ATOM   1240 C  CD1 . PHE A 1 161 ? 54.229  16.948  9.289   1.00 6.80  ? 161 PHE A CD1 1 
ATOM   1241 C  CD2 . PHE A 1 161 ? 55.463  15.383  10.593  1.00 7.28  ? 161 PHE A CD2 1 
ATOM   1242 C  CE1 . PHE A 1 161 ? 54.092  16.010  8.292   1.00 7.19  ? 161 PHE A CE1 1 
ATOM   1243 C  CE2 . PHE A 1 161 ? 55.328  14.435  9.601   1.00 7.79  ? 161 PHE A CE2 1 
ATOM   1244 C  CZ  . PHE A 1 161 ? 54.626  14.741  8.454   1.00 7.25  ? 161 PHE A CZ  1 
ATOM   1245 N  N   . PRO A 1 162 ? 51.621  17.095  11.964  1.00 4.72  ? 162 PRO A N   1 
ATOM   1246 C  CA  . PRO A 1 162 ? 50.717  16.059  12.481  1.00 4.97  ? 162 PRO A CA  1 
ATOM   1247 C  C   . PRO A 1 162 ? 51.237  14.676  12.169  1.00 5.11  ? 162 PRO A C   1 
ATOM   1248 O  O   . PRO A 1 162 ? 51.656  14.412  11.047  1.00 6.05  ? 162 PRO A O   1 
ATOM   1249 C  CB  . PRO A 1 162 ? 49.404  16.307  11.725  1.00 4.76  ? 162 PRO A CB  1 
ATOM   1250 C  CG  . PRO A 1 162 ? 49.548  17.730  11.197  1.00 4.60  ? 162 PRO A CG  1 
ATOM   1251 C  CD  . PRO A 1 162 ? 51.001  17.866  10.878  1.00 5.35  ? 162 PRO A CD  1 
ATOM   1252 N  N   . ILE A 1 163 ? 51.235  13.814  13.180  1.00 5.13  ? 163 ILE A N   1 
ATOM   1253 C  CA  . ILE A 1 163 ? 51.643  12.442  13.017  1.00 4.76  ? 163 ILE A CA  1 
ATOM   1254 C  C   . ILE A 1 163 ? 50.375  11.626  12.807  1.00 4.60  ? 163 ILE A C   1 
ATOM   1255 O  O   . ILE A 1 163 ? 50.307  10.768  11.939  1.00 4.61  ? 163 ILE A O   1 
ATOM   1256 C  CB  . ILE A 1 163 ? 52.376  11.935  14.276  1.00 4.46  ? 163 ILE A CB  1 
ATOM   1257 C  CG1 . ILE A 1 163 ? 53.600  12.805  14.534  1.00 3.83  ? 163 ILE A CG1 1 
ATOM   1258 C  CG2 . ILE A 1 163 ? 52.739  10.458  14.137  1.00 5.41  ? 163 ILE A CG2 1 
ATOM   1259 C  CD1 . ILE A 1 163 ? 54.526  12.862  13.323  1.00 4.26  ? 163 ILE A CD1 1 
ATOM   1260 N  N   . MET A 1 164 ? 49.347  11.925  13.585  1.00 5.08  ? 164 MET A N   1 
ATOM   1261 C  CA  . MET A 1 164 ? 48.067  11.221  13.462  1.00 5.23  ? 164 MET A CA  1 
ATOM   1262 C  C   . MET A 1 164 ? 46.996  12.134  14.028  1.00 4.86  ? 164 MET A C   1 
ATOM   1263 O  O   . MET A 1 164 ? 47.310  13.078  14.737  1.00 4.54  ? 164 MET A O   1 
ATOM   1264 C  CB  . MET A 1 164 ? 48.163  9.832   14.153  1.00 6.03  ? 164 MET A CB  1 
ATOM   1265 C  CG  . MET A 1 164 ? 46.976  9.297   14.920  1.00 9.28  ? 164 MET A CG  1 
ATOM   1266 S  SD  . MET A 1 164 ? 46.730  10.157  16.454  1.00 6.66  ? 164 MET A SD  1 
ATOM   1267 C  CE  . MET A 1 164 ? 47.578  9.246   17.726  1.00 7.45  ? 164 MET A CE  1 
ATOM   1268 N  N   . GLY A 1 165 ? 45.737  11.902  13.674  1.00 3.90  ? 165 GLY A N   1 
ATOM   1269 C  CA  . GLY A 1 165 ? 44.669  12.718  14.244  1.00 3.53  ? 165 GLY A CA  1 
ATOM   1270 C  C   . GLY A 1 165 ? 43.326  12.015  14.287  1.00 3.58  ? 165 GLY A C   1 
ATOM   1271 O  O   . GLY A 1 165 ? 43.093  11.065  13.554  1.00 4.26  ? 165 GLY A O   1 
ATOM   1272 N  N   . LEU A 1 166 ? 42.449  12.494  15.158  1.00 2.90  ? 166 LEU A N   1 
ATOM   1273 C  CA  . LEU A 1 166 ? 41.115  11.914  15.297  1.00 3.54  ? 166 LEU A CA  1 
ATOM   1274 C  C   . LEU A 1 166 ? 40.088  13.027  15.146  1.00 2.83  ? 166 LEU A C   1 
ATOM   1275 O  O   . LEU A 1 166 ? 40.132  14.015  15.887  1.00 2.81  ? 166 LEU A O   1 
ATOM   1276 C  CB  . LEU A 1 166 ? 40.955  11.264  16.675  1.00 3.10  ? 166 LEU A CB  1 
ATOM   1277 C  CG  . LEU A 1 166 ? 39.515  10.840  17.009  1.00 3.95  ? 166 LEU A CG  1 
ATOM   1278 C  CD1 . LEU A 1 166 ? 39.057  9.711   16.087  1.00 2.12  ? 166 LEU A CD1 1 
ATOM   1279 C  CD2 . LEU A 1 166 ? 39.320  10.441  18.472  1.00 4.64  ? 166 LEU A CD2 1 
ATOM   1280 N  N   . ASP A 1 167 ? 39.170  12.855  14.194  1.00 2.57  ? 167 ASP A N   1 
ATOM   1281 C  CA  . ASP A 1 167 ? 38.050  13.768  13.961  1.00 1.94  ? 167 ASP A CA  1 
ATOM   1282 C  C   . ASP A 1 167 ? 37.070  13.660  15.115  1.00 2.20  ? 167 ASP A C   1 
ATOM   1283 O  O   . ASP A 1 167 ? 36.548  12.574  15.363  1.00 1.41  ? 167 ASP A O   1 
ATOM   1284 C  CB  . ASP A 1 167 ? 37.382  13.349  12.644  1.00 1.91  ? 167 ASP A CB  1 
ATOM   1285 C  CG  . ASP A 1 167 ? 36.359  14.344  12.128  1.00 1.62  ? 167 ASP A CG  1 
ATOM   1286 O  OD1 . ASP A 1 167 ? 36.061  15.350  12.825  1.00 2.50  ? 167 ASP A OD1 1 
ATOM   1287 O  OD2 . ASP A 1 167 ? 35.845  14.083  10.997  1.00 1.92  ? 167 ASP A OD2 1 
ATOM   1288 N  N   . VAL A 1 168 ? 36.827  14.759  15.835  1.00 1.88  ? 168 VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 168 ? 35.810  14.734  16.908  1.00 2.02  ? 168 VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 168 ? 34.556  15.591  16.628  1.00 2.03  ? 168 VAL A C   1 
ATOM   1291 O  O   . VAL A 1 168 ? 33.787  15.903  17.538  1.00 2.13  ? 168 VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 168 ? 36.396  14.970  18.332  1.00 2.06  ? 168 VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 168 ? 37.280  13.837  18.721  1.00 1.64  ? 168 VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 168 ? 37.159  16.300  18.427  1.00 2.06  ? 168 VAL A CG2 1 
ATOM   1295 N  N   . TRP A 1 169 ? 34.360  15.980  15.368  1.00 1.80  ? 169 TRP A N   1 
ATOM   1296 C  CA  . TRP A 1 169 ? 33.062  16.478  14.956  1.00 2.18  ? 169 TRP A CA  1 
ATOM   1297 C  C   . TRP A 1 169 ? 32.061  15.368  15.289  1.00 2.17  ? 169 TRP A C   1 
ATOM   1298 O  O   . TRP A 1 169 ? 32.375  14.159  15.189  1.00 2.65  ? 169 TRP A O   1 
ATOM   1299 C  CB  . TRP A 1 169 ? 33.023  16.763  13.447  1.00 2.26  ? 169 TRP A CB  1 
ATOM   1300 C  CG  . TRP A 1 169 ? 33.728  18.026  12.988  1.00 2.14  ? 169 TRP A CG  1 
ATOM   1301 C  CD1 . TRP A 1 169 ? 35.007  18.361  13.215  1.00 1.58  ? 169 TRP A CD1 1 
ATOM   1302 C  CD2 . TRP A 1 169 ? 33.153  19.086  12.207  1.00 1.90  ? 169 TRP A CD2 1 
ATOM   1303 N  NE1 . TRP A 1 169 ? 35.291  19.595  12.634  1.00 1.01  ? 169 TRP A NE1 1 
ATOM   1304 C  CE2 . TRP A 1 169 ? 34.168  20.036  11.980  1.00 1.62  ? 169 TRP A CE2 1 
ATOM   1305 C  CE3 . TRP A 1 169 ? 31.888  19.306  11.637  1.00 1.41  ? 169 TRP A CE3 1 
ATOM   1306 C  CZ2 . TRP A 1 169 ? 33.951  21.196  11.236  1.00 0.94  ? 169 TRP A CZ2 1 
ATOM   1307 C  CZ3 . TRP A 1 169 ? 31.675  20.450  10.892  1.00 2.00  ? 169 TRP A CZ3 1 
ATOM   1308 C  CH2 . TRP A 1 169 ? 32.702  21.395  10.701  1.00 0.74  ? 169 TRP A CH2 1 
ATOM   1309 N  N   . GLU A 1 170 ? 30.868  15.755  15.689  1.00 2.40  ? 170 GLU A N   1 
ATOM   1310 C  CA  . GLU A 1 170 ? 29.862  14.771  16.060  1.00 2.83  ? 170 GLU A CA  1 
ATOM   1311 C  C   . GLU A 1 170 ? 29.494  13.849  14.885  1.00 2.70  ? 170 GLU A C   1 
ATOM   1312 O  O   . GLU A 1 170 ? 29.210  12.684  15.102  1.00 2.89  ? 170 GLU A O   1 
ATOM   1313 C  CB  . GLU A 1 170 ? 28.627  15.473  16.649  1.00 2.54  ? 170 GLU A CB  1 
ATOM   1314 C  CG  . GLU A 1 170 ? 28.861  15.900  18.089  1.00 2.52  ? 170 GLU A CG  1 
ATOM   1315 C  CD  . GLU A 1 170 ? 27.766  16.775  18.662  1.00 3.12  ? 170 GLU A CD  1 
ATOM   1316 O  OE1 . GLU A 1 170 ? 27.098  17.524  17.920  1.00 3.30  ? 170 GLU A OE1 1 
ATOM   1317 O  OE2 . GLU A 1 170 ? 27.636  16.765  19.900  1.00 3.64  ? 170 GLU A OE2 1 
ATOM   1318 N  N   . HIS A 1 171 ? 29.537  14.363  13.651  1.00 2.31  ? 171 HIS A N   1 
ATOM   1319 C  CA  . HIS A 1 171 ? 29.253  13.521  12.477  1.00 2.03  ? 171 HIS A CA  1 
ATOM   1320 C  C   . HIS A 1 171 ? 30.133  12.267  12.423  1.00 2.38  ? 171 HIS A C   1 
ATOM   1321 O  O   . HIS A 1 171 ? 29.757  11.240  11.823  1.00 2.51  ? 171 HIS A O   1 
ATOM   1322 C  CB  . HIS A 1 171 ? 29.296  14.332  11.154  1.00 1.69  ? 171 HIS A CB  1 
ATOM   1323 C  CG  . HIS A 1 171 ? 30.667  14.798  10.729  1.00 2.02  ? 171 HIS A CG  1 
ATOM   1324 N  ND1 . HIS A 1 171 ? 30.926  16.113  10.400  1.00 2.90  ? 171 HIS A ND1 1 
ATOM   1325 C  CD2 . HIS A 1 171 ? 31.842  14.135  10.559  1.00 2.71  ? 171 HIS A CD2 1 
ATOM   1326 C  CE1 . HIS A 1 171 ? 32.193  16.237  10.034  1.00 2.79  ? 171 HIS A CE1 1 
ATOM   1327 N  NE2 . HIS A 1 171 ? 32.779  15.054  10.135  1.00 1.69  ? 171 HIS A NE2 1 
ATOM   1328 N  N   . ALA A 1 172 ? 31.291  12.317  13.074  1.00 1.39  ? 172 ALA A N   1 
ATOM   1329 C  CA  . ALA A 1 172 ? 32.222  11.201  12.970  1.00 2.00  ? 172 ALA A CA  1 
ATOM   1330 C  C   . ALA A 1 172 ? 31.836  10.067  13.910  1.00 1.70  ? 172 ALA A C   1 
ATOM   1331 O  O   . ALA A 1 172 ? 32.361  8.939   13.794  1.00 2.08  ? 172 ALA A O   1 
ATOM   1332 C  CB  . ALA A 1 172 ? 33.664  11.661  13.254  1.00 1.24  ? 172 ALA A CB  1 
ATOM   1333 N  N   . TYR A 1 173 ? 30.925  10.359  14.841  1.00 2.02  ? 173 TYR A N   1 
ATOM   1334 C  CA  . TYR A 1 173 ? 30.616  9.381   15.880  1.00 2.65  ? 173 TYR A CA  1 
ATOM   1335 C  C   . TYR A 1 173 ? 29.151  9.304   16.312  1.00 2.62  ? 173 TYR A C   1 
ATOM   1336 O  O   . TYR A 1 173 ? 28.773  8.427   17.103  1.00 2.55  ? 173 TYR A O   1 
ATOM   1337 C  CB  . TYR A 1 173 ? 31.518  9.568   17.103  1.00 1.99  ? 173 TYR A CB  1 
ATOM   1338 C  CG  . TYR A 1 173 ? 31.359  10.849  17.902  1.00 3.21  ? 173 TYR A CG  1 
ATOM   1339 C  CD1 . TYR A 1 173 ? 30.332  11.000  18.842  1.00 2.01  ? 173 TYR A CD1 1 
ATOM   1340 C  CD2 . TYR A 1 173 ? 32.265  11.893  17.748  1.00 2.29  ? 173 TYR A CD2 1 
ATOM   1341 C  CE1 . TYR A 1 173 ? 30.218  12.168  19.621  1.00 0.98  ? 173 TYR A CE1 1 
ATOM   1342 C  CE2 . TYR A 1 173 ? 32.154  13.062  18.514  1.00 0.81  ? 173 TYR A CE2 1 
ATOM   1343 C  CZ  . TYR A 1 173 ? 31.131  13.197  19.433  1.00 2.45  ? 173 TYR A CZ  1 
ATOM   1344 O  OH  . TYR A 1 173 ? 31.029  14.337  20.190  1.00 1.11  ? 173 TYR A OH  1 
ATOM   1345 N  N   . TYR A 1 174 ? 28.315  10.213  15.846  1.00 2.99  ? 174 TYR A N   1 
ATOM   1346 C  CA  . TYR A 1 174 ? 26.980  10.269  16.440  1.00 3.60  ? 174 TYR A CA  1 
ATOM   1347 C  C   . TYR A 1 174 ? 26.107  9.058   16.111  1.00 4.06  ? 174 TYR A C   1 
ATOM   1348 O  O   . TYR A 1 174 ? 25.320  8.616   16.960  1.00 4.50  ? 174 TYR A O   1 
ATOM   1349 C  CB  . TYR A 1 174 ? 26.240  11.582  16.152  1.00 3.19  ? 174 TYR A CB  1 
ATOM   1350 C  CG  . TYR A 1 174 ? 25.425  11.996  17.350  1.00 2.92  ? 174 TYR A CG  1 
ATOM   1351 C  CD1 . TYR A 1 174 ? 26.024  12.677  18.412  1.00 2.65  ? 174 TYR A CD1 1 
ATOM   1352 C  CD2 . TYR A 1 174 ? 24.080  11.672  17.450  1.00 2.86  ? 174 TYR A CD2 1 
ATOM   1353 C  CE1 . TYR A 1 174 ? 25.297  13.025  19.546  1.00 2.14  ? 174 TYR A CE1 1 
ATOM   1354 C  CE2 . TYR A 1 174 ? 23.339  12.025  18.571  1.00 1.56  ? 174 TYR A CE2 1 
ATOM   1355 C  CZ  . TYR A 1 174 ? 23.954  12.701  19.620  1.00 3.40  ? 174 TYR A CZ  1 
ATOM   1356 O  OH  . TYR A 1 174 ? 23.240  13.057  20.746  1.00 3.36  ? 174 TYR A OH  1 
ATOM   1357 N  N   . LEU A 1 175 ? 26.255  8.494   14.915  1.00 4.26  ? 175 LEU A N   1 
ATOM   1358 C  CA  . LEU A 1 175 ? 25.394  7.373   14.549  1.00 5.00  ? 175 LEU A CA  1 
ATOM   1359 C  C   . LEU A 1 175 ? 25.521  6.188   15.476  1.00 5.20  ? 175 LEU A C   1 
ATOM   1360 O  O   . LEU A 1 175 ? 24.505  5.637   15.897  1.00 5.53  ? 175 LEU A O   1 
ATOM   1361 C  CB  . LEU A 1 175 ? 25.592  6.939   13.091  1.00 5.36  ? 175 LEU A CB  1 
ATOM   1362 C  CG  . LEU A 1 175 ? 25.169  7.987   12.063  1.00 5.81  ? 175 LEU A CG  1 
ATOM   1363 C  CD1 . LEU A 1 175 ? 25.320  7.381   10.676  1.00 5.14  ? 175 LEU A CD1 1 
ATOM   1364 C  CD2 . LEU A 1 175 ? 23.746  8.514   12.270  1.00 5.90  ? 175 LEU A CD2 1 
ATOM   1365 N  N   . LYS A 1 176 ? 26.748  5.776   15.775  1.00 5.11  ? 176 LYS A N   1 
ATOM   1366 C  CA  . LYS A 1 176 ? 26.970  4.619   16.625  1.00 4.34  ? 176 LYS A CA  1 
ATOM   1367 C  C   . LYS A 1 176 ? 27.120  4.971   18.101  1.00 4.81  ? 176 LYS A C   1 
ATOM   1368 O  O   . LYS A 1 176 ? 26.785  4.165   18.955  1.00 4.80  ? 176 LYS A O   1 
ATOM   1369 C  CB  . LYS A 1 176 ? 28.173  3.800   16.128  1.00 4.64  ? 176 LYS A CB  1 
ATOM   1370 C  CG  . LYS A 1 176 ? 28.780  2.834   17.138  1.00 3.84  ? 176 LYS A CG  1 
ATOM   1371 C  CD  . LYS A 1 176 ? 29.799  1.890   16.479  1.00 4.75  ? 176 LYS A CD  1 
ATOM   1372 C  CE  . LYS A 1 176 ? 30.498  0.965   17.474  1.00 5.36  ? 176 LYS A CE  1 
ATOM   1373 N  NZ  . LYS A 1 176 ? 31.540  0.073   16.857  1.00 5.85  ? 176 LYS A NZ  1 
ATOM   1374 N  N   . PHE A 1 177 ? 27.625  6.165   18.398  1.00 3.04  ? 177 PHE A N   1 
ATOM   1375 C  CA  . PHE A 1 177 ? 27.999  6.480   19.780  1.00 4.19  ? 177 PHE A CA  1 
ATOM   1376 C  C   . PHE A 1 177 ? 27.158  7.553   20.468  1.00 4.16  ? 177 PHE A C   1 
ATOM   1377 O  O   . PHE A 1 177 ? 27.275  7.723   21.685  1.00 4.07  ? 177 PHE A O   1 
ATOM   1378 C  CB  . PHE A 1 177 ? 29.470  6.901   19.843  1.00 4.27  ? 177 PHE A CB  1 
ATOM   1379 C  CG  . PHE A 1 177 ? 30.427  5.861   19.336  1.00 4.40  ? 177 PHE A CG  1 
ATOM   1380 C  CD1 . PHE A 1 177 ? 30.883  5.896   18.021  1.00 3.59  ? 177 PHE A CD1 1 
ATOM   1381 C  CD2 . PHE A 1 177 ? 30.884  4.843   20.170  1.00 4.76  ? 177 PHE A CD2 1 
ATOM   1382 C  CE1 . PHE A 1 177 ? 31.782  4.939   17.542  1.00 4.21  ? 177 PHE A CE1 1 
ATOM   1383 C  CE2 . PHE A 1 177 ? 31.776  3.880   19.709  1.00 5.53  ? 177 PHE A CE2 1 
ATOM   1384 C  CZ  . PHE A 1 177 ? 32.240  3.933   18.374  1.00 5.80  ? 177 PHE A CZ  1 
ATOM   1385 N  N   . GLN A 1 178 ? 26.317  8.254   19.703  1.00 4.20  ? 178 GLN A N   1 
ATOM   1386 C  CA  . GLN A 1 178 ? 25.632  9.455   20.163  1.00 4.79  ? 178 GLN A CA  1 
ATOM   1387 C  C   . GLN A 1 178 ? 26.582  10.338  21.003  1.00 4.89  ? 178 GLN A C   1 
ATOM   1388 O  O   . GLN A 1 178 ? 27.706  10.594  20.584  1.00 4.29  ? 178 GLN A O   1 
ATOM   1389 C  CB  . GLN A 1 178 ? 24.293  9.129   20.866  1.00 5.01  ? 178 GLN A CB  1 
ATOM   1390 C  CG  . GLN A 1 178 ? 23.254  8.454   19.927  1.00 5.21  ? 178 GLN A CG  1 
ATOM   1391 C  CD  . GLN A 1 178 ? 23.420  6.945   19.879  1.00 4.66  ? 178 GLN A CD  1 
ATOM   1392 O  OE1 . GLN A 1 178 ? 23.323  6.270   20.908  1.00 8.90  ? 178 GLN A OE1 1 
ATOM   1393 N  NE2 . GLN A 1 178 ? 23.656  6.408   18.694  1.00 4.49  ? 178 GLN A NE2 1 
ATOM   1394 N  N   . ASN A 1 179 ? 26.142  10.764  22.185  1.00 5.44  ? 179 ASN A N   1 
ATOM   1395 C  CA  . ASN A 1 179 ? 26.897  11.686  23.032  1.00 5.21  ? 179 ASN A CA  1 
ATOM   1396 C  C   . ASN A 1 179 ? 28.158  11.094  23.646  1.00 5.06  ? 179 ASN A C   1 
ATOM   1397 O  O   . ASN A 1 179 ? 28.926  11.820  24.270  1.00 5.13  ? 179 ASN A O   1 
ATOM   1398 C  CB  . ASN A 1 179 ? 25.991  12.148  24.179  1.00 6.27  ? 179 ASN A CB  1 
ATOM   1399 C  CG  . ASN A 1 179 ? 25.491  10.974  25.012  1.00 7.13  ? 179 ASN A CG  1 
ATOM   1400 O  OD1 . ASN A 1 179 ? 24.704  10.140  24.536  1.00 11.38 ? 179 ASN A OD1 1 
ATOM   1401 N  ND2 . ASN A 1 179 ? 25.972  10.880  26.250  1.00 9.82  ? 179 ASN A ND2 1 
ATOM   1402 N  N   . ARG A 1 180 ? 28.365  9.784   23.489  1.00 3.78  ? 180 ARG A N   1 
ATOM   1403 C  CA  . ARG A 1 180 ? 29.456  9.083   24.181  1.00 3.80  ? 180 ARG A CA  1 
ATOM   1404 C  C   . ARG A 1 180 ? 30.802  9.147   23.448  1.00 3.67  ? 180 ARG A C   1 
ATOM   1405 O  O   . ARG A 1 180 ? 31.372  8.123   23.075  1.00 3.25  ? 180 ARG A O   1 
ATOM   1406 C  CB  . ARG A 1 180 ? 29.044  7.636   24.472  1.00 3.98  ? 180 ARG A CB  1 
ATOM   1407 C  CG  . ARG A 1 180 ? 27.656  7.562   25.109  1.00 4.10  ? 180 ARG A CG  1 
ATOM   1408 C  CD  . ARG A 1 180 ? 27.157  6.134   25.300  1.00 4.57  ? 180 ARG A CD  1 
ATOM   1409 N  NE  . ARG A 1 180 ? 26.782  5.445   24.059  1.00 5.48  ? 180 ARG A NE  1 
ATOM   1410 C  CZ  . ARG A 1 180 ? 25.680  5.691   23.353  1.00 5.97  ? 180 ARG A CZ  1 
ATOM   1411 N  NH1 . ARG A 1 180 ? 24.814  6.631   23.732  1.00 7.56  ? 180 ARG A NH1 1 
ATOM   1412 N  NH2 . ARG A 1 180 ? 25.433  4.990   22.259  1.00 7.35  ? 180 ARG A NH2 1 
ATOM   1413 N  N   . ARG A 1 181 ? 31.322  10.365  23.283  1.00 3.51  ? 181 ARG A N   1 
ATOM   1414 C  CA  . ARG A 1 181 ? 32.584  10.569  22.564  1.00 3.17  ? 181 ARG A CA  1 
ATOM   1415 C  C   . ARG A 1 181 ? 33.779  9.789   23.174  1.00 3.33  ? 181 ARG A C   1 
ATOM   1416 O  O   . ARG A 1 181 ? 34.612  9.248   22.450  1.00 3.41  ? 181 ARG A O   1 
ATOM   1417 C  CB  . ARG A 1 181 ? 32.894  12.074  22.459  1.00 3.13  ? 181 ARG A CB  1 
ATOM   1418 C  CG  . ARG A 1 181 ? 34.055  12.384  21.542  1.00 3.32  ? 181 ARG A CG  1 
ATOM   1419 C  CD  . ARG A 1 181 ? 34.615  13.786  21.731  1.00 4.19  ? 181 ARG A CD  1 
ATOM   1420 N  NE  . ARG A 1 181 ? 33.690  14.839  21.343  1.00 2.07  ? 181 ARG A NE  1 
ATOM   1421 C  CZ  . ARG A 1 181 ? 33.985  16.146  21.387  1.00 3.22  ? 181 ARG A CZ  1 
ATOM   1422 N  NH1 . ARG A 1 181 ? 35.184  16.559  21.797  1.00 3.52  ? 181 ARG A NH1 1 
ATOM   1423 N  NH2 . ARG A 1 181 ? 33.081  17.050  21.019  1.00 1.77  ? 181 ARG A NH2 1 
ATOM   1424 N  N   . PRO A 1 182 ? 33.861  9.703   24.513  1.00 3.24  ? 182 PRO A N   1 
ATOM   1425 C  CA  . PRO A 1 182 ? 34.996  8.954   25.059  1.00 3.02  ? 182 PRO A CA  1 
ATOM   1426 C  C   . PRO A 1 182 ? 34.976  7.486   24.619  1.00 2.92  ? 182 PRO A C   1 
ATOM   1427 O  O   . PRO A 1 182 ? 36.036  6.901   24.446  1.00 2.08  ? 182 PRO A O   1 
ATOM   1428 C  CB  . PRO A 1 182 ? 34.848  9.129   26.581  1.00 3.72  ? 182 PRO A CB  1 
ATOM   1429 C  CG  . PRO A 1 182 ? 34.093  10.455  26.696  1.00 4.32  ? 182 PRO A CG  1 
ATOM   1430 C  CD  . PRO A 1 182 ? 33.129  10.449  25.548  1.00 3.91  ? 182 PRO A CD  1 
ATOM   1431 N  N   . ASP A 1 183 ? 33.786  6.913   24.408  1.00 3.28  ? 183 ASP A N   1 
ATOM   1432 C  CA  . ASP A 1 183 ? 33.688  5.537   23.872  1.00 4.93  ? 183 ASP A CA  1 
ATOM   1433 C  C   . ASP A 1 183 ? 34.247  5.504   22.435  1.00 4.81  ? 183 ASP A C   1 
ATOM   1434 O  O   . ASP A 1 183 ? 35.009  4.614   22.056  1.00 4.32  ? 183 ASP A O   1 
ATOM   1435 C  CB  . ASP A 1 183 ? 32.226  5.042   23.888  1.00 5.50  ? 183 ASP A CB  1 
ATOM   1436 C  CG  . ASP A 1 183 ? 31.719  4.680   25.290  1.00 6.86  ? 183 ASP A CG  1 
ATOM   1437 O  OD1 . ASP A 1 183 ? 32.479  4.751   26.270  1.00 9.67  ? 183 ASP A OD1 1 
ATOM   1438 O  OD2 . ASP A 1 183 ? 30.540  4.301   25.402  1.00 8.63  ? 183 ASP A OD2 1 
ATOM   1439 N  N   . TYR A 1 184 ? 33.900  6.518   21.655  1.00 4.14  ? 184 TYR A N   1 
ATOM   1440 C  CA  . TYR A 1 184 ? 34.386  6.609   20.272  1.00 3.82  ? 184 TYR A CA  1 
ATOM   1441 C  C   . TYR A 1 184 ? 35.917  6.747   20.274  1.00 3.00  ? 184 TYR A C   1 
ATOM   1442 O  O   . TYR A 1 184 ? 36.610  6.107   19.485  1.00 2.48  ? 184 TYR A O   1 
ATOM   1443 C  CB  . TYR A 1 184 ? 33.687  7.779   19.570  1.00 2.62  ? 184 TYR A CB  1 
ATOM   1444 C  CG  . TYR A 1 184 ? 34.342  8.295   18.308  1.00 3.95  ? 184 TYR A CG  1 
ATOM   1445 C  CD1 . TYR A 1 184 ? 34.335  7.556   17.144  1.00 3.82  ? 184 TYR A CD1 1 
ATOM   1446 C  CD2 . TYR A 1 184 ? 34.954  9.539   18.288  1.00 3.18  ? 184 TYR A CD2 1 
ATOM   1447 C  CE1 . TYR A 1 184 ? 34.935  8.035   15.979  1.00 2.88  ? 184 TYR A CE1 1 
ATOM   1448 C  CE2 . TYR A 1 184 ? 35.560  10.036  17.133  1.00 3.02  ? 184 TYR A CE2 1 
ATOM   1449 C  CZ  . TYR A 1 184 ? 35.541  9.290   15.987  1.00 2.82  ? 184 TYR A CZ  1 
ATOM   1450 O  OH  . TYR A 1 184 ? 36.130  9.771   14.845  1.00 2.32  ? 184 TYR A OH  1 
ATOM   1451 N  N   . ILE A 1 185 ? 36.435  7.564   21.179  1.00 3.73  ? 185 ILE A N   1 
ATOM   1452 C  CA  . ILE A 1 185 ? 37.870  7.769   21.302  1.00 3.16  ? 185 ILE A CA  1 
ATOM   1453 C  C   . ILE A 1 185 ? 38.584  6.470   21.686  1.00 4.08  ? 185 ILE A C   1 
ATOM   1454 O  O   . ILE A 1 185 ? 39.645  6.186   21.168  1.00 4.65  ? 185 ILE A O   1 
ATOM   1455 C  CB  . ILE A 1 185 ? 38.204  8.898   22.309  1.00 3.61  ? 185 ILE A CB  1 
ATOM   1456 C  CG1 . ILE A 1 185 ? 37.608  10.220  21.831  1.00 4.28  ? 185 ILE A CG1 1 
ATOM   1457 C  CG2 . ILE A 1 185 ? 39.708  9.061   22.442  1.00 2.94  ? 185 ILE A CG2 1 
ATOM   1458 C  CD1 . ILE A 1 185 ? 37.269  11.161  22.962  1.00 6.46  ? 185 ILE A CD1 1 
ATOM   1459 N  N   . LYS A 1 186 ? 38.007  5.672   22.593  1.00 5.08  ? 186 LYS A N   1 
ATOM   1460 C  CA  . LYS A 1 186 ? 38.652  4.393   22.939  1.00 5.16  ? 186 LYS A CA  1 
ATOM   1461 C  C   . LYS A 1 186 ? 38.663  3.452   21.726  1.00 5.12  ? 186 LYS A C   1 
ATOM   1462 O  O   . LYS A 1 186 ? 39.609  2.684   21.539  1.00 5.06  ? 186 LYS A O   1 
ATOM   1463 C  CB  . LYS A 1 186 ? 37.969  3.694   24.125  1.00 5.87  ? 186 LYS A CB  1 
ATOM   1464 C  CG  . LYS A 1 186 ? 38.073  4.430   25.455  1.00 6.52  ? 186 LYS A CG  1 
ATOM   1465 C  CD  . LYS A 1 186 ? 39.156  3.916   26.363  1.00 10.29 ? 186 LYS A CD  1 
ATOM   1466 C  CE  . LYS A 1 186 ? 39.098  4.666   27.702  1.00 10.77 ? 186 LYS A CE  1 
ATOM   1467 N  NZ  . LYS A 1 186 ? 40.162  4.263   28.654  1.00 13.21 ? 186 LYS A NZ  1 
ATOM   1468 N  N   . GLU A 1 187 ? 37.630  3.529   20.892  1.00 4.61  ? 187 GLU A N   1 
ATOM   1469 C  CA  . GLU A 1 187 ? 37.579  2.665   19.715  1.00 5.29  ? 187 GLU A CA  1 
ATOM   1470 C  C   . GLU A 1 187 ? 38.628  3.048   18.689  1.00 4.78  ? 187 GLU A C   1 
ATOM   1471 O  O   . GLU A 1 187 ? 39.109  2.191   17.923  1.00 5.02  ? 187 GLU A O   1 
ATOM   1472 C  CB  . GLU A 1 187 ? 36.190  2.646   19.064  1.00 5.48  ? 187 GLU A CB  1 
ATOM   1473 C  CG  . GLU A 1 187 ? 35.157  1.857   19.844  1.00 5.53  ? 187 GLU A CG  1 
ATOM   1474 C  CD  . GLU A 1 187 ? 35.297  0.341   19.683  1.00 6.25  ? 187 GLU A CD  1 
ATOM   1475 O  OE1 . GLU A 1 187 ? 34.427  -0.387  20.212  1.00 10.86 ? 187 GLU A OE1 1 
ATOM   1476 O  OE2 . GLU A 1 187 ? 36.258  -0.133  19.050  1.00 6.69  ? 187 GLU A OE2 1 
ATOM   1477 N  N   . PHE A 1 188 ? 38.998  4.331   18.685  1.00 4.83  ? 188 PHE A N   1 
ATOM   1478 C  CA  . PHE A 1 188 ? 40.051  4.815   17.797  1.00 4.20  ? 188 PHE A CA  1 
ATOM   1479 C  C   . PHE A 1 188 ? 41.338  4.018   17.977  1.00 4.54  ? 188 PHE A C   1 
ATOM   1480 O  O   . PHE A 1 188 ? 42.006  3.709   17.022  1.00 3.80  ? 188 PHE A O   1 
ATOM   1481 C  CB  . PHE A 1 188 ? 40.261  6.334   17.994  1.00 4.07  ? 188 PHE A CB  1 
ATOM   1482 C  CG  . PHE A 1 188 ? 41.421  6.932   17.206  1.00 2.88  ? 188 PHE A CG  1 
ATOM   1483 C  CD1 . PHE A 1 188 ? 41.479  6.868   15.817  1.00 2.35  ? 188 PHE A CD1 1 
ATOM   1484 C  CD2 . PHE A 1 188 ? 42.432  7.622   17.876  1.00 1.84  ? 188 PHE A CD2 1 
ATOM   1485 C  CE1 . PHE A 1 188 ? 42.554  7.453   15.126  1.00 1.52  ? 188 PHE A CE1 1 
ATOM   1486 C  CE2 . PHE A 1 188 ? 43.488  8.200   17.187  1.00 2.49  ? 188 PHE A CE2 1 
ATOM   1487 C  CZ  . PHE A 1 188 ? 43.554  8.124   15.816  1.00 1.77  ? 188 PHE A CZ  1 
ATOM   1488 N  N   . TRP A 1 189 ? 41.668  3.660   19.213  1.00 4.99  ? 189 TRP A N   1 
ATOM   1489 C  CA  . TRP A 1 189 ? 42.882  2.886   19.464  1.00 5.25  ? 189 TRP A CA  1 
ATOM   1490 C  C   . TRP A 1 189 ? 42.929  1.578   18.671  1.00 5.28  ? 189 TRP A C   1 
ATOM   1491 O  O   . TRP A 1 189 ? 44.006  1.062   18.409  1.00 6.42  ? 189 TRP A O   1 
ATOM   1492 C  CB  . TRP A 1 189 ? 43.057  2.618   20.973  1.00 5.37  ? 189 TRP A CB  1 
ATOM   1493 C  CG  . TRP A 1 189 ? 43.220  3.871   21.786  1.00 4.59  ? 189 TRP A CG  1 
ATOM   1494 C  CD1 . TRP A 1 189 ? 42.516  4.234   22.907  1.00 5.96  ? 189 TRP A CD1 1 
ATOM   1495 C  CD2 . TRP A 1 189 ? 44.120  4.941   21.520  1.00 5.85  ? 189 TRP A CD2 1 
ATOM   1496 N  NE1 . TRP A 1 189 ? 42.954  5.456   23.374  1.00 3.80  ? 189 TRP A NE1 1 
ATOM   1497 C  CE2 . TRP A 1 189 ? 43.935  5.912   22.532  1.00 5.40  ? 189 TRP A CE2 1 
ATOM   1498 C  CE3 . TRP A 1 189 ? 45.084  5.166   20.538  1.00 6.56  ? 189 TRP A CE3 1 
ATOM   1499 C  CZ2 . TRP A 1 189 ? 44.680  7.090   22.574  1.00 4.85  ? 189 TRP A CZ2 1 
ATOM   1500 C  CZ3 . TRP A 1 189 ? 45.806  6.332   20.585  1.00 6.30  ? 189 TRP A CZ3 1 
ATOM   1501 C  CH2 . TRP A 1 189 ? 45.601  7.276   21.594  1.00 5.80  ? 189 TRP A CH2 1 
ATOM   1502 N  N   . ASN A 1 190 ? 41.758  1.050   18.309  1.00 6.29  ? 190 ASN A N   1 
ATOM   1503 C  CA  . ASN A 1 190 ? 41.648  -0.193  17.562  1.00 6.04  ? 190 ASN A CA  1 
ATOM   1504 C  C   . ASN A 1 190 ? 41.894  -0.010  16.062  1.00 5.96  ? 190 ASN A C   1 
ATOM   1505 O  O   . ASN A 1 190 ? 42.109  -0.989  15.323  1.00 5.68  ? 190 ASN A O   1 
ATOM   1506 C  CB  . ASN A 1 190 ? 40.269  -0.821  17.803  1.00 5.90  ? 190 ASN A CB  1 
ATOM   1507 C  CG  . ASN A 1 190 ? 40.116  -1.358  19.223  1.00 6.35  ? 190 ASN A CG  1 
ATOM   1508 O  OD1 . ASN A 1 190 ? 41.031  -1.998  19.764  1.00 7.12  ? 190 ASN A OD1 1 
ATOM   1509 N  ND2 . ASN A 1 190 ? 38.978  -1.085  19.837  1.00 7.70  ? 190 ASN A ND2 1 
ATOM   1510 N  N   . VAL A 1 191 ? 41.858  1.243   15.616  1.00 6.05  ? 191 VAL A N   1 
ATOM   1511 C  CA  . VAL A 1 191 ? 41.906  1.517   14.173  1.00 5.69  ? 191 VAL A CA  1 
ATOM   1512 C  C   . VAL A 1 191 ? 42.923  2.570   13.750  1.00 5.07  ? 191 VAL A C   1 
ATOM   1513 O  O   . VAL A 1 191 ? 43.082  2.835   12.559  1.00 4.55  ? 191 VAL A O   1 
ATOM   1514 C  CB  . VAL A 1 191 ? 40.522  1.884   13.601  1.00 5.49  ? 191 VAL A CB  1 
ATOM   1515 C  CG1 . VAL A 1 191 ? 39.595  0.676   13.646  1.00 7.45  ? 191 VAL A CG1 1 
ATOM   1516 C  CG2 . VAL A 1 191 ? 39.909  3.057   14.346  1.00 5.51  ? 191 VAL A CG2 1 
ATOM   1517 N  N   . VAL A 1 192 ? 43.609  3.191   14.703  1.00 4.99  ? 192 VAL A N   1 
ATOM   1518 C  CA  . VAL A 1 192 ? 44.655  4.131   14.303  1.00 4.43  ? 192 VAL A CA  1 
ATOM   1519 C  C   . VAL A 1 192 ? 45.734  3.340   13.589  1.00 4.29  ? 192 VAL A C   1 
ATOM   1520 O  O   . VAL A 1 192 ? 46.154  2.275   14.046  1.00 3.39  ? 192 VAL A O   1 
ATOM   1521 C  CB  . VAL A 1 192 ? 45.244  4.987   15.466  1.00 3.86  ? 192 VAL A CB  1 
ATOM   1522 C  CG1 . VAL A 1 192 ? 45.899  4.114   16.505  1.00 4.08  ? 192 VAL A CG1 1 
ATOM   1523 C  CG2 . VAL A 1 192 ? 46.273  5.982   14.915  1.00 4.28  ? 192 VAL A CG2 1 
ATOM   1524 N  N   . ASN A 1 193 ? 46.121  3.835   12.424  1.00 3.83  ? 193 ASN A N   1 
ATOM   1525 C  CA  . ASN A 1 193 ? 47.073  3.131   11.597  1.00 4.55  ? 193 ASN A CA  1 
ATOM   1526 C  C   . ASN A 1 193 ? 48.482  3.485   12.073  1.00 5.13  ? 193 ASN A C   1 
ATOM   1527 O  O   . ASN A 1 193 ? 49.035  4.526   11.703  1.00 5.60  ? 193 ASN A O   1 
ATOM   1528 C  CB  . ASN A 1 193 ? 46.841  3.516   10.133  1.00 4.65  ? 193 ASN A CB  1 
ATOM   1529 C  CG  . ASN A 1 193 ? 47.809  2.836   9.165   1.00 4.45  ? 193 ASN A CG  1 
ATOM   1530 O  OD1 . ASN A 1 193 ? 47.651  2.974   7.952   1.00 6.69  ? 193 ASN A OD1 1 
ATOM   1531 N  ND2 . ASN A 1 193 ? 48.816  2.137   9.681   1.00 5.93  ? 193 ASN A ND2 1 
ATOM   1532 N  N   . TRP A 1 194 ? 49.064  2.631   12.917  1.00 4.95  ? 194 TRP A N   1 
ATOM   1533 C  CA  . TRP A 1 194 ? 50.395  2.927   13.440  1.00 5.54  ? 194 TRP A CA  1 
ATOM   1534 C  C   . TRP A 1 194 ? 51.518  2.848   12.380  1.00 5.66  ? 194 TRP A C   1 
ATOM   1535 O  O   . TRP A 1 194 ? 52.564  3.477   12.542  1.00 5.32  ? 194 TRP A O   1 
ATOM   1536 C  CB  . TRP A 1 194 ? 50.711  2.068   14.681  1.00 5.64  ? 194 TRP A CB  1 
ATOM   1537 C  CG  . TRP A 1 194 ? 49.905  2.459   15.918  1.00 5.79  ? 194 TRP A CG  1 
ATOM   1538 C  CD1 . TRP A 1 194 ? 49.002  1.681   16.610  1.00 6.09  ? 194 TRP A CD1 1 
ATOM   1539 C  CD2 . TRP A 1 194 ? 49.937  3.724   16.596  1.00 5.05  ? 194 TRP A CD2 1 
ATOM   1540 N  NE1 . TRP A 1 194 ? 48.490  2.382   17.676  1.00 5.07  ? 194 TRP A NE1 1 
ATOM   1541 C  CE2 . TRP A 1 194 ? 49.034  3.641   17.683  1.00 5.32  ? 194 TRP A CE2 1 
ATOM   1542 C  CE3 . TRP A 1 194 ? 50.633  4.921   16.382  1.00 4.55  ? 194 TRP A CE3 1 
ATOM   1543 C  CZ2 . TRP A 1 194 ? 48.814  4.712   18.557  1.00 6.72  ? 194 TRP A CZ2 1 
ATOM   1544 C  CZ3 . TRP A 1 194 ? 50.405  5.986   17.246  1.00 3.86  ? 194 TRP A CZ3 1 
ATOM   1545 C  CH2 . TRP A 1 194 ? 49.505  5.874   18.322  1.00 5.82  ? 194 TRP A CH2 1 
ATOM   1546 N  N   . ASP A 1 195 ? 51.299  2.094   11.300  1.00 5.85  ? 195 ASP A N   1 
ATOM   1547 C  CA  . ASP A 1 195 ? 52.299  1.990   10.226  1.00 6.51  ? 195 ASP A CA  1 
ATOM   1548 C  C   . ASP A 1 195 ? 52.428  3.345   9.512   1.00 6.20  ? 195 ASP A C   1 
ATOM   1549 O  O   . ASP A 1 195 ? 53.536  3.818   9.214   1.00 6.65  ? 195 ASP A O   1 
ATOM   1550 C  CB  . ASP A 1 195 ? 51.907  0.920   9.197   1.00 7.17  ? 195 ASP A CB  1 
ATOM   1551 C  CG  . ASP A 1 195 ? 51.846  -0.490  9.780   1.00 8.34  ? 195 ASP A CG  1 
ATOM   1552 O  OD1 . ASP A 1 195 ? 52.331  -0.727  10.905  1.00 8.83  ? 195 ASP A OD1 1 
ATOM   1553 O  OD2 . ASP A 1 195 ? 51.286  -1.365  9.099   1.00 8.74  ? 195 ASP A OD2 1 
ATOM   1554 N  N   . GLU A 1 196 ? 51.285  3.961   9.211   1.00 6.11  ? 196 GLU A N   1 
ATOM   1555 C  CA  . GLU A 1 196 ? 51.309  5.273   8.568   1.00 6.13  ? 196 GLU A CA  1 
ATOM   1556 C  C   . GLU A 1 196 ? 51.837  6.320   9.538   1.00 5.36  ? 196 GLU A C   1 
ATOM   1557 O  O   . GLU A 1 196 ? 52.583  7.206   9.135   1.00 5.02  ? 196 GLU A O   1 
ATOM   1558 C  CB  . GLU A 1 196 ? 49.927  5.662   8.019   1.00 6.12  ? 196 GLU A CB  1 
ATOM   1559 C  CG  . GLU A 1 196 ? 49.890  6.974   7.232   1.00 6.82  ? 196 GLU A CG  1 
ATOM   1560 C  CD  . GLU A 1 196 ? 50.721  6.942   5.953   1.00 7.91  ? 196 GLU A CD  1 
ATOM   1561 O  OE1 . GLU A 1 196 ? 51.164  5.851   5.528   1.00 10.09 ? 196 GLU A OE1 1 
ATOM   1562 O  OE2 . GLU A 1 196 ? 50.909  8.017   5.351   1.00 8.84  ? 196 GLU A OE2 1 
ATOM   1563 N  N   . ALA A 1 197 ? 51.484  6.218   10.818  1.00 4.93  ? 197 ALA A N   1 
ATOM   1564 C  CA  . ALA A 1 197 ? 51.997  7.190   11.782  1.00 5.02  ? 197 ALA A CA  1 
ATOM   1565 C  C   . ALA A 1 197 ? 53.515  7.074   11.900  1.00 5.58  ? 197 ALA A C   1 
ATOM   1566 O  O   . ALA A 1 197 ? 54.225  8.092   11.901  1.00 5.56  ? 197 ALA A O   1 
ATOM   1567 C  CB  . ALA A 1 197 ? 51.317  7.041   13.151  1.00 4.46  ? 197 ALA A CB  1 
ATOM   1568 N  N   . ALA A 1 198 ? 54.012  5.841   11.959  1.00 6.28  ? 198 ALA A N   1 
ATOM   1569 C  CA  . ALA A 1 198 ? 55.455  5.619   11.930  1.00 6.52  ? 198 ALA A CA  1 
ATOM   1570 C  C   . ALA A 1 198 ? 56.096  6.260   10.702  1.00 6.45  ? 198 ALA A C   1 
ATOM   1571 O  O   . ALA A 1 198 ? 57.137  6.915   10.813  1.00 6.80  ? 198 ALA A O   1 
ATOM   1572 C  CB  . ALA A 1 198 ? 55.796  4.125   12.008  1.00 5.97  ? 198 ALA A CB  1 
ATOM   1573 N  N   . ALA A 1 199 ? 55.488  6.053   9.528   1.00 6.55  ? 199 ALA A N   1 
ATOM   1574 C  CA  . ALA A 1 199 ? 56.066  6.549   8.279   1.00 6.23  ? 199 ALA A CA  1 
ATOM   1575 C  C   . ALA A 1 199 ? 56.164  8.076   8.295   1.00 6.67  ? 199 ALA A C   1 
ATOM   1576 O  O   . ALA A 1 199 ? 57.200  8.643   7.936   1.00 6.41  ? 199 ALA A O   1 
ATOM   1577 C  CB  . ALA A 1 199 ? 55.257  6.059   7.084   1.00 6.39  ? 199 ALA A CB  1 
ATOM   1578 N  N   . ARG A 1 200 ? 55.086  8.735   8.713   1.00 6.47  ? 200 ARG A N   1 
ATOM   1579 C  CA  . ARG A 1 200 ? 55.132  10.172  8.996   1.00 6.63  ? 200 ARG A CA  1 
ATOM   1580 C  C   . ARG A 1 200 ? 56.193  10.532  10.062  1.00 7.08  ? 200 ARG A C   1 
ATOM   1581 O  O   . ARG A 1 200 ? 56.946  11.506  9.905   1.00 7.24  ? 200 ARG A O   1 
ATOM   1582 C  CB  . ARG A 1 200 ? 53.749  10.715  9.388   1.00 6.88  ? 200 ARG A CB  1 
ATOM   1583 C  CG  . ARG A 1 200 ? 52.612  10.473  8.355   1.00 5.12  ? 200 ARG A CG  1 
ATOM   1584 C  CD  . ARG A 1 200 ? 51.276  11.096  8.801   1.00 4.53  ? 200 ARG A CD  1 
ATOM   1585 N  NE  . ARG A 1 200 ? 51.316  12.552  8.922   1.00 5.36  ? 200 ARG A NE  1 
ATOM   1586 C  CZ  . ARG A 1 200 ? 51.124  13.392  7.908   1.00 5.51  ? 200 ARG A CZ  1 
ATOM   1587 N  NH1 . ARG A 1 200 ? 50.870  12.920  6.700   1.00 4.54  ? 200 ARG A NH1 1 
ATOM   1588 N  NH2 . ARG A 1 200 ? 51.185  14.704  8.106   1.00 5.04  ? 200 ARG A NH2 1 
ATOM   1589 N  N   . PHE A 1 201 ? 56.270  9.760   11.141  1.00 6.90  ? 201 PHE A N   1 
ATOM   1590 C  CA  . PHE A 1 201 ? 57.289  10.042  12.157  1.00 7.11  ? 201 PHE A CA  1 
ATOM   1591 C  C   . PHE A 1 201 ? 58.710  9.978   11.599  1.00 7.39  ? 201 PHE A C   1 
ATOM   1592 O  O   . PHE A 1 201 ? 59.568  10.768  11.995  1.00 7.72  ? 201 PHE A O   1 
ATOM   1593 C  CB  . PHE A 1 201 ? 57.182  9.118   13.356  1.00 7.21  ? 201 PHE A CB  1 
ATOM   1594 C  CG  . PHE A 1 201 ? 58.171  9.438   14.443  1.00 6.72  ? 201 PHE A CG  1 
ATOM   1595 C  CD1 . PHE A 1 201 ? 57.971  10.525  15.266  1.00 7.85  ? 201 PHE A CD1 1 
ATOM   1596 C  CD2 . PHE A 1 201 ? 59.317  8.668   14.629  1.00 6.98  ? 201 PHE A CD2 1 
ATOM   1597 C  CE1 . PHE A 1 201 ? 58.874  10.848  16.267  1.00 8.36  ? 201 PHE A CE1 1 
ATOM   1598 C  CE2 . PHE A 1 201 ? 60.239  8.992   15.643  1.00 6.81  ? 201 PHE A CE2 1 
ATOM   1599 C  CZ  . PHE A 1 201 ? 60.001  10.081  16.466  1.00 6.14  ? 201 PHE A CZ  1 
ATOM   1600 N  N   . ALA A 1 202 ? 58.977  9.038   10.702  1.00 7.78  ? 202 ALA A N   1 
ATOM   1601 C  CA  . ALA A 1 202 ? 60.306  8.972   10.123  1.00 8.67  ? 202 ALA A CA  1 
ATOM   1602 C  C   . ALA A 1 202 ? 60.508  10.223  9.283   1.00 9.00  ? 202 ALA A C   1 
ATOM   1603 O  O   . ALA A 1 202 ? 61.566  10.865  9.315   1.00 10.34 ? 202 ALA A O   1 
ATOM   1604 C  CB  . ALA A 1 202 ? 60.457  7.722   9.254   1.00 8.62  ? 202 ALA A CB  1 
ATOM   1605 N  N   . ALA A 1 203 ? 59.489  10.562  8.507   1.00 9.24  ? 203 ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 203 ? 59.647  11.611  7.506   1.00 9.00  ? 203 ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 203 ? 59.732  13.001  8.141   1.00 9.02  ? 203 ALA A C   1 
ATOM   1608 O  O   . ALA A 1 203 ? 60.548  13.831  7.715   1.00 8.96  ? 203 ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 203 ? 58.531  11.520  6.455   1.00 9.74  ? 203 ALA A CB  1 
ATOM   1610 N  N   . LYS A 1 204 ? 58.883  13.253  9.145   1.00 9.33  ? 204 LYS A N   1 
ATOM   1611 C  CA  . LYS A 1 204 ? 59.033  14.405  10.038  1.00 9.12  ? 204 LYS A CA  1 
ATOM   1612 C  C   . LYS A 1 204 ? 58.619  15.756  9.437   1.00 9.56  ? 204 LYS A C   1 
ATOM   1613 O  O   . LYS A 1 204 ? 58.581  16.788  10.127  1.00 10.22 ? 204 LYS A O   1 
ATOM   1614 C  CB  . LYS A 1 204 ? 60.455  14.465  10.596  1.00 9.18  ? 204 LYS A CB  1 
ATOM   1615 C  CG  . LYS A 1 204 ? 60.764  13.383  11.617  1.00 7.46  ? 204 LYS A CG  1 
ATOM   1616 C  CD  . LYS A 1 204 ? 62.191  13.494  12.122  1.00 8.30  ? 204 LYS A CD  1 
ATOM   1617 C  CE  . LYS A 1 204 ? 62.490  12.608  13.321  1.00 8.92  ? 204 LYS A CE  1 
ATOM   1618 N  NZ  . LYS A 1 204 ? 61.883  11.259  13.291  1.00 11.45 ? 204 LYS A NZ  1 
ATOM   1619 N  N   . LYS A 1 205 ? 58.312  15.759  8.153   1.00 9.75  ? 205 LYS A N   1 
ATOM   1620 C  CA  . LYS A 1 205 ? 57.728  16.948  7.570   1.00 10.26 ? 205 LYS A CA  1 
ATOM   1621 C  C   . LYS A 1 205 ? 57.033  16.516  6.312   1.00 10.27 ? 205 LYS A C   1 
ATOM   1622 O  O   . LYS A 1 205 ? 56.229  17.226  5.728   1.00 11.56 ? 205 LYS A O   1 
ATOM   1623 C  CB  . LYS A 1 205 ? 58.797  18.002  7.293   1.00 10.43 ? 205 LYS A CB  1 
ATOM   1624 C  CG  . LYS A 1 205 ? 59.706  17.690  6.127   1.00 12.02 ? 205 LYS A CG  1 
ATOM   1625 C  CD  . LYS A 1 205 ? 60.886  18.658  6.118   1.00 12.91 ? 205 LYS A CD  1 
ATOM   1626 C  CE  . LYS A 1 205 ? 61.470  18.804  4.726   1.00 13.65 ? 205 LYS A CE  1 
ATOM   1627 N  NZ  . LYS A 1 205 ? 62.933  19.098  4.786   1.00 14.99 ? 205 LYS A NZ  1 
ATOM   1628 O  OXT . LYS A 1 205 ? 57.259  15.393  5.886   1.00 10.72 ? 205 LYS A OXT 1 
ATOM   1629 N  N   . SER B 1 1   ? 21.840  27.500  42.188  1.00 9.00  ? 1   SER B N   1 
ATOM   1630 C  CA  . SER B 1 1   ? 21.772  26.108  41.640  1.00 7.92  ? 1   SER B CA  1 
ATOM   1631 C  C   . SER B 1 1   ? 20.810  25.914  40.475  1.00 6.65  ? 1   SER B C   1 
ATOM   1632 O  O   . SER B 1 1   ? 19.588  25.954  40.658  1.00 6.00  ? 1   SER B O   1 
ATOM   1633 C  CB  . SER B 1 1   ? 21.354  25.152  42.745  1.00 8.72  ? 1   SER B CB  1 
ATOM   1634 O  OG  . SER B 1 1   ? 21.572  23.821  42.349  1.00 9.22  ? 1   SER B OG  1 
ATOM   1635 N  N   . TYR B 1 2   ? 21.355  25.635  39.287  1.00 5.06  ? 2   TYR B N   1 
ATOM   1636 C  CA  . TYR B 1 2   ? 20.511  25.429  38.107  1.00 4.38  ? 2   TYR B CA  1 
ATOM   1637 C  C   . TYR B 1 2   ? 19.799  24.074  38.110  1.00 4.05  ? 2   TYR B C   1 
ATOM   1638 O  O   . TYR B 1 2   ? 20.394  23.039  38.432  1.00 3.53  ? 2   TYR B O   1 
ATOM   1639 C  CB  . TYR B 1 2   ? 21.328  25.519  36.824  1.00 3.74  ? 2   TYR B CB  1 
ATOM   1640 C  CG  . TYR B 1 2   ? 22.034  26.829  36.569  1.00 4.50  ? 2   TYR B CG  1 
ATOM   1641 C  CD1 . TYR B 1 2   ? 21.506  28.043  37.003  1.00 5.40  ? 2   TYR B CD1 1 
ATOM   1642 C  CD2 . TYR B 1 2   ? 23.201  26.849  35.830  1.00 4.46  ? 2   TYR B CD2 1 
ATOM   1643 C  CE1 . TYR B 1 2   ? 22.169  29.253  36.723  1.00 7.02  ? 2   TYR B CE1 1 
ATOM   1644 C  CE2 . TYR B 1 2   ? 23.846  28.006  35.537  1.00 8.97  ? 2   TYR B CE2 1 
ATOM   1645 C  CZ  . TYR B 1 2   ? 23.346  29.213  35.983  1.00 7.59  ? 2   TYR B CZ  1 
ATOM   1646 O  OH  . TYR B 1 2   ? 24.050  30.348  35.651  1.00 6.86  ? 2   TYR B OH  1 
ATOM   1647 N  N   . THR B 1 3   ? 18.530  24.088  37.708  1.00 4.03  ? 3   THR B N   1 
ATOM   1648 C  CA  . THR B 1 3   ? 17.742  22.884  37.582  1.00 4.32  ? 3   THR B CA  1 
ATOM   1649 C  C   . THR B 1 3   ? 17.561  22.580  36.094  1.00 3.63  ? 3   THR B C   1 
ATOM   1650 O  O   . THR B 1 3   ? 17.233  23.461  35.322  1.00 3.62  ? 3   THR B O   1 
ATOM   1651 C  CB  . THR B 1 3   ? 16.362  23.071  38.235  1.00 4.29  ? 3   THR B CB  1 
ATOM   1652 O  OG1 . THR B 1 3   ? 16.526  23.282  39.653  1.00 4.53  ? 3   THR B OG1 1 
ATOM   1653 C  CG2 . THR B 1 3   ? 15.500  21.841  37.997  1.00 5.36  ? 3   THR B CG2 1 
ATOM   1654 N  N   . LEU B 1 4   ? 17.798  21.342  35.686  1.00 2.94  ? 4   LEU B N   1 
ATOM   1655 C  CA  . LEU B 1 4   ? 17.491  20.958  34.306  1.00 3.12  ? 4   LEU B CA  1 
ATOM   1656 C  C   . LEU B 1 4   ? 15.984  21.039  34.173  1.00 3.85  ? 4   LEU B C   1 
ATOM   1657 O  O   . LEU B 1 4   ? 15.256  20.346  34.883  1.00 3.26  ? 4   LEU B O   1 
ATOM   1658 C  CB  . LEU B 1 4   ? 17.977  19.530  34.022  1.00 2.93  ? 4   LEU B CB  1 
ATOM   1659 C  CG  . LEU B 1 4   ? 17.723  18.862  32.656  1.00 2.87  ? 4   LEU B CG  1 
ATOM   1660 C  CD1 . LEU B 1 4   ? 18.643  19.457  31.582  1.00 3.94  ? 4   LEU B CD1 1 
ATOM   1661 C  CD2 . LEU B 1 4   ? 17.969  17.349  32.739  1.00 2.99  ? 4   LEU B CD2 1 
ATOM   1662 N  N   . PRO B 1 5   ? 15.498  21.914  33.297  1.00 4.40  ? 5   PRO B N   1 
ATOM   1663 C  CA  . PRO B 1 5   ? 14.047  21.962  33.164  1.00 4.75  ? 5   PRO B CA  1 
ATOM   1664 C  C   . PRO B 1 5   ? 13.521  20.701  32.492  1.00 4.97  ? 5   PRO B C   1 
ATOM   1665 O  O   . PRO B 1 5   ? 14.227  20.108  31.689  1.00 4.94  ? 5   PRO B O   1 
ATOM   1666 C  CB  . PRO B 1 5   ? 13.846  23.104  32.176  1.00 4.63  ? 5   PRO B CB  1 
ATOM   1667 C  CG  . PRO B 1 5   ? 15.083  23.063  31.297  1.00 5.13  ? 5   PRO B CG  1 
ATOM   1668 C  CD  . PRO B 1 5   ? 16.184  22.732  32.277  1.00 4.02  ? 5   PRO B CD  1 
ATOM   1669 N  N   . SER B 1 6   ? 12.280  20.315  32.803  1.00 5.28  ? 6   SER B N   1 
ATOM   1670 C  CA  A SER B 1 6   ? 11.599  19.275  32.054  0.50 5.41  ? 6   SER B CA  1 
ATOM   1671 C  CA  B SER B 1 6   ? 11.586  19.276  32.046  0.50 5.17  ? 6   SER B CA  1 
ATOM   1672 C  C   . SER B 1 6   ? 11.143  19.852  30.712  1.00 5.37  ? 6   SER B C   1 
ATOM   1673 O  O   . SER B 1 6   ? 10.919  21.072  30.596  1.00 5.29  ? 6   SER B O   1 
ATOM   1674 C  CB  A SER B 1 6   ? 10.382  18.795  32.843  0.50 5.30  ? 6   SER B CB  1 
ATOM   1675 C  CB  B SER B 1 6   ? 10.330  18.803  32.779  0.50 4.93  ? 6   SER B CB  1 
ATOM   1676 O  OG  A SER B 1 6   ? 9.566   19.903  33.195  0.50 5.80  ? 6   SER B OG  1 
ATOM   1677 O  OG  B SER B 1 6   ? 10.629  18.245  34.033  0.50 4.14  ? 6   SER B OG  1 
ATOM   1678 N  N   . LEU B 1 7   ? 11.001  18.983  29.717  1.00 5.19  ? 7   LEU B N   1 
ATOM   1679 C  CA  . LEU B 1 7   ? 10.479  19.371  28.396  1.00 5.14  ? 7   LEU B CA  1 
ATOM   1680 C  C   . LEU B 1 7   ? 8.992   19.709  28.532  1.00 5.07  ? 7   LEU B C   1 
ATOM   1681 O  O   . LEU B 1 7   ? 8.329   19.139  29.380  1.00 4.49  ? 7   LEU B O   1 
ATOM   1682 C  CB  . LEU B 1 7   ? 10.647  18.220  27.405  1.00 5.56  ? 7   LEU B CB  1 
ATOM   1683 C  CG  . LEU B 1 7   ? 12.059  17.826  26.954  1.00 5.43  ? 7   LEU B CG  1 
ATOM   1684 C  CD1 . LEU B 1 7   ? 12.033  16.587  26.048  1.00 6.06  ? 7   LEU B CD1 1 
ATOM   1685 C  CD2 . LEU B 1 7   ? 12.761  18.961  26.224  1.00 7.70  ? 7   LEU B CD2 1 
ATOM   1686 N  N   . PRO B 1 8   ? 8.467   20.638  27.704  1.00 4.87  ? 8   PRO B N   1 
ATOM   1687 C  CA  . PRO B 1 8   ? 7.053   21.035  27.758  1.00 5.88  ? 8   PRO B CA  1 
ATOM   1688 C  C   . PRO B 1 8   ? 6.177   20.035  27.022  1.00 5.93  ? 8   PRO B C   1 
ATOM   1689 O  O   . PRO B 1 8   ? 5.010   20.317  26.738  1.00 7.25  ? 8   PRO B O   1 
ATOM   1690 C  CB  . PRO B 1 8   ? 7.021   22.398  27.050  1.00 6.28  ? 8   PRO B CB  1 
ATOM   1691 C  CG  . PRO B 1 8   ? 8.491   22.705  26.676  1.00 4.37  ? 8   PRO B CG  1 
ATOM   1692 C  CD  . PRO B 1 8   ? 9.215   21.399  26.689  1.00 5.51  ? 8   PRO B CD  1 
ATOM   1693 N  N   . TYR B 1 9   ? 6.730   18.875  26.704  1.00 5.54  ? 9   TYR B N   1 
ATOM   1694 C  CA  . TYR B 1 9   ? 5.986   17.883  25.928  1.00 5.85  ? 9   TYR B CA  1 
ATOM   1695 C  C   . TYR B 1 9   ? 6.674   16.535  26.039  1.00 5.65  ? 9   TYR B C   1 
ATOM   1696 O  O   . TYR B 1 9   ? 7.768   16.430  26.595  1.00 5.97  ? 9   TYR B O   1 
ATOM   1697 C  CB  . TYR B 1 9   ? 5.899   18.316  24.441  1.00 5.82  ? 9   TYR B CB  1 
ATOM   1698 C  CG  . TYR B 1 9   ? 7.142   19.058  23.976  1.00 5.67  ? 9   TYR B CG  1 
ATOM   1699 C  CD1 . TYR B 1 9   ? 8.355   18.399  23.845  1.00 6.08  ? 9   TYR B CD1 1 
ATOM   1700 C  CD2 . TYR B 1 9   ? 7.106   20.423  23.735  1.00 5.70  ? 9   TYR B CD2 1 
ATOM   1701 C  CE1 . TYR B 1 9   ? 9.511   19.089  23.445  1.00 4.89  ? 9   TYR B CE1 1 
ATOM   1702 C  CE2 . TYR B 1 9   ? 8.243   21.116  23.325  1.00 4.31  ? 9   TYR B CE2 1 
ATOM   1703 C  CZ  . TYR B 1 9   ? 9.435   20.447  23.190  1.00 5.37  ? 9   TYR B CZ  1 
ATOM   1704 O  OH  . TYR B 1 9   ? 10.579  21.141  22.815  1.00 5.47  ? 9   TYR B OH  1 
ATOM   1705 N  N   . ALA B 1 10  ? 6.035   15.503  25.503  1.00 5.29  ? 10  ALA B N   1 
ATOM   1706 C  CA  . ALA B 1 10  ? 6.652   14.191  25.449  1.00 5.04  ? 10  ALA B CA  1 
ATOM   1707 C  C   . ALA B 1 10  ? 7.751   14.212  24.379  1.00 5.02  ? 10  ALA B C   1 
ATOM   1708 O  O   . ALA B 1 10  ? 7.776   15.096  23.515  1.00 4.66  ? 10  ALA B O   1 
ATOM   1709 C  CB  . ALA B 1 10  ? 5.619   13.113  25.109  1.00 5.85  ? 10  ALA B CB  1 
ATOM   1710 N  N   . TYR B 1 11  ? 8.628   13.226  24.408  1.00 4.97  ? 11  TYR B N   1 
ATOM   1711 C  CA  . TYR B 1 11  ? 9.729   13.199  23.434  1.00 5.12  ? 11  TYR B CA  1 
ATOM   1712 C  C   . TYR B 1 11  ? 9.237   13.142  21.996  1.00 5.69  ? 11  TYR B C   1 
ATOM   1713 O  O   . TYR B 1 11  ? 9.901   13.624  21.077  1.00 4.68  ? 11  TYR B O   1 
ATOM   1714 C  CB  . TYR B 1 11  ? 10.657  12.024  23.685  1.00 5.19  ? 11  TYR B CB  1 
ATOM   1715 C  CG  . TYR B 1 11  ? 11.296  11.995  25.032  1.00 6.76  ? 11  TYR B CG  1 
ATOM   1716 C  CD1 . TYR B 1 11  ? 11.877  13.126  25.568  1.00 4.53  ? 11  TYR B CD1 1 
ATOM   1717 C  CD2 . TYR B 1 11  ? 11.341  10.819  25.761  1.00 7.31  ? 11  TYR B CD2 1 
ATOM   1718 C  CE1 . TYR B 1 11  ? 12.482  13.092  26.813  1.00 8.81  ? 11  TYR B CE1 1 
ATOM   1719 C  CE2 . TYR B 1 11  ? 11.945  10.769  27.007  1.00 8.33  ? 11  TYR B CE2 1 
ATOM   1720 C  CZ  . TYR B 1 11  ? 12.509  11.908  27.524  1.00 7.87  ? 11  TYR B CZ  1 
ATOM   1721 O  OH  . TYR B 1 11  ? 13.124  11.841  28.750  1.00 8.84  ? 11  TYR B OH  1 
ATOM   1722 N  N   . ASP B 1 12  ? 8.066   12.542  21.802  1.00 5.42  ? 12  ASP B N   1 
ATOM   1723 C  CA  . ASP B 1 12  ? 7.562   12.301  20.465  1.00 6.99  ? 12  ASP B CA  1 
ATOM   1724 C  C   . ASP B 1 12  ? 6.628   13.410  19.978  1.00 6.12  ? 12  ASP B C   1 
ATOM   1725 O  O   . ASP B 1 12  ? 6.026   13.307  18.903  1.00 6.61  ? 12  ASP B O   1 
ATOM   1726 C  CB  . ASP B 1 12  ? 6.846   10.954  20.441  1.00 7.31  ? 12  ASP B CB  1 
ATOM   1727 C  CG  . ASP B 1 12  ? 5.505   10.993  21.143  1.00 8.66  ? 12  ASP B CG  1 
ATOM   1728 O  OD1 . ASP B 1 12  ? 5.155   12.027  21.762  1.00 7.71  ? 12  ASP B OD1 1 
ATOM   1729 O  OD2 . ASP B 1 12  ? 4.796   9.973   21.064  1.00 12.98 ? 12  ASP B OD2 1 
ATOM   1730 N  N   . ALA B 1 13  ? 6.505   14.477  20.762  1.00 5.92  ? 13  ALA B N   1 
ATOM   1731 C  CA  . ALA B 1 13  ? 5.540   15.542  20.484  1.00 5.09  ? 13  ALA B CA  1 
ATOM   1732 C  C   . ALA B 1 13  ? 5.862   16.436  19.283  1.00 4.77  ? 13  ALA B C   1 
ATOM   1733 O  O   . ALA B 1 13  ? 5.056   17.301  18.916  1.00 4.97  ? 13  ALA B O   1 
ATOM   1734 C  CB  . ALA B 1 13  ? 5.324   16.399  21.720  1.00 4.96  ? 13  ALA B CB  1 
ATOM   1735 N  N   . LEU B 1 14  ? 7.043   16.254  18.698  1.00 4.41  ? 14  LEU B N   1 
ATOM   1736 C  CA  . LEU B 1 14  ? 7.466   17.061  17.570  1.00 4.32  ? 14  LEU B CA  1 
ATOM   1737 C  C   . LEU B 1 14  ? 7.522   16.193  16.309  1.00 4.90  ? 14  LEU B C   1 
ATOM   1738 O  O   . LEU B 1 14  ? 7.885   16.683  15.230  1.00 5.04  ? 14  LEU B O   1 
ATOM   1739 C  CB  . LEU B 1 14  ? 8.852   17.662  17.833  1.00 3.96  ? 14  LEU B CB  1 
ATOM   1740 C  CG  . LEU B 1 14  ? 8.966   18.625  19.022  1.00 3.07  ? 14  LEU B CG  1 
ATOM   1741 C  CD1 . LEU B 1 14  ? 10.400  19.182  19.161  1.00 2.93  ? 14  LEU B CD1 1 
ATOM   1742 C  CD2 . LEU B 1 14  ? 7.952   19.755  18.927  1.00 2.06  ? 14  LEU B CD2 1 
ATOM   1743 N  N   . GLU B 1 15  ? 7.191   14.908  16.453  1.00 5.42  ? 15  GLU B N   1 
ATOM   1744 C  CA  . GLU B 1 15  ? 7.059   13.989  15.315  1.00 5.78  ? 15  GLU B CA  1 
ATOM   1745 C  C   . GLU B 1 15  ? 5.957   14.528  14.396  1.00 5.30  ? 15  GLU B C   1 
ATOM   1746 O  O   . GLU B 1 15  ? 4.999   15.166  14.856  1.00 5.37  ? 15  GLU B O   1 
ATOM   1747 C  CB  . GLU B 1 15  ? 6.699   12.562  15.790  1.00 5.65  ? 15  GLU B CB  1 
ATOM   1748 C  CG  . GLU B 1 15  ? 7.801   11.787  16.519  1.00 5.62  ? 15  GLU B CG  1 
ATOM   1749 C  CD  . GLU B 1 15  ? 8.896   11.283  15.584  1.00 5.68  ? 15  GLU B CD  1 
ATOM   1750 O  OE1 . GLU B 1 15  ? 8.765   11.522  14.357  1.00 5.99  ? 15  GLU B OE1 1 
ATOM   1751 O  OE2 . GLU B 1 15  ? 9.869   10.636  16.058  1.00 4.54  ? 15  GLU B OE2 1 
ATOM   1752 N  N   . PRO B 1 16  ? 6.081   14.300  13.081  1.00 4.98  ? 16  PRO B N   1 
ATOM   1753 C  CA  . PRO B 1 16  ? 7.063   13.601  12.266  1.00 4.47  ? 16  PRO B CA  1 
ATOM   1754 C  C   . PRO B 1 16  ? 8.282   14.458  11.890  1.00 4.78  ? 16  PRO B C   1 
ATOM   1755 O  O   . PRO B 1 16  ? 9.093   14.038  11.046  1.00 4.50  ? 16  PRO B O   1 
ATOM   1756 C  CB  . PRO B 1 16  ? 6.271   13.284  10.995  1.00 4.82  ? 16  PRO B CB  1 
ATOM   1757 C  CG  . PRO B 1 16  ? 5.332   14.381  10.858  1.00 4.04  ? 16  PRO B CG  1 
ATOM   1758 C  CD  . PRO B 1 16  ? 4.977   14.838  12.256  1.00 4.69  ? 16  PRO B CD  1 
ATOM   1759 N  N   . HIS B 1 17  ? 8.429   15.619  12.523  1.00 3.66  ? 17  HIS B N   1 
ATOM   1760 C  CA  . HIS B 1 17  ? 9.418   16.606  12.060  1.00 4.33  ? 17  HIS B CA  1 
ATOM   1761 C  C   . HIS B 1 17  ? 10.791  16.434  12.729  1.00 3.90  ? 17  HIS B C   1 
ATOM   1762 O  O   . HIS B 1 17  ? 11.792  16.138  12.048  1.00 3.06  ? 17  HIS B O   1 
ATOM   1763 C  CB  . HIS B 1 17  ? 8.873   18.034  12.203  1.00 4.60  ? 17  HIS B CB  1 
ATOM   1764 C  CG  . HIS B 1 17  ? 7.467   18.192  11.703  1.00 4.79  ? 17  HIS B CG  1 
ATOM   1765 N  ND1 . HIS B 1 17  ? 7.124   18.016  10.376  1.00 5.34  ? 17  HIS B ND1 1 
ATOM   1766 C  CD2 . HIS B 1 17  ? 6.317   18.504  12.351  1.00 4.57  ? 17  HIS B CD2 1 
ATOM   1767 C  CE1 . HIS B 1 17  ? 5.824   18.202  10.232  1.00 6.83  ? 17  HIS B CE1 1 
ATOM   1768 N  NE2 . HIS B 1 17  ? 5.309   18.498  11.414  1.00 4.79  ? 17  HIS B NE2 1 
ATOM   1769 N  N   . PHE B 1 18  ? 10.836  16.614  14.048  1.00 4.35  ? 18  PHE B N   1 
ATOM   1770 C  CA  . PHE B 1 18  ? 12.009  16.272  14.851  1.00 4.73  ? 18  PHE B CA  1 
ATOM   1771 C  C   . PHE B 1 18  ? 11.777  14.941  15.560  1.00 4.60  ? 18  PHE B C   1 
ATOM   1772 O  O   . PHE B 1 18  ? 10.717  14.737  16.156  1.00 4.94  ? 18  PHE B O   1 
ATOM   1773 C  CB  . PHE B 1 18  ? 12.262  17.330  15.929  1.00 4.99  ? 18  PHE B CB  1 
ATOM   1774 C  CG  . PHE B 1 18  ? 12.857  18.599  15.410  1.00 5.19  ? 18  PHE B CG  1 
ATOM   1775 C  CD1 . PHE B 1 18  ? 13.054  18.793  14.048  1.00 5.18  ? 18  PHE B CD1 1 
ATOM   1776 C  CD2 . PHE B 1 18  ? 13.194  19.625  16.293  1.00 5.15  ? 18  PHE B CD2 1 
ATOM   1777 C  CE1 . PHE B 1 18  ? 13.587  19.996  13.586  1.00 4.66  ? 18  PHE B CE1 1 
ATOM   1778 C  CE2 . PHE B 1 18  ? 13.717  20.818  15.833  1.00 3.14  ? 18  PHE B CE2 1 
ATOM   1779 C  CZ  . PHE B 1 18  ? 13.924  20.995  14.473  1.00 5.16  ? 18  PHE B CZ  1 
ATOM   1780 N  N   . ASP B 1 19  ? 12.770  14.064  15.508  1.00 4.55  ? 19  ASP B N   1 
ATOM   1781 C  CA  . ASP B 1 19  ? 12.650  12.688  15.987  1.00 4.13  ? 19  ASP B CA  1 
ATOM   1782 C  C   . ASP B 1 19  ? 12.734  12.552  17.491  1.00 4.84  ? 19  ASP B C   1 
ATOM   1783 O  O   . ASP B 1 19  ? 13.527  13.228  18.128  1.00 4.31  ? 19  ASP B O   1 
ATOM   1784 C  CB  . ASP B 1 19  ? 13.703  11.791  15.343  1.00 3.94  ? 19  ASP B CB  1 
ATOM   1785 C  CG  . ASP B 1 19  ? 15.135  12.235  15.632  1.00 3.74  ? 19  ASP B CG  1 
ATOM   1786 O  OD1 . ASP B 1 19  ? 15.525  13.322  15.159  1.00 2.58  ? 19  ASP B OD1 1 
ATOM   1787 O  OD2 . ASP B 1 19  ? 15.869  11.482  16.298  1.00 3.64  ? 19  ASP B OD2 1 
ATOM   1788 N  N   . LYS B 1 20  ? 11.922  11.649  18.047  1.00 4.86  ? 20  LYS B N   1 
ATOM   1789 C  CA  . LYS B 1 20  ? 11.879  11.447  19.499  1.00 4.58  ? 20  LYS B CA  1 
ATOM   1790 C  C   . LYS B 1 20  ? 13.150  10.870  20.136  1.00 4.38  ? 20  LYS B C   1 
ATOM   1791 O  O   . LYS B 1 20  ? 13.405  11.098  21.323  1.00 4.20  ? 20  LYS B O   1 
ATOM   1792 C  CB  . LYS B 1 20  ? 10.660  10.584  19.864  1.00 5.01  ? 20  LYS B CB  1 
ATOM   1793 C  CG  . LYS B 1 20  ? 10.599  9.289   19.101  1.00 5.76  ? 20  LYS B CG  1 
ATOM   1794 C  CD  . LYS B 1 20  ? 9.390   8.455   19.535  1.00 7.67  ? 20  LYS B CD  1 
ATOM   1795 C  CE  . LYS B 1 20  ? 9.729   6.979   19.480  1.00 9.28  ? 20  LYS B CE  1 
ATOM   1796 N  NZ  . LYS B 1 20  ? 9.609   6.483   18.103  1.00 12.62 ? 20  LYS B NZ  1 
ATOM   1797 N  N   . GLN B 1 21  ? 13.942  10.121  19.372  1.00 3.60  ? 21  GLN B N   1 
ATOM   1798 C  CA  . GLN B 1 21  ? 15.160  9.546   19.902  1.00 3.75  ? 21  GLN B CA  1 
ATOM   1799 C  C   . GLN B 1 21  ? 16.052  10.715  20.217  1.00 3.84  ? 21  GLN B C   1 
ATOM   1800 O  O   . GLN B 1 21  ? 16.611  10.809  21.286  1.00 4.31  ? 21  GLN B O   1 
ATOM   1801 C  CB  . GLN B 1 21  ? 15.854  8.647   18.878  1.00 3.65  ? 21  GLN B CB  1 
ATOM   1802 C  CG  . GLN B 1 21  ? 16.996  7.860   19.487  1.00 5.72  ? 21  GLN B CG  1 
ATOM   1803 C  CD  . GLN B 1 21  ? 17.764  7.035   18.460  1.00 8.66  ? 21  GLN B CD  1 
ATOM   1804 O  OE1 . GLN B 1 21  ? 18.671  6.279   18.813  1.00 10.56 ? 21  GLN B OE1 1 
ATOM   1805 N  NE2 . GLN B 1 21  ? 17.404  7.179   17.187  1.00 10.84 ? 21  GLN B NE2 1 
ATOM   1806 N  N   . THR B 1 22  ? 16.186  11.620  19.260  1.00 3.87  ? 22  THR B N   1 
ATOM   1807 C  CA  . THR B 1 22  ? 17.004  12.793  19.494  1.00 3.93  ? 22  THR B CA  1 
ATOM   1808 C  C   . THR B 1 22  ? 16.465  13.674  20.628  1.00 3.44  ? 22  THR B C   1 
ATOM   1809 O  O   . THR B 1 22  ? 17.250  14.153  21.461  1.00 3.04  ? 22  THR B O   1 
ATOM   1810 C  CB  . THR B 1 22  ? 17.214  13.600  18.203  1.00 4.60  ? 22  THR B CB  1 
ATOM   1811 O  OG1 . THR B 1 22  ? 17.892  12.773  17.248  1.00 3.83  ? 22  THR B OG1 1 
ATOM   1812 C  CG2 . THR B 1 22  ? 18.023  14.861  18.485  1.00 3.85  ? 22  THR B CG2 1 
ATOM   1813 N  N   . MET B 1 23  ? 15.153  13.921  20.670  1.00 2.53  ? 23  MET B N   1 
ATOM   1814 C  CA  . MET B 1 23  ? 14.634  14.782  21.731  1.00 2.86  ? 23  MET B CA  1 
ATOM   1815 C  C   . MET B 1 23  ? 15.097  14.273  23.099  1.00 3.09  ? 23  MET B C   1 
ATOM   1816 O  O   . MET B 1 23  ? 15.535  15.063  23.955  1.00 2.90  ? 23  MET B O   1 
ATOM   1817 C  CB  . MET B 1 23  ? 13.109  14.900  21.665  1.00 2.09  ? 23  MET B CB  1 
ATOM   1818 C  CG  . MET B 1 23  ? 12.583  15.600  20.396  1.00 4.32  ? 23  MET B CG  1 
ATOM   1819 S  SD  . MET B 1 23  ? 13.212  17.282  20.191  1.00 5.11  ? 23  MET B SD  1 
ATOM   1820 C  CE  . MET B 1 23  ? 12.502  18.065  21.651  1.00 6.14  ? 23  MET B CE  1 
ATOM   1821 N  N   . GLU B 1 24  ? 15.051  12.946  23.266  1.00 2.87  ? 24  GLU B N   1 
ATOM   1822 C  CA  . GLU B 1 24  ? 15.375  12.313  24.547  1.00 3.76  ? 24  GLU B CA  1 
ATOM   1823 C  C   . GLU B 1 24  ? 16.853  12.423  24.893  1.00 3.73  ? 24  GLU B C   1 
ATOM   1824 O  O   . GLU B 1 24  ? 17.200  12.885  25.981  1.00 3.57  ? 24  GLU B O   1 
ATOM   1825 C  CB  . GLU B 1 24  ? 14.904  10.858  24.612  1.00 4.80  ? 24  GLU B CB  1 
ATOM   1826 C  CG  . GLU B 1 24  ? 15.374  10.155  25.884  1.00 5.90  ? 24  GLU B CG  1 
ATOM   1827 C  CD  . GLU B 1 24  ? 14.682  8.852   26.117  1.00 8.22  ? 24  GLU B CD  1 
ATOM   1828 O  OE1 . GLU B 1 24  ? 13.833  8.482   25.284  1.00 10.09 ? 24  GLU B OE1 1 
ATOM   1829 O  OE2 . GLU B 1 24  ? 14.968  8.207   27.144  1.00 10.46 ? 24  GLU B OE2 1 
ATOM   1830 N  N   . ILE B 1 25  ? 17.713  12.039  23.955  1.00 3.90  ? 25  ILE B N   1 
ATOM   1831 C  CA  . ILE B 1 25  ? 19.151  12.128  24.156  1.00 3.56  ? 25  ILE B CA  1 
ATOM   1832 C  C   . ILE B 1 25  ? 19.594  13.590  24.303  1.00 3.31  ? 25  ILE B C   1 
ATOM   1833 O  O   . ILE B 1 25  ? 20.391  13.915  25.177  1.00 3.12  ? 25  ILE B O   1 
ATOM   1834 C  CB  . ILE B 1 25  ? 19.943  11.473  23.005  1.00 3.31  ? 25  ILE B CB  1 
ATOM   1835 C  CG1 . ILE B 1 25  ? 19.552  9.995   22.829  1.00 3.89  ? 25  ILE B CG1 1 
ATOM   1836 C  CG2 . ILE B 1 25  ? 21.443  11.617  23.242  1.00 4.45  ? 25  ILE B CG2 1 
ATOM   1837 C  CD1 . ILE B 1 25  ? 20.099  9.397   21.553  1.00 7.49  ? 25  ILE B CD1 1 
ATOM   1838 N  N   . HIS B 1 26  ? 19.079  14.474  23.448  1.00 3.59  ? 26  HIS B N   1 
ATOM   1839 C  CA  . HIS B 1 26  ? 19.487  15.870  23.471  1.00 3.21  ? 26  HIS B CA  1 
ATOM   1840 C  C   . HIS B 1 26  ? 19.222  16.465  24.848  1.00 3.77  ? 26  HIS B C   1 
ATOM   1841 O  O   . HIS B 1 26  ? 20.039  17.220  25.369  1.00 2.87  ? 26  HIS B O   1 
ATOM   1842 C  CB  . HIS B 1 26  ? 18.702  16.644  22.396  1.00 3.52  ? 26  HIS B CB  1 
ATOM   1843 C  CG  . HIS B 1 26  ? 19.313  17.951  21.980  1.00 2.70  ? 26  HIS B CG  1 
ATOM   1844 N  ND1 . HIS B 1 26  ? 18.773  18.709  20.965  1.00 2.92  ? 26  HIS B ND1 1 
ATOM   1845 C  CD2 . HIS B 1 26  ? 20.413  18.623  22.410  1.00 2.84  ? 26  HIS B CD2 1 
ATOM   1846 C  CE1 . HIS B 1 26  ? 19.508  19.799  20.797  1.00 2.67  ? 26  HIS B CE1 1 
ATOM   1847 N  NE2 . HIS B 1 26  ? 20.510  19.774  21.660  1.00 1.80  ? 26  HIS B NE2 1 
ATOM   1848 N  N   . HIS B 1 27  ? 18.090  16.107  25.440  1.00 3.91  ? 27  HIS B N   1 
ATOM   1849 C  CA  . HIS B 1 27  ? 17.674  16.670  26.735  1.00 4.61  ? 27  HIS B CA  1 
ATOM   1850 C  C   . HIS B 1 27  ? 18.338  15.978  27.905  1.00 4.91  ? 27  HIS B C   1 
ATOM   1851 O  O   . HIS B 1 27  ? 19.005  16.623  28.740  1.00 4.91  ? 27  HIS B O   1 
ATOM   1852 C  CB  . HIS B 1 27  ? 16.150  16.560  26.890  1.00 4.27  ? 27  HIS B CB  1 
ATOM   1853 C  CG  . HIS B 1 27  ? 15.650  17.129  28.175  1.00 4.18  ? 27  HIS B CG  1 
ATOM   1854 N  ND1 . HIS B 1 27  ? 15.064  16.355  29.154  1.00 4.89  ? 27  HIS B ND1 1 
ATOM   1855 C  CD2 . HIS B 1 27  ? 15.670  18.394  28.655  1.00 3.63  ? 27  HIS B CD2 1 
ATOM   1856 C  CE1 . HIS B 1 27  ? 14.730  17.124  30.174  1.00 3.75  ? 27  HIS B CE1 1 
ATOM   1857 N  NE2 . HIS B 1 27  ? 15.072  18.366  29.892  1.00 3.73  ? 27  HIS B NE2 1 
ATOM   1858 N  N   . THR B 1 28  ? 18.180  14.658  27.957  1.00 5.14  ? 28  THR B N   1 
ATOM   1859 C  CA  . THR B 1 28  ? 18.659  13.900  29.122  1.00 4.82  ? 28  THR B CA  1 
ATOM   1860 C  C   . THR B 1 28  ? 20.173  13.696  29.172  1.00 4.21  ? 28  THR B C   1 
ATOM   1861 O  O   . THR B 1 28  ? 20.712  13.399  30.237  1.00 3.29  ? 28  THR B O   1 
ATOM   1862 C  CB  . THR B 1 28  ? 18.005  12.518  29.247  1.00 5.10  ? 28  THR B CB  1 
ATOM   1863 O  OG1 . THR B 1 28  ? 18.503  11.683  28.203  1.00 5.03  ? 28  THR B OG1 1 
ATOM   1864 C  CG2 . THR B 1 28  ? 16.431  12.577  29.203  1.00 3.34  ? 28  THR B CG2 1 
ATOM   1865 N  N   . LYS B 1 29  ? 20.857  13.839  28.039  1.00 3.79  ? 29  LYS B N   1 
ATOM   1866 C  CA  . LYS B 1 29  ? 22.300  13.710  28.029  1.00 3.49  ? 29  LYS B CA  1 
ATOM   1867 C  C   . LYS B 1 29  ? 23.007  15.050  27.797  1.00 3.02  ? 29  LYS B C   1 
ATOM   1868 O  O   . LYS B 1 29  ? 23.772  15.497  28.655  1.00 2.81  ? 29  LYS B O   1 
ATOM   1869 C  CB  . LYS B 1 29  ? 22.744  12.652  27.019  1.00 3.17  ? 29  LYS B CB  1 
ATOM   1870 C  CG  . LYS B 1 29  ? 22.076  11.289  27.230  1.00 4.65  ? 29  LYS B CG  1 
ATOM   1871 C  CD  . LYS B 1 29  ? 22.450  10.693  28.576  1.00 6.53  ? 29  LYS B CD  1 
ATOM   1872 C  CE  . LYS B 1 29  ? 21.876  9.278   28.728  1.00 8.55  ? 29  LYS B CE  1 
ATOM   1873 N  NZ  . LYS B 1 29  ? 20.402  9.362   28.923  1.00 8.75  ? 29  LYS B NZ  1 
ATOM   1874 N  N   . HIS B 1 30  ? 22.754  15.703  26.659  1.00 2.80  ? 30  HIS B N   1 
ATOM   1875 C  CA  . HIS B 1 30  ? 23.499  16.930  26.346  1.00 2.40  ? 30  HIS B CA  1 
ATOM   1876 C  C   . HIS B 1 30  ? 23.141  18.099  27.291  1.00 2.54  ? 30  HIS B C   1 
ATOM   1877 O  O   . HIS B 1 30  ? 24.020  18.697  27.924  1.00 2.34  ? 30  HIS B O   1 
ATOM   1878 C  CB  . HIS B 1 30  ? 23.289  17.339  24.870  1.00 2.32  ? 30  HIS B CB  1 
ATOM   1879 C  CG  . HIS B 1 30  ? 23.876  16.377  23.873  1.00 3.02  ? 30  HIS B CG  1 
ATOM   1880 N  ND1 . HIS B 1 30  ? 25.152  16.511  23.357  1.00 3.65  ? 30  HIS B ND1 1 
ATOM   1881 C  CD2 . HIS B 1 30  ? 23.356  15.264  23.302  1.00 2.53  ? 30  HIS B CD2 1 
ATOM   1882 C  CE1 . HIS B 1 30  ? 25.390  15.516  22.519  1.00 3.61  ? 30  HIS B CE1 1 
ATOM   1883 N  NE2 . HIS B 1 30  ? 24.313  14.751  22.460  1.00 2.55  ? 30  HIS B NE2 1 
ATOM   1884 N  N   . HIS B 1 31  ? 21.858  18.425  27.397  1.00 2.26  ? 31  HIS B N   1 
ATOM   1885 C  CA  . HIS B 1 31  ? 21.438  19.508  28.283  1.00 2.96  ? 31  HIS B CA  1 
ATOM   1886 C  C   . HIS B 1 31  ? 21.837  19.214  29.743  1.00 2.73  ? 31  HIS B C   1 
ATOM   1887 O  O   . HIS B 1 31  ? 22.344  20.075  30.440  1.00 1.75  ? 31  HIS B O   1 
ATOM   1888 C  CB  . HIS B 1 31  ? 19.933  19.832  28.130  1.00 3.12  ? 31  HIS B CB  1 
ATOM   1889 C  CG  . HIS B 1 31  ? 19.535  21.148  28.736  1.00 3.14  ? 31  HIS B CG  1 
ATOM   1890 N  ND1 . HIS B 1 31  ? 18.285  21.705  28.553  1.00 1.53  ? 31  HIS B ND1 1 
ATOM   1891 C  CD2 . HIS B 1 31  ? 20.229  22.028  29.505  1.00 3.22  ? 31  HIS B CD2 1 
ATOM   1892 C  CE1 . HIS B 1 31  ? 18.220  22.859  29.194  1.00 1.90  ? 31  HIS B CE1 1 
ATOM   1893 N  NE2 . HIS B 1 31  ? 19.385  23.077  29.784  1.00 1.07  ? 31  HIS B NE2 1 
ATOM   1894 N  N   . GLN B 1 32  ? 21.650  17.969  30.176  1.00 2.48  ? 32  GLN B N   1 
ATOM   1895 C  CA  . GLN B 1 32  ? 22.007  17.563  31.541  1.00 2.56  ? 32  GLN B CA  1 
ATOM   1896 C  C   . GLN B 1 32  ? 23.479  17.888  31.808  1.00 3.09  ? 32  GLN B C   1 
ATOM   1897 O  O   . GLN B 1 32  ? 23.833  18.366  32.882  1.00 3.31  ? 32  GLN B O   1 
ATOM   1898 C  CB  . GLN B 1 32  ? 21.725  16.052  31.711  1.00 2.06  ? 32  GLN B CB  1 
ATOM   1899 C  CG  . GLN B 1 32  ? 22.130  15.441  33.049  1.00 1.52  ? 32  GLN B CG  1 
ATOM   1900 C  CD  . GLN B 1 32  ? 21.285  15.991  34.196  1.00 2.83  ? 32  GLN B CD  1 
ATOM   1901 O  OE1 . GLN B 1 32  ? 20.179  15.528  34.436  1.00 4.67  ? 32  GLN B OE1 1 
ATOM   1902 N  NE2 . GLN B 1 32  ? 21.800  17.008  34.891  1.00 2.56  ? 32  GLN B NE2 1 
ATOM   1903 N  N   . THR B 1 33  ? 24.337  17.634  30.821  1.00 2.45  ? 33  THR B N   1 
ATOM   1904 C  CA  . THR B 1 33  ? 25.776  17.865  30.999  1.00 2.44  ? 33  THR B CA  1 
ATOM   1905 C  C   . THR B 1 33  ? 26.140  19.338  31.161  1.00 2.07  ? 33  THR B C   1 
ATOM   1906 O  O   . THR B 1 33  ? 26.994  19.699  31.985  1.00 0.96  ? 33  THR B O   1 
ATOM   1907 C  CB  . THR B 1 33  ? 26.577  17.223  29.852  1.00 2.24  ? 33  THR B CB  1 
ATOM   1908 O  OG1 . THR B 1 33  ? 26.550  15.808  30.013  1.00 3.68  ? 33  THR B OG1 1 
ATOM   1909 C  CG2 . THR B 1 33  ? 28.034  17.652  29.904  1.00 2.57  ? 33  THR B CG2 1 
ATOM   1910 N  N   . TYR B 1 34  ? 25.491  20.191  30.385  1.00 2.33  ? 34  TYR B N   1 
ATOM   1911 C  CA  . TYR B 1 34  ? 25.710  21.634  30.493  1.00 2.25  ? 34  TYR B CA  1 
ATOM   1912 C  C   . TYR B 1 34  ? 25.328  22.140  31.886  1.00 2.76  ? 34  TYR B C   1 
ATOM   1913 O  O   . TYR B 1 34  ? 26.063  22.909  32.501  1.00 2.33  ? 34  TYR B O   1 
ATOM   1914 C  CB  . TYR B 1 34  ? 24.902  22.389  29.426  1.00 1.84  ? 34  TYR B CB  1 
ATOM   1915 C  CG  . TYR B 1 34  ? 25.358  22.107  28.015  1.00 3.67  ? 34  TYR B CG  1 
ATOM   1916 C  CD1 . TYR B 1 34  ? 26.701  22.133  27.697  1.00 5.26  ? 34  TYR B CD1 1 
ATOM   1917 C  CD2 . TYR B 1 34  ? 24.444  21.822  26.999  1.00 5.03  ? 34  TYR B CD2 1 
ATOM   1918 C  CE1 . TYR B 1 34  ? 27.142  21.857  26.423  1.00 6.00  ? 34  TYR B CE1 1 
ATOM   1919 C  CE2 . TYR B 1 34  ? 24.893  21.563  25.708  1.00 6.40  ? 34  TYR B CE2 1 
ATOM   1920 C  CZ  . TYR B 1 34  ? 26.238  21.585  25.438  1.00 5.44  ? 34  TYR B CZ  1 
ATOM   1921 O  OH  . TYR B 1 34  ? 26.719  21.328  24.167  1.00 7.27  ? 34  TYR B OH  1 
ATOM   1922 N  N   . VAL B 1 35  ? 24.169  21.708  32.371  1.00 2.80  ? 35  VAL B N   1 
ATOM   1923 C  CA  . VAL B 1 35  ? 23.717  22.112  33.698  1.00 3.51  ? 35  VAL B CA  1 
ATOM   1924 C  C   . VAL B 1 35  ? 24.745  21.681  34.728  1.00 3.36  ? 35  VAL B C   1 
ATOM   1925 O  O   . VAL B 1 35  ? 25.157  22.473  35.576  1.00 4.10  ? 35  VAL B O   1 
ATOM   1926 C  CB  . VAL B 1 35  ? 22.329  21.497  34.046  1.00 3.32  ? 35  VAL B CB  1 
ATOM   1927 C  CG1 . VAL B 1 35  ? 21.997  21.711  35.509  1.00 2.92  ? 35  VAL B CG1 1 
ATOM   1928 C  CG2 . VAL B 1 35  ? 21.253  22.108  33.184  1.00 3.06  ? 35  VAL B CG2 1 
ATOM   1929 N  N   . ASN B 1 36  ? 25.166  20.423  34.642  1.00 3.09  ? 36  ASN B N   1 
ATOM   1930 C  CA  . ASN B 1 36  ? 26.121  19.879  35.592  1.00 2.88  ? 36  ASN B CA  1 
ATOM   1931 C  C   . ASN B 1 36  ? 27.400  20.690  35.600  1.00 3.64  ? 36  ASN B C   1 
ATOM   1932 O  O   . ASN B 1 36  ? 27.910  21.059  36.665  1.00 3.71  ? 36  ASN B O   1 
ATOM   1933 C  CB  . ASN B 1 36  ? 26.455  18.412  35.289  1.00 2.95  ? 36  ASN B CB  1 
ATOM   1934 C  CG  . ASN B 1 36  ? 25.321  17.471  35.633  1.00 2.69  ? 36  ASN B CG  1 
ATOM   1935 O  OD1 . ASN B 1 36  ? 24.421  17.821  36.404  1.00 3.32  ? 36  ASN B OD1 1 
ATOM   1936 N  ND2 . ASN B 1 36  ? 25.358  16.275  35.075  1.00 3.38  ? 36  ASN B ND2 1 
ATOM   1937 N  N   . ASN B 1 37  ? 27.932  20.950  34.413  1.00 3.25  ? 37  ASN B N   1 
ATOM   1938 C  CA  . ASN B 1 37  ? 29.242  21.600  34.330  1.00 3.48  ? 37  ASN B CA  1 
ATOM   1939 C  C   . ASN B 1 37  ? 29.197  23.094  34.712  1.00 3.58  ? 37  ASN B C   1 
ATOM   1940 O  O   . ASN B 1 37  ? 30.154  23.618  35.293  1.00 4.15  ? 37  ASN B O   1 
ATOM   1941 C  CB  . ASN B 1 37  ? 29.935  21.324  32.985  1.00 2.96  ? 37  ASN B CB  1 
ATOM   1942 C  CG  . ASN B 1 37  ? 30.469  19.891  32.886  1.00 3.24  ? 37  ASN B CG  1 
ATOM   1943 O  OD1 . ASN B 1 37  ? 30.734  19.231  33.897  1.00 3.67  ? 37  ASN B OD1 1 
ATOM   1944 N  ND2 . ASN B 1 37  ? 30.621  19.406  31.662  1.00 2.01  ? 37  ASN B ND2 1 
ATOM   1945 N  N   . ALA B 1 38  ? 28.078  23.765  34.449  1.00 4.05  ? 38  ALA B N   1 
ATOM   1946 C  CA  . ALA B 1 38  ? 27.902  25.139  34.917  1.00 3.55  ? 38  ALA B CA  1 
ATOM   1947 C  C   . ALA B 1 38  ? 27.766  25.130  36.430  1.00 3.53  ? 38  ALA B C   1 
ATOM   1948 O  O   . ALA B 1 38  ? 28.389  25.933  37.115  1.00 4.30  ? 38  ALA B O   1 
ATOM   1949 C  CB  . ALA B 1 38  ? 26.678  25.793  34.292  1.00 3.43  ? 38  ALA B CB  1 
ATOM   1950 N  N   . ASN B 1 39  ? 26.918  24.245  36.940  1.00 2.97  ? 39  ASN B N   1 
ATOM   1951 C  CA  . ASN B 1 39  ? 26.756  24.093  38.395  1.00 3.11  ? 39  ASN B CA  1 
ATOM   1952 C  C   . ASN B 1 39  ? 28.068  23.812  39.136  1.00 3.69  ? 39  ASN B C   1 
ATOM   1953 O  O   . ASN B 1 39  ? 28.355  24.445  40.158  1.00 4.62  ? 39  ASN B O   1 
ATOM   1954 C  CB  . ASN B 1 39  ? 25.701  23.019  38.698  1.00 2.93  ? 39  ASN B CB  1 
ATOM   1955 C  CG  . ASN B 1 39  ? 24.273  23.575  38.668  1.00 2.02  ? 39  ASN B CG  1 
ATOM   1956 O  OD1 . ASN B 1 39  ? 24.065  24.764  38.839  1.00 2.94  ? 39  ASN B OD1 1 
ATOM   1957 N  ND2 . ASN B 1 39  ? 23.291  22.695  38.509  1.00 1.95  ? 39  ASN B ND2 1 
ATOM   1958 N  N   . ALA B 1 40  ? 28.870  22.876  38.631  1.00 3.83  ? 40  ALA B N   1 
ATOM   1959 C  CA  . ALA B 1 40  ? 30.157  22.560  39.252  1.00 4.27  ? 40  ALA B CA  1 
ATOM   1960 C  C   . ALA B 1 40  ? 31.043  23.809  39.297  1.00 4.34  ? 40  ALA B C   1 
ATOM   1961 O  O   . ALA B 1 40  ? 31.691  24.073  40.311  1.00 5.05  ? 40  ALA B O   1 
ATOM   1962 C  CB  . ALA B 1 40  ? 30.856  21.447  38.495  1.00 4.10  ? 40  ALA B CB  1 
ATOM   1963 N  N   . ALA B 1 41  ? 31.077  24.555  38.195  1.00 4.92  ? 41  ALA B N   1 
ATOM   1964 C  CA  . ALA B 1 41  ? 31.901  25.764  38.094  1.00 4.94  ? 41  ALA B CA  1 
ATOM   1965 C  C   . ALA B 1 41  ? 31.377  26.903  38.955  1.00 5.89  ? 41  ALA B C   1 
ATOM   1966 O  O   . ALA B 1 41  ? 32.095  27.854  39.224  1.00 6.45  ? 41  ALA B O   1 
ATOM   1967 C  CB  . ALA B 1 41  ? 32.007  26.234  36.624  1.00 5.67  ? 41  ALA B CB  1 
ATOM   1968 N  N   . LEU B 1 42  ? 30.113  26.831  39.349  1.00 5.90  ? 42  LEU B N   1 
ATOM   1969 C  CA  . LEU B 1 42  ? 29.534  27.953  40.079  1.00 6.07  ? 42  LEU B CA  1 
ATOM   1970 C  C   . LEU B 1 42  ? 29.618  27.722  41.582  1.00 6.57  ? 42  LEU B C   1 
ATOM   1971 O  O   . LEU B 1 42  ? 29.260  28.578  42.372  1.00 7.00  ? 42  LEU B O   1 
ATOM   1972 C  CB  . LEU B 1 42  ? 28.086  28.154  39.659  1.00 5.68  ? 42  LEU B CB  1 
ATOM   1973 C  CG  . LEU B 1 42  ? 27.908  28.937  38.356  1.00 5.01  ? 42  LEU B CG  1 
ATOM   1974 C  CD1 . LEU B 1 42  ? 26.460  28.841  37.884  1.00 4.30  ? 42  LEU B CD1 1 
ATOM   1975 C  CD2 . LEU B 1 42  ? 28.340  30.388  38.558  1.00 6.83  ? 42  LEU B CD2 1 
ATOM   1976 N  N   . GLU B 1 43  ? 30.075  26.548  41.974  1.00 7.72  ? 43  GLU B N   1 
ATOM   1977 C  CA  . GLU B 1 43  ? 30.085  26.186  43.379  1.00 8.22  ? 43  GLU B CA  1 
ATOM   1978 C  C   . GLU B 1 43  ? 30.950  27.118  44.211  1.00 8.52  ? 43  GLU B C   1 
ATOM   1979 O  O   . GLU B 1 43  ? 30.620  27.406  45.354  1.00 8.61  ? 43  GLU B O   1 
ATOM   1980 C  CB  . GLU B 1 43  ? 30.522  24.726  43.545  1.00 8.75  ? 43  GLU B CB  1 
ATOM   1981 C  CG  . GLU B 1 43  ? 29.883  24.045  44.722  1.00 11.66 ? 43  GLU B CG  1 
ATOM   1982 C  CD  . GLU B 1 43  ? 30.840  23.804  45.872  1.00 14.27 ? 43  GLU B CD  1 
ATOM   1983 O  OE1 . GLU B 1 43  ? 31.906  24.474  45.924  1.00 17.10 ? 43  GLU B OE1 1 
ATOM   1984 O  OE2 . GLU B 1 43  ? 30.513  22.950  46.732  1.00 14.14 ? 43  GLU B OE2 1 
ATOM   1985 N  N   . SER B 1 44  ? 32.028  27.627  43.625  1.00 8.05  ? 44  SER B N   1 
ATOM   1986 C  CA  . SER B 1 44  ? 32.915  28.540  44.359  1.00 8.44  ? 44  SER B CA  1 
ATOM   1987 C  C   . SER B 1 44  ? 32.581  30.007  44.089  1.00 8.32  ? 44  SER B C   1 
ATOM   1988 O  O   . SER B 1 44  ? 33.353  30.905  44.462  1.00 9.13  ? 44  SER B O   1 
ATOM   1989 C  CB  . SER B 1 44  ? 34.364  28.272  43.976  1.00 8.57  ? 44  SER B CB  1 
ATOM   1990 O  OG  . SER B 1 44  ? 34.636  28.798  42.693  1.00 9.58  ? 44  SER B OG  1 
ATOM   1991 N  N   . LEU B 1 45  ? 31.441  30.256  43.440  1.00 8.54  ? 45  LEU B N   1 
ATOM   1992 C  CA  . LEU B 1 45  ? 31.034  31.613  43.062  1.00 8.65  ? 45  LEU B CA  1 
ATOM   1993 C  C   . LEU B 1 45  ? 29.612  31.963  43.527  1.00 8.57  ? 45  LEU B C   1 
ATOM   1994 O  O   . LEU B 1 45  ? 28.753  32.333  42.714  1.00 9.25  ? 45  LEU B O   1 
ATOM   1995 C  CB  . LEU B 1 45  ? 31.172  31.798  41.540  1.00 9.29  ? 45  LEU B CB  1 
ATOM   1996 C  CG  . LEU B 1 45  ? 32.557  31.482  40.951  1.00 9.31  ? 45  LEU B CG  1 
ATOM   1997 C  CD1 . LEU B 1 45  ? 32.515  31.351  39.432  1.00 9.59  ? 45  LEU B CD1 1 
ATOM   1998 C  CD2 . LEU B 1 45  ? 33.533  32.563  41.362  1.00 10.26 ? 45  LEU B CD2 1 
ATOM   1999 N  N   . PRO B 1 46  ? 29.344  31.839  44.835  1.00 8.76  ? 46  PRO B N   1 
ATOM   2000 C  CA  . PRO B 1 46  ? 27.985  32.103  45.300  1.00 8.90  ? 46  PRO B CA  1 
ATOM   2001 C  C   . PRO B 1 46  ? 27.543  33.516  44.890  1.00 9.69  ? 46  PRO B C   1 
ATOM   2002 O  O   . PRO B 1 46  ? 26.347  33.805  44.831  1.00 10.48 ? 46  PRO B O   1 
ATOM   2003 C  CB  . PRO B 1 46  ? 28.104  31.955  46.821  1.00 9.09  ? 46  PRO B CB  1 
ATOM   2004 C  CG  . PRO B 1 46  ? 29.248  30.983  46.998  1.00 9.09  ? 46  PRO B CG  1 
ATOM   2005 C  CD  . PRO B 1 46  ? 30.228  31.395  45.926  1.00 8.63  ? 46  PRO B CD  1 
ATOM   2006 N  N   . GLU B 1 47  ? 28.522  34.364  44.593  1.00 10.64 ? 47  GLU B N   1 
ATOM   2007 C  CA  . GLU B 1 47  ? 28.308  35.707  44.064  1.00 10.35 ? 47  GLU B CA  1 
ATOM   2008 C  C   . GLU B 1 47  ? 27.512  35.679  42.744  1.00 10.06 ? 47  GLU B C   1 
ATOM   2009 O  O   . GLU B 1 47  ? 26.721  36.581  42.453  1.00 10.20 ? 47  GLU B O   1 
ATOM   2010 C  CB  . GLU B 1 47  ? 29.686  36.339  43.881  1.00 11.49 ? 47  GLU B CB  1 
ATOM   2011 C  CG  . GLU B 1 47  ? 30.782  35.273  44.051  1.00 12.49 ? 47  GLU B CG  1 
ATOM   2012 C  CD  . GLU B 1 47  ? 32.192  35.821  44.172  1.00 15.50 ? 47  GLU B CD  1 
ATOM   2013 O  OE1 . GLU B 1 47  ? 32.721  36.291  43.143  1.00 15.35 ? 47  GLU B OE1 1 
ATOM   2014 O  OE2 . GLU B 1 47  ? 32.780  35.742  45.285  1.00 17.02 ? 47  GLU B OE2 1 
ATOM   2015 N  N   . PHE B 1 48  ? 27.683  34.609  41.977  1.00 8.67  ? 48  PHE B N   1 
ATOM   2016 C  CA  . PHE B 1 48  ? 27.101  34.530  40.638  1.00 8.16  ? 48  PHE B CA  1 
ATOM   2017 C  C   . PHE B 1 48  ? 26.063  33.415  40.514  1.00 8.29  ? 48  PHE B C   1 
ATOM   2018 O  O   . PHE B 1 48  ? 25.240  33.443  39.599  1.00 7.77  ? 48  PHE B O   1 
ATOM   2019 C  CB  . PHE B 1 48  ? 28.194  34.291  39.587  1.00 7.87  ? 48  PHE B CB  1 
ATOM   2020 C  CG  . PHE B 1 48  ? 29.108  35.458  39.363  1.00 8.72  ? 48  PHE B CG  1 
ATOM   2021 C  CD1 . PHE B 1 48  ? 28.859  36.373  38.355  1.00 9.09  ? 48  PHE B CD1 1 
ATOM   2022 C  CD2 . PHE B 1 48  ? 30.227  35.619  40.145  1.00 8.36  ? 48  PHE B CD2 1 
ATOM   2023 C  CE1 . PHE B 1 48  ? 29.718  37.441  38.136  1.00 9.84  ? 48  PHE B CE1 1 
ATOM   2024 C  CE2 . PHE B 1 48  ? 31.083  36.680  39.941  1.00 8.31  ? 48  PHE B CE2 1 
ATOM   2025 C  CZ  . PHE B 1 48  ? 30.837  37.584  38.938  1.00 8.69  ? 48  PHE B CZ  1 
ATOM   2026 N  N   . ALA B 1 49  ? 26.133  32.419  41.396  1.00 8.19  ? 49  ALA B N   1 
ATOM   2027 C  CA  . ALA B 1 49  ? 25.240  31.256  41.290  1.00 8.65  ? 49  ALA B CA  1 
ATOM   2028 C  C   . ALA B 1 49  ? 23.780  31.638  41.466  1.00 8.97  ? 49  ALA B C   1 
ATOM   2029 O  O   . ALA B 1 49  ? 22.899  30.894  41.045  1.00 10.18 ? 49  ALA B O   1 
ATOM   2030 C  CB  . ALA B 1 49  ? 25.632  30.146  42.290  1.00 8.87  ? 49  ALA B CB  1 
ATOM   2031 N  N   . ASN B 1 50  ? 23.533  32.798  42.075  1.00 9.86  ? 50  ASN B N   1 
ATOM   2032 C  CA  . ASN B 1 50  ? 22.170  33.268  42.379  1.00 10.45 ? 50  ASN B CA  1 
ATOM   2033 C  C   . ASN B 1 50  ? 21.430  33.814  41.161  1.00 9.98  ? 50  ASN B C   1 
ATOM   2034 O  O   . ASN B 1 50  ? 20.197  33.752  41.093  1.00 10.34 ? 50  ASN B O   1 
ATOM   2035 C  CB  . ASN B 1 50  ? 22.203  34.347  43.465  1.00 11.31 ? 50  ASN B CB  1 
ATOM   2036 C  CG  . ASN B 1 50  ? 22.095  33.778  44.866  1.00 13.28 ? 50  ASN B CG  1 
ATOM   2037 O  OD1 . ASN B 1 50  ? 22.614  32.701  45.154  1.00 15.99 ? 50  ASN B OD1 1 
ATOM   2038 N  ND2 . ASN B 1 50  ? 21.430  34.521  45.758  1.00 15.49 ? 50  ASN B ND2 1 
ATOM   2039 N  N   . LEU B 1 51  ? 22.179  34.348  40.199  1.00 9.30  ? 51  LEU B N   1 
ATOM   2040 C  CA  . LEU B 1 51  ? 21.582  34.942  39.007  1.00 8.75  ? 51  LEU B CA  1 
ATOM   2041 C  C   . LEU B 1 51  ? 20.876  33.893  38.167  1.00 8.18  ? 51  LEU B C   1 
ATOM   2042 O  O   . LEU B 1 51  ? 21.318  32.746  38.099  1.00 9.11  ? 51  LEU B O   1 
ATOM   2043 C  CB  . LEU B 1 51  ? 22.647  35.611  38.132  1.00 8.50  ? 51  LEU B CB  1 
ATOM   2044 C  CG  . LEU B 1 51  ? 23.469  36.748  38.735  1.00 9.07  ? 51  LEU B CG  1 
ATOM   2045 C  CD1 . LEU B 1 51  ? 24.586  37.172  37.783  1.00 10.52 ? 51  LEU B CD1 1 
ATOM   2046 C  CD2 . LEU B 1 51  ? 22.576  37.918  39.065  1.00 10.67 ? 51  LEU B CD2 1 
ATOM   2047 N  N   . PRO B 1 52  ? 19.777  34.285  37.516  1.00 8.04  ? 52  PRO B N   1 
ATOM   2048 C  CA  . PRO B 1 52  ? 19.273  33.506  36.390  1.00 7.31  ? 52  PRO B CA  1 
ATOM   2049 C  C   . PRO B 1 52  ? 20.373  33.275  35.350  1.00 6.90  ? 52  PRO B C   1 
ATOM   2050 O  O   . PRO B 1 52  ? 21.165  34.168  35.067  1.00 6.08  ? 52  PRO B O   1 
ATOM   2051 C  CB  . PRO B 1 52  ? 18.187  34.416  35.808  1.00 7.40  ? 52  PRO B CB  1 
ATOM   2052 C  CG  . PRO B 1 52  ? 17.696  35.216  37.017  1.00 8.05  ? 52  PRO B CG  1 
ATOM   2053 C  CD  . PRO B 1 52  ? 18.986  35.505  37.746  1.00 7.76  ? 52  PRO B CD  1 
ATOM   2054 N  N   . VAL B 1 53  ? 20.419  32.074  34.787  1.00 6.34  ? 53  VAL B N   1 
ATOM   2055 C  CA  . VAL B 1 53  ? 21.422  31.763  33.775  1.00 6.63  ? 53  VAL B CA  1 
ATOM   2056 C  C   . VAL B 1 53  ? 21.479  32.825  32.663  1.00 6.60  ? 53  VAL B C   1 
ATOM   2057 O  O   . VAL B 1 53  ? 22.579  33.194  32.207  1.00 6.39  ? 53  VAL B O   1 
ATOM   2058 C  CB  . VAL B 1 53  ? 21.197  30.350  33.204  1.00 6.42  ? 53  VAL B CB  1 
ATOM   2059 C  CG1 . VAL B 1 53  ? 19.897  30.303  32.404  1.00 7.39  ? 53  VAL B CG1 1 
ATOM   2060 C  CG2 . VAL B 1 53  ? 22.385  29.932  32.346  1.00 5.31  ? 53  VAL B CG2 1 
ATOM   2061 N  N   . GLU B 1 54  ? 20.320  33.338  32.231  1.00 6.68  ? 54  GLU B N   1 
ATOM   2062 C  CA  . GLU B 1 54  ? 20.309  34.342  31.152  1.00 6.95  ? 54  GLU B CA  1 
ATOM   2063 C  C   . GLU B 1 54  ? 20.947  35.674  31.546  1.00 6.99  ? 54  GLU B C   1 
ATOM   2064 O  O   . GLU B 1 54  ? 21.395  36.423  30.685  1.00 6.86  ? 54  GLU B O   1 
ATOM   2065 C  CB  . GLU B 1 54  ? 18.898  34.581  30.589  1.00 7.72  ? 54  GLU B CB  1 
ATOM   2066 C  CG  . GLU B 1 54  ? 18.217  33.328  30.046  1.00 8.58  ? 54  GLU B CG  1 
ATOM   2067 C  CD  . GLU B 1 54  ? 17.600  32.466  31.130  1.00 9.56  ? 54  GLU B CD  1 
ATOM   2068 O  OE1 . GLU B 1 54  ? 17.628  32.862  32.331  1.00 9.42  ? 54  GLU B OE1 1 
ATOM   2069 O  OE2 . GLU B 1 54  ? 17.050  31.402  30.768  1.00 10.08 ? 54  GLU B OE2 1 
ATOM   2070 N  N   . GLU B 1 55  ? 20.965  35.969  32.839  1.00 6.66  ? 55  GLU B N   1 
ATOM   2071 C  CA  . GLU B 1 55  ? 21.682  37.150  33.343  1.00 6.50  ? 55  GLU B CA  1 
ATOM   2072 C  C   . GLU B 1 55  ? 23.188  36.844  33.492  1.00 6.25  ? 55  GLU B C   1 
ATOM   2073 O  O   . GLU B 1 55  ? 24.052  37.665  33.160  1.00 6.44  ? 55  GLU B O   1 
ATOM   2074 C  CB  . GLU B 1 55  ? 21.078  37.625  34.676  1.00 6.83  ? 55  GLU B CB  1 
ATOM   2075 C  CG  . GLU B 1 55  ? 21.871  38.756  35.336  1.00 8.59  ? 55  GLU B CG  1 
ATOM   2076 C  CD  . GLU B 1 55  ? 21.352  39.131  36.718  1.00 10.96 ? 55  GLU B CD  1 
ATOM   2077 O  OE1 . GLU B 1 55  ? 20.139  38.976  36.972  1.00 12.37 ? 55  GLU B OE1 1 
ATOM   2078 O  OE2 . GLU B 1 55  ? 22.162  39.568  37.564  1.00 14.86 ? 55  GLU B OE2 1 
ATOM   2079 N  N   . LEU B 1 56  ? 23.500  35.637  33.954  1.00 5.91  ? 56  LEU B N   1 
ATOM   2080 C  CA  . LEU B 1 56  ? 24.886  35.222  34.118  1.00 6.25  ? 56  LEU B CA  1 
ATOM   2081 C  C   . LEU B 1 56  ? 25.730  35.312  32.842  1.00 5.97  ? 56  LEU B C   1 
ATOM   2082 O  O   . LEU B 1 56  ? 26.872  35.791  32.873  1.00 6.78  ? 56  LEU B O   1 
ATOM   2083 C  CB  . LEU B 1 56  ? 24.968  33.810  34.687  1.00 5.56  ? 56  LEU B CB  1 
ATOM   2084 C  CG  . LEU B 1 56  ? 26.429  33.379  34.785  1.00 7.77  ? 56  LEU B CG  1 
ATOM   2085 C  CD1 . LEU B 1 56  ? 27.131  34.463  35.570  1.00 7.31  ? 56  LEU B CD1 1 
ATOM   2086 C  CD2 . LEU B 1 56  ? 26.566  32.050  35.464  1.00 8.37  ? 56  LEU B CD2 1 
ATOM   2087 N  N   . ILE B 1 57  ? 25.175  34.876  31.712  1.00 6.76  ? 57  ILE B N   1 
ATOM   2088 C  CA  . ILE B 1 57  ? 25.934  34.927  30.470  1.00 6.24  ? 57  ILE B CA  1 
ATOM   2089 C  C   . ILE B 1 57  ? 26.032  36.341  29.892  1.00 6.36  ? 57  ILE B C   1 
ATOM   2090 O  O   . ILE B 1 57  ? 26.702  36.547  28.876  1.00 6.16  ? 57  ILE B O   1 
ATOM   2091 C  CB  . ILE B 1 57  ? 25.390  33.984  29.388  1.00 6.35  ? 57  ILE B CB  1 
ATOM   2092 C  CG1 . ILE B 1 57  ? 24.019  34.445  28.899  1.00 6.66  ? 57  ILE B CG1 1 
ATOM   2093 C  CG2 . ILE B 1 57  ? 25.280  32.562  29.895  1.00 5.46  ? 57  ILE B CG2 1 
ATOM   2094 C  CD1 . ILE B 1 57  ? 23.454  33.510  27.853  1.00 7.46  ? 57  ILE B CD1 1 
ATOM   2095 N  N   . THR B 1 58  ? 25.368  37.312  30.527  1.00 6.86  ? 58  THR B N   1 
ATOM   2096 C  CA  . THR B 1 58  ? 25.641  38.715  30.205  1.00 7.57  ? 58  THR B CA  1 
ATOM   2097 C  C   . THR B 1 58  ? 26.813  39.266  31.013  1.00 8.04  ? 58  THR B C   1 
ATOM   2098 O  O   . THR B 1 58  ? 27.289  40.367  30.730  1.00 8.58  ? 58  THR B O   1 
ATOM   2099 C  CB  . THR B 1 58  ? 24.436  39.679  30.446  1.00 7.61  ? 58  THR B CB  1 
ATOM   2100 O  OG1 . THR B 1 58  ? 24.151  39.786  31.851  1.00 8.49  ? 58  THR B OG1 1 
ATOM   2101 C  CG2 . THR B 1 58  ? 23.175  39.266  29.673  1.00 7.55  ? 58  THR B CG2 1 
ATOM   2102 N  N   . LYS B 1 59  ? 27.250  38.528  32.027  1.00 8.02  ? 59  LYS B N   1 
ATOM   2103 C  CA  . LYS B 1 59  ? 28.280  39.010  32.957  1.00 8.09  ? 59  LYS B CA  1 
ATOM   2104 C  C   . LYS B 1 59  ? 29.590  38.222  32.853  1.00 7.81  ? 59  LYS B C   1 
ATOM   2105 O  O   . LYS B 1 59  ? 30.370  38.170  33.796  1.00 6.94  ? 59  LYS B O   1 
ATOM   2106 C  CB  . LYS B 1 59  ? 27.768  38.952  34.409  1.00 8.50  ? 59  LYS B CB  1 
ATOM   2107 C  CG  . LYS B 1 59  ? 26.591  39.875  34.730  1.00 9.26  ? 59  LYS B CG  1 
ATOM   2108 C  CD  . LYS B 1 59  ? 26.245  39.848  36.232  1.00 10.25 ? 59  LYS B CD  1 
ATOM   2109 C  CE  . LYS B 1 59  ? 27.381  40.428  37.077  1.00 12.12 ? 59  LYS B CE  1 
ATOM   2110 N  NZ  . LYS B 1 59  ? 27.099  40.514  38.555  1.00 13.46 ? 59  LYS B NZ  1 
ATOM   2111 N  N   . LEU B 1 60  ? 29.832  37.583  31.719  1.00 7.45  ? 60  LEU B N   1 
ATOM   2112 C  CA  . LEU B 1 60  ? 30.972  36.675  31.649  1.00 7.08  ? 60  LEU B CA  1 
ATOM   2113 C  C   . LEU B 1 60  ? 32.311  37.379  31.912  1.00 7.92  ? 60  LEU B C   1 
ATOM   2114 O  O   . LEU B 1 60  ? 33.243  36.795  32.489  1.00 8.65  ? 60  LEU B O   1 
ATOM   2115 C  CB  . LEU B 1 60  ? 31.002  35.960  30.307  1.00 6.54  ? 60  LEU B CB  1 
ATOM   2116 C  CG  . LEU B 1 60  ? 29.789  35.069  30.081  1.00 5.48  ? 60  LEU B CG  1 
ATOM   2117 C  CD1 . LEU B 1 60  ? 29.875  34.466  28.680  1.00 6.44  ? 60  LEU B CD1 1 
ATOM   2118 C  CD2 . LEU B 1 60  ? 29.742  33.995  31.142  1.00 5.98  ? 60  LEU B CD2 1 
ATOM   2119 N  N   . ASP B 1 61  ? 32.391  38.638  31.514  1.00 7.95  ? 61  ASP B N   1 
ATOM   2120 C  CA  . ASP B 1 61  ? 33.620  39.403  31.700  1.00 9.64  ? 61  ASP B CA  1 
ATOM   2121 C  C   . ASP B 1 61  ? 33.865  39.810  33.146  1.00 9.11  ? 61  ASP B C   1 
ATOM   2122 O  O   . ASP B 1 61  ? 34.914  40.370  33.438  1.00 9.54  ? 61  ASP B O   1 
ATOM   2123 C  CB  . ASP B 1 61  ? 33.647  40.645  30.803  1.00 10.82 ? 61  ASP B CB  1 
ATOM   2124 C  CG  . ASP B 1 61  ? 34.565  41.736  31.351  1.00 13.68 ? 61  ASP B CG  1 
ATOM   2125 O  OD1 . ASP B 1 61  ? 34.460  42.035  32.561  1.00 17.56 ? 61  ASP B OD1 1 
ATOM   2126 O  OD2 . ASP B 1 61  ? 35.386  42.300  30.586  1.00 17.14 ? 61  ASP B OD2 1 
ATOM   2127 N  N   . GLN B 1 62  ? 32.907  39.553  34.037  1.00 9.41  ? 62  GLN B N   1 
ATOM   2128 C  CA  . GLN B 1 62  ? 33.085  39.853  35.470  1.00 9.26  ? 62  GLN B CA  1 
ATOM   2129 C  C   . GLN B 1 62  ? 33.528  38.616  36.278  1.00 9.17  ? 62  GLN B C   1 
ATOM   2130 O  O   . GLN B 1 62  ? 33.828  38.727  37.461  1.00 9.65  ? 62  GLN B O   1 
ATOM   2131 C  CB  . GLN B 1 62  ? 31.820  40.453  36.095  1.00 9.64  ? 62  GLN B CB  1 
ATOM   2132 C  CG  . GLN B 1 62  ? 31.039  41.437  35.244  1.00 11.24 ? 62  GLN B CG  1 
ATOM   2133 C  CD  . GLN B 1 62  ? 29.805  41.903  35.979  1.00 14.21 ? 62  GLN B CD  1 
ATOM   2134 O  OE1 . GLN B 1 62  ? 28.989  42.671  35.457  1.00 16.61 ? 62  GLN B OE1 1 
ATOM   2135 N  NE2 . GLN B 1 62  ? 29.661  41.437  37.219  1.00 14.55 ? 62  GLN B NE2 1 
ATOM   2136 N  N   . LEU B 1 63  ? 33.559  37.445  35.638  1.00 8.81  ? 63  LEU B N   1 
ATOM   2137 C  CA  . LEU B 1 63  ? 34.070  36.212  36.248  1.00 8.15  ? 63  LEU B CA  1 
ATOM   2138 C  C   . LEU B 1 63  ? 35.590  36.228  36.420  1.00 8.12  ? 63  LEU B C   1 
ATOM   2139 O  O   . LEU B 1 63  ? 36.270  36.960  35.723  1.00 8.64  ? 63  LEU B O   1 
ATOM   2140 C  CB  . LEU B 1 63  ? 33.738  35.026  35.349  1.00 7.76  ? 63  LEU B CB  1 
ATOM   2141 C  CG  . LEU B 1 63  ? 32.251  34.807  35.172  1.00 6.39  ? 63  LEU B CG  1 
ATOM   2142 C  CD1 . LEU B 1 63  ? 31.982  33.914  33.952  1.00 6.12  ? 63  LEU B CD1 1 
ATOM   2143 C  CD2 . LEU B 1 63  ? 31.732  34.186  36.441  1.00 7.39  ? 63  LEU B CD2 1 
ATOM   2144 N  N   . PRO B 1 64  ? 36.122  35.387  37.324  1.00 8.45  ? 64  PRO B N   1 
ATOM   2145 C  CA  . PRO B 1 64  ? 37.575  35.226  37.539  1.00 8.82  ? 64  PRO B CA  1 
ATOM   2146 C  C   . PRO B 1 64  ? 38.397  34.418  36.516  1.00 9.72  ? 64  PRO B C   1 
ATOM   2147 O  O   . PRO B 1 64  ? 38.713  33.241  36.763  1.00 10.82 ? 64  PRO B O   1 
ATOM   2148 C  CB  . PRO B 1 64  ? 37.657  34.517  38.895  1.00 9.06  ? 64  PRO B CB  1 
ATOM   2149 C  CG  . PRO B 1 64  ? 36.292  34.545  39.478  1.00 8.24  ? 64  PRO B CG  1 
ATOM   2150 C  CD  . PRO B 1 64  ? 35.334  34.678  38.347  1.00 8.57  ? 64  PRO B CD  1 
ATOM   2151 N  N   . ALA B 1 65  ? 38.826  35.070  35.434  1.00 9.14  ? 65  ALA B N   1 
ATOM   2152 C  CA  . ALA B 1 65  ? 39.690  34.464  34.411  1.00 8.80  ? 65  ALA B CA  1 
ATOM   2153 C  C   . ALA B 1 65  ? 39.559  32.951  34.201  1.00 8.22  ? 65  ALA B C   1 
ATOM   2154 O  O   . ALA B 1 65  ? 39.225  32.514  33.101  1.00 8.88  ? 65  ALA B O   1 
ATOM   2155 C  CB  . ALA B 1 65  ? 41.147  34.831  34.665  1.00 8.59  ? 65  ALA B CB  1 
ATOM   2156 N  N   . ASP B 1 66  ? 39.852  32.154  35.228  1.00 8.47  ? 66  ASP B N   1 
ATOM   2157 C  CA  . ASP B 1 66  ? 39.825  30.707  35.052  1.00 8.69  ? 66  ASP B CA  1 
ATOM   2158 C  C   . ASP B 1 66  ? 38.390  30.131  35.037  1.00 8.54  ? 66  ASP B C   1 
ATOM   2159 O  O   . ASP B 1 66  ? 38.194  28.922  34.936  1.00 8.74  ? 66  ASP B O   1 
ATOM   2160 C  CB  . ASP B 1 66  ? 40.780  29.979  36.027  1.00 9.08  ? 66  ASP B CB  1 
ATOM   2161 C  CG  . ASP B 1 66  ? 40.361  30.096  37.493  1.00 10.35 ? 66  ASP B CG  1 
ATOM   2162 O  OD1 . ASP B 1 66  ? 39.354  30.766  37.788  1.00 10.84 ? 66  ASP B OD1 1 
ATOM   2163 O  OD2 . ASP B 1 66  ? 41.058  29.516  38.367  1.00 12.65 ? 66  ASP B OD2 1 
ATOM   2164 N  N   . LYS B 1 67  ? 37.401  31.011  35.110  1.00 8.31  ? 67  LYS B N   1 
ATOM   2165 C  CA  . LYS B 1 67  ? 36.004  30.601  35.090  1.00 7.58  ? 67  LYS B CA  1 
ATOM   2166 C  C   . LYS B 1 67  ? 35.288  30.954  33.788  1.00 6.94  ? 67  LYS B C   1 
ATOM   2167 O  O   . LYS B 1 67  ? 34.191  30.462  33.541  1.00 7.12  ? 67  LYS B O   1 
ATOM   2168 C  CB  . LYS B 1 67  ? 35.239  31.298  36.220  1.00 7.19  ? 67  LYS B CB  1 
ATOM   2169 C  CG  . LYS B 1 67  ? 35.738  30.984  37.593  1.00 7.56  ? 67  LYS B CG  1 
ATOM   2170 C  CD  . LYS B 1 67  ? 35.498  29.520  37.889  1.00 6.75  ? 67  LYS B CD  1 
ATOM   2171 C  CE  . LYS B 1 67  ? 35.580  29.228  39.370  1.00 7.37  ? 67  LYS B CE  1 
ATOM   2172 N  NZ  . LYS B 1 67  ? 34.849  27.975  39.666  1.00 6.93  ? 67  LYS B NZ  1 
ATOM   2173 N  N   . LYS B 1 68  ? 35.866  31.836  32.980  1.00 6.70  ? 68  LYS B N   1 
ATOM   2174 C  CA  . LYS B 1 68  ? 35.107  32.476  31.903  1.00 6.05  ? 68  LYS B CA  1 
ATOM   2175 C  C   . LYS B 1 68  ? 34.720  31.499  30.791  1.00 6.08  ? 68  LYS B C   1 
ATOM   2176 O  O   . LYS B 1 68  ? 33.593  31.514  30.321  1.00 6.35  ? 68  LYS B O   1 
ATOM   2177 C  CB  . LYS B 1 68  ? 35.886  33.671  31.327  1.00 6.62  ? 68  LYS B CB  1 
ATOM   2178 C  CG  . LYS B 1 68  ? 35.264  34.324  30.095  1.00 8.41  ? 68  LYS B CG  1 
ATOM   2179 C  CD  . LYS B 1 68  ? 36.092  35.552  29.721  1.00 9.25  ? 68  LYS B CD  1 
ATOM   2180 C  CE  . LYS B 1 68  ? 35.685  36.206  28.404  1.00 10.30 ? 68  LYS B CE  1 
ATOM   2181 N  NZ  . LYS B 1 68  ? 36.624  35.885  27.276  1.00 12.77 ? 68  LYS B NZ  1 
ATOM   2182 N  N   . THR B 1 69  ? 35.670  30.676  30.367  1.00 5.09  ? 69  THR B N   1 
ATOM   2183 C  CA  . THR B 1 69  ? 35.424  29.728  29.275  1.00 5.41  ? 69  THR B CA  1 
ATOM   2184 C  C   . THR B 1 69  ? 34.441  28.641  29.697  1.00 5.35  ? 69  THR B C   1 
ATOM   2185 O  O   . THR B 1 69  ? 33.457  28.390  28.988  1.00 4.71  ? 69  THR B O   1 
ATOM   2186 C  CB  . THR B 1 69  ? 36.732  29.098  28.747  1.00 5.65  ? 69  THR B CB  1 
ATOM   2187 O  OG1 . THR B 1 69  ? 37.536  30.122  28.162  1.00 7.08  ? 69  THR B OG1 1 
ATOM   2188 C  CG2 . THR B 1 69  ? 36.434  28.044  27.653  1.00 3.71  ? 69  THR B CG2 1 
ATOM   2189 N  N   . VAL B 1 70  ? 34.710  27.986  30.834  1.00 4.71  ? 70  VAL B N   1 
ATOM   2190 C  CA  . VAL B 1 70  ? 33.810  26.936  31.344  1.00 5.10  ? 70  VAL B CA  1 
ATOM   2191 C  C   . VAL B 1 70  ? 32.345  27.412  31.481  1.00 4.77  ? 70  VAL B C   1 
ATOM   2192 O  O   . VAL B 1 70  ? 31.401  26.703  31.120  1.00 3.57  ? 70  VAL B O   1 
ATOM   2193 C  CB  . VAL B 1 70  ? 34.283  26.403  32.693  1.00 4.85  ? 70  VAL B CB  1 
ATOM   2194 C  CG1 . VAL B 1 70  ? 34.095  27.469  33.777  1.00 6.78  ? 70  VAL B CG1 1 
ATOM   2195 C  CG2 . VAL B 1 70  ? 33.504  25.135  33.046  1.00 4.37  ? 70  VAL B CG2 1 
ATOM   2196 N  N   . LEU B 1 71  ? 32.143  28.622  31.994  1.00 4.49  ? 71  LEU B N   1 
ATOM   2197 C  CA  . LEU B 1 71  ? 30.775  29.125  32.135  1.00 4.56  ? 71  LEU B CA  1 
ATOM   2198 C  C   . LEU B 1 71  ? 30.201  29.668  30.820  1.00 4.34  ? 71  LEU B C   1 
ATOM   2199 O  O   . LEU B 1 71  ? 29.023  29.467  30.537  1.00 3.25  ? 71  LEU B O   1 
ATOM   2200 C  CB  . LEU B 1 71  ? 30.627  30.094  33.328  1.00 4.38  ? 71  LEU B CB  1 
ATOM   2201 C  CG  . LEU B 1 71  ? 30.698  29.358  34.666  1.00 5.14  ? 71  LEU B CG  1 
ATOM   2202 C  CD1 . LEU B 1 71  ? 31.183  30.301  35.793  1.00 6.16  ? 71  LEU B CD1 1 
ATOM   2203 C  CD2 . LEU B 1 71  ? 29.351  28.691  35.010  1.00 5.68  ? 71  LEU B CD2 1 
ATOM   2204 N  N   . ARG B 1 72  ? 31.023  30.318  29.994  1.00 4.51  ? 72  ARG B N   1 
ATOM   2205 C  CA  . ARG B 1 72  ? 30.584  30.686  28.645  1.00 3.38  ? 72  ARG B CA  1 
ATOM   2206 C  C   . ARG B 1 72  ? 29.943  29.471  27.960  1.00 3.15  ? 72  ARG B C   1 
ATOM   2207 O  O   . ARG B 1 72  ? 28.800  29.530  27.472  1.00 2.53  ? 72  ARG B O   1 
ATOM   2208 C  CB  . ARG B 1 72  ? 31.777  31.172  27.813  1.00 4.02  ? 72  ARG B CB  1 
ATOM   2209 C  CG  . ARG B 1 72  ? 31.480  31.541  26.371  1.00 1.63  ? 72  ARG B CG  1 
ATOM   2210 C  CD  . ARG B 1 72  ? 32.785  31.970  25.669  1.00 3.26  ? 72  ARG B CD  1 
ATOM   2211 N  NE  . ARG B 1 72  ? 32.659  32.118  24.232  1.00 4.71  ? 72  ARG B NE  1 
ATOM   2212 C  CZ  . ARG B 1 72  ? 33.601  32.681  23.482  1.00 4.20  ? 72  ARG B CZ  1 
ATOM   2213 N  NH1 . ARG B 1 72  ? 34.685  33.182  24.074  1.00 5.87  ? 72  ARG B NH1 1 
ATOM   2214 N  NH2 . ARG B 1 72  ? 33.451  32.782  22.171  1.00 3.17  ? 72  ARG B NH2 1 
ATOM   2215 N  N   . ASN B 1 73  ? 30.682  28.371  27.969  1.00 2.28  ? 73  ASN B N   1 
ATOM   2216 C  CA  . ASN B 1 73  ? 30.297  27.174  27.227  1.00 2.39  ? 73  ASN B CA  1 
ATOM   2217 C  C   . ASN B 1 73  ? 29.086  26.516  27.866  1.00 2.54  ? 73  ASN B C   1 
ATOM   2218 O  O   . ASN B 1 73  ? 28.117  26.147  27.181  1.00 2.29  ? 73  ASN B O   1 
ATOM   2219 C  CB  . ASN B 1 73  ? 31.469  26.167  27.171  1.00 2.17  ? 73  ASN B CB  1 
ATOM   2220 C  CG  . ASN B 1 73  ? 32.580  26.592  26.216  1.00 2.39  ? 73  ASN B CG  1 
ATOM   2221 O  OD1 . ASN B 1 73  ? 32.400  27.484  25.387  1.00 3.01  ? 73  ASN B OD1 1 
ATOM   2222 N  ND2 . ASN B 1 73  ? 33.727  25.889  26.292  1.00 3.14  ? 73  ASN B ND2 1 
ATOM   2223 N  N   . ASN B 1 74  ? 29.131  26.380  29.186  1.00 2.18  ? 74  ASN B N   1 
ATOM   2224 C  CA  . ASN B 1 74  ? 28.087  25.607  29.885  1.00 2.48  ? 74  ASN B CA  1 
ATOM   2225 C  C   . ASN B 1 74  ? 26.863  26.379  30.366  1.00 3.17  ? 74  ASN B C   1 
ATOM   2226 O  O   . ASN B 1 74  ? 25.726  25.880  30.260  1.00 2.48  ? 74  ASN B O   1 
ATOM   2227 C  CB  . ASN B 1 74  ? 28.684  24.766  31.016  1.00 2.60  ? 74  ASN B CB  1 
ATOM   2228 C  CG  . ASN B 1 74  ? 29.608  23.704  30.492  1.00 2.95  ? 74  ASN B CG  1 
ATOM   2229 O  OD1 . ASN B 1 74  ? 29.175  22.705  29.910  1.00 3.32  ? 74  ASN B OD1 1 
ATOM   2230 N  ND2 . ASN B 1 74  ? 30.900  23.939  30.640  1.00 3.03  ? 74  ASN B ND2 1 
ATOM   2231 N  N   . ALA B 1 75  ? 27.077  27.586  30.881  1.00 2.92  ? 75  ALA B N   1 
ATOM   2232 C  CA  . ALA B 1 75  ? 25.939  28.457  31.118  1.00 2.80  ? 75  ALA B CA  1 
ATOM   2233 C  C   . ALA B 1 75  ? 25.307  28.869  29.790  1.00 2.91  ? 75  ALA B C   1 
ATOM   2234 O  O   . ALA B 1 75  ? 24.096  28.984  29.689  1.00 2.23  ? 75  ALA B O   1 
ATOM   2235 C  CB  . ALA B 1 75  ? 26.343  29.700  31.937  1.00 2.51  ? 75  ALA B CB  1 
ATOM   2236 N  N   . GLY B 1 76  ? 26.131  29.102  28.768  1.00 2.72  ? 76  GLY B N   1 
ATOM   2237 C  CA  . GLY B 1 76  ? 25.594  29.306  27.422  1.00 2.58  ? 76  GLY B CA  1 
ATOM   2238 C  C   . GLY B 1 76  ? 24.715  28.133  26.983  1.00 2.88  ? 76  GLY B C   1 
ATOM   2239 O  O   . GLY B 1 76  ? 23.606  28.325  26.500  1.00 2.82  ? 76  GLY B O   1 
ATOM   2240 N  N   . GLY B 1 77  ? 25.226  26.914  27.165  1.00 2.23  ? 77  GLY B N   1 
ATOM   2241 C  CA  . GLY B 1 77  ? 24.497  25.695  26.779  1.00 2.82  ? 77  GLY B CA  1 
ATOM   2242 C  C   . GLY B 1 77  ? 23.173  25.541  27.491  1.00 2.90  ? 77  GLY B C   1 
ATOM   2243 O  O   . GLY B 1 77  ? 22.171  25.235  26.878  1.00 3.10  ? 77  GLY B O   1 
ATOM   2244 N  N   . HIS B 1 78  ? 23.162  25.780  28.796  1.00 2.49  ? 78  HIS B N   1 
ATOM   2245 C  CA  . HIS B 1 78  ? 21.927  25.719  29.591  1.00 2.71  ? 78  HIS B CA  1 
ATOM   2246 C  C   . HIS B 1 78  ? 20.899  26.776  29.172  1.00 2.81  ? 78  HIS B C   1 
ATOM   2247 O  O   . HIS B 1 78  ? 19.722  26.470  28.934  1.00 2.76  ? 78  HIS B O   1 
ATOM   2248 C  CB  . HIS B 1 78  ? 22.276  25.873  31.064  1.00 2.28  ? 78  HIS B CB  1 
ATOM   2249 C  CG  . HIS B 1 78  ? 21.095  25.934  31.968  1.00 2.46  ? 78  HIS B CG  1 
ATOM   2250 N  ND1 . HIS B 1 78  ? 20.034  25.059  31.871  1.00 2.92  ? 78  HIS B ND1 1 
ATOM   2251 C  CD2 . HIS B 1 78  ? 20.817  26.754  33.008  1.00 2.66  ? 78  HIS B CD2 1 
ATOM   2252 C  CE1 . HIS B 1 78  ? 19.151  25.341  32.814  1.00 2.29  ? 78  HIS B CE1 1 
ATOM   2253 N  NE2 . HIS B 1 78  ? 19.605  26.365  33.520  1.00 1.58  ? 78  HIS B NE2 1 
ATOM   2254 N  N   . ALA B 1 79  ? 21.359  28.012  29.040  1.00 3.03  ? 79  ALA B N   1 
ATOM   2255 C  CA  . ALA B 1 79  ? 20.519  29.095  28.549  1.00 3.14  ? 79  ALA B CA  1 
ATOM   2256 C  C   . ALA B 1 79  ? 19.914  28.770  27.169  1.00 3.34  ? 79  ALA B C   1 
ATOM   2257 O  O   . ALA B 1 79  ? 18.705  28.881  26.960  1.00 2.75  ? 79  ALA B O   1 
ATOM   2258 C  CB  . ALA B 1 79  ? 21.344  30.382  28.472  1.00 3.55  ? 79  ALA B CB  1 
ATOM   2259 N  N   . ASN B 1 80  ? 20.759  28.366  26.228  1.00 2.95  ? 80  ASN B N   1 
ATOM   2260 C  CA  . ASN B 1 80  ? 20.304  28.169  24.850  1.00 2.71  ? 80  ASN B CA  1 
ATOM   2261 C  C   . ASN B 1 80  ? 19.315  27.014  24.742  1.00 2.93  ? 80  ASN B C   1 
ATOM   2262 O  O   . ASN B 1 80  ? 18.308  27.123  24.049  1.00 1.96  ? 80  ASN B O   1 
ATOM   2263 C  CB  . ASN B 1 80  ? 21.465  27.869  23.921  1.00 2.08  ? 80  ASN B CB  1 
ATOM   2264 C  CG  . ASN B 1 80  ? 22.430  29.019  23.792  1.00 1.63  ? 80  ASN B CG  1 
ATOM   2265 O  OD1 . ASN B 1 80  ? 22.105  30.158  24.110  1.00 1.26  ? 80  ASN B OD1 1 
ATOM   2266 N  ND2 . ASN B 1 80  ? 23.644  28.717  23.327  1.00 1.65  ? 80  ASN B ND2 1 
ATOM   2267 N  N   . HIS B 1 81  ? 19.630  25.901  25.403  1.00 2.86  ? 81  HIS B N   1 
ATOM   2268 C  CA  . HIS B 1 81  ? 18.731  24.741  25.356  1.00 2.89  ? 81  HIS B CA  1 
ATOM   2269 C  C   . HIS B 1 81  ? 17.416  24.981  26.094  1.00 3.32  ? 81  HIS B C   1 
ATOM   2270 O  O   . HIS B 1 81  ? 16.392  24.540  25.633  1.00 2.94  ? 81  HIS B O   1 
ATOM   2271 C  CB  . HIS B 1 81  ? 19.424  23.430  25.769  1.00 1.93  ? 81  HIS B CB  1 
ATOM   2272 C  CG  . HIS B 1 81  ? 20.453  22.970  24.773  1.00 3.42  ? 81  HIS B CG  1 
ATOM   2273 N  ND1 . HIS B 1 81  ? 21.745  23.462  24.754  1.00 2.85  ? 81  HIS B ND1 1 
ATOM   2274 C  CD2 . HIS B 1 81  ? 20.366  22.101  23.738  1.00 2.21  ? 81  HIS B CD2 1 
ATOM   2275 C  CE1 . HIS B 1 81  ? 22.407  22.908  23.751  1.00 1.72  ? 81  HIS B CE1 1 
ATOM   2276 N  NE2 . HIS B 1 81  ? 21.594  22.078  23.119  1.00 1.89  ? 81  HIS B NE2 1 
ATOM   2277 N  N   . SER B 1 82  ? 17.440  25.724  27.202  1.00 3.59  ? 82  SER B N   1 
ATOM   2278 C  CA  . SER B 1 82  ? 16.198  26.057  27.894  1.00 3.21  ? 82  SER B CA  1 
ATOM   2279 C  C   . SER B 1 82  ? 15.265  26.850  26.952  1.00 3.62  ? 82  SER B C   1 
ATOM   2280 O  O   . SER B 1 82  ? 14.054  26.596  26.868  1.00 2.88  ? 82  SER B O   1 
ATOM   2281 C  CB  . SER B 1 82  ? 16.509  26.852  29.159  1.00 3.76  ? 82  SER B CB  1 
ATOM   2282 O  OG  . SER B 1 82  ? 17.264  26.073  30.080  1.00 2.26  ? 82  SER B OG  1 
ATOM   2283 N  N   . LEU B 1 83  ? 15.829  27.805  26.222  1.00 3.29  ? 83  LEU B N   1 
ATOM   2284 C  CA  . LEU B 1 83  ? 15.055  28.573  25.257  1.00 4.23  ? 83  LEU B CA  1 
ATOM   2285 C  C   . LEU B 1 83  ? 14.555  27.677  24.114  1.00 4.13  ? 83  LEU B C   1 
ATOM   2286 O  O   . LEU B 1 83  ? 13.394  27.740  23.724  1.00 4.49  ? 83  LEU B O   1 
ATOM   2287 C  CB  . LEU B 1 83  ? 15.893  29.736  24.710  1.00 4.99  ? 83  LEU B CB  1 
ATOM   2288 C  CG  . LEU B 1 83  ? 15.186  30.726  23.778  1.00 5.74  ? 83  LEU B CG  1 
ATOM   2289 C  CD1 . LEU B 1 83  ? 15.876  32.080  23.804  1.00 7.63  ? 83  LEU B CD1 1 
ATOM   2290 C  CD2 . LEU B 1 83  ? 15.071  30.186  22.345  1.00 7.54  ? 83  LEU B CD2 1 
ATOM   2291 N  N   . PHE B 1 84  ? 15.432  26.821  23.609  1.00 4.44  ? 84  PHE B N   1 
ATOM   2292 C  CA  . PHE B 1 84  ? 15.104  25.902  22.507  1.00 4.44  ? 84  PHE B CA  1 
ATOM   2293 C  C   . PHE B 1 84  ? 13.858  25.043  22.778  1.00 5.01  ? 84  PHE B C   1 
ATOM   2294 O  O   . PHE B 1 84  ? 12.960  24.961  21.927  1.00 4.34  ? 84  PHE B O   1 
ATOM   2295 C  CB  . PHE B 1 84  ? 16.307  25.011  22.190  1.00 4.98  ? 84  PHE B CB  1 
ATOM   2296 C  CG  . PHE B 1 84  ? 16.228  24.290  20.871  1.00 2.73  ? 84  PHE B CG  1 
ATOM   2297 C  CD1 . PHE B 1 84  ? 15.881  24.968  19.705  1.00 4.01  ? 84  PHE B CD1 1 
ATOM   2298 C  CD2 . PHE B 1 84  ? 16.600  22.949  20.774  1.00 2.38  ? 84  PHE B CD2 1 
ATOM   2299 C  CE1 . PHE B 1 84  ? 15.851  24.311  18.480  1.00 3.69  ? 84  PHE B CE1 1 
ATOM   2300 C  CE2 . PHE B 1 84  ? 16.558  22.278  19.560  1.00 1.23  ? 84  PHE B CE2 1 
ATOM   2301 C  CZ  . PHE B 1 84  ? 16.180  22.972  18.405  1.00 2.91  ? 84  PHE B CZ  1 
ATOM   2302 N  N   . TRP B 1 85  ? 13.802  24.387  23.941  1.00 4.63  ? 85  TRP B N   1 
ATOM   2303 C  CA  . TRP B 1 85  ? 12.646  23.543  24.282  1.00 4.89  ? 85  TRP B CA  1 
ATOM   2304 C  C   . TRP B 1 85  ? 11.316  24.316  24.276  1.00 5.27  ? 85  TRP B C   1 
ATOM   2305 O  O   . TRP B 1 85  ? 10.292  23.843  23.734  1.00 5.65  ? 85  TRP B O   1 
ATOM   2306 C  CB  . TRP B 1 85  ? 12.835  22.850  25.637  1.00 4.59  ? 85  TRP B CB  1 
ATOM   2307 C  CG  . TRP B 1 85  ? 14.163  22.181  25.846  1.00 2.83  ? 85  TRP B CG  1 
ATOM   2308 C  CD1 . TRP B 1 85  ? 14.924  22.216  26.976  1.00 3.77  ? 85  TRP B CD1 1 
ATOM   2309 C  CD2 . TRP B 1 85  ? 14.876  21.366  24.914  1.00 2.79  ? 85  TRP B CD2 1 
ATOM   2310 N  NE1 . TRP B 1 85  ? 16.070  21.492  26.802  1.00 3.43  ? 85  TRP B NE1 1 
ATOM   2311 C  CE2 . TRP B 1 85  ? 16.056  20.942  25.548  1.00 2.15  ? 85  TRP B CE2 1 
ATOM   2312 C  CE3 . TRP B 1 85  ? 14.625  20.944  23.602  1.00 3.93  ? 85  TRP B CE3 1 
ATOM   2313 C  CZ2 . TRP B 1 85  ? 16.998  20.139  24.910  1.00 3.63  ? 85  TRP B CZ2 1 
ATOM   2314 C  CZ3 . TRP B 1 85  ? 15.555  20.148  22.978  1.00 3.70  ? 85  TRP B CZ3 1 
ATOM   2315 C  CH2 . TRP B 1 85  ? 16.726  19.749  23.635  1.00 4.32  ? 85  TRP B CH2 1 
ATOM   2316 N  N   . LYS B 1 86  ? 11.320  25.500  24.883  1.00 5.03  ? 86  LYS B N   1 
ATOM   2317 C  CA  . LYS B 1 86  ? 10.130  26.320  24.935  1.00 5.36  ? 86  LYS B CA  1 
ATOM   2318 C  C   . LYS B 1 86  ? 9.849   26.911  23.563  1.00 5.01  ? 86  LYS B C   1 
ATOM   2319 O  O   . LYS B 1 86  ? 8.726   27.260  23.252  1.00 5.48  ? 86  LYS B O   1 
ATOM   2320 C  CB  . LYS B 1 86  ? 10.261  27.396  26.019  1.00 5.30  ? 86  LYS B CB  1 
ATOM   2321 C  CG  . LYS B 1 86  ? 10.404  26.756  27.390  1.00 6.19  ? 86  LYS B CG  1 
ATOM   2322 C  CD  . LYS B 1 86  ? 10.064  27.651  28.547  1.00 10.44 ? 86  LYS B CD  1 
ATOM   2323 C  CE  . LYS B 1 86  ? 10.829  28.930  28.597  1.00 11.88 ? 86  LYS B CE  1 
ATOM   2324 N  NZ  . LYS B 1 86  ? 10.204  29.789  29.661  1.00 13.43 ? 86  LYS B NZ  1 
ATOM   2325 N  N   . GLY B 1 87  ? 10.864  26.951  22.713  1.00 5.05  ? 87  GLY B N   1 
ATOM   2326 C  CA  . GLY B 1 87  ? 10.662  27.547  21.408  1.00 4.49  ? 87  GLY B CA  1 
ATOM   2327 C  C   . GLY B 1 87  ? 10.289  26.540  20.343  1.00 4.79  ? 87  GLY B C   1 
ATOM   2328 O  O   . GLY B 1 87  ? 10.331  26.858  19.147  1.00 4.70  ? 87  GLY B O   1 
ATOM   2329 N  N   . LEU B 1 88  ? 9.942   25.321  20.771  1.00 3.82  ? 88  LEU B N   1 
ATOM   2330 C  CA  . LEU B 1 88  ? 9.463   24.276  19.868  1.00 3.96  ? 88  LEU B CA  1 
ATOM   2331 C  C   . LEU B 1 88  ? 8.054   23.806  20.243  1.00 4.83  ? 88  LEU B C   1 
ATOM   2332 O  O   . LEU B 1 88  ? 7.755   23.623  21.428  1.00 5.71  ? 88  LEU B O   1 
ATOM   2333 C  CB  . LEU B 1 88  ? 10.405  23.074  19.880  1.00 3.40  ? 88  LEU B CB  1 
ATOM   2334 C  CG  . LEU B 1 88  ? 11.842  23.341  19.418  1.00 2.10  ? 88  LEU B CG  1 
ATOM   2335 C  CD1 . LEU B 1 88  ? 12.715  22.151  19.807  1.00 2.56  ? 88  LEU B CD1 1 
ATOM   2336 C  CD2 . LEU B 1 88  ? 11.913  23.594  17.905  1.00 2.43  ? 88  LEU B CD2 1 
ATOM   2337 N  N   . LYS B 1 89  ? 7.228   23.584  19.221  1.00 5.24  ? 89  LYS B N   1 
ATOM   2338 C  CA  . LYS B 1 89  ? 5.812   23.209  19.352  1.00 5.39  ? 89  LYS B CA  1 
ATOM   2339 C  C   . LYS B 1 89  ? 5.214   23.056  17.959  1.00 5.32  ? 89  LYS B C   1 
ATOM   2340 O  O   . LYS B 1 89  ? 5.491   23.864  17.081  1.00 6.01  ? 89  LYS B O   1 
ATOM   2341 C  CB  . LYS B 1 89  ? 5.029   24.280  20.107  1.00 5.37  ? 89  LYS B CB  1 
ATOM   2342 C  CG  . LYS B 1 89  ? 3.598   23.832  20.419  1.00 6.90  ? 89  LYS B CG  1 
ATOM   2343 C  CD  . LYS B 1 89  ? 2.937   24.672  21.478  1.00 8.12  ? 89  LYS B CD  1 
ATOM   2344 C  CE  . LYS B 1 89  ? 2.643   26.090  21.054  1.00 9.58  ? 89  LYS B CE  1 
ATOM   2345 N  NZ  . LYS B 1 89  ? 2.105   26.837  22.217  1.00 11.91 ? 89  LYS B NZ  1 
ATOM   2346 N  N   . LYS B 1 90  ? 4.384   22.043  17.755  1.00 5.57  ? 90  LYS B N   1 
ATOM   2347 C  CA  . LYS B 1 90  ? 3.631   21.898  16.508  1.00 6.08  ? 90  LYS B CA  1 
ATOM   2348 C  C   . LYS B 1 90  ? 2.339   22.707  16.515  1.00 5.86  ? 90  LYS B C   1 
ATOM   2349 O  O   . LYS B 1 90  ? 1.819   23.059  17.581  1.00 5.91  ? 90  LYS B O   1 
ATOM   2350 C  CB  . LYS B 1 90  ? 3.283   20.436  16.291  1.00 6.24  ? 90  LYS B CB  1 
ATOM   2351 C  CG  . LYS B 1 90  ? 4.491   19.596  16.011  1.00 7.27  ? 90  LYS B CG  1 
ATOM   2352 C  CD  . LYS B 1 90  ? 4.150   18.480  15.083  1.00 11.12 ? 90  LYS B CD  1 
ATOM   2353 C  CE  . LYS B 1 90  ? 4.006   17.189  15.846  1.00 12.26 ? 90  LYS B CE  1 
ATOM   2354 N  NZ  . LYS B 1 90  ? 3.167   17.373  17.038  1.00 13.64 ? 90  LYS B NZ  1 
ATOM   2355 N  N   . GLY B 1 91  ? 1.844   23.034  15.323  1.00 6.05  ? 91  GLY B N   1 
ATOM   2356 C  CA  . GLY B 1 91  ? 0.496   23.631  15.167  1.00 6.68  ? 91  GLY B CA  1 
ATOM   2357 C  C   . GLY B 1 91  ? 0.343   25.136  15.319  1.00 7.33  ? 91  GLY B C   1 
ATOM   2358 O  O   . GLY B 1 91  ? -0.788  25.666  15.345  1.00 7.61  ? 91  GLY B O   1 
ATOM   2359 N  N   . THR B 1 92  ? 1.458   25.855  15.427  1.00 7.02  ? 92  THR B N   1 
ATOM   2360 C  CA  . THR B 1 92  ? 1.369   27.285  15.613  1.00 6.46  ? 92  THR B CA  1 
ATOM   2361 C  C   . THR B 1 92  ? 1.439   27.990  14.267  1.00 6.48  ? 92  THR B C   1 
ATOM   2362 O  O   . THR B 1 92  ? 1.841   27.407  13.258  1.00 6.37  ? 92  THR B O   1 
ATOM   2363 C  CB  . THR B 1 92  ? 2.441   27.847  16.582  1.00 6.26  ? 92  THR B CB  1 
ATOM   2364 O  OG1 . THR B 1 92  ? 3.723   27.873  15.939  1.00 4.85  ? 92  THR B OG1 1 
ATOM   2365 C  CG2 . THR B 1 92  ? 2.506   27.009  17.877  1.00 6.60  ? 92  THR B CG2 1 
ATOM   2366 N  N   . THR B 1 93  ? 1.036   29.254  14.283  1.00 6.60  ? 93  THR B N   1 
ATOM   2367 C  CA  . THR B 1 93  ? 0.983   30.090  13.087  1.00 7.39  ? 93  THR B CA  1 
ATOM   2368 C  C   . THR B 1 93  ? 1.600   31.449  13.352  1.00 6.79  ? 93  THR B C   1 
ATOM   2369 O  O   . THR B 1 93  ? 1.228   32.133  14.290  1.00 6.64  ? 93  THR B O   1 
ATOM   2370 C  CB  . THR B 1 93  ? -0.465  30.333  12.623  1.00 7.55  ? 93  THR B CB  1 
ATOM   2371 O  OG1 . THR B 1 93  ? -1.063  29.089  12.246  1.00 10.01 ? 93  THR B OG1 1 
ATOM   2372 C  CG2 . THR B 1 93  ? -0.485  31.274  11.431  1.00 8.28  ? 93  THR B CG2 1 
ATOM   2373 N  N   . LEU B 1 94  ? 2.538   31.848  12.502  1.00 7.25  ? 94  LEU B N   1 
ATOM   2374 C  CA  . LEU B 1 94  ? 3.120   33.164  12.637  1.00 7.23  ? 94  LEU B CA  1 
ATOM   2375 C  C   . LEU B 1 94  ? 2.007   34.116  12.284  1.00 7.84  ? 94  LEU B C   1 
ATOM   2376 O  O   . LEU B 1 94  ? 1.363   33.953  11.247  1.00 8.53  ? 94  LEU B O   1 
ATOM   2377 C  CB  . LEU B 1 94  ? 4.289   33.339  11.661  1.00 7.50  ? 94  LEU B CB  1 
ATOM   2378 C  CG  . LEU B 1 94  ? 4.825   34.771  11.544  1.00 7.47  ? 94  LEU B CG  1 
ATOM   2379 C  CD1 . LEU B 1 94  ? 5.335   35.256  12.885  1.00 7.48  ? 94  LEU B CD1 1 
ATOM   2380 C  CD2 . LEU B 1 94  ? 5.935   34.862  10.490  1.00 9.47  ? 94  LEU B CD2 1 
ATOM   2381 N  N   . GLN B 1 95  ? 1.756   35.082  13.158  1.00 8.68  ? 95  GLN B N   1 
ATOM   2382 C  CA  . GLN B 1 95  ? 0.846   36.175  12.825  1.00 8.92  ? 95  GLN B CA  1 
ATOM   2383 C  C   . GLN B 1 95  ? 0.899   37.330  13.818  1.00 8.85  ? 95  GLN B C   1 
ATOM   2384 O  O   . GLN B 1 95  ? 1.840   37.460  14.604  1.00 8.67  ? 95  GLN B O   1 
ATOM   2385 C  CB  . GLN B 1 95  ? -0.586  35.670  12.625  1.00 10.32 ? 95  GLN B CB  1 
ATOM   2386 C  CG  . GLN B 1 95  ? -0.912  34.375  13.328  1.00 11.00 ? 95  GLN B CG  1 
ATOM   2387 C  CD  . GLN B 1 95  ? -1.200  34.580  14.789  1.00 13.35 ? 95  GLN B CD  1 
ATOM   2388 O  OE1 . GLN B 1 95  ? -2.196  34.068  15.321  1.00 16.37 ? 95  GLN B OE1 1 
ATOM   2389 N  NE2 . GLN B 1 95  ? -0.352  35.359  15.448  1.00 13.35 ? 95  GLN B NE2 1 
ATOM   2390 N  N   . GLY B 1 96  ? -0.111  38.185  13.771  1.00 8.67  ? 96  GLY B N   1 
ATOM   2391 C  CA  . GLY B 1 96  ? -0.161  39.317  14.686  1.00 9.13  ? 96  GLY B CA  1 
ATOM   2392 C  C   . GLY B 1 96  ? 1.101   40.154  14.549  1.00 8.61  ? 96  GLY B C   1 
ATOM   2393 O  O   . GLY B 1 96  ? 1.673   40.231  13.463  1.00 9.51  ? 96  GLY B O   1 
ATOM   2394 N  N   . ASP B 1 97  ? 1.552   40.747  15.650  1.00 9.46  ? 97  ASP B N   1 
ATOM   2395 C  CA  . ASP B 1 97  ? 2.632   41.747  15.622  1.00 9.60  ? 97  ASP B CA  1 
ATOM   2396 C  C   . ASP B 1 97  ? 3.981   41.190  15.127  1.00 9.67  ? 97  ASP B C   1 
ATOM   2397 O  O   . ASP B 1 97  ? 4.594   41.698  14.170  1.00 10.27 ? 97  ASP B O   1 
ATOM   2398 C  CB  . ASP B 1 97  ? 2.805   42.403  17.008  1.00 9.53  ? 97  ASP B CB  1 
ATOM   2399 C  CG  . ASP B 1 97  ? 1.475   42.714  17.692  1.00 11.38 ? 97  ASP B CG  1 
ATOM   2400 O  OD1 . ASP B 1 97  ? 0.430   42.338  17.137  1.00 14.20 ? 97  ASP B OD1 1 
ATOM   2401 O  OD2 . ASP B 1 97  ? 1.472   43.341  18.781  1.00 12.56 ? 97  ASP B OD2 1 
ATOM   2402 N  N   . LEU B 1 98  ? 4.461   40.145  15.781  1.00 9.73  ? 98  LEU B N   1 
ATOM   2403 C  CA  . LEU B 1 98  ? 5.745   39.601  15.382  1.00 9.48  ? 98  LEU B CA  1 
ATOM   2404 C  C   . LEU B 1 98  ? 5.935   39.903  13.892  1.00 10.19 ? 98  LEU B C   1 
ATOM   2405 O  O   . LEU B 1 98  ? 6.655   39.204  13.183  1.00 10.17 ? 98  LEU B O   1 
ATOM   2406 C  CB  . LEU B 1 98  ? 5.804   38.101  15.695  1.00 9.51  ? 98  LEU B CB  1 
ATOM   2407 C  CG  . LEU B 1 98  ? 7.090   37.279  15.506  1.00 9.16  ? 98  LEU B CG  1 
ATOM   2408 C  CD1 . LEU B 1 98  ? 8.383   38.000  15.912  1.00 10.16 ? 98  LEU B CD1 1 
ATOM   2409 C  CD2 . LEU B 1 98  ? 6.955   35.938  16.266  1.00 9.89  ? 98  LEU B CD2 1 
ATOM   2410 N  N   . LYS B 1 99  ? 5.281   40.952  13.388  1.00 11.08 ? 99  LYS B N   1 
ATOM   2411 C  CA  . LYS B 1 99  ? 5.558   41.275  11.974  1.00 11.59 ? 99  LYS B CA  1 
ATOM   2412 C  C   . LYS B 1 99  ? 5.908   42.747  11.792  1.00 11.53 ? 99  LYS B C   1 
ATOM   2413 O  O   . LYS B 1 99  ? 5.963   43.271  10.668  1.00 12.59 ? 99  LYS B O   1 
ATOM   2414 C  CB  . LYS B 1 99  ? 4.398   40.831  11.070  1.00 11.50 ? 99  LYS B CB  1 
ATOM   2415 C  CG  . LYS B 1 99  ? 4.869   40.444  9.660   1.00 12.72 ? 99  LYS B CG  1 
ATOM   2416 C  CD  . LYS B 1 99  ? 3.721   40.381  8.643   1.00 12.98 ? 99  LYS B CD  1 
ATOM   2417 C  CE  . LYS B 1 99  ? 4.214   40.691  7.219   1.00 12.17 ? 99  LYS B CE  1 
ATOM   2418 N  NZ  . LYS B 1 99  ? 3.623   39.807  6.183   1.00 11.17 ? 99  LYS B NZ  1 
ATOM   2419 N  N   . ALA B 1 100 ? 6.217   43.382  12.913  1.00 12.35 ? 100 ALA B N   1 
ATOM   2420 C  CA  . ALA B 1 100 ? 6.117   44.837  13.045  1.00 12.46 ? 100 ALA B CA  1 
ATOM   2421 C  C   . ALA B 1 100 ? 7.458   45.592  13.157  1.00 12.78 ? 100 ALA B C   1 
ATOM   2422 O  O   . ALA B 1 100 ? 7.494   46.835  13.115  1.00 13.63 ? 100 ALA B O   1 
ATOM   2423 C  CB  . ALA B 1 100 ? 5.192   45.173  14.215  1.00 13.26 ? 100 ALA B CB  1 
ATOM   2424 N  N   . ALA B 1 101 ? 8.545   44.836  13.293  1.00 12.97 ? 101 ALA B N   1 
ATOM   2425 C  CA  . ALA B 1 101 ? 9.909   45.370  13.280  1.00 12.41 ? 101 ALA B CA  1 
ATOM   2426 C  C   . ALA B 1 101 ? 10.651  44.722  12.114  1.00 12.50 ? 101 ALA B C   1 
ATOM   2427 O  O   . ALA B 1 101 ? 11.837  45.013  11.859  1.00 12.91 ? 101 ALA B O   1 
ATOM   2428 C  CB  . ALA B 1 101 ? 10.608  45.066  14.591  1.00 12.40 ? 101 ALA B CB  1 
ATOM   2429 N  N   . ILE B 1 102 ? 9.919   43.849  11.415  1.00 12.50 ? 102 ILE B N   1 
ATOM   2430 C  CA  . ILE B 1 102 ? 10.422  43.124  10.256  1.00 12.46 ? 102 ILE B CA  1 
ATOM   2431 C  C   . ILE B 1 102 ? 10.851  44.016  9.073   1.00 12.70 ? 102 ILE B C   1 
ATOM   2432 O  O   . ILE B 1 102 ? 12.057  44.237  8.837   1.00 13.86 ? 102 ILE B O   1 
ATOM   2433 C  CB  . ILE B 1 102 ? 9.389   42.067  9.764   1.00 12.20 ? 102 ILE B CB  1 
ATOM   2434 C  CG1 . ILE B 1 102 ? 9.051   41.067  10.887  1.00 12.73 ? 102 ILE B CG1 1 
ATOM   2435 C  CG2 . ILE B 1 102 ? 9.893   41.346  8.512   1.00 10.99 ? 102 ILE B CG2 1 
ATOM   2436 C  CD1 . ILE B 1 102 ? 8.473   39.777  10.369  1.00 12.62 ? 102 ILE B CD1 1 
ATOM   2437 N  N   . GLU B 1 103 ? 9.848   44.512  8.352   1.00 13.49 ? 103 GLU B N   1 
ATOM   2438 C  CA  . GLU B 1 103 ? 10.000  45.080  7.014   1.00 13.75 ? 103 GLU B CA  1 
ATOM   2439 C  C   . GLU B 1 103 ? 10.437  46.531  7.046   1.00 13.49 ? 103 GLU B C   1 
ATOM   2440 O  O   . GLU B 1 103 ? 9.949   47.366  6.268   1.00 14.42 ? 103 GLU B O   1 
ATOM   2441 C  CB  . GLU B 1 103 ? 8.691   44.913  6.233   1.00 14.01 ? 103 GLU B CB  1 
ATOM   2442 C  CG  . GLU B 1 103 ? 8.139   43.488  6.273   1.00 15.49 ? 103 GLU B CG  1 
ATOM   2443 C  CD  . GLU B 1 103 ? 6.606   43.441  6.363   1.00 18.13 ? 103 GLU B CD  1 
ATOM   2444 O  OE1 . GLU B 1 103 ? 5.945   44.470  6.057   1.00 19.59 ? 103 GLU B OE1 1 
ATOM   2445 O  OE2 . GLU B 1 103 ? 6.063   42.379  6.756   1.00 18.69 ? 103 GLU B OE2 1 
ATOM   2446 N  N   . ARG B 1 104 ? 11.301  46.831  8.006   1.00 13.79 ? 104 ARG B N   1 
ATOM   2447 C  CA  . ARG B 1 104 ? 12.238  47.930  7.900   1.00 13.89 ? 104 ARG B CA  1 
ATOM   2448 C  C   . ARG B 1 104 ? 13.574  47.201  7.970   1.00 14.30 ? 104 ARG B C   1 
ATOM   2449 O  O   . ARG B 1 104 ? 14.648  47.783  7.791   1.00 15.33 ? 104 ARG B O   1 
ATOM   2450 C  CB  . ARG B 1 104 ? 12.081  48.949  9.036   1.00 14.10 ? 104 ARG B CB  1 
ATOM   2451 C  CG  . ARG B 1 104 ? 12.989  50.184  8.905   1.00 14.20 ? 104 ARG B CG  1 
ATOM   2452 C  CD  . ARG B 1 104 ? 13.271  50.840  10.256  1.00 14.96 ? 104 ARG B CD  1 
ATOM   2453 N  NE  . ARG B 1 104 ? 13.436  49.843  11.313  1.00 16.73 ? 104 ARG B NE  1 
ATOM   2454 C  CZ  . ARG B 1 104 ? 12.417  49.260  11.938  1.00 17.85 ? 104 ARG B CZ  1 
ATOM   2455 N  NH1 . ARG B 1 104 ? 11.175  49.601  11.620  1.00 19.15 ? 104 ARG B NH1 1 
ATOM   2456 N  NH2 . ARG B 1 104 ? 12.633  48.350  12.883  1.00 17.74 ? 104 ARG B NH2 1 
ATOM   2457 N  N   . ASP B 1 105 ? 13.480  45.888  8.199   1.00 14.66 ? 105 ASP B N   1 
ATOM   2458 C  CA  . ASP B 1 105 ? 14.667  45.041  8.343   1.00 14.33 ? 105 ASP B CA  1 
ATOM   2459 C  C   . ASP B 1 105 ? 14.612  43.730  7.571   1.00 13.69 ? 105 ASP B C   1 
ATOM   2460 O  O   . ASP B 1 105 ? 15.659  43.229  7.137   1.00 15.59 ? 105 ASP B O   1 
ATOM   2461 C  CB  . ASP B 1 105 ? 15.001  44.820  9.823   1.00 14.99 ? 105 ASP B CB  1 
ATOM   2462 C  CG  . ASP B 1 105 ? 15.581  46.064  10.467  1.00 16.29 ? 105 ASP B CG  1 
ATOM   2463 O  OD1 . ASP B 1 105 ? 16.648  46.517  10.005  1.00 19.87 ? 105 ASP B OD1 1 
ATOM   2464 O  OD2 . ASP B 1 105 ? 14.954  46.603  11.412  1.00 18.11 ? 105 ASP B OD2 1 
ATOM   2465 N  N   . PHE B 1 106 ? 13.416  43.168  7.415   1.00 13.52 ? 106 PHE B N   1 
ATOM   2466 C  CA  . PHE B 1 106 ? 13.179  42.185  6.361   1.00 12.51 ? 106 PHE B CA  1 
ATOM   2467 C  C   . PHE B 1 106 ? 12.135  42.844  5.482   1.00 12.72 ? 106 PHE B C   1 
ATOM   2468 O  O   . PHE B 1 106 ? 11.980  44.063  5.545   1.00 14.62 ? 106 PHE B O   1 
ATOM   2469 C  CB  . PHE B 1 106 ? 12.746  40.804  6.902   1.00 11.64 ? 106 PHE B CB  1 
ATOM   2470 C  CG  . PHE B 1 106 ? 13.631  40.282  8.006   1.00 10.21 ? 106 PHE B CG  1 
ATOM   2471 C  CD1 . PHE B 1 106 ? 14.961  39.973  7.763   1.00 8.71  ? 106 PHE B CD1 1 
ATOM   2472 C  CD2 . PHE B 1 106 ? 13.141  40.112  9.286   1.00 9.43  ? 106 PHE B CD2 1 
ATOM   2473 C  CE1 . PHE B 1 106 ? 15.782  39.505  8.786   1.00 8.35  ? 106 PHE B CE1 1 
ATOM   2474 C  CE2 . PHE B 1 106 ? 13.958  39.649  10.309  1.00 8.58  ? 106 PHE B CE2 1 
ATOM   2475 C  CZ  . PHE B 1 106 ? 15.277  39.354  10.060  1.00 9.39  ? 106 PHE B CZ  1 
ATOM   2476 N  N   . GLY B 1 107 ? 11.428  42.083  4.652   1.00 12.45 ? 107 GLY B N   1 
ATOM   2477 C  CA  . GLY B 1 107 ? 10.379  42.680  3.821   1.00 11.60 ? 107 GLY B CA  1 
ATOM   2478 C  C   . GLY B 1 107 ? 9.241   41.734  3.511   1.00 11.18 ? 107 GLY B C   1 
ATOM   2479 O  O   . GLY B 1 107 ? 8.276   42.076  2.811   1.00 11.65 ? 107 GLY B O   1 
ATOM   2480 N  N   . SER B 1 108 ? 9.362   40.525  4.025   1.00 10.77 ? 108 SER B N   1 
ATOM   2481 C  CA  . SER B 1 108 ? 8.368   39.505  3.802   1.00 10.12 ? 108 SER B CA  1 
ATOM   2482 C  C   . SER B 1 108 ? 8.759   38.326  4.669   1.00 9.22  ? 108 SER B C   1 
ATOM   2483 O  O   . SER B 1 108 ? 9.923   38.174  5.030   1.00 9.10  ? 108 SER B O   1 
ATOM   2484 C  CB  . SER B 1 108 ? 8.370   39.073  2.340   1.00 10.54 ? 108 SER B CB  1 
ATOM   2485 O  OG  . SER B 1 108 ? 9.280   37.998  2.129   1.00 12.33 ? 108 SER B OG  1 
ATOM   2486 N  N   . VAL B 1 109 ? 7.792   37.483  4.995   1.00 8.51  ? 109 VAL B N   1 
ATOM   2487 C  CA  . VAL B 1 109 ? 8.098   36.296  5.752   1.00 8.44  ? 109 VAL B CA  1 
ATOM   2488 C  C   . VAL B 1 109 ? 9.089   35.407  4.989   1.00 8.40  ? 109 VAL B C   1 
ATOM   2489 O  O   . VAL B 1 109 ? 10.060  34.921  5.579   1.00 9.21  ? 109 VAL B O   1 
ATOM   2490 C  CB  . VAL B 1 109 ? 6.825   35.513  6.140   1.00 8.33  ? 109 VAL B CB  1 
ATOM   2491 C  CG1 . VAL B 1 109 ? 7.203   34.228  6.847   1.00 6.97  ? 109 VAL B CG1 1 
ATOM   2492 C  CG2 . VAL B 1 109 ? 5.937   36.341  7.043   1.00 9.47  ? 109 VAL B CG2 1 
ATOM   2493 N  N   . ASP B 1 110 ? 8.881   35.214  3.686   1.00 8.49  ? 110 ASP B N   1 
ATOM   2494 C  CA  . ASP B 1 110 ? 9.754   34.310  2.926   1.00 8.58  ? 110 ASP B CA  1 
ATOM   2495 C  C   . ASP B 1 110 ? 11.208  34.809  2.814   1.00 8.67  ? 110 ASP B C   1 
ATOM   2496 O  O   . ASP B 1 110 ? 12.123  33.991  2.763   1.00 9.58  ? 110 ASP B O   1 
ATOM   2497 C  CB  . ASP B 1 110 ? 9.179   33.955  1.539   1.00 9.22  ? 110 ASP B CB  1 
ATOM   2498 C  CG  . ASP B 1 110 ? 8.083   32.888  1.612   1.00 11.37 ? 110 ASP B CG  1 
ATOM   2499 O  OD1 . ASP B 1 110 ? 7.748   32.443  2.732   1.00 11.60 ? 110 ASP B OD1 1 
ATOM   2500 O  OD2 . ASP B 1 110 ? 7.558   32.481  0.550   1.00 13.86 ? 110 ASP B OD2 1 
ATOM   2501 N  N   . ASN B 1 111 ? 11.399  36.127  2.748   1.00 8.58  ? 111 ASN B N   1 
ATOM   2502 C  CA  . ASN B 1 111 ? 12.730  36.740  2.753   1.00 8.84  ? 111 ASN B CA  1 
ATOM   2503 C  C   . ASN B 1 111 ? 13.441  36.404  4.044   1.00 8.56  ? 111 ASN B C   1 
ATOM   2504 O  O   . ASN B 1 111 ? 14.581  35.913  4.024   1.00 9.58  ? 111 ASN B O   1 
ATOM   2505 C  CB  . ASN B 1 111 ? 12.643  38.266  2.644   1.00 8.84  ? 111 ASN B CB  1 
ATOM   2506 C  CG  . ASN B 1 111 ? 12.433  38.745  1.231   1.00 10.50 ? 111 ASN B CG  1 
ATOM   2507 O  OD1 . ASN B 1 111 ? 12.256  37.954  0.303   1.00 13.81 ? 111 ASN B OD1 1 
ATOM   2508 N  ND2 . ASN B 1 111 ? 12.474  40.054  1.051   1.00 11.16 ? 111 ASN B ND2 1 
ATOM   2509 N  N   . PHE B 1 112 ? 12.765  36.692  5.164   1.00 8.45  ? 112 PHE B N   1 
ATOM   2510 C  CA  . PHE B 1 112 ? 13.283  36.373  6.489   1.00 7.82  ? 112 PHE B CA  1 
ATOM   2511 C  C   . PHE B 1 112 ? 13.658  34.898  6.612   1.00 7.22  ? 112 PHE B C   1 
ATOM   2512 O  O   . PHE B 1 112 ? 14.725  34.584  7.134   1.00 7.31  ? 112 PHE B O   1 
ATOM   2513 C  CB  . PHE B 1 112 ? 12.292  36.742  7.597   1.00 7.94  ? 112 PHE B CB  1 
ATOM   2514 C  CG  . PHE B 1 112 ? 12.359  35.805  8.773   1.00 7.32  ? 112 PHE B CG  1 
ATOM   2515 C  CD1 . PHE B 1 112 ? 13.454  35.820  9.623   1.00 7.94  ? 112 PHE B CD1 1 
ATOM   2516 C  CD2 . PHE B 1 112 ? 11.360  34.884  8.988   1.00 7.12  ? 112 PHE B CD2 1 
ATOM   2517 C  CE1 . PHE B 1 112 ? 13.525  34.953  10.691  1.00 7.81  ? 112 PHE B CE1 1 
ATOM   2518 C  CE2 . PHE B 1 112 ? 11.434  33.999  10.062  1.00 5.29  ? 112 PHE B CE2 1 
ATOM   2519 C  CZ  . PHE B 1 112 ? 12.513  34.030  10.900  1.00 5.92  ? 112 PHE B CZ  1 
ATOM   2520 N  N   . LYS B 1 113 ? 12.789  33.996  6.131   1.00 6.57  ? 113 LYS B N   1 
ATOM   2521 C  CA  . LYS B 1 113 ? 13.102  32.566  6.120   1.00 6.64  ? 113 LYS B CA  1 
ATOM   2522 C  C   . LYS B 1 113 ? 14.360  32.275  5.333   1.00 6.25  ? 113 LYS B C   1 
ATOM   2523 O  O   . LYS B 1 113 ? 15.179  31.478  5.753   1.00 5.99  ? 113 LYS B O   1 
ATOM   2524 C  CB  . LYS B 1 113 ? 11.929  31.721  5.589   1.00 6.89  ? 113 LYS B CB  1 
ATOM   2525 C  CG  . LYS B 1 113 ? 10.761  31.668  6.572   1.00 6.48  ? 113 LYS B CG  1 
ATOM   2526 C  CD  . LYS B 1 113 ? 9.524   30.976  6.000   1.00 7.76  ? 113 LYS B CD  1 
ATOM   2527 C  CE  . LYS B 1 113 ? 9.817   29.503  5.742   1.00 7.03  ? 113 LYS B CE  1 
ATOM   2528 N  NZ  . LYS B 1 113 ? 8.683   28.787  5.100   1.00 10.64 ? 113 LYS B NZ  1 
ATOM   2529 N  N   . ALA B 1 114 ? 14.500  32.905  4.171   1.00 6.07  ? 114 ALA B N   1 
ATOM   2530 C  CA  . ALA B 1 114 ? 15.682  32.716  3.359   1.00 6.12  ? 114 ALA B CA  1 
ATOM   2531 C  C   . ALA B 1 114 ? 16.918  33.251  4.069   1.00 5.57  ? 114 ALA B C   1 
ATOM   2532 O  O   . ALA B 1 114 ? 17.975  32.645  3.994   1.00 5.13  ? 114 ALA B O   1 
ATOM   2533 C  CB  . ALA B 1 114 ? 15.506  33.370  1.984   1.00 5.94  ? 114 ALA B CB  1 
ATOM   2534 N  N   . GLU B 1 115 ? 16.799  34.371  4.779   1.00 5.88  ? 115 GLU B N   1 
ATOM   2535 C  CA  . GLU B 1 115 ? 17.955  34.837  5.547   1.00 6.12  ? 115 GLU B CA  1 
ATOM   2536 C  C   . GLU B 1 115 ? 18.277  33.890  6.708   1.00 5.59  ? 115 GLU B C   1 
ATOM   2537 O  O   . GLU B 1 115 ? 19.453  33.698  7.056   1.00 5.28  ? 115 GLU B O   1 
ATOM   2538 C  CB  . GLU B 1 115 ? 17.791  36.270  6.075   1.00 6.95  ? 115 GLU B CB  1 
ATOM   2539 C  CG  . GLU B 1 115 ? 19.137  37.010  6.027   1.00 8.93  ? 115 GLU B CG  1 
ATOM   2540 C  CD  . GLU B 1 115 ? 19.128  38.453  6.504   1.00 12.34 ? 115 GLU B CD  1 
ATOM   2541 O  OE1 . GLU B 1 115 ? 19.726  39.312  5.804   1.00 14.60 ? 115 GLU B OE1 1 
ATOM   2542 O  OE2 . GLU B 1 115 ? 18.571  38.740  7.573   1.00 11.63 ? 115 GLU B OE2 1 
ATOM   2543 N  N   . PHE B 1 116 ? 17.239  33.342  7.340   1.00 5.10  ? 116 PHE B N   1 
ATOM   2544 C  CA  . PHE B 1 116 ? 17.468  32.498  8.496   1.00 5.10  ? 116 PHE B CA  1 
ATOM   2545 C  C   . PHE B 1 116 ? 18.113  31.189  8.055   1.00 4.68  ? 116 PHE B C   1 
ATOM   2546 O  O   . PHE B 1 116 ? 19.037  30.698  8.702   1.00 5.46  ? 116 PHE B O   1 
ATOM   2547 C  CB  . PHE B 1 116 ? 16.166  32.256  9.282   1.00 4.37  ? 116 PHE B CB  1 
ATOM   2548 C  CG  . PHE B 1 116 ? 16.362  31.505  10.577  1.00 3.57  ? 116 PHE B CG  1 
ATOM   2549 C  CD1 . PHE B 1 116 ? 16.644  32.173  11.754  1.00 3.29  ? 116 PHE B CD1 1 
ATOM   2550 C  CD2 . PHE B 1 116 ? 16.244  30.125  10.615  1.00 2.92  ? 116 PHE B CD2 1 
ATOM   2551 C  CE1 . PHE B 1 116 ? 16.826  31.485  12.937  1.00 3.38  ? 116 PHE B CE1 1 
ATOM   2552 C  CE2 . PHE B 1 116 ? 16.427  29.420  11.814  1.00 1.90  ? 116 PHE B CE2 1 
ATOM   2553 C  CZ  . PHE B 1 116 ? 16.713  30.107  12.973  1.00 1.37  ? 116 PHE B CZ  1 
ATOM   2554 N  N   . GLU B 1 117 ? 17.644  30.632  6.940   1.00 4.72  ? 117 GLU B N   1 
ATOM   2555 C  CA  . GLU B 1 117 ? 18.196  29.378  6.441   1.00 4.36  ? 117 GLU B CA  1 
ATOM   2556 C  C   . GLU B 1 117 ? 19.665  29.545  6.062   1.00 4.26  ? 117 GLU B C   1 
ATOM   2557 O  O   . GLU B 1 117 ? 20.472  28.648  6.314   1.00 2.74  ? 117 GLU B O   1 
ATOM   2558 C  CB  . GLU B 1 117 ? 17.390  28.862  5.247   1.00 4.70  ? 117 GLU B CB  1 
ATOM   2559 C  CG  . GLU B 1 117 ? 15.951  28.520  5.595   1.00 3.93  ? 117 GLU B CG  1 
ATOM   2560 C  CD  . GLU B 1 117 ? 15.065  28.250  4.387   1.00 4.35  ? 117 GLU B CD  1 
ATOM   2561 O  OE1 . GLU B 1 117 ? 13.958  27.695  4.596   1.00 5.12  ? 117 GLU B OE1 1 
ATOM   2562 O  OE2 . GLU B 1 117 ? 15.421  28.617  3.243   1.00 6.19  ? 117 GLU B OE2 1 
ATOM   2563 N  N   . LYS B 1 118 ? 19.997  30.684  5.443   1.00 4.38  ? 118 LYS B N   1 
ATOM   2564 C  CA  . LYS B 1 118 ? 21.394  31.007  5.124   1.00 4.97  ? 118 LYS B CA  1 
ATOM   2565 C  C   . LYS B 1 118 ? 22.311  30.957  6.352   1.00 4.16  ? 118 LYS B C   1 
ATOM   2566 O  O   . LYS B 1 118 ? 23.404  30.375  6.312   1.00 3.18  ? 118 LYS B O   1 
ATOM   2567 C  CB  . LYS B 1 118 ? 21.495  32.405  4.480   1.00 5.44  ? 118 LYS B CB  1 
ATOM   2568 C  CG  . LYS B 1 118 ? 22.597  32.518  3.440   1.00 8.67  ? 118 LYS B CG  1 
ATOM   2569 C  CD  . LYS B 1 118 ? 23.161  33.950  3.363   1.00 10.03 ? 118 LYS B CD  1 
ATOM   2570 C  CE  . LYS B 1 118 ? 22.070  34.983  3.188   1.00 9.77  ? 118 LYS B CE  1 
ATOM   2571 N  NZ  . LYS B 1 118 ? 22.575  36.364  3.478   1.00 11.98 ? 118 LYS B NZ  1 
ATOM   2572 N  N   . ALA B 1 119 ? 21.890  31.614  7.429   1.00 3.46  ? 119 ALA B N   1 
ATOM   2573 C  CA  . ALA B 1 119 ? 22.697  31.647  8.639   1.00 3.24  ? 119 ALA B CA  1 
ATOM   2574 C  C   . ALA B 1 119 ? 22.821  30.257  9.238   1.00 3.24  ? 119 ALA B C   1 
ATOM   2575 O  O   . ALA B 1 119 ? 23.902  29.828  9.667   1.00 2.84  ? 119 ALA B O   1 
ATOM   2576 C  CB  . ALA B 1 119 ? 22.091  32.633  9.663   1.00 2.94  ? 119 ALA B CB  1 
ATOM   2577 N  N   . ALA B 1 120 ? 21.700  29.552  9.278   1.00 3.38  ? 120 ALA B N   1 
ATOM   2578 C  CA  . ALA B 1 120 ? 21.705  28.213  9.836   1.00 3.42  ? 120 ALA B CA  1 
ATOM   2579 C  C   . ALA B 1 120 ? 22.611  27.276  9.051   1.00 3.06  ? 120 ALA B C   1 
ATOM   2580 O  O   . ALA B 1 120 ? 23.321  26.446  9.635   1.00 3.53  ? 120 ALA B O   1 
ATOM   2581 C  CB  . ALA B 1 120 ? 20.288  27.661  9.903   1.00 3.70  ? 120 ALA B CB  1 
ATOM   2582 N  N   . ALA B 1 121 ? 22.584  27.375  7.722   1.00 3.37  ? 121 ALA B N   1 
ATOM   2583 C  CA  . ALA B 1 121 ? 23.327  26.420  6.912   1.00 3.91  ? 121 ALA B CA  1 
ATOM   2584 C  C   . ALA B 1 121 ? 24.794  26.751  6.859   1.00 4.25  ? 121 ALA B C   1 
ATOM   2585 O  O   . ALA B 1 121 ? 25.652  25.854  6.764   1.00 4.60  ? 121 ALA B O   1 
ATOM   2586 C  CB  . ALA B 1 121 ? 22.769  26.372  5.506   1.00 3.83  ? 121 ALA B CB  1 
ATOM   2587 N  N   . SER B 1 122 ? 25.056  28.050  6.916   1.00 4.93  ? 122 SER B N   1 
ATOM   2588 C  CA  . SER B 1 122 ? 26.398  28.588  6.727   1.00 5.86  ? 122 SER B CA  1 
ATOM   2589 C  C   . SER B 1 122 ? 27.219  28.507  7.990   1.00 4.63  ? 122 SER B C   1 
ATOM   2590 O  O   . SER B 1 122 ? 28.428  28.640  7.948   1.00 4.95  ? 122 SER B O   1 
ATOM   2591 C  CB  . SER B 1 122 ? 26.352  30.038  6.279   1.00 6.16  ? 122 SER B CB  1 
ATOM   2592 O  OG  . SER B 1 122 ? 27.546  30.320  5.590   1.00 11.57 ? 122 SER B OG  1 
ATOM   2593 N  N   . ARG B 1 123 ? 26.568  28.285  9.125   1.00 3.64  ? 123 ARG B N   1 
ATOM   2594 C  CA  . ARG B 1 123 ? 27.300  28.178  10.387  1.00 3.02  ? 123 ARG B CA  1 
ATOM   2595 C  C   . ARG B 1 123 ? 28.227  26.989  10.350  1.00 2.92  ? 123 ARG B C   1 
ATOM   2596 O  O   . ARG B 1 123 ? 27.777  25.840  10.380  1.00 2.81  ? 123 ARG B O   1 
ATOM   2597 C  CB  . ARG B 1 123 ? 26.328  28.085  11.564  1.00 3.26  ? 123 ARG B CB  1 
ATOM   2598 C  CG  . ARG B 1 123 ? 26.925  27.609  12.899  1.00 4.04  ? 123 ARG B CG  1 
ATOM   2599 C  CD  . ARG B 1 123 ? 28.158  28.397  13.328  1.00 3.49  ? 123 ARG B CD  1 
ATOM   2600 N  NE  . ARG B 1 123 ? 27.951  29.854  13.402  1.00 4.36  ? 123 ARG B NE  1 
ATOM   2601 C  CZ  . ARG B 1 123 ? 28.912  30.722  13.712  1.00 5.78  ? 123 ARG B CZ  1 
ATOM   2602 N  NH1 . ARG B 1 123 ? 30.151  30.297  13.977  1.00 5.65  ? 123 ARG B NH1 1 
ATOM   2603 N  NH2 . ARG B 1 123 ? 28.644  32.016  13.763  1.00 4.32  ? 123 ARG B NH2 1 
ATOM   2604 N  N   . PHE B 1 124 ? 29.526  27.262  10.248  1.00 1.90  ? 124 PHE B N   1 
ATOM   2605 C  CA  . PHE B 1 124 ? 30.500  26.192  10.047  1.00 2.16  ? 124 PHE B CA  1 
ATOM   2606 C  C   . PHE B 1 124 ? 31.017  25.612  11.363  1.00 2.56  ? 124 PHE B C   1 
ATOM   2607 O  O   . PHE B 1 124 ? 31.621  26.310  12.181  1.00 3.22  ? 124 PHE B O   1 
ATOM   2608 C  CB  . PHE B 1 124 ? 31.672  26.661  9.173   1.00 1.95  ? 124 PHE B CB  1 
ATOM   2609 C  CG  . PHE B 1 124 ? 32.544  25.541  8.676   1.00 2.35  ? 124 PHE B CG  1 
ATOM   2610 C  CD1 . PHE B 1 124 ? 32.208  24.834  7.533   1.00 3.46  ? 124 PHE B CD1 1 
ATOM   2611 C  CD2 . PHE B 1 124 ? 33.724  25.219  9.333   1.00 1.14  ? 124 PHE B CD2 1 
ATOM   2612 C  CE1 . PHE B 1 124 ? 33.030  23.799  7.065   1.00 2.19  ? 124 PHE B CE1 1 
ATOM   2613 C  CE2 . PHE B 1 124 ? 34.547  24.183  8.868   1.00 2.02  ? 124 PHE B CE2 1 
ATOM   2614 C  CZ  . PHE B 1 124 ? 34.199  23.482  7.741   1.00 1.59  ? 124 PHE B CZ  1 
ATOM   2615 N  N   . GLY B 1 125 ? 30.789  24.320  11.549  1.00 2.04  ? 125 GLY B N   1 
ATOM   2616 C  CA  . GLY B 1 125 ? 31.062  23.686  12.828  1.00 1.01  ? 125 GLY B CA  1 
ATOM   2617 C  C   . GLY B 1 125 ? 29.797  23.740  13.672  1.00 1.12  ? 125 GLY B C   1 
ATOM   2618 O  O   . GLY B 1 125 ? 28.685  23.793  13.145  1.00 1.89  ? 125 GLY B O   1 
ATOM   2619 N  N   . SER B 1 126 ? 29.966  23.734  14.988  1.00 0.95  ? 126 SER B N   1 
ATOM   2620 C  CA  . SER B 1 126 ? 28.844  23.740  15.910  1.00 1.31  ? 126 SER B CA  1 
ATOM   2621 C  C   . SER B 1 126 ? 28.364  25.161  16.159  1.00 2.34  ? 126 SER B C   1 
ATOM   2622 O  O   . SER B 1 126 ? 29.165  26.101  16.167  1.00 2.54  ? 126 SER B O   1 
ATOM   2623 C  CB  . SER B 1 126 ? 29.296  23.097  17.214  1.00 1.63  ? 126 SER B CB  1 
ATOM   2624 O  OG  . SER B 1 126 ? 29.729  21.770  16.989  1.00 1.45  ? 126 SER B OG  1 
ATOM   2625 N  N   . GLY B 1 127 ? 27.056  25.336  16.346  1.00 2.36  ? 127 GLY B N   1 
ATOM   2626 C  CA  . GLY B 1 127 ? 26.531  26.634  16.796  1.00 2.15  ? 127 GLY B CA  1 
ATOM   2627 C  C   . GLY B 1 127 ? 25.026  26.731  16.702  1.00 2.61  ? 127 GLY B C   1 
ATOM   2628 O  O   . GLY B 1 127 ? 24.331  25.705  16.756  1.00 2.13  ? 127 GLY B O   1 
ATOM   2629 N  N   . TRP B 1 128 ? 24.547  27.967  16.552  1.00 2.63  ? 128 TRP B N   1 
ATOM   2630 C  CA  . TRP B 1 128 ? 23.134  28.332  16.623  1.00 3.17  ? 128 TRP B CA  1 
ATOM   2631 C  C   . TRP B 1 128 ? 22.810  29.419  15.599  1.00 2.66  ? 128 TRP B C   1 
ATOM   2632 O  O   . TRP B 1 128 ? 23.635  30.314  15.328  1.00 2.48  ? 128 TRP B O   1 
ATOM   2633 C  CB  . TRP B 1 128 ? 22.817  28.873  18.016  1.00 3.09  ? 128 TRP B CB  1 
ATOM   2634 C  CG  . TRP B 1 128 ? 22.817  27.831  19.109  1.00 2.95  ? 128 TRP B CG  1 
ATOM   2635 C  CD1 . TRP B 1 128 ? 23.886  27.285  19.746  1.00 3.58  ? 128 TRP B CD1 1 
ATOM   2636 C  CD2 . TRP B 1 128 ? 21.657  27.226  19.667  1.00 2.24  ? 128 TRP B CD2 1 
ATOM   2637 N  NE1 . TRP B 1 128 ? 23.456  26.358  20.694  1.00 3.20  ? 128 TRP B NE1 1 
ATOM   2638 C  CE2 . TRP B 1 128 ? 22.088  26.304  20.645  1.00 2.70  ? 128 TRP B CE2 1 
ATOM   2639 C  CE3 . TRP B 1 128 ? 20.287  27.366  19.418  1.00 2.22  ? 128 TRP B CE3 1 
ATOM   2640 C  CZ2 . TRP B 1 128 ? 21.197  25.539  21.383  1.00 3.22  ? 128 TRP B CZ2 1 
ATOM   2641 C  CZ3 . TRP B 1 128 ? 19.401  26.599  20.157  1.00 3.13  ? 128 TRP B CZ3 1 
ATOM   2642 C  CH2 . TRP B 1 128 ? 19.864  25.697  21.121  1.00 2.50  ? 128 TRP B CH2 1 
ATOM   2643 N  N   . ALA B 1 129 ? 21.615  29.349  15.023  1.00 2.51  ? 129 ALA B N   1 
ATOM   2644 C  CA  . ALA B 1 129 ? 21.044  30.460  14.283  1.00 3.34  ? 129 ALA B CA  1 
ATOM   2645 C  C   . ALA B 1 129 ? 19.954  31.118  15.119  1.00 3.53  ? 129 ALA B C   1 
ATOM   2646 O  O   . ALA B 1 129 ? 19.180  30.429  15.803  1.00 4.04  ? 129 ALA B O   1 
ATOM   2647 C  CB  . ALA B 1 129 ? 20.491  30.011  12.935  1.00 3.30  ? 129 ALA B CB  1 
ATOM   2648 N  N   . TRP B 1 130 ? 19.894  32.447  15.049  1.00 3.66  ? 130 TRP B N   1 
ATOM   2649 C  CA  . TRP B 1 130 ? 18.974  33.232  15.884  1.00 3.92  ? 130 TRP B CA  1 
ATOM   2650 C  C   . TRP B 1 130 ? 18.174  34.310  15.141  1.00 5.04  ? 130 TRP B C   1 
ATOM   2651 O  O   . TRP B 1 130 ? 18.682  34.999  14.235  1.00 4.52  ? 130 TRP B O   1 
ATOM   2652 C  CB  . TRP B 1 130 ? 19.720  33.958  17.004  1.00 4.18  ? 130 TRP B CB  1 
ATOM   2653 C  CG  . TRP B 1 130 ? 20.671  33.138  17.834  1.00 3.08  ? 130 TRP B CG  1 
ATOM   2654 C  CD1 . TRP B 1 130 ? 22.013  32.990  17.636  1.00 2.70  ? 130 TRP B CD1 1 
ATOM   2655 C  CD2 . TRP B 1 130 ? 20.351  32.379  19.000  1.00 3.02  ? 130 TRP B CD2 1 
ATOM   2656 N  NE1 . TRP B 1 130 ? 22.549  32.188  18.611  1.00 2.92  ? 130 TRP B NE1 1 
ATOM   2657 C  CE2 . TRP B 1 130 ? 21.547  31.794  19.460  1.00 4.12  ? 130 TRP B CE2 1 
ATOM   2658 C  CE3 . TRP B 1 130 ? 19.163  32.122  19.698  1.00 2.60  ? 130 TRP B CE3 1 
ATOM   2659 C  CZ2 . TRP B 1 130 ? 21.592  30.972  20.582  1.00 4.30  ? 130 TRP B CZ2 1 
ATOM   2660 C  CZ3 . TRP B 1 130 ? 19.218  31.329  20.826  1.00 3.49  ? 130 TRP B CZ3 1 
ATOM   2661 C  CH2 . TRP B 1 130 ? 20.413  30.753  21.251  1.00 4.87  ? 130 TRP B CH2 1 
ATOM   2662 N  N   . LEU B 1 131 ? 16.918  34.468  15.559  1.00 4.85  ? 131 LEU B N   1 
ATOM   2663 C  CA  . LEU B 1 131 ? 16.143  35.669  15.317  1.00 5.81  ? 131 LEU B CA  1 
ATOM   2664 C  C   . LEU B 1 131 ? 16.238  36.512  16.579  1.00 6.35  ? 131 LEU B C   1 
ATOM   2665 O  O   . LEU B 1 131 ? 15.777  36.088  17.660  1.00 6.74  ? 131 LEU B O   1 
ATOM   2666 C  CB  . LEU B 1 131 ? 14.692  35.328  15.000  1.00 5.53  ? 131 LEU B CB  1 
ATOM   2667 C  CG  . LEU B 1 131 ? 13.769  36.534  14.842  1.00 6.36  ? 131 LEU B CG  1 
ATOM   2668 C  CD1 . LEU B 1 131 ? 14.180  37.365  13.640  1.00 7.74  ? 131 LEU B CD1 1 
ATOM   2669 C  CD2 . LEU B 1 131 ? 12.330  36.032  14.705  1.00 8.21  ? 131 LEU B CD2 1 
ATOM   2670 N  N   . VAL B 1 132 ? 16.855  37.686  16.460  1.00 6.30  ? 132 VAL B N   1 
ATOM   2671 C  CA  . VAL B 1 132 ? 17.067  38.550  17.614  1.00 6.69  ? 132 VAL B CA  1 
ATOM   2672 C  C   . VAL B 1 132 ? 16.323  39.877  17.482  1.00 7.39  ? 132 VAL B C   1 
ATOM   2673 O  O   . VAL B 1 132 ? 15.961  40.285  16.373  1.00 8.21  ? 132 VAL B O   1 
ATOM   2674 C  CB  . VAL B 1 132 ? 18.564  38.853  17.894  1.00 6.82  ? 132 VAL B CB  1 
ATOM   2675 C  CG1 . VAL B 1 132 ? 19.338  37.582  18.251  1.00 6.30  ? 132 VAL B CG1 1 
ATOM   2676 C  CG2 . VAL B 1 132 ? 19.209  39.559  16.715  1.00 6.52  ? 132 VAL B CG2 1 
ATOM   2677 N  N   . LEU B 1 133 ? 16.097  40.537  18.615  1.00 7.83  ? 133 LEU B N   1 
ATOM   2678 C  CA  . LEU B 1 133 ? 15.563  41.903  18.617  1.00 8.71  ? 133 LEU B CA  1 
ATOM   2679 C  C   . LEU B 1 133 ? 16.668  42.872  19.011  1.00 8.89  ? 133 LEU B C   1 
ATOM   2680 O  O   . LEU B 1 133 ? 17.090  42.900  20.165  1.00 9.68  ? 133 LEU B O   1 
ATOM   2681 C  CB  . LEU B 1 133 ? 14.418  42.065  19.620  1.00 8.67  ? 133 LEU B CB  1 
ATOM   2682 C  CG  . LEU B 1 133 ? 13.772  43.458  19.493  1.00 10.77 ? 133 LEU B CG  1 
ATOM   2683 C  CD1 . LEU B 1 133 ? 13.177  43.617  18.098  1.00 11.03 ? 133 LEU B CD1 1 
ATOM   2684 C  CD2 . LEU B 1 133 ? 12.733  43.751  20.582  1.00 12.68 ? 133 LEU B CD2 1 
ATOM   2685 N  N   . LYS B 1 134 ? 17.135  43.667  18.061  1.00 9.71  ? 134 LYS B N   1 
ATOM   2686 C  CA  . LYS B 1 134 ? 18.172  44.635  18.348  1.00 10.39 ? 134 LYS B CA  1 
ATOM   2687 C  C   . LYS B 1 134 ? 17.525  45.996  18.462  1.00 10.80 ? 134 LYS B C   1 
ATOM   2688 O  O   . LYS B 1 134 ? 17.253  46.655  17.454  1.00 10.86 ? 134 LYS B O   1 
ATOM   2689 C  CB  . LYS B 1 134 ? 19.266  44.612  17.275  1.00 10.59 ? 134 LYS B CB  1 
ATOM   2690 C  CG  . LYS B 1 134 ? 20.294  43.486  17.481  1.00 12.30 ? 134 LYS B CG  1 
ATOM   2691 C  CD  . LYS B 1 134 ? 21.459  43.582  16.488  1.00 14.77 ? 134 LYS B CD  1 
ATOM   2692 C  CE  . LYS B 1 134 ? 22.229  44.891  16.679  1.00 15.97 ? 134 LYS B CE  1 
ATOM   2693 N  NZ  . LYS B 1 134 ? 23.616  44.850  16.115  1.00 17.79 ? 134 LYS B NZ  1 
ATOM   2694 N  N   . GLY B 1 135 ? 17.249  46.370  19.707  1.00 11.21 ? 135 GLY B N   1 
ATOM   2695 C  CA  . GLY B 1 135 ? 16.523  47.592  20.036  1.00 11.94 ? 135 GLY B CA  1 
ATOM   2696 C  C   . GLY B 1 135 ? 15.214  47.673  19.289  1.00 12.16 ? 135 GLY B C   1 
ATOM   2697 O  O   . GLY B 1 135 ? 14.230  47.037  19.672  1.00 13.40 ? 135 GLY B O   1 
ATOM   2698 N  N   . ASP B 1 136 ? 15.203  48.478  18.232  1.00 12.73 ? 136 ASP B N   1 
ATOM   2699 C  CA  . ASP B 1 136 ? 14.109  48.499  17.280  1.00 12.95 ? 136 ASP B CA  1 
ATOM   2700 C  C   . ASP B 1 136 ? 14.660  47.947  15.975  1.00 12.79 ? 136 ASP B C   1 
ATOM   2701 O  O   . ASP B 1 136 ? 15.310  48.669  15.195  1.00 14.04 ? 136 ASP B O   1 
ATOM   2702 C  CB  . ASP B 1 136 ? 13.599  49.925  17.055  1.00 13.71 ? 136 ASP B CB  1 
ATOM   2703 C  CG  . ASP B 1 136 ? 14.179  50.918  18.049  1.00 15.64 ? 136 ASP B CG  1 
ATOM   2704 O  OD1 . ASP B 1 136 ? 14.723  50.476  19.096  1.00 18.21 ? 136 ASP B OD1 1 
ATOM   2705 O  OD2 . ASP B 1 136 ? 14.092  52.142  17.779  1.00 17.24 ? 136 ASP B OD2 1 
ATOM   2706 N  N   . LYS B 1 137 ? 14.390  46.668  15.728  1.00 11.97 ? 137 LYS B N   1 
ATOM   2707 C  CA  . LYS B 1 137 ? 14.997  45.988  14.594  1.00 11.26 ? 137 LYS B CA  1 
ATOM   2708 C  C   . LYS B 1 137 ? 15.167  44.493  14.899  1.00 10.27 ? 137 LYS B C   1 
ATOM   2709 O  O   . LYS B 1 137 ? 15.918  44.107  15.802  1.00 9.85  ? 137 LYS B O   1 
ATOM   2710 C  CB  . LYS B 1 137 ? 16.343  46.668  14.280  1.00 11.86 ? 137 LYS B CB  1 
ATOM   2711 C  CG  . LYS B 1 137 ? 17.386  45.852  13.493  1.00 12.42 ? 137 LYS B CG  1 
ATOM   2712 C  CD  . LYS B 1 137 ? 18.799  46.513  13.536  1.00 13.74 ? 137 LYS B CD  1 
ATOM   2713 C  CE  . LYS B 1 137 ? 18.915  47.723  12.607  1.00 13.85 ? 137 LYS B CE  1 
ATOM   2714 N  NZ  . LYS B 1 137 ? 20.322  48.203  12.389  1.00 14.88 ? 137 LYS B NZ  1 
ATOM   2715 N  N   . LEU B 1 138 ? 14.423  43.656  14.184  1.00 9.61  ? 138 LEU B N   1 
ATOM   2716 C  CA  . LEU B 1 138 ? 14.727  42.241  14.188  1.00 9.13  ? 138 LEU B CA  1 
ATOM   2717 C  C   . LEU B 1 138 ? 15.915  42.008  13.266  1.00 8.61  ? 138 LEU B C   1 
ATOM   2718 O  O   . LEU B 1 138 ? 16.173  42.772  12.337  1.00 9.48  ? 138 LEU B O   1 
ATOM   2719 C  CB  . LEU B 1 138 ? 13.530  41.412  13.728  1.00 9.30  ? 138 LEU B CB  1 
ATOM   2720 C  CG  . LEU B 1 138 ? 12.312  41.470  14.663  1.00 9.79  ? 138 LEU B CG  1 
ATOM   2721 C  CD1 . LEU B 1 138 ? 11.044  41.042  13.938  1.00 9.68  ? 138 LEU B CD1 1 
ATOM   2722 C  CD2 . LEU B 1 138 ? 12.510  40.651  15.929  1.00 9.36  ? 138 LEU B CD2 1 
ATOM   2723 N  N   . ALA B 1 139 ? 16.655  40.950  13.540  1.00 8.30  ? 139 ALA B N   1 
ATOM   2724 C  CA  . ALA B 1 139 ? 17.797  40.617  12.740  1.00 8.03  ? 139 ALA B CA  1 
ATOM   2725 C  C   . ALA B 1 139 ? 18.058  39.143  12.906  1.00 7.73  ? 139 ALA B C   1 
ATOM   2726 O  O   . ALA B 1 139 ? 17.669  38.545  13.917  1.00 7.74  ? 139 ALA B O   1 
ATOM   2727 C  CB  . ALA B 1 139 ? 19.003  41.420  13.188  1.00 8.63  ? 139 ALA B CB  1 
ATOM   2728 N  N   . VAL B 1 140 ? 18.709  38.570  11.902  1.00 7.29  ? 140 VAL B N   1 
ATOM   2729 C  CA  . VAL B 1 140 ? 19.126  37.184  11.903  1.00 6.65  ? 140 VAL B CA  1 
ATOM   2730 C  C   . VAL B 1 140 ? 20.634  37.157  12.136  1.00 6.60  ? 140 VAL B C   1 
ATOM   2731 O  O   . VAL B 1 140 ? 21.376  37.912  11.513  1.00 6.71  ? 140 VAL B O   1 
ATOM   2732 C  CB  . VAL B 1 140 ? 18.817  36.519  10.549  1.00 6.57  ? 140 VAL B CB  1 
ATOM   2733 C  CG1 . VAL B 1 140 ? 19.519  35.175  10.441  1.00 5.29  ? 140 VAL B CG1 1 
ATOM   2734 C  CG2 . VAL B 1 140 ? 17.296  36.408  10.323  1.00 6.11  ? 140 VAL B CG2 1 
ATOM   2735 N  N   . VAL B 1 141 ? 21.084  36.285  13.035  1.00 6.10  ? 141 VAL B N   1 
ATOM   2736 C  CA  . VAL B 1 141 ? 22.496  36.219  13.422  1.00 6.23  ? 141 VAL B CA  1 
ATOM   2737 C  C   . VAL B 1 141 ? 22.791  34.772  13.767  1.00 6.01  ? 141 VAL B C   1 
ATOM   2738 O  O   . VAL B 1 141 ? 21.861  33.963  13.911  1.00 6.33  ? 141 VAL B O   1 
ATOM   2739 C  CB  . VAL B 1 141 ? 22.802  37.115  14.669  1.00 6.18  ? 141 VAL B CB  1 
ATOM   2740 C  CG1 . VAL B 1 141 ? 24.152  36.762  15.249  1.00 8.78  ? 141 VAL B CG1 1 
ATOM   2741 C  CG2 . VAL B 1 141 ? 22.708  38.602  14.340  1.00 5.57  ? 141 VAL B CG2 1 
ATOM   2742 N  N   . SER B 1 142 ? 24.075  34.434  13.896  1.00 5.51  ? 142 SER B N   1 
ATOM   2743 C  CA  . SER B 1 142 ? 24.471  33.109  14.306  1.00 5.31  ? 142 SER B CA  1 
ATOM   2744 C  C   . SER B 1 142 ? 25.656  33.210  15.243  1.00 5.13  ? 142 SER B C   1 
ATOM   2745 O  O   . SER B 1 142 ? 26.370  34.238  15.263  1.00 5.28  ? 142 SER B O   1 
ATOM   2746 C  CB  . SER B 1 142 ? 24.808  32.235  13.096  1.00 5.82  ? 142 SER B CB  1 
ATOM   2747 O  OG  . SER B 1 142 ? 26.044  32.580  12.520  1.00 6.67  ? 142 SER B OG  1 
ATOM   2748 N  N   . THR B 1 143 ? 25.820  32.167  16.047  1.00 3.68  ? 143 THR B N   1 
ATOM   2749 C  CA  . THR B 1 143 ? 26.883  32.094  17.022  1.00 3.26  ? 143 THR B CA  1 
ATOM   2750 C  C   . THR B 1 143 ? 27.536  30.743  16.954  1.00 2.62  ? 143 THR B C   1 
ATOM   2751 O  O   . THR B 1 143 ? 26.933  29.770  16.476  1.00 1.66  ? 143 THR B O   1 
ATOM   2752 C  CB  . THR B 1 143 ? 26.361  32.337  18.462  1.00 2.84  ? 143 THR B CB  1 
ATOM   2753 O  OG1 . THR B 1 143 ? 25.301  31.408  18.758  1.00 3.05  ? 143 THR B OG1 1 
ATOM   2754 C  CG2 . THR B 1 143 ? 25.818  33.760  18.579  1.00 4.28  ? 143 THR B CG2 1 
ATOM   2755 N  N   . ALA B 1 144 ? 28.773  30.708  17.444  1.00 2.27  ? 144 ALA B N   1 
ATOM   2756 C  CA  . ALA B 1 144 ? 29.565  29.502  17.582  1.00 2.12  ? 144 ALA B CA  1 
ATOM   2757 C  C   . ALA B 1 144 ? 29.296  28.719  18.870  1.00 1.89  ? 144 ALA B C   1 
ATOM   2758 O  O   . ALA B 1 144 ? 29.110  29.296  19.946  1.00 1.47  ? 144 ALA B O   1 
ATOM   2759 C  CB  . ALA B 1 144 ? 31.020  29.850  17.504  1.00 1.68  ? 144 ALA B CB  1 
ATOM   2760 N  N   . ASN B 1 145 ? 29.315  27.400  18.756  1.00 1.36  ? 145 ASN B N   1 
ATOM   2761 C  CA  . ASN B 1 145 ? 29.286  26.536  19.934  1.00 1.44  ? 145 ASN B CA  1 
ATOM   2762 C  C   . ASN B 1 145 ? 28.079  26.828  20.819  1.00 1.72  ? 145 ASN B C   1 
ATOM   2763 O  O   . ASN B 1 145 ? 26.953  26.774  20.324  1.00 1.32  ? 145 ASN B O   1 
ATOM   2764 C  CB  . ASN B 1 145 ? 30.635  26.661  20.661  1.00 1.62  ? 145 ASN B CB  1 
ATOM   2765 C  CG  . ASN B 1 145 ? 31.787  26.225  19.771  1.00 1.86  ? 145 ASN B CG  1 
ATOM   2766 O  OD1 . ASN B 1 145 ? 31.621  25.338  18.936  1.00 1.29  ? 145 ASN B OD1 1 
ATOM   2767 N  ND2 . ASN B 1 145 ? 32.944  26.870  19.916  1.00 1.26  ? 145 ASN B ND2 1 
ATOM   2768 N  N   . GLN B 1 146 ? 28.278  27.111  22.103  1.00 1.19  ? 146 GLN B N   1 
ATOM   2769 C  CA  . GLN B 1 146 ? 27.134  27.523  22.943  1.00 2.20  ? 146 GLN B CA  1 
ATOM   2770 C  C   . GLN B 1 146 ? 27.091  29.026  23.232  1.00 2.51  ? 146 GLN B C   1 
ATOM   2771 O  O   . GLN B 1 146 ? 26.442  29.459  24.200  1.00 2.69  ? 146 GLN B O   1 
ATOM   2772 C  CB  . GLN B 1 146 ? 27.110  26.751  24.270  1.00 1.47  ? 146 GLN B CB  1 
ATOM   2773 C  CG  . GLN B 1 146 ? 26.880  25.253  24.138  1.00 2.36  ? 146 GLN B CG  1 
ATOM   2774 C  CD  . GLN B 1 146 ? 25.634  24.942  23.353  1.00 1.97  ? 146 GLN B CD  1 
ATOM   2775 O  OE1 . GLN B 1 146 ? 24.784  25.809  23.163  1.00 2.32  ? 146 GLN B OE1 1 
ATOM   2776 N  NE2 . GLN B 1 146 ? 25.518  23.713  22.877  1.00 2.00  ? 146 GLN B NE2 1 
ATOM   2777 N  N   . ASP B 1 147 ? 27.760  29.836  22.417  1.00 3.34  ? 147 ASP B N   1 
ATOM   2778 C  CA  . ASP B 1 147 ? 27.655  31.276  22.580  1.00 3.44  ? 147 ASP B CA  1 
ATOM   2779 C  C   . ASP B 1 147 ? 26.234  31.731  22.308  1.00 3.75  ? 147 ASP B C   1 
ATOM   2780 O  O   . ASP B 1 147 ? 25.496  31.096  21.557  1.00 2.47  ? 147 ASP B O   1 
ATOM   2781 C  CB  . ASP B 1 147 ? 28.600  32.014  21.635  1.00 3.06  ? 147 ASP B CB  1 
ATOM   2782 C  CG  . ASP B 1 147 ? 30.063  31.773  21.970  1.00 2.59  ? 147 ASP B CG  1 
ATOM   2783 O  OD1 . ASP B 1 147 ? 30.355  31.095  22.977  1.00 3.92  ? 147 ASP B OD1 1 
ATOM   2784 O  OD2 . ASP B 1 147 ? 30.915  32.256  21.201  1.00 3.23  ? 147 ASP B OD2 1 
ATOM   2785 N  N   . SER B 1 148 ? 25.859  32.849  22.922  1.00 3.90  ? 148 SER B N   1 
ATOM   2786 C  CA  . SER B 1 148 ? 24.542  33.423  22.736  1.00 4.16  ? 148 SER B CA  1 
ATOM   2787 C  C   . SER B 1 148 ? 24.710  34.894  22.433  1.00 4.68  ? 148 SER B C   1 
ATOM   2788 O  O   . SER B 1 148 ? 25.670  35.502  22.927  1.00 4.10  ? 148 SER B O   1 
ATOM   2789 C  CB  . SER B 1 148 ? 23.767  33.282  24.039  1.00 4.30  ? 148 SER B CB  1 
ATOM   2790 O  OG  . SER B 1 148 ? 22.593  34.077  24.006  1.00 4.16  ? 148 SER B OG  1 
ATOM   2791 N  N   . PRO B 1 149 ? 23.789  35.486  21.640  1.00 4.91  ? 149 PRO B N   1 
ATOM   2792 C  CA  . PRO B 1 149 ? 23.921  36.916  21.440  1.00 5.42  ? 149 PRO B CA  1 
ATOM   2793 C  C   . PRO B 1 149 ? 23.819  37.665  22.748  1.00 5.62  ? 149 PRO B C   1 
ATOM   2794 O  O   . PRO B 1 149 ? 24.297  38.785  22.826  1.00 5.73  ? 149 PRO B O   1 
ATOM   2795 C  CB  . PRO B 1 149 ? 22.728  37.270  20.535  1.00 5.77  ? 149 PRO B CB  1 
ATOM   2796 C  CG  . PRO B 1 149 ? 22.294  35.999  19.943  1.00 6.08  ? 149 PRO B CG  1 
ATOM   2797 C  CD  . PRO B 1 149 ? 22.588  34.946  20.970  1.00 5.14  ? 149 PRO B CD  1 
ATOM   2798 N  N   . LEU B 1 150 ? 23.209  37.049  23.766  1.00 5.51  ? 150 LEU B N   1 
ATOM   2799 C  CA  . LEU B 1 150 ? 23.140  37.658  25.107  1.00 6.06  ? 150 LEU B CA  1 
ATOM   2800 C  C   . LEU B 1 150 ? 24.514  37.914  25.740  1.00 6.13  ? 150 LEU B C   1 
ATOM   2801 O  O   . LEU B 1 150 ? 24.638  38.747  26.632  1.00 5.39  ? 150 LEU B O   1 
ATOM   2802 C  CB  . LEU B 1 150 ? 22.285  36.811  26.046  1.00 6.62  ? 150 LEU B CB  1 
ATOM   2803 C  CG  . LEU B 1 150 ? 20.796  36.735  25.720  1.00 5.92  ? 150 LEU B CG  1 
ATOM   2804 C  CD1 . LEU B 1 150 ? 20.054  35.852  26.720  1.00 3.98  ? 150 LEU B CD1 1 
ATOM   2805 C  CD2 . LEU B 1 150 ? 20.175  38.131  25.628  1.00 6.13  ? 150 LEU B CD2 1 
ATOM   2806 N  N   . MET B 1 151 ? 25.535  37.167  25.318  1.00 5.81  ? 151 MET B N   1 
ATOM   2807 C  CA  . MET B 1 151 ? 26.904  37.439  25.779  1.00 6.62  ? 151 MET B CA  1 
ATOM   2808 C  C   . MET B 1 151 ? 27.575  38.697  25.194  1.00 6.86  ? 151 MET B C   1 
ATOM   2809 O  O   . MET B 1 151 ? 28.667  39.078  25.636  1.00 6.92  ? 151 MET B O   1 
ATOM   2810 C  CB  . MET B 1 151 ? 27.809  36.243  25.490  1.00 6.14  ? 151 MET B CB  1 
ATOM   2811 C  CG  . MET B 1 151 ? 27.389  34.978  26.203  1.00 6.02  ? 151 MET B CG  1 
ATOM   2812 S  SD  . MET B 1 151 ? 28.214  33.546  25.455  1.00 2.69  ? 151 MET B SD  1 
ATOM   2813 C  CE  . MET B 1 151 ? 27.397  32.241  26.363  1.00 3.96  ? 151 MET B CE  1 
ATOM   2814 N  N   . GLY B 1 152 ? 26.950  39.326  24.203  1.00 6.87  ? 152 GLY B N   1 
ATOM   2815 C  CA  . GLY B 1 152 ? 27.526  40.492  23.545  1.00 6.73  ? 152 GLY B CA  1 
ATOM   2816 C  C   . GLY B 1 152 ? 28.449  40.216  22.368  1.00 6.81  ? 152 GLY B C   1 
ATOM   2817 O  O   . GLY B 1 152 ? 28.905  39.097  22.164  1.00 5.94  ? 152 GLY B O   1 
ATOM   2818 N  N   . GLU B 1 153 ? 28.705  41.260  21.590  1.00 7.64  ? 153 GLU B N   1 
ATOM   2819 C  CA  . GLU B 1 153 ? 29.552  41.206  20.394  1.00 7.69  ? 153 GLU B CA  1 
ATOM   2820 C  C   . GLU B 1 153 ? 30.991  40.728  20.619  1.00 7.48  ? 153 GLU B C   1 
ATOM   2821 O  O   . GLU B 1 153 ? 31.516  39.870  19.891  1.00 7.02  ? 153 GLU B O   1 
ATOM   2822 C  CB  . GLU B 1 153 ? 29.629  42.612  19.818  1.00 8.93  ? 153 GLU B CB  1 
ATOM   2823 C  CG  . GLU B 1 153 ? 30.200  42.696  18.421  1.00 11.69 ? 153 GLU B CG  1 
ATOM   2824 C  CD  . GLU B 1 153 ? 29.107  42.767  17.372  1.00 15.46 ? 153 GLU B CD  1 
ATOM   2825 O  OE1 . GLU B 1 153 ? 28.418  41.743  17.159  1.00 15.71 ? 153 GLU B OE1 1 
ATOM   2826 O  OE2 . GLU B 1 153 ? 28.942  43.851  16.760  1.00 17.91 ? 153 GLU B OE2 1 
ATOM   2827 N  N   . ALA B 1 154 ? 31.643  41.325  21.609  1.00 7.25  ? 154 ALA B N   1 
ATOM   2828 C  CA  . ALA B 1 154 ? 33.045  41.045  21.904  1.00 7.48  ? 154 ALA B CA  1 
ATOM   2829 C  C   . ALA B 1 154 ? 33.288  39.553  22.081  1.00 7.17  ? 154 ALA B C   1 
ATOM   2830 O  O   . ALA B 1 154 ? 34.203  38.982  21.478  1.00 7.56  ? 154 ALA B O   1 
ATOM   2831 C  CB  . ALA B 1 154 ? 33.458  41.782  23.145  1.00 6.84  ? 154 ALA B CB  1 
ATOM   2832 N  N   . ILE B 1 155 ? 32.453  38.919  22.901  1.00 7.54  ? 155 ILE B N   1 
ATOM   2833 C  CA  . ILE B 1 155 ? 32.521  37.465  23.098  1.00 6.40  ? 155 ILE B CA  1 
ATOM   2834 C  C   . ILE B 1 155 ? 31.914  36.608  21.953  1.00 6.28  ? 155 ILE B C   1 
ATOM   2835 O  O   . ILE B 1 155 ? 32.559  35.658  21.505  1.00 6.35  ? 155 ILE B O   1 
ATOM   2836 C  CB  . ILE B 1 155 ? 31.858  37.062  24.442  1.00 7.09  ? 155 ILE B CB  1 
ATOM   2837 C  CG1 . ILE B 1 155 ? 32.549  37.748  25.625  1.00 7.10  ? 155 ILE B CG1 1 
ATOM   2838 C  CG2 . ILE B 1 155 ? 31.855  35.547  24.611  1.00 6.19  ? 155 ILE B CG2 1 
ATOM   2839 C  CD1 . ILE B 1 155 ? 32.025  37.312  26.974  1.00 6.82  ? 155 ILE B CD1 1 
ATOM   2840 N  N   . SER B 1 156 ? 30.696  36.936  21.493  1.00 5.30  ? 156 SER B N   1 
ATOM   2841 C  CA  . SER B 1 156 ? 29.924  36.045  20.596  1.00 5.32  ? 156 SER B CA  1 
ATOM   2842 C  C   . SER B 1 156 ? 29.910  36.395  19.112  1.00 4.82  ? 156 SER B C   1 
ATOM   2843 O  O   . SER B 1 156 ? 29.447  35.606  18.292  1.00 3.82  ? 156 SER B O   1 
ATOM   2844 C  CB  . SER B 1 156 ? 28.469  35.920  21.083  1.00 5.21  ? 156 SER B CB  1 
ATOM   2845 O  OG  . SER B 1 156 ? 27.698  37.040  20.688  1.00 6.11  ? 156 SER B OG  1 
ATOM   2846 N  N   . GLY B 1 157 ? 30.373  37.585  18.754  1.00 5.00  ? 157 GLY B N   1 
ATOM   2847 C  CA  . GLY B 1 157 ? 30.265  37.999  17.377  1.00 6.13  ? 157 GLY B CA  1 
ATOM   2848 C  C   . GLY B 1 157 ? 28.842  38.425  17.071  1.00 6.00  ? 157 GLY B C   1 
ATOM   2849 O  O   . GLY B 1 157 ? 28.532  38.771  15.934  1.00 5.91  ? 157 GLY B O   1 
ATOM   2850 N  N   . ALA B 1 158 ? 27.974  38.387  18.089  1.00 5.99  ? 158 ALA B N   1 
ATOM   2851 C  CA  . ALA B 1 158 ? 26.552  38.688  17.911  1.00 6.41  ? 158 ALA B CA  1 
ATOM   2852 C  C   . ALA B 1 158 ? 25.951  39.468  19.080  1.00 6.39  ? 158 ALA B C   1 
ATOM   2853 O  O   . ALA B 1 158 ? 26.492  39.485  20.180  1.00 6.97  ? 158 ALA B O   1 
ATOM   2854 C  CB  . ALA B 1 158 ? 25.770  37.385  17.712  1.00 6.69  ? 158 ALA B CB  1 
ATOM   2855 N  N   . SER B 1 159 ? 24.801  40.086  18.857  1.00 6.25  ? 159 SER B N   1 
ATOM   2856 C  CA  . SER B 1 159 ? 24.103  40.732  19.955  1.00 6.53  ? 159 SER B CA  1 
ATOM   2857 C  C   . SER B 1 159 ? 22.604  40.804  19.684  1.00 6.76  ? 159 SER B C   1 
ATOM   2858 O  O   . SER B 1 159 ? 22.140  40.548  18.563  1.00 7.27  ? 159 SER B O   1 
ATOM   2859 C  CB  . SER B 1 159 ? 24.684  42.133  20.205  1.00 6.55  ? 159 SER B CB  1 
ATOM   2860 O  OG  . SER B 1 159 ? 24.487  42.964  19.075  1.00 8.29  ? 159 SER B OG  1 
ATOM   2861 N  N   . GLY B 1 160 ? 21.857  41.166  20.718  1.00 7.25  ? 160 GLY B N   1 
ATOM   2862 C  CA  . GLY B 1 160 ? 20.406  41.243  20.617  1.00 6.97  ? 160 GLY B CA  1 
ATOM   2863 C  C   . GLY B 1 160 ? 19.690  40.301  21.571  1.00 7.31  ? 160 GLY B C   1 
ATOM   2864 O  O   . GLY B 1 160 ? 20.293  39.366  22.096  1.00 6.85  ? 160 GLY B O   1 
ATOM   2865 N  N   . PHE B 1 161 ? 18.415  40.579  21.835  1.00 7.10  ? 161 PHE B N   1 
ATOM   2866 C  CA  . PHE B 1 161 ? 17.563  39.700  22.639  1.00 7.02  ? 161 PHE B CA  1 
ATOM   2867 C  C   . PHE B 1 161 ? 17.009  38.564  21.753  1.00 6.62  ? 161 PHE B C   1 
ATOM   2868 O  O   . PHE B 1 161 ? 16.354  38.829  20.757  1.00 6.54  ? 161 PHE B O   1 
ATOM   2869 C  CB  . PHE B 1 161 ? 16.419  40.528  23.290  1.00 7.67  ? 161 PHE B CB  1 
ATOM   2870 C  CG  . PHE B 1 161 ? 15.422  39.698  24.036  1.00 7.12  ? 161 PHE B CG  1 
ATOM   2871 C  CD1 . PHE B 1 161 ? 15.767  39.096  25.239  1.00 7.69  ? 161 PHE B CD1 1 
ATOM   2872 C  CD2 . PHE B 1 161 ? 14.138  39.522  23.539  1.00 5.87  ? 161 PHE B CD2 1 
ATOM   2873 C  CE1 . PHE B 1 161 ? 14.842  38.310  25.939  1.00 7.78  ? 161 PHE B CE1 1 
ATOM   2874 C  CE2 . PHE B 1 161 ? 13.209  38.729  24.224  1.00 7.18  ? 161 PHE B CE2 1 
ATOM   2875 C  CZ  . PHE B 1 161 ? 13.556  38.137  25.426  1.00 8.00  ? 161 PHE B CZ  1 
ATOM   2876 N  N   . PRO B 1 162 ? 17.308  37.296  22.092  1.00 6.55  ? 162 PRO B N   1 
ATOM   2877 C  CA  . PRO B 1 162 ? 16.806  36.172  21.262  1.00 6.23  ? 162 PRO B CA  1 
ATOM   2878 C  C   . PRO B 1 162 ? 15.292  36.015  21.340  1.00 6.66  ? 162 PRO B C   1 
ATOM   2879 O  O   . PRO B 1 162 ? 14.742  35.904  22.455  1.00 7.01  ? 162 PRO B O   1 
ATOM   2880 C  CB  . PRO B 1 162 ? 17.515  34.934  21.838  1.00 6.01  ? 162 PRO B CB  1 
ATOM   2881 C  CG  . PRO B 1 162 ? 18.611  35.465  22.757  1.00 6.41  ? 162 PRO B CG  1 
ATOM   2882 C  CD  . PRO B 1 162 ? 18.219  36.861  23.163  1.00 6.25  ? 162 PRO B CD  1 
ATOM   2883 N  N   . ILE B 1 163 ? 14.645  36.031  20.165  1.00 6.46  ? 163 ILE B N   1 
ATOM   2884 C  CA  . ILE B 1 163 ? 13.207  35.767  20.005  1.00 6.49  ? 163 ILE B CA  1 
ATOM   2885 C  C   . ILE B 1 163 ? 12.961  34.280  19.848  1.00 6.53  ? 163 ILE B C   1 
ATOM   2886 O  O   . ILE B 1 163 ? 12.050  33.717  20.479  1.00 6.47  ? 163 ILE B O   1 
ATOM   2887 C  CB  . ILE B 1 163 ? 12.654  36.483  18.743  1.00 7.05  ? 163 ILE B CB  1 
ATOM   2888 C  CG1 . ILE B 1 163 ? 12.784  37.992  18.900  1.00 8.35  ? 163 ILE B CG1 1 
ATOM   2889 C  CG2 . ILE B 1 163 ? 11.186  36.074  18.445  1.00 6.31  ? 163 ILE B CG2 1 
ATOM   2890 C  CD1 . ILE B 1 163 ? 12.453  38.509  20.294  1.00 8.86  ? 163 ILE B CD1 1 
ATOM   2891 N  N   . MET B 1 164 ? 13.793  33.656  19.016  1.00 6.04  ? 164 MET B N   1 
ATOM   2892 C  CA  . MET B 1 164 ? 13.730  32.221  18.737  1.00 5.30  ? 164 MET B CA  1 
ATOM   2893 C  C   . MET B 1 164 ? 15.100  31.772  18.172  1.00 5.13  ? 164 MET B C   1 
ATOM   2894 O  O   . MET B 1 164 ? 15.942  32.620  17.819  1.00 4.35  ? 164 MET B O   1 
ATOM   2895 C  CB  . MET B 1 164 ? 12.538  31.957  17.802  1.00 6.16  ? 164 MET B CB  1 
ATOM   2896 C  CG  . MET B 1 164 ? 12.716  30.904  16.740  1.00 7.54  ? 164 MET B CG  1 
ATOM   2897 S  SD  . MET B 1 164 ? 13.907  31.376  15.472  1.00 6.76  ? 164 MET B SD  1 
ATOM   2898 C  CE  . MET B 1 164 ? 12.966  31.922  14.042  1.00 7.45  ? 164 MET B CE  1 
ATOM   2899 N  N   . GLY B 1 165 ? 15.360  30.467  18.136  1.00 3.83  ? 165 GLY B N   1 
ATOM   2900 C  CA  . GLY B 1 165 ? 16.652  29.964  17.649  1.00 3.74  ? 165 GLY B CA  1 
ATOM   2901 C  C   . GLY B 1 165 ? 16.690  28.499  17.258  1.00 4.19  ? 165 GLY B C   1 
ATOM   2902 O  O   . GLY B 1 165 ? 15.898  27.697  17.756  1.00 4.42  ? 165 GLY B O   1 
ATOM   2903 N  N   . LEU B 1 166 ? 17.615  28.154  16.365  1.00 3.51  ? 166 LEU B N   1 
ATOM   2904 C  CA  . LEU B 1 166 ? 17.820  26.773  15.951  1.00 3.28  ? 166 LEU B CA  1 
ATOM   2905 C  C   . LEU B 1 166 ? 19.223  26.261  16.268  1.00 3.33  ? 166 LEU B C   1 
ATOM   2906 O  O   . LEU B 1 166 ? 20.224  26.875  15.927  1.00 3.41  ? 166 LEU B O   1 
ATOM   2907 C  CB  . LEU B 1 166 ? 17.523  26.592  14.457  1.00 2.88  ? 166 LEU B CB  1 
ATOM   2908 C  CG  . LEU B 1 166 ? 17.826  25.226  13.855  1.00 3.26  ? 166 LEU B CG  1 
ATOM   2909 C  CD1 . LEU B 1 166 ? 16.932  24.141  14.488  1.00 2.25  ? 166 LEU B CD1 1 
ATOM   2910 C  CD2 . LEU B 1 166 ? 17.618  25.304  12.348  1.00 1.90  ? 166 LEU B CD2 1 
ATOM   2911 N  N   . ASP B 1 167 ? 19.257  25.135  16.956  1.00 2.36  ? 167 ASP B N   1 
ATOM   2912 C  CA  . ASP B 1 167 ? 20.481  24.414  17.306  1.00 1.67  ? 167 ASP B CA  1 
ATOM   2913 C  C   . ASP B 1 167 ? 21.002  23.671  16.072  1.00 1.78  ? 167 ASP B C   1 
ATOM   2914 O  O   . ASP B 1 167 ? 20.344  22.751  15.561  1.00 1.59  ? 167 ASP B O   1 
ATOM   2915 C  CB  . ASP B 1 167 ? 20.123  23.419  18.422  1.00 1.66  ? 167 ASP B CB  1 
ATOM   2916 C  CG  . ASP B 1 167 ? 21.336  22.723  19.035  1.00 1.44  ? 167 ASP B CG  1 
ATOM   2917 O  OD1 . ASP B 1 167 ? 22.478  23.054  18.631  1.00 1.09  ? 167 ASP B OD1 1 
ATOM   2918 O  OD2 . ASP B 1 167 ? 21.155  21.832  19.927  1.00 1.88  ? 167 ASP B OD2 1 
ATOM   2919 N  N   . VAL B 1 168 ? 22.162  24.063  15.563  1.00 1.67  ? 168 VAL B N   1 
ATOM   2920 C  CA  . VAL B 1 168 ? 22.696  23.365  14.398  1.00 1.46  ? 168 VAL B CA  1 
ATOM   2921 C  C   . VAL B 1 168 ? 23.974  22.594  14.739  1.00 1.59  ? 168 VAL B C   1 
ATOM   2922 O  O   . VAL B 1 168 ? 24.756  22.261  13.854  1.00 1.97  ? 168 VAL B O   1 
ATOM   2923 C  CB  . VAL B 1 168 ? 22.935  24.315  13.169  1.00 1.36  ? 168 VAL B CB  1 
ATOM   2924 C  CG1 . VAL B 1 168 ? 21.630  24.853  12.615  1.00 1.67  ? 168 VAL B CG1 1 
ATOM   2925 C  CG2 . VAL B 1 168 ? 23.864  25.503  13.551  1.00 2.43  ? 168 VAL B CG2 1 
ATOM   2926 N  N   . TRP B 1 169 ? 24.211  22.335  16.028  1.00 1.71  ? 169 TRP B N   1 
ATOM   2927 C  CA  . TRP B 1 169 ? 25.178  21.303  16.371  1.00 1.25  ? 169 TRP B CA  1 
ATOM   2928 C  C   . TRP B 1 169 ? 24.670  20.006  15.729  1.00 1.55  ? 169 TRP B C   1 
ATOM   2929 O  O   . TRP B 1 169 ? 23.464  19.728  15.695  1.00 1.50  ? 169 TRP B O   1 
ATOM   2930 C  CB  . TRP B 1 169 ? 25.249  21.060  17.871  1.00 1.71  ? 169 TRP B CB  1 
ATOM   2931 C  CG  . TRP B 1 169 ? 25.956  22.082  18.670  1.00 1.62  ? 169 TRP B CG  1 
ATOM   2932 C  CD1 . TRP B 1 169 ? 25.691  23.412  18.719  1.00 2.87  ? 169 TRP B CD1 1 
ATOM   2933 C  CD2 . TRP B 1 169 ? 27.029  21.846  19.578  1.00 1.44  ? 169 TRP B CD2 1 
ATOM   2934 N  NE1 . TRP B 1 169 ? 26.557  24.037  19.602  1.00 1.71  ? 169 TRP B NE1 1 
ATOM   2935 C  CE2 . TRP B 1 169 ? 27.378  23.089  20.148  1.00 1.03  ? 169 TRP B CE2 1 
ATOM   2936 C  CE3 . TRP B 1 169 ? 27.730  20.704  19.968  1.00 1.27  ? 169 TRP B CE3 1 
ATOM   2937 C  CZ2 . TRP B 1 169 ? 28.403  23.217  21.060  1.00 0.88  ? 169 TRP B CZ2 1 
ATOM   2938 C  CZ3 . TRP B 1 169 ? 28.732  20.821  20.870  1.00 1.97  ? 169 TRP B CZ3 1 
ATOM   2939 C  CH2 . TRP B 1 169 ? 29.071  22.078  21.421  1.00 1.06  ? 169 TRP B CH2 1 
ATOM   2940 N  N   . GLU B 1 170 ? 25.591  19.199  15.238  1.00 1.82  ? 170 GLU B N   1 
ATOM   2941 C  CA  . GLU B 1 170 ? 25.212  17.968  14.584  1.00 1.90  ? 170 GLU B CA  1 
ATOM   2942 C  C   . GLU B 1 170 ? 24.398  17.046  15.480  1.00 2.29  ? 170 GLU B C   1 
ATOM   2943 O  O   . GLU B 1 170 ? 23.542  16.327  14.970  1.00 2.30  ? 170 GLU B O   1 
ATOM   2944 C  CB  . GLU B 1 170 ? 26.425  17.253  14.000  1.00 1.85  ? 170 GLU B CB  1 
ATOM   2945 C  CG  . GLU B 1 170 ? 26.872  17.898  12.703  1.00 1.37  ? 170 GLU B CG  1 
ATOM   2946 C  CD  . GLU B 1 170 ? 28.266  17.493  12.237  1.00 1.55  ? 170 GLU B CD  1 
ATOM   2947 O  OE1 . GLU B 1 170 ? 29.118  17.070  13.059  1.00 1.66  ? 170 GLU B OE1 1 
ATOM   2948 O  OE2 . GLU B 1 170 ? 28.498  17.624  11.010  1.00 2.43  ? 170 GLU B OE2 1 
ATOM   2949 N  N   . HIS B 1 171 ? 24.652  17.055  16.788  1.00 2.23  ? 171 HIS B N   1 
ATOM   2950 C  CA  . HIS B 1 171 ? 23.848  16.191  17.699  1.00 2.37  ? 171 HIS B CA  1 
ATOM   2951 C  C   . HIS B 1 171 ? 22.348  16.449  17.597  1.00 2.98  ? 171 HIS B C   1 
ATOM   2952 O  O   . HIS B 1 171 ? 21.553  15.553  17.917  1.00 3.39  ? 171 HIS B O   1 
ATOM   2953 C  CB  . HIS B 1 171 ? 24.313  16.260  19.172  1.00 1.99  ? 171 HIS B CB  1 
ATOM   2954 C  CG  . HIS B 1 171 ? 24.090  17.593  19.849  1.00 1.84  ? 171 HIS B CG  1 
ATOM   2955 N  ND1 . HIS B 1 171 ? 25.116  18.297  20.456  1.00 1.44  ? 171 HIS B ND1 1 
ATOM   2956 C  CD2 . HIS B 1 171 ? 22.968  18.332  20.040  1.00 1.71  ? 171 HIS B CD2 1 
ATOM   2957 C  CE1 . HIS B 1 171 ? 24.629  19.410  20.988  1.00 2.05  ? 171 HIS B CE1 1 
ATOM   2958 N  NE2 . HIS B 1 171 ? 23.326  19.454  20.757  1.00 2.39  ? 171 HIS B NE2 1 
ATOM   2959 N  N   . ALA B 1 172 ? 21.967  17.656  17.164  1.00 3.04  ? 172 ALA B N   1 
ATOM   2960 C  CA  . ALA B 1 172 ? 20.562  18.063  17.114  1.00 2.94  ? 172 ALA B CA  1 
ATOM   2961 C  C   . ALA B 1 172 ? 19.852  17.436  15.935  1.00 2.90  ? 172 ALA B C   1 
ATOM   2962 O  O   . ALA B 1 172 ? 18.617  17.387  15.904  1.00 3.03  ? 172 ALA B O   1 
ATOM   2963 C  CB  . ALA B 1 172 ? 20.420  19.612  17.070  1.00 4.02  ? 172 ALA B CB  1 
ATOM   2964 N  N   . TYR B 1 173 ? 20.623  16.967  14.957  1.00 2.57  ? 173 TYR B N   1 
ATOM   2965 C  CA  . TYR B 1 173 ? 20.007  16.526  13.699  1.00 3.07  ? 173 TYR B CA  1 
ATOM   2966 C  C   . TYR B 1 173 ? 20.620  15.285  13.061  1.00 3.31  ? 173 TYR B C   1 
ATOM   2967 O  O   . TYR B 1 173 ? 20.072  14.769  12.078  1.00 2.96  ? 173 TYR B O   1 
ATOM   2968 C  CB  . TYR B 1 173 ? 19.919  17.667  12.668  1.00 3.56  ? 173 TYR B CB  1 
ATOM   2969 C  CG  . TYR B 1 173 ? 21.261  18.164  12.140  1.00 3.44  ? 173 TYR B CG  1 
ATOM   2970 C  CD1 . TYR B 1 173 ? 22.019  17.402  11.254  1.00 2.85  ? 173 TYR B CD1 1 
ATOM   2971 C  CD2 . TYR B 1 173 ? 21.753  19.425  12.507  1.00 4.41  ? 173 TYR B CD2 1 
ATOM   2972 C  CE1 . TYR B 1 173 ? 23.253  17.900  10.749  1.00 3.21  ? 173 TYR B CE1 1 
ATOM   2973 C  CE2 . TYR B 1 173 ? 22.956  19.907  12.031  1.00 4.16  ? 173 TYR B CE2 1 
ATOM   2974 C  CZ  . TYR B 1 173 ? 23.706  19.160  11.162  1.00 4.76  ? 173 TYR B CZ  1 
ATOM   2975 O  OH  . TYR B 1 173 ? 24.904  19.692  10.699  1.00 1.92  ? 173 TYR B OH  1 
ATOM   2976 N  N   . TYR B 1 174 ? 21.707  14.763  13.618  1.00 2.69  ? 174 TYR B N   1 
ATOM   2977 C  CA  . TYR B 1 174 ? 22.408  13.698  12.906  1.00 2.57  ? 174 TYR B CA  1 
ATOM   2978 C  C   . TYR B 1 174 ? 21.654  12.352  12.801  1.00 2.92  ? 174 TYR B C   1 
ATOM   2979 O  O   . TYR B 1 174 ? 21.699  11.678  11.764  1.00 3.95  ? 174 TYR B O   1 
ATOM   2980 C  CB  . TYR B 1 174 ? 23.864  13.528  13.384  1.00 2.56  ? 174 TYR B CB  1 
ATOM   2981 C  CG  . TYR B 1 174 ? 24.759  13.241  12.207  1.00 1.98  ? 174 TYR B CG  1 
ATOM   2982 C  CD1 . TYR B 1 174 ? 25.175  14.271  11.356  1.00 2.17  ? 174 TYR B CD1 1 
ATOM   2983 C  CD2 . TYR B 1 174 ? 25.149  11.941  11.904  1.00 3.16  ? 174 TYR B CD2 1 
ATOM   2984 C  CE1 . TYR B 1 174 ? 25.990  13.994  10.240  1.00 1.25  ? 174 TYR B CE1 1 
ATOM   2985 C  CE2 . TYR B 1 174 ? 25.947  11.663  10.798  1.00 3.50  ? 174 TYR B CE2 1 
ATOM   2986 C  CZ  . TYR B 1 174 ? 26.356  12.701  9.972   1.00 2.47  ? 174 TYR B CZ  1 
ATOM   2987 O  OH  . TYR B 1 174 ? 27.128  12.409  8.883   1.00 2.42  ? 174 TYR B OH  1 
ATOM   2988 N  N   . LEU B 1 175 ? 20.957  11.946  13.848  1.00 3.32  ? 175 LEU B N   1 
ATOM   2989 C  CA  . LEU B 1 175 ? 20.413  10.587  13.868  1.00 3.30  ? 175 LEU B CA  1 
ATOM   2990 C  C   . LEU B 1 175 ? 19.383  10.397  12.761  1.00 3.31  ? 175 LEU B C   1 
ATOM   2991 O  O   . LEU B 1 175 ? 19.284  9.324   12.155  1.00 2.64  ? 175 LEU B O   1 
ATOM   2992 C  CB  . LEU B 1 175 ? 19.782  10.274  15.230  1.00 3.39  ? 175 LEU B CB  1 
ATOM   2993 C  CG  . LEU B 1 175 ? 20.763  10.220  16.408  1.00 3.70  ? 175 LEU B CG  1 
ATOM   2994 C  CD1 . LEU B 1 175 ? 20.034  9.866   17.707  1.00 4.55  ? 175 LEU B CD1 1 
ATOM   2995 C  CD2 . LEU B 1 175 ? 21.915  9.249   16.156  1.00 7.23  ? 175 LEU B CD2 1 
ATOM   2996 N  N   . LYS B 1 176 ? 18.614  11.439  12.506  1.00 2.55  ? 176 LYS B N   1 
ATOM   2997 C  CA  . LYS B 1 176 ? 17.596  11.397  11.461  1.00 3.04  ? 176 LYS B CA  1 
ATOM   2998 C  C   . LYS B 1 176 ? 18.079  11.900  10.103  1.00 3.38  ? 176 LYS B C   1 
ATOM   2999 O  O   . LYS B 1 176 ? 17.774  11.286  9.071   1.00 3.19  ? 176 LYS B O   1 
ATOM   3000 C  CB  . LYS B 1 176 ? 16.369  12.199  11.884  1.00 3.75  ? 176 LYS B CB  1 
ATOM   3001 C  CG  . LYS B 1 176 ? 15.308  12.318  10.784  1.00 4.60  ? 176 LYS B CG  1 
ATOM   3002 C  CD  . LYS B 1 176 ? 14.091  13.162  11.225  1.00 5.72  ? 176 LYS B CD  1 
ATOM   3003 C  CE  . LYS B 1 176 ? 12.970  13.066  10.200  1.00 5.64  ? 176 LYS B CE  1 
ATOM   3004 N  NZ  . LYS B 1 176 ? 11.756  13.818  10.603  1.00 4.95  ? 176 LYS B NZ  1 
ATOM   3005 N  N   . PHE B 1 177 ? 18.825  13.016  10.105  1.00 3.69  ? 177 PHE B N   1 
ATOM   3006 C  CA  . PHE B 1 177 ? 19.131  13.784  8.877   1.00 3.70  ? 177 PHE B CA  1 
ATOM   3007 C  C   . PHE B 1 177 ? 20.583  13.618  8.408   1.00 3.90  ? 177 PHE B C   1 
ATOM   3008 O  O   . PHE B 1 177 ? 20.957  14.093  7.320   1.00 4.66  ? 177 PHE B O   1 
ATOM   3009 C  CB  . PHE B 1 177 ? 18.891  15.295  9.098   1.00 3.69  ? 177 PHE B CB  1 
ATOM   3010 C  CG  . PHE B 1 177 ? 17.474  15.660  9.479   1.00 4.54  ? 177 PHE B CG  1 
ATOM   3011 C  CD1 . PHE B 1 177 ? 16.511  15.953  8.512   1.00 4.33  ? 177 PHE B CD1 1 
ATOM   3012 C  CD2 . PHE B 1 177 ? 17.107  15.751  10.808  1.00 2.97  ? 177 PHE B CD2 1 
ATOM   3013 C  CE1 . PHE B 1 177 ? 15.203  16.306  8.883   1.00 4.55  ? 177 PHE B CE1 1 
ATOM   3014 C  CE2 . PHE B 1 177 ? 15.810  16.086  11.163  1.00 5.50  ? 177 PHE B CE2 1 
ATOM   3015 C  CZ  . PHE B 1 177 ? 14.870  16.373  10.203  1.00 5.14  ? 177 PHE B CZ  1 
ATOM   3016 N  N   . GLN B 1 178 ? 21.393  12.964  9.228   1.00 3.78  ? 178 GLN B N   1 
ATOM   3017 C  CA  . GLN B 1 178 ? 22.846  12.879  8.992   1.00 3.32  ? 178 GLN B CA  1 
ATOM   3018 C  C   . GLN B 1 178 ? 23.379  14.202  8.473   1.00 3.81  ? 178 GLN B C   1 
ATOM   3019 O  O   . GLN B 1 178 ? 23.120  15.238  9.073   1.00 3.97  ? 178 GLN B O   1 
ATOM   3020 C  CB  . GLN B 1 178 ? 23.201  11.714  8.066   1.00 3.62  ? 178 GLN B CB  1 
ATOM   3021 C  CG  . GLN B 1 178 ? 22.756  10.374  8.685   1.00 3.11  ? 178 GLN B CG  1 
ATOM   3022 C  CD  . GLN B 1 178 ? 21.285  10.056  8.381   1.00 4.40  ? 178 GLN B CD  1 
ATOM   3023 O  OE1 . GLN B 1 178 ? 20.905  9.930   7.219   1.00 5.91  ? 178 GLN B OE1 1 
ATOM   3024 N  NE2 . GLN B 1 178 ? 20.466  9.905   9.422   1.00 3.44  ? 178 GLN B NE2 1 
ATOM   3025 N  N   . ASN B 1 179 ? 24.118  14.174  7.366   1.00 3.16  ? 179 ASN B N   1 
ATOM   3026 C  CA  . ASN B 1 179 ? 24.700  15.401  6.871   1.00 4.30  ? 179 ASN B CA  1 
ATOM   3027 C  C   . ASN B 1 179 ? 23.679  16.364  6.316   1.00 3.69  ? 179 ASN B C   1 
ATOM   3028 O  O   . ASN B 1 179 ? 24.027  17.471  5.929   1.00 3.34  ? 179 ASN B O   1 
ATOM   3029 C  CB  . ASN B 1 179 ? 25.656  15.099  5.734   1.00 4.26  ? 179 ASN B CB  1 
ATOM   3030 C  CG  . ASN B 1 179 ? 24.920  14.587  4.518   1.00 7.40  ? 179 ASN B CG  1 
ATOM   3031 O  OD1 . ASN B 1 179 ? 24.790  15.281  3.492   1.00 9.64  ? 179 ASN B OD1 1 
ATOM   3032 N  ND2 . ASN B 1 179 ? 24.388  13.388  4.640   1.00 5.28  ? 179 ASN B ND2 1 
ATOM   3033 N  N   . ARG B 1 180 ? 22.415  15.955  6.227   1.00 3.82  ? 180 ARG B N   1 
ATOM   3034 C  CA  . ARG B 1 180 ? 21.442  16.776  5.499   1.00 4.21  ? 180 ARG B CA  1 
ATOM   3035 C  C   . ARG B 1 180 ? 20.867  17.933  6.334   1.00 4.19  ? 180 ARG B C   1 
ATOM   3036 O  O   . ARG B 1 180 ? 19.649  18.000  6.589   1.00 3.98  ? 180 ARG B O   1 
ATOM   3037 C  CB  . ARG B 1 180 ? 20.329  15.897  4.878   1.00 4.76  ? 180 ARG B CB  1 
ATOM   3038 C  CG  . ARG B 1 180 ? 20.899  14.781  4.009   1.00 5.26  ? 180 ARG B CG  1 
ATOM   3039 C  CD  . ARG B 1 180 ? 19.804  13.967  3.407   1.00 6.22  ? 180 ARG B CD  1 
ATOM   3040 N  NE  . ARG B 1 180 ? 19.084  13.246  4.440   1.00 7.38  ? 180 ARG B NE  1 
ATOM   3041 C  CZ  . ARG B 1 180 ? 19.587  12.202  5.088   1.00 8.11  ? 180 ARG B CZ  1 
ATOM   3042 N  NH1 . ARG B 1 180 ? 20.820  11.789  4.816   1.00 9.17  ? 180 ARG B NH1 1 
ATOM   3043 N  NH2 . ARG B 1 180 ? 18.869  11.587  6.022   1.00 8.73  ? 180 ARG B NH2 1 
ATOM   3044 N  N   . ARG B 1 181 ? 21.738  18.851  6.751   1.00 3.87  ? 181 ARG B N   1 
ATOM   3045 C  CA  . ARG B 1 181 ? 21.301  19.946  7.606   1.00 3.15  ? 181 ARG B CA  1 
ATOM   3046 C  C   . ARG B 1 181 ? 20.199  20.771  6.945   1.00 3.19  ? 181 ARG B C   1 
ATOM   3047 O  O   . ARG B 1 181 ? 19.283  21.213  7.605   1.00 2.24  ? 181 ARG B O   1 
ATOM   3048 C  CB  . ARG B 1 181 ? 22.470  20.851  8.054   1.00 2.69  ? 181 ARG B CB  1 
ATOM   3049 C  CG  . ARG B 1 181 ? 22.018  21.956  9.046   1.00 3.28  ? 181 ARG B CG  1 
ATOM   3050 C  CD  . ARG B 1 181 ? 23.079  23.022  9.344   1.00 2.45  ? 181 ARG B CD  1 
ATOM   3051 N  NE  . ARG B 1 181 ? 24.283  22.492  9.960   1.00 2.46  ? 181 ARG B NE  1 
ATOM   3052 C  CZ  . ARG B 1 181 ? 25.322  23.274  10.225  1.00 1.72  ? 181 ARG B CZ  1 
ATOM   3053 N  NH1 . ARG B 1 181 ? 25.231  24.568  9.937   1.00 3.69  ? 181 ARG B NH1 1 
ATOM   3054 N  NH2 . ARG B 1 181 ? 26.418  22.790  10.764  1.00 2.61  ? 181 ARG B NH2 1 
ATOM   3055 N  N   . PRO B 1 182 ? 20.279  20.987  5.621   1.00 3.42  ? 182 PRO B N   1 
ATOM   3056 C  CA  . PRO B 1 182 ? 19.179  21.754  5.023   1.00 3.79  ? 182 PRO B CA  1 
ATOM   3057 C  C   . PRO B 1 182 ? 17.811  21.086  5.189   1.00 3.80  ? 182 PRO B C   1 
ATOM   3058 O  O   . PRO B 1 182 ? 16.807  21.783  5.252   1.00 4.13  ? 182 PRO B O   1 
ATOM   3059 C  CB  . PRO B 1 182 ? 19.555  21.798  3.538   1.00 3.39  ? 182 PRO B CB  1 
ATOM   3060 C  CG  . PRO B 1 182 ? 21.076  21.752  3.572   1.00 3.71  ? 182 PRO B CG  1 
ATOM   3061 C  CD  . PRO B 1 182 ? 21.369  20.736  4.661   1.00 3.06  ? 182 PRO B CD  1 
ATOM   3062 N  N   . ASP B 1 183 ? 17.773  19.758  5.238   1.00 4.64  ? 183 ASP B N   1 
ATOM   3063 C  CA  . ASP B 1 183 ? 16.484  19.054  5.419   1.00 4.17  ? 183 ASP B CA  1 
ATOM   3064 C  C   . ASP B 1 183 ? 16.002  19.252  6.851   1.00 4.43  ? 183 ASP B C   1 
ATOM   3065 O  O   . ASP B 1 183 ? 14.810  19.430  7.100   1.00 4.22  ? 183 ASP B O   1 
ATOM   3066 C  CB  . ASP B 1 183 ? 16.575  17.555  5.074   1.00 4.65  ? 183 ASP B CB  1 
ATOM   3067 C  CG  . ASP B 1 183 ? 16.746  17.293  3.576   1.00 5.09  ? 183 ASP B CG  1 
ATOM   3068 O  OD1 . ASP B 1 183 ? 17.166  16.171  3.232   1.00 5.85  ? 183 ASP B OD1 1 
ATOM   3069 O  OD2 . ASP B 1 183 ? 16.504  18.207  2.751   1.00 5.63  ? 183 ASP B OD2 1 
ATOM   3070 N  N   . TYR B 1 184 ? 16.944  19.231  7.787   1.00 4.07  ? 184 TYR B N   1 
ATOM   3071 C  CA  . TYR B 1 184 ? 16.647  19.544  9.179   1.00 4.03  ? 184 TYR B CA  1 
ATOM   3072 C  C   . TYR B 1 184 ? 16.139  20.981  9.327   1.00 4.09  ? 184 TYR B C   1 
ATOM   3073 O  O   . TYR B 1 184 ? 15.151  21.232  9.989   1.00 3.73  ? 184 TYR B O   1 
ATOM   3074 C  CB  . TYR B 1 184 ? 17.918  19.337  9.986   1.00 4.19  ? 184 TYR B CB  1 
ATOM   3075 C  CG  . TYR B 1 184 ? 17.895  19.858  11.400  1.00 4.67  ? 184 TYR B CG  1 
ATOM   3076 C  CD1 . TYR B 1 184 ? 17.071  19.284  12.370  1.00 5.69  ? 184 TYR B CD1 1 
ATOM   3077 C  CD2 . TYR B 1 184 ? 18.728  20.900  11.780  1.00 5.25  ? 184 TYR B CD2 1 
ATOM   3078 C  CE1 . TYR B 1 184 ? 17.066  19.776  13.677  1.00 4.96  ? 184 TYR B CE1 1 
ATOM   3079 C  CE2 . TYR B 1 184 ? 18.739  21.382  13.071  1.00 4.55  ? 184 TYR B CE2 1 
ATOM   3080 C  CZ  . TYR B 1 184 ? 17.917  20.816  14.025  1.00 3.42  ? 184 TYR B CZ  1 
ATOM   3081 O  OH  . TYR B 1 184 ? 17.947  21.316  15.320  1.00 2.12  ? 184 TYR B OH  1 
ATOM   3082 N  N   . ILE B 1 185 ? 16.840  21.935  8.723   1.00 4.38  ? 185 ILE B N   1 
ATOM   3083 C  CA  . ILE B 1 185 ? 16.412  23.328  8.759   1.00 5.24  ? 185 ILE B CA  1 
ATOM   3084 C  C   . ILE B 1 185 ? 15.006  23.527  8.189   1.00 5.96  ? 185 ILE B C   1 
ATOM   3085 O  O   . ILE B 1 185 ? 14.229  24.343  8.694   1.00 6.32  ? 185 ILE B O   1 
ATOM   3086 C  CB  . ILE B 1 185 ? 17.404  24.197  7.971   1.00 5.12  ? 185 ILE B CB  1 
ATOM   3087 C  CG1 . ILE B 1 185 ? 18.775  24.117  8.649   1.00 3.32  ? 185 ILE B CG1 1 
ATOM   3088 C  CG2 . ILE B 1 185 ? 16.894  25.627  7.842   1.00 6.11  ? 185 ILE B CG2 1 
ATOM   3089 C  CD1 . ILE B 1 185 ? 19.917  24.844  7.884   1.00 3.45  ? 185 ILE B CD1 1 
ATOM   3090 N  N   . LYS B 1 186 ? 14.674  22.779  7.135   1.00 6.44  ? 186 LYS B N   1 
ATOM   3091 C  CA  . LYS B 1 186 ? 13.339  22.884  6.540   1.00 6.94  ? 186 LYS B CA  1 
ATOM   3092 C  C   . LYS B 1 186 ? 12.302  22.413  7.536   1.00 6.28  ? 186 LYS B C   1 
ATOM   3093 O  O   . LYS B 1 186 ? 11.265  23.035  7.699   1.00 6.27  ? 186 LYS B O   1 
ATOM   3094 C  CB  . LYS B 1 186 ? 13.241  22.113  5.221   1.00 8.09  ? 186 LYS B CB  1 
ATOM   3095 C  CG  . LYS B 1 186 ? 13.730  22.899  4.032   1.00 10.21 ? 186 LYS B CG  1 
ATOM   3096 C  CD  . LYS B 1 186 ? 14.515  22.009  3.082   1.00 12.83 ? 186 LYS B CD  1 
ATOM   3097 C  CE  . LYS B 1 186 ? 15.598  22.799  2.348   1.00 14.09 ? 186 LYS B CE  1 
ATOM   3098 N  NZ  . LYS B 1 186 ? 16.504  23.543  3.309   1.00 15.83 ? 186 LYS B NZ  1 
ATOM   3099 N  N   . GLU B 1 187 ? 12.624  21.347  8.249   1.00 6.35  ? 187 GLU B N   1 
ATOM   3100 C  CA  . GLU B 1 187 ? 11.686  20.811  9.240   1.00 5.40  ? 187 GLU B CA  1 
ATOM   3101 C  C   . GLU B 1 187 ? 11.452  21.746  10.421  1.00 5.08  ? 187 GLU B C   1 
ATOM   3102 O  O   . GLU B 1 187 ? 10.374  21.766  11.014  1.00 3.42  ? 187 GLU B O   1 
ATOM   3103 C  CB  . GLU B 1 187 ? 12.191  19.455  9.732   1.00 6.25  ? 187 GLU B CB  1 
ATOM   3104 C  CG  . GLU B 1 187 ? 11.925  18.320  8.768   1.00 7.85  ? 187 GLU B CG  1 
ATOM   3105 C  CD  . GLU B 1 187 ? 10.430  18.098  8.499   1.00 10.28 ? 187 GLU B CD  1 
ATOM   3106 O  OE1 . GLU B 1 187 ? 10.116  17.231  7.656   1.00 12.75 ? 187 GLU B OE1 1 
ATOM   3107 O  OE2 . GLU B 1 187 ? 9.579   18.796  9.105   1.00 10.56 ? 187 GLU B OE2 1 
ATOM   3108 N  N   . PHE B 1 188 ? 12.477  22.496  10.808  1.00 4.00  ? 188 PHE B N   1 
ATOM   3109 C  CA  . PHE B 1 188 ? 12.351  23.421  11.929  1.00 4.99  ? 188 PHE B CA  1 
ATOM   3110 C  C   . PHE B 1 188 ? 11.162  24.361  11.720  1.00 5.03  ? 188 PHE B C   1 
ATOM   3111 O  O   . PHE B 1 188 ? 10.504  24.778  12.682  1.00 5.38  ? 188 PHE B O   1 
ATOM   3112 C  CB  . PHE B 1 188 ? 13.667  24.208  12.076  1.00 4.14  ? 188 PHE B CB  1 
ATOM   3113 C  CG  . PHE B 1 188 ? 13.597  25.390  13.031  1.00 4.99  ? 188 PHE B CG  1 
ATOM   3114 C  CD1 . PHE B 1 188 ? 13.388  25.200  14.388  1.00 5.23  ? 188 PHE B CD1 1 
ATOM   3115 C  CD2 . PHE B 1 188 ? 13.770  26.683  12.572  1.00 6.01  ? 188 PHE B CD2 1 
ATOM   3116 C  CE1 . PHE B 1 188 ? 13.337  26.280  15.262  1.00 4.91  ? 188 PHE B CE1 1 
ATOM   3117 C  CE2 . PHE B 1 188 ? 13.733  27.764  13.437  1.00 7.28  ? 188 PHE B CE2 1 
ATOM   3118 C  CZ  . PHE B 1 188 ? 13.525  27.558  14.800  1.00 5.88  ? 188 PHE B CZ  1 
ATOM   3119 N  N   . TRP B 1 189 ? 10.875  24.695  10.465  1.00 5.18  ? 189 TRP B N   1 
ATOM   3120 C  CA  . TRP B 1 189 ? 9.772   25.612  10.187  1.00 4.89  ? 189 TRP B CA  1 
ATOM   3121 C  C   . TRP B 1 189 ? 8.442   25.060  10.669  1.00 4.90  ? 189 TRP B C   1 
ATOM   3122 O  O   . TRP B 1 189 ? 7.558   25.826  11.028  1.00 4.64  ? 189 TRP B O   1 
ATOM   3123 C  CB  . TRP B 1 189 ? 9.698   26.020  8.705   1.00 4.99  ? 189 TRP B CB  1 
ATOM   3124 C  CG  . TRP B 1 189 ? 10.878  26.856  8.229   1.00 4.71  ? 189 TRP B CG  1 
ATOM   3125 C  CD1 . TRP B 1 189 ? 11.698  26.596  7.155   1.00 5.39  ? 189 TRP B CD1 1 
ATOM   3126 C  CD2 . TRP B 1 189 ? 11.358  28.078  8.808   1.00 5.60  ? 189 TRP B CD2 1 
ATOM   3127 N  NE1 . TRP B 1 189 ? 12.655  27.588  7.037   1.00 6.06  ? 189 TRP B NE1 1 
ATOM   3128 C  CE2 . TRP B 1 189 ? 12.462  28.510  8.030   1.00 5.60  ? 189 TRP B CE2 1 
ATOM   3129 C  CE3 . TRP B 1 189 ? 10.955  28.858  9.898   1.00 7.18  ? 189 TRP B CE3 1 
ATOM   3130 C  CZ2 . TRP B 1 189 ? 13.191  29.676  8.334   1.00 5.42  ? 189 TRP B CZ2 1 
ATOM   3131 C  CZ3 . TRP B 1 189 ? 11.672  30.013  10.200  1.00 5.46  ? 189 TRP B CZ3 1 
ATOM   3132 C  CH2 . TRP B 1 189 ? 12.781  30.412  9.419   1.00 5.16  ? 189 TRP B CH2 1 
ATOM   3133 N  N   . ASN B 1 190 ? 8.344   23.734  10.686  1.00 4.35  ? 190 ASN B N   1 
ATOM   3134 C  CA  . ASN B 1 190 ? 7.118   23.034  11.098  1.00 5.32  ? 190 ASN B CA  1 
ATOM   3135 C  C   . ASN B 1 190 ? 7.032   22.898  12.615  1.00 5.43  ? 190 ASN B C   1 
ATOM   3136 O  O   . ASN B 1 190 ? 5.964   22.580  13.157  1.00 5.68  ? 190 ASN B O   1 
ATOM   3137 C  CB  . ASN B 1 190 ? 7.040   21.654  10.453  1.00 5.75  ? 190 ASN B CB  1 
ATOM   3138 C  CG  . ASN B 1 190 ? 6.417   21.677  9.056   1.00 8.48  ? 190 ASN B CG  1 
ATOM   3139 O  OD1 . ASN B 1 190 ? 6.265   22.712  8.454   1.00 9.39  ? 190 ASN B OD1 1 
ATOM   3140 N  ND2 . ASN B 1 190 ? 6.031   20.509  8.564   1.00 12.16 ? 190 ASN B ND2 1 
ATOM   3141 N  N   . VAL B 1 191 ? 8.143   23.149  13.304  1.00 5.16  ? 191 VAL B N   1 
ATOM   3142 C  CA  . VAL B 1 191 ? 8.132   23.034  14.767  1.00 4.91  ? 191 VAL B CA  1 
ATOM   3143 C  C   . VAL B 1 191 ? 8.545   24.287  15.529  1.00 4.81  ? 191 VAL B C   1 
ATOM   3144 O  O   . VAL B 1 191 ? 8.533   24.318  16.760  1.00 4.17  ? 191 VAL B O   1 
ATOM   3145 C  CB  . VAL B 1 191 ? 8.930   21.774  15.251  1.00 5.62  ? 191 VAL B CB  1 
ATOM   3146 C  CG1 . VAL B 1 191 ? 8.193   20.531  14.844  1.00 5.65  ? 191 VAL B CG1 1 
ATOM   3147 C  CG2 . VAL B 1 191 ? 10.356  21.765  14.683  1.00 4.92  ? 191 VAL B CG2 1 
ATOM   3148 N  N   . VAL B 1 192 ? 8.895   25.351  14.819  1.00 4.32  ? 192 VAL B N   1 
ATOM   3149 C  CA  . VAL B 1 192 ? 9.236   26.567  15.547  1.00 4.28  ? 192 VAL B CA  1 
ATOM   3150 C  C   . VAL B 1 192 ? 7.992   27.143  16.248  1.00 4.57  ? 192 VAL B C   1 
ATOM   3151 O  O   . VAL B 1 192 ? 6.915   27.222  15.653  1.00 3.86  ? 192 VAL B O   1 
ATOM   3152 C  CB  . VAL B 1 192 ? 9.959   27.602  14.642  1.00 4.63  ? 192 VAL B CB  1 
ATOM   3153 C  CG1 . VAL B 1 192 ? 9.096   27.978  13.478  1.00 6.09  ? 192 VAL B CG1 1 
ATOM   3154 C  CG2 . VAL B 1 192 ? 10.366  28.826  15.453  1.00 4.24  ? 192 VAL B CG2 1 
ATOM   3155 N  N   . ASN B 1 193 ? 8.113   27.474  17.531  1.00 4.96  ? 193 ASN B N   1 
ATOM   3156 C  CA  . ASN B 1 193 ? 6.929   27.870  18.323  1.00 5.59  ? 193 ASN B CA  1 
ATOM   3157 C  C   . ASN B 1 193 ? 6.600   29.354  18.192  1.00 5.64  ? 193 ASN B C   1 
ATOM   3158 O  O   . ASN B 1 193 ? 7.107   30.183  18.936  1.00 5.14  ? 193 ASN B O   1 
ATOM   3159 C  CB  . ASN B 1 193 ? 7.084   27.418  19.802  1.00 5.51  ? 193 ASN B CB  1 
ATOM   3160 C  CG  . ASN B 1 193 ? 5.903   27.834  20.681  1.00 6.35  ? 193 ASN B CG  1 
ATOM   3161 O  OD1 . ASN B 1 193 ? 4.909   28.390  20.207  1.00 6.69  ? 193 ASN B OD1 1 
ATOM   3162 N  ND2 . ASN B 1 193 ? 6.026   27.580  21.982  1.00 7.41  ? 193 ASN B ND2 1 
ATOM   3163 N  N   . TRP B 1 194 ? 5.751   29.692  17.221  1.00 6.37  ? 194 TRP B N   1 
ATOM   3164 C  CA  . TRP B 1 194 ? 5.426   31.108  16.988  1.00 5.93  ? 194 TRP B CA  1 
ATOM   3165 C  C   . TRP B 1 194 ? 4.698   31.793  18.149  1.00 6.36  ? 194 TRP B C   1 
ATOM   3166 O  O   . TRP B 1 194 ? 4.831   33.002  18.345  1.00 5.55  ? 194 TRP B O   1 
ATOM   3167 C  CB  . TRP B 1 194 ? 4.682   31.310  15.654  1.00 6.11  ? 194 TRP B CB  1 
ATOM   3168 C  CG  . TRP B 1 194 ? 5.571   31.020  14.468  1.00 6.00  ? 194 TRP B CG  1 
ATOM   3169 C  CD1 . TRP B 1 194 ? 5.416   30.034  13.532  1.00 6.97  ? 194 TRP B CD1 1 
ATOM   3170 C  CD2 . TRP B 1 194 ? 6.796   31.689  14.145  1.00 6.51  ? 194 TRP B CD2 1 
ATOM   3171 N  NE1 . TRP B 1 194 ? 6.462   30.073  12.627  1.00 6.61  ? 194 TRP B NE1 1 
ATOM   3172 C  CE2 . TRP B 1 194 ? 7.315   31.084  12.987  1.00 6.21  ? 194 TRP B CE2 1 
ATOM   3173 C  CE3 . TRP B 1 194 ? 7.494   32.756  14.720  1.00 7.25  ? 194 TRP B CE3 1 
ATOM   3174 C  CZ2 . TRP B 1 194 ? 8.507   31.503  12.402  1.00 5.40  ? 194 TRP B CZ2 1 
ATOM   3175 C  CZ3 . TRP B 1 194 ? 8.663   33.173  14.131  1.00 6.40  ? 194 TRP B CZ3 1 
ATOM   3176 C  CH2 . TRP B 1 194 ? 9.161   32.544  12.990  1.00 6.16  ? 194 TRP B CH2 1 
ATOM   3177 N  N   . ASP B 1 195 ? 3.959   31.019  18.941  1.00 6.98  ? 195 ASP B N   1 
ATOM   3178 C  CA  . ASP B 1 195 ? 3.311   31.573  20.126  1.00 7.27  ? 195 ASP B CA  1 
ATOM   3179 C  C   . ASP B 1 195 ? 4.371   32.061  21.129  1.00 7.35  ? 195 ASP B C   1 
ATOM   3180 O  O   . ASP B 1 195 ? 4.284   33.180  21.635  1.00 8.06  ? 195 ASP B O   1 
ATOM   3181 C  CB  . ASP B 1 195 ? 2.360   30.546  20.775  1.00 7.15  ? 195 ASP B CB  1 
ATOM   3182 C  CG  . ASP B 1 195 ? 1.297   30.025  19.811  1.00 8.43  ? 195 ASP B CG  1 
ATOM   3183 O  OD1 . ASP B 1 195 ? 1.106   30.615  18.734  1.00 11.14 ? 195 ASP B OD1 1 
ATOM   3184 O  OD2 . ASP B 1 195 ? 0.646   28.997  20.115  1.00 9.67  ? 195 ASP B OD2 1 
ATOM   3185 N  N   . GLU B 1 196 ? 5.370   31.226  21.402  1.00 6.85  ? 196 GLU B N   1 
ATOM   3186 C  CA  . GLU B 1 196 ? 6.434   31.597  22.344  1.00 6.45  ? 196 GLU B CA  1 
ATOM   3187 C  C   . GLU B 1 196 ? 7.303   32.724  21.786  1.00 5.88  ? 196 GLU B C   1 
ATOM   3188 O  O   . GLU B 1 196 ? 7.604   33.692  22.489  1.00 5.61  ? 196 GLU B O   1 
ATOM   3189 C  CB  . GLU B 1 196 ? 7.253   30.361  22.750  1.00 6.42  ? 196 GLU B CB  1 
ATOM   3190 C  CG  . GLU B 1 196 ? 8.265   30.592  23.892  1.00 6.17  ? 196 GLU B CG  1 
ATOM   3191 C  CD  . GLU B 1 196 ? 7.637   31.070  25.195  1.00 8.79  ? 196 GLU B CD  1 
ATOM   3192 O  OE1 . GLU B 1 196 ? 6.452   30.767  25.489  1.00 9.84  ? 196 GLU B OE1 1 
ATOM   3193 O  OE2 . GLU B 1 196 ? 8.349   31.765  25.953  1.00 9.86  ? 196 GLU B OE2 1 
ATOM   3194 N  N   . ALA B 1 197 ? 7.660   32.621  20.511  1.00 6.03  ? 197 ALA B N   1 
ATOM   3195 C  CA  . ALA B 1 197 ? 8.386   33.694  19.839  1.00 6.44  ? 197 ALA B CA  1 
ATOM   3196 C  C   . ALA B 1 197 ? 7.617   35.015  19.980  1.00 6.79  ? 197 ALA B C   1 
ATOM   3197 O  O   . ALA B 1 197 ? 8.179   36.061  20.370  1.00 8.24  ? 197 ALA B O   1 
ATOM   3198 C  CB  . ALA B 1 197 ? 8.597   33.343  18.365  1.00 6.79  ? 197 ALA B CB  1 
ATOM   3199 N  N   . ALA B 1 198 ? 6.323   34.974  19.683  1.00 6.86  ? 198 ALA B N   1 
ATOM   3200 C  CA  . ALA B 1 198 ? 5.482   36.162  19.853  1.00 6.77  ? 198 ALA B CA  1 
ATOM   3201 C  C   . ALA B 1 198 ? 5.470   36.679  21.299  1.00 7.41  ? 198 ALA B C   1 
ATOM   3202 O  O   . ALA B 1 198 ? 5.489   37.897  21.528  1.00 7.29  ? 198 ALA B O   1 
ATOM   3203 C  CB  . ALA B 1 198 ? 4.066   35.892  19.373  1.00 6.59  ? 198 ALA B CB  1 
ATOM   3204 N  N   . ALA B 1 199 ? 5.426   35.769  22.268  1.00 7.25  ? 199 ALA B N   1 
ATOM   3205 C  CA  . ALA B 1 199 ? 5.434   36.176  23.673  1.00 7.85  ? 199 ALA B CA  1 
ATOM   3206 C  C   . ALA B 1 199 ? 6.755   36.871  24.005  1.00 8.57  ? 199 ALA B C   1 
ATOM   3207 O  O   . ALA B 1 199 ? 6.760   37.984  24.552  1.00 9.69  ? 199 ALA B O   1 
ATOM   3208 C  CB  . ALA B 1 199 ? 5.167   34.988  24.598  1.00 7.93  ? 199 ALA B CB  1 
ATOM   3209 N  N   . ARG B 1 200 ? 7.871   36.253  23.627  1.00 8.60  ? 200 ARG B N   1 
ATOM   3210 C  CA  . ARG B 1 200 ? 9.179   36.907  23.779  1.00 9.31  ? 200 ARG B CA  1 
ATOM   3211 C  C   . ARG B 1 200 ? 9.243   38.276  23.090  1.00 9.76  ? 200 ARG B C   1 
ATOM   3212 O  O   . ARG B 1 200 ? 9.689   39.259  23.687  1.00 10.51 ? 200 ARG B O   1 
ATOM   3213 C  CB  . ARG B 1 200 ? 10.306  35.990  23.289  1.00 8.97  ? 200 ARG B CB  1 
ATOM   3214 C  CG  . ARG B 1 200 ? 10.517  34.750  24.181  1.00 7.63  ? 200 ARG B CG  1 
ATOM   3215 C  CD  . ARG B 1 200 ? 11.648  33.873  23.684  1.00 6.80  ? 200 ARG B CD  1 
ATOM   3216 N  NE  . ARG B 1 200 ? 12.941  34.533  23.917  1.00 6.64  ? 200 ARG B NE  1 
ATOM   3217 C  CZ  . ARG B 1 200 ? 13.611  34.495  25.067  1.00 7.10  ? 200 ARG B CZ  1 
ATOM   3218 N  NH1 . ARG B 1 200 ? 13.149  33.798  26.108  1.00 6.31  ? 200 ARG B NH1 1 
ATOM   3219 N  NH2 . ARG B 1 200 ? 14.756  35.148  25.183  1.00 7.81  ? 200 ARG B NH2 1 
ATOM   3220 N  N   . PHE B 1 201 ? 8.823   38.349  21.832  1.00 10.08 ? 201 PHE B N   1 
ATOM   3221 C  CA  . PHE B 1 201 ? 8.785   39.644  21.168  1.00 10.63 ? 201 PHE B CA  1 
ATOM   3222 C  C   . PHE B 1 201 ? 8.218   40.663  22.179  1.00 11.34 ? 201 PHE B C   1 
ATOM   3223 O  O   . PHE B 1 201 ? 8.321   41.876  21.980  1.00 12.12 ? 201 PHE B O   1 
ATOM   3224 C  CB  . PHE B 1 201 ? 8.002   39.570  19.851  1.00 10.52 ? 201 PHE B CB  1 
ATOM   3225 C  CG  . PHE B 1 201 ? 8.053   40.834  19.034  1.00 11.21 ? 201 PHE B CG  1 
ATOM   3226 C  CD1 . PHE B 1 201 ? 9.272   41.395  18.666  1.00 12.40 ? 201 PHE B CD1 1 
ATOM   3227 C  CD2 . PHE B 1 201 ? 6.878   41.445  18.613  1.00 11.35 ? 201 PHE B CD2 1 
ATOM   3228 C  CE1 . PHE B 1 201 ? 9.321   42.559  17.910  1.00 12.35 ? 201 PHE B CE1 1 
ATOM   3229 C  CE2 . PHE B 1 201 ? 6.913   42.617  17.852  1.00 11.68 ? 201 PHE B CE2 1 
ATOM   3230 C  CZ  . PHE B 1 201 ? 8.139   43.177  17.502  1.00 12.43 ? 201 PHE B CZ  1 
ATOM   3231 N  N   . ALA B 1 202 ? 7.678   40.149  23.295  1.00 12.60 ? 202 ALA B N   1 
ATOM   3232 C  CA  . ALA B 1 202 ? 7.226   40.990  24.436  1.00 12.39 ? 202 ALA B CA  1 
ATOM   3233 C  C   . ALA B 1 202 ? 8.287   41.160  25.546  1.00 12.76 ? 202 ALA B C   1 
ATOM   3234 O  O   . ALA B 1 202 ? 8.422   42.247  26.114  1.00 13.40 ? 202 ALA B O   1 
ATOM   3235 C  CB  . ALA B 1 202 ? 5.904   40.474  25.016  1.00 13.10 ? 202 ALA B CB  1 
ATOM   3236 N  N   . ALA B 1 203 ? 9.048   40.101  25.852  1.00 12.77 ? 203 ALA B N   1 
ATOM   3237 C  CA  . ALA B 1 203 ? 10.174  40.211  26.797  1.00 12.72 ? 203 ALA B CA  1 
ATOM   3238 C  C   . ALA B 1 203 ? 11.209  41.227  26.311  1.00 12.77 ? 203 ALA B C   1 
ATOM   3239 O  O   . ALA B 1 203 ? 12.257  41.446  26.951  1.00 13.55 ? 203 ALA B O   1 
ATOM   3240 C  CB  . ALA B 1 203 ? 10.839  38.844  27.020  1.00 12.57 ? 203 ALA B CB  1 
ATOM   3241 N  N   . LYS B 1 204 ? 10.927  41.833  25.161  1.00 12.61 ? 204 LYS B N   1 
ATOM   3242 C  CA  . LYS B 1 204 ? 11.839  42.812  24.633  1.00 12.56 ? 204 LYS B CA  1 
ATOM   3243 C  C   . LYS B 1 204 ? 13.139  42.666  25.399  1.00 12.76 ? 204 LYS B C   1 
ATOM   3244 O  O   . LYS B 1 204 ? 14.228  42.757  24.828  1.00 14.04 ? 204 LYS B O   1 
ATOM   3245 C  CB  . LYS B 1 204 ? 11.275  44.218  24.811  1.00 12.37 ? 204 LYS B CB  1 
ATOM   3246 C  CG  . LYS B 1 204 ? 10.006  44.474  24.008  1.00 12.30 ? 204 LYS B CG  1 
ATOM   3247 C  CD  . LYS B 1 204 ? 9.882   45.930  23.578  1.00 14.13 ? 204 LYS B CD  1 
ATOM   3248 C  CE  . LYS B 1 204 ? 8.660   46.139  22.671  1.00 14.50 ? 204 LYS B CE  1 
ATOM   3249 N  NZ  . LYS B 1 204 ? 8.637   45.138  21.557  1.00 15.06 ? 204 LYS B NZ  1 
ATOM   3250 N  N   . LYS B 1 205 ? 13.031  42.402  26.693  1.00 13.53 ? 205 LYS B N   1 
ATOM   3251 C  CA  . LYS B 1 205 ? 14.229  42.288  27.516  1.00 13.94 ? 205 LYS B CA  1 
ATOM   3252 C  C   . LYS B 1 205 ? 14.301  40.930  28.188  1.00 14.12 ? 205 LYS B C   1 
ATOM   3253 O  O   . LYS B 1 205 ? 13.268  40.257  28.335  1.00 14.76 ? 205 LYS B O   1 
ATOM   3254 C  CB  . LYS B 1 205 ? 14.341  43.443  28.532  1.00 14.23 ? 205 LYS B CB  1 
ATOM   3255 C  CG  . LYS B 1 205 ? 14.892  44.749  27.925  1.00 14.65 ? 205 LYS B CG  1 
ATOM   3256 C  CD  . LYS B 1 205 ? 15.791  45.538  28.878  1.00 15.30 ? 205 LYS B CD  1 
ATOM   3257 C  CE  . LYS B 1 205 ? 14.996  46.289  29.952  1.00 14.56 ? 205 LYS B CE  1 
ATOM   3258 N  NZ  . LYS B 1 205 ? 15.724  47.484  30.482  1.00 14.55 ? 205 LYS B NZ  1 
ATOM   3259 O  OXT . LYS B 1 205 ? 15.396  40.483  28.545  1.00 15.01 ? 205 LYS B OXT 1 
ATOM   3260 N  N   . SER C 1 1   ? 79.677  11.972  54.854  1.00 10.43 ? 1   SER C N   1 
ATOM   3261 C  CA  . SER C 1 1   ? 79.123  11.358  53.602  1.00 9.49  ? 1   SER C CA  1 
ATOM   3262 C  C   . SER C 1 1   ? 80.223  11.060  52.570  1.00 8.22  ? 1   SER C C   1 
ATOM   3263 O  O   . SER C 1 1   ? 81.109  10.229  52.818  1.00 8.54  ? 1   SER C O   1 
ATOM   3264 C  CB  . SER C 1 1   ? 78.020  12.257  53.032  1.00 10.68 ? 1   SER C CB  1 
ATOM   3265 O  OG  . SER C 1 1   ? 77.320  12.968  54.072  1.00 13.72 ? 1   SER C OG  1 
ATOM   3266 N  N   . TYR C 1 2   ? 80.160  11.708  51.408  1.00 6.62  ? 2   TYR C N   1 
ATOM   3267 C  CA  . TYR C 1 2   ? 81.268  11.663  50.455  1.00 5.74  ? 2   TYR C CA  1 
ATOM   3268 C  C   . TYR C 1 2   ? 82.402  12.581  50.917  1.00 4.90  ? 2   TYR C C   1 
ATOM   3269 O  O   . TYR C 1 2   ? 82.170  13.564  51.632  1.00 4.17  ? 2   TYR C O   1 
ATOM   3270 C  CB  . TYR C 1 2   ? 80.829  12.161  49.086  1.00 5.65  ? 2   TYR C CB  1 
ATOM   3271 C  CG  . TYR C 1 2   ? 79.740  11.389  48.387  1.00 4.91  ? 2   TYR C CG  1 
ATOM   3272 C  CD1 . TYR C 1 2   ? 79.607  10.028  48.544  1.00 3.53  ? 2   TYR C CD1 1 
ATOM   3273 C  CD2 . TYR C 1 2   ? 78.867  12.034  47.509  1.00 5.95  ? 2   TYR C CD2 1 
ATOM   3274 C  CE1 . TYR C 1 2   ? 78.604  9.323   47.868  1.00 5.30  ? 2   TYR C CE1 1 
ATOM   3275 C  CE2 . TYR C 1 2   ? 77.867  11.345  46.850  1.00 7.15  ? 2   TYR C CE2 1 
ATOM   3276 C  CZ  . TYR C 1 2   ? 77.746  9.984   47.022  1.00 5.60  ? 2   TYR C CZ  1 
ATOM   3277 O  OH  . TYR C 1 2   ? 76.754  9.303   46.358  1.00 5.50  ? 2   TYR C OH  1 
ATOM   3278 N  N   . THR C 1 3   ? 83.620  12.259  50.488  1.00 5.45  ? 3   THR C N   1 
ATOM   3279 C  CA  . THR C 1 3   ? 84.785  13.085  50.742  1.00 6.31  ? 3   THR C CA  1 
ATOM   3280 C  C   . THR C 1 3   ? 85.567  13.184  49.462  1.00 5.49  ? 3   THR C C   1 
ATOM   3281 O  O   . THR C 1 3   ? 85.517  12.295  48.604  1.00 6.50  ? 3   THR C O   1 
ATOM   3282 C  CB  . THR C 1 3   ? 85.754  12.441  51.721  1.00 6.00  ? 3   THR C CB  1 
ATOM   3283 O  OG1 . THR C 1 3   ? 86.132  11.146  51.224  1.00 8.43  ? 3   THR C OG1 1 
ATOM   3284 C  CG2 . THR C 1 3   ? 85.152  12.354  53.113  1.00 7.67  ? 3   THR C CG2 1 
ATOM   3285 N  N   . LEU C 1 4   ? 86.303  14.273  49.342  1.00 4.63  ? 4   LEU C N   1 
ATOM   3286 C  CA  . LEU C 1 4   ? 87.116  14.478  48.180  1.00 4.35  ? 4   LEU C CA  1 
ATOM   3287 C  C   . LEU C 1 4   ? 88.320  13.597  48.327  1.00 4.75  ? 4   LEU C C   1 
ATOM   3288 O  O   . LEU C 1 4   ? 89.078  13.761  49.268  1.00 4.37  ? 4   LEU C O   1 
ATOM   3289 C  CB  . LEU C 1 4   ? 87.585  15.909  48.129  1.00 3.41  ? 4   LEU C CB  1 
ATOM   3290 C  CG  . LEU C 1 4   ? 88.491  16.224  46.942  1.00 3.96  ? 4   LEU C CG  1 
ATOM   3291 C  CD1 . LEU C 1 4   ? 87.658  16.207  45.669  1.00 5.38  ? 4   LEU C CD1 1 
ATOM   3292 C  CD2 . LEU C 1 4   ? 89.131  17.581  47.195  1.00 2.97  ? 4   LEU C CD2 1 
ATOM   3293 N  N   . PRO C 1 5   ? 88.524  12.688  47.377  1.00 5.76  ? 5   PRO C N   1 
ATOM   3294 C  CA  . PRO C 1 5   ? 89.657  11.791  47.455  1.00 6.33  ? 5   PRO C CA  1 
ATOM   3295 C  C   . PRO C 1 5   ? 90.966  12.541  47.256  1.00 6.65  ? 5   PRO C C   1 
ATOM   3296 O  O   . PRO C 1 5   ? 91.018  13.520  46.501  1.00 7.33  ? 5   PRO C O   1 
ATOM   3297 C  CB  . PRO C 1 5   ? 89.418  10.829  46.300  1.00 6.11  ? 5   PRO C CB  1 
ATOM   3298 C  CG  . PRO C 1 5   ? 88.678  11.650  45.282  1.00 7.16  ? 5   PRO C CG  1 
ATOM   3299 C  CD  . PRO C 1 5   ? 87.821  12.607  46.080  1.00 6.21  ? 5   PRO C CD  1 
ATOM   3300 N  N   . SER C 1 6   ? 92.010  12.095  47.947  1.00 7.10  ? 6   SER C N   1 
ATOM   3301 C  CA  . SER C 1 6   ? 93.341  12.626  47.711  1.00 8.29  ? 6   SER C CA  1 
ATOM   3302 C  C   . SER C 1 6   ? 93.712  12.288  46.290  1.00 8.49  ? 6   SER C C   1 
ATOM   3303 O  O   . SER C 1 6   ? 93.336  11.214  45.793  1.00 8.61  ? 6   SER C O   1 
ATOM   3304 C  CB  . SER C 1 6   ? 94.366  12.018  48.678  1.00 8.64  ? 6   SER C CB  1 
ATOM   3305 O  OG  . SER C 1 6   ? 94.589  10.640  48.410  1.00 11.22 ? 6   SER C OG  1 
ATOM   3306 N  N   . LEU C 1 7   ? 94.405  13.216  45.631  1.00 9.00  ? 7   LEU C N   1 
ATOM   3307 C  CA  . LEU C 1 7   ? 95.051  12.917  44.366  1.00 9.41  ? 7   LEU C CA  1 
ATOM   3308 C  C   . LEU C 1 7   ? 96.145  11.923  44.692  1.00 9.00  ? 7   LEU C C   1 
ATOM   3309 O  O   . LEU C 1 7   ? 96.772  12.021  45.758  1.00 9.77  ? 7   LEU C O   1 
ATOM   3310 C  CB  . LEU C 1 7   ? 95.649  14.177  43.729  1.00 9.68  ? 7   LEU C CB  1 
ATOM   3311 C  CG  . LEU C 1 7   ? 94.681  15.218  43.163  1.00 10.72 ? 7   LEU C CG  1 
ATOM   3312 C  CD1 . LEU C 1 7   ? 95.427  16.309  42.393  1.00 11.81 ? 7   LEU C CD1 1 
ATOM   3313 C  CD2 . LEU C 1 7   ? 93.630  14.567  42.266  1.00 11.44 ? 7   LEU C CD2 1 
ATOM   3314 N  N   . PRO C 1 8   ? 96.359  10.950  43.803  1.00 9.15  ? 8   PRO C N   1 
ATOM   3315 C  CA  . PRO C 1 8   ? 97.420  9.958   43.956  1.00 8.91  ? 8   PRO C CA  1 
ATOM   3316 C  C   . PRO C 1 8   ? 98.823  10.552  43.720  1.00 8.72  ? 8   PRO C C   1 
ATOM   3317 O  O   . PRO C 1 8   ? 99.827  9.847   43.863  1.00 10.93 ? 8   PRO C O   1 
ATOM   3318 C  CB  . PRO C 1 8   ? 97.075  8.898   42.895  1.00 9.06  ? 8   PRO C CB  1 
ATOM   3319 C  CG  . PRO C 1 8   ? 95.717  9.323   42.290  1.00 8.61  ? 8   PRO C CG  1 
ATOM   3320 C  CD  . PRO C 1 8   ? 95.614  10.781  42.543  1.00 8.55  ? 8   PRO C CD  1 
ATOM   3321 N  N   . TYR C 1 9   ? 98.893  11.843  43.412  1.00 8.55  ? 9   TYR C N   1 
ATOM   3322 C  CA  . TYR C 1 9   ? 100.158 12.462  42.985  1.00 7.49  ? 9   TYR C CA  1 
ATOM   3323 C  C   . TYR C 1 9   ? 100.145 13.955  43.274  1.00 7.65  ? 9   TYR C C   1 
ATOM   3324 O  O   . TYR C 1 9   ? 99.114  14.519  43.654  1.00 7.94  ? 9   TYR C O   1 
ATOM   3325 C  CB  . TYR C 1 9   ? 100.399 12.189  41.492  1.00 7.33  ? 9   TYR C CB  1 
ATOM   3326 C  CG  . TYR C 1 9   ? 99.124  12.219  40.684  1.00 6.25  ? 9   TYR C CG  1 
ATOM   3327 C  CD1 . TYR C 1 9   ? 98.402  13.394  40.545  1.00 5.81  ? 9   TYR C CD1 1 
ATOM   3328 C  CD2 . TYR C 1 9   ? 98.616  11.063  40.111  1.00 6.85  ? 9   TYR C CD2 1 
ATOM   3329 C  CE1 . TYR C 1 9   ? 97.214  13.425  39.822  1.00 4.33  ? 9   TYR C CE1 1 
ATOM   3330 C  CE2 . TYR C 1 9   ? 97.430  11.090  39.397  1.00 6.36  ? 9   TYR C CE2 1 
ATOM   3331 C  CZ  . TYR C 1 9   ? 96.745  12.273  39.261  1.00 4.59  ? 9   TYR C CZ  1 
ATOM   3332 O  OH  . TYR C 1 9   ? 95.555  12.292  38.558  1.00 3.37  ? 9   TYR C OH  1 
ATOM   3333 N  N   . ALA C 1 10  ? 101.280 14.619  43.086  1.00 6.69  ? 10  ALA C N   1 
ATOM   3334 C  CA  . ALA C 1 10  ? 101.278 16.070  43.191  1.00 6.27  ? 10  ALA C CA  1 
ATOM   3335 C  C   . ALA C 1 10  ? 100.590 16.677  41.983  1.00 5.88  ? 10  ALA C C   1 
ATOM   3336 O  O   . ALA C 1 10  ? 100.412 16.020  40.938  1.00 6.30  ? 10  ALA C O   1 
ATOM   3337 C  CB  . ALA C 1 10  ? 102.731 16.607  43.332  1.00 6.46  ? 10  ALA C CB  1 
ATOM   3338 N  N   . TYR C 1 11  ? 100.231 17.944  42.106  1.00 5.84  ? 11  TYR C N   1 
ATOM   3339 C  CA  . TYR C 1 11  ? 99.513  18.633  41.044  1.00 6.82  ? 11  TYR C CA  1 
ATOM   3340 C  C   . TYR C 1 11  ? 100.347 18.745  39.765  1.00 6.83  ? 11  TYR C C   1 
ATOM   3341 O  O   . TYR C 1 11  ? 99.803  18.908  38.671  1.00 6.22  ? 11  TYR C O   1 
ATOM   3342 C  CB  . TYR C 1 11  ? 98.969  19.972  41.555  1.00 7.26  ? 11  TYR C CB  1 
ATOM   3343 C  CG  . TYR C 1 11  ? 97.861  19.769  42.589  1.00 9.64  ? 11  TYR C CG  1 
ATOM   3344 C  CD1 . TYR C 1 11  ? 96.685  19.119  42.232  1.00 9.71  ? 11  TYR C CD1 1 
ATOM   3345 C  CD2 . TYR C 1 11  ? 97.990  20.212  43.900  1.00 11.52 ? 11  TYR C CD2 1 
ATOM   3346 C  CE1 . TYR C 1 11  ? 95.655  18.902  43.158  1.00 11.74 ? 11  TYR C CE1 1 
ATOM   3347 C  CE2 . TYR C 1 11  ? 96.957  20.004  44.833  1.00 12.40 ? 11  TYR C CE2 1 
ATOM   3348 C  CZ  . TYR C 1 11  ? 95.797  19.346  44.448  1.00 11.95 ? 11  TYR C CZ  1 
ATOM   3349 O  OH  . TYR C 1 11  ? 94.767  19.132  45.365  1.00 12.75 ? 11  TYR C OH  1 
ATOM   3350 N  N   . ASP C 1 12  ? 101.664 18.639  39.899  1.00 6.53  ? 12  ASP C N   1 
ATOM   3351 C  CA  . ASP C 1 12  ? 102.558 18.793  38.755  1.00 6.78  ? 12  ASP C CA  1 
ATOM   3352 C  C   . ASP C 1 12  ? 102.965 17.435  38.154  1.00 6.90  ? 12  ASP C C   1 
ATOM   3353 O  O   . ASP C 1 12  ? 103.797 17.359  37.236  1.00 6.80  ? 12  ASP C O   1 
ATOM   3354 C  CB  . ASP C 1 12  ? 103.778 19.657  39.147  1.00 6.78  ? 12  ASP C CB  1 
ATOM   3355 C  CG  . ASP C 1 12  ? 104.833 18.885  39.948  1.00 6.78  ? 12  ASP C CG  1 
ATOM   3356 O  OD1 . ASP C 1 12  ? 106.004 19.328  39.956  1.00 9.97  ? 12  ASP C OD1 1 
ATOM   3357 O  OD2 . ASP C 1 12  ? 104.523 17.849  40.570  1.00 6.60  ? 12  ASP C OD2 1 
ATOM   3358 N  N   . ALA C 1 13  ? 102.341 16.363  38.640  1.00 6.51  ? 13  ALA C N   1 
ATOM   3359 C  CA  . ALA C 1 13  ? 102.706 14.997  38.256  1.00 5.91  ? 13  ALA C CA  1 
ATOM   3360 C  C   . ALA C 1 13  ? 102.324 14.594  36.826  1.00 6.12  ? 13  ALA C C   1 
ATOM   3361 O  O   . ALA C 1 13  ? 102.760 13.548  36.326  1.00 7.08  ? 13  ALA C O   1 
ATOM   3362 C  CB  . ALA C 1 13  ? 102.095 14.014  39.222  1.00 6.35  ? 13  ALA C CB  1 
ATOM   3363 N  N   . LEU C 1 14  ? 101.468 15.385  36.201  1.00 6.04  ? 14  LEU C N   1 
ATOM   3364 C  CA  . LEU C 1 14  ? 101.117 15.164  34.808  1.00 5.28  ? 14  LEU C CA  1 
ATOM   3365 C  C   . LEU C 1 14  ? 101.784 16.164  33.863  1.00 4.65  ? 14  LEU C C   1 
ATOM   3366 O  O   . LEU C 1 14  ? 101.501 16.187  32.661  1.00 3.68  ? 14  LEU C O   1 
ATOM   3367 C  CB  . LEU C 1 14  ? 99.613  15.248  34.650  1.00 5.48  ? 14  LEU C CB  1 
ATOM   3368 C  CG  . LEU C 1 14  ? 98.897  14.347  35.649  1.00 6.61  ? 14  LEU C CG  1 
ATOM   3369 C  CD1 . LEU C 1 14  ? 97.409  14.440  35.421  1.00 7.64  ? 14  LEU C CD1 1 
ATOM   3370 C  CD2 . LEU C 1 14  ? 99.390  12.908  35.507  1.00 4.84  ? 14  LEU C CD2 1 
ATOM   3371 N  N   . GLU C 1 15  ? 102.653 17.006  34.410  1.00 4.53  ? 15  GLU C N   1 
ATOM   3372 C  CA  . GLU C 1 15  ? 103.535 17.819  33.582  1.00 4.83  ? 15  GLU C CA  1 
ATOM   3373 C  C   . GLU C 1 15  ? 104.463 16.933  32.756  1.00 4.57  ? 15  GLU C C   1 
ATOM   3374 O  O   . GLU C 1 15  ? 104.920 15.885  33.210  1.00 4.60  ? 15  GLU C O   1 
ATOM   3375 C  CB  . GLU C 1 15  ? 104.373 18.731  34.474  1.00 4.14  ? 15  GLU C CB  1 
ATOM   3376 C  CG  . GLU C 1 15  ? 103.590 19.839  35.106  1.00 4.40  ? 15  GLU C CG  1 
ATOM   3377 C  CD  . GLU C 1 15  ? 103.153 20.883  34.115  1.00 5.27  ? 15  GLU C CD  1 
ATOM   3378 O  OE1 . GLU C 1 15  ? 103.456 20.736  32.899  1.00 5.24  ? 15  GLU C OE1 1 
ATOM   3379 O  OE2 . GLU C 1 15  ? 102.530 21.869  34.560  1.00 4.64  ? 15  GLU C OE2 1 
ATOM   3380 N  N   . PRO C 1 16  ? 104.758 17.350  31.514  1.00 4.76  ? 16  PRO C N   1 
ATOM   3381 C  CA  . PRO C 1 16  ? 104.370 18.594  30.875  1.00 4.51  ? 16  PRO C CA  1 
ATOM   3382 C  C   . PRO C 1 16  ? 103.074 18.513  30.036  1.00 4.40  ? 16  PRO C C   1 
ATOM   3383 O  O   . PRO C 1 16  ? 102.860 19.330  29.144  1.00 4.34  ? 16  PRO C O   1 
ATOM   3384 C  CB  . PRO C 1 16  ? 105.553 18.853  29.944  1.00 4.41  ? 16  PRO C CB  1 
ATOM   3385 C  CG  . PRO C 1 16  ? 105.945 17.481  29.500  1.00 5.11  ? 16  PRO C CG  1 
ATOM   3386 C  CD  . PRO C 1 16  ? 105.664 16.555  30.670  1.00 4.73  ? 16  PRO C CD  1 
ATOM   3387 N  N   . HIS C 1 17  ? 102.204 17.554  30.334  1.00 3.94  ? 17  HIS C N   1 
ATOM   3388 C  CA  . HIS C 1 17  ? 101.077 17.293  29.482  1.00 3.94  ? 17  HIS C CA  1 
ATOM   3389 C  C   . HIS C 1 17  ? 99.829  18.025  29.973  1.00 3.81  ? 17  HIS C C   1 
ATOM   3390 O  O   . HIS C 1 17  ? 99.272  18.821  29.240  1.00 3.20  ? 17  HIS C O   1 
ATOM   3391 C  CB  . HIS C 1 17  ? 100.882 15.774  29.372  1.00 3.86  ? 17  HIS C CB  1 
ATOM   3392 C  CG  . HIS C 1 17  ? 102.153 15.044  29.045  1.00 4.24  ? 17  HIS C CG  1 
ATOM   3393 N  ND1 . HIS C 1 17  ? 102.741 15.101  27.799  1.00 6.46  ? 17  HIS C ND1 1 
ATOM   3394 C  CD2 . HIS C 1 17  ? 102.948 14.248  29.797  1.00 4.19  ? 17  HIS C CD2 1 
ATOM   3395 C  CE1 . HIS C 1 17  ? 103.840 14.371  27.796  1.00 6.08  ? 17  HIS C CE1 1 
ATOM   3396 N  NE2 . HIS C 1 17  ? 104.001 13.856  29.000  1.00 4.04  ? 17  HIS C NE2 1 
ATOM   3397 N  N   . PHE C 1 18  ? 99.420  17.776  31.217  1.00 3.43  ? 18  PHE C N   1 
ATOM   3398 C  CA  . PHE C 1 18  ? 98.327  18.544  31.827  1.00 4.16  ? 18  PHE C CA  1 
ATOM   3399 C  C   . PHE C 1 18  ? 98.927  19.552  32.817  1.00 4.10  ? 18  PHE C C   1 
ATOM   3400 O  O   . PHE C 1 18  ? 99.767  19.193  33.643  1.00 5.32  ? 18  PHE C O   1 
ATOM   3401 C  CB  . PHE C 1 18  ? 97.333  17.618  32.560  1.00 3.68  ? 18  PHE C CB  1 
ATOM   3402 C  CG  . PHE C 1 18  ? 96.446  16.783  31.639  1.00 5.74  ? 18  PHE C CG  1 
ATOM   3403 C  CD1 . PHE C 1 18  ? 96.673  16.702  30.275  1.00 5.33  ? 18  PHE C CD1 1 
ATOM   3404 C  CD2 . PHE C 1 18  ? 95.415  16.037  32.180  1.00 6.18  ? 18  PHE C CD2 1 
ATOM   3405 C  CE1 . PHE C 1 18  ? 95.844  15.925  29.453  1.00 6.86  ? 18  PHE C CE1 1 
ATOM   3406 C  CE2 . PHE C 1 18  ? 94.591  15.242  31.372  1.00 5.29  ? 18  PHE C CE2 1 
ATOM   3407 C  CZ  . PHE C 1 18  ? 94.802  15.189  30.010  1.00 6.72  ? 18  PHE C CZ  1 
ATOM   3408 N  N   . ASP C 1 19  ? 98.505  20.807  32.747  1.00 4.38  ? 19  ASP C N   1 
ATOM   3409 C  CA  . ASP C 1 19  ? 99.124  21.856  33.556  1.00 4.30  ? 19  ASP C CA  1 
ATOM   3410 C  C   . ASP C 1 19  ? 98.801  21.783  35.064  1.00 5.09  ? 19  ASP C C   1 
ATOM   3411 O  O   . ASP C 1 19  ? 97.689  21.420  35.469  1.00 5.40  ? 19  ASP C O   1 
ATOM   3412 C  CB  . ASP C 1 19  ? 98.810  23.248  32.981  1.00 4.46  ? 19  ASP C CB  1 
ATOM   3413 C  CG  . ASP C 1 19  ? 97.327  23.563  32.973  1.00 4.34  ? 19  ASP C CG  1 
ATOM   3414 O  OD1 . ASP C 1 19  ? 96.581  22.866  32.243  1.00 4.10  ? 19  ASP C OD1 1 
ATOM   3415 O  OD2 . ASP C 1 19  ? 96.927  24.542  33.658  1.00 4.69  ? 19  ASP C OD2 1 
ATOM   3416 N  N   . LYS C 1 20  ? 99.806  22.085  35.879  1.00 5.97  ? 20  LYS C N   1 
ATOM   3417 C  CA  . LYS C 1 20  ? 99.698  21.998  37.339  1.00 6.14  ? 20  LYS C CA  1 
ATOM   3418 C  C   . LYS C 1 20  ? 98.639  22.923  37.916  1.00 5.81  ? 20  LYS C C   1 
ATOM   3419 O  O   . LYS C 1 20  ? 97.956  22.566  38.894  1.00 5.80  ? 20  LYS C O   1 
ATOM   3420 C  CB  . LYS C 1 20  ? 101.059 22.304  37.989  1.00 6.41  ? 20  LYS C CB  1 
ATOM   3421 C  CG  . LYS C 1 20  ? 101.184 21.861  39.448  1.00 9.55  ? 20  LYS C CG  1 
ATOM   3422 C  CD  . LYS C 1 20  ? 102.118 22.764  40.272  1.00 10.48 ? 20  LYS C CD  1 
ATOM   3423 C  CE  . LYS C 1 20  ? 101.994 22.502  41.783  1.00 10.06 ? 20  LYS C CE  1 
ATOM   3424 N  NZ  . LYS C 1 20  ? 101.769 23.758  42.548  1.00 11.78 ? 20  LYS C NZ  1 
ATOM   3425 N  N   . GLN C 1 21  ? 98.525  24.125  37.356  1.00 5.22  ? 21  GLN C N   1 
ATOM   3426 C  CA  . GLN C 1 21  ? 97.535  25.084  37.835  1.00 4.85  ? 21  GLN C CA  1 
ATOM   3427 C  C   . GLN C 1 21  ? 96.143  24.502  37.678  1.00 4.72  ? 21  GLN C C   1 
ATOM   3428 O  O   . GLN C 1 21  ? 95.311  24.599  38.586  1.00 4.90  ? 21  GLN C O   1 
ATOM   3429 C  CB  . GLN C 1 21  ? 97.629  26.431  37.111  1.00 5.53  ? 21  GLN C CB  1 
ATOM   3430 C  CG  . GLN C 1 21  ? 96.630  27.462  37.602  1.00 5.48  ? 21  GLN C CG  1 
ATOM   3431 C  CD  . GLN C 1 21  ? 96.647  28.752  36.800  1.00 7.36  ? 21  GLN C CD  1 
ATOM   3432 O  OE1 . GLN C 1 21  ? 96.107  29.761  37.233  1.00 7.38  ? 21  GLN C OE1 1 
ATOM   3433 N  NE2 . GLN C 1 21  ? 97.245  28.709  35.609  1.00 8.55  ? 21  GLN C NE2 1 
ATOM   3434 N  N   . THR C 1 22  ? 95.896  23.891  36.527  1.00 4.49  ? 22  THR C N   1 
ATOM   3435 C  CA  . THR C 1 22  ? 94.575  23.310  36.256  1.00 3.51  ? 22  THR C CA  1 
ATOM   3436 C  C   . THR C 1 22  ? 94.311  22.120  37.168  1.00 3.39  ? 22  THR C C   1 
ATOM   3437 O  O   . THR C 1 22  ? 93.238  22.026  37.753  1.00 3.30  ? 22  THR C O   1 
ATOM   3438 C  CB  . THR C 1 22  ? 94.413  22.917  34.765  1.00 2.94  ? 22  THR C CB  1 
ATOM   3439 O  OG1 . THR C 1 22  ? 94.229  24.108  33.987  1.00 3.54  ? 22  THR C OG1 1 
ATOM   3440 C  CG2 . THR C 1 22  ? 93.192  21.997  34.555  1.00 2.89  ? 22  THR C CG2 1 
ATOM   3441 N  N   . MET C 1 23  ? 95.287  21.229  37.321  1.00 3.94  ? 23  MET C N   1 
ATOM   3442 C  CA  . MET C 1 23  ? 95.103  20.096  38.219  1.00 4.38  ? 23  MET C CA  1 
ATOM   3443 C  C   . MET C 1 23  ? 94.611  20.623  39.584  1.00 4.78  ? 23  MET C C   1 
ATOM   3444 O  O   . MET C 1 23  ? 93.644  20.108  40.150  1.00 4.74  ? 23  MET C O   1 
ATOM   3445 C  CB  . MET C 1 23  ? 96.378  19.255  38.358  1.00 4.82  ? 23  MET C CB  1 
ATOM   3446 C  CG  . MET C 1 23  ? 96.797  18.475  37.106  1.00 4.16  ? 23  MET C CG  1 
ATOM   3447 S  SD  . MET C 1 23  ? 95.555  17.380  36.368  1.00 5.10  ? 23  MET C SD  1 
ATOM   3448 C  CE  . MET C 1 23  ? 96.589  16.047  35.773  1.00 9.33  ? 23  MET C CE  1 
ATOM   3449 N  N   . GLU C 1 24  ? 95.237  21.683  40.084  1.00 5.50  ? 24  GLU C N   1 
ATOM   3450 C  CA  . GLU C 1 24  ? 94.920  22.171  41.432  1.00 5.39  ? 24  GLU C CA  1 
ATOM   3451 C  C   . GLU C 1 24  ? 93.501  22.682  41.524  1.00 5.10  ? 24  GLU C C   1 
ATOM   3452 O  O   . GLU C 1 24  ? 92.737  22.253  42.398  1.00 4.93  ? 24  GLU C O   1 
ATOM   3453 C  CB  . GLU C 1 24  ? 95.907  23.254  41.893  1.00 5.65  ? 24  GLU C CB  1 
ATOM   3454 C  CG  . GLU C 1 24  ? 95.735  23.609  43.358  1.00 6.95  ? 24  GLU C CG  1 
ATOM   3455 C  CD  . GLU C 1 24  ? 96.986  24.242  43.962  1.00 9.21  ? 24  GLU C CD  1 
ATOM   3456 O  OE1 . GLU C 1 24  ? 97.075  24.299  45.199  1.00 11.67 ? 24  GLU C OE1 1 
ATOM   3457 O  OE2 . GLU C 1 24  ? 97.875  24.669  43.209  1.00 11.67 ? 24  GLU C OE2 1 
ATOM   3458 N  N   . ILE C 1 25  ? 93.148  23.593  40.617  1.00 5.20  ? 25  ILE C N   1 
ATOM   3459 C  CA  . ILE C 1 25  ? 91.820  24.190  40.573  1.00 4.56  ? 25  ILE C CA  1 
ATOM   3460 C  C   . ILE C 1 25  ? 90.737  23.139  40.307  1.00 4.35  ? 25  ILE C C   1 
ATOM   3461 O  O   . ILE C 1 25  ? 89.681  23.136  40.960  1.00 3.94  ? 25  ILE C O   1 
ATOM   3462 C  CB  . ILE C 1 25  ? 91.708  25.211  39.440  1.00 4.50  ? 25  ILE C CB  1 
ATOM   3463 C  CG1 . ILE C 1 25  ? 92.684  26.365  39.658  1.00 6.29  ? 25  ILE C CG1 1 
ATOM   3464 C  CG2 . ILE C 1 25  ? 90.307  25.752  39.347  1.00 4.75  ? 25  ILE C CG2 1 
ATOM   3465 C  CD1 . ILE C 1 25  ? 92.762  27.254  38.489  1.00 6.90  ? 25  ILE C CD1 1 
ATOM   3466 N  N   . HIS C 1 26  ? 91.016  22.240  39.370  1.00 3.28  ? 26  HIS C N   1 
ATOM   3467 C  CA  . HIS C 1 26  ? 90.052  21.198  38.972  1.00 3.02  ? 26  HIS C CA  1 
ATOM   3468 C  C   . HIS C 1 26  ? 89.683  20.327  40.169  1.00 3.13  ? 26  HIS C C   1 
ATOM   3469 O  O   . HIS C 1 26  ? 88.515  19.999  40.396  1.00 1.75  ? 26  HIS C O   1 
ATOM   3470 C  CB  . HIS C 1 26  ? 90.657  20.358  37.835  1.00 2.96  ? 26  HIS C CB  1 
ATOM   3471 C  CG  . HIS C 1 26  ? 89.646  19.643  36.993  1.00 2.53  ? 26  HIS C CG  1 
ATOM   3472 N  ND1 . HIS C 1 26  ? 90.001  18.920  35.875  1.00 3.53  ? 26  HIS C ND1 1 
ATOM   3473 C  CD2 . HIS C 1 26  ? 88.296  19.545  37.095  1.00 2.46  ? 26  HIS C CD2 1 
ATOM   3474 C  CE1 . HIS C 1 26  ? 88.912  18.393  35.336  1.00 2.90  ? 26  HIS C CE1 1 
ATOM   3475 N  NE2 . HIS C 1 26  ? 87.863  18.763  36.056  1.00 1.81  ? 26  HIS C NE2 1 
ATOM   3476 N  N   . HIS C 1 27  ? 90.684  19.994  40.975  1.00 2.99  ? 27  HIS C N   1 
ATOM   3477 C  CA  . HIS C 1 27  ? 90.488  19.096  42.107  1.00 4.20  ? 27  HIS C CA  1 
ATOM   3478 C  C   . HIS C 1 27  ? 89.902  19.846  43.301  1.00 4.30  ? 27  HIS C C   1 
ATOM   3479 O  O   . HIS C 1 27  ? 88.853  19.446  43.810  1.00 3.96  ? 27  HIS C O   1 
ATOM   3480 C  CB  . HIS C 1 27  ? 91.819  18.418  42.448  1.00 4.16  ? 27  HIS C CB  1 
ATOM   3481 C  CG  . HIS C 1 27  ? 91.750  17.446  43.588  1.00 4.15  ? 27  HIS C CG  1 
ATOM   3482 N  ND1 . HIS C 1 27  ? 92.392  17.667  44.789  1.00 4.22  ? 27  HIS C ND1 1 
ATOM   3483 C  CD2 . HIS C 1 27  ? 91.160  16.232  43.694  1.00 5.83  ? 27  HIS C CD2 1 
ATOM   3484 C  CE1 . HIS C 1 27  ? 92.188  16.638  45.590  1.00 4.44  ? 27  HIS C CE1 1 
ATOM   3485 N  NE2 . HIS C 1 27  ? 91.443  15.755  44.954  1.00 3.93  ? 27  HIS C NE2 1 
ATOM   3486 N  N   . THR C 1 28  ? 90.572  20.917  43.741  1.00 4.66  ? 28  THR C N   1 
ATOM   3487 C  CA  . THR C 1 28  ? 90.160  21.668  44.946  1.00 4.24  ? 28  THR C CA  1 
ATOM   3488 C  C   . THR C 1 28  ? 88.966  22.572  44.806  1.00 4.31  ? 28  THR C C   1 
ATOM   3489 O  O   . THR C 1 28  ? 88.343  22.920  45.805  1.00 4.02  ? 28  THR C O   1 
ATOM   3490 C  CB  . THR C 1 28  ? 91.280  22.566  45.493  1.00 5.37  ? 28  THR C CB  1 
ATOM   3491 O  OG1 . THR C 1 28  ? 91.541  23.616  44.544  1.00 4.29  ? 28  THR C OG1 1 
ATOM   3492 C  CG2 . THR C 1 28  ? 92.515  21.739  45.762  1.00 4.82  ? 28  THR C CG2 1 
ATOM   3493 N  N   . LYS C 1 29  ? 88.627  22.978  43.590  1.00 4.71  ? 29  LYS C N   1 
ATOM   3494 C  CA  . LYS C 1 29  ? 87.465  23.842  43.424  1.00 4.53  ? 29  LYS C CA  1 
ATOM   3495 C  C   . LYS C 1 29  ? 86.313  23.066  42.789  1.00 4.19  ? 29  LYS C C   1 
ATOM   3496 O  O   . LYS C 1 29  ? 85.301  22.834  43.433  1.00 4.21  ? 29  LYS C O   1 
ATOM   3497 C  CB  . LYS C 1 29  ? 87.801  25.115  42.656  1.00 5.30  ? 29  LYS C CB  1 
ATOM   3498 C  CG  . LYS C 1 29  ? 88.949  25.933  43.286  1.00 5.49  ? 29  LYS C CG  1 
ATOM   3499 C  CD  . LYS C 1 29  ? 88.524  26.594  44.616  1.00 8.29  ? 29  LYS C CD  1 
ATOM   3500 C  CE  . LYS C 1 29  ? 89.523  27.695  45.002  1.00 10.49 ? 29  LYS C CE  1 
ATOM   3501 N  NZ  . LYS C 1 29  ? 89.336  28.238  46.381  1.00 13.10 ? 29  LYS C NZ  1 
ATOM   3502 N  N   . HIS C 1 30  ? 86.484  22.615  41.553  1.00 3.58  ? 30  HIS C N   1 
ATOM   3503 C  CA  . HIS C 1 30  ? 85.383  21.938  40.864  1.00 3.75  ? 30  HIS C CA  1 
ATOM   3504 C  C   . HIS C 1 30  ? 84.918  20.642  41.534  1.00 3.60  ? 30  HIS C C   1 
ATOM   3505 O  O   . HIS C 1 30  ? 83.723  20.481  41.822  1.00 2.95  ? 30  HIS C O   1 
ATOM   3506 C  CB  . HIS C 1 30  ? 85.745  21.684  39.401  1.00 3.54  ? 30  HIS C CB  1 
ATOM   3507 C  CG  . HIS C 1 30  ? 85.912  22.928  38.599  1.00 4.75  ? 30  HIS C CG  1 
ATOM   3508 N  ND1 . HIS C 1 30  ? 84.865  23.515  37.923  1.00 4.11  ? 30  HIS C ND1 1 
ATOM   3509 C  CD2 . HIS C 1 30  ? 87.003  23.697  38.355  1.00 4.75  ? 30  HIS C CD2 1 
ATOM   3510 C  CE1 . HIS C 1 30  ? 85.306  24.594  37.294  1.00 5.10  ? 30  HIS C CE1 1 
ATOM   3511 N  NE2 . HIS C 1 30  ? 86.597  24.725  37.542  1.00 5.00  ? 30  HIS C NE2 1 
ATOM   3512 N  N   . HIS C 1 31  ? 85.841  19.706  41.732  1.00 3.13  ? 31  HIS C N   1 
ATOM   3513 C  CA  . HIS C 1 31  ? 85.481  18.402  42.303  1.00 2.33  ? 31  HIS C CA  1 
ATOM   3514 C  C   . HIS C 1 31  ? 84.952  18.564  43.729  1.00 3.15  ? 31  HIS C C   1 
ATOM   3515 O  O   . HIS C 1 31  ? 83.961  17.924  44.097  1.00 3.40  ? 31  HIS C O   1 
ATOM   3516 C  CB  . HIS C 1 31  ? 86.661  17.433  42.268  1.00 2.89  ? 31  HIS C CB  1 
ATOM   3517 C  CG  . HIS C 1 31  ? 86.299  16.024  42.598  1.00 1.87  ? 31  HIS C CG  1 
ATOM   3518 N  ND1 . HIS C 1 31  ? 87.176  14.973  42.439  1.00 0.94  ? 31  HIS C ND1 1 
ATOM   3519 C  CD2 . HIS C 1 31  ? 85.151  15.486  43.082  1.00 2.60  ? 31  HIS C CD2 1 
ATOM   3520 C  CE1 . HIS C 1 31  ? 86.584  13.846  42.801  1.00 2.28  ? 31  HIS C CE1 1 
ATOM   3521 N  NE2 . HIS C 1 31  ? 85.355  14.129  43.191  1.00 1.07  ? 31  HIS C NE2 1 
ATOM   3522 N  N   . GLN C 1 32  ? 85.613  19.409  44.521  1.00 2.75  ? 32  GLN C N   1 
ATOM   3523 C  CA  . GLN C 1 32  ? 85.157  19.665  45.890  1.00 2.25  ? 32  GLN C CA  1 
ATOM   3524 C  C   . GLN C 1 32  ? 83.691  20.089  45.888  1.00 3.05  ? 32  GLN C C   1 
ATOM   3525 O  O   . GLN C 1 32  ? 82.902  19.608  46.713  1.00 1.39  ? 32  GLN C O   1 
ATOM   3526 C  CB  . GLN C 1 32  ? 86.022  20.737  46.576  1.00 2.36  ? 32  GLN C CB  1 
ATOM   3527 C  CG  . GLN C 1 32  ? 85.601  20.989  48.031  1.00 2.29  ? 32  GLN C CG  1 
ATOM   3528 C  CD  . GLN C 1 32  ? 85.938  19.823  48.938  1.00 2.33  ? 32  GLN C CD  1 
ATOM   3529 O  OE1 . GLN C 1 32  ? 87.121  19.533  49.184  1.00 3.79  ? 32  GLN C OE1 1 
ATOM   3530 N  NE2 . GLN C 1 32  ? 84.897  19.108  49.408  1.00 2.78  ? 32  GLN C NE2 1 
ATOM   3531 N  N   . THR C 1 33  ? 83.341  20.988  44.965  1.00 2.19  ? 33  THR C N   1 
ATOM   3532 C  CA  . THR C 1 33  ? 81.986  21.480  44.854  1.00 3.20  ? 33  THR C CA  1 
ATOM   3533 C  C   . THR C 1 33  ? 80.980  20.357  44.568  1.00 3.14  ? 33  THR C C   1 
ATOM   3534 O  O   . THR C 1 33  ? 79.899  20.350  45.173  1.00 2.70  ? 33  THR C O   1 
ATOM   3535 C  CB  . THR C 1 33  ? 81.881  22.651  43.824  1.00 3.44  ? 33  THR C CB  1 
ATOM   3536 O  OG1 . THR C 1 33  ? 82.723  23.735  44.250  1.00 3.65  ? 33  THR C OG1 1 
ATOM   3537 C  CG2 . THR C 1 33  ? 80.448  23.163  43.694  1.00 3.29  ? 33  THR C CG2 1 
ATOM   3538 N  N   . TYR C 1 34  ? 81.310  19.403  43.692  1.00 3.08  ? 34  TYR C N   1 
ATOM   3539 C  CA  . TYR C 1 34  ? 80.364  18.286  43.431  1.00 3.05  ? 34  TYR C CA  1 
ATOM   3540 C  C   . TYR C 1 34  ? 80.140  17.564  44.740  1.00 3.24  ? 34  TYR C C   1 
ATOM   3541 O  O   . TYR C 1 34  ? 79.007  17.229  45.091  1.00 3.24  ? 34  TYR C O   1 
ATOM   3542 C  CB  . TYR C 1 34  ? 80.880  17.284  42.389  1.00 3.30  ? 34  TYR C CB  1 
ATOM   3543 C  CG  . TYR C 1 34  ? 81.241  17.909  41.068  1.00 3.42  ? 34  TYR C CG  1 
ATOM   3544 C  CD1 . TYR C 1 34  ? 80.365  18.756  40.399  1.00 2.27  ? 34  TYR C CD1 1 
ATOM   3545 C  CD2 . TYR C 1 34  ? 82.469  17.644  40.489  1.00 2.76  ? 34  TYR C CD2 1 
ATOM   3546 C  CE1 . TYR C 1 34  ? 80.737  19.335  39.174  1.00 3.92  ? 34  TYR C CE1 1 
ATOM   3547 C  CE2 . TYR C 1 34  ? 82.830  18.196  39.305  1.00 5.87  ? 34  TYR C CE2 1 
ATOM   3548 C  CZ  . TYR C 1 34  ? 81.985  19.053  38.662  1.00 4.64  ? 34  TYR C CZ  1 
ATOM   3549 O  OH  . TYR C 1 34  ? 82.426  19.561  37.471  1.00 6.84  ? 34  TYR C OH  1 
ATOM   3550 N  N   . VAL C 1 35  ? 81.234  17.330  45.463  1.00 2.59  ? 35  VAL C N   1 
ATOM   3551 C  CA  . VAL C 1 35  ? 81.159  16.622  46.737  1.00 2.87  ? 35  VAL C CA  1 
ATOM   3552 C  C   . VAL C 1 35  ? 80.246  17.367  47.714  1.00 3.29  ? 35  VAL C C   1 
ATOM   3553 O  O   . VAL C 1 35  ? 79.361  16.756  48.335  1.00 2.48  ? 35  VAL C O   1 
ATOM   3554 C  CB  . VAL C 1 35  ? 82.555  16.430  47.361  1.00 3.46  ? 35  VAL C CB  1 
ATOM   3555 C  CG1 . VAL C 1 35  ? 82.432  15.969  48.819  1.00 3.69  ? 35  VAL C CG1 1 
ATOM   3556 C  CG2 . VAL C 1 35  ? 83.344  15.404  46.539  1.00 2.77  ? 35  VAL C CG2 1 
ATOM   3557 N  N   . ASN C 1 36  ? 80.435  18.685  47.824  1.00 3.00  ? 36  ASN C N   1 
ATOM   3558 C  CA  . ASN C 1 36  ? 79.638  19.470  48.758  1.00 2.98  ? 36  ASN C CA  1 
ATOM   3559 C  C   . ASN C 1 36  ? 78.169  19.368  48.394  1.00 3.16  ? 36  ASN C C   1 
ATOM   3560 O  O   . ASN C 1 36  ? 77.298  19.130  49.249  1.00 3.42  ? 36  ASN C O   1 
ATOM   3561 C  CB  . ASN C 1 36  ? 80.042  20.945  48.762  1.00 2.83  ? 36  ASN C CB  1 
ATOM   3562 C  CG  . ASN C 1 36  ? 81.458  21.166  49.225  1.00 3.62  ? 36  ASN C CG  1 
ATOM   3563 O  OD1 . ASN C 1 36  ? 82.119  20.258  49.760  1.00 2.81  ? 36  ASN C OD1 1 
ATOM   3564 N  ND2 . ASN C 1 36  ? 81.950  22.379  49.012  1.00 4.00  ? 36  ASN C ND2 1 
ATOM   3565 N  N   . ASN C 1 37  ? 77.898  19.541  47.106  1.00 2.24  ? 37  ASN C N   1 
ATOM   3566 C  CA  . ASN C 1 37  ? 76.521  19.606  46.638  1.00 2.79  ? 37  ASN C CA  1 
ATOM   3567 C  C   . ASN C 1 37  ? 75.790  18.269  46.694  1.00 3.40  ? 37  ASN C C   1 
ATOM   3568 O  O   . ASN C 1 37  ? 74.592  18.233  47.004  1.00 4.47  ? 37  ASN C O   1 
ATOM   3569 C  CB  . ASN C 1 37  ? 76.466  20.228  45.232  1.00 2.75  ? 37  ASN C CB  1 
ATOM   3570 C  CG  . ASN C 1 37  ? 76.887  21.709  45.229  1.00 2.72  ? 37  ASN C CG  1 
ATOM   3571 O  OD1 . ASN C 1 37  ? 76.972  22.366  46.284  1.00 3.80  ? 37  ASN C OD1 1 
ATOM   3572 N  ND2 . ASN C 1 37  ? 77.179  22.230  44.037  1.00 2.54  ? 37  ASN C ND2 1 
ATOM   3573 N  N   . ALA C 1 38  ? 76.507  17.182  46.420  1.00 4.11  ? 38  ALA C N   1 
ATOM   3574 C  CA  . ALA C 1 38  ? 75.954  15.825  46.566  1.00 3.89  ? 38  ALA C CA  1 
ATOM   3575 C  C   . ALA C 1 38  ? 75.611  15.505  48.016  1.00 4.28  ? 38  ALA C C   1 
ATOM   3576 O  O   . ALA C 1 38  ? 74.532  15.023  48.314  1.00 3.93  ? 38  ALA C O   1 
ATOM   3577 C  CB  . ALA C 1 38  ? 76.917  14.775  45.992  1.00 4.88  ? 38  ALA C CB  1 
ATOM   3578 N  N   . ASN C 1 39  ? 76.527  15.826  48.921  1.00 3.79  ? 39  ASN C N   1 
ATOM   3579 C  CA  . ASN C 1 39  ? 76.308  15.549  50.326  1.00 3.89  ? 39  ASN C CA  1 
ATOM   3580 C  C   . ASN C 1 39  ? 75.117  16.349  50.814  1.00 4.01  ? 39  ASN C C   1 
ATOM   3581 O  O   . ASN C 1 39  ? 74.306  15.853  51.606  1.00 4.44  ? 39  ASN C O   1 
ATOM   3582 C  CB  . ASN C 1 39  ? 77.528  15.975  51.147  1.00 4.08  ? 39  ASN C CB  1 
ATOM   3583 C  CG  . ASN C 1 39  ? 78.658  14.961  51.127  1.00 3.90  ? 39  ASN C CG  1 
ATOM   3584 O  OD1 . ASN C 1 39  ? 78.479  13.785  50.787  1.00 3.00  ? 39  ASN C OD1 1 
ATOM   3585 N  ND2 . ASN C 1 39  ? 79.842  15.413  51.544  1.00 3.09  ? 39  ASN C ND2 1 
ATOM   3586 N  N   . ALA C 1 40  ? 75.031  17.600  50.375  1.00 3.92  ? 40  ALA C N   1 
ATOM   3587 C  CA  . ALA C 1 40  ? 73.900  18.453  50.753  1.00 4.11  ? 40  ALA C CA  1 
ATOM   3588 C  C   . ALA C 1 40  ? 72.572  17.792  50.396  1.00 4.16  ? 40  ALA C C   1 
ATOM   3589 O  O   . ALA C 1 40  ? 71.648  17.761  51.222  1.00 4.85  ? 40  ALA C O   1 
ATOM   3590 C  CB  . ALA C 1 40  ? 74.014  19.827  50.078  1.00 4.56  ? 40  ALA C CB  1 
ATOM   3591 N  N   . ALA C 1 41  ? 72.478  17.258  49.176  1.00 3.85  ? 41  ALA C N   1 
ATOM   3592 C  CA  . ALA C 1 41  ? 71.225  16.680  48.663  1.00 3.91  ? 41  ALA C CA  1 
ATOM   3593 C  C   . ALA C 1 41  ? 70.885  15.378  49.359  1.00 4.14  ? 41  ALA C C   1 
ATOM   3594 O  O   . ALA C 1 41  ? 69.708  15.052  49.548  1.00 4.03  ? 41  ALA C O   1 
ATOM   3595 C  CB  . ALA C 1 41  ? 71.305  16.454  47.175  1.00 4.00  ? 41  ALA C CB  1 
ATOM   3596 N  N   . LEU C 1 42  ? 71.918  14.651  49.750  1.00 4.36  ? 42  LEU C N   1 
ATOM   3597 C  CA  . LEU C 1 42  ? 71.767  13.321  50.332  1.00 4.62  ? 42  LEU C CA  1 
ATOM   3598 C  C   . LEU C 1 42  ? 71.476  13.328  51.837  1.00 4.56  ? 42  LEU C C   1 
ATOM   3599 O  O   . LEU C 1 42  ? 71.156  12.306  52.411  1.00 4.56  ? 42  LEU C O   1 
ATOM   3600 C  CB  . LEU C 1 42  ? 73.000  12.474  50.025  1.00 5.06  ? 42  LEU C CB  1 
ATOM   3601 C  CG  . LEU C 1 42  ? 73.128  11.988  48.578  1.00 4.12  ? 42  LEU C CG  1 
ATOM   3602 C  CD1 . LEU C 1 42  ? 74.513  11.477  48.249  1.00 5.31  ? 42  LEU C CD1 1 
ATOM   3603 C  CD2 . LEU C 1 42  ? 72.066  10.912  48.287  1.00 4.34  ? 42  LEU C CD2 1 
ATOM   3604 N  N   . GLU C 1 43  ? 71.604  14.485  52.475  1.00 4.37  ? 43  GLU C N   1 
ATOM   3605 C  CA  . GLU C 1 43  ? 71.357  14.574  53.915  1.00 4.87  ? 43  GLU C CA  1 
ATOM   3606 C  C   . GLU C 1 43  ? 69.969  14.078  54.300  1.00 6.18  ? 43  GLU C C   1 
ATOM   3607 O  O   . GLU C 1 43  ? 69.823  13.409  55.315  1.00 6.79  ? 43  GLU C O   1 
ATOM   3608 C  CB  . GLU C 1 43  ? 71.578  15.993  54.429  1.00 4.23  ? 43  GLU C CB  1 
ATOM   3609 C  CG  . GLU C 1 43  ? 71.243  16.170  55.924  1.00 5.15  ? 43  GLU C CG  1 
ATOM   3610 C  CD  . GLU C 1 43  ? 72.221  15.448  56.881  1.00 7.64  ? 43  GLU C CD  1 
ATOM   3611 O  OE1 . GLU C 1 43  ? 73.393  15.226  56.523  1.00 8.34  ? 43  GLU C OE1 1 
ATOM   3612 O  OE2 . GLU C 1 43  ? 71.821  15.111  58.019  1.00 8.87  ? 43  GLU C OE2 1 
ATOM   3613 N  N   . SER C 1 44  ? 68.969  14.402  53.481  1.00 6.59  ? 44  SER C N   1 
ATOM   3614 C  CA  . SER C 1 44  ? 67.601  14.003  53.761  1.00 7.42  ? 44  SER C CA  1 
ATOM   3615 C  C   . SER C 1 44  ? 67.330  12.541  53.340  1.00 7.61  ? 44  SER C C   1 
ATOM   3616 O  O   . SER C 1 44  ? 66.236  12.026  53.564  1.00 8.13  ? 44  SER C O   1 
ATOM   3617 C  CB  . SER C 1 44  ? 66.615  14.960  53.082  1.00 7.78  ? 44  SER C CB  1 
ATOM   3618 O  OG  . SER C 1 44  ? 66.438  14.658  51.700  1.00 8.51  ? 44  SER C OG  1 
ATOM   3619 N  N   . LEU C 1 45  ? 68.327  11.866  52.755  1.00 7.53  ? 45  LEU C N   1 
ATOM   3620 C  CA  . LEU C 1 45  ? 68.114  10.546  52.137  1.00 7.85  ? 45  LEU C CA  1 
ATOM   3621 C  C   . LEU C 1 45  ? 69.042  9.454   52.677  1.00 8.19  ? 45  LEU C C   1 
ATOM   3622 O  O   . LEU C 1 45  ? 69.951  9.009   51.979  1.00 8.14  ? 45  LEU C O   1 
ATOM   3623 C  CB  . LEU C 1 45  ? 68.325  10.634  50.621  1.00 7.08  ? 45  LEU C CB  1 
ATOM   3624 C  CG  . LEU C 1 45  ? 67.375  11.507  49.803  1.00 8.20  ? 45  LEU C CG  1 
ATOM   3625 C  CD1 . LEU C 1 45  ? 67.833  11.726  48.338  1.00 8.65  ? 45  LEU C CD1 1 
ATOM   3626 C  CD2 . LEU C 1 45  ? 65.963  10.944  49.870  1.00 8.33  ? 45  LEU C CD2 1 
ATOM   3627 N  N   . PRO C 1 46  ? 68.811  9.001   53.921  1.00 8.22  ? 46  PRO C N   1 
ATOM   3628 C  CA  . PRO C 1 46  ? 69.759  8.069   54.541  1.00 8.27  ? 46  PRO C CA  1 
ATOM   3629 C  C   . PRO C 1 46  ? 69.830  6.677   53.880  1.00 8.83  ? 46  PRO C C   1 
ATOM   3630 O  O   . PRO C 1 46  ? 70.785  5.942   54.117  1.00 10.44 ? 46  PRO C O   1 
ATOM   3631 C  CB  . PRO C 1 46  ? 69.238  7.949   55.982  1.00 8.14  ? 46  PRO C CB  1 
ATOM   3632 C  CG  . PRO C 1 46  ? 67.793  8.231   55.863  1.00 7.64  ? 46  PRO C CG  1 
ATOM   3633 C  CD  . PRO C 1 46  ? 67.688  9.323   54.815  1.00 8.38  ? 46  PRO C CD  1 
ATOM   3634 N  N   . GLU C 1 47  ? 68.849  6.305   53.064  1.00 9.11  ? 47  GLU C N   1 
ATOM   3635 C  CA  . GLU C 1 47  ? 68.924  5.005   52.389  1.00 9.51  ? 47  GLU C CA  1 
ATOM   3636 C  C   . GLU C 1 47  ? 69.827  5.133   51.168  1.00 8.91  ? 47  GLU C C   1 
ATOM   3637 O  O   . GLU C 1 47  ? 70.426  4.160   50.718  1.00 9.52  ? 47  GLU C O   1 
ATOM   3638 C  CB  . GLU C 1 47  ? 67.543  4.472   51.992  1.00 10.45 ? 47  GLU C CB  1 
ATOM   3639 C  CG  . GLU C 1 47  ? 66.383  5.144   52.689  1.00 13.20 ? 47  GLU C CG  1 
ATOM   3640 C  CD  . GLU C 1 47  ? 65.911  6.387   51.953  1.00 14.73 ? 47  GLU C CD  1 
ATOM   3641 O  OE1 . GLU C 1 47  ? 65.049  6.269   51.040  1.00 17.63 ? 47  GLU C OE1 1 
ATOM   3642 O  OE2 . GLU C 1 47  ? 66.398  7.479   52.305  1.00 14.36 ? 47  GLU C OE2 1 
ATOM   3643 N  N   . PHE C 1 48  ? 69.956  6.354   50.652  1.00 7.79  ? 48  PHE C N   1 
ATOM   3644 C  CA  . PHE C 1 48  ? 70.840  6.586   49.513  1.00 6.69  ? 48  PHE C CA  1 
ATOM   3645 C  C   . PHE C 1 48  ? 72.241  7.093   49.915  1.00 6.65  ? 48  PHE C C   1 
ATOM   3646 O  O   . PHE C 1 48  ? 73.233  6.859   49.209  1.00 6.20  ? 48  PHE C O   1 
ATOM   3647 C  CB  . PHE C 1 48  ? 70.195  7.570   48.528  1.00 6.89  ? 48  PHE C CB  1 
ATOM   3648 C  CG  . PHE C 1 48  ? 68.961  7.042   47.828  1.00 7.89  ? 48  PHE C CG  1 
ATOM   3649 C  CD1 . PHE C 1 48  ? 69.073  6.203   46.730  1.00 8.86  ? 48  PHE C CD1 1 
ATOM   3650 C  CD2 . PHE C 1 48  ? 67.682  7.434   48.239  1.00 8.63  ? 48  PHE C CD2 1 
ATOM   3651 C  CE1 . PHE C 1 48  ? 67.943  5.728   46.077  1.00 9.51  ? 48  PHE C CE1 1 
ATOM   3652 C  CE2 . PHE C 1 48  ? 66.540  6.961   47.580  1.00 9.91  ? 48  PHE C CE2 1 
ATOM   3653 C  CZ  . PHE C 1 48  ? 66.670  6.112   46.501  1.00 10.36 ? 48  PHE C CZ  1 
ATOM   3654 N  N   . ALA C 1 49  ? 72.312  7.785   51.042  1.00 7.00  ? 49  ALA C N   1 
ATOM   3655 C  CA  . ALA C 1 49  ? 73.539  8.453   51.442  1.00 8.05  ? 49  ALA C CA  1 
ATOM   3656 C  C   . ALA C 1 49  ? 74.650  7.474   51.736  1.00 8.60  ? 49  ALA C C   1 
ATOM   3657 O  O   . ALA C 1 49  ? 75.824  7.805   51.577  1.00 10.09 ? 49  ALA C O   1 
ATOM   3658 C  CB  . ALA C 1 49  ? 73.312  9.342   52.656  1.00 7.55  ? 49  ALA C CB  1 
ATOM   3659 N  N   . ASN C 1 50  ? 74.300  6.265   52.158  1.00 9.44  ? 50  ASN C N   1 
ATOM   3660 C  CA  . ASN C 1 50  ? 75.338  5.299   52.510  1.00 9.95  ? 50  ASN C CA  1 
ATOM   3661 C  C   . ASN C 1 50  ? 75.961  4.562   51.330  1.00 9.50  ? 50  ASN C C   1 
ATOM   3662 O  O   . ASN C 1 50  ? 77.006  3.914   51.484  1.00 10.33 ? 50  ASN C O   1 
ATOM   3663 C  CB  . ASN C 1 50  ? 74.843  4.303   53.556  1.00 11.17 ? 50  ASN C CB  1 
ATOM   3664 C  CG  . ASN C 1 50  ? 73.390  3.941   53.378  1.00 13.21 ? 50  ASN C CG  1 
ATOM   3665 O  OD1 . ASN C 1 50  ? 72.972  3.473   52.311  1.00 17.40 ? 50  ASN C OD1 1 
ATOM   3666 N  ND2 . ASN C 1 50  ? 72.602  4.141   54.429  1.00 16.30 ? 50  ASN C ND2 1 
ATOM   3667 N  N   . LEU C 1 51  ? 75.336  4.660   50.159  1.00 9.01  ? 51  LEU C N   1 
ATOM   3668 C  CA  . LEU C 1 51  ? 75.815  3.912   48.990  1.00 7.76  ? 51  LEU C CA  1 
ATOM   3669 C  C   . LEU C 1 51  ? 77.092  4.491   48.396  1.00 7.17  ? 51  LEU C C   1 
ATOM   3670 O  O   . LEU C 1 51  ? 77.366  5.689   48.514  1.00 6.88  ? 51  LEU C O   1 
ATOM   3671 C  CB  . LEU C 1 51  ? 74.743  3.849   47.895  1.00 7.70  ? 51  LEU C CB  1 
ATOM   3672 C  CG  . LEU C 1 51  ? 73.359  3.359   48.296  1.00 7.75  ? 51  LEU C CG  1 
ATOM   3673 C  CD1 . LEU C 1 51  ? 72.392  3.524   47.131  1.00 6.48  ? 51  LEU C CD1 1 
ATOM   3674 C  CD2 . LEU C 1 51  ? 73.481  1.886   48.736  1.00 6.92  ? 51  LEU C CD2 1 
ATOM   3675 N  N   . PRO C 1 52  ? 77.887  3.629   47.769  1.00 5.83  ? 52  PRO C N   1 
ATOM   3676 C  CA  . PRO C 1 52  ? 79.002  4.140   46.978  1.00 5.59  ? 52  PRO C CA  1 
ATOM   3677 C  C   . PRO C 1 52  ? 78.485  5.070   45.891  1.00 4.90  ? 52  PRO C C   1 
ATOM   3678 O  O   . PRO C 1 52  ? 77.431  4.814   45.294  1.00 4.14  ? 52  PRO C O   1 
ATOM   3679 C  CB  . PRO C 1 52  ? 79.605  2.876   46.359  1.00 5.60  ? 52  PRO C CB  1 
ATOM   3680 C  CG  . PRO C 1 52  ? 79.153  1.751   47.233  1.00 5.33  ? 52  PRO C CG  1 
ATOM   3681 C  CD  . PRO C 1 52  ? 77.802  2.157   47.744  1.00 6.60  ? 52  PRO C CD  1 
ATOM   3682 N  N   . VAL C 1 53  ? 79.225  6.132   45.608  1.00 4.92  ? 53  VAL C N   1 
ATOM   3683 C  CA  . VAL C 1 53  ? 78.759  7.056   44.585  1.00 4.85  ? 53  VAL C CA  1 
ATOM   3684 C  C   . VAL C 1 53  ? 78.501  6.336   43.243  1.00 5.47  ? 53  VAL C C   1 
ATOM   3685 O  O   . VAL C 1 53  ? 77.552  6.662   42.530  1.00 3.89  ? 53  VAL C O   1 
ATOM   3686 C  CB  . VAL C 1 53  ? 79.713  8.262   44.421  1.00 4.51  ? 53  VAL C CB  1 
ATOM   3687 C  CG1 . VAL C 1 53  ? 81.038  7.819   43.814  1.00 3.41  ? 53  VAL C CG1 1 
ATOM   3688 C  CG2 . VAL C 1 53  ? 79.053  9.349   43.580  1.00 3.83  ? 53  VAL C CG2 1 
ATOM   3689 N  N   . GLU C 1 54  ? 79.332  5.357   42.902  1.00 6.25  ? 54  GLU C N   1 
ATOM   3690 C  CA  . GLU C 1 54  ? 79.217  4.710   41.606  1.00 7.14  ? 54  GLU C CA  1 
ATOM   3691 C  C   . GLU C 1 54  ? 77.939  3.887   41.542  1.00 6.61  ? 54  GLU C C   1 
ATOM   3692 O  O   . GLU C 1 54  ? 77.359  3.669   40.464  1.00 6.96  ? 54  GLU C O   1 
ATOM   3693 C  CB  . GLU C 1 54  ? 80.448  3.859   41.324  1.00 7.95  ? 54  GLU C CB  1 
ATOM   3694 C  CG  . GLU C 1 54  ? 81.737  4.643   41.204  1.00 10.54 ? 54  GLU C CG  1 
ATOM   3695 C  CD  . GLU C 1 54  ? 82.351  5.094   42.551  1.00 11.65 ? 54  GLU C CD  1 
ATOM   3696 O  OE1 . GLU C 1 54  ? 81.821  4.771   43.645  1.00 10.79 ? 54  GLU C OE1 1 
ATOM   3697 O  OE2 . GLU C 1 54  ? 83.401  5.771   42.504  1.00 13.79 ? 54  GLU C OE2 1 
ATOM   3698 N  N   . GLU C 1 55  ? 77.475  3.452   42.716  1.00 7.11  ? 55  GLU C N   1 
ATOM   3699 C  CA  . GLU C 1 55  ? 76.230  2.704   42.784  1.00 7.06  ? 55  GLU C CA  1 
ATOM   3700 C  C   . GLU C 1 55  ? 75.034  3.645   42.738  1.00 6.36  ? 55  GLU C C   1 
ATOM   3701 O  O   . GLU C 1 55  ? 74.082  3.417   41.994  1.00 6.93  ? 55  GLU C O   1 
ATOM   3702 C  CB  . GLU C 1 55  ? 76.175  1.830   44.041  1.00 7.72  ? 55  GLU C CB  1 
ATOM   3703 C  CG  . GLU C 1 55  ? 74.837  1.161   44.225  1.00 9.70  ? 55  GLU C CG  1 
ATOM   3704 C  CD  . GLU C 1 55  ? 74.827  0.139   45.351  1.00 12.09 ? 55  GLU C CD  1 
ATOM   3705 O  OE1 . GLU C 1 55  ? 75.855  -0.013  46.062  1.00 11.80 ? 55  GLU C OE1 1 
ATOM   3706 O  OE2 . GLU C 1 55  ? 73.782  -0.519  45.523  1.00 15.41 ? 55  GLU C OE2 1 
ATOM   3707 N  N   . LEU C 1 56  ? 75.097  4.698   43.539  1.00 6.18  ? 56  LEU C N   1 
ATOM   3708 C  CA  . LEU C 1 56  ? 74.049  5.739   43.582  1.00 6.00  ? 56  LEU C CA  1 
ATOM   3709 C  C   . LEU C 1 56  ? 73.622  6.245   42.201  1.00 6.29  ? 56  LEU C C   1 
ATOM   3710 O  O   . LEU C 1 56  ? 72.427  6.446   41.938  1.00 6.08  ? 56  LEU C O   1 
ATOM   3711 C  CB  . LEU C 1 56  ? 74.530  6.923   44.432  1.00 6.61  ? 56  LEU C CB  1 
ATOM   3712 C  CG  . LEU C 1 56  ? 73.497  8.048   44.498  1.00 7.56  ? 56  LEU C CG  1 
ATOM   3713 C  CD1 . LEU C 1 56  ? 72.186  7.571   45.131  1.00 7.70  ? 56  LEU C CD1 1 
ATOM   3714 C  CD2 . LEU C 1 56  ? 74.046  9.265   45.230  1.00 9.09  ? 56  LEU C CD2 1 
ATOM   3715 N  N   . ILE C 1 57  ? 74.589  6.446   41.307  1.00 5.93  ? 57  ILE C N   1 
ATOM   3716 C  CA  . ILE C 1 57  ? 74.279  6.988   39.981  1.00 6.16  ? 57  ILE C CA  1 
ATOM   3717 C  C   . ILE C 1 57  ? 73.592  5.979   39.054  1.00 6.34  ? 57  ILE C C   1 
ATOM   3718 O  O   . ILE C 1 57  ? 73.118  6.317   37.967  1.00 6.88  ? 57  ILE C O   1 
ATOM   3719 C  CB  . ILE C 1 57  ? 75.525  7.624   39.330  1.00 5.50  ? 57  ILE C CB  1 
ATOM   3720 C  CG1 . ILE C 1 57  ? 76.642  6.590   39.119  1.00 5.90  ? 57  ILE C CG1 1 
ATOM   3721 C  CG2 . ILE C 1 57  ? 75.989  8.783   40.193  1.00 5.12  ? 57  ILE C CG2 1 
ATOM   3722 C  CD1 . ILE C 1 57  ? 77.860  7.133   38.352  1.00 5.77  ? 57  ILE C CD1 1 
ATOM   3723 N  N   . THR C 1 58  ? 73.516  4.733   39.491  1.00 6.94  ? 58  THR C N   1 
ATOM   3724 C  CA  . THR C 1 58  ? 72.712  3.766   38.759  1.00 7.03  ? 58  THR C CA  1 
ATOM   3725 C  C   . THR C 1 58  ? 71.270  3.723   39.286  1.00 7.36  ? 58  THR C C   1 
ATOM   3726 O  O   . THR C 1 58  ? 70.497  2.851   38.894  1.00 7.84  ? 58  THR C O   1 
ATOM   3727 C  CB  . THR C 1 58  ? 73.306  2.362   38.875  1.00 7.11  ? 58  THR C CB  1 
ATOM   3728 O  OG1 . THR C 1 58  ? 73.098  1.866   40.207  1.00 7.87  ? 58  THR C OG1 1 
ATOM   3729 C  CG2 . THR C 1 58  ? 74.810  2.383   38.544  1.00 7.17  ? 58  THR C CG2 1 
ATOM   3730 N  N   . LYS C 1 59  ? 70.904  4.672   40.143  1.00 7.38  ? 59  LYS C N   1 
ATOM   3731 C  CA  . LYS C 1 59  ? 69.607  4.635   40.834  1.00 7.39  ? 59  LYS C CA  1 
ATOM   3732 C  C   . LYS C 1 59  ? 68.889  5.976   40.811  1.00 7.14  ? 59  LYS C C   1 
ATOM   3733 O  O   . LYS C 1 59  ? 68.045  6.258   41.638  1.00 7.04  ? 59  LYS C O   1 
ATOM   3734 C  CB  . LYS C 1 59  ? 69.811  4.162   42.280  1.00 8.22  ? 59  LYS C CB  1 
ATOM   3735 C  CG  . LYS C 1 59  ? 70.481  2.814   42.333  1.00 9.41  ? 59  LYS C CG  1 
ATOM   3736 C  CD  . LYS C 1 59  ? 70.639  2.260   43.730  1.00 11.71 ? 59  LYS C CD  1 
ATOM   3737 C  CE  . LYS C 1 59  ? 70.431  0.740   43.707  1.00 13.28 ? 59  LYS C CE  1 
ATOM   3738 N  NZ  . LYS C 1 59  ? 70.570  0.131   45.067  1.00 14.96 ? 59  LYS C NZ  1 
ATOM   3739 N  N   . LEU C 1 60  ? 69.241  6.817   39.852  1.00 6.19  ? 60  LEU C N   1 
ATOM   3740 C  CA  . LEU C 1 60  ? 68.714  8.168   39.842  1.00 6.44  ? 60  LEU C CA  1 
ATOM   3741 C  C   . LEU C 1 60  ? 67.202  8.160   39.734  1.00 6.28  ? 60  LEU C C   1 
ATOM   3742 O  O   . LEU C 1 60  ? 66.539  9.059   40.245  1.00 6.18  ? 60  LEU C O   1 
ATOM   3743 C  CB  . LEU C 1 60  ? 69.324  8.963   38.687  1.00 6.05  ? 60  LEU C CB  1 
ATOM   3744 C  CG  . LEU C 1 60  ? 70.836  9.153   38.868  1.00 4.65  ? 60  LEU C CG  1 
ATOM   3745 C  CD1 . LEU C 1 60  ? 71.475  9.704   37.564  1.00 7.55  ? 60  LEU C CD1 1 
ATOM   3746 C  CD2 . LEU C 1 60  ? 71.172  10.031  40.102  1.00 4.22  ? 60  LEU C CD2 1 
ATOM   3747 N  N   . ASP C 1 61  ? 66.672  7.148   39.049  1.00 7.37  ? 61  ASP C N   1 
ATOM   3748 C  CA  . ASP C 1 61  ? 65.238  6.984   38.868  1.00 8.41  ? 61  ASP C CA  1 
ATOM   3749 C  C   . ASP C 1 61  ? 64.578  6.705   40.213  1.00 8.31  ? 61  ASP C C   1 
ATOM   3750 O  O   . ASP C 1 61  ? 63.433  7.096   40.442  1.00 8.55  ? 61  ASP C O   1 
ATOM   3751 C  CB  . ASP C 1 61  ? 64.952  5.818   37.914  1.00 9.15  ? 61  ASP C CB  1 
ATOM   3752 C  CG  . ASP C 1 61  ? 65.257  6.151   36.468  1.00 12.11 ? 61  ASP C CG  1 
ATOM   3753 O  OD1 . ASP C 1 61  ? 65.714  5.248   35.721  1.00 15.12 ? 61  ASP C OD1 1 
ATOM   3754 O  OD2 . ASP C 1 61  ? 65.034  7.318   36.059  1.00 14.97 ? 61  ASP C OD2 1 
ATOM   3755 N  N   . GLN C 1 62  ? 65.298  6.026   41.104  1.00 7.82  ? 62  GLN C N   1 
ATOM   3756 C  CA  . GLN C 1 62  ? 64.716  5.653   42.413  1.00 7.61  ? 62  GLN C CA  1 
ATOM   3757 C  C   . GLN C 1 62  ? 64.593  6.833   43.385  1.00 7.27  ? 62  GLN C C   1 
ATOM   3758 O  O   . GLN C 1 62  ? 63.887  6.743   44.387  1.00 7.44  ? 62  GLN C O   1 
ATOM   3759 C  CB  . GLN C 1 62  ? 65.550  4.577   43.077  1.00 7.30  ? 62  GLN C CB  1 
ATOM   3760 C  CG  . GLN C 1 62  ? 65.705  3.293   42.297  1.00 8.59  ? 62  GLN C CG  1 
ATOM   3761 C  CD  . GLN C 1 62  ? 66.402  2.229   43.115  1.00 9.93  ? 62  GLN C CD  1 
ATOM   3762 O  OE1 . GLN C 1 62  ? 66.428  2.292   44.344  1.00 13.88 ? 62  GLN C OE1 1 
ATOM   3763 N  NE2 . GLN C 1 62  ? 66.970  1.243   42.446  1.00 10.48 ? 62  GLN C NE2 1 
ATOM   3764 N  N   . LEU C 1 63  ? 65.320  7.916   43.114  1.00 7.10  ? 63  LEU C N   1 
ATOM   3765 C  CA  . LEU C 1 63  ? 65.303  9.084   43.977  1.00 6.64  ? 63  LEU C CA  1 
ATOM   3766 C  C   . LEU C 1 63  ? 63.953  9.788   43.853  1.00 7.06  ? 63  LEU C C   1 
ATOM   3767 O  O   . LEU C 1 63  ? 63.238  9.596   42.852  1.00 6.94  ? 63  LEU C O   1 
ATOM   3768 C  CB  . LEU C 1 63  ? 66.416  10.067  43.578  1.00 5.96  ? 63  LEU C CB  1 
ATOM   3769 C  CG  . LEU C 1 63  ? 67.885  9.659   43.693  1.00 6.41  ? 63  LEU C CG  1 
ATOM   3770 C  CD1 . LEU C 1 63  ? 68.765  10.807  43.148  1.00 5.63  ? 63  LEU C CD1 1 
ATOM   3771 C  CD2 . LEU C 1 63  ? 68.237  9.343   45.121  1.00 4.45  ? 63  LEU C CD2 1 
ATOM   3772 N  N   . PRO C 1 64  ? 63.605  10.595  44.863  1.00 7.39  ? 64  PRO C N   1 
ATOM   3773 C  CA  . PRO C 1 64  ? 62.467  11.508  44.759  1.00 7.28  ? 64  PRO C CA  1 
ATOM   3774 C  C   . PRO C 1 64  ? 62.685  12.469  43.596  1.00 7.77  ? 64  PRO C C   1 
ATOM   3775 O  O   . PRO C 1 64  ? 63.820  12.938  43.356  1.00 8.02  ? 64  PRO C O   1 
ATOM   3776 C  CB  . PRO C 1 64  ? 62.508  12.273  46.080  1.00 7.30  ? 64  PRO C CB  1 
ATOM   3777 C  CG  . PRO C 1 64  ? 63.266  11.412  47.010  1.00 7.53  ? 64  PRO C CG  1 
ATOM   3778 C  CD  . PRO C 1 64  ? 64.271  10.686  46.176  1.00 7.24  ? 64  PRO C CD  1 
ATOM   3779 N  N   . ALA C 1 65  ? 61.617  12.771  42.864  1.00 7.77  ? 65  ALA C N   1 
ATOM   3780 C  CA  . ALA C 1 65  ? 61.768  13.550  41.648  1.00 7.22  ? 65  ALA C CA  1 
ATOM   3781 C  C   . ALA C 1 65  ? 62.594  14.836  41.817  1.00 7.40  ? 65  ALA C C   1 
ATOM   3782 O  O   . ALA C 1 65  ? 63.332  15.211  40.906  1.00 7.91  ? 65  ALA C O   1 
ATOM   3783 C  CB  . ALA C 1 65  ? 60.416  13.848  41.024  1.00 7.68  ? 65  ALA C CB  1 
ATOM   3784 N  N   . ASP C 1 66  ? 62.450  15.517  42.955  1.00 6.95  ? 66  ASP C N   1 
ATOM   3785 C  CA  . ASP C 1 66  ? 63.136  16.782  43.171  1.00 7.43  ? 66  ASP C CA  1 
ATOM   3786 C  C   . ASP C 1 66  ? 64.573  16.607  43.661  1.00 6.76  ? 66  ASP C C   1 
ATOM   3787 O  O   . ASP C 1 66  ? 65.225  17.583  44.014  1.00 7.49  ? 66  ASP C O   1 
ATOM   3788 C  CB  . ASP C 1 66  ? 62.318  17.733  44.073  1.00 7.35  ? 66  ASP C CB  1 
ATOM   3789 C  CG  . ASP C 1 66  ? 62.220  17.262  45.516  1.00 10.43 ? 66  ASP C CG  1 
ATOM   3790 O  OD1 . ASP C 1 66  ? 61.688  18.028  46.347  1.00 14.24 ? 66  ASP C OD1 1 
ATOM   3791 O  OD2 . ASP C 1 66  ? 62.682  16.150  45.843  1.00 12.39 ? 66  ASP C OD2 1 
ATOM   3792 N  N   . LYS C 1 67  ? 65.054  15.365  43.671  1.00 6.19  ? 67  LYS C N   1 
ATOM   3793 C  CA  . LYS C 1 67  ? 66.472  15.076  43.957  1.00 5.76  ? 67  LYS C CA  1 
ATOM   3794 C  C   . LYS C 1 67  ? 67.247  14.534  42.752  1.00 5.60  ? 67  LYS C C   1 
ATOM   3795 O  O   . LYS C 1 67  ? 68.466  14.341  42.808  1.00 5.21  ? 67  LYS C O   1 
ATOM   3796 C  CB  . LYS C 1 67  ? 66.576  14.049  45.082  1.00 5.82  ? 67  LYS C CB  1 
ATOM   3797 C  CG  . LYS C 1 67  ? 66.031  14.524  46.396  1.00 6.50  ? 67  LYS C CG  1 
ATOM   3798 C  CD  . LYS C 1 67  ? 66.984  15.456  47.108  1.00 6.61  ? 67  LYS C CD  1 
ATOM   3799 C  CE  . LYS C 1 67  ? 66.540  15.623  48.545  1.00 7.00  ? 67  LYS C CE  1 
ATOM   3800 N  NZ  . LYS C 1 67  ? 67.421  16.600  49.242  1.00 6.42  ? 67  LYS C NZ  1 
ATOM   3801 N  N   . LYS C 1 68  ? 66.540  14.275  41.665  1.00 5.29  ? 68  LYS C N   1 
ATOM   3802 C  CA  . LYS C 1 68  ? 67.128  13.624  40.513  1.00 5.76  ? 68  LYS C CA  1 
ATOM   3803 C  C   . LYS C 1 68  ? 68.250  14.433  39.881  1.00 5.10  ? 68  LYS C C   1 
ATOM   3804 O  O   . LYS C 1 68  ? 69.362  13.932  39.656  1.00 5.36  ? 68  LYS C O   1 
ATOM   3805 C  CB  . LYS C 1 68  ? 66.042  13.382  39.468  1.00 5.76  ? 68  LYS C CB  1 
ATOM   3806 C  CG  . LYS C 1 68  ? 66.563  12.851  38.145  1.00 8.11  ? 68  LYS C CG  1 
ATOM   3807 C  CD  . LYS C 1 68  ? 65.467  12.143  37.370  1.00 9.88  ? 68  LYS C CD  1 
ATOM   3808 C  CE  . LYS C 1 68  ? 66.024  11.521  36.078  1.00 11.19 ? 68  LYS C CE  1 
ATOM   3809 N  NZ  . LYS C 1 68  ? 65.097  10.546  35.416  1.00 11.71 ? 68  LYS C NZ  1 
ATOM   3810 N  N   . THR C 1 69  ? 67.950  15.681  39.568  1.00 4.84  ? 69  THR C N   1 
ATOM   3811 C  CA  . THR C 1 69  ? 68.877  16.482  38.780  1.00 4.16  ? 69  THR C CA  1 
ATOM   3812 C  C   . THR C 1 69  ? 70.096  16.947  39.560  1.00 3.79  ? 69  THR C C   1 
ATOM   3813 O  O   . THR C 1 69  ? 71.227  16.911  39.060  1.00 3.28  ? 69  THR C O   1 
ATOM   3814 C  CB  . THR C 1 69  ? 68.188  17.703  38.200  1.00 3.75  ? 69  THR C CB  1 
ATOM   3815 O  OG1 . THR C 1 69  ? 67.159  17.291  37.292  1.00 4.02  ? 69  THR C OG1 1 
ATOM   3816 C  CG2 . THR C 1 69  ? 69.196  18.545  37.447  1.00 3.77  ? 69  THR C CG2 1 
ATOM   3817 N  N   . VAL C 1 70  ? 69.873  17.388  40.786  1.00 3.37  ? 70  VAL C N   1 
ATOM   3818 C  CA  . VAL C 1 70  ? 70.990  17.823  41.617  1.00 3.87  ? 70  VAL C CA  1 
ATOM   3819 C  C   . VAL C 1 70  ? 71.942  16.659  41.874  1.00 3.37  ? 70  VAL C C   1 
ATOM   3820 O  O   . VAL C 1 70  ? 73.157  16.838  41.980  1.00 2.44  ? 70  VAL C O   1 
ATOM   3821 C  CB  . VAL C 1 70  ? 70.502  18.469  42.946  1.00 3.62  ? 70  VAL C CB  1 
ATOM   3822 C  CG1 . VAL C 1 70  ? 69.745  17.464  43.790  1.00 4.73  ? 70  VAL C CG1 1 
ATOM   3823 C  CG2 . VAL C 1 70  ? 71.661  19.096  43.730  1.00 3.85  ? 70  VAL C CG2 1 
ATOM   3824 N  N   . LEU C 1 71  ? 71.416  15.448  41.958  1.00 2.81  ? 71  LEU C N   1 
ATOM   3825 C  CA  . LEU C 1 71  ? 72.311  14.312  42.210  1.00 3.35  ? 71  LEU C CA  1 
ATOM   3826 C  C   . LEU C 1 71  ? 72.882  13.726  40.931  1.00 3.41  ? 71  LEU C C   1 
ATOM   3827 O  O   . LEU C 1 71  ? 74.010  13.205  40.915  1.00 3.81  ? 71  LEU C O   1 
ATOM   3828 C  CB  . LEU C 1 71  ? 71.673  13.217  43.077  1.00 3.55  ? 71  LEU C CB  1 
ATOM   3829 C  CG  . LEU C 1 71  ? 71.673  13.517  44.568  1.00 3.55  ? 71  LEU C CG  1 
ATOM   3830 C  CD1 . LEU C 1 71  ? 70.716  12.560  45.294  1.00 5.55  ? 71  LEU C CD1 1 
ATOM   3831 C  CD2 . LEU C 1 71  ? 73.088  13.450  45.179  1.00 2.57  ? 71  LEU C CD2 1 
ATOM   3832 N  N   . ARG C 1 72  ? 72.101  13.775  39.858  1.00 2.86  ? 72  ARG C N   1 
ATOM   3833 C  CA  . ARG C 1 72  ? 72.652  13.419  38.570  1.00 3.53  ? 72  ARG C CA  1 
ATOM   3834 C  C   . ARG C 1 72  ? 73.885  14.267  38.294  1.00 3.26  ? 72  ARG C C   1 
ATOM   3835 O  O   . ARG C 1 72  ? 74.946  13.741  37.950  1.00 2.63  ? 72  ARG C O   1 
ATOM   3836 C  CB  . ARG C 1 72  ? 71.609  13.616  37.479  1.00 2.99  ? 72  ARG C CB  1 
ATOM   3837 C  CG  . ARG C 1 72  ? 72.067  13.348  36.060  1.00 2.83  ? 72  ARG C CG  1 
ATOM   3838 C  CD  . ARG C 1 72  ? 70.907  13.677  35.133  1.00 2.38  ? 72  ARG C CD  1 
ATOM   3839 N  NE  . ARG C 1 72  ? 71.268  13.778  33.723  1.00 1.89  ? 72  ARG C NE  1 
ATOM   3840 C  CZ  . ARG C 1 72  ? 70.365  13.862  32.749  1.00 3.08  ? 72  ARG C CZ  1 
ATOM   3841 N  NH1 . ARG C 1 72  ? 69.062  13.844  33.033  1.00 4.58  ? 72  ARG C NH1 1 
ATOM   3842 N  NH2 . ARG C 1 72  ? 70.761  13.960  31.490  1.00 4.06  ? 72  ARG C NH2 1 
ATOM   3843 N  N   . ASN C 1 73  ? 73.746  15.576  38.472  1.00 2.90  ? 73  ASN C N   1 
ATOM   3844 C  CA  . ASN C 1 73  ? 74.861  16.473  38.202  1.00 3.02  ? 73  ASN C CA  1 
ATOM   3845 C  C   . ASN C 1 73  ? 76.041  16.301  39.160  1.00 2.94  ? 73  ASN C C   1 
ATOM   3846 O  O   . ASN C 1 73  ? 77.194  16.192  38.738  1.00 3.71  ? 73  ASN C O   1 
ATOM   3847 C  CB  . ASN C 1 73  ? 74.389  17.937  38.163  1.00 1.82  ? 73  ASN C CB  1 
ATOM   3848 C  CG  . ASN C 1 73  ? 73.414  18.207  37.027  1.00 2.09  ? 73  ASN C CG  1 
ATOM   3849 O  OD1 . ASN C 1 73  ? 73.368  17.475  36.045  1.00 1.98  ? 73  ASN C OD1 1 
ATOM   3850 N  ND2 . ASN C 1 73  ? 72.627  19.269  37.168  1.00 1.03  ? 73  ASN C ND2 1 
ATOM   3851 N  N   . ASN C 1 74  ? 75.756  16.275  40.452  1.00 3.92  ? 74  ASN C N   1 
ATOM   3852 C  CA  . ASN C 1 74  ? 76.819  16.268  41.441  1.00 2.98  ? 74  ASN C CA  1 
ATOM   3853 C  C   . ASN C 1 74  ? 77.372  14.899  41.858  1.00 3.63  ? 74  ASN C C   1 
ATOM   3854 O  O   . ASN C 1 74  ? 78.570  14.766  42.077  1.00 2.00  ? 74  ASN C O   1 
ATOM   3855 C  CB  . ASN C 1 74  ? 76.396  17.113  42.656  1.00 3.17  ? 74  ASN C CB  1 
ATOM   3856 C  CG  . ASN C 1 74  ? 76.300  18.584  42.322  1.00 3.53  ? 74  ASN C CG  1 
ATOM   3857 O  OD1 . ASN C 1 74  ? 77.307  19.300  42.284  1.00 3.11  ? 74  ASN C OD1 1 
ATOM   3858 N  ND2 . ASN C 1 74  ? 75.072  19.049  42.064  1.00 3.76  ? 74  ASN C ND2 1 
ATOM   3859 N  N   . ALA C 1 75  ? 76.515  13.889  42.002  1.00 2.31  ? 75  ALA C N   1 
ATOM   3860 C  CA  . ALA C 1 75  ? 77.024  12.551  42.191  1.00 2.73  ? 75  ALA C CA  1 
ATOM   3861 C  C   . ALA C 1 75  ? 77.729  12.139  40.914  1.00 2.08  ? 75  ALA C C   1 
ATOM   3862 O  O   . ALA C 1 75  ? 78.750  11.494  40.954  1.00 2.24  ? 75  ALA C O   1 
ATOM   3863 C  CB  . ALA C 1 75  ? 75.904  11.581  42.540  1.00 1.86  ? 75  ALA C CB  1 
ATOM   3864 N  N   . GLY C 1 76  ? 77.150  12.482  39.766  1.00 2.63  ? 76  GLY C N   1 
ATOM   3865 C  CA  . GLY C 1 76  ? 77.828  12.213  38.511  1.00 1.87  ? 76  GLY C CA  1 
ATOM   3866 C  C   . GLY C 1 76  ? 79.220  12.844  38.492  1.00 2.32  ? 76  GLY C C   1 
ATOM   3867 O  O   . GLY C 1 76  ? 80.197  12.196  38.104  1.00 1.57  ? 76  GLY C O   1 
ATOM   3868 N  N   . GLY C 1 77  ? 79.304  14.116  38.879  1.00 1.92  ? 77  GLY C N   1 
ATOM   3869 C  CA  . GLY C 1 77  ? 80.590  14.821  38.906  1.00 2.12  ? 77  GLY C CA  1 
ATOM   3870 C  C   . GLY C 1 77  ? 81.581  14.117  39.827  1.00 2.27  ? 77  GLY C C   1 
ATOM   3871 O  O   . GLY C 1 77  ? 82.752  13.943  39.487  1.00 2.12  ? 77  GLY C O   1 
ATOM   3872 N  N   . HIS C 1 78  ? 81.116  13.705  41.002  1.00 2.14  ? 78  HIS C N   1 
ATOM   3873 C  CA  . HIS C 1 78  ? 81.989  13.029  41.971  1.00 2.23  ? 78  HIS C CA  1 
ATOM   3874 C  C   . HIS C 1 78  ? 82.495  11.687  41.427  1.00 2.06  ? 78  HIS C C   1 
ATOM   3875 O  O   . HIS C 1 78  ? 83.690  11.389  41.469  1.00 2.00  ? 78  HIS C O   1 
ATOM   3876 C  CB  . HIS C 1 78  ? 81.242  12.845  43.311  1.00 2.15  ? 78  HIS C CB  1 
ATOM   3877 C  CG  . HIS C 1 78  ? 82.047  12.184  44.386  1.00 1.29  ? 78  HIS C CG  1 
ATOM   3878 N  ND1 . HIS C 1 78  ? 83.351  12.532  44.680  1.00 2.63  ? 78  HIS C ND1 1 
ATOM   3879 C  CD2 . HIS C 1 78  ? 81.713  11.205  45.261  1.00 2.03  ? 78  HIS C CD2 1 
ATOM   3880 C  CE1 . HIS C 1 78  ? 83.794  11.778  45.671  1.00 3.02  ? 78  HIS C CE1 1 
ATOM   3881 N  NE2 . HIS C 1 78  ? 82.812  10.977  46.056  1.00 1.97  ? 78  HIS C NE2 1 
ATOM   3882 N  N   . ALA C 1 79  ? 81.598  10.860  40.914  1.00 2.18  ? 79  ALA C N   1 
ATOM   3883 C  CA  . ALA C 1 79  ? 82.014  9.585   40.357  1.00 2.41  ? 79  ALA C CA  1 
ATOM   3884 C  C   . ALA C 1 79  ? 82.987  9.792   39.203  1.00 2.69  ? 79  ALA C C   1 
ATOM   3885 O  O   . ALA C 1 79  ? 84.023  9.162   39.173  1.00 2.43  ? 79  ALA C O   1 
ATOM   3886 C  CB  . ALA C 1 79  ? 80.814  8.794   39.874  1.00 2.15  ? 79  ALA C CB  1 
ATOM   3887 N  N   . ASN C 1 80  ? 82.655  10.699  38.291  1.00 3.35  ? 80  ASN C N   1 
ATOM   3888 C  CA  . ASN C 1 80  ? 83.470  10.894  37.093  1.00 2.48  ? 80  ASN C CA  1 
ATOM   3889 C  C   . ASN C 1 80  ? 84.856  11.401  37.408  1.00 2.60  ? 80  ASN C C   1 
ATOM   3890 O  O   . ASN C 1 80  ? 85.828  10.895  36.858  1.00 1.72  ? 80  ASN C O   1 
ATOM   3891 C  CB  . ASN C 1 80  ? 82.828  11.854  36.097  1.00 2.44  ? 80  ASN C CB  1 
ATOM   3892 C  CG  . ASN C 1 80  ? 81.500  11.360  35.579  1.00 3.36  ? 80  ASN C CG  1 
ATOM   3893 O  OD1 . ASN C 1 80  ? 81.206  10.161  35.604  1.00 1.94  ? 80  ASN C OD1 1 
ATOM   3894 N  ND2 . ASN C 1 80  ? 80.704  12.290  35.057  1.00 2.69  ? 80  ASN C ND2 1 
ATOM   3895 N  N   . HIS C 1 81  ? 84.950  12.399  38.288  1.00 2.05  ? 81  HIS C N   1 
ATOM   3896 C  CA  . HIS C 1 81  ? 86.261  12.946  38.631  1.00 2.21  ? 81  HIS C CA  1 
ATOM   3897 C  C   . HIS C 1 81  ? 87.072  11.961  39.475  1.00 2.40  ? 81  HIS C C   1 
ATOM   3898 O  O   . HIS C 1 81  ? 88.279  11.840  39.287  1.00 2.03  ? 81  HIS C O   1 
ATOM   3899 C  CB  . HIS C 1 81  ? 86.143  14.336  39.252  1.00 2.08  ? 81  HIS C CB  1 
ATOM   3900 C  CG  . HIS C 1 81  ? 85.717  15.386  38.270  1.00 2.27  ? 81  HIS C CG  1 
ATOM   3901 N  ND1 . HIS C 1 81  ? 84.399  15.586  37.916  1.00 2.53  ? 81  HIS C ND1 1 
ATOM   3902 C  CD2 . HIS C 1 81  ? 86.442  16.256  37.515  1.00 3.27  ? 81  HIS C CD2 1 
ATOM   3903 C  CE1 . HIS C 1 81  ? 84.326  16.549  37.013  1.00 3.64  ? 81  HIS C CE1 1 
ATOM   3904 N  NE2 . HIS C 1 81  ? 85.548  16.979  36.756  1.00 2.69  ? 81  HIS C NE2 1 
ATOM   3905 N  N   . SER C 1 82  ? 86.416  11.210  40.370  1.00 2.04  ? 82  SER C N   1 
ATOM   3906 C  CA  . SER C 1 82  ? 87.175  10.186  41.097  1.00 2.51  ? 82  SER C CA  1 
ATOM   3907 C  C   . SER C 1 82  ? 87.836  9.156   40.174  1.00 2.64  ? 82  SER C C   1 
ATOM   3908 O  O   . SER C 1 82  ? 88.977  8.742   40.415  1.00 2.94  ? 82  SER C O   1 
ATOM   3909 C  CB  . SER C 1 82  ? 86.272  9.477   42.107  1.00 2.43  ? 82  SER C CB  1 
ATOM   3910 O  OG  . SER C 1 82  ? 85.728  10.400  43.032  1.00 2.57  ? 82  SER C OG  1 
ATOM   3911 N  N   . LEU C 1 83  ? 87.119  8.730   39.136  1.00 2.66  ? 83  LEU C N   1 
ATOM   3912 C  CA  . LEU C 1 83  ? 87.671  7.832   38.124  1.00 3.26  ? 83  LEU C CA  1 
ATOM   3913 C  C   . LEU C 1 83  ? 88.812  8.536   37.362  1.00 3.72  ? 83  LEU C C   1 
ATOM   3914 O  O   . LEU C 1 83  ? 89.899  7.966   37.166  1.00 4.32  ? 83  LEU C O   1 
ATOM   3915 C  CB  . LEU C 1 83  ? 86.546  7.359   37.181  1.00 3.00  ? 83  LEU C CB  1 
ATOM   3916 C  CG  . LEU C 1 83  ? 86.908  6.432   36.021  1.00 4.91  ? 83  LEU C CG  1 
ATOM   3917 C  CD1 . LEU C 1 83  ? 85.669  5.795   35.440  1.00 5.07  ? 83  LEU C CD1 1 
ATOM   3918 C  CD2 . LEU C 1 83  ? 87.647  7.233   34.965  1.00 5.12  ? 83  LEU C CD2 1 
ATOM   3919 N  N   . PHE C 1 84  ? 88.570  9.783   36.956  1.00 4.39  ? 84  PHE C N   1 
ATOM   3920 C  CA  . PHE C 1 84  ? 89.555  10.557  36.211  1.00 3.27  ? 84  PHE C CA  1 
ATOM   3921 C  C   . PHE C 1 84  ? 90.891  10.574  36.935  1.00 3.68  ? 84  PHE C C   1 
ATOM   3922 O  O   . PHE C 1 84  ? 91.923  10.212  36.348  1.00 3.52  ? 84  PHE C O   1 
ATOM   3923 C  CB  . PHE C 1 84  ? 89.041  11.993  35.962  1.00 2.71  ? 84  PHE C CB  1 
ATOM   3924 C  CG  . PHE C 1 84  ? 89.776  12.757  34.869  1.00 1.47  ? 84  PHE C CG  1 
ATOM   3925 C  CD1 . PHE C 1 84  ? 89.990  12.210  33.603  1.00 1.07  ? 84  PHE C CD1 1 
ATOM   3926 C  CD2 . PHE C 1 84  ? 90.164  14.071  35.106  1.00 1.47  ? 84  PHE C CD2 1 
ATOM   3927 C  CE1 . PHE C 1 84  ? 90.629  12.933  32.611  1.00 0.91  ? 84  PHE C CE1 1 
ATOM   3928 C  CE2 . PHE C 1 84  ? 90.790  14.807  34.117  1.00 1.42  ? 84  PHE C CE2 1 
ATOM   3929 C  CZ  . PHE C 1 84  ? 91.032  14.246  32.883  1.00 1.92  ? 84  PHE C CZ  1 
ATOM   3930 N  N   . TRP C 1 85  ? 90.900  10.962  38.208  1.00 3.91  ? 85  TRP C N   1 
ATOM   3931 C  CA  . TRP C 1 85  ? 92.193  11.135  38.870  1.00 3.78  ? 85  TRP C CA  1 
ATOM   3932 C  C   . TRP C 1 85  ? 93.002  9.827   38.889  1.00 4.10  ? 85  TRP C C   1 
ATOM   3933 O  O   . TRP C 1 85  ? 94.209  9.838   38.602  1.00 3.59  ? 85  TRP C O   1 
ATOM   3934 C  CB  . TRP C 1 85  ? 92.072  11.715  40.287  1.00 3.97  ? 85  TRP C CB  1 
ATOM   3935 C  CG  . TRP C 1 85  ? 91.210  12.921  40.409  1.00 2.85  ? 85  TRP C CG  1 
ATOM   3936 C  CD1 . TRP C 1 85  ? 90.187  13.108  41.299  1.00 1.99  ? 85  TRP C CD1 1 
ATOM   3937 C  CD2 . TRP C 1 85  ? 91.286  14.123  39.631  1.00 2.95  ? 85  TRP C CD2 1 
ATOM   3938 N  NE1 . TRP C 1 85  ? 89.616  14.345  41.111  1.00 2.29  ? 85  TRP C NE1 1 
ATOM   3939 C  CE2 . TRP C 1 85  ? 90.277  14.996  40.102  1.00 1.90  ? 85  TRP C CE2 1 
ATOM   3940 C  CE3 . TRP C 1 85  ? 92.107  14.554  38.582  1.00 2.86  ? 85  TRP C CE3 1 
ATOM   3941 C  CZ2 . TRP C 1 85  ? 90.051  16.264  39.542  1.00 2.16  ? 85  TRP C CZ2 1 
ATOM   3942 C  CZ3 . TRP C 1 85  ? 91.875  15.811  38.030  1.00 3.52  ? 85  TRP C CZ3 1 
ATOM   3943 C  CH2 . TRP C 1 85  ? 90.867  16.654  38.511  1.00 2.64  ? 85  TRP C CH2 1 
ATOM   3944 N  N   . LYS C 1 86  ? 92.344  8.709   39.210  1.00 4.45  ? 86  LYS C N   1 
ATOM   3945 C  CA  . LYS C 1 86  ? 92.985  7.393   39.252  1.00 5.42  ? 86  LYS C CA  1 
ATOM   3946 C  C   . LYS C 1 86  ? 93.320  6.869   37.859  1.00 5.97  ? 86  LYS C C   1 
ATOM   3947 O  O   . LYS C 1 86  ? 94.127  5.952   37.709  1.00 6.32  ? 86  LYS C O   1 
ATOM   3948 C  CB  . LYS C 1 86  ? 92.073  6.373   39.946  1.00 5.46  ? 86  LYS C CB  1 
ATOM   3949 C  CG  . LYS C 1 86  ? 91.888  6.602   41.432  1.00 5.67  ? 86  LYS C CG  1 
ATOM   3950 C  CD  . LYS C 1 86  ? 90.958  5.537   42.047  1.00 6.41  ? 86  LYS C CD  1 
ATOM   3951 C  CE  . LYS C 1 86  ? 91.412  5.178   43.450  1.00 8.40  ? 86  LYS C CE  1 
ATOM   3952 N  NZ  . LYS C 1 86  ? 90.257  4.637   44.259  1.00 11.23 ? 86  LYS C NZ  1 
ATOM   3953 N  N   . GLY C 1 87  ? 92.665  7.444   36.851  1.00 5.69  ? 87  GLY C N   1 
ATOM   3954 C  CA  . GLY C 1 87  ? 92.874  7.066   35.469  1.00 5.17  ? 87  GLY C CA  1 
ATOM   3955 C  C   . GLY C 1 87  ? 93.973  7.848   34.773  1.00 4.77  ? 87  GLY C C   1 
ATOM   3956 O  O   . GLY C 1 87  ? 94.120  7.725   33.572  1.00 4.79  ? 87  GLY C O   1 
ATOM   3957 N  N   . LEU C 1 88  ? 94.730  8.648   35.521  1.00 4.85  ? 88  LEU C N   1 
ATOM   3958 C  CA  . LEU C 1 88  ? 95.835  9.411   34.941  1.00 4.75  ? 88  LEU C CA  1 
ATOM   3959 C  C   . LEU C 1 88  ? 97.162  9.062   35.615  1.00 5.65  ? 88  LEU C C   1 
ATOM   3960 O  O   . LEU C 1 88  ? 97.237  9.041   36.844  1.00 7.06  ? 88  LEU C O   1 
ATOM   3961 C  CB  . LEU C 1 88  ? 95.572  10.902  35.073  1.00 4.38  ? 88  LEU C CB  1 
ATOM   3962 C  CG  . LEU C 1 88  ? 94.311  11.400  34.364  1.00 2.95  ? 88  LEU C CG  1 
ATOM   3963 C  CD1 . LEU C 1 88  ? 94.032  12.824  34.843  1.00 2.76  ? 88  LEU C CD1 1 
ATOM   3964 C  CD2 . LEU C 1 88  ? 94.447  11.308  32.823  1.00 3.76  ? 88  LEU C CD2 1 
ATOM   3965 N  N   . LYS C 1 89  ? 98.193  8.802   34.805  1.00 6.25  ? 89  LYS C N   1 
ATOM   3966 C  CA  . LYS C 1 89  ? 99.533  8.493   35.302  1.00 7.11  ? 89  LYS C CA  1 
ATOM   3967 C  C   . LYS C 1 89  ? 100.474 8.417   34.120  1.00 7.05  ? 89  LYS C C   1 
ATOM   3968 O  O   . LYS C 1 89  ? 100.119 7.857   33.081  1.00 7.34  ? 89  LYS C O   1 
ATOM   3969 C  CB  . LYS C 1 89  ? 99.557  7.168   36.058  1.00 7.34  ? 89  LYS C CB  1 
ATOM   3970 C  CG  . LYS C 1 89  ? 100.848 6.937   36.847  1.00 8.66  ? 89  LYS C CG  1 
ATOM   3971 C  CD  . LYS C 1 89  ? 100.882 5.521   37.373  1.00 10.88 ? 89  LYS C CD  1 
ATOM   3972 C  CE  . LYS C 1 89  ? 101.784 5.390   38.584  1.00 12.90 ? 89  LYS C CE  1 
ATOM   3973 N  NZ  . LYS C 1 89  ? 101.381 4.224   39.401  1.00 13.90 ? 89  LYS C NZ  1 
ATOM   3974 N  N   . LYS C 1 90  ? 101.662 9.007   34.277  1.00 7.33  ? 90  LYS C N   1 
ATOM   3975 C  CA  . LYS C 1 90  ? 102.720 8.943   33.278  1.00 7.65  ? 90  LYS C CA  1 
ATOM   3976 C  C   . LYS C 1 90  ? 103.487 7.624   33.300  1.00 7.32  ? 90  LYS C C   1 
ATOM   3977 O  O   . LYS C 1 90  ? 103.548 6.929   34.330  1.00 7.73  ? 90  LYS C O   1 
ATOM   3978 C  CB  . LYS C 1 90  ? 103.743 10.058  33.510  1.00 7.70  ? 90  LYS C CB  1 
ATOM   3979 C  CG  . LYS C 1 90  ? 103.301 11.479  33.131  1.00 8.52  ? 90  LYS C CG  1 
ATOM   3980 C  CD  . LYS C 1 90  ? 104.456 12.501  33.286  1.00 9.06  ? 90  LYS C CD  1 
ATOM   3981 C  CE  . LYS C 1 90  ? 105.552 12.353  32.230  1.00 9.99  ? 90  LYS C CE  1 
ATOM   3982 N  NZ  . LYS C 1 90  ? 106.643 13.380  32.407  1.00 10.64 ? 90  LYS C NZ  1 
ATOM   3983 N  N   . GLY C 1 91  ? 104.119 7.316   32.173  1.00 7.45  ? 91  GLY C N   1 
ATOM   3984 C  CA  . GLY C 1 91  ? 105.057 6.207   32.110  1.00 7.98  ? 91  GLY C CA  1 
ATOM   3985 C  C   . GLY C 1 91  ? 104.415 4.845   31.956  1.00 8.00  ? 91  GLY C C   1 
ATOM   3986 O  O   . GLY C 1 91  ? 105.102 3.827   32.025  1.00 9.33  ? 91  GLY C O   1 
ATOM   3987 N  N   . THR C 1 92  ? 103.104 4.805   31.720  1.00 7.93  ? 92  THR C N   1 
ATOM   3988 C  CA  . THR C 1 92  ? 102.441 3.517   31.519  1.00 7.12  ? 92  THR C CA  1 
ATOM   3989 C  C   . THR C 1 92  ? 102.444 3.112   30.053  1.00 7.00  ? 92  THR C C   1 
ATOM   3990 O  O   . THR C 1 92  ? 102.602 3.951   29.161  1.00 6.13  ? 92  THR C O   1 
ATOM   3991 C  CB  . THR C 1 92  ? 100.978 3.506   32.013  1.00 7.67  ? 92  THR C CB  1 
ATOM   3992 O  OG1 . THR C 1 92  ? 100.161 4.298   31.135  1.00 8.04  ? 92  THR C OG1 1 
ATOM   3993 C  CG2 . THR C 1 92  ? 100.876 4.022   33.440  1.00 7.40  ? 92  THR C CG2 1 
ATOM   3994 N  N   . THR C 1 93  ? 102.250 1.819   29.804  1.00 7.70  ? 93  THR C N   1 
ATOM   3995 C  CA  . THR C 1 93  ? 102.203 1.304   28.442  1.00 8.42  ? 93  THR C CA  1 
ATOM   3996 C  C   . THR C 1 93  ? 100.988 0.389   28.218  1.00 8.18  ? 93  THR C C   1 
ATOM   3997 O  O   . THR C 1 93  ? 100.762 -0.552  28.960  1.00 8.05  ? 93  THR C O   1 
ATOM   3998 C  CB  . THR C 1 93  ? 103.505 0.557   28.093  1.00 9.10  ? 93  THR C CB  1 
ATOM   3999 O  OG1 . THR C 1 93  ? 104.615 1.448   28.252  1.00 11.36 ? 93  THR C OG1 1 
ATOM   4000 C  CG2 . THR C 1 93  ? 103.464 0.054   26.663  1.00 9.98  ? 93  THR C CG2 1 
ATOM   4001 N  N   . LEU C 1 94  ? 100.195 0.695   27.193  1.00 7.88  ? 94  LEU C N   1 
ATOM   4002 C  CA  . LEU C 1 94  ? 99.055  -0.129  26.854  1.00 7.51  ? 94  LEU C CA  1 
ATOM   4003 C  C   . LEU C 1 94  ? 99.583  -1.470  26.410  1.00 7.64  ? 94  LEU C C   1 
ATOM   4004 O  O   . LEU C 1 94  ? 100.515 -1.523  25.610  1.00 8.59  ? 94  LEU C O   1 
ATOM   4005 C  CB  . LEU C 1 94  ? 98.252  0.508   25.728  1.00 7.42  ? 94  LEU C CB  1 
ATOM   4006 C  CG  . LEU C 1 94  ? 97.170  -0.347  25.087  1.00 7.52  ? 94  LEU C CG  1 
ATOM   4007 C  CD1 . LEU C 1 94  ? 96.154  -0.756  26.149  1.00 7.46  ? 94  LEU C CD1 1 
ATOM   4008 C  CD2 . LEU C 1 94  ? 96.497  0.440   23.989  1.00 7.78  ? 94  LEU C CD2 1 
ATOM   4009 N  N   . GLN C 1 95  ? 99.007  -2.542  26.942  1.00 8.64  ? 95  GLN C N   1 
ATOM   4010 C  CA  . GLN C 1 95  ? 99.584  -3.866  26.776  1.00 9.10  ? 95  GLN C CA  1 
ATOM   4011 C  C   . GLN C 1 95  ? 98.662  -4.961  27.291  1.00 9.39  ? 95  GLN C C   1 
ATOM   4012 O  O   . GLN C 1 95  ? 97.692  -4.695  27.999  1.00 10.52 ? 95  GLN C O   1 
ATOM   4013 C  CB  . GLN C 1 95  ? 100.898 -3.939  27.550  1.00 9.38  ? 95  GLN C CB  1 
ATOM   4014 C  CG  . GLN C 1 95  ? 100.729 -3.756  29.048  1.00 9.96  ? 95  GLN C CG  1 
ATOM   4015 C  CD  . GLN C 1 95  ? 102.032 -3.920  29.782  1.00 12.04 ? 95  GLN C CD  1 
ATOM   4016 O  OE1 . GLN C 1 95  ? 102.566 -5.037  29.892  1.00 15.14 ? 95  GLN C OE1 1 
ATOM   4017 N  NE2 . GLN C 1 95  ? 102.568 -2.820  30.281  1.00 12.20 ? 95  GLN C NE2 1 
ATOM   4018 N  N   . GLY C 1 96  ? 98.983  -6.204  26.950  1.00 9.74  ? 96  GLY C N   1 
ATOM   4019 C  CA  . GLY C 1 96  ? 98.272  -7.342  27.502  1.00 9.11  ? 96  GLY C CA  1 
ATOM   4020 C  C   . GLY C 1 96  ? 96.875  -7.534  26.972  1.00 9.12  ? 96  GLY C C   1 
ATOM   4021 O  O   . GLY C 1 96  ? 96.603  -7.283  25.791  1.00 9.13  ? 96  GLY C O   1 
ATOM   4022 N  N   . ASP C 1 97  ? 95.993  -8.012  27.851  1.00 8.97  ? 97  ASP C N   1 
ATOM   4023 C  CA  . ASP C 1 97  ? 94.644  -8.383  27.487  1.00 8.73  ? 97  ASP C CA  1 
ATOM   4024 C  C   . ASP C 1 97  ? 93.911  -7.167  26.935  1.00 8.48  ? 97  ASP C C   1 
ATOM   4025 O  O   . ASP C 1 97  ? 93.295  -7.232  25.870  1.00 8.69  ? 97  ASP C O   1 
ATOM   4026 C  CB  . ASP C 1 97  ? 93.881  -8.883  28.721  1.00 9.17  ? 97  ASP C CB  1 
ATOM   4027 C  CG  . ASP C 1 97  ? 94.401  -10.210 29.248  1.00 9.40  ? 97  ASP C CG  1 
ATOM   4028 O  OD1 . ASP C 1 97  ? 95.120  -10.939 28.517  1.00 11.37 ? 97  ASP C OD1 1 
ATOM   4029 O  OD2 . ASP C 1 97  ? 94.079  -10.527 30.409  1.00 11.18 ? 97  ASP C OD2 1 
ATOM   4030 N  N   . LEU C 1 98  ? 93.969  -6.061  27.674  1.00 8.42  ? 98  LEU C N   1 
ATOM   4031 C  CA  . LEU C 1 98  ? 93.288  -4.832  27.237  1.00 8.31  ? 98  LEU C CA  1 
ATOM   4032 C  C   . LEU C 1 98  ? 93.691  -4.408  25.823  1.00 8.15  ? 98  LEU C C   1 
ATOM   4033 O  O   . LEU C 1 98  ? 92.834  -4.104  24.978  1.00 9.27  ? 98  LEU C O   1 
ATOM   4034 C  CB  . LEU C 1 98  ? 93.527  -3.694  28.224  1.00 8.74  ? 98  LEU C CB  1 
ATOM   4035 C  CG  . LEU C 1 98  ? 92.956  -2.317  27.825  1.00 8.33  ? 98  LEU C CG  1 
ATOM   4036 C  CD1 . LEU C 1 98  ? 91.447  -2.399  27.619  1.00 9.31  ? 98  LEU C CD1 1 
ATOM   4037 C  CD2 . LEU C 1 98  ? 93.289  -1.250  28.890  1.00 9.06  ? 98  LEU C CD2 1 
ATOM   4038 N  N   . LYS C 1 99  ? 94.994  -4.361  25.566  1.00 8.51  ? 99  LYS C N   1 
ATOM   4039 C  CA  . LYS C 1 99  ? 95.471  -4.033  24.231  1.00 8.34  ? 99  LYS C CA  1 
ATOM   4040 C  C   . LYS C 1 99  ? 94.888  -4.987  23.187  1.00 8.38  ? 99  LYS C C   1 
ATOM   4041 O  O   . LYS C 1 99  ? 94.427  -4.550  22.137  1.00 8.73  ? 99  LYS C O   1 
ATOM   4042 C  CB  . LYS C 1 99  ? 96.995  -4.044  24.176  1.00 8.18  ? 99  LYS C CB  1 
ATOM   4043 C  CG  . LYS C 1 99  ? 97.562  -3.398  22.910  1.00 9.35  ? 99  LYS C CG  1 
ATOM   4044 C  CD  . LYS C 1 99  ? 99.002  -3.829  22.700  1.00 9.69  ? 99  LYS C CD  1 
ATOM   4045 C  CE  . LYS C 1 99  ? 99.663  -3.057  21.573  1.00 9.65  ? 99  LYS C CE  1 
ATOM   4046 N  NZ  . LYS C 1 99  ? 101.115 -2.790  21.852  1.00 10.76 ? 99  LYS C NZ  1 
ATOM   4047 N  N   . ALA C 1 100 ? 94.932  -6.291  23.477  1.00 8.59  ? 100 ALA C N   1 
ATOM   4048 C  CA  . ALA C 1 100 ? 94.381  -7.312  22.595  1.00 8.92  ? 100 ALA C CA  1 
ATOM   4049 C  C   . ALA C 1 100 ? 92.900  -7.061  22.342  1.00 8.94  ? 100 ALA C C   1 
ATOM   4050 O  O   . ALA C 1 100 ? 92.411  -7.199  21.213  1.00 10.20 ? 100 ALA C O   1 
ATOM   4051 C  CB  . ALA C 1 100 ? 94.586  -8.727  23.192  1.00 8.50  ? 100 ALA C CB  1 
ATOM   4052 N  N   . ALA C 1 101 ? 92.196  -6.663  23.394  1.00 8.86  ? 101 ALA C N   1 
ATOM   4053 C  CA  . ALA C 1 101 ? 90.760  -6.460  23.301  1.00 8.89  ? 101 ALA C CA  1 
ATOM   4054 C  C   . ALA C 1 101 ? 90.511  -5.238  22.451  1.00 8.36  ? 101 ALA C C   1 
ATOM   4055 O  O   . ALA C 1 101 ? 89.598  -5.216  21.628  1.00 8.27  ? 101 ALA C O   1 
ATOM   4056 C  CB  . ALA C 1 101 ? 90.157  -6.286  24.666  1.00 8.88  ? 101 ALA C CB  1 
ATOM   4057 N  N   . ILE C 1 102 ? 91.335  -4.215  22.645  1.00 8.72  ? 102 ILE C N   1 
ATOM   4058 C  CA  . ILE C 1 102 ? 91.161  -3.005  21.884  1.00 8.71  ? 102 ILE C CA  1 
ATOM   4059 C  C   . ILE C 1 102 ? 91.370  -3.295  20.396  1.00 8.62  ? 102 ILE C C   1 
ATOM   4060 O  O   . ILE C 1 102 ? 90.641  -2.779  19.548  1.00 8.58  ? 102 ILE C O   1 
ATOM   4061 C  CB  . ILE C 1 102 ? 92.103  -1.894  22.378  1.00 8.65  ? 102 ILE C CB  1 
ATOM   4062 C  CG1 . ILE C 1 102 ? 91.643  -1.392  23.757  1.00 7.51  ? 102 ILE C CG1 1 
ATOM   4063 C  CG2 . ILE C 1 102 ? 92.160  -0.753  21.360  1.00 9.68  ? 102 ILE C CG2 1 
ATOM   4064 C  CD1 . ILE C 1 102 ? 92.590  -0.377  24.395  1.00 6.83  ? 102 ILE C CD1 1 
ATOM   4065 N  N   . GLU C 1 103 ? 92.371  -4.113  20.087  1.00 8.73  ? 103 GLU C N   1 
ATOM   4066 C  CA  . GLU C 1 103 ? 92.669  -4.451  18.707  1.00 9.59  ? 103 GLU C CA  1 
ATOM   4067 C  C   . GLU C 1 103 ? 91.544  -5.284  18.078  1.00 9.22  ? 103 GLU C C   1 
ATOM   4068 O  O   . GLU C 1 103 ? 91.259  -5.152  16.899  1.00 9.47  ? 103 GLU C O   1 
ATOM   4069 C  CB  . GLU C 1 103 ? 94.039  -5.149  18.592  1.00 10.03 ? 103 GLU C CB  1 
ATOM   4070 C  CG  . GLU C 1 103 ? 95.203  -4.272  19.033  1.00 11.29 ? 103 GLU C CG  1 
ATOM   4071 C  CD  . GLU C 1 103 ? 96.551  -4.989  19.014  1.00 12.72 ? 103 GLU C CD  1 
ATOM   4072 O  OE1 . GLU C 1 103 ? 96.602  -6.184  19.377  1.00 13.76 ? 103 GLU C OE1 1 
ATOM   4073 O  OE2 . GLU C 1 103 ? 97.565  -4.344  18.640  1.00 12.28 ? 103 GLU C OE2 1 
ATOM   4074 N  N   . ARG C 1 104 ? 90.907  -6.126  18.888  1.00 9.50  ? 104 ARG C N   1 
ATOM   4075 C  CA  . ARG C 1 104 ? 89.801  -6.975  18.448  1.00 9.46  ? 104 ARG C CA  1 
ATOM   4076 C  C   . ARG C 1 104 ? 88.587  -6.139  18.083  1.00 9.48  ? 104 ARG C C   1 
ATOM   4077 O  O   . ARG C 1 104 ? 87.944  -6.369  17.059  1.00 9.43  ? 104 ARG C O   1 
ATOM   4078 C  CB  . ARG C 1 104 ? 89.415  -7.985  19.552  1.00 9.84  ? 104 ARG C CB  1 
ATOM   4079 C  CG  . ARG C 1 104 ? 88.115  -8.774  19.296  1.00 10.64 ? 104 ARG C CG  1 
ATOM   4080 C  CD  . ARG C 1 104 ? 87.687  -9.709  20.465  1.00 13.03 ? 104 ARG C CD  1 
ATOM   4081 N  NE  . ARG C 1 104 ? 87.763  -9.067  21.775  1.00 14.29 ? 104 ARG C NE  1 
ATOM   4082 C  CZ  . ARG C 1 104 ? 87.483  -9.664  22.933  1.00 14.63 ? 104 ARG C CZ  1 
ATOM   4083 N  NH1 . ARG C 1 104 ? 87.104  -10.929 22.963  1.00 15.85 ? 104 ARG C NH1 1 
ATOM   4084 N  NH2 . ARG C 1 104 ? 87.598  -8.997  24.072  1.00 14.69 ? 104 ARG C NH2 1 
ATOM   4085 N  N   . ASP C 1 105 ? 88.276  -5.156  18.919  1.00 9.32  ? 105 ASP C N   1 
ATOM   4086 C  CA  . ASP C 1 105 ? 87.010  -4.437  18.773  1.00 9.20  ? 105 ASP C CA  1 
ATOM   4087 C  C   . ASP C 1 105 ? 87.049  -3.203  17.873  1.00 9.14  ? 105 ASP C C   1 
ATOM   4088 O  O   . ASP C 1 105 ? 86.003  -2.754  17.396  1.00 8.74  ? 105 ASP C O   1 
ATOM   4089 C  CB  . ASP C 1 105 ? 86.457  -4.066  20.145  1.00 9.71  ? 105 ASP C CB  1 
ATOM   4090 C  CG  . ASP C 1 105 ? 86.096  -5.293  20.975  1.00 11.46 ? 105 ASP C CG  1 
ATOM   4091 O  OD1 . ASP C 1 105 ? 86.124  -6.428  20.432  1.00 14.57 ? 105 ASP C OD1 1 
ATOM   4092 O  OD2 . ASP C 1 105 ? 85.771  -5.131  22.158  1.00 13.14 ? 105 ASP C OD2 1 
ATOM   4093 N  N   . PHE C 1 106 ? 88.246  -2.658  17.662  1.00 9.08  ? 106 PHE C N   1 
ATOM   4094 C  CA  . PHE C 1 106 ? 88.436  -1.485  16.802  1.00 8.89  ? 106 PHE C CA  1 
ATOM   4095 C  C   . PHE C 1 106 ? 89.422  -1.797  15.675  1.00 9.33  ? 106 PHE C C   1 
ATOM   4096 O  O   . PHE C 1 106 ? 89.729  -0.928  14.847  1.00 9.83  ? 106 PHE C O   1 
ATOM   4097 C  CB  . PHE C 1 106 ? 88.972  -0.294  17.607  1.00 9.36  ? 106 PHE C CB  1 
ATOM   4098 C  CG  . PHE C 1 106 ? 88.129  0.090   18.805  1.00 8.67  ? 106 PHE C CG  1 
ATOM   4099 C  CD1 . PHE C 1 106 ? 87.128  1.035   18.684  1.00 9.36  ? 106 PHE C CD1 1 
ATOM   4100 C  CD2 . PHE C 1 106 ? 88.369  -0.463  20.055  1.00 9.60  ? 106 PHE C CD2 1 
ATOM   4101 C  CE1 . PHE C 1 106 ? 86.362  1.404   19.778  1.00 8.99  ? 106 PHE C CE1 1 
ATOM   4102 C  CE2 . PHE C 1 106 ? 87.602  -0.084  21.170  1.00 7.96  ? 106 PHE C CE2 1 
ATOM   4103 C  CZ  . PHE C 1 106 ? 86.598  0.851   21.021  1.00 8.33  ? 106 PHE C CZ  1 
ATOM   4104 N  N   . GLY C 1 107 ? 89.940  -3.026  15.666  1.00 9.32  ? 107 GLY C N   1 
ATOM   4105 C  CA  . GLY C 1 107 ? 90.831  -3.490  14.600  1.00 9.76  ? 107 GLY C CA  1 
ATOM   4106 C  C   . GLY C 1 107 ? 92.297  -3.151  14.820  1.00 9.76  ? 107 GLY C C   1 
ATOM   4107 O  O   . GLY C 1 107 ? 93.182  -3.790  14.244  1.00 10.88 ? 107 GLY C O   1 
ATOM   4108 N  N   . SER C 1 108 ? 92.558  -2.147  15.658  1.00 9.82  ? 108 SER C N   1 
ATOM   4109 C  CA  . SER C 1 108 ? 93.924  -1.673  15.915  1.00 9.09  ? 108 SER C CA  1 
ATOM   4110 C  C   . SER C 1 108 ? 93.907  -0.528  16.929  1.00 9.29  ? 108 SER C C   1 
ATOM   4111 O  O   . SER C 1 108 ? 92.887  0.154   17.095  1.00 9.24  ? 108 SER C O   1 
ATOM   4112 C  CB  . SER C 1 108 ? 94.596  -1.216  14.610  1.00 9.36  ? 108 SER C CB  1 
ATOM   4113 O  OG  . SER C 1 108 ? 94.215  0.099   14.222  1.00 10.48 ? 108 SER C OG  1 
ATOM   4114 N  N   . VAL C 1 109 ? 95.029  -0.309  17.605  1.00 8.90  ? 109 VAL C N   1 
ATOM   4115 C  CA  . VAL C 1 109 ? 95.099  0.765   18.590  1.00 8.45  ? 109 VAL C CA  1 
ATOM   4116 C  C   . VAL C 1 109 ? 94.853  2.122   17.945  1.00 8.16  ? 109 VAL C C   1 
ATOM   4117 O  O   . VAL C 1 109 ? 94.180  2.969   18.528  1.00 8.09  ? 109 VAL C O   1 
ATOM   4118 C  CB  . VAL C 1 109 ? 96.465  0.849   19.291  1.00 8.53  ? 109 VAL C CB  1 
ATOM   4119 C  CG1 . VAL C 1 109 ? 96.545  2.151   20.093  1.00 8.15  ? 109 VAL C CG1 1 
ATOM   4120 C  CG2 . VAL C 1 109 ? 96.726  -0.391  20.179  1.00 8.91  ? 109 VAL C CG2 1 
ATOM   4121 N  N   . ASP C 1 110 ? 95.412  2.329   16.757  1.00 8.60  ? 110 ASP C N   1 
ATOM   4122 C  CA  . ASP C 1 110 ? 95.258  3.599   16.059  1.00 8.47  ? 110 ASP C CA  1 
ATOM   4123 C  C   . ASP C 1 110 ? 93.807  3.837   15.658  1.00 8.52  ? 110 ASP C C   1 
ATOM   4124 O  O   . ASP C 1 110 ? 93.302  4.964   15.751  1.00 8.77  ? 110 ASP C O   1 
ATOM   4125 C  CB  . ASP C 1 110 ? 96.207  3.714   14.857  1.00 9.33  ? 110 ASP C CB  1 
ATOM   4126 C  CG  . ASP C 1 110 ? 97.661  3.898   15.275  1.00 10.83 ? 110 ASP C CG  1 
ATOM   4127 O  OD1 . ASP C 1 110 ? 97.951  3.863   16.490  1.00 13.46 ? 110 ASP C OD1 1 
ATOM   4128 O  OD2 . ASP C 1 110 ? 98.535  4.044   14.380  1.00 14.65 ? 110 ASP C OD2 1 
ATOM   4129 N  N   . ASN C 1 111 ? 93.127  2.777   15.236  1.00 8.25  ? 111 ASN C N   1 
ATOM   4130 C  CA  . ASN C 1 111 ? 91.705  2.864   14.950  1.00 8.59  ? 111 ASN C CA  1 
ATOM   4131 C  C   . ASN C 1 111 ? 90.982  3.314   16.203  1.00 8.13  ? 111 ASN C C   1 
ATOM   4132 O  O   . ASN C 1 111 ? 90.143  4.212   16.147  1.00 9.18  ? 111 ASN C O   1 
ATOM   4133 C  CB  . ASN C 1 111 ? 91.125  1.509   14.504  1.00 9.31  ? 111 ASN C CB  1 
ATOM   4134 C  CG  . ASN C 1 111 ? 91.592  1.086   13.103  1.00 10.53 ? 111 ASN C CG  1 
ATOM   4135 O  OD1 . ASN C 1 111 ? 91.376  -0.056  12.668  1.00 11.07 ? 111 ASN C OD1 1 
ATOM   4136 N  ND2 . ASN C 1 111 ? 92.211  2.009   12.393  1.00 10.50 ? 111 ASN C ND2 1 
ATOM   4137 N  N   . PHE C 1 112 ? 91.279  2.669   17.332  1.00 7.96  ? 112 PHE C N   1 
ATOM   4138 C  CA  . PHE C 1 112 ? 90.664  3.076   18.596  1.00 7.23  ? 112 PHE C CA  1 
ATOM   4139 C  C   . PHE C 1 112 ? 90.930  4.554   18.913  1.00 6.94  ? 112 PHE C C   1 
ATOM   4140 O  O   . PHE C 1 112 ? 90.011  5.282   19.244  1.00 6.19  ? 112 PHE C O   1 
ATOM   4141 C  CB  . PHE C 1 112 ? 91.117  2.202   19.767  1.00 7.14  ? 112 PHE C CB  1 
ATOM   4142 C  CG  . PHE C 1 112 ? 91.047  2.912   21.099  1.00 7.59  ? 112 PHE C CG  1 
ATOM   4143 C  CD1 . PHE C 1 112 ? 89.836  3.095   21.739  1.00 7.89  ? 112 PHE C CD1 1 
ATOM   4144 C  CD2 . PHE C 1 112 ? 92.186  3.433   21.686  1.00 8.17  ? 112 PHE C CD2 1 
ATOM   4145 C  CE1 . PHE C 1 112 ? 89.768  3.777   22.947  1.00 6.76  ? 112 PHE C CE1 1 
ATOM   4146 C  CE2 . PHE C 1 112 ? 92.125  4.091   22.902  1.00 8.44  ? 112 PHE C CE2 1 
ATOM   4147 C  CZ  . PHE C 1 112 ? 90.918  4.270   23.523  1.00 8.48  ? 112 PHE C CZ  1 
ATOM   4148 N  N   . LYS C 1 113 ? 92.195  4.977   18.815  1.00 6.96  ? 113 LYS C N   1 
ATOM   4149 C  CA  . LYS C 1 113 ? 92.598  6.345   19.146  1.00 6.99  ? 113 LYS C CA  1 
ATOM   4150 C  C   . LYS C 1 113 ? 91.885  7.384   18.280  1.00 6.85  ? 113 LYS C C   1 
ATOM   4151 O  O   . LYS C 1 113 ? 91.445  8.424   18.768  1.00 6.75  ? 113 LYS C O   1 
ATOM   4152 C  CB  . LYS C 1 113 ? 94.132  6.486   19.026  1.00 7.15  ? 113 LYS C CB  1 
ATOM   4153 C  CG  . LYS C 1 113 ? 94.913  5.731   20.116  1.00 7.93  ? 113 LYS C CG  1 
ATOM   4154 C  CD  . LYS C 1 113 ? 96.437  5.824   19.964  1.00 7.43  ? 113 LYS C CD  1 
ATOM   4155 C  CE  . LYS C 1 113 ? 96.993  7.185   20.325  1.00 7.09  ? 113 LYS C CE  1 
ATOM   4156 N  NZ  . LYS C 1 113 ? 98.434  7.296   19.908  1.00 7.50  ? 113 LYS C NZ  1 
ATOM   4157 N  N   . ALA C 1 114 ? 91.758  7.108   16.987  1.00 5.93  ? 114 ALA C N   1 
ATOM   4158 C  CA  . ALA C 1 114 ? 91.052  8.033   16.107  1.00 6.16  ? 114 ALA C CA  1 
ATOM   4159 C  C   . ALA C 1 114 ? 89.560  8.152   16.481  1.00 6.12  ? 114 ALA C C   1 
ATOM   4160 O  O   . ALA C 1 114 ? 88.998  9.246   16.497  1.00 5.72  ? 114 ALA C O   1 
ATOM   4161 C  CB  . ALA C 1 114 ? 91.224  7.619   14.638  1.00 6.95  ? 114 ALA C CB  1 
ATOM   4162 N  N   . GLU C 1 115 ? 88.930  7.024   16.797  1.00 6.29  ? 115 GLU C N   1 
ATOM   4163 C  CA  . GLU C 1 115 ? 87.526  7.030   17.164  1.00 6.03  ? 115 GLU C CA  1 
ATOM   4164 C  C   . GLU C 1 115 ? 87.325  7.778   18.487  1.00 5.27  ? 115 GLU C C   1 
ATOM   4165 O  O   . GLU C 1 115 ? 86.341  8.489   18.658  1.00 4.88  ? 115 GLU C O   1 
ATOM   4166 C  CB  . GLU C 1 115 ? 86.956  5.604   17.228  1.00 5.95  ? 115 GLU C CB  1 
ATOM   4167 C  CG  . GLU C 1 115 ? 85.458  5.550   17.544  1.00 7.68  ? 115 GLU C CG  1 
ATOM   4168 C  CD  . GLU C 1 115 ? 84.901  4.127   17.540  1.00 9.80  ? 115 GLU C CD  1 
ATOM   4169 O  OE1 . GLU C 1 115 ? 85.564  3.230   16.986  1.00 11.90 ? 115 GLU C OE1 1 
ATOM   4170 O  OE2 . GLU C 1 115 ? 83.800  3.886   18.089  1.00 10.56 ? 115 GLU C OE2 1 
ATOM   4171 N  N   . PHE C 1 116 ? 88.267  7.632   19.406  1.00 4.67  ? 116 PHE C N   1 
ATOM   4172 C  CA  . PHE C 1 116 ? 88.179  8.304   20.699  1.00 4.42  ? 116 PHE C CA  1 
ATOM   4173 C  C   . PHE C 1 116 ? 88.380  9.815   20.549  1.00 4.29  ? 116 PHE C C   1 
ATOM   4174 O  O   . PHE C 1 116 ? 87.670  10.623  21.163  1.00 3.80  ? 116 PHE C O   1 
ATOM   4175 C  CB  . PHE C 1 116 ? 89.201  7.715   21.682  1.00 4.58  ? 116 PHE C CB  1 
ATOM   4176 C  CG  . PHE C 1 116 ? 89.023  8.193   23.098  1.00 4.64  ? 116 PHE C CG  1 
ATOM   4177 C  CD1 . PHE C 1 116 ? 88.212  7.490   23.981  1.00 5.04  ? 116 PHE C CD1 1 
ATOM   4178 C  CD2 . PHE C 1 116 ? 89.646  9.348   23.539  1.00 3.39  ? 116 PHE C CD2 1 
ATOM   4179 C  CE1 . PHE C 1 116 ? 88.028  7.936   25.284  1.00 4.14  ? 116 PHE C CE1 1 
ATOM   4180 C  CE2 . PHE C 1 116 ? 89.465  9.811   24.822  1.00 3.96  ? 116 PHE C CE2 1 
ATOM   4181 C  CZ  . PHE C 1 116 ? 88.668  9.097   25.705  1.00 4.09  ? 116 PHE C CZ  1 
ATOM   4182 N  N   . GLU C 1 117 ? 89.355  10.189  19.729  1.00 4.59  ? 117 GLU C N   1 
ATOM   4183 C  CA  . GLU C 1 117 ? 89.612  11.598  19.450  1.00 4.83  ? 117 GLU C CA  1 
ATOM   4184 C  C   . GLU C 1 117 ? 88.394  12.252  18.819  1.00 4.62  ? 117 GLU C C   1 
ATOM   4185 O  O   . GLU C 1 117 ? 88.033  13.386  19.143  1.00 5.47  ? 117 GLU C O   1 
ATOM   4186 C  CB  . GLU C 1 117 ? 90.821  11.726  18.517  1.00 4.29  ? 117 GLU C CB  1 
ATOM   4187 C  CG  . GLU C 1 117 ? 92.105  11.229  19.167  1.00 6.08  ? 117 GLU C CG  1 
ATOM   4188 C  CD  . GLU C 1 117 ? 93.249  10.963  18.199  1.00 6.69  ? 117 GLU C CD  1 
ATOM   4189 O  OE1 . GLU C 1 117 ? 93.045  11.009  16.957  1.00 6.24  ? 117 GLU C OE1 1 
ATOM   4190 O  OE2 . GLU C 1 117 ? 94.367  10.720  18.705  1.00 6.04  ? 117 GLU C OE2 1 
ATOM   4191 N  N   . LYS C 1 118 ? 87.761  11.550  17.888  1.00 4.97  ? 118 LYS C N   1 
ATOM   4192 C  CA  . LYS C 1 118 ? 86.595  12.111  17.231  1.00 5.00  ? 118 LYS C CA  1 
ATOM   4193 C  C   . LYS C 1 118 ? 85.464  12.309  18.213  1.00 5.09  ? 118 LYS C C   1 
ATOM   4194 O  O   . LYS C 1 118 ? 84.784  13.311  18.162  1.00 5.35  ? 118 LYS C O   1 
ATOM   4195 C  CB  . LYS C 1 118 ? 86.114  11.226  16.089  1.00 5.35  ? 118 LYS C CB  1 
ATOM   4196 C  CG  . LYS C 1 118 ? 87.135  11.042  15.032  1.00 7.11  ? 118 LYS C CG  1 
ATOM   4197 C  CD  . LYS C 1 118 ? 86.658  10.071  13.959  1.00 8.02  ? 118 LYS C CD  1 
ATOM   4198 C  CE  . LYS C 1 118 ? 87.095  10.588  12.584  1.00 10.51 ? 118 LYS C CE  1 
ATOM   4199 N  NZ  . LYS C 1 118 ? 86.545  9.796   11.448  1.00 15.04 ? 118 LYS C NZ  1 
ATOM   4200 N  N   . ALA C 1 119 ? 85.251  11.356  19.109  1.00 5.11  ? 119 ALA C N   1 
ATOM   4201 C  CA  . ALA C 1 119 ? 84.145  11.502  20.048  1.00 4.54  ? 119 ALA C CA  1 
ATOM   4202 C  C   . ALA C 1 119 ? 84.436  12.614  21.044  1.00 4.35  ? 119 ALA C C   1 
ATOM   4203 O  O   . ALA C 1 119 ? 83.553  13.366  21.424  1.00 4.09  ? 119 ALA C O   1 
ATOM   4204 C  CB  . ALA C 1 119 ? 83.868  10.198  20.778  1.00 5.08  ? 119 ALA C CB  1 
ATOM   4205 N  N   . ALA C 1 120 ? 85.676  12.687  21.498  1.00 3.42  ? 120 ALA C N   1 
ATOM   4206 C  CA  . ALA C 1 120 ? 86.051  13.731  22.452  1.00 3.84  ? 120 ALA C CA  1 
ATOM   4207 C  C   . ALA C 1 120 ? 85.889  15.125  21.826  1.00 3.47  ? 120 ALA C C   1 
ATOM   4208 O  O   . ALA C 1 120 ? 85.424  16.075  22.464  1.00 3.49  ? 120 ALA C O   1 
ATOM   4209 C  CB  . ALA C 1 120 ? 87.462  13.513  22.923  1.00 2.93  ? 120 ALA C CB  1 
ATOM   4210 N  N   . ALA C 1 121 ? 86.288  15.248  20.566  1.00 3.84  ? 121 ALA C N   1 
ATOM   4211 C  CA  . ALA C 1 121 ? 86.193  16.519  19.879  1.00 3.85  ? 121 ALA C CA  1 
ATOM   4212 C  C   . ALA C 1 121 ? 84.750  16.914  19.542  1.00 4.34  ? 121 ALA C C   1 
ATOM   4213 O  O   . ALA C 1 121 ? 84.413  18.097  19.609  1.00 5.06  ? 121 ALA C O   1 
ATOM   4214 C  CB  . ALA C 1 121 ? 87.024  16.489  18.622  1.00 3.35  ? 121 ALA C CB  1 
ATOM   4215 N  N   . SER C 1 122 ? 83.914  15.927  19.218  1.00 5.06  ? 122 SER C N   1 
ATOM   4216 C  CA  . SER C 1 122 ? 82.538  16.144  18.726  1.00 5.82  ? 122 SER C CA  1 
ATOM   4217 C  C   . SER C 1 122 ? 81.525  16.391  19.838  1.00 5.41  ? 122 SER C C   1 
ATOM   4218 O  O   . SER C 1 122 ? 80.368  16.720  19.576  1.00 6.22  ? 122 SER C O   1 
ATOM   4219 C  CB  . SER C 1 122 ? 82.066  14.948  17.876  1.00 5.87  ? 122 SER C CB  1 
ATOM   4220 O  OG  . SER C 1 122 ? 82.750  14.897  16.628  1.00 9.88  ? 122 SER C OG  1 
ATOM   4221 N  N   . ARG C 1 123 ? 81.952  16.208  21.082  1.00 4.49  ? 123 ARG C N   1 
ATOM   4222 C  CA  . ARG C 1 123 ? 81.075  16.452  22.216  1.00 4.22  ? 123 ARG C CA  1 
ATOM   4223 C  C   . ARG C 1 123 ? 80.850  17.961  22.327  1.00 4.02  ? 123 ARG C C   1 
ATOM   4224 O  O   . ARG C 1 123 ? 81.743  18.728  22.709  1.00 4.30  ? 123 ARG C O   1 
ATOM   4225 C  CB  . ARG C 1 123 ? 81.627  15.821  23.497  1.00 3.91  ? 123 ARG C CB  1 
ATOM   4226 C  CG  . ARG C 1 123 ? 81.009  16.355  24.791  1.00 2.38  ? 123 ARG C CG  1 
ATOM   4227 C  CD  . ARG C 1 123 ? 79.488  16.318  24.773  1.00 2.14  ? 123 ARG C CD  1 
ATOM   4228 N  NE  . ARG C 1 123 ? 78.943  14.993  24.473  1.00 3.30  ? 123 ARG C NE  1 
ATOM   4229 C  CZ  . ARG C 1 123 ? 77.647  14.707  24.490  1.00 3.03  ? 123 ARG C CZ  1 
ATOM   4230 N  NH1 . ARG C 1 123 ? 76.751  15.633  24.831  1.00 3.91  ? 123 ARG C NH1 1 
ATOM   4231 N  NH2 . ARG C 1 123 ? 77.243  13.483  24.189  1.00 3.64  ? 123 ARG C NH2 1 
ATOM   4232 N  N   . PHE C 1 124 ? 79.657  18.383  21.929  1.00 3.33  ? 124 PHE C N   1 
ATOM   4233 C  CA  . PHE C 1 124 ? 79.344  19.779  21.855  1.00 2.54  ? 124 PHE C CA  1 
ATOM   4234 C  C   . PHE C 1 124 ? 78.855  20.331  23.194  1.00 2.67  ? 124 PHE C C   1 
ATOM   4235 O  O   . PHE C 1 124 ? 77.857  19.879  23.738  1.00 2.59  ? 124 PHE C O   1 
ATOM   4236 C  CB  . PHE C 1 124 ? 78.332  20.026  20.735  1.00 2.78  ? 124 PHE C CB  1 
ATOM   4237 C  CG  . PHE C 1 124 ? 78.176  21.457  20.398  1.00 2.96  ? 124 PHE C CG  1 
ATOM   4238 C  CD1 . PHE C 1 124 ? 79.078  22.078  19.529  1.00 5.61  ? 124 PHE C CD1 1 
ATOM   4239 C  CD2 . PHE C 1 124 ? 77.164  22.201  20.978  1.00 2.51  ? 124 PHE C CD2 1 
ATOM   4240 C  CE1 . PHE C 1 124 ? 78.935  23.413  19.221  1.00 3.03  ? 124 PHE C CE1 1 
ATOM   4241 C  CE2 . PHE C 1 124 ? 77.006  23.536  20.679  1.00 1.93  ? 124 PHE C CE2 1 
ATOM   4242 C  CZ  . PHE C 1 124 ? 77.913  24.153  19.803  1.00 3.20  ? 124 PHE C CZ  1 
ATOM   4243 N  N   . GLY C 1 125 ? 79.563  21.323  23.718  1.00 1.57  ? 125 GLY C N   1 
ATOM   4244 C  CA  . GLY C 1 125 ? 79.260  21.842  25.058  1.00 1.96  ? 125 GLY C CA  1 
ATOM   4245 C  C   . GLY C 1 125 ? 80.112  21.085  26.043  1.00 1.54  ? 125 GLY C C   1 
ATOM   4246 O  O   . GLY C 1 125 ? 81.198  20.633  25.697  1.00 2.24  ? 125 GLY C O   1 
ATOM   4247 N  N   . SER C 1 126 ? 79.615  20.918  27.267  1.00 1.26  ? 126 SER C N   1 
ATOM   4248 C  CA  . SER C 1 126 ? 80.373  20.239  28.313  1.00 2.25  ? 126 SER C CA  1 
ATOM   4249 C  C   . SER C 1 126 ? 80.135  18.732  28.294  1.00 1.63  ? 126 SER C C   1 
ATOM   4250 O  O   . SER C 1 126 ? 79.031  18.295  27.976  1.00 1.56  ? 126 SER C O   1 
ATOM   4251 C  CB  . SER C 1 126 ? 79.926  20.783  29.668  1.00 2.04  ? 126 SER C CB  1 
ATOM   4252 O  OG  . SER C 1 126 ? 80.103  22.194  29.747  1.00 2.50  ? 126 SER C OG  1 
ATOM   4253 N  N   . GLY C 1 127 ? 81.139  17.937  28.661  1.00 2.42  ? 127 GLY C N   1 
ATOM   4254 C  CA  . GLY C 1 127 ? 80.930  16.496  28.798  1.00 1.92  ? 127 GLY C CA  1 
ATOM   4255 C  C   . GLY C 1 127 ? 82.185  15.671  28.915  1.00 2.94  ? 127 GLY C C   1 
ATOM   4256 O  O   . GLY C 1 127 ? 83.246  16.183  29.272  1.00 2.07  ? 127 GLY C O   1 
ATOM   4257 N  N   . TRP C 1 128 ? 82.039  14.379  28.626  1.00 2.66  ? 128 TRP C N   1 
ATOM   4258 C  CA  . TRP C 1 128 ? 83.084  13.401  28.822  1.00 2.58  ? 128 TRP C CA  1 
ATOM   4259 C  C   . TRP C 1 128 ? 83.113  12.495  27.605  1.00 2.94  ? 128 TRP C C   1 
ATOM   4260 O  O   . TRP C 1 128 ? 82.082  12.279  26.983  1.00 2.62  ? 128 TRP C O   1 
ATOM   4261 C  CB  . TRP C 1 128 ? 82.780  12.533  30.064  1.00 2.07  ? 128 TRP C CB  1 
ATOM   4262 C  CG  . TRP C 1 128 ? 82.988  13.234  31.361  1.00 3.01  ? 128 TRP C CG  1 
ATOM   4263 C  CD1 . TRP C 1 128 ? 82.157  14.144  31.946  1.00 3.46  ? 128 TRP C CD1 1 
ATOM   4264 C  CD2 . TRP C 1 128 ? 84.110  13.095  32.238  1.00 2.81  ? 128 TRP C CD2 1 
ATOM   4265 N  NE1 . TRP C 1 128 ? 82.690  14.575  33.132  1.00 1.95  ? 128 TRP C NE1 1 
ATOM   4266 C  CE2 . TRP C 1 128 ? 83.896  13.960  33.327  1.00 2.12  ? 128 TRP C CE2 1 
ATOM   4267 C  CE3 . TRP C 1 128 ? 85.283  12.343  32.202  1.00 2.29  ? 128 TRP C CE3 1 
ATOM   4268 C  CZ2 . TRP C 1 128 ? 84.789  14.060  34.383  1.00 2.21  ? 128 TRP C CZ2 1 
ATOM   4269 C  CZ3 . TRP C 1 128 ? 86.178  12.460  33.240  1.00 3.20  ? 128 TRP C CZ3 1 
ATOM   4270 C  CH2 . TRP C 1 128 ? 85.939  13.318  34.308  1.00 2.04  ? 128 TRP C CH2 1 
ATOM   4271 N  N   . ALA C 1 129 ? 84.291  11.989  27.260  1.00 3.16  ? 129 ALA C N   1 
ATOM   4272 C  CA  . ALA C 1 129 ? 84.411  10.899  26.308  1.00 3.28  ? 129 ALA C CA  1 
ATOM   4273 C  C   . ALA C 1 129 ? 84.919  9.685   27.078  1.00 3.29  ? 129 ALA C C   1 
ATOM   4274 O  O   . ALA C 1 129 ? 85.712  9.843   28.022  1.00 3.18  ? 129 ALA C O   1 
ATOM   4275 C  CB  . ALA C 1 129 ? 85.375  11.256  25.154  1.00 3.70  ? 129 ALA C CB  1 
ATOM   4276 N  N   . TRP C 1 130 ? 84.453  8.500   26.690  1.00 3.58  ? 130 TRP C N   1 
ATOM   4277 C  CA  . TRP C 1 130 ? 84.711  7.273   27.434  1.00 3.49  ? 130 TRP C CA  1 
ATOM   4278 C  C   . TRP C 1 130 ? 85.110  6.115   26.540  1.00 3.73  ? 130 TRP C C   1 
ATOM   4279 O  O   . TRP C 1 130 ? 84.614  5.987   25.417  1.00 3.06  ? 130 TRP C O   1 
ATOM   4280 C  CB  . TRP C 1 130 ? 83.444  6.807   28.177  1.00 3.27  ? 130 TRP C CB  1 
ATOM   4281 C  CG  . TRP C 1 130 ? 82.761  7.820   29.019  1.00 2.96  ? 130 TRP C CG  1 
ATOM   4282 C  CD1 . TRP C 1 130 ? 81.736  8.616   28.643  1.00 2.43  ? 130 TRP C CD1 1 
ATOM   4283 C  CD2 . TRP C 1 130 ? 83.036  8.139   30.401  1.00 2.55  ? 130 TRP C CD2 1 
ATOM   4284 N  NE1 . TRP C 1 130 ? 81.349  9.418   29.689  1.00 2.56  ? 130 TRP C NE1 1 
ATOM   4285 C  CE2 . TRP C 1 130 ? 82.121  9.137   30.785  1.00 2.17  ? 130 TRP C CE2 1 
ATOM   4286 C  CE3 . TRP C 1 130 ? 83.952  7.659   31.347  1.00 3.84  ? 130 TRP C CE3 1 
ATOM   4287 C  CZ2 . TRP C 1 130 ? 82.120  9.700   32.074  1.00 3.18  ? 130 TRP C CZ2 1 
ATOM   4288 C  CZ3 . TRP C 1 130 ? 83.948  8.184   32.604  1.00 2.45  ? 130 TRP C CZ3 1 
ATOM   4289 C  CH2 . TRP C 1 130 ? 83.029  9.198   32.973  1.00 1.12  ? 130 TRP C CH2 1 
ATOM   4290 N  N   . LEU C 1 131 ? 85.976  5.258   27.064  1.00 4.54  ? 131 LEU C N   1 
ATOM   4291 C  CA  . LEU C 1 131 ? 86.063  3.881   26.586  1.00 4.83  ? 131 LEU C CA  1 
ATOM   4292 C  C   . LEU C 1 131 ? 85.294  3.023   27.587  1.00 5.03  ? 131 LEU C C   1 
ATOM   4293 O  O   . LEU C 1 131 ? 85.602  3.009   28.777  1.00 4.95  ? 131 LEU C O   1 
ATOM   4294 C  CB  . LEU C 1 131 ? 87.515  3.429   26.479  1.00 4.33  ? 131 LEU C CB  1 
ATOM   4295 C  CG  . LEU C 1 131 ? 87.857  1.950   26.268  1.00 5.31  ? 131 LEU C CG  1 
ATOM   4296 C  CD1 . LEU C 1 131 ? 87.479  1.489   24.845  1.00 4.55  ? 131 LEU C CD1 1 
ATOM   4297 C  CD2 . LEU C 1 131 ? 89.346  1.773   26.508  1.00 5.84  ? 131 LEU C CD2 1 
ATOM   4298 N  N   . VAL C 1 132 ? 84.246  2.366   27.098  1.00 5.96  ? 132 VAL C N   1 
ATOM   4299 C  CA  . VAL C 1 132 ? 83.387  1.567   27.956  1.00 6.46  ? 132 VAL C CA  1 
ATOM   4300 C  C   . VAL C 1 132 ? 83.427  0.093   27.557  1.00 6.76  ? 132 VAL C C   1 
ATOM   4301 O  O   . VAL C 1 132 ? 83.801  -0.261  26.432  1.00 6.98  ? 132 VAL C O   1 
ATOM   4302 C  CB  . VAL C 1 132 ? 81.914  2.056   27.924  1.00 6.76  ? 132 VAL C CB  1 
ATOM   4303 C  CG1 . VAL C 1 132 ? 81.787  3.554   28.348  1.00 7.10  ? 132 VAL C CG1 1 
ATOM   4304 C  CG2 . VAL C 1 132 ? 81.277  1.811   26.546  1.00 8.29  ? 132 VAL C CG2 1 
ATOM   4305 N  N   . LEU C 1 133 ? 83.049  -0.761  28.497  1.00 7.04  ? 133 LEU C N   1 
ATOM   4306 C  CA  . LEU C 1 133 ? 82.823  -2.173  28.203  1.00 7.44  ? 133 LEU C CA  1 
ATOM   4307 C  C   . LEU C 1 133 ? 81.337  -2.459  28.234  1.00 7.91  ? 133 LEU C C   1 
ATOM   4308 O  O   . LEU C 1 133 ? 80.710  -2.405  29.294  1.00 7.97  ? 133 LEU C O   1 
ATOM   4309 C  CB  . LEU C 1 133 ? 83.506  -3.034  29.246  1.00 7.63  ? 133 LEU C CB  1 
ATOM   4310 C  CG  . LEU C 1 133 ? 83.358  -4.521  28.945  1.00 8.14  ? 133 LEU C CG  1 
ATOM   4311 C  CD1 . LEU C 1 133 ? 83.843  -4.812  27.537  1.00 6.88  ? 133 LEU C CD1 1 
ATOM   4312 C  CD2 . LEU C 1 133 ? 84.115  -5.340  29.966  1.00 9.10  ? 133 LEU C CD2 1 
ATOM   4313 N  N   . LYS C 1 134 ? 80.761  -2.739  27.068  1.00 8.04  ? 134 LYS C N   1 
ATOM   4314 C  CA  . LYS C 1 134 ? 79.345  -3.073  26.993  1.00 9.15  ? 134 LYS C CA  1 
ATOM   4315 C  C   . LYS C 1 134 ? 79.201  -4.554  26.729  1.00 9.48  ? 134 LYS C C   1 
ATOM   4316 O  O   . LYS C 1 134 ? 79.293  -4.997  25.576  1.00 10.60 ? 134 LYS C O   1 
ATOM   4317 C  CB  . LYS C 1 134 ? 78.671  -2.320  25.862  1.00 9.32  ? 134 LYS C CB  1 
ATOM   4318 C  CG  . LYS C 1 134 ? 78.349  -0.879  26.157  1.00 9.55  ? 134 LYS C CG  1 
ATOM   4319 C  CD  . LYS C 1 134 ? 77.429  -0.354  25.074  1.00 11.29 ? 134 LYS C CD  1 
ATOM   4320 C  CE  . LYS C 1 134 ? 77.882  0.979   24.530  1.00 10.92 ? 134 LYS C CE  1 
ATOM   4321 N  NZ  . LYS C 1 134 ? 77.196  1.288   23.242  1.00 9.92  ? 134 LYS C NZ  1 
ATOM   4322 N  N   . GLY C 1 135 ? 78.964  -5.317  27.791  1.00 10.22 ? 135 GLY C N   1 
ATOM   4323 C  CA  . GLY C 1 135 ? 78.928  -6.761  27.686  1.00 9.76  ? 135 GLY C CA  1 
ATOM   4324 C  C   . GLY C 1 135 ? 80.344  -7.248  27.489  1.00 9.20  ? 135 GLY C C   1 
ATOM   4325 O  O   . GLY C 1 135 ? 81.210  -7.095  28.366  1.00 9.90  ? 135 GLY C O   1 
ATOM   4326 N  N   . ASP C 1 136 ? 80.585  -7.824  26.322  1.00 8.48  ? 136 ASP C N   1 
ATOM   4327 C  CA  . ASP C 1 136 ? 81.913  -8.285  25.987  1.00 8.36  ? 136 ASP C CA  1 
ATOM   4328 C  C   . ASP C 1 136 ? 82.558  -7.414  24.914  1.00 7.65  ? 136 ASP C C   1 
ATOM   4329 O  O   . ASP C 1 136 ? 83.577  -7.798  24.368  1.00 7.86  ? 136 ASP C O   1 
ATOM   4330 C  CB  . ASP C 1 136 ? 81.868  -9.752  25.528  1.00 8.13  ? 136 ASP C CB  1 
ATOM   4331 C  CG  . ASP C 1 136 ? 80.986  -9.957  24.314  1.00 9.89  ? 136 ASP C CG  1 
ATOM   4332 O  OD1 . ASP C 1 136 ? 80.799  -11.124 23.894  1.00 10.27 ? 136 ASP C OD1 1 
ATOM   4333 O  OD2 . ASP C 1 136 ? 80.480  -8.952  23.775  1.00 11.96 ? 136 ASP C OD2 1 
ATOM   4334 N  N   . LYS C 1 137 ? 81.967  -6.260  24.585  1.00 7.77  ? 137 LYS C N   1 
ATOM   4335 C  CA  . LYS C 1 137 ? 82.559  -5.411  23.533  1.00 8.05  ? 137 LYS C CA  1 
ATOM   4336 C  C   . LYS C 1 137 ? 82.918  -4.010  24.021  1.00 7.83  ? 137 LYS C C   1 
ATOM   4337 O  O   . LYS C 1 137 ? 82.116  -3.337  24.644  1.00 9.25  ? 137 LYS C O   1 
ATOM   4338 C  CB  . LYS C 1 137 ? 81.638  -5.313  22.313  1.00 8.47  ? 137 LYS C CB  1 
ATOM   4339 C  CG  . LYS C 1 137 ? 82.305  -4.771  21.047  1.00 10.51 ? 137 LYS C CG  1 
ATOM   4340 C  CD  . LYS C 1 137 ? 81.276  -4.637  19.920  1.00 12.35 ? 137 LYS C CD  1 
ATOM   4341 C  CE  . LYS C 1 137 ? 81.869  -4.016  18.657  1.00 14.17 ? 137 LYS C CE  1 
ATOM   4342 N  NZ  . LYS C 1 137 ? 80.821  -3.641  17.659  1.00 15.72 ? 137 LYS C NZ  1 
ATOM   4343 N  N   . LEU C 1 138 ? 84.127  -3.569  23.700  1.00 7.45  ? 138 LEU C N   1 
ATOM   4344 C  CA  . LEU C 1 138 ? 84.578  -2.245  24.080  1.00 7.02  ? 138 LEU C CA  1 
ATOM   4345 C  C   . LEU C 1 138 ? 83.974  -1.239  23.115  1.00 6.73  ? 138 LEU C C   1 
ATOM   4346 O  O   . LEU C 1 138 ? 83.802  -1.532  21.939  1.00 7.20  ? 138 LEU C O   1 
ATOM   4347 C  CB  . LEU C 1 138 ? 86.102  -2.182  23.987  1.00 7.12  ? 138 LEU C CB  1 
ATOM   4348 C  CG  . LEU C 1 138 ? 86.873  -2.935  25.063  1.00 6.92  ? 138 LEU C CG  1 
ATOM   4349 C  CD1 . LEU C 1 138 ? 88.375  -2.966  24.716  1.00 6.84  ? 138 LEU C CD1 1 
ATOM   4350 C  CD2 . LEU C 1 138 ? 86.638  -2.283  26.417  1.00 8.41  ? 138 LEU C CD2 1 
ATOM   4351 N  N   . ALA C 1 139 ? 83.660  -0.044  23.595  1.00 5.87  ? 139 ALA C N   1 
ATOM   4352 C  CA  . ALA C 1 139 ? 83.103  0.966   22.712  1.00 5.28  ? 139 ALA C CA  1 
ATOM   4353 C  C   . ALA C 1 139 ? 83.548  2.345   23.146  1.00 5.33  ? 139 ALA C C   1 
ATOM   4354 O  O   . ALA C 1 139 ? 83.937  2.545   24.300  1.00 4.91  ? 139 ALA C O   1 
ATOM   4355 C  CB  . ALA C 1 139 ? 81.608  0.901   22.749  1.00 4.80  ? 139 ALA C CB  1 
ATOM   4356 N  N   . VAL C 1 140 ? 83.465  3.288   22.217  1.00 5.47  ? 140 VAL C N   1 
ATOM   4357 C  CA  . VAL C 1 140 ? 83.682  4.686   22.508  1.00 5.48  ? 140 VAL C CA  1 
ATOM   4358 C  C   . VAL C 1 140 ? 82.327  5.409   22.520  1.00 5.40  ? 140 VAL C C   1 
ATOM   4359 O  O   . VAL C 1 140 ? 81.533  5.266   21.603  1.00 6.69  ? 140 VAL C O   1 
ATOM   4360 C  CB  . VAL C 1 140 ? 84.618  5.332   21.467  1.00 4.95  ? 140 VAL C CB  1 
ATOM   4361 C  CG1 . VAL C 1 140 ? 84.595  6.845   21.615  1.00 5.58  ? 140 VAL C CG1 1 
ATOM   4362 C  CG2 . VAL C 1 140 ? 86.015  4.788   21.625  1.00 6.10  ? 140 VAL C CG2 1 
ATOM   4363 N  N   . VAL C 1 141 ? 82.066  6.160   23.580  1.00 5.47  ? 141 VAL C N   1 
ATOM   4364 C  CA  . VAL C 1 141 ? 80.829  6.909   23.705  1.00 4.90  ? 141 VAL C CA  1 
ATOM   4365 C  C   . VAL C 1 141 ? 81.138  8.206   24.419  1.00 4.83  ? 141 VAL C C   1 
ATOM   4366 O  O   . VAL C 1 141 ? 82.209  8.382   24.979  1.00 4.29  ? 141 VAL C O   1 
ATOM   4367 C  CB  . VAL C 1 141 ? 79.760  6.162   24.538  1.00 5.31  ? 141 VAL C CB  1 
ATOM   4368 C  CG1 . VAL C 1 141 ? 79.397  4.856   23.871  1.00 5.83  ? 141 VAL C CG1 1 
ATOM   4369 C  CG2 . VAL C 1 141 ? 80.222  5.941   25.970  1.00 4.61  ? 141 VAL C CG2 1 
ATOM   4370 N  N   . SER C 1 142 ? 80.189  9.119   24.397  1.00 4.85  ? 142 SER C N   1 
ATOM   4371 C  CA  . SER C 1 142 ? 80.384  10.355  25.102  1.00 4.59  ? 142 SER C CA  1 
ATOM   4372 C  C   . SER C 1 142 ? 79.086  10.739  25.769  1.00 4.64  ? 142 SER C C   1 
ATOM   4373 O  O   . SER C 1 142 ? 78.016  10.307  25.353  1.00 3.84  ? 142 SER C O   1 
ATOM   4374 C  CB  . SER C 1 142 ? 80.884  11.463  24.159  1.00 5.06  ? 142 SER C CB  1 
ATOM   4375 O  OG  . SER C 1 142 ? 79.825  12.147  23.531  1.00 5.15  ? 142 SER C OG  1 
ATOM   4376 N  N   . THR C 1 143 ? 79.196  11.515  26.839  1.00 3.40  ? 143 THR C N   1 
ATOM   4377 C  CA  . THR C 1 143 ? 78.046  11.989  27.543  1.00 2.75  ? 143 THR C CA  1 
ATOM   4378 C  C   . THR C 1 143 ? 78.132  13.504  27.755  1.00 2.59  ? 143 THR C C   1 
ATOM   4379 O  O   . THR C 1 143 ? 79.193  14.108  27.602  1.00 2.38  ? 143 THR C O   1 
ATOM   4380 C  CB  . THR C 1 143 ? 77.913  11.301  28.931  1.00 1.84  ? 143 THR C CB  1 
ATOM   4381 O  OG1 . THR C 1 143 ? 79.149  11.433  29.635  1.00 2.05  ? 143 THR C OG1 1 
ATOM   4382 C  CG2 . THR C 1 143 ? 77.624  9.804   28.790  1.00 2.40  ? 143 THR C CG2 1 
ATOM   4383 N  N   . ALA C 1 144 ? 77.007  14.083  28.140  1.00 2.74  ? 144 ALA C N   1 
ATOM   4384 C  CA  . ALA C 1 144 ? 76.847  15.508  28.393  1.00 2.70  ? 144 ALA C CA  1 
ATOM   4385 C  C   . ALA C 1 144 ? 77.046  15.815  29.861  1.00 2.17  ? 144 ALA C C   1 
ATOM   4386 O  O   . ALA C 1 144 ? 76.665  15.035  30.737  1.00 2.24  ? 144 ALA C O   1 
ATOM   4387 C  CB  . ALA C 1 144 ? 75.463  15.960  27.986  1.00 2.24  ? 144 ALA C CB  1 
ATOM   4388 N  N   . ASN C 1 145 ? 77.625  16.973  30.121  1.00 1.51  ? 145 ASN C N   1 
ATOM   4389 C  CA  . ASN C 1 145 ? 77.741  17.475  31.469  1.00 1.34  ? 145 ASN C CA  1 
ATOM   4390 C  C   . ASN C 1 145 ? 78.439  16.451  32.389  1.00 1.23  ? 145 ASN C C   1 
ATOM   4391 O  O   . ASN C 1 145 ? 79.579  16.012  32.089  1.00 1.34  ? 145 ASN C O   1 
ATOM   4392 C  CB  . ASN C 1 145 ? 76.350  17.929  31.923  1.00 0.99  ? 145 ASN C CB  1 
ATOM   4393 C  CG  . ASN C 1 145 ? 75.738  18.901  30.928  1.00 1.75  ? 145 ASN C CG  1 
ATOM   4394 O  OD1 . ASN C 1 145 ? 76.437  19.772  30.406  1.00 1.16  ? 145 ASN C OD1 1 
ATOM   4395 N  ND2 . ASN C 1 145 ? 74.455  18.723  30.603  1.00 1.38  ? 145 ASN C ND2 1 
ATOM   4396 N  N   . GLN C 1 146 ? 77.812  16.081  33.504  1.00 1.62  ? 146 GLN C N   1 
ATOM   4397 C  CA  . GLN C 1 146 ? 78.414  15.070  34.370  1.00 1.74  ? 146 GLN C CA  1 
ATOM   4398 C  C   . GLN C 1 146 ? 77.674  13.735  34.276  1.00 2.17  ? 146 GLN C C   1 
ATOM   4399 O  O   . GLN C 1 146 ? 77.770  12.916  35.184  1.00 2.23  ? 146 GLN C O   1 
ATOM   4400 C  CB  . GLN C 1 146 ? 78.474  15.504  35.831  1.00 1.85  ? 146 GLN C CB  1 
ATOM   4401 C  CG  . GLN C 1 146 ? 79.331  16.751  36.104  1.00 1.78  ? 146 GLN C CG  1 
ATOM   4402 C  CD  . GLN C 1 146 ? 80.763  16.611  35.639  1.00 2.75  ? 146 GLN C CD  1 
ATOM   4403 O  OE1 . GLN C 1 146 ? 81.270  15.509  35.450  1.00 1.74  ? 146 GLN C OE1 1 
ATOM   4404 N  NE2 . GLN C 1 146 ? 81.431  17.749  35.457  1.00 3.28  ? 146 GLN C NE2 1 
ATOM   4405 N  N   . ASP C 1 147 ? 76.930  13.534  33.198  1.00 2.18  ? 147 ASP C N   1 
ATOM   4406 C  CA  . ASP C 1 147 ? 76.340  12.215  32.969  1.00 2.54  ? 147 ASP C CA  1 
ATOM   4407 C  C   . ASP C 1 147 ? 77.430  11.138  32.806  1.00 3.18  ? 147 ASP C C   1 
ATOM   4408 O  O   . ASP C 1 147 ? 78.535  11.427  32.347  1.00 2.29  ? 147 ASP C O   1 
ATOM   4409 C  CB  . ASP C 1 147 ? 75.409  12.251  31.753  1.00 2.29  ? 147 ASP C CB  1 
ATOM   4410 C  CG  . ASP C 1 147 ? 74.217  13.199  31.933  1.00 2.21  ? 147 ASP C CG  1 
ATOM   4411 O  OD1 . ASP C 1 147 ? 73.970  13.732  33.034  1.00 1.69  ? 147 ASP C OD1 1 
ATOM   4412 O  OD2 . ASP C 1 147 ? 73.472  13.382  30.952  1.00 4.26  ? 147 ASP C OD2 1 
ATOM   4413 N  N   . SER C 1 148 ? 77.127  9.906   33.215  1.00 3.40  ? 148 SER C N   1 
ATOM   4414 C  CA  . SER C 1 148 ? 78.048  8.781   33.091  1.00 4.04  ? 148 SER C CA  1 
ATOM   4415 C  C   . SER C 1 148 ? 77.314  7.608   32.448  1.00 4.42  ? 148 SER C C   1 
ATOM   4416 O  O   . SER C 1 148 ? 76.098  7.443   32.646  1.00 3.51  ? 148 SER C O   1 
ATOM   4417 C  CB  . SER C 1 148 ? 78.591  8.367   34.457  1.00 4.37  ? 148 SER C CB  1 
ATOM   4418 O  OG  . SER C 1 148 ? 79.092  7.035   34.420  1.00 3.62  ? 148 SER C OG  1 
ATOM   4419 N  N   . PRO C 1 149 ? 78.046  6.777   31.698  1.00 4.61  ? 149 PRO C N   1 
ATOM   4420 C  CA  . PRO C 1 149 ? 77.427  5.609   31.095  1.00 4.90  ? 149 PRO C CA  1 
ATOM   4421 C  C   . PRO C 1 149 ? 76.817  4.743   32.180  1.00 5.17  ? 149 PRO C C   1 
ATOM   4422 O  O   . PRO C 1 149 ? 75.864  4.026   31.919  1.00 6.10  ? 149 PRO C O   1 
ATOM   4423 C  CB  . PRO C 1 149 ? 78.599  4.883   30.402  1.00 4.62  ? 149 PRO C CB  1 
ATOM   4424 C  CG  . PRO C 1 149 ? 79.850  5.571   30.890  1.00 5.44  ? 149 PRO C CG  1 
ATOM   4425 C  CD  . PRO C 1 149 ? 79.446  6.950   31.267  1.00 4.30  ? 149 PRO C CD  1 
ATOM   4426 N  N   . LEU C 1 150 ? 77.331  4.852   33.403  1.00 4.92  ? 150 LEU C N   1 
ATOM   4427 C  CA  . LEU C 1 150 ? 76.775  4.075   34.508  1.00 5.16  ? 150 LEU C CA  1 
ATOM   4428 C  C   . LEU C 1 150 ? 75.314  4.439   34.752  1.00 4.83  ? 150 LEU C C   1 
ATOM   4429 O  O   . LEU C 1 150 ? 74.564  3.632   35.308  1.00 4.98  ? 150 LEU C O   1 
ATOM   4430 C  CB  . LEU C 1 150 ? 77.585  4.235   35.797  1.00 4.83  ? 150 LEU C CB  1 
ATOM   4431 C  CG  . LEU C 1 150 ? 78.992  3.647   35.782  1.00 5.69  ? 150 LEU C CG  1 
ATOM   4432 C  CD1 . LEU C 1 150 ? 79.702  4.037   37.064  1.00 4.21  ? 150 LEU C CD1 1 
ATOM   4433 C  CD2 . LEU C 1 150 ? 78.986  2.135   35.584  1.00 5.88  ? 150 LEU C CD2 1 
ATOM   4434 N  N   . MET C 1 151 ? 74.901  5.637   34.352  1.00 4.92  ? 151 MET C N   1 
ATOM   4435 C  CA  . MET C 1 151 ? 73.505  6.048   34.551  1.00 4.62  ? 151 MET C CA  1 
ATOM   4436 C  C   . MET C 1 151 ? 72.543  5.368   33.583  1.00 5.41  ? 151 MET C C   1 
ATOM   4437 O  O   . MET C 1 151 ? 71.328  5.436   33.788  1.00 5.08  ? 151 MET C O   1 
ATOM   4438 C  CB  . MET C 1 151 ? 73.334  7.565   34.429  1.00 4.12  ? 151 MET C CB  1 
ATOM   4439 C  CG  . MET C 1 151 ? 74.228  8.358   35.346  1.00 4.57  ? 151 MET C CG  1 
ATOM   4440 S  SD  . MET C 1 151 ? 74.103  10.125  35.056  1.00 3.55  ? 151 MET C SD  1 
ATOM   4441 C  CE  . MET C 1 151 ? 75.253  10.701  36.302  1.00 1.81  ? 151 MET C CE  1 
ATOM   4442 N  N   . GLY C 1 152 ? 73.087  4.710   32.552  1.00 5.42  ? 152 GLY C N   1 
ATOM   4443 C  CA  . GLY C 1 152 ? 72.291  3.972   31.548  1.00 5.89  ? 152 GLY C CA  1 
ATOM   4444 C  C   . GLY C 1 152 ? 71.796  4.815   30.376  1.00 5.89  ? 152 GLY C C   1 
ATOM   4445 O  O   . GLY C 1 152 ? 71.909  6.026   30.399  1.00 6.03  ? 152 GLY C O   1 
ATOM   4446 N  N   . GLU C 1 153 ? 71.209  4.182   29.364  1.00 5.67  ? 153 GLU C N   1 
ATOM   4447 C  CA  . GLU C 1 153 ? 70.784  4.907   28.141  1.00 6.08  ? 153 GLU C CA  1 
ATOM   4448 C  C   . GLU C 1 153 ? 69.691  5.978   28.299  1.00 5.89  ? 153 GLU C C   1 
ATOM   4449 O  O   . GLU C 1 153 ? 69.776  7.065   27.704  1.00 6.42  ? 153 GLU C O   1 
ATOM   4450 C  CB  . GLU C 1 153 ? 70.327  3.927   27.059  1.00 6.70  ? 153 GLU C CB  1 
ATOM   4451 C  CG  . GLU C 1 153 ? 71.360  2.860   26.710  1.00 9.88  ? 153 GLU C CG  1 
ATOM   4452 C  CD  . GLU C 1 153 ? 72.397  3.354   25.722  1.00 12.10 ? 153 GLU C CD  1 
ATOM   4453 O  OE1 . GLU C 1 153 ? 72.169  4.419   25.101  1.00 13.67 ? 153 GLU C OE1 1 
ATOM   4454 O  OE2 . GLU C 1 153 ? 73.435  2.670   25.551  1.00 13.83 ? 153 GLU C OE2 1 
ATOM   4455 N  N   . ALA C 1 154 ? 68.637  5.652   29.036  1.00 5.46  ? 154 ALA C N   1 
ATOM   4456 C  CA  . ALA C 1 154 ? 67.504  6.545   29.153  1.00 6.26  ? 154 ALA C CA  1 
ATOM   4457 C  C   . ALA C 1 154 ? 67.966  7.917   29.624  1.00 6.10  ? 154 ALA C C   1 
ATOM   4458 O  O   . ALA C 1 154 ? 67.546  8.939   29.102  1.00 6.69  ? 154 ALA C O   1 
ATOM   4459 C  CB  . ALA C 1 154 ? 66.473  5.963   30.110  1.00 7.03  ? 154 ALA C CB  1 
ATOM   4460 N  N   . ILE C 1 155 ? 68.849  7.918   30.611  1.00 5.53  ? 155 ILE C N   1 
ATOM   4461 C  CA  . ILE C 1 155 ? 69.311  9.161   31.207  1.00 5.48  ? 155 ILE C CA  1 
ATOM   4462 C  C   . ILE C 1 155 ? 70.471  9.768   30.435  1.00 4.87  ? 155 ILE C C   1 
ATOM   4463 O  O   . ILE C 1 155 ? 70.421  10.932  30.076  1.00 4.33  ? 155 ILE C O   1 
ATOM   4464 C  CB  . ILE C 1 155 ? 69.706  8.963   32.676  1.00 5.16  ? 155 ILE C CB  1 
ATOM   4465 C  CG1 . ILE C 1 155 ? 68.447  8.781   33.533  1.00 6.91  ? 155 ILE C CG1 1 
ATOM   4466 C  CG2 . ILE C 1 155 ? 70.467  10.161  33.201  1.00 4.93  ? 155 ILE C CG2 1 
ATOM   4467 C  CD1 . ILE C 1 155 ? 68.726  8.391   34.932  1.00 7.68  ? 155 ILE C CD1 1 
ATOM   4468 N  N   . SER C 1 156 ? 71.500  8.975   30.159  1.00 4.86  ? 156 SER C N   1 
ATOM   4469 C  CA  . SER C 1 156 ? 72.775  9.529   29.693  1.00 4.84  ? 156 SER C CA  1 
ATOM   4470 C  C   . SER C 1 156 ? 72.982  9.471   28.172  1.00 4.72  ? 156 SER C C   1 
ATOM   4471 O  O   . SER C 1 156 ? 73.923  10.068  27.639  1.00 4.65  ? 156 SER C O   1 
ATOM   4472 C  CB  . SER C 1 156 ? 73.928  8.795   30.362  1.00 4.51  ? 156 SER C CB  1 
ATOM   4473 O  OG  . SER C 1 156 ? 74.204  7.559   29.708  1.00 6.82  ? 156 SER C OG  1 
ATOM   4474 N  N   . GLY C 1 157 ? 72.140  8.735   27.468  1.00 5.01  ? 157 GLY C N   1 
ATOM   4475 C  CA  . GLY C 1 157 ? 72.378  8.529   26.031  1.00 5.20  ? 157 GLY C CA  1 
ATOM   4476 C  C   . GLY C 1 157 ? 73.471  7.508   25.781  1.00 5.62  ? 157 GLY C C   1 
ATOM   4477 O  O   . GLY C 1 157 ? 73.847  7.238   24.635  1.00 6.12  ? 157 GLY C O   1 
ATOM   4478 N  N   . ALA C 1 158 ? 73.993  6.946   26.860  1.00 5.34  ? 158 ALA C N   1 
ATOM   4479 C  CA  . ALA C 1 158 ? 75.017  5.924   26.739  1.00 5.39  ? 158 ALA C CA  1 
ATOM   4480 C  C   . ALA C 1 158 ? 74.865  4.867   27.814  1.00 5.45  ? 158 ALA C C   1 
ATOM   4481 O  O   . ALA C 1 158 ? 74.030  4.974   28.697  1.00 5.10  ? 158 ALA C O   1 
ATOM   4482 C  CB  . ALA C 1 158 ? 76.402  6.543   26.792  1.00 5.23  ? 158 ALA C CB  1 
ATOM   4483 N  N   . SER C 1 159 ? 75.682  3.836   27.720  1.00 5.94  ? 159 SER C N   1 
ATOM   4484 C  CA  . SER C 1 159 ? 75.737  2.824   28.754  1.00 6.25  ? 159 SER C CA  1 
ATOM   4485 C  C   . SER C 1 159 ? 77.065  2.118   28.684  1.00 6.95  ? 159 SER C C   1 
ATOM   4486 O  O   . SER C 1 159 ? 77.846  2.294   27.734  1.00 8.22  ? 159 SER C O   1 
ATOM   4487 C  CB  . SER C 1 159 ? 74.593  1.815   28.587  1.00 6.62  ? 159 SER C CB  1 
ATOM   4488 O  OG  . SER C 1 159 ? 74.525  1.340   27.253  1.00 8.01  ? 159 SER C OG  1 
ATOM   4489 N  N   . GLY C 1 160 ? 77.314  1.300   29.695  1.00 6.53  ? 160 GLY C N   1 
ATOM   4490 C  CA  . GLY C 1 160 ? 78.492  0.466   29.727  1.00 6.52  ? 160 GLY C CA  1 
ATOM   4491 C  C   . GLY C 1 160 ? 79.323  0.804   30.947  1.00 5.99  ? 160 GLY C C   1 
ATOM   4492 O  O   . GLY C 1 160 ? 79.086  1.827   31.610  1.00 7.03  ? 160 GLY C O   1 
ATOM   4493 N  N   . PHE C 1 161 ? 80.286  -0.067  31.237  1.00 5.67  ? 161 PHE C N   1 
ATOM   4494 C  CA  . PHE C 1 161 ? 81.179  0.068   32.374  1.00 5.60  ? 161 PHE C CA  1 
ATOM   4495 C  C   . PHE C 1 161 ? 82.406  0.861   31.955  1.00 5.52  ? 161 PHE C C   1 
ATOM   4496 O  O   . PHE C 1 161 ? 83.219  0.373   31.187  1.00 5.88  ? 161 PHE C O   1 
ATOM   4497 C  CB  . PHE C 1 161 ? 81.605  -1.323  32.874  1.00 6.43  ? 161 PHE C CB  1 
ATOM   4498 C  CG  . PHE C 1 161 ? 82.684  -1.293  33.914  1.00 6.68  ? 161 PHE C CG  1 
ATOM   4499 C  CD1 . PHE C 1 161 ? 82.400  -0.905  35.208  1.00 7.31  ? 161 PHE C CD1 1 
ATOM   4500 C  CD2 . PHE C 1 161 ? 83.986  -1.653  33.593  1.00 8.94  ? 161 PHE C CD2 1 
ATOM   4501 C  CE1 . PHE C 1 161 ? 83.406  -0.876  36.178  1.00 6.94  ? 161 PHE C CE1 1 
ATOM   4502 C  CE2 . PHE C 1 161 ? 84.992  -1.620  34.546  1.00 8.52  ? 161 PHE C CE2 1 
ATOM   4503 C  CZ  . PHE C 1 161 ? 84.707  -1.224  35.840  1.00 9.21  ? 161 PHE C CZ  1 
ATOM   4504 N  N   . PRO C 1 162 ? 82.541  2.091   32.459  1.00 5.44  ? 162 PRO C N   1 
ATOM   4505 C  CA  . PRO C 1 162 ? 83.675  2.894   32.013  1.00 5.37  ? 162 PRO C CA  1 
ATOM   4506 C  C   . PRO C 1 162 ? 85.037  2.222   32.290  1.00 6.04  ? 162 PRO C C   1 
ATOM   4507 O  O   . PRO C 1 162 ? 85.303  1.793   33.410  1.00 6.69  ? 162 PRO C O   1 
ATOM   4508 C  CB  . PRO C 1 162 ? 83.545  4.180   32.847  1.00 5.45  ? 162 PRO C CB  1 
ATOM   4509 C  CG  . PRO C 1 162 ? 82.080  4.247   33.227  1.00 5.95  ? 162 PRO C CG  1 
ATOM   4510 C  CD  . PRO C 1 162 ? 81.720  2.802   33.448  1.00 5.07  ? 162 PRO C CD  1 
ATOM   4511 N  N   . ILE C 1 163 ? 85.889  2.150   31.277  1.00 5.54  ? 163 ILE C N   1 
ATOM   4512 C  CA  . ILE C 1 163 ? 87.248  1.670   31.465  1.00 5.17  ? 163 ILE C CA  1 
ATOM   4513 C  C   . ILE C 1 163 ? 88.163  2.859   31.705  1.00 5.19  ? 163 ILE C C   1 
ATOM   4514 O  O   . ILE C 1 163 ? 89.012  2.814   32.574  1.00 5.11  ? 163 ILE C O   1 
ATOM   4515 C  CB  . ILE C 1 163 ? 87.739  0.875   30.255  1.00 5.92  ? 163 ILE C CB  1 
ATOM   4516 C  CG1 . ILE C 1 163 ? 86.813  -0.333  29.996  1.00 6.20  ? 163 ILE C CG1 1 
ATOM   4517 C  CG2 . ILE C 1 163 ? 89.203  0.486   30.425  1.00 4.45  ? 163 ILE C CG2 1 
ATOM   4518 C  CD1 . ILE C 1 163 ? 86.849  -1.427  31.077  1.00 5.82  ? 163 ILE C CD1 1 
ATOM   4519 N  N   . MET C 1 164 ? 87.973  3.925   30.941  1.00 4.67  ? 164 MET C N   1 
ATOM   4520 C  CA  . MET C 1 164 ? 88.651  5.176   31.257  1.00 4.24  ? 164 MET C CA  1 
ATOM   4521 C  C   . MET C 1 164 ? 87.875  6.297   30.626  1.00 4.16  ? 164 MET C C   1 
ATOM   4522 O  O   . MET C 1 164 ? 86.934  6.056   29.866  1.00 3.52  ? 164 MET C O   1 
ATOM   4523 C  CB  . MET C 1 164 ? 90.109  5.187   30.792  1.00 4.74  ? 164 MET C CB  1 
ATOM   4524 C  CG  . MET C 1 164 ? 90.314  4.921   29.319  1.00 5.78  ? 164 MET C CG  1 
ATOM   4525 S  SD  . MET C 1 164 ? 90.046  6.359   28.247  1.00 6.30  ? 164 MET C SD  1 
ATOM   4526 C  CE  . MET C 1 164 ? 90.770  5.697   26.718  1.00 4.90  ? 164 MET C CE  1 
ATOM   4527 N  N   . GLY C 1 165 ? 88.265  7.526   30.940  1.00 4.43  ? 165 GLY C N   1 
ATOM   4528 C  CA  . GLY C 1 165 ? 87.525  8.672   30.439  1.00 3.98  ? 165 GLY C CA  1 
ATOM   4529 C  C   . GLY C 1 165 ? 88.333  9.955   30.426  1.00 4.07  ? 165 GLY C C   1 
ATOM   4530 O  O   . GLY C 1 165 ? 89.305  10.097  31.166  1.00 3.23  ? 165 GLY C O   1 
ATOM   4531 N  N   . LEU C 1 166 ? 87.871  10.892  29.604  1.00 3.68  ? 166 LEU C N   1 
ATOM   4532 C  CA  . LEU C 1 166 ? 88.516  12.190  29.423  1.00 2.98  ? 166 LEU C CA  1 
ATOM   4533 C  C   . LEU C 1 166 ? 87.479  13.279  29.614  1.00 2.75  ? 166 LEU C C   1 
ATOM   4534 O  O   . LEU C 1 166 ? 86.451  13.300  28.916  1.00 2.84  ? 166 LEU C O   1 
ATOM   4535 C  CB  . LEU C 1 166 ? 89.109  12.292  28.011  1.00 3.13  ? 166 LEU C CB  1 
ATOM   4536 C  CG  . LEU C 1 166 ? 89.784  13.648  27.756  1.00 2.38  ? 166 LEU C CG  1 
ATOM   4537 C  CD1 . LEU C 1 166 ? 90.974  13.925  28.700  1.00 3.94  ? 166 LEU C CD1 1 
ATOM   4538 C  CD2 . LEU C 1 166 ? 90.215  13.765  26.297  1.00 2.41  ? 166 LEU C CD2 1 
ATOM   4539 N  N   . ASP C 1 167 ? 87.751  14.180  30.563  1.00 2.18  ? 167 ASP C N   1 
ATOM   4540 C  CA  . ASP C 1 167 ? 86.908  15.311  30.865  1.00 1.89  ? 167 ASP C CA  1 
ATOM   4541 C  C   . ASP C 1 167 ? 87.102  16.327  29.739  1.00 1.83  ? 167 ASP C C   1 
ATOM   4542 O  O   . ASP C 1 167 ? 88.226  16.770  29.506  1.00 3.03  ? 167 ASP C O   1 
ATOM   4543 C  CB  . ASP C 1 167 ? 87.375  15.893  32.228  1.00 1.45  ? 167 ASP C CB  1 
ATOM   4544 C  CG  . ASP C 1 167 ? 86.446  16.962  32.769  1.00 3.03  ? 167 ASP C CG  1 
ATOM   4545 O  OD1 . ASP C 1 167 ? 85.421  17.252  32.089  1.00 1.32  ? 167 ASP C OD1 1 
ATOM   4546 O  OD2 . ASP C 1 167 ? 86.743  17.501  33.871  1.00 2.21  ? 167 ASP C OD2 1 
ATOM   4547 N  N   . VAL C 1 168 ? 86.034  16.671  29.012  1.00 1.64  ? 168 VAL C N   1 
ATOM   4548 C  CA  . VAL C 1 168 ? 86.165  17.690  27.953  1.00 1.79  ? 168 VAL C CA  1 
ATOM   4549 C  C   . VAL C 1 168 ? 85.374  18.954  28.270  1.00 1.69  ? 168 VAL C C   1 
ATOM   4550 O  O   . VAL C 1 168 ? 85.117  19.786  27.406  1.00 1.04  ? 168 VAL C O   1 
ATOM   4551 C  CB  . VAL C 1 168 ? 85.887  17.140  26.511  1.00 2.26  ? 168 VAL C CB  1 
ATOM   4552 C  CG1 . VAL C 1 168 ? 86.910  16.092  26.131  1.00 2.66  ? 168 VAL C CG1 1 
ATOM   4553 C  CG2 . VAL C 1 168 ? 84.484  16.569  26.390  1.00 2.83  ? 168 VAL C CG2 1 
ATOM   4554 N  N   . TRP C 1 169 ? 85.016  19.123  29.539  1.00 1.47  ? 169 TRP C N   1 
ATOM   4555 C  CA  . TRP C 1 169 ? 84.574  20.426  29.993  1.00 1.68  ? 169 TRP C CA  1 
ATOM   4556 C  C   . TRP C 1 169 ? 85.712  21.427  29.754  1.00 1.91  ? 169 TRP C C   1 
ATOM   4557 O  O   . TRP C 1 169 ? 86.891  21.096  29.896  1.00 1.58  ? 169 TRP C O   1 
ATOM   4558 C  CB  . TRP C 1 169 ? 84.245  20.427  31.481  1.00 2.16  ? 169 TRP C CB  1 
ATOM   4559 C  CG  . TRP C 1 169 ? 82.935  19.836  31.860  1.00 2.00  ? 169 TRP C CG  1 
ATOM   4560 C  CD1 . TRP C 1 169 ? 82.493  18.568  31.600  1.00 1.69  ? 169 TRP C CD1 1 
ATOM   4561 C  CD2 . TRP C 1 169 ? 81.903  20.479  32.620  1.00 1.13  ? 169 TRP C CD2 1 
ATOM   4562 N  NE1 . TRP C 1 169 ? 81.239  18.386  32.152  1.00 1.44  ? 169 TRP C NE1 1 
ATOM   4563 C  CE2 . TRP C 1 169 ? 80.856  19.540  32.781  1.00 1.90  ? 169 TRP C CE2 1 
ATOM   4564 C  CE3 . TRP C 1 169 ? 81.757  21.757  33.174  1.00 1.79  ? 169 TRP C CE3 1 
ATOM   4565 C  CZ2 . TRP C 1 169 ? 79.677  19.840  33.485  1.00 2.83  ? 169 TRP C CZ2 1 
ATOM   4566 C  CZ3 . TRP C 1 169 ? 80.592  22.061  33.861  1.00 2.11  ? 169 TRP C CZ3 1 
ATOM   4567 C  CH2 . TRP C 1 169 ? 79.565  21.097  34.023  1.00 3.31  ? 169 TRP C CH2 1 
ATOM   4568 N  N   . GLU C 1 170 ? 85.359  22.651  29.398  1.00 1.69  ? 170 GLU C N   1 
ATOM   4569 C  CA  . GLU C 1 170 ? 86.397  23.617  29.072  1.00 2.29  ? 170 GLU C CA  1 
ATOM   4570 C  C   . GLU C 1 170 ? 87.323  23.885  30.266  1.00 2.88  ? 170 GLU C C   1 
ATOM   4571 O  O   . GLU C 1 170 ? 88.515  24.163  30.090  1.00 2.86  ? 170 GLU C O   1 
ATOM   4572 C  CB  . GLU C 1 170 ? 85.811  24.888  28.465  1.00 1.92  ? 170 GLU C CB  1 
ATOM   4573 C  CG  . GLU C 1 170 ? 85.482  24.754  26.976  1.00 1.83  ? 170 GLU C CG  1 
ATOM   4574 C  CD  . GLU C 1 170 ? 84.639  25.904  26.433  1.00 1.60  ? 170 GLU C CD  1 
ATOM   4575 O  OE1 . GLU C 1 170 ? 83.915  26.557  27.227  1.00 1.00  ? 170 GLU C OE1 1 
ATOM   4576 O  OE2 . GLU C 1 170 ? 84.690  26.146  25.204  1.00 1.67  ? 170 GLU C OE2 1 
ATOM   4577 N  N   . HIS C 1 171 ? 86.795  23.806  31.486  1.00 2.78  ? 171 HIS C N   1 
ATOM   4578 C  CA  . HIS C 1 171 ? 87.652  23.997  32.653  1.00 3.15  ? 171 HIS C CA  1 
ATOM   4579 C  C   . HIS C 1 171 ? 88.861  23.081  32.688  1.00 3.12  ? 171 HIS C C   1 
ATOM   4580 O  O   . HIS C 1 171 ? 89.860  23.385  33.342  1.00 2.64  ? 171 HIS C O   1 
ATOM   4581 C  CB  . HIS C 1 171 ? 86.876  23.937  33.990  1.00 3.13  ? 171 HIS C CB  1 
ATOM   4582 C  CG  . HIS C 1 171 ? 86.269  22.594  34.331  1.00 2.22  ? 171 HIS C CG  1 
ATOM   4583 N  ND1 . HIS C 1 171 ? 84.916  22.431  34.549  1.00 3.23  ? 171 HIS C ND1 1 
ATOM   4584 C  CD2 . HIS C 1 171 ? 86.831  21.377  34.557  1.00 2.33  ? 171 HIS C CD2 1 
ATOM   4585 C  CE1 . HIS C 1 171 ? 84.666  21.165  34.860  1.00 2.45  ? 171 HIS C CE1 1 
ATOM   4586 N  NE2 . HIS C 1 171 ? 85.810  20.499  34.873  1.00 2.86  ? 171 HIS C NE2 1 
ATOM   4587 N  N   . ALA C 1 172 ? 88.780  21.967  31.981  1.00 2.28  ? 172 ALA C N   1 
ATOM   4588 C  CA  . ALA C 1 172 ? 89.814  20.945  32.108  1.00 2.43  ? 172 ALA C CA  1 
ATOM   4589 C  C   . ALA C 1 172 ? 91.012  21.246  31.220  1.00 2.26  ? 172 ALA C C   1 
ATOM   4590 O  O   . ALA C 1 172 ? 92.067  20.672  31.415  1.00 3.07  ? 172 ALA C O   1 
ATOM   4591 C  CB  . ALA C 1 172 ? 89.255  19.577  31.802  1.00 3.15  ? 172 ALA C CB  1 
ATOM   4592 N  N   . TYR C 1 173 ? 90.836  22.149  30.269  1.00 2.06  ? 173 TYR C N   1 
ATOM   4593 C  CA  . TYR C 1 173 ? 91.909  22.423  29.303  1.00 2.23  ? 173 TYR C CA  1 
ATOM   4594 C  C   . TYR C 1 173 ? 92.074  23.877  28.899  1.00 2.01  ? 173 TYR C C   1 
ATOM   4595 O  O   . TYR C 1 173 ? 92.955  24.184  28.084  1.00 1.42  ? 173 TYR C O   1 
ATOM   4596 C  CB  . TYR C 1 173 ? 91.706  21.578  28.043  1.00 1.75  ? 173 TYR C CB  1 
ATOM   4597 C  CG  . TYR C 1 173 ? 90.433  21.861  27.241  1.00 2.12  ? 173 TYR C CG  1 
ATOM   4598 C  CD1 . TYR C 1 173 ? 90.368  22.912  26.326  1.00 1.99  ? 173 TYR C CD1 1 
ATOM   4599 C  CD2 . TYR C 1 173 ? 89.294  21.068  27.407  1.00 1.16  ? 173 TYR C CD2 1 
ATOM   4600 C  CE1 . TYR C 1 173 ? 89.218  23.136  25.562  1.00 2.21  ? 173 TYR C CE1 1 
ATOM   4601 C  CE2 . TYR C 1 173 ? 88.131  21.288  26.662  1.00 0.86  ? 173 TYR C CE2 1 
ATOM   4602 C  CZ  . TYR C 1 173 ? 88.101  22.332  25.741  1.00 1.96  ? 173 TYR C CZ  1 
ATOM   4603 O  OH  . TYR C 1 173 ? 86.950  22.565  25.005  1.00 1.99  ? 173 TYR C OH  1 
ATOM   4604 N  N   . TYR C 1 174 ? 91.233  24.765  29.414  1.00 3.00  ? 174 TYR C N   1 
ATOM   4605 C  CA  . TYR C 1 174 ? 91.203  26.117  28.865  1.00 3.22  ? 174 TYR C CA  1 
ATOM   4606 C  C   . TYR C 1 174 ? 92.450  26.928  29.217  1.00 4.16  ? 174 TYR C C   1 
ATOM   4607 O  O   . TYR C 1 174 ? 92.986  27.603  28.344  1.00 4.22  ? 174 TYR C O   1 
ATOM   4608 C  CB  . TYR C 1 174 ? 89.903  26.880  29.155  1.00 3.89  ? 174 TYR C CB  1 
ATOM   4609 C  CG  . TYR C 1 174 ? 89.561  27.781  28.010  1.00 3.76  ? 174 TYR C CG  1 
ATOM   4610 C  CD1 . TYR C 1 174 ? 88.979  27.270  26.852  1.00 3.90  ? 174 TYR C CD1 1 
ATOM   4611 C  CD2 . TYR C 1 174 ? 89.882  29.140  28.037  1.00 5.15  ? 174 TYR C CD2 1 
ATOM   4612 C  CE1 . TYR C 1 174 ? 88.693  28.098  25.774  1.00 3.35  ? 174 TYR C CE1 1 
ATOM   4613 C  CE2 . TYR C 1 174 ? 89.587  29.968  26.959  1.00 3.94  ? 174 TYR C CE2 1 
ATOM   4614 C  CZ  . TYR C 1 174 ? 89.012  29.446  25.835  1.00 4.34  ? 174 TYR C CZ  1 
ATOM   4615 O  OH  . TYR C 1 174 ? 88.736  30.290  24.781  1.00 4.29  ? 174 TYR C OH  1 
ATOM   4616 N  N   . LEU C 1 175 ? 92.923  26.834  30.451  1.00 3.94  ? 175 LEU C N   1 
ATOM   4617 C  CA  . LEU C 1 175 ? 94.077  27.652  30.879  1.00 4.76  ? 175 LEU C CA  1 
ATOM   4618 C  C   . LEU C 1 175 ? 95.298  27.467  29.985  1.00 5.16  ? 175 LEU C C   1 
ATOM   4619 O  O   . LEU C 1 175 ? 96.007  28.445  29.681  1.00 5.24  ? 175 LEU C O   1 
ATOM   4620 C  CB  . LEU C 1 175 ? 94.451  27.350  32.328  1.00 4.87  ? 175 LEU C CB  1 
ATOM   4621 C  CG  . LEU C 1 175 ? 93.416  27.772  33.365  1.00 4.85  ? 175 LEU C CG  1 
ATOM   4622 C  CD1 . LEU C 1 175 ? 93.789  27.327  34.771  1.00 4.89  ? 175 LEU C CD1 1 
ATOM   4623 C  CD2 . LEU C 1 175 ? 93.131  29.269  33.341  1.00 5.41  ? 175 LEU C CD2 1 
ATOM   4624 N  N   . LYS C 1 176 ? 95.548  26.220  29.591  1.00 4.89  ? 176 LYS C N   1 
ATOM   4625 C  CA  . LYS C 1 176 ? 96.703  25.872  28.757  1.00 4.58  ? 176 LYS C CA  1 
ATOM   4626 C  C   . LYS C 1 176 ? 96.415  25.717  27.253  1.00 4.65  ? 176 LYS C C   1 
ATOM   4627 O  O   . LYS C 1 176 ? 97.289  25.982  26.436  1.00 5.11  ? 176 LYS C O   1 
ATOM   4628 C  CB  . LYS C 1 176 ? 97.357  24.597  29.253  1.00 4.76  ? 176 LYS C CB  1 
ATOM   4629 C  CG  . LYS C 1 176 ? 98.415  24.062  28.319  1.00 5.45  ? 176 LYS C CG  1 
ATOM   4630 C  CD  . LYS C 1 176 ? 99.104  22.844  28.882  1.00 4.35  ? 176 LYS C CD  1 
ATOM   4631 C  CE  . LYS C 1 176 ? 100.126 22.319  27.899  1.00 5.65  ? 176 LYS C CE  1 
ATOM   4632 N  NZ  . LYS C 1 176 ? 100.926 21.211  28.444  1.00 5.65  ? 176 LYS C NZ  1 
ATOM   4633 N  N   . PHE C 1 177 ? 95.213  25.281  26.880  1.00 3.84  ? 177 PHE C N   1 
ATOM   4634 C  CA  . PHE C 1 177 ? 94.943  25.036  25.462  1.00 3.84  ? 177 PHE C CA  1 
ATOM   4635 C  C   . PHE C 1 177 ? 93.925  25.997  24.857  1.00 3.68  ? 177 PHE C C   1 
ATOM   4636 O  O   . PHE C 1 177 ? 93.723  26.011  23.632  1.00 4.05  ? 177 PHE C O   1 
ATOM   4637 C  CB  . PHE C 1 177 ? 94.465  23.584  25.258  1.00 3.92  ? 177 PHE C CB  1 
ATOM   4638 C  CG  . PHE C 1 177 ? 95.396  22.535  25.798  1.00 2.30  ? 177 PHE C CG  1 
ATOM   4639 C  CD1 . PHE C 1 177 ? 96.326  21.898  24.970  1.00 1.64  ? 177 PHE C CD1 1 
ATOM   4640 C  CD2 . PHE C 1 177 ? 95.307  22.137  27.120  1.00 2.25  ? 177 PHE C CD2 1 
ATOM   4641 C  CE1 . PHE C 1 177 ? 97.182  20.935  25.459  1.00 3.02  ? 177 PHE C CE1 1 
ATOM   4642 C  CE2 . PHE C 1 177 ? 96.152  21.144  27.629  1.00 2.77  ? 177 PHE C CE2 1 
ATOM   4643 C  CZ  . PHE C 1 177 ? 97.089  20.534  26.800  1.00 3.70  ? 177 PHE C CZ  1 
ATOM   4644 N  N   . GLN C 1 178 ? 93.271  26.790  25.701  1.00 3.73  ? 178 GLN C N   1 
ATOM   4645 C  CA  . GLN C 1 178 ? 92.158  27.618  25.253  1.00 4.24  ? 178 GLN C CA  1 
ATOM   4646 C  C   . GLN C 1 178 ? 91.186  26.802  24.385  1.00 4.66  ? 178 GLN C C   1 
ATOM   4647 O  O   . GLN C 1 178 ? 90.701  25.770  24.834  1.00 4.93  ? 178 GLN C O   1 
ATOM   4648 C  CB  . GLN C 1 178 ? 92.668  28.890  24.559  1.00 4.97  ? 178 GLN C CB  1 
ATOM   4649 C  CG  . GLN C 1 178 ? 93.438  29.819  25.540  1.00 5.25  ? 178 GLN C CG  1 
ATOM   4650 C  CD  . GLN C 1 178 ? 94.897  29.418  25.698  1.00 6.42  ? 178 GLN C CD  1 
ATOM   4651 O  OE1 . GLN C 1 178 ? 95.641  29.361  24.723  1.00 5.93  ? 178 GLN C OE1 1 
ATOM   4652 N  NE2 . GLN C 1 178 ? 95.313  29.145  26.923  1.00 7.97  ? 178 GLN C NE2 1 
ATOM   4653 N  N   . ASN C 1 179 ? 90.906  27.251  23.163  1.00 4.66  ? 179 ASN C N   1 
ATOM   4654 C  CA  . ASN C 1 179 ? 89.938  26.563  22.308  1.00 3.81  ? 179 ASN C CA  1 
ATOM   4655 C  C   . ASN C 1 179 ? 90.494  25.278  21.701  1.00 3.53  ? 179 ASN C C   1 
ATOM   4656 O  O   . ASN C 1 179 ? 89.779  24.560  21.018  1.00 1.95  ? 179 ASN C O   1 
ATOM   4657 C  CB  . ASN C 1 179 ? 89.531  27.476  21.165  1.00 4.51  ? 179 ASN C CB  1 
ATOM   4658 C  CG  . ASN C 1 179 ? 90.702  27.837  20.308  1.00 4.99  ? 179 ASN C CG  1 
ATOM   4659 O  OD1 . ASN C 1 179 ? 91.592  28.567  20.752  1.00 5.58  ? 179 ASN C OD1 1 
ATOM   4660 N  ND2 . ASN C 1 179 ? 90.758  27.285  19.100  1.00 7.27  ? 179 ASN C ND2 1 
ATOM   4661 N  N   . ARG C 1 180 ? 91.779  25.005  21.917  1.00 3.52  ? 180 ARG C N   1 
ATOM   4662 C  CA  . ARG C 1 180 ? 92.447  23.935  21.201  1.00 3.81  ? 180 ARG C CA  1 
ATOM   4663 C  C   . ARG C 1 180 ? 92.230  22.537  21.825  1.00 3.67  ? 180 ARG C C   1 
ATOM   4664 O  O   . ARG C 1 180 ? 93.190  21.800  22.141  1.00 3.12  ? 180 ARG C O   1 
ATOM   4665 C  CB  . ARG C 1 180 ? 93.932  24.277  21.008  1.00 4.32  ? 180 ARG C CB  1 
ATOM   4666 C  CG  . ARG C 1 180 ? 94.142  25.646  20.345  1.00 4.77  ? 180 ARG C CG  1 
ATOM   4667 C  CD  . ARG C 1 180 ? 95.630  25.963  20.110  1.00 6.00  ? 180 ARG C CD  1 
ATOM   4668 N  NE  . ARG C 1 180 ? 96.358  26.082  21.370  1.00 5.78  ? 180 ARG C NE  1 
ATOM   4669 C  CZ  . ARG C 1 180 ? 96.268  27.101  22.221  1.00 6.32  ? 180 ARG C CZ  1 
ATOM   4670 N  NH1 . ARG C 1 180 ? 95.452  28.132  21.995  1.00 6.88  ? 180 ARG C NH1 1 
ATOM   4671 N  NH2 . ARG C 1 180 ? 96.988  27.075  23.337  1.00 10.31 ? 180 ARG C NH2 1 
ATOM   4672 N  N   . ARG C 1 181 ? 90.957  22.155  21.965  1.00 3.42  ? 181 ARG C N   1 
ATOM   4673 C  CA  . ARG C 1 181 ? 90.623  20.831  22.509  1.00 3.45  ? 181 ARG C CA  1 
ATOM   4674 C  C   . ARG C 1 181 ? 91.357  19.650  21.848  1.00 3.62  ? 181 ARG C C   1 
ATOM   4675 O  O   . ARG C 1 181 ? 91.794  18.725  22.549  1.00 2.44  ? 181 ARG C O   1 
ATOM   4676 C  CB  . ARG C 1 181 ? 89.108  20.578  22.487  1.00 3.13  ? 181 ARG C CB  1 
ATOM   4677 C  CG  . ARG C 1 181 ? 88.723  19.451  23.431  1.00 3.22  ? 181 ARG C CG  1 
ATOM   4678 C  CD  . ARG C 1 181 ? 87.309  18.950  23.190  1.00 3.63  ? 181 ARG C CD  1 
ATOM   4679 N  NE  . ARG C 1 181 ? 86.288  19.893  23.613  1.00 1.51  ? 181 ARG C NE  1 
ATOM   4680 C  CZ  . ARG C 1 181 ? 84.973  19.674  23.518  1.00 1.46  ? 181 ARG C CZ  1 
ATOM   4681 N  NH1 . ARG C 1 181 ? 84.509  18.525  23.021  1.00 1.31  ? 181 ARG C NH1 1 
ATOM   4682 N  NH2 . ARG C 1 181 ? 84.110  20.588  23.932  1.00 2.79  ? 181 ARG C NH2 1 
ATOM   4683 N  N   . PRO C 1 182 ? 91.468  19.643  20.499  1.00 3.92  ? 182 PRO C N   1 
ATOM   4684 C  CA  . PRO C 1 182 ? 92.130  18.453  19.945  1.00 4.00  ? 182 PRO C CA  1 
ATOM   4685 C  C   . PRO C 1 182 ? 93.580  18.282  20.431  1.00 4.13  ? 182 PRO C C   1 
ATOM   4686 O  O   . PRO C 1 182 ? 94.078  17.155  20.519  1.00 3.66  ? 182 PRO C O   1 
ATOM   4687 C  CB  . PRO C 1 182 ? 92.070  18.675  18.426  1.00 3.97  ? 182 PRO C CB  1 
ATOM   4688 C  CG  . PRO C 1 182 ? 90.951  19.680  18.218  1.00 4.56  ? 182 PRO C CG  1 
ATOM   4689 C  CD  . PRO C 1 182 ? 90.932  20.536  19.461  1.00 4.25  ? 182 PRO C CD  1 
ATOM   4690 N  N   . ASP C 1 183 ? 94.245  19.388  20.747  1.00 4.24  ? 183 ASP C N   1 
ATOM   4691 C  CA  . ASP C 1 183 ? 95.604  19.315  21.265  1.00 4.62  ? 183 ASP C CA  1 
ATOM   4692 C  C   . ASP C 1 183 ? 95.604  18.684  22.636  1.00 4.32  ? 183 ASP C C   1 
ATOM   4693 O  O   . ASP C 1 183 ? 96.513  17.927  22.991  1.00 4.72  ? 183 ASP C O   1 
ATOM   4694 C  CB  . ASP C 1 183 ? 96.232  20.708  21.355  1.00 5.26  ? 183 ASP C CB  1 
ATOM   4695 C  CG  . ASP C 1 183 ? 96.623  21.249  20.001  1.00 6.54  ? 183 ASP C CG  1 
ATOM   4696 O  OD1 . ASP C 1 183 ? 96.624  20.469  19.042  1.00 6.61  ? 183 ASP C OD1 1 
ATOM   4697 O  OD2 . ASP C 1 183 ? 96.965  22.436  19.914  1.00 9.00  ? 183 ASP C OD2 1 
ATOM   4698 N  N   . TYR C 1 184 ? 94.571  19.003  23.408  1.00 4.14  ? 184 TYR C N   1 
ATOM   4699 C  CA  . TYR C 1 184 ? 94.449  18.505  24.770  1.00 3.81  ? 184 TYR C CA  1 
ATOM   4700 C  C   . TYR C 1 184 ? 94.170  17.012  24.733  1.00 3.68  ? 184 TYR C C   1 
ATOM   4701 O  O   . TYR C 1 184 ? 94.715  16.249  25.520  1.00 2.89  ? 184 TYR C O   1 
ATOM   4702 C  CB  . TYR C 1 184 ? 93.334  19.269  25.486  1.00 3.57  ? 184 TYR C CB  1 
ATOM   4703 C  CG  . TYR C 1 184 ? 92.715  18.626  26.723  1.00 3.91  ? 184 TYR C CG  1 
ATOM   4704 C  CD1 . TYR C 1 184 ? 93.423  18.545  27.912  1.00 3.71  ? 184 TYR C CD1 1 
ATOM   4705 C  CD2 . TYR C 1 184 ? 91.405  18.165  26.707  1.00 3.08  ? 184 TYR C CD2 1 
ATOM   4706 C  CE1 . TYR C 1 184 ? 92.867  17.986  29.041  1.00 5.26  ? 184 TYR C CE1 1 
ATOM   4707 C  CE2 . TYR C 1 184 ? 90.832  17.593  27.842  1.00 2.17  ? 184 TYR C CE2 1 
ATOM   4708 C  CZ  . TYR C 1 184 ? 91.573  17.509  28.994  1.00 2.53  ? 184 TYR C CZ  1 
ATOM   4709 O  OH  . TYR C 1 184 ? 91.032  16.981  30.126  1.00 2.72  ? 184 TYR C OH  1 
ATOM   4710 N  N   . ILE C 1 185 ? 93.330  16.616  23.779  1.00 3.29  ? 185 ILE C N   1 
ATOM   4711 C  CA  . ILE C 1 185 ? 93.007  15.222  23.558  1.00 3.74  ? 185 ILE C CA  1 
ATOM   4712 C  C   . ILE C 1 185 ? 94.255  14.408  23.184  1.00 3.74  ? 185 ILE C C   1 
ATOM   4713 O  O   . ILE C 1 185 ? 94.460  13.318  23.692  1.00 3.34  ? 185 ILE C O   1 
ATOM   4714 C  CB  . ILE C 1 185 ? 91.917  15.103  22.467  1.00 3.91  ? 185 ILE C CB  1 
ATOM   4715 C  CG1 . ILE C 1 185 ? 90.634  15.797  22.941  1.00 3.71  ? 185 ILE C CG1 1 
ATOM   4716 C  CG2 . ILE C 1 185 ? 91.652  13.678  22.179  1.00 4.62  ? 185 ILE C CG2 1 
ATOM   4717 C  CD1 . ILE C 1 185 ? 89.611  16.049  21.839  1.00 2.70  ? 185 ILE C CD1 1 
ATOM   4718 N  N   . LYS C 1 186 ? 95.104  14.938  22.312  1.00 4.32  ? 186 LYS C N   1 
ATOM   4719 C  CA  . LYS C 1 186 ? 96.341  14.238  22.008  1.00 5.54  ? 186 LYS C CA  1 
ATOM   4720 C  C   . LYS C 1 186 ? 97.269  14.089  23.218  1.00 5.14  ? 186 LYS C C   1 
ATOM   4721 O  O   . LYS C 1 186 ? 97.956  13.069  23.344  1.00 5.99  ? 186 LYS C O   1 
ATOM   4722 C  CB  . LYS C 1 186 ? 97.099  14.932  20.871  1.00 6.00  ? 186 LYS C CB  1 
ATOM   4723 C  CG  . LYS C 1 186 ? 96.317  15.056  19.589  1.00 8.06  ? 186 LYS C CG  1 
ATOM   4724 C  CD  . LYS C 1 186 ? 95.899  13.692  19.033  1.00 10.55 ? 186 LYS C CD  1 
ATOM   4725 C  CE  . LYS C 1 186 ? 97.056  12.691  18.990  1.00 11.77 ? 186 LYS C CE  1 
ATOM   4726 N  NZ  . LYS C 1 186 ? 96.863  11.553  18.022  1.00 12.96 ? 186 LYS C NZ  1 
ATOM   4727 N  N   . GLU C 1 187 ? 97.319  15.113  24.076  1.00 5.28  ? 187 GLU C N   1 
ATOM   4728 C  CA  . GLU C 1 187 ? 98.165  15.070  25.274  1.00 5.39  ? 187 GLU C CA  1 
ATOM   4729 C  C   . GLU C 1 187 ? 97.667  13.988  26.219  1.00 5.07  ? 187 GLU C C   1 
ATOM   4730 O  O   . GLU C 1 187 ? 98.447  13.378  26.951  1.00 5.46  ? 187 GLU C O   1 
ATOM   4731 C  CB  . GLU C 1 187 ? 98.187  16.424  26.004  1.00 5.85  ? 187 GLU C CB  1 
ATOM   4732 C  CG  . GLU C 1 187 ? 98.994  17.532  25.338  1.00 7.33  ? 187 GLU C CG  1 
ATOM   4733 C  CD  . GLU C 1 187 ? 100.481 17.268  25.295  1.00 10.30 ? 187 GLU C CD  1 
ATOM   4734 O  OE1 . GLU C 1 187 ? 101.167 17.927  24.473  1.00 13.89 ? 187 GLU C OE1 1 
ATOM   4735 O  OE2 . GLU C 1 187 ? 100.967 16.409  26.057  1.00 9.71  ? 187 GLU C OE2 1 
ATOM   4736 N  N   . PHE C 1 188 ? 96.356  13.772  26.217  1.00 4.09  ? 188 PHE C N   1 
ATOM   4737 C  CA  . PHE C 1 188 ? 95.765  12.716  27.045  1.00 4.48  ? 188 PHE C CA  1 
ATOM   4738 C  C   . PHE C 1 188 ? 96.450  11.371  26.808  1.00 4.74  ? 188 PHE C C   1 
ATOM   4739 O  O   . PHE C 1 188 ? 96.604  10.561  27.719  1.00 4.65  ? 188 PHE C O   1 
ATOM   4740 C  CB  . PHE C 1 188 ? 94.248  12.640  26.768  1.00 4.11  ? 188 PHE C CB  1 
ATOM   4741 C  CG  . PHE C 1 188 ? 93.529  11.555  27.520  1.00 3.66  ? 188 PHE C CG  1 
ATOM   4742 C  CD1 . PHE C 1 188 ? 93.554  11.515  28.908  1.00 4.60  ? 188 PHE C CD1 1 
ATOM   4743 C  CD2 . PHE C 1 188 ? 92.790  10.591  26.828  1.00 4.62  ? 188 PHE C CD2 1 
ATOM   4744 C  CE1 . PHE C 1 188 ? 92.880  10.516  29.603  1.00 4.61  ? 188 PHE C CE1 1 
ATOM   4745 C  CE2 . PHE C 1 188 ? 92.100  9.594   27.505  1.00 4.58  ? 188 PHE C CE2 1 
ATOM   4746 C  CZ  . PHE C 1 188 ? 92.134  9.557   28.904  1.00 4.56  ? 188 PHE C CZ  1 
ATOM   4747 N  N   . TRP C 1 189 ? 96.889  11.113  25.581  1.00 4.75  ? 189 TRP C N   1 
ATOM   4748 C  CA  . TRP C 1 189 ? 97.456  9.800   25.328  1.00 4.76  ? 189 TRP C CA  1 
ATOM   4749 C  C   . TRP C 1 189 ? 98.728  9.622   26.148  1.00 4.70  ? 189 TRP C C   1 
ATOM   4750 O  O   . TRP C 1 189 ? 99.090  8.508   26.484  1.00 4.59  ? 189 TRP C O   1 
ATOM   4751 C  CB  . TRP C 1 189 ? 97.729  9.601   23.842  1.00 4.74  ? 189 TRP C CB  1 
ATOM   4752 C  CG  . TRP C 1 189 ? 96.485  9.511   23.007  1.00 5.38  ? 189 TRP C CG  1 
ATOM   4753 C  CD1 . TRP C 1 189 ? 96.244  10.187  21.851  1.00 6.79  ? 189 TRP C CD1 1 
ATOM   4754 C  CD2 . TRP C 1 189 ? 95.330  8.684   23.241  1.00 5.41  ? 189 TRP C CD2 1 
ATOM   4755 N  NE1 . TRP C 1 189 ? 95.007  9.849   21.349  1.00 7.42  ? 189 TRP C NE1 1 
ATOM   4756 C  CE2 . TRP C 1 189 ? 94.422  8.932   22.184  1.00 6.03  ? 189 TRP C CE2 1 
ATOM   4757 C  CE3 . TRP C 1 189 ? 94.969  7.771   24.238  1.00 6.07  ? 189 TRP C CE3 1 
ATOM   4758 C  CZ2 . TRP C 1 189 ? 93.179  8.297   22.095  1.00 5.07  ? 189 TRP C CZ2 1 
ATOM   4759 C  CZ3 . TRP C 1 189 ? 93.732  7.132   24.144  1.00 6.74  ? 189 TRP C CZ3 1 
ATOM   4760 C  CH2 . TRP C 1 189 ? 92.853  7.405   23.083  1.00 5.30  ? 189 TRP C CH2 1 
ATOM   4761 N  N   . ASN C 1 190 ? 99.375  10.737  26.493  1.00 4.50  ? 190 ASN C N   1 
ATOM   4762 C  CA  . ASN C 1 190 ? 100.600 10.714  27.308  1.00 5.47  ? 190 ASN C CA  1 
ATOM   4763 C  C   . ASN C 1 190 ? 100.338 10.488  28.797  1.00 5.69  ? 190 ASN C C   1 
ATOM   4764 O  O   . ASN C 1 190 ? 101.245 10.141  29.561  1.00 5.22  ? 190 ASN C O   1 
ATOM   4765 C  CB  . ASN C 1 190 ? 101.380 12.011  27.110  1.00 5.39  ? 190 ASN C CB  1 
ATOM   4766 C  CG  . ASN C 1 190 ? 101.923 12.144  25.699  1.00 5.45  ? 190 ASN C CG  1 
ATOM   4767 O  OD1 . ASN C 1 190 ? 102.460 11.191  25.149  1.00 3.56  ? 190 ASN C OD1 1 
ATOM   4768 N  ND2 . ASN C 1 190 ? 101.740 13.304  25.100  1.00 6.77  ? 190 ASN C ND2 1 
ATOM   4769 N  N   . VAL C 1 191 ? 99.097  10.712  29.220  1.00 5.19  ? 191 VAL C N   1 
ATOM   4770 C  CA  . VAL C 1 191 ? 98.795  10.649  30.655  1.00 6.10  ? 191 VAL C CA  1 
ATOM   4771 C  C   . VAL C 1 191 ? 97.717  9.627   31.007  1.00 6.00  ? 191 VAL C C   1 
ATOM   4772 O  O   . VAL C 1 191 ? 97.479  9.344   32.182  1.00 6.75  ? 191 VAL C O   1 
ATOM   4773 C  CB  . VAL C 1 191 ? 98.452  12.046  31.283  1.00 5.73  ? 191 VAL C CB  1 
ATOM   4774 C  CG1 . VAL C 1 191 ? 99.719  12.944  31.407  1.00 6.11  ? 191 VAL C CG1 1 
ATOM   4775 C  CG2 . VAL C 1 191 ? 97.338  12.743  30.520  1.00 5.09  ? 191 VAL C CG2 1 
ATOM   4776 N  N   . VAL C 1 192 ? 97.083  9.029   30.007  1.00 5.59  ? 192 VAL C N   1 
ATOM   4777 C  CA  . VAL C 1 192 ? 96.072  8.026   30.343  1.00 5.63  ? 192 VAL C CA  1 
ATOM   4778 C  C   . VAL C 1 192 ? 96.746  6.849   31.060  1.00 5.76  ? 192 VAL C C   1 
ATOM   4779 O  O   . VAL C 1 192 ? 97.690  6.250   30.548  1.00 6.07  ? 192 VAL C O   1 
ATOM   4780 C  CB  . VAL C 1 192 ? 95.218  7.590   29.116  1.00 5.68  ? 192 VAL C CB  1 
ATOM   4781 C  CG1 . VAL C 1 192 ? 96.053  6.846   28.092  1.00 5.43  ? 192 VAL C CG1 1 
ATOM   4782 C  CG2 . VAL C 1 192 ? 94.019  6.755   29.563  1.00 5.81  ? 192 VAL C CG2 1 
ATOM   4783 N  N   . ASN C 1 193 ? 96.288  6.556   32.275  1.00 6.41  ? 193 ASN C N   1 
ATOM   4784 C  CA  . ASN C 1 193 ? 96.839  5.443   33.045  1.00 6.36  ? 193 ASN C CA  1 
ATOM   4785 C  C   . ASN C 1 193 ? 96.377  4.106   32.486  1.00 6.66  ? 193 ASN C C   1 
ATOM   4786 O  O   . ASN C 1 193 ? 95.264  3.675   32.773  1.00 5.88  ? 193 ASN C O   1 
ATOM   4787 C  CB  . ASN C 1 193 ? 96.382  5.548   34.503  1.00 6.42  ? 193 ASN C CB  1 
ATOM   4788 C  CG  . ASN C 1 193 ? 97.057  4.526   35.401  1.00 6.66  ? 193 ASN C CG  1 
ATOM   4789 O  OD1 . ASN C 1 193 ? 97.711  3.616   34.923  1.00 6.09  ? 193 ASN C OD1 1 
ATOM   4790 N  ND2 . ASN C 1 193 ? 96.884  4.675   36.716  1.00 5.59  ? 193 ASN C ND2 1 
ATOM   4791 N  N   . TRP C 1 194 ? 97.219  3.425   31.712  1.00 6.84  ? 194 TRP C N   1 
ATOM   4792 C  CA  . TRP C 1 194 ? 96.810  2.140   31.137  1.00 6.73  ? 194 TRP C CA  1 
ATOM   4793 C  C   . TRP C 1 194 ? 96.776  1.011   32.170  1.00 6.63  ? 194 TRP C C   1 
ATOM   4794 O  O   . TRP C 1 194 ? 96.065  0.017   31.980  1.00 6.75  ? 194 TRP C O   1 
ATOM   4795 C  CB  . TRP C 1 194 ? 97.675  1.750   29.923  1.00 6.97  ? 194 TRP C CB  1 
ATOM   4796 C  CG  . TRP C 1 194 ? 97.392  2.621   28.713  1.00 6.83  ? 194 TRP C CG  1 
ATOM   4797 C  CD1 . TRP C 1 194 ? 98.246  3.511   28.112  1.00 7.06  ? 194 TRP C CD1 1 
ATOM   4798 C  CD2 . TRP C 1 194 ? 96.159  2.707   27.999  1.00 6.97  ? 194 TRP C CD2 1 
ATOM   4799 N  NE1 . TRP C 1 194 ? 97.618  4.128   27.062  1.00 6.42  ? 194 TRP C NE1 1 
ATOM   4800 C  CE2 . TRP C 1 194 ? 96.336  3.652   26.970  1.00 7.35  ? 194 TRP C CE2 1 
ATOM   4801 C  CE3 . TRP C 1 194 ? 94.919  2.063   28.126  1.00 6.81  ? 194 TRP C CE3 1 
ATOM   4802 C  CZ2 . TRP C 1 194 ? 95.326  3.963   26.064  1.00 6.57  ? 194 TRP C CZ2 1 
ATOM   4803 C  CZ3 . TRP C 1 194 ? 93.919  2.368   27.230  1.00 6.70  ? 194 TRP C CZ3 1 
ATOM   4804 C  CH2 . TRP C 1 194 ? 94.126  3.318   26.208  1.00 7.79  ? 194 TRP C CH2 1 
ATOM   4805 N  N   . ASP C 1 195 ? 97.515  1.201   33.259  1.00 7.42  ? 195 ASP C N   1 
ATOM   4806 C  CA  . ASP C 1 195 ? 97.641  0.208   34.325  1.00 7.92  ? 195 ASP C CA  1 
ATOM   4807 C  C   . ASP C 1 195 ? 96.293  0.117   35.010  1.00 7.51  ? 195 ASP C C   1 
ATOM   4808 O  O   . ASP C 1 195 ? 95.786  -0.977  35.254  1.00 7.59  ? 195 ASP C O   1 
ATOM   4809 C  CB  . ASP C 1 195 ? 98.714  0.618   35.342  1.00 8.33  ? 195 ASP C CB  1 
ATOM   4810 C  CG  . ASP C 1 195 ? 100.126 0.535   34.778  1.00 9.72  ? 195 ASP C CG  1 
ATOM   4811 O  OD1 . ASP C 1 195 ? 100.291 -0.079  33.701  1.00 12.52 ? 195 ASP C OD1 1 
ATOM   4812 O  OD2 . ASP C 1 195 ? 101.064 1.087   35.411  1.00 10.96 ? 195 ASP C OD2 1 
ATOM   4813 N  N   . GLU C 1 196 ? 95.721  1.276   35.317  1.00 7.31  ? 196 GLU C N   1 
ATOM   4814 C  CA  . GLU C 1 196 ? 94.409  1.330   35.952  1.00 7.23  ? 196 GLU C CA  1 
ATOM   4815 C  C   . GLU C 1 196 ? 93.318  0.955   34.957  1.00 7.38  ? 196 GLU C C   1 
ATOM   4816 O  O   . GLU C 1 196 ? 92.374  0.255   35.289  1.00 7.79  ? 196 GLU C O   1 
ATOM   4817 C  CB  . GLU C 1 196 ? 94.138  2.702   36.589  1.00 7.65  ? 196 GLU C CB  1 
ATOM   4818 C  CG  . GLU C 1 196 ? 92.843  2.758   37.383  1.00 6.61  ? 196 GLU C CG  1 
ATOM   4819 C  CD  . GLU C 1 196 ? 92.832  1.838   38.627  1.00 8.11  ? 196 GLU C CD  1 
ATOM   4820 O  OE1 . GLU C 1 196 ? 93.900  1.391   39.096  1.00 8.53  ? 196 GLU C OE1 1 
ATOM   4821 O  OE2 . GLU C 1 196 ? 91.737  1.584   39.158  1.00 9.25  ? 196 GLU C OE2 1 
ATOM   4822 N  N   . ALA C 1 197 ? 93.449  1.397   33.717  1.00 7.34  ? 197 ALA C N   1 
ATOM   4823 C  CA  . ALA C 1 197 ? 92.483  0.966   32.729  1.00 6.94  ? 197 ALA C CA  1 
ATOM   4824 C  C   . ALA C 1 197 ? 92.504  -0.564  32.637  1.00 6.78  ? 197 ALA C C   1 
ATOM   4825 O  O   . ALA C 1 197 ? 91.455  -1.193  32.551  1.00 6.89  ? 197 ALA C O   1 
ATOM   4826 C  CB  . ALA C 1 197 ? 92.760  1.607   31.393  1.00 7.10  ? 197 ALA C CB  1 
ATOM   4827 N  N   . ALA C 1 198 ? 93.700  -1.149  32.702  1.00 7.04  ? 198 ALA C N   1 
ATOM   4828 C  CA  . ALA C 1 198 ? 93.868  -2.600  32.635  1.00 6.47  ? 198 ALA C CA  1 
ATOM   4829 C  C   . ALA C 1 198 ? 93.235  -3.325  33.829  1.00 6.87  ? 198 ALA C C   1 
ATOM   4830 O  O   . ALA C 1 198 ? 92.605  -4.373  33.647  1.00 7.08  ? 198 ALA C O   1 
ATOM   4831 C  CB  . ALA C 1 198 ? 95.360  -2.972  32.473  1.00 6.38  ? 198 ALA C CB  1 
ATOM   4832 N  N   . ALA C 1 199 ? 93.370  -2.735  35.018  1.00 6.94  ? 199 ALA C N   1 
ATOM   4833 C  CA  . ALA C 1 199 ? 92.806  -3.285  36.255  1.00 7.45  ? 199 ALA C CA  1 
ATOM   4834 C  C   . ALA C 1 199 ? 91.290  -3.298  36.184  1.00 7.66  ? 199 ALA C C   1 
ATOM   4835 O  O   . ALA C 1 199 ? 90.637  -4.305  36.490  1.00 8.40  ? 199 ALA C O   1 
ATOM   4836 C  CB  . ALA C 1 199 ? 93.270  -2.474  37.462  1.00 7.69  ? 199 ALA C CB  1 
ATOM   4837 N  N   . ARG C 1 200 ? 90.730  -2.173  35.757  1.00 7.21  ? 200 ARG C N   1 
ATOM   4838 C  CA  . ARG C 1 200 ? 89.287  -2.064  35.563  1.00 7.10  ? 200 ARG C CA  1 
ATOM   4839 C  C   . ARG C 1 200 ? 88.759  -3.051  34.496  1.00 7.71  ? 200 ARG C C   1 
ATOM   4840 O  O   . ARG C 1 200 ? 87.706  -3.674  34.688  1.00 8.22  ? 200 ARG C O   1 
ATOM   4841 C  CB  . ARG C 1 200 ? 88.890  -0.622  35.212  1.00 6.97  ? 200 ARG C CB  1 
ATOM   4842 C  CG  . ARG C 1 200 ? 89.216  0.433   36.274  1.00 5.98  ? 200 ARG C CG  1 
ATOM   4843 C  CD  . ARG C 1 200 ? 88.730  1.823   35.850  1.00 7.73  ? 200 ARG C CD  1 
ATOM   4844 N  NE  . ARG C 1 200 ? 87.292  1.852   35.655  1.00 9.74  ? 200 ARG C NE  1 
ATOM   4845 C  CZ  . ARG C 1 200 ? 86.417  2.111   36.618  1.00 10.20 ? 200 ARG C CZ  1 
ATOM   4846 N  NH1 . ARG C 1 200 ? 86.844  2.386   37.851  1.00 8.11  ? 200 ARG C NH1 1 
ATOM   4847 N  NH2 . ARG C 1 200 ? 85.116  2.110   36.344  1.00 9.75  ? 200 ARG C NH2 1 
ATOM   4848 N  N   . PHE C 1 201 ? 89.470  -3.188  33.373  1.00 8.16  ? 201 PHE C N   1 
ATOM   4849 C  CA  . PHE C 1 201 ? 89.047  -4.104  32.317  1.00 8.64  ? 201 PHE C CA  1 
ATOM   4850 C  C   . PHE C 1 201 ? 89.066  -5.555  32.799  1.00 8.58  ? 201 PHE C C   1 
ATOM   4851 O  O   . PHE C 1 201 ? 88.324  -6.405  32.281  1.00 9.48  ? 201 PHE C O   1 
ATOM   4852 C  CB  . PHE C 1 201 ? 89.924  -3.978  31.058  1.00 8.65  ? 201 PHE C CB  1 
ATOM   4853 C  CG  . PHE C 1 201 ? 89.547  -4.953  29.957  1.00 8.76  ? 201 PHE C CG  1 
ATOM   4854 C  CD1 . PHE C 1 201 ? 88.415  -4.743  29.183  1.00 9.06  ? 201 PHE C CD1 1 
ATOM   4855 C  CD2 . PHE C 1 201 ? 90.334  -6.067  29.693  1.00 7.61  ? 201 PHE C CD2 1 
ATOM   4856 C  CE1 . PHE C 1 201 ? 88.061  -5.625  28.171  1.00 9.44  ? 201 PHE C CE1 1 
ATOM   4857 C  CE2 . PHE C 1 201 ? 89.983  -6.955  28.697  1.00 8.03  ? 201 PHE C CE2 1 
ATOM   4858 C  CZ  . PHE C 1 201 ? 88.842  -6.736  27.930  1.00 8.07  ? 201 PHE C CZ  1 
ATOM   4859 N  N   . ALA C 1 202 ? 89.920  -5.825  33.783  1.00 9.29  ? 202 ALA C N   1 
ATOM   4860 C  CA  . ALA C 1 202 ? 90.086  -7.176  34.334  1.00 9.86  ? 202 ALA C CA  1 
ATOM   4861 C  C   . ALA C 1 202 ? 88.923  -7.531  35.253  1.00 10.35 ? 202 ALA C C   1 
ATOM   4862 O  O   . ALA C 1 202 ? 88.343  -8.620  35.149  1.00 11.35 ? 202 ALA C O   1 
ATOM   4863 C  CB  . ALA C 1 202 ? 91.408  -7.298  35.075  1.00 9.93  ? 202 ALA C CB  1 
ATOM   4864 N  N   . ALA C 1 203 ? 88.588  -6.599  36.142  1.00 10.47 ? 203 ALA C N   1 
ATOM   4865 C  CA  . ALA C 1 203 ? 87.448  -6.735  37.060  1.00 10.29 ? 203 ALA C CA  1 
ATOM   4866 C  C   . ALA C 1 203 ? 86.103  -6.752  36.326  1.00 10.64 ? 203 ALA C C   1 
ATOM   4867 O  O   . ALA C 1 203 ? 85.267  -7.625  36.577  1.00 11.09 ? 203 ALA C O   1 
ATOM   4868 C  CB  . ALA C 1 203 ? 87.469  -5.617  38.073  1.00 10.41 ? 203 ALA C CB  1 
ATOM   4869 N  N   . LYS C 1 204 ? 85.904  -5.764  35.445  1.00 10.92 ? 204 LYS C N   1 
ATOM   4870 C  CA  . LYS C 1 204 ? 84.680  -5.600  34.656  1.00 11.02 ? 204 LYS C CA  1 
ATOM   4871 C  C   . LYS C 1 204 ? 83.517  -5.178  35.556  1.00 11.35 ? 204 LYS C C   1 
ATOM   4872 O  O   . LYS C 1 204 ? 82.345  -5.200  35.177  1.00 11.93 ? 204 LYS C O   1 
ATOM   4873 C  CB  . LYS C 1 204 ? 84.383  -6.872  33.859  1.00 10.52 ? 204 LYS C CB  1 
ATOM   4874 C  CG  . LYS C 1 204 ? 85.600  -7.328  33.045  1.00 11.64 ? 204 LYS C CG  1 
ATOM   4875 C  CD  . LYS C 1 204 ? 85.278  -8.412  32.036  1.00 12.34 ? 204 LYS C CD  1 
ATOM   4876 C  CE  . LYS C 1 204 ? 86.550  -9.137  31.590  1.00 11.24 ? 204 LYS C CE  1 
ATOM   4877 N  NZ  . LYS C 1 204 ? 87.249  -8.496  30.442  1.00 13.08 ? 204 LYS C NZ  1 
ATOM   4878 N  N   . LYS C 1 205 ? 83.894  -4.760  36.752  1.00 12.26 ? 205 LYS C N   1 
ATOM   4879 C  CA  . LYS C 1 205 ? 82.972  -4.296  37.770  1.00 12.43 ? 205 LYS C CA  1 
ATOM   4880 C  C   . LYS C 1 205 ? 83.684  -3.236  38.608  1.00 12.63 ? 205 LYS C C   1 
ATOM   4881 O  O   . LYS C 1 205 ? 84.884  -3.303  38.923  1.00 13.20 ? 205 LYS C O   1 
ATOM   4882 C  CB  . LYS C 1 205 ? 82.499  -5.481  38.635  1.00 13.00 ? 205 LYS C CB  1 
ATOM   4883 C  CG  . LYS C 1 205 ? 81.634  -6.480  37.853  1.00 13.33 ? 205 LYS C CG  1 
ATOM   4884 C  CD  . LYS C 1 205 ? 81.079  -7.614  38.708  1.00 14.04 ? 205 LYS C CD  1 
ATOM   4885 C  CE  . LYS C 1 205 ? 81.875  -8.896  38.464  1.00 14.06 ? 205 LYS C CE  1 
ATOM   4886 N  NZ  . LYS C 1 205 ? 81.440  -10.042 39.332  1.00 16.26 ? 205 LYS C NZ  1 
ATOM   4887 O  OXT . LYS C 1 205 ? 83.071  -2.248  38.984  1.00 13.35 ? 205 LYS C OXT 1 
ATOM   4888 N  N   . SER D 1 1   ? 75.660  31.997  2.759   1.00 8.12  ? 1   SER D N   1 
ATOM   4889 C  CA  . SER D 1 1   ? 77.000  32.261  3.376   1.00 7.88  ? 1   SER D CA  1 
ATOM   4890 C  C   . SER D 1 1   ? 76.961  33.242  4.546   1.00 7.26  ? 1   SER D C   1 
ATOM   4891 O  O   . SER D 1 1   ? 76.505  34.389  4.405   1.00 7.49  ? 1   SER D O   1 
ATOM   4892 C  CB  . SER D 1 1   ? 77.929  32.803  2.312   1.00 8.14  ? 1   SER D CB  1 
ATOM   4893 O  OG  . SER D 1 1   ? 79.237  32.937  2.812   1.00 8.22  ? 1   SER D OG  1 
ATOM   4894 N  N   . TYR D 1 2   ? 77.443  32.809  5.708   1.00 5.92  ? 2   TYR D N   1 
ATOM   4895 C  CA  . TYR D 1 2   ? 77.549  33.714  6.845   1.00 4.94  ? 2   TYR D CA  1 
ATOM   4896 C  C   . TYR D 1 2   ? 78.914  34.384  6.894   1.00 4.35  ? 2   TYR D C   1 
ATOM   4897 O  O   . TYR D 1 2   ? 79.917  33.719  6.693   1.00 4.23  ? 2   TYR D O   1 
ATOM   4898 C  CB  . TYR D 1 2   ? 77.384  32.936  8.145   1.00 5.60  ? 2   TYR D CB  1 
ATOM   4899 C  CG  . TYR D 1 2   ? 76.030  32.324  8.346   1.00 5.43  ? 2   TYR D CG  1 
ATOM   4900 C  CD1 . TYR D 1 2   ? 74.881  32.958  7.893   1.00 5.84  ? 2   TYR D CD1 1 
ATOM   4901 C  CD2 . TYR D 1 2   ? 75.894  31.109  9.024   1.00 5.91  ? 2   TYR D CD2 1 
ATOM   4902 C  CE1 . TYR D 1 2   ? 73.629  32.381  8.098   1.00 6.11  ? 2   TYR D CE1 1 
ATOM   4903 C  CE2 . TYR D 1 2   ? 74.650  30.540  9.241   1.00 5.32  ? 2   TYR D CE2 1 
ATOM   4904 C  CZ  . TYR D 1 2   ? 73.523  31.177  8.775   1.00 5.11  ? 2   TYR D CZ  1 
ATOM   4905 O  OH  . TYR D 1 2   ? 72.277  30.604  8.993   1.00 5.32  ? 2   TYR D OH  1 
ATOM   4906 N  N   . THR D 1 3   ? 78.943  35.678  7.211   1.00 3.79  ? 3   THR D N   1 
ATOM   4907 C  CA  . THR D 1 3   ? 80.186  36.396  7.442   1.00 3.27  ? 3   THR D CA  1 
ATOM   4908 C  C   . THR D 1 3   ? 80.387  36.617  8.943   1.00 4.08  ? 3   THR D C   1 
ATOM   4909 O  O   . THR D 1 3   ? 79.467  37.016  9.653   1.00 3.26  ? 3   THR D O   1 
ATOM   4910 C  CB  . THR D 1 3   ? 80.169  37.775  6.724   1.00 4.08  ? 3   THR D CB  1 
ATOM   4911 O  OG1 . THR D 1 3   ? 80.100  37.569  5.313   1.00 2.53  ? 3   THR D OG1 1 
ATOM   4912 C  CG2 . THR D 1 3   ? 81.410  38.598  7.037   1.00 3.22  ? 3   THR D CG2 1 
ATOM   4913 N  N   . LEU D 1 4   ? 81.585  36.339  9.426   1.00 3.15  ? 4   LEU D N   1 
ATOM   4914 C  CA  . LEU D 1 4   ? 81.929  36.636  10.817  1.00 3.87  ? 4   LEU D CA  1 
ATOM   4915 C  C   . LEU D 1 4   ? 81.930  38.135  10.977  1.00 3.85  ? 4   LEU D C   1 
ATOM   4916 O  O   . LEU D 1 4   ? 82.705  38.841  10.314  1.00 2.95  ? 4   LEU D O   1 
ATOM   4917 C  CB  . LEU D 1 4   ? 83.303  36.071  11.132  1.00 2.91  ? 4   LEU D CB  1 
ATOM   4918 C  CG  . LEU D 1 4   ? 83.861  36.339  12.537  1.00 4.48  ? 4   LEU D CG  1 
ATOM   4919 C  CD1 . LEU D 1 4   ? 83.214  35.433  13.596  1.00 3.62  ? 4   LEU D CD1 1 
ATOM   4920 C  CD2 . LEU D 1 4   ? 85.374  36.168  12.544  1.00 3.24  ? 4   LEU D CD2 1 
ATOM   4921 N  N   . PRO D 1 5   ? 81.040  38.659  11.823  1.00 4.94  ? 5   PRO D N   1 
ATOM   4922 C  CA  . PRO D 1 5   ? 81.060  40.092  11.928  1.00 4.63  ? 5   PRO D CA  1 
ATOM   4923 C  C   . PRO D 1 5   ? 82.279  40.518  12.716  1.00 5.30  ? 5   PRO D C   1 
ATOM   4924 O  O   . PRO D 1 5   ? 82.708  39.794  13.592  1.00 5.62  ? 5   PRO D O   1 
ATOM   4925 C  CB  . PRO D 1 5   ? 79.795  40.401  12.748  1.00 4.62  ? 5   PRO D CB  1 
ATOM   4926 C  CG  . PRO D 1 5   ? 79.608  39.172  13.606  1.00 4.61  ? 5   PRO D CG  1 
ATOM   4927 C  CD  . PRO D 1 5   ? 80.008  38.035  12.681  1.00 4.04  ? 5   PRO D CD  1 
ATOM   4928 N  N   . SER D 1 6   ? 82.819  41.697  12.428  1.00 5.28  ? 6   SER D N   1 
ATOM   4929 C  CA  . SER D 1 6   ? 83.805  42.277  13.301  1.00 6.12  ? 6   SER D CA  1 
ATOM   4930 C  C   . SER D 1 6   ? 83.171  42.747  14.609  1.00 5.87  ? 6   SER D C   1 
ATOM   4931 O  O   . SER D 1 6   ? 81.983  43.077  14.660  1.00 5.96  ? 6   SER D O   1 
ATOM   4932 C  CB  . SER D 1 6   ? 84.466  43.452  12.603  1.00 7.13  ? 6   SER D CB  1 
ATOM   4933 O  OG  . SER D 1 6   ? 84.891  43.042  11.329  1.00 9.36  ? 6   SER D OG  1 
ATOM   4934 N  N   . LEU D 1 7   ? 83.979  42.783  15.658  1.00 5.46  ? 7   LEU D N   1 
ATOM   4935 C  CA  . LEU D 1 7   ? 83.543  43.353  16.912  1.00 6.05  ? 7   LEU D CA  1 
ATOM   4936 C  C   . LEU D 1 7   ? 83.198  44.818  16.718  1.00 5.88  ? 7   LEU D C   1 
ATOM   4937 O  O   . LEU D 1 7   ? 83.751  45.483  15.837  1.00 6.64  ? 7   LEU D O   1 
ATOM   4938 C  CB  . LEU D 1 7   ? 84.613  43.214  17.989  1.00 6.92  ? 7   LEU D CB  1 
ATOM   4939 C  CG  . LEU D 1 7   ? 84.831  41.789  18.485  1.00 7.04  ? 7   LEU D CG  1 
ATOM   4940 C  CD1 . LEU D 1 7   ? 85.848  41.698  19.644  1.00 7.56  ? 7   LEU D CD1 1 
ATOM   4941 C  CD2 . LEU D 1 7   ? 83.483  41.218  18.924  1.00 4.93  ? 7   LEU D CD2 1 
ATOM   4942 N  N   . PRO D 1 8   ? 82.288  45.331  17.550  1.00 5.85  ? 8   PRO D N   1 
ATOM   4943 C  CA  . PRO D 1 8   ? 81.932  46.735  17.558  1.00 5.99  ? 8   PRO D CA  1 
ATOM   4944 C  C   . PRO D 1 8   ? 82.927  47.581  18.349  1.00 6.20  ? 8   PRO D C   1 
ATOM   4945 O  O   . PRO D 1 8   ? 82.653  48.748  18.606  1.00 7.36  ? 8   PRO D O   1 
ATOM   4946 C  CB  . PRO D 1 8   ? 80.545  46.750  18.240  1.00 5.96  ? 8   PRO D CB  1 
ATOM   4947 C  CG  . PRO D 1 8   ? 80.171  45.294  18.452  1.00 5.86  ? 8   PRO D CG  1 
ATOM   4948 C  CD  . PRO D 1 8   ? 81.463  44.554  18.486  1.00 5.70  ? 8   PRO D CD  1 
ATOM   4949 N  N   . TYR D 1 9   ? 84.078  47.009  18.703  1.00 6.36  ? 9   TYR D N   1 
ATOM   4950 C  CA  . TYR D 1 9   ? 85.088  47.718  19.490  1.00 6.57  ? 9   TYR D CA  1 
ATOM   4951 C  C   . TYR D 1 9   ? 86.416  46.974  19.440  1.00 6.63  ? 9   TYR D C   1 
ATOM   4952 O  O   . TYR D 1 9   ? 86.498  45.837  18.938  1.00 7.66  ? 9   TYR D O   1 
ATOM   4953 C  CB  . TYR D 1 9   ? 84.633  47.855  20.953  1.00 6.78  ? 9   TYR D CB  1 
ATOM   4954 C  CG  . TYR D 1 9   ? 83.771  46.686  21.400  1.00 5.99  ? 9   TYR D CG  1 
ATOM   4955 C  CD1 . TYR D 1 9   ? 84.315  45.420  21.558  1.00 7.19  ? 9   TYR D CD1 1 
ATOM   4956 C  CD2 . TYR D 1 9   ? 82.404  46.842  21.622  1.00 7.82  ? 9   TYR D CD2 1 
ATOM   4957 C  CE1 . TYR D 1 9   ? 83.520  44.326  21.940  1.00 9.16  ? 9   TYR D CE1 1 
ATOM   4958 C  CE2 . TYR D 1 9   ? 81.603  45.758  22.013  1.00 7.67  ? 9   TYR D CE2 1 
ATOM   4959 C  CZ  . TYR D 1 9   ? 82.178  44.501  22.159  1.00 8.57  ? 9   TYR D CZ  1 
ATOM   4960 O  OH  . TYR D 1 9   ? 81.403  43.411  22.531  1.00 10.77 ? 9   TYR D OH  1 
ATOM   4961 N  N   . ALA D 1 10  ? 87.462  47.625  19.942  1.00 6.45  ? 10  ALA D N   1 
ATOM   4962 C  CA  . ALA D 1 10  ? 88.749  46.997  20.146  1.00 6.32  ? 10  ALA D CA  1 
ATOM   4963 C  C   . ALA D 1 10  ? 88.576  45.936  21.215  1.00 6.15  ? 10  ALA D C   1 
ATOM   4964 O  O   . ALA D 1 10  ? 87.659  46.020  22.033  1.00 6.96  ? 10  ALA D O   1 
ATOM   4965 C  CB  . ALA D 1 10  ? 89.783  48.017  20.592  1.00 6.52  ? 10  ALA D CB  1 
ATOM   4966 N  N   . TYR D 1 11  ? 89.477  44.972  21.209  1.00 6.34  ? 11  TYR D N   1 
ATOM   4967 C  CA  . TYR D 1 11  ? 89.451  43.862  22.150  1.00 6.31  ? 11  TYR D CA  1 
ATOM   4968 C  C   . TYR D 1 11  ? 89.533  44.307  23.608  1.00 6.36  ? 11  TYR D C   1 
ATOM   4969 O  O   . TYR D 1 11  ? 89.173  43.546  24.497  1.00 5.96  ? 11  TYR D O   1 
ATOM   4970 C  CB  . TYR D 1 11  ? 90.610  42.899  21.878  1.00 6.51  ? 11  TYR D CB  1 
ATOM   4971 C  CG  . TYR D 1 11  ? 90.615  42.234  20.515  1.00 7.47  ? 11  TYR D CG  1 
ATOM   4972 C  CD1 . TYR D 1 11  ? 89.467  41.664  19.978  1.00 6.63  ? 11  TYR D CD1 1 
ATOM   4973 C  CD2 . TYR D 1 11  ? 91.801  42.149  19.774  1.00 6.88  ? 11  TYR D CD2 1 
ATOM   4974 C  CE1 . TYR D 1 11  ? 89.505  41.039  18.724  1.00 8.26  ? 11  TYR D CE1 1 
ATOM   4975 C  CE2 . TYR D 1 11  ? 91.844  41.544  18.550  1.00 6.20  ? 11  TYR D CE2 1 
ATOM   4976 C  CZ  . TYR D 1 11  ? 90.704  40.983  18.024  1.00 8.44  ? 11  TYR D CZ  1 
ATOM   4977 O  OH  . TYR D 1 11  ? 90.782  40.370  16.795  1.00 10.70 ? 11  TYR D OH  1 
ATOM   4978 N  N   . ASP D 1 12  ? 90.038  45.512  23.869  1.00 7.07  ? 12  ASP D N   1 
ATOM   4979 C  CA  . ASP D 1 12  ? 90.173  45.988  25.259  1.00 7.54  ? 12  ASP D CA  1 
ATOM   4980 C  C   . ASP D 1 12  ? 89.108  47.016  25.655  1.00 6.89  ? 12  ASP D C   1 
ATOM   4981 O  O   . ASP D 1 12  ? 89.244  47.670  26.700  1.00 7.64  ? 12  ASP D O   1 
ATOM   4982 C  CB  . ASP D 1 12  ? 91.579  46.562  25.520  1.00 8.07  ? 12  ASP D CB  1 
ATOM   4983 C  CG  . ASP D 1 12  ? 91.859  47.830  24.728  1.00 9.80  ? 12  ASP D CG  1 
ATOM   4984 O  OD1 . ASP D 1 12  ? 92.902  48.495  24.998  1.00 11.94 ? 12  ASP D OD1 1 
ATOM   4985 O  OD2 . ASP D 1 12  ? 91.044  48.158  23.839  1.00 8.89  ? 12  ASP D OD2 1 
ATOM   4986 N  N   . ALA D 1 13  ? 88.062  47.154  24.838  1.00 6.36  ? 13  ALA D N   1 
ATOM   4987 C  CA  . ALA D 1 13  ? 87.041  48.192  25.028  1.00 5.47  ? 13  ALA D CA  1 
ATOM   4988 C  C   . ALA D 1 13  ? 86.098  47.888  26.178  1.00 5.63  ? 13  ALA D C   1 
ATOM   4989 O  O   . ALA D 1 13  ? 85.280  48.745  26.557  1.00 4.39  ? 13  ALA D O   1 
ATOM   4990 C  CB  . ALA D 1 13  ? 86.235  48.396  23.746  1.00 4.97  ? 13  ALA D CB  1 
ATOM   4991 N  N   . LEU D 1 14  ? 86.205  46.663  26.703  1.00 5.29  ? 14  LEU D N   1 
ATOM   4992 C  CA  . LEU D 1 14  ? 85.391  46.209  27.832  1.00 6.22  ? 14  LEU D CA  1 
ATOM   4993 C  C   . LEU D 1 14  ? 86.174  46.075  29.164  1.00 6.84  ? 14  LEU D C   1 
ATOM   4994 O  O   . LEU D 1 14  ? 85.593  45.712  30.209  1.00 7.73  ? 14  LEU D O   1 
ATOM   4995 C  CB  . LEU D 1 14  ? 84.671  44.896  27.476  1.00 5.34  ? 14  LEU D CB  1 
ATOM   4996 C  CG  . LEU D 1 14  ? 83.706  44.987  26.284  1.00 5.48  ? 14  LEU D CG  1 
ATOM   4997 C  CD1 . LEU D 1 14  ? 82.953  43.651  26.014  1.00 3.43  ? 14  LEU D CD1 1 
ATOM   4998 C  CD2 . LEU D 1 14  ? 82.695  46.088  26.441  1.00 6.05  ? 14  LEU D CD2 1 
ATOM   4999 N  N   . GLU D 1 15  ? 87.472  46.378  29.138  1.00 7.16  ? 15  GLU D N   1 
ATOM   5000 C  CA  . GLU D 1 15  ? 88.307  46.378  30.359  1.00 7.04  ? 15  GLU D CA  1 
ATOM   5001 C  C   . GLU D 1 15  ? 87.850  47.541  31.238  1.00 6.99  ? 15  GLU D C   1 
ATOM   5002 O  O   . GLU D 1 15  ? 87.381  48.530  30.717  1.00 7.47  ? 15  GLU D O   1 
ATOM   5003 C  CB  . GLU D 1 15  ? 89.774  46.617  29.997  1.00 6.34  ? 15  GLU D CB  1 
ATOM   5004 C  CG  . GLU D 1 15  ? 90.438  45.521  29.236  1.00 8.22  ? 15  GLU D CG  1 
ATOM   5005 C  CD  . GLU D 1 15  ? 90.912  44.428  30.164  1.00 10.02 ? 15  GLU D CD  1 
ATOM   5006 O  OE1 . GLU D 1 15  ? 90.678  44.577  31.384  1.00 11.54 ? 15  GLU D OE1 1 
ATOM   5007 O  OE2 . GLU D 1 15  ? 91.528  43.447  29.700  1.00 10.05 ? 15  GLU D OE2 1 
ATOM   5008 N  N   . PRO D 1 16  ? 88.018  47.442  32.567  1.00 7.34  ? 16  PRO D N   1 
ATOM   5009 C  CA  . PRO D 1 16  ? 88.665  46.376  33.312  1.00 7.29  ? 16  PRO D CA  1 
ATOM   5010 C  C   . PRO D 1 16  ? 87.739  45.214  33.636  1.00 7.45  ? 16  PRO D C   1 
ATOM   5011 O  O   . PRO D 1 16  ? 88.089  44.412  34.481  1.00 8.86  ? 16  PRO D O   1 
ATOM   5012 C  CB  . PRO D 1 16  ? 89.079  47.067  34.617  1.00 6.99  ? 16  PRO D CB  1 
ATOM   5013 C  CG  . PRO D 1 16  ? 88.071  48.154  34.799  1.00 7.68  ? 16  PRO D CG  1 
ATOM   5014 C  CD  . PRO D 1 16  ? 87.683  48.596  33.420  1.00 6.82  ? 16  PRO D CD  1 
ATOM   5015 N  N   . HIS D 1 17  ? 86.600  45.108  32.949  1.00 7.86  ? 17  HIS D N   1 
ATOM   5016 C  CA  . HIS D 1 17  ? 85.544  44.148  33.333  1.00 7.25  ? 17  HIS D CA  1 
ATOM   5017 C  C   . HIS D 1 17  ? 85.657  42.766  32.660  1.00 7.39  ? 17  HIS D C   1 
ATOM   5018 O  O   . HIS D 1 17  ? 85.777  41.757  33.349  1.00 7.31  ? 17  HIS D O   1 
ATOM   5019 C  CB  . HIS D 1 17  ? 84.157  44.743  33.097  1.00 7.65  ? 17  HIS D CB  1 
ATOM   5020 C  CG  . HIS D 1 17  ? 83.993  46.135  33.632  1.00 8.46  ? 17  HIS D CG  1 
ATOM   5021 N  ND1 . HIS D 1 17  ? 83.901  46.404  34.981  1.00 8.80  ? 17  HIS D ND1 1 
ATOM   5022 C  CD2 . HIS D 1 17  ? 83.886  47.330  33.001  1.00 7.14  ? 17  HIS D CD2 1 
ATOM   5023 C  CE1 . HIS D 1 17  ? 83.742  47.704  35.160  1.00 9.02  ? 17  HIS D CE1 1 
ATOM   5024 N  NE2 . HIS D 1 17  ? 83.732  48.290  33.977  1.00 9.62  ? 17  HIS D NE2 1 
ATOM   5025 N  N   . PHE D 1 18  ? 85.597  42.720  31.329  1.00 6.85  ? 18  PHE D N   1 
ATOM   5026 C  CA  . PHE D 1 18  ? 85.917  41.487  30.614  1.00 6.51  ? 18  PHE D CA  1 
ATOM   5027 C  C   . PHE D 1 18  ? 87.320  41.684  30.032  1.00 6.82  ? 18  PHE D C   1 
ATOM   5028 O  O   . PHE D 1 18  ? 87.632  42.787  29.533  1.00 7.72  ? 18  PHE D O   1 
ATOM   5029 C  CB  . PHE D 1 18  ? 84.932  41.208  29.472  1.00 6.31  ? 18  PHE D CB  1 
ATOM   5030 C  CG  . PHE D 1 18  ? 83.538  40.760  29.907  1.00 6.04  ? 18  PHE D CG  1 
ATOM   5031 C  CD1 . PHE D 1 18  ? 83.249  40.436  31.230  1.00 7.89  ? 18  PHE D CD1 1 
ATOM   5032 C  CD2 . PHE D 1 18  ? 82.527  40.645  28.967  1.00 5.18  ? 18  PHE D CD2 1 
ATOM   5033 C  CE1 . PHE D 1 18  ? 81.972  40.019  31.599  1.00 7.01  ? 18  PHE D CE1 1 
ATOM   5034 C  CE2 . PHE D 1 18  ? 81.249  40.225  29.330  1.00 5.72  ? 18  PHE D CE2 1 
ATOM   5035 C  CZ  . PHE D 1 18  ? 80.968  39.917  30.650  1.00 8.09  ? 18  PHE D CZ  1 
ATOM   5036 N  N   . ASP D 1 19  ? 88.157  40.646  30.112  1.00 6.75  ? 19  ASP D N   1 
ATOM   5037 C  CA  . ASP D 1 19  ? 89.571  40.695  29.683  1.00 6.37  ? 19  ASP D CA  1 
ATOM   5038 C  C   . ASP D 1 19  ? 89.780  40.649  28.170  1.00 6.07  ? 19  ASP D C   1 
ATOM   5039 O  O   . ASP D 1 19  ? 89.111  39.905  27.460  1.00 5.56  ? 19  ASP D O   1 
ATOM   5040 C  CB  . ASP D 1 19  ? 90.351  39.531  30.289  1.00 6.05  ? 19  ASP D CB  1 
ATOM   5041 C  CG  . ASP D 1 19  ? 89.750  38.187  29.939  1.00 5.67  ? 19  ASP D CG  1 
ATOM   5042 O  OD1 . ASP D 1 19  ? 88.561  37.950  30.291  1.00 4.60  ? 19  ASP D OD1 1 
ATOM   5043 O  OD2 . ASP D 1 19  ? 90.474  37.362  29.335  1.00 5.37  ? 19  ASP D OD2 1 
ATOM   5044 N  N   . LYS D 1 20  ? 90.752  41.422  27.690  1.00 5.61  ? 20  LYS D N   1 
ATOM   5045 C  CA  . LYS D 1 20  ? 90.975  41.577  26.259  1.00 5.45  ? 20  LYS D CA  1 
ATOM   5046 C  C   . LYS D 1 20  ? 91.505  40.305  25.620  1.00 5.65  ? 20  LYS D C   1 
ATOM   5047 O  O   . LYS D 1 20  ? 91.212  40.035  24.466  1.00 6.05  ? 20  LYS D O   1 
ATOM   5048 C  CB  . LYS D 1 20  ? 91.903  42.753  25.958  1.00 5.64  ? 20  LYS D CB  1 
ATOM   5049 C  CG  . LYS D 1 20  ? 93.313  42.570  26.426  1.00 6.04  ? 20  LYS D CG  1 
ATOM   5050 C  CD  . LYS D 1 20  ? 94.020  43.930  26.517  1.00 6.52  ? 20  LYS D CD  1 
ATOM   5051 C  CE  . LYS D 1 20  ? 95.448  43.749  26.964  1.00 9.82  ? 20  LYS D CE  1 
ATOM   5052 N  NZ  . LYS D 1 20  ? 96.036  45.063  27.335  1.00 12.12 ? 20  LYS D NZ  1 
ATOM   5053 N  N   . GLN D 1 21  ? 92.276  39.513  26.352  1.00 5.38  ? 21  GLN D N   1 
ATOM   5054 C  CA  . GLN D 1 21  ? 92.693  38.225  25.806  1.00 5.19  ? 21  GLN D CA  1 
ATOM   5055 C  C   . GLN D 1 21  ? 91.467  37.403  25.418  1.00 4.71  ? 21  GLN D C   1 
ATOM   5056 O  O   . GLN D 1 21  ? 91.371  36.917  24.306  1.00 4.39  ? 21  GLN D O   1 
ATOM   5057 C  CB  . GLN D 1 21  ? 93.563  37.435  26.783  1.00 5.28  ? 21  GLN D CB  1 
ATOM   5058 C  CG  . GLN D 1 21  ? 94.048  36.087  26.230  1.00 7.10  ? 21  GLN D CG  1 
ATOM   5059 C  CD  . GLN D 1 21  ? 94.886  35.306  27.224  1.00 7.36  ? 21  GLN D CD  1 
ATOM   5060 O  OE1 . GLN D 1 21  ? 95.671  34.419  26.851  1.00 9.88  ? 21  GLN D OE1 1 
ATOM   5061 N  NE2 . GLN D 1 21  ? 94.722  35.618  28.492  1.00 8.57  ? 21  GLN D NE2 1 
ATOM   5062 N  N   . THR D 1 22  ? 90.517  37.255  26.341  1.00 4.27  ? 22  THR D N   1 
ATOM   5063 C  CA  . THR D 1 22  ? 89.322  36.473  26.046  1.00 4.15  ? 22  THR D CA  1 
ATOM   5064 C  C   . THR D 1 22  ? 88.532  37.043  24.875  1.00 3.90  ? 22  THR D C   1 
ATOM   5065 O  O   . THR D 1 22  ? 88.061  36.298  24.017  1.00 3.42  ? 22  THR D O   1 
ATOM   5066 C  CB  . THR D 1 22  ? 88.417  36.342  27.287  1.00 3.84  ? 22  THR D CB  1 
ATOM   5067 O  OG1 . THR D 1 22  ? 89.093  35.545  28.262  1.00 3.65  ? 22  THR D OG1 1 
ATOM   5068 C  CG2 . THR D 1 22  ? 87.083  35.652  26.924  1.00 2.89  ? 22  THR D CG2 1 
ATOM   5069 N  N   . MET D 1 23  ? 88.356  38.357  24.841  1.00 3.63  ? 23  MET D N   1 
ATOM   5070 C  CA  . MET D 1 23  ? 87.549  38.950  23.788  1.00 4.36  ? 23  MET D CA  1 
ATOM   5071 C  C   . MET D 1 23  ? 88.110  38.516  22.436  1.00 4.10  ? 23  MET D C   1 
ATOM   5072 O  O   . MET D 1 23  ? 87.331  38.234  21.509  1.00 3.47  ? 23  MET D O   1 
ATOM   5073 C  CB  . MET D 1 23  ? 87.502  40.475  23.894  1.00 4.16  ? 23  MET D CB  1 
ATOM   5074 C  CG  . MET D 1 23  ? 86.708  41.009  25.092  1.00 6.62  ? 23  MET D CG  1 
ATOM   5075 S  SD  . MET D 1 23  ? 84.980  40.491  25.250  1.00 8.23  ? 23  MET D SD  1 
ATOM   5076 C  CE  . MET D 1 23  ? 84.214  41.185  23.791  1.00 8.70  ? 23  MET D CE  1 
ATOM   5077 N  N   . GLU D 1 24  ? 89.449  38.478  22.336  1.00 3.58  ? 24  GLU D N   1 
ATOM   5078 C  CA  . GLU D 1 24  ? 90.145  38.162  21.088  1.00 4.04  ? 24  GLU D CA  1 
ATOM   5079 C  C   . GLU D 1 24  ? 90.011  36.690  20.711  1.00 3.73  ? 24  GLU D C   1 
ATOM   5080 O  O   . GLU D 1 24  ? 89.639  36.383  19.583  1.00 3.50  ? 24  GLU D O   1 
ATOM   5081 C  CB  . GLU D 1 24  ? 91.627  38.588  21.105  1.00 3.92  ? 24  GLU D CB  1 
ATOM   5082 C  CG  . GLU D 1 24  ? 92.350  38.106  19.829  1.00 4.52  ? 24  GLU D CG  1 
ATOM   5083 C  CD  . GLU D 1 24  ? 93.756  38.641  19.679  1.00 7.33  ? 24  GLU D CD  1 
ATOM   5084 O  OE1 . GLU D 1 24  ? 94.206  39.385  20.563  1.00 8.09  ? 24  GLU D OE1 1 
ATOM   5085 O  OE2 . GLU D 1 24  ? 94.421  38.299  18.686  1.00 8.05  ? 24  GLU D OE2 1 
ATOM   5086 N  N   . ILE D 1 25  ? 90.289  35.783  21.652  1.00 3.81  ? 25  ILE D N   1 
ATOM   5087 C  CA  . ILE D 1 25  ? 90.112  34.340  21.406  1.00 3.04  ? 25  ILE D CA  1 
ATOM   5088 C  C   . ILE D 1 25  ? 88.645  33.994  21.176  1.00 3.27  ? 25  ILE D C   1 
ATOM   5089 O  O   . ILE D 1 25  ? 88.306  33.273  20.237  1.00 3.05  ? 25  ILE D O   1 
ATOM   5090 C  CB  . ILE D 1 25  ? 90.609  33.500  22.589  1.00 2.78  ? 25  ILE D CB  1 
ATOM   5091 C  CG1 . ILE D 1 25  ? 92.074  33.837  22.873  1.00 3.36  ? 25  ILE D CG1 1 
ATOM   5092 C  CG2 . ILE D 1 25  ? 90.365  32.006  22.309  1.00 2.81  ? 25  ILE D CG2 1 
ATOM   5093 C  CD1 . ILE D 1 25  ? 92.520  33.580  24.287  1.00 4.58  ? 25  ILE D CD1 1 
ATOM   5094 N  N   . HIS D 1 26  ? 87.780  34.505  22.043  1.00 3.57  ? 26  HIS D N   1 
ATOM   5095 C  CA  . HIS D 1 26  ? 86.352  34.200  21.936  1.00 3.52  ? 26  HIS D CA  1 
ATOM   5096 C  C   . HIS D 1 26  ? 85.848  34.472  20.509  1.00 3.66  ? 26  HIS D C   1 
ATOM   5097 O  O   . HIS D 1 26  ? 85.139  33.652  19.900  1.00 3.36  ? 26  HIS D O   1 
ATOM   5098 C  CB  . HIS D 1 26  ? 85.572  34.990  23.002  1.00 3.66  ? 26  HIS D CB  1 
ATOM   5099 C  CG  . HIS D 1 26  ? 84.252  34.379  23.378  1.00 3.69  ? 26  HIS D CG  1 
ATOM   5100 N  ND1 . HIS D 1 26  ? 83.412  34.961  24.299  1.00 4.66  ? 26  HIS D ND1 1 
ATOM   5101 C  CD2 . HIS D 1 26  ? 83.604  33.279  22.921  1.00 3.64  ? 26  HIS D CD2 1 
ATOM   5102 C  CE1 . HIS D 1 26  ? 82.317  34.229  24.423  1.00 3.61  ? 26  HIS D CE1 1 
ATOM   5103 N  NE2 . HIS D 1 26  ? 82.411  33.199  23.602  1.00 3.05  ? 26  HIS D NE2 1 
ATOM   5104 N  N   . HIS D 1 27  ? 86.233  35.622  19.974  1.00 3.51  ? 27  HIS D N   1 
ATOM   5105 C  CA  . HIS D 1 27  ? 85.793  36.059  18.653  1.00 3.39  ? 27  HIS D CA  1 
ATOM   5106 C  C   . HIS D 1 27  ? 86.546  35.378  17.526  1.00 3.44  ? 27  HIS D C   1 
ATOM   5107 O  O   . HIS D 1 27  ? 85.933  34.852  16.600  1.00 2.82  ? 27  HIS D O   1 
ATOM   5108 C  CB  . HIS D 1 27  ? 85.993  37.582  18.553  1.00 4.14  ? 27  HIS D CB  1 
ATOM   5109 C  CG  . HIS D 1 27  ? 85.518  38.186  17.264  1.00 4.26  ? 27  HIS D CG  1 
ATOM   5110 N  ND1 . HIS D 1 27  ? 86.385  38.693  16.309  1.00 5.24  ? 27  HIS D ND1 1 
ATOM   5111 C  CD2 . HIS D 1 27  ? 84.269  38.404  16.789  1.00 4.73  ? 27  HIS D CD2 1 
ATOM   5112 C  CE1 . HIS D 1 27  ? 85.686  39.164  15.294  1.00 4.52  ? 27  HIS D CE1 1 
ATOM   5113 N  NE2 . HIS D 1 27  ? 84.400  39.004  15.558  1.00 4.41  ? 27  HIS D NE2 1 
ATOM   5114 N  N   . THR D 1 28  ? 87.875  35.397  17.586  1.00 3.39  ? 28  THR D N   1 
ATOM   5115 C  CA  . THR D 1 28  ? 88.664  34.972  16.427  1.00 3.38  ? 28  THR D CA  1 
ATOM   5116 C  C   . THR D 1 28  ? 88.815  33.443  16.330  1.00 3.02  ? 28  THR D C   1 
ATOM   5117 O  O   . THR D 1 28  ? 89.141  32.909  15.269  1.00 2.88  ? 28  THR D O   1 
ATOM   5118 C  CB  . THR D 1 28  ? 90.057  35.656  16.403  1.00 3.89  ? 28  THR D CB  1 
ATOM   5119 O  OG1 . THR D 1 28  ? 90.833  35.231  17.528  1.00 4.47  ? 28  THR D OG1 1 
ATOM   5120 C  CG2 . THR D 1 28  ? 89.911  37.203  16.438  1.00 4.74  ? 28  THR D CG2 1 
ATOM   5121 N  N   . LYS D 1 29  ? 88.549  32.748  17.432  1.00 2.65  ? 29  LYS D N   1 
ATOM   5122 C  CA  . LYS D 1 29  ? 88.617  31.291  17.431  1.00 2.87  ? 29  LYS D CA  1 
ATOM   5123 C  C   . LYS D 1 29  ? 87.211  30.710  17.546  1.00 2.37  ? 29  LYS D C   1 
ATOM   5124 O  O   . LYS D 1 29  ? 86.745  30.064  16.620  1.00 2.04  ? 29  LYS D O   1 
ATOM   5125 C  CB  . LYS D 1 29  ? 89.521  30.779  18.556  1.00 3.47  ? 29  LYS D CB  1 
ATOM   5126 C  CG  . LYS D 1 29  ? 90.934  31.380  18.528  1.00 5.21  ? 29  LYS D CG  1 
ATOM   5127 C  CD  . LYS D 1 29  ? 91.581  31.083  17.198  1.00 5.90  ? 29  LYS D CD  1 
ATOM   5128 C  CE  . LYS D 1 29  ? 93.083  31.366  17.195  1.00 8.97  ? 29  LYS D CE  1 
ATOM   5129 N  NZ  . LYS D 1 29  ? 93.676  30.906  15.906  1.00 10.27 ? 29  LYS D NZ  1 
ATOM   5130 N  N   . HIS D 1 30  ? 86.530  30.971  18.656  1.00 2.72  ? 30  HIS D N   1 
ATOM   5131 C  CA  . HIS D 1 30  ? 85.231  30.354  18.870  1.00 2.01  ? 30  HIS D CA  1 
ATOM   5132 C  C   . HIS D 1 30  ? 84.176  30.762  17.859  1.00 2.70  ? 30  HIS D C   1 
ATOM   5133 O  O   . HIS D 1 30  ? 83.605  29.914  17.195  1.00 1.00  ? 30  HIS D O   1 
ATOM   5134 C  CB  . HIS D 1 30  ? 84.714  30.600  20.293  1.00 2.32  ? 30  HIS D CB  1 
ATOM   5135 C  CG  . HIS D 1 30  ? 85.556  29.967  21.353  1.00 2.11  ? 30  HIS D CG  1 
ATOM   5136 N  ND1 . HIS D 1 30  ? 85.335  28.686  21.817  1.00 1.66  ? 30  HIS D ND1 1 
ATOM   5137 C  CD2 . HIS D 1 30  ? 86.627  30.435  22.035  1.00 2.00  ? 30  HIS D CD2 1 
ATOM   5138 C  CE1 . HIS D 1 30  ? 86.239  28.394  22.735  1.00 2.16  ? 30  HIS D CE1 1 
ATOM   5139 N  NE2 . HIS D 1 30  ? 87.032  29.440  22.889  1.00 3.11  ? 30  HIS D NE2 1 
ATOM   5140 N  N   . HIS D 1 31  ? 83.904  32.058  17.737  1.00 1.62  ? 31  HIS D N   1 
ATOM   5141 C  CA  . HIS D 1 31  ? 82.818  32.486  16.869  1.00 2.45  ? 31  HIS D CA  1 
ATOM   5142 C  C   . HIS D 1 31  ? 83.191  32.170  15.411  1.00 1.88  ? 31  HIS D C   1 
ATOM   5143 O  O   . HIS D 1 31  ? 82.349  31.685  14.647  1.00 2.20  ? 31  HIS D O   1 
ATOM   5144 C  CB  . HIS D 1 31  ? 82.491  33.958  17.119  1.00 2.20  ? 31  HIS D CB  1 
ATOM   5145 C  CG  . HIS D 1 31  ? 81.286  34.466  16.388  1.00 2.14  ? 31  HIS D CG  1 
ATOM   5146 N  ND1 . HIS D 1 31  ? 80.890  35.780  16.454  1.00 2.23  ? 31  HIS D ND1 1 
ATOM   5147 C  CD2 . HIS D 1 31  ? 80.397  33.846  15.577  1.00 2.13  ? 31  HIS D CD2 1 
ATOM   5148 C  CE1 . HIS D 1 31  ? 79.811  35.955  15.717  1.00 2.75  ? 31  HIS D CE1 1 
ATOM   5149 N  NE2 . HIS D 1 31  ? 79.481  34.795  15.183  1.00 1.63  ? 31  HIS D NE2 1 
ATOM   5150 N  N   . GLN D 1 32  ? 84.460  32.373  15.054  1.00 2.31  ? 32  GLN D N   1 
ATOM   5151 C  CA  . GLN D 1 32  ? 84.971  31.984  13.727  1.00 2.31  ? 32  GLN D CA  1 
ATOM   5152 C  C   . GLN D 1 32  ? 84.682  30.510  13.404  1.00 2.55  ? 32  GLN D C   1 
ATOM   5153 O  O   . GLN D 1 32  ? 84.261  30.168  12.294  1.00 2.99  ? 32  GLN D O   1 
ATOM   5154 C  CB  . GLN D 1 32  ? 86.490  32.236  13.656  1.00 2.22  ? 32  GLN D CB  1 
ATOM   5155 C  CG  . GLN D 1 32  ? 87.186  31.723  12.380  1.00 1.22  ? 32  GLN D CG  1 
ATOM   5156 C  CD  . GLN D 1 32  ? 86.858  32.554  11.149  1.00 1.98  ? 32  GLN D CD  1 
ATOM   5157 O  OE1 . GLN D 1 32  ? 87.398  33.636  10.948  1.00 2.65  ? 32  GLN D OE1 1 
ATOM   5158 N  NE2 . GLN D 1 32  ? 85.946  32.037  10.322  1.00 2.08  ? 32  GLN D NE2 1 
ATOM   5159 N  N   . THR D 1 33  ? 84.875  29.638  14.384  1.00 2.54  ? 33  THR D N   1 
ATOM   5160 C  CA  . THR D 1 33  ? 84.565  28.229  14.167  1.00 2.91  ? 33  THR D CA  1 
ATOM   5161 C  C   . THR D 1 33  ? 83.067  27.946  13.974  1.00 2.16  ? 33  THR D C   1 
ATOM   5162 O  O   . THR D 1 33  ? 82.720  27.094  13.165  1.00 2.31  ? 33  THR D O   1 
ATOM   5163 C  CB  . THR D 1 33  ? 85.186  27.314  15.246  1.00 3.32  ? 33  THR D CB  1 
ATOM   5164 O  OG1 . THR D 1 33  ? 86.602  27.341  15.102  1.00 3.75  ? 33  THR D OG1 1 
ATOM   5165 C  CG2 . THR D 1 33  ? 84.732  25.884  15.051  1.00 3.57  ? 33  THR D CG2 1 
ATOM   5166 N  N   . TYR D 1 34  ? 82.184  28.641  14.686  1.00 2.40  ? 34  TYR D N   1 
ATOM   5167 C  CA  . TYR D 1 34  ? 80.723  28.448  14.473  1.00 2.65  ? 34  TYR D CA  1 
ATOM   5168 C  C   . TYR D 1 34  ? 80.342  28.862  13.061  1.00 3.18  ? 34  TYR D C   1 
ATOM   5169 O  O   . TYR D 1 34  ? 79.579  28.175  12.347  1.00 2.60  ? 34  TYR D O   1 
ATOM   5170 C  CB  . TYR D 1 34  ? 79.891  29.263  15.478  1.00 2.34  ? 34  TYR D CB  1 
ATOM   5171 C  CG  . TYR D 1 34  ? 80.083  28.884  16.931  1.00 2.94  ? 34  TYR D CG  1 
ATOM   5172 C  CD1 . TYR D 1 34  ? 79.943  27.569  17.340  1.00 2.75  ? 34  TYR D CD1 1 
ATOM   5173 C  CD2 . TYR D 1 34  ? 80.376  29.843  17.893  1.00 4.72  ? 34  TYR D CD2 1 
ATOM   5174 C  CE1 . TYR D 1 34  ? 80.123  27.213  18.687  1.00 3.40  ? 34  TYR D CE1 1 
ATOM   5175 C  CE2 . TYR D 1 34  ? 80.536  29.497  19.225  1.00 5.99  ? 34  TYR D CE2 1 
ATOM   5176 C  CZ  . TYR D 1 34  ? 80.417  28.179  19.605  1.00 5.39  ? 34  TYR D CZ  1 
ATOM   5177 O  OH  . TYR D 1 34  ? 80.581  27.837  20.936  1.00 8.96  ? 34  TYR D OH  1 
ATOM   5178 N  N   . VAL D 1 35  ? 80.885  29.997  12.645  1.00 2.56  ? 35  VAL D N   1 
ATOM   5179 C  CA  . VAL D 1 35  ? 80.650  30.467  11.291  1.00 2.77  ? 35  VAL D CA  1 
ATOM   5180 C  C   . VAL D 1 35  ? 81.142  29.465  10.233  1.00 2.22  ? 35  VAL D C   1 
ATOM   5181 O  O   . VAL D 1 35  ? 80.426  29.154  9.285   1.00 2.16  ? 35  VAL D O   1 
ATOM   5182 C  CB  . VAL D 1 35  ? 81.306  31.843  11.090  1.00 2.33  ? 35  VAL D CB  1 
ATOM   5183 C  CG1 . VAL D 1 35  ? 81.299  32.231  9.609   1.00 1.93  ? 35  VAL D CG1 1 
ATOM   5184 C  CG2 . VAL D 1 35  ? 80.623  32.884  11.943  1.00 3.13  ? 35  VAL D CG2 1 
ATOM   5185 N  N   . ASN D 1 36  ? 82.362  28.948  10.399  1.00 2.15  ? 36  ASN D N   1 
ATOM   5186 C  CA  . ASN D 1 36  ? 82.923  27.978  9.450   1.00 2.10  ? 36  ASN D CA  1 
ATOM   5187 C  C   . ASN D 1 36  ? 82.088  26.708  9.377   1.00 2.13  ? 36  ASN D C   1 
ATOM   5188 O  O   . ASN D 1 36  ? 81.771  26.207  8.287   1.00 2.18  ? 36  ASN D O   1 
ATOM   5189 C  CB  . ASN D 1 36  ? 84.375  27.611  9.826   1.00 1.94  ? 36  ASN D CB  1 
ATOM   5190 C  CG  . ASN D 1 36  ? 85.375  28.750  9.552   1.00 1.50  ? 36  ASN D CG  1 
ATOM   5191 O  OD1 . ASN D 1 36  ? 85.107  29.628  8.777   1.00 1.41  ? 36  ASN D OD1 1 
ATOM   5192 N  ND2 . ASN D 1 36  ? 86.553  28.694  10.190  1.00 1.82  ? 36  ASN D ND2 1 
ATOM   5193 N  N   . ASN D 1 37  ? 81.739  26.176  10.545  1.00 1.76  ? 37  ASN D N   1 
ATOM   5194 C  CA  . ASN D 1 37  ? 81.000  24.922  10.584  1.00 2.01  ? 37  ASN D CA  1 
ATOM   5195 C  C   . ASN D 1 37  ? 79.566  25.056  10.084  1.00 1.71  ? 37  ASN D C   1 
ATOM   5196 O  O   . ASN D 1 37  ? 79.056  24.146  9.434   1.00 1.54  ? 37  ASN D O   1 
ATOM   5197 C  CB  . ASN D 1 37  ? 81.081  24.277  11.977  1.00 2.23  ? 37  ASN D CB  1 
ATOM   5198 C  CG  . ASN D 1 37  ? 82.447  23.674  12.239  1.00 2.97  ? 37  ASN D CG  1 
ATOM   5199 O  OD1 . ASN D 1 37  ? 83.185  23.371  11.292  1.00 3.87  ? 37  ASN D OD1 1 
ATOM   5200 N  ND2 . ASN D 1 37  ? 82.800  23.507  13.515  1.00 2.64  ? 37  ASN D ND2 1 
ATOM   5201 N  N   . ALA D 1 38  ? 78.934  26.194  10.353  1.00 1.64  ? 38  ALA D N   1 
ATOM   5202 C  CA  . ALA D 1 38  ? 77.616  26.486  9.760   1.00 2.02  ? 38  ALA D CA  1 
ATOM   5203 C  C   . ALA D 1 38  ? 77.728  26.644  8.247   1.00 2.56  ? 38  ALA D C   1 
ATOM   5204 O  O   . ALA D 1 38  ? 76.920  26.096  7.485   1.00 2.28  ? 38  ALA D O   1 
ATOM   5205 C  CB  . ALA D 1 38  ? 77.028  27.770  10.384  1.00 1.93  ? 38  ALA D CB  1 
ATOM   5206 N  N   . ASN D 1 39  ? 78.735  27.389  7.794   1.00 2.34  ? 39  ASN D N   1 
ATOM   5207 C  CA  . ASN D 1 39  ? 78.857  27.606  6.360   1.00 2.59  ? 39  ASN D CA  1 
ATOM   5208 C  C   . ASN D 1 39  ? 79.091  26.302  5.603   1.00 2.57  ? 39  ASN D C   1 
ATOM   5209 O  O   . ASN D 1 39  ? 78.563  26.107  4.497   1.00 2.49  ? 39  ASN D O   1 
ATOM   5210 C  CB  . ASN D 1 39  ? 79.980  28.602  6.065   1.00 2.64  ? 39  ASN D CB  1 
ATOM   5211 C  CG  . ASN D 1 39  ? 79.550  30.038  6.236   1.00 2.59  ? 39  ASN D CG  1 
ATOM   5212 O  OD1 . ASN D 1 39  ? 78.361  30.365  6.183   1.00 3.01  ? 39  ASN D OD1 1 
ATOM   5213 N  ND2 . ASN D 1 39  ? 80.525  30.923  6.419   1.00 1.34  ? 39  ASN D ND2 1 
ATOM   5214 N  N   . ALA D 1 40  ? 79.897  25.417  6.188   1.00 2.64  ? 40  ALA D N   1 
ATOM   5215 C  CA  . ALA D 1 40  ? 80.146  24.103  5.600   1.00 3.00  ? 40  ALA D CA  1 
ATOM   5216 C  C   . ALA D 1 40  ? 78.829  23.325  5.496   1.00 2.94  ? 40  ALA D C   1 
ATOM   5217 O  O   . ALA D 1 40  ? 78.564  22.659  4.504   1.00 3.07  ? 40  ALA D O   1 
ATOM   5218 C  CB  . ALA D 1 40  ? 81.169  23.307  6.456   1.00 2.85  ? 40  ALA D CB  1 
ATOM   5219 N  N   . ALA D 1 41  ? 78.007  23.413  6.536   1.00 3.41  ? 41  ALA D N   1 
ATOM   5220 C  CA  . ALA D 1 41  ? 76.732  22.696  6.542   1.00 4.04  ? 41  ALA D CA  1 
ATOM   5221 C  C   . ALA D 1 41  ? 75.725  23.318  5.580   1.00 3.96  ? 41  ALA D C   1 
ATOM   5222 O  O   . ALA D 1 41  ? 74.808  22.641  5.096   1.00 3.13  ? 41  ALA D O   1 
ATOM   5223 C  CB  . ALA D 1 41  ? 76.147  22.618  7.963   1.00 2.88  ? 41  ALA D CB  1 
ATOM   5224 N  N   . LEU D 1 42  ? 75.880  24.598  5.294   1.00 4.85  ? 42  LEU D N   1 
ATOM   5225 C  CA  . LEU D 1 42  ? 74.912  25.253  4.419   1.00 5.53  ? 42  LEU D CA  1 
ATOM   5226 C  C   . LEU D 1 42  ? 75.225  25.122  2.923   1.00 5.79  ? 42  LEU D C   1 
ATOM   5227 O  O   . LEU D 1 42  ? 74.391  25.485  2.088   1.00 6.00  ? 42  LEU D O   1 
ATOM   5228 C  CB  . LEU D 1 42  ? 74.726  26.714  4.835   1.00 5.44  ? 42  LEU D CB  1 
ATOM   5229 C  CG  . LEU D 1 42  ? 73.896  26.918  6.115   1.00 6.14  ? 42  LEU D CG  1 
ATOM   5230 C  CD1 . LEU D 1 42  ? 73.958  28.363  6.603   1.00 7.36  ? 42  LEU D CD1 1 
ATOM   5231 C  CD2 . LEU D 1 42  ? 72.435  26.470  5.917   1.00 6.43  ? 42  LEU D CD2 1 
ATOM   5232 N  N   . GLU D 1 43  ? 76.405  24.602  2.573   1.00 5.94  ? 43  GLU D N   1 
ATOM   5233 C  CA  . GLU D 1 43  ? 76.791  24.548  1.157   1.00 5.82  ? 43  GLU D CA  1 
ATOM   5234 C  C   . GLU D 1 43  ? 75.691  23.925  0.305   1.00 5.77  ? 43  GLU D C   1 
ATOM   5235 O  O   . GLU D 1 43  ? 75.395  24.425  -0.778  1.00 6.22  ? 43  GLU D O   1 
ATOM   5236 C  CB  . GLU D 1 43  ? 78.112  23.787  0.935   1.00 6.19  ? 43  GLU D CB  1 
ATOM   5237 C  CG  . GLU D 1 43  ? 78.427  23.524  -0.566  1.00 7.05  ? 43  GLU D CG  1 
ATOM   5238 C  CD  . GLU D 1 43  ? 79.851  23.028  -0.832  1.00 10.41 ? 43  GLU D CD  1 
ATOM   5239 O  OE1 . GLU D 1 43  ? 80.310  22.094  -0.139  1.00 12.30 ? 43  GLU D OE1 1 
ATOM   5240 O  OE2 . GLU D 1 43  ? 80.512  23.557  -1.756  1.00 11.85 ? 43  GLU D OE2 1 
ATOM   5241 N  N   . SER D 1 44  ? 75.115  22.824  0.777   1.00 5.63  ? 44  SER D N   1 
ATOM   5242 C  CA  . SER D 1 44  ? 74.174  22.050  -0.027  1.00 6.32  ? 44  SER D CA  1 
ATOM   5243 C  C   . SER D 1 44  ? 72.750  22.581  0.118   1.00 6.72  ? 44  SER D C   1 
ATOM   5244 O  O   . SER D 1 44  ? 71.826  22.051  -0.494  1.00 7.86  ? 44  SER D O   1 
ATOM   5245 C  CB  . SER D 1 44  ? 74.229  20.540  0.314   1.00 6.42  ? 44  SER D CB  1 
ATOM   5246 O  OG  . SER D 1 44  ? 73.725  20.259  1.611   1.00 6.78  ? 44  SER D OG  1 
ATOM   5247 N  N   . LEU D 1 45  ? 72.589  23.660  0.882   1.00 5.45  ? 45  LEU D N   1 
ATOM   5248 C  CA  . LEU D 1 45  ? 71.257  24.170  1.182   1.00 5.33  ? 45  LEU D CA  1 
ATOM   5249 C  C   . LEU D 1 45  ? 71.095  25.655  0.793   1.00 4.80  ? 45  LEU D C   1 
ATOM   5250 O  O   . LEU D 1 45  ? 70.938  26.499  1.645   1.00 3.51  ? 45  LEU D O   1 
ATOM   5251 C  CB  . LEU D 1 45  ? 70.936  23.934  2.672   1.00 5.65  ? 45  LEU D CB  1 
ATOM   5252 C  CG  . LEU D 1 45  ? 70.978  22.451  3.126   1.00 5.28  ? 45  LEU D CG  1 
ATOM   5253 C  CD1 . LEU D 1 45  ? 71.119  22.293  4.624   1.00 7.68  ? 45  LEU D CD1 1 
ATOM   5254 C  CD2 . LEU D 1 45  ? 69.755  21.658  2.616   1.00 7.69  ? 45  LEU D CD2 1 
ATOM   5255 N  N   . PRO D 1 46  ? 71.167  25.985  -0.505  1.00 5.36  ? 46  PRO D N   1 
ATOM   5256 C  CA  . PRO D 1 46  ? 71.266  27.419  -0.811  1.00 5.80  ? 46  PRO D CA  1 
ATOM   5257 C  C   . PRO D 1 46  ? 70.037  28.226  -0.404  1.00 6.18  ? 46  PRO D C   1 
ATOM   5258 O  O   . PRO D 1 46  ? 70.157  29.403  -0.076  1.00 6.50  ? 46  PRO D O   1 
ATOM   5259 C  CB  . PRO D 1 46  ? 71.460  27.457  -2.343  1.00 5.71  ? 46  PRO D CB  1 
ATOM   5260 C  CG  . PRO D 1 46  ? 71.057  26.112  -2.826  1.00 5.90  ? 46  PRO D CG  1 
ATOM   5261 C  CD  . PRO D 1 46  ? 71.388  25.156  -1.701  1.00 5.71  ? 46  PRO D CD  1 
ATOM   5262 N  N   . GLU D 1 47  ? 68.871  27.589  -0.421  1.00 5.87  ? 47  GLU D N   1 
ATOM   5263 C  CA  . GLU D 1 47  ? 67.650  28.269  -0.003  1.00 7.17  ? 47  GLU D CA  1 
ATOM   5264 C  C   . GLU D 1 47  ? 67.709  28.610  1.497   1.00 7.23  ? 47  GLU D C   1 
ATOM   5265 O  O   . GLU D 1 47  ? 67.399  29.735  1.900   1.00 8.32  ? 47  GLU D O   1 
ATOM   5266 C  CB  . GLU D 1 47  ? 66.368  27.496  -0.423  1.00 7.46  ? 47  GLU D CB  1 
ATOM   5267 C  CG  . GLU D 1 47  ? 66.119  26.064  0.156   1.00 10.24 ? 47  GLU D CG  1 
ATOM   5268 C  CD  . GLU D 1 47  ? 64.703  25.519  -0.173  1.00 13.81 ? 47  GLU D CD  1 
ATOM   5269 O  OE1 . GLU D 1 47  ? 64.562  24.404  -0.757  1.00 14.53 ? 47  GLU D OE1 1 
ATOM   5270 O  OE2 . GLU D 1 47  ? 63.715  26.219  0.143   1.00 15.29 ? 47  GLU D OE2 1 
ATOM   5271 N  N   . PHE D 1 48  ? 68.167  27.671  2.317   1.00 6.83  ? 48  PHE D N   1 
ATOM   5272 C  CA  . PHE D 1 48  ? 68.344  27.978  3.735   1.00 6.79  ? 48  PHE D CA  1 
ATOM   5273 C  C   . PHE D 1 48  ? 69.491  28.950  3.985   1.00 6.07  ? 48  PHE D C   1 
ATOM   5274 O  O   . PHE D 1 48  ? 69.431  29.748  4.912   1.00 6.26  ? 48  PHE D O   1 
ATOM   5275 C  CB  . PHE D 1 48  ? 68.527  26.711  4.563   1.00 6.83  ? 48  PHE D CB  1 
ATOM   5276 C  CG  . PHE D 1 48  ? 67.272  25.937  4.736   1.00 7.88  ? 48  PHE D CG  1 
ATOM   5277 C  CD1 . PHE D 1 48  ? 66.218  26.471  5.443   1.00 8.04  ? 48  PHE D CD1 1 
ATOM   5278 C  CD2 . PHE D 1 48  ? 67.144  24.678  4.182   1.00 8.10  ? 48  PHE D CD2 1 
ATOM   5279 C  CE1 . PHE D 1 48  ? 65.042  25.767  5.596   1.00 9.33  ? 48  PHE D CE1 1 
ATOM   5280 C  CE2 . PHE D 1 48  ? 65.983  23.960  4.330   1.00 9.12  ? 48  PHE D CE2 1 
ATOM   5281 C  CZ  . PHE D 1 48  ? 64.923  24.509  5.050   1.00 9.47  ? 48  PHE D CZ  1 
ATOM   5282 N  N   . ALA D 1 49  ? 70.540  28.893  3.172   1.00 6.21  ? 49  ALA D N   1 
ATOM   5283 C  CA  . ALA D 1 49  ? 71.700  29.759  3.424   1.00 6.71  ? 49  ALA D CA  1 
ATOM   5284 C  C   . ALA D 1 49  ? 71.397  31.239  3.164   1.00 7.14  ? 49  ALA D C   1 
ATOM   5285 O  O   . ALA D 1 49  ? 72.068  32.117  3.690   1.00 7.51  ? 49  ALA D O   1 
ATOM   5286 C  CB  . ALA D 1 49  ? 72.917  29.290  2.604   1.00 6.51  ? 49  ALA D CB  1 
ATOM   5287 N  N   . ASN D 1 50  ? 70.390  31.486  2.330   1.00 8.12  ? 50  ASN D N   1 
ATOM   5288 C  CA  . ASN D 1 50  ? 69.937  32.819  1.943   1.00 8.73  ? 50  ASN D CA  1 
ATOM   5289 C  C   . ASN D 1 50  ? 69.351  33.597  3.139   1.00 8.38  ? 50  ASN D C   1 
ATOM   5290 O  O   . ASN D 1 50  ? 69.384  34.833  3.186   1.00 8.98  ? 50  ASN D O   1 
ATOM   5291 C  CB  . ASN D 1 50  ? 68.882  32.615  0.840   1.00 9.53  ? 50  ASN D CB  1 
ATOM   5292 C  CG  . ASN D 1 50  ? 68.651  33.826  -0.025  1.00 11.28 ? 50  ASN D CG  1 
ATOM   5293 O  OD1 . ASN D 1 50  ? 67.730  33.823  -0.849  1.00 13.19 ? 50  ASN D OD1 1 
ATOM   5294 N  ND2 . ASN D 1 50  ? 69.488  34.856  0.122   1.00 14.20 ? 50  ASN D ND2 1 
ATOM   5295 N  N   . LEU D 1 51  ? 68.843  32.867  4.129   1.00 8.03  ? 51  LEU D N   1 
ATOM   5296 C  CA  . LEU D 1 51  ? 68.083  33.498  5.219   1.00 7.24  ? 51  LEU D CA  1 
ATOM   5297 C  C   . LEU D 1 51  ? 69.030  34.124  6.261   1.00 7.07  ? 51  LEU D C   1 
ATOM   5298 O  O   . LEU D 1 51  ? 70.157  33.666  6.415   1.00 6.46  ? 51  LEU D O   1 
ATOM   5299 C  CB  . LEU D 1 51  ? 67.169  32.462  5.869   1.00 7.75  ? 51  LEU D CB  1 
ATOM   5300 C  CG  . LEU D 1 51  ? 66.289  31.548  5.008   1.00 8.30  ? 51  LEU D CG  1 
ATOM   5301 C  CD1 . LEU D 1 51  ? 66.961  31.115  3.685   1.00 9.77  ? 51  LEU D CD1 1 
ATOM   5302 C  CD2 . LEU D 1 51  ? 65.846  30.350  5.812   1.00 8.37  ? 51  LEU D CD2 1 
ATOM   5303 N  N   . PRO D 1 52  ? 68.594  35.193  6.956   1.00 6.55  ? 52  PRO D N   1 
ATOM   5304 C  CA  . PRO D 1 52  ? 69.372  35.640  8.117   1.00 6.52  ? 52  PRO D CA  1 
ATOM   5305 C  C   . PRO D 1 52  ? 69.438  34.501  9.154   1.00 6.15  ? 52  PRO D C   1 
ATOM   5306 O  O   . PRO D 1 52  ? 68.479  33.740  9.305   1.00 6.20  ? 52  PRO D O   1 
ATOM   5307 C  CB  . PRO D 1 52  ? 68.552  36.805  8.670   1.00 6.72  ? 52  PRO D CB  1 
ATOM   5308 C  CG  . PRO D 1 52  ? 67.640  37.223  7.538   1.00 6.09  ? 52  PRO D CG  1 
ATOM   5309 C  CD  . PRO D 1 52  ? 67.350  35.967  6.801   1.00 6.96  ? 52  PRO D CD  1 
ATOM   5310 N  N   . VAL D 1 53  ? 70.556  34.398  9.867   1.00 5.57  ? 53  VAL D N   1 
ATOM   5311 C  CA  . VAL D 1 53  ? 70.795  33.259  10.752  1.00 5.64  ? 53  VAL D CA  1 
ATOM   5312 C  C   . VAL D 1 53  ? 69.708  33.139  11.814  1.00 6.03  ? 53  VAL D C   1 
ATOM   5313 O  O   . VAL D 1 53  ? 69.329  32.033  12.239  1.00 5.27  ? 53  VAL D O   1 
ATOM   5314 C  CB  . VAL D 1 53  ? 72.190  33.367  11.408  1.00 5.69  ? 53  VAL D CB  1 
ATOM   5315 C  CG1 . VAL D 1 53  ? 72.314  34.678  12.202  1.00 4.87  ? 53  VAL D CG1 1 
ATOM   5316 C  CG2 . VAL D 1 53  ? 72.465  32.148  12.272  1.00 5.24  ? 53  VAL D CG2 1 
ATOM   5317 N  N   . GLU D 1 54  ? 69.212  34.296  12.240  1.00 6.23  ? 54  GLU D N   1 
ATOM   5318 C  CA  . GLU D 1 54  ? 68.192  34.355  13.265  1.00 6.94  ? 54  GLU D CA  1 
ATOM   5319 C  C   . GLU D 1 54  ? 66.861  33.822  12.751  1.00 6.89  ? 54  GLU D C   1 
ATOM   5320 O  O   . GLU D 1 54  ? 66.027  33.373  13.537  1.00 6.69  ? 54  GLU D O   1 
ATOM   5321 C  CB  . GLU D 1 54  ? 68.021  35.795  13.763  1.00 7.22  ? 54  GLU D CB  1 
ATOM   5322 C  CG  . GLU D 1 54  ? 69.273  36.426  14.384  1.00 8.62  ? 54  GLU D CG  1 
ATOM   5323 C  CD  . GLU D 1 54  ? 70.222  37.057  13.353  1.00 9.49  ? 54  GLU D CD  1 
ATOM   5324 O  OE1 . GLU D 1 54  ? 69.876  37.124  12.148  1.00 10.06 ? 54  GLU D OE1 1 
ATOM   5325 O  OE2 . GLU D 1 54  ? 71.316  37.501  13.768  1.00 10.17 ? 54  GLU D OE2 1 
ATOM   5326 N  N   . GLU D 1 55  ? 66.634  33.921  11.441  1.00 6.75  ? 55  GLU D N   1 
ATOM   5327 C  CA  . GLU D 1 55  ? 65.461  33.289  10.845  1.00 7.18  ? 55  GLU D CA  1 
ATOM   5328 C  C   . GLU D 1 55  ? 65.687  31.777  10.710  1.00 6.50  ? 55  GLU D C   1 
ATOM   5329 O  O   . GLU D 1 55  ? 64.800  30.978  10.996  1.00 6.80  ? 55  GLU D O   1 
ATOM   5330 C  CB  . GLU D 1 55  ? 65.130  33.919  9.484   1.00 7.28  ? 55  GLU D CB  1 
ATOM   5331 C  CG  . GLU D 1 55  ? 63.914  33.296  8.770   1.00 9.16  ? 55  GLU D CG  1 
ATOM   5332 C  CD  . GLU D 1 55  ? 63.509  34.046  7.513   1.00 10.55 ? 55  GLU D CD  1 
ATOM   5333 O  OE1 . GLU D 1 55  ? 64.009  35.166  7.286   1.00 12.28 ? 55  GLU D OE1 1 
ATOM   5334 O  OE2 . GLU D 1 55  ? 62.685  33.512  6.742   1.00 13.17 ? 55  GLU D OE2 1 
ATOM   5335 N  N   . LEU D 1 56  ? 66.878  31.377  10.263  1.00 5.85  ? 56  LEU D N   1 
ATOM   5336 C  CA  . LEU D 1 56  ? 67.144  29.953  10.083  1.00 5.37  ? 56  LEU D CA  1 
ATOM   5337 C  C   . LEU D 1 56  ? 66.889  29.203  11.371  1.00 4.60  ? 56  LEU D C   1 
ATOM   5338 O  O   . LEU D 1 56  ? 66.328  28.119  11.354  1.00 5.11  ? 56  LEU D O   1 
ATOM   5339 C  CB  . LEU D 1 56  ? 68.580  29.698  9.621   1.00 5.38  ? 56  LEU D CB  1 
ATOM   5340 C  CG  . LEU D 1 56  ? 69.083  28.259  9.421   1.00 6.70  ? 56  LEU D CG  1 
ATOM   5341 C  CD1 . LEU D 1 56  ? 68.162  27.439  8.511   1.00 5.14  ? 56  LEU D CD1 1 
ATOM   5342 C  CD2 . LEU D 1 56  ? 70.510  28.232  8.886   1.00 9.85  ? 56  LEU D CD2 1 
ATOM   5343 N  N   . ILE D 1 57  ? 67.326  29.770  12.488  1.00 5.15  ? 57  ILE D N   1 
ATOM   5344 C  CA  . ILE D 1 57  ? 67.229  29.029  13.739  1.00 4.54  ? 57  ILE D CA  1 
ATOM   5345 C  C   . ILE D 1 57  ? 65.792  28.921  14.236  1.00 5.37  ? 57  ILE D C   1 
ATOM   5346 O  O   . ILE D 1 57  ? 65.550  28.275  15.221  1.00 4.32  ? 57  ILE D O   1 
ATOM   5347 C  CB  . ILE D 1 57  ? 68.170  29.565  14.848  1.00 4.02  ? 57  ILE D CB  1 
ATOM   5348 C  CG1 . ILE D 1 57  ? 67.924  31.046  15.119  1.00 3.85  ? 57  ILE D CG1 1 
ATOM   5349 C  CG2 . ILE D 1 57  ? 69.631  29.317  14.461  1.00 4.65  ? 57  ILE D CG2 1 
ATOM   5350 C  CD1 . ILE D 1 57  ? 68.570  31.554  16.366  1.00 4.54  ? 57  ILE D CD1 1 
ATOM   5351 N  N   . THR D 1 58  ? 64.848  29.519  13.517  1.00 6.12  ? 58  THR D N   1 
ATOM   5352 C  CA  . THR D 1 58  ? 63.425  29.330  13.846  1.00 6.63  ? 58  THR D CA  1 
ATOM   5353 C  C   . THR D 1 58  ? 62.785  28.255  12.987  1.00 7.04  ? 58  THR D C   1 
ATOM   5354 O  O   . THR D 1 58  ? 61.628  27.861  13.219  1.00 7.38  ? 58  THR D O   1 
ATOM   5355 C  CB  . THR D 1 58  ? 62.580  30.611  13.665  1.00 6.53  ? 58  THR D CB  1 
ATOM   5356 O  OG1 . THR D 1 58  ? 62.440  30.915  12.269  1.00 7.04  ? 58  THR D OG1 1 
ATOM   5357 C  CG2 . THR D 1 58  ? 63.171  31.805  14.444  1.00 7.47  ? 58  THR D CG2 1 
ATOM   5358 N  N   . LYS D 1 59  ? 63.516  27.801  11.978  1.00 6.98  ? 59  LYS D N   1 
ATOM   5359 C  CA  . LYS D 1 59  ? 62.991  26.861  11.018  1.00 7.18  ? 59  LYS D CA  1 
ATOM   5360 C  C   . LYS D 1 59  ? 63.825  25.613  11.042  1.00 6.25  ? 59  LYS D C   1 
ATOM   5361 O  O   . LYS D 1 59  ? 63.964  24.973  10.024  1.00 7.01  ? 59  LYS D O   1 
ATOM   5362 C  CB  . LYS D 1 59  ? 63.020  27.445  9.592   1.00 7.75  ? 59  LYS D CB  1 
ATOM   5363 C  CG  . LYS D 1 59  ? 61.915  28.437  9.279   1.00 10.02 ? 59  LYS D CG  1 
ATOM   5364 C  CD  . LYS D 1 59  ? 62.257  29.312  8.081   1.00 12.05 ? 59  LYS D CD  1 
ATOM   5365 C  CE  . LYS D 1 59  ? 61.285  30.477  7.999   1.00 13.15 ? 59  LYS D CE  1 
ATOM   5366 N  NZ  . LYS D 1 59  ? 61.161  30.994  6.608   1.00 15.16 ? 59  LYS D NZ  1 
ATOM   5367 N  N   . LEU D 1 60  ? 64.376  25.241  12.205  1.00 5.95  ? 60  LEU D N   1 
ATOM   5368 C  CA  . LEU D 1 60  ? 65.189  24.036  12.274  1.00 4.99  ? 60  LEU D CA  1 
ATOM   5369 C  C   . LEU D 1 60  ? 64.436  22.779  11.854  1.00 5.13  ? 60  LEU D C   1 
ATOM   5370 O  O   . LEU D 1 60  ? 65.025  21.867  11.300  1.00 5.24  ? 60  LEU D O   1 
ATOM   5371 C  CB  . LEU D 1 60  ? 65.804  23.862  13.660  1.00 4.62  ? 60  LEU D CB  1 
ATOM   5372 C  CG  . LEU D 1 60  ? 66.848  24.934  14.037  1.00 3.50  ? 60  LEU D CG  1 
ATOM   5373 C  CD1 . LEU D 1 60  ? 67.086  24.938  15.560  1.00 4.18  ? 60  LEU D CD1 1 
ATOM   5374 C  CD2 . LEU D 1 60  ? 68.166  24.727  13.254  1.00 3.65  ? 60  LEU D CD2 1 
ATOM   5375 N  N   . ASP D 1 61  ? 63.134  22.725  12.121  1.00 4.95  ? 61  ASP D N   1 
ATOM   5376 C  CA  . ASP D 1 61  ? 62.363  21.537  11.781  1.00 6.15  ? 61  ASP D CA  1 
ATOM   5377 C  C   . ASP D 1 61  ? 62.269  21.342  10.274  1.00 6.53  ? 61  ASP D C   1 
ATOM   5378 O  O   . ASP D 1 61  ? 62.080  20.229  9.812   1.00 7.00  ? 61  ASP D O   1 
ATOM   5379 C  CB  . ASP D 1 61  ? 60.970  21.635  12.391  1.00 5.39  ? 61  ASP D CB  1 
ATOM   5380 C  CG  . ASP D 1 61  ? 60.953  21.300  13.866  1.00 7.18  ? 61  ASP D CG  1 
ATOM   5381 O  OD1 . ASP D 1 61  ? 62.041  21.138  14.467  1.00 8.16  ? 61  ASP D OD1 1 
ATOM   5382 O  OD2 . ASP D 1 61  ? 59.840  21.206  14.425  1.00 10.66 ? 61  ASP D OD2 1 
ATOM   5383 N  N   . GLN D 1 62  ? 62.446  22.422  9.520   1.00 6.72  ? 62  GLN D N   1 
ATOM   5384 C  CA  . GLN D 1 62  ? 62.410  22.382  8.046   1.00 7.13  ? 62  GLN D CA  1 
ATOM   5385 C  C   . GLN D 1 62  ? 63.651  21.753  7.420   1.00 7.36  ? 62  GLN D C   1 
ATOM   5386 O  O   . GLN D 1 62  ? 63.662  21.443  6.219   1.00 8.34  ? 62  GLN D O   1 
ATOM   5387 C  CB  . GLN D 1 62  ? 62.213  23.791  7.458   1.00 7.23  ? 62  GLN D CB  1 
ATOM   5388 C  CG  . GLN D 1 62  ? 60.860  24.413  7.790   1.00 8.83  ? 62  GLN D CG  1 
ATOM   5389 C  CD  . GLN D 1 62  ? 60.666  25.807  7.200   1.00 11.48 ? 62  GLN D CD  1 
ATOM   5390 O  OE1 . GLN D 1 62  ? 59.878  26.608  7.716   1.00 12.39 ? 62  GLN D OE1 1 
ATOM   5391 N  NE2 . GLN D 1 62  ? 61.371  26.095  6.111   1.00 12.56 ? 62  GLN D NE2 1 
ATOM   5392 N  N   . LEU D 1 63  ? 64.695  21.579  8.228   1.00 7.12  ? 63  LEU D N   1 
ATOM   5393 C  CA  . LEU D 1 63  ? 65.982  21.108  7.738   1.00 7.00  ? 63  LEU D CA  1 
ATOM   5394 C  C   . LEU D 1 63  ? 65.991  19.600  7.484   1.00 7.69  ? 63  LEU D C   1 
ATOM   5395 O  O   . LEU D 1 63  ? 65.215  18.853  8.080   1.00 8.17  ? 63  LEU D O   1 
ATOM   5396 C  CB  . LEU D 1 63  ? 67.106  21.520  8.708   1.00 6.43  ? 63  LEU D CB  1 
ATOM   5397 C  CG  . LEU D 1 63  ? 67.491  23.011  8.720   1.00 4.97  ? 63  LEU D CG  1 
ATOM   5398 C  CD1 . LEU D 1 63  ? 68.298  23.509  9.986   1.00 5.05  ? 63  LEU D CD1 1 
ATOM   5399 C  CD2 . LEU D 1 63  ? 68.279  23.292  7.469   1.00 6.24  ? 63  LEU D CD2 1 
ATOM   5400 N  N   . PRO D 1 64  ? 66.858  19.141  6.581   1.00 8.02  ? 64  PRO D N   1 
ATOM   5401 C  CA  . PRO D 1 64  ? 67.007  17.706  6.421   1.00 8.38  ? 64  PRO D CA  1 
ATOM   5402 C  C   . PRO D 1 64  ? 67.474  17.135  7.752   1.00 8.56  ? 64  PRO D C   1 
ATOM   5403 O  O   . PRO D 1 64  ? 68.091  17.860  8.544   1.00 8.93  ? 64  PRO D O   1 
ATOM   5404 C  CB  . PRO D 1 64  ? 68.099  17.594  5.359   1.00 8.66  ? 64  PRO D CB  1 
ATOM   5405 C  CG  . PRO D 1 64  ? 67.958  18.866  4.568   1.00 7.68  ? 64  PRO D CG  1 
ATOM   5406 C  CD  . PRO D 1 64  ? 67.666  19.891  5.608   1.00 8.11  ? 64  PRO D CD  1 
ATOM   5407 N  N   . ALA D 1 65  ? 67.187  15.866  8.015   1.00 8.70  ? 65  ALA D N   1 
ATOM   5408 C  CA  . ALA D 1 65  ? 67.433  15.320  9.343   1.00 8.51  ? 65  ALA D CA  1 
ATOM   5409 C  C   . ALA D 1 65  ? 68.902  15.412  9.680   1.00 8.20  ? 65  ALA D C   1 
ATOM   5410 O  O   . ALA D 1 65  ? 69.271  15.620  10.839  1.00 8.58  ? 65  ALA D O   1 
ATOM   5411 C  CB  . ALA D 1 65  ? 66.956  13.842  9.445   1.00 8.48  ? 65  ALA D CB  1 
ATOM   5412 N  N   . ASP D 1 66  ? 69.738  15.252  8.659   1.00 8.28  ? 66  ASP D N   1 
ATOM   5413 C  CA  . ASP D 1 66  ? 71.175  15.126  8.860   1.00 8.43  ? 66  ASP D CA  1 
ATOM   5414 C  C   . ASP D 1 66  ? 71.888  16.462  8.976   1.00 8.03  ? 66  ASP D C   1 
ATOM   5415 O  O   . ASP D 1 66  ? 73.094  16.483  9.163   1.00 7.99  ? 66  ASP D O   1 
ATOM   5416 C  CB  . ASP D 1 66  ? 71.834  14.232  7.784   1.00 9.64  ? 66  ASP D CB  1 
ATOM   5417 C  CG  . ASP D 1 66  ? 72.028  14.933  6.433   1.00 11.43 ? 66  ASP D CG  1 
ATOM   5418 O  OD1 . ASP D 1 66  ? 71.384  15.971  6.142   1.00 12.98 ? 66  ASP D OD1 1 
ATOM   5419 O  OD2 . ASP D 1 66  ? 72.828  14.412  5.623   1.00 15.71 ? 66  ASP D OD2 1 
ATOM   5420 N  N   . LYS D 1 67  ? 71.139  17.558  8.874   1.00 7.43  ? 67  LYS D N   1 
ATOM   5421 C  CA  . LYS D 1 67  ? 71.699  18.910  9.035   1.00 7.13  ? 67  LYS D CA  1 
ATOM   5422 C  C   . LYS D 1 67  ? 71.240  19.553  10.320  1.00 6.60  ? 67  LYS D C   1 
ATOM   5423 O  O   . LYS D 1 67  ? 71.739  20.592  10.728  1.00 7.10  ? 67  LYS D O   1 
ATOM   5424 C  CB  . LYS D 1 67  ? 71.249  19.823  7.897   1.00 6.85  ? 67  LYS D CB  1 
ATOM   5425 C  CG  . LYS D 1 67  ? 71.625  19.345  6.553   1.00 7.44  ? 67  LYS D CG  1 
ATOM   5426 C  CD  . LYS D 1 67  ? 72.996  19.799  6.171   1.00 7.74  ? 67  LYS D CD  1 
ATOM   5427 C  CE  . LYS D 1 67  ? 73.371  19.143  4.840   1.00 10.40 ? 67  LYS D CE  1 
ATOM   5428 N  NZ  . LYS D 1 67  ? 74.588  19.776  4.256   1.00 9.42  ? 67  LYS D NZ  1 
ATOM   5429 N  N   . LYS D 1 68  ? 70.255  18.942  10.952  1.00 5.91  ? 68  LYS D N   1 
ATOM   5430 C  CA  . LYS D 1 68  ? 69.553  19.597  12.034  1.00 6.06  ? 68  LYS D CA  1 
ATOM   5431 C  C   . LYS D 1 68  ? 70.457  19.951  13.196  1.00 5.42  ? 68  LYS D C   1 
ATOM   5432 O  O   . LYS D 1 68  ? 70.457  21.093  13.637  1.00 6.52  ? 68  LYS D O   1 
ATOM   5433 C  CB  . LYS D 1 68  ? 68.407  18.716  12.509  1.00 5.82  ? 68  LYS D CB  1 
ATOM   5434 C  CG  . LYS D 1 68  ? 67.254  18.656  11.496  1.00 7.97  ? 68  LYS D CG  1 
ATOM   5435 C  CD  . LYS D 1 68  ? 66.059  17.867  12.038  1.00 9.22  ? 68  LYS D CD  1 
ATOM   5436 C  CE  . LYS D 1 68  ? 64.878  17.964  11.071  1.00 12.48 ? 68  LYS D CE  1 
ATOM   5437 N  NZ  . LYS D 1 68  ? 63.675  17.257  11.624  1.00 13.77 ? 68  LYS D NZ  1 
ATOM   5438 N  N   . THR D 1 69  ? 71.195  18.965  13.706  1.00 5.01  ? 69  THR D N   1 
ATOM   5439 C  CA  . THR D 1 69  ? 72.045  19.172  14.883  1.00 4.51  ? 69  THR D CA  1 
ATOM   5440 C  C   . THR D 1 69  ? 73.178  20.143  14.567  1.00 4.48  ? 69  THR D C   1 
ATOM   5441 O  O   . THR D 1 69  ? 73.428  21.099  15.325  1.00 3.82  ? 69  THR D O   1 
ATOM   5442 C  CB  . THR D 1 69  ? 72.643  17.843  15.391  1.00 4.40  ? 69  THR D CB  1 
ATOM   5443 O  OG1 . THR D 1 69  ? 71.591  16.967  15.819  1.00 5.49  ? 69  THR D OG1 1 
ATOM   5444 C  CG2 . THR D 1 69  ? 73.581  18.071  16.583  1.00 4.49  ? 69  THR D CG2 1 
ATOM   5445 N  N   . VAL D 1 70  ? 73.859  19.885  13.461  1.00 3.63  ? 70  VAL D N   1 
ATOM   5446 C  CA  . VAL D 1 70  ? 75.021  20.706  13.093  1.00 3.94  ? 70  VAL D CA  1 
ATOM   5447 C  C   . VAL D 1 70  ? 74.621  22.175  12.965  1.00 3.58  ? 70  VAL D C   1 
ATOM   5448 O  O   . VAL D 1 70  ? 75.351  23.063  13.404  1.00 3.11  ? 70  VAL D O   1 
ATOM   5449 C  CB  . VAL D 1 70  ? 75.750  20.181  11.831  1.00 4.12  ? 70  VAL D CB  1 
ATOM   5450 C  CG1 . VAL D 1 70  ? 74.859  20.288  10.603  1.00 5.95  ? 70  VAL D CG1 1 
ATOM   5451 C  CG2 . VAL D 1 70  ? 77.024  20.974  11.602  1.00 4.21  ? 70  VAL D CG2 1 
ATOM   5452 N  N   . LEU D 1 71  ? 73.461  22.448  12.370  1.00 2.96  ? 71  LEU D N   1 
ATOM   5453 C  CA  . LEU D 1 71  ? 73.024  23.837  12.250  1.00 2.89  ? 71  LEU D CA  1 
ATOM   5454 C  C   . LEU D 1 71  ? 72.470  24.445  13.554  1.00 2.98  ? 71  LEU D C   1 
ATOM   5455 O  O   . LEU D 1 71  ? 72.646  25.629  13.811  1.00 2.61  ? 71  LEU D O   1 
ATOM   5456 C  CB  . LEU D 1 71  ? 72.046  24.025  11.092  1.00 2.25  ? 71  LEU D CB  1 
ATOM   5457 C  CG  . LEU D 1 71  ? 72.788  24.098  9.747   1.00 2.09  ? 71  LEU D CG  1 
ATOM   5458 C  CD1 . LEU D 1 71  ? 71.856  23.976  8.551   1.00 2.01  ? 71  LEU D CD1 1 
ATOM   5459 C  CD2 . LEU D 1 71  ? 73.655  25.352  9.651   1.00 1.64  ? 71  LEU D CD2 1 
ATOM   5460 N  N   . ARG D 1 72  ? 71.765  23.646  14.349  1.00 3.09  ? 72  ARG D N   1 
ATOM   5461 C  CA  . ARG D 1 72  ? 71.313  24.112  15.652  1.00 2.48  ? 72  ARG D CA  1 
ATOM   5462 C  C   . ARG D 1 72  ? 72.517  24.624  16.450  1.00 2.52  ? 72  ARG D C   1 
ATOM   5463 O  O   . ARG D 1 72  ? 72.525  25.747  16.970  1.00 2.59  ? 72  ARG D O   1 
ATOM   5464 C  CB  . ARG D 1 72  ? 70.628  22.961  16.397  1.00 2.95  ? 72  ARG D CB  1 
ATOM   5465 C  CG  . ARG D 1 72  ? 70.355  23.201  17.876  1.00 2.28  ? 72  ARG D CG  1 
ATOM   5466 C  CD  . ARG D 1 72  ? 69.655  21.968  18.440  1.00 3.92  ? 72  ARG D CD  1 
ATOM   5467 N  NE  . ARG D 1 72  ? 69.489  21.966  19.892  1.00 2.82  ? 72  ARG D NE  1 
ATOM   5468 C  CZ  . ARG D 1 72  ? 68.859  21.004  20.564  1.00 3.50  ? 72  ARG D CZ  1 
ATOM   5469 N  NH1 . ARG D 1 72  ? 68.342  19.955  19.931  1.00 5.68  ? 72  ARG D NH1 1 
ATOM   5470 N  NH2 . ARG D 1 72  ? 68.758  21.080  21.879  1.00 4.53  ? 72  ARG D NH2 1 
ATOM   5471 N  N   . ASN D 1 73  ? 73.549  23.796  16.502  1.00 2.37  ? 73  ASN D N   1 
ATOM   5472 C  CA  . ASN D 1 73  ? 74.761  24.110  17.241  1.00 2.73  ? 73  ASN D CA  1 
ATOM   5473 C  C   . ASN D 1 73  ? 75.511  25.300  16.650  1.00 2.47  ? 73  ASN D C   1 
ATOM   5474 O  O   . ASN D 1 73  ? 75.875  26.214  17.366  1.00 2.07  ? 73  ASN D O   1 
ATOM   5475 C  CB  . ASN D 1 73  ? 75.663  22.866  17.325  1.00 2.75  ? 73  ASN D CB  1 
ATOM   5476 C  CG  . ASN D 1 73  ? 75.058  21.762  18.190  1.00 2.80  ? 73  ASN D CG  1 
ATOM   5477 O  OD1 . ASN D 1 73  ? 74.150  22.007  18.975  1.00 2.57  ? 73  ASN D OD1 1 
ATOM   5478 N  ND2 . ASN D 1 73  ? 75.554  20.554  18.042  1.00 1.64  ? 73  ASN D ND2 1 
ATOM   5479 N  N   . ASN D 1 74  ? 75.712  25.309  15.338  1.00 2.90  ? 74  ASN D N   1 
ATOM   5480 C  CA  . ASN D 1 74  ? 76.600  26.318  14.750  1.00 3.38  ? 74  ASN D CA  1 
ATOM   5481 C  C   . ASN D 1 74  ? 75.879  27.582  14.303  1.00 3.72  ? 74  ASN D C   1 
ATOM   5482 O  O   . ASN D 1 74  ? 76.375  28.679  14.487  1.00 3.25  ? 74  ASN D O   1 
ATOM   5483 C  CB  . ASN D 1 74  ? 77.460  25.723  13.634  1.00 3.28  ? 74  ASN D CB  1 
ATOM   5484 C  CG  . ASN D 1 74  ? 78.456  24.700  14.154  1.00 3.04  ? 74  ASN D CG  1 
ATOM   5485 O  OD1 . ASN D 1 74  ? 79.496  25.062  14.704  1.00 4.38  ? 74  ASN D OD1 1 
ATOM   5486 N  ND2 . ASN D 1 74  ? 78.142  23.409  13.988  1.00 2.61  ? 74  ASN D ND2 1 
ATOM   5487 N  N   . ALA D 1 75  ? 74.683  27.437  13.753  1.00 3.51  ? 75  ALA D N   1 
ATOM   5488 C  CA  . ALA D 1 75  ? 73.908  28.629  13.484  1.00 3.40  ? 75  ALA D CA  1 
ATOM   5489 C  C   . ALA D 1 75  ? 73.461  29.254  14.804  1.00 2.80  ? 75  ALA D C   1 
ATOM   5490 O  O   . ALA D 1 75  ? 73.436  30.473  14.957  1.00 2.35  ? 75  ALA D O   1 
ATOM   5491 C  CB  . ALA D 1 75  ? 72.722  28.353  12.565  1.00 3.58  ? 75  ALA D CB  1 
ATOM   5492 N  N   . GLY D 1 76  ? 73.117  28.424  15.782  1.00 2.66  ? 76  GLY D N   1 
ATOM   5493 C  CA  . GLY D 1 76  ? 72.852  28.957  17.107  1.00 2.83  ? 76  GLY D CA  1 
ATOM   5494 C  C   . GLY D 1 76  ? 74.028  29.759  17.639  1.00 2.86  ? 76  GLY D C   1 
ATOM   5495 O  O   . GLY D 1 76  ? 73.870  30.887  18.070  1.00 3.29  ? 76  GLY D O   1 
ATOM   5496 N  N   . GLY D 1 77  ? 75.216  29.173  17.584  1.00 2.97  ? 77  GLY D N   1 
ATOM   5497 C  CA  . GLY D 1 77  ? 76.425  29.860  18.056  1.00 2.71  ? 77  GLY D CA  1 
ATOM   5498 C  C   . GLY D 1 77  ? 76.653  31.163  17.324  1.00 3.22  ? 77  GLY D C   1 
ATOM   5499 O  O   . GLY D 1 77  ? 77.016  32.180  17.926  1.00 2.38  ? 77  GLY D O   1 
ATOM   5500 N  N   . HIS D 1 78  ? 76.453  31.153  16.012  1.00 3.15  ? 78  HIS D N   1 
ATOM   5501 C  CA  . HIS D 1 78  ? 76.663  32.362  15.242  1.00 2.83  ? 78  HIS D CA  1 
ATOM   5502 C  C   . HIS D 1 78  ? 75.657  33.452  15.648  1.00 3.00  ? 78  HIS D C   1 
ATOM   5503 O  O   . HIS D 1 78  ? 76.032  34.590  15.918  1.00 2.90  ? 78  HIS D O   1 
ATOM   5504 C  CB  . HIS D 1 78  ? 76.624  32.029  13.746  1.00 3.50  ? 78  HIS D CB  1 
ATOM   5505 C  CG  . HIS D 1 78  ? 76.704  33.225  12.844  1.00 3.18  ? 78  HIS D CG  1 
ATOM   5506 N  ND1 . HIS D 1 78  ? 77.627  34.235  13.018  1.00 4.07  ? 78  HIS D ND1 1 
ATOM   5507 C  CD2 . HIS D 1 78  ? 75.959  33.579  11.764  1.00 3.46  ? 78  HIS D CD2 1 
ATOM   5508 C  CE1 . HIS D 1 78  ? 77.458  35.149  12.075  1.00 4.35  ? 78  HIS D CE1 1 
ATOM   5509 N  NE2 . HIS D 1 78  ? 76.455  34.774  11.300  1.00 4.02  ? 78  HIS D NE2 1 
ATOM   5510 N  N   . ALA D 1 79  ? 74.381  33.109  15.721  1.00 2.34  ? 79  ALA D N   1 
ATOM   5511 C  CA  . ALA D 1 79  ? 73.374  34.106  16.146  1.00 3.66  ? 79  ALA D CA  1 
ATOM   5512 C  C   . ALA D 1 79  ? 73.597  34.597  17.571  1.00 3.93  ? 79  ALA D C   1 
ATOM   5513 O  O   . ALA D 1 79  ? 73.473  35.792  17.854  1.00 4.76  ? 79  ALA D O   1 
ATOM   5514 C  CB  . ALA D 1 79  ? 71.944  33.564  15.965  1.00 4.44  ? 79  ALA D CB  1 
ATOM   5515 N  N   . ASN D 1 80  ? 73.936  33.681  18.470  1.00 3.77  ? 80  ASN D N   1 
ATOM   5516 C  CA  . ASN D 1 80  ? 74.137  34.040  19.870  1.00 3.23  ? 80  ASN D CA  1 
ATOM   5517 C  C   . ASN D 1 80  ? 75.334  34.949  20.101  1.00 2.85  ? 80  ASN D C   1 
ATOM   5518 O  O   . ASN D 1 80  ? 75.210  35.976  20.749  1.00 2.56  ? 80  ASN D O   1 
ATOM   5519 C  CB  . ASN D 1 80  ? 74.276  32.793  20.737  1.00 3.48  ? 80  ASN D CB  1 
ATOM   5520 C  CG  . ASN D 1 80  ? 73.012  31.990  20.782  1.00 3.17  ? 80  ASN D CG  1 
ATOM   5521 O  OD1 . ASN D 1 80  ? 71.933  32.477  20.416  1.00 2.83  ? 80  ASN D OD1 1 
ATOM   5522 N  ND2 . ASN D 1 80  ? 73.122  30.744  21.236  1.00 5.25  ? 80  ASN D ND2 1 
ATOM   5523 N  N   . HIS D 1 81  ? 76.481  34.596  19.527  1.00 3.06  ? 81  HIS D N   1 
ATOM   5524 C  CA  . HIS D 1 81  ? 77.650  35.459  19.655  1.00 3.29  ? 81  HIS D CA  1 
ATOM   5525 C  C   . HIS D 1 81  ? 77.495  36.806  18.921  1.00 3.92  ? 81  HIS D C   1 
ATOM   5526 O  O   . HIS D 1 81  ? 77.958  37.830  19.423  1.00 4.19  ? 81  HIS D O   1 
ATOM   5527 C  CB  . HIS D 1 81  ? 78.944  34.739  19.259  1.00 3.62  ? 81  HIS D CB  1 
ATOM   5528 C  CG  . HIS D 1 81  ? 79.317  33.649  20.216  1.00 4.00  ? 81  HIS D CG  1 
ATOM   5529 N  ND1 . HIS D 1 81  ? 78.773  32.381  20.143  1.00 4.19  ? 81  HIS D ND1 1 
ATOM   5530 C  CD2 . HIS D 1 81  ? 80.113  33.652  21.317  1.00 3.80  ? 81  HIS D CD2 1 
ATOM   5531 C  CE1 . HIS D 1 81  ? 79.253  31.643  21.132  1.00 4.53  ? 81  HIS D CE1 1 
ATOM   5532 N  NE2 . HIS D 1 81  ? 80.052  32.395  21.868  1.00 4.64  ? 81  HIS D NE2 1 
ATOM   5533 N  N   . SER D 1 82  ? 76.838  36.801  17.764  1.00 4.43  ? 82  SER D N   1 
ATOM   5534 C  CA  . SER D 1 82  ? 76.557  38.043  17.051  1.00 4.69  ? 82  SER D CA  1 
ATOM   5535 C  C   . SER D 1 82  ? 75.767  39.002  17.932  1.00 5.00  ? 82  SER D C   1 
ATOM   5536 O  O   . SER D 1 82  ? 76.084  40.162  18.032  1.00 5.02  ? 82  SER D O   1 
ATOM   5537 C  CB  . SER D 1 82  ? 75.805  37.768  15.732  1.00 4.42  ? 82  SER D CB  1 
ATOM   5538 O  OG  . SER D 1 82  ? 76.656  37.126  14.805  1.00 6.16  ? 82  SER D OG  1 
ATOM   5539 N  N   . LEU D 1 83  ? 74.724  38.490  18.572  1.00 3.90  ? 83  LEU D N   1 
ATOM   5540 C  CA  . LEU D 1 83  ? 73.966  39.266  19.525  1.00 3.98  ? 83  LEU D CA  1 
ATOM   5541 C  C   . LEU D 1 83  ? 74.863  39.680  20.708  1.00 3.92  ? 83  LEU D C   1 
ATOM   5542 O  O   . LEU D 1 83  ? 74.884  40.850  21.118  1.00 4.64  ? 83  LEU D O   1 
ATOM   5543 C  CB  . LEU D 1 83  ? 72.784  38.440  19.991  1.00 3.36  ? 83  LEU D CB  1 
ATOM   5544 C  CG  . LEU D 1 83  ? 71.698  39.153  20.774  1.00 3.74  ? 83  LEU D CG  1 
ATOM   5545 C  CD1 . LEU D 1 83  ? 70.437  38.294  20.750  1.00 5.08  ? 83  LEU D CD1 1 
ATOM   5546 C  CD2 . LEU D 1 83  ? 72.138  39.482  22.202  1.00 4.39  ? 83  LEU D CD2 1 
ATOM   5547 N  N   . PHE D 1 84  ? 75.600  38.726  21.254  1.00 4.33  ? 84  PHE D N   1 
ATOM   5548 C  CA  . PHE D 1 84  ? 76.487  38.995  22.400  1.00 4.94  ? 84  PHE D CA  1 
ATOM   5549 C  C   . PHE D 1 84  ? 77.391  40.220  22.148  1.00 5.38  ? 84  PHE D C   1 
ATOM   5550 O  O   . PHE D 1 84  ? 77.434  41.143  22.967  1.00 5.46  ? 84  PHE D O   1 
ATOM   5551 C  CB  . PHE D 1 84  ? 77.311  37.743  22.780  1.00 4.81  ? 84  PHE D CB  1 
ATOM   5552 C  CG  . PHE D 1 84  ? 77.993  37.814  24.144  1.00 4.60  ? 84  PHE D CG  1 
ATOM   5553 C  CD1 . PHE D 1 84  ? 77.292  38.224  25.289  1.00 3.31  ? 84  PHE D CD1 1 
ATOM   5554 C  CD2 . PHE D 1 84  ? 79.309  37.409  24.293  1.00 3.97  ? 84  PHE D CD2 1 
ATOM   5555 C  CE1 . PHE D 1 84  ? 77.926  38.268  26.532  1.00 3.71  ? 84  PHE D CE1 1 
ATOM   5556 C  CE2 . PHE D 1 84  ? 79.941  37.440  25.545  1.00 2.70  ? 84  PHE D CE2 1 
ATOM   5557 C  CZ  . PHE D 1 84  ? 79.243  37.872  26.659  1.00 4.50  ? 84  PHE D CZ  1 
ATOM   5558 N  N   . TRP D 1 85  ? 78.103  40.260  21.020  1.00 5.69  ? 85  TRP D N   1 
ATOM   5559 C  CA  . TRP D 1 85  ? 79.058  41.356  20.840  1.00 5.26  ? 85  TRP D CA  1 
ATOM   5560 C  C   . TRP D 1 85  ? 78.386  42.744  20.862  1.00 5.32  ? 85  TRP D C   1 
ATOM   5561 O  O   . TRP D 1 85  ? 78.915  43.690  21.444  1.00 6.12  ? 85  TRP D O   1 
ATOM   5562 C  CB  . TRP D 1 85  ? 79.884  41.181  19.558  1.00 4.69  ? 85  TRP D CB  1 
ATOM   5563 C  CG  . TRP D 1 85  ? 80.481  39.813  19.324  1.00 3.60  ? 85  TRP D CG  1 
ATOM   5564 C  CD1 . TRP D 1 85  ? 80.401  39.078  18.170  1.00 4.42  ? 85  TRP D CD1 1 
ATOM   5565 C  CD2 . TRP D 1 85  ? 81.239  39.020  20.247  1.00 3.56  ? 85  TRP D CD2 1 
ATOM   5566 N  NE1 . TRP D 1 85  ? 81.065  37.892  18.318  1.00 5.43  ? 85  TRP D NE1 1 
ATOM   5567 C  CE2 . TRP D 1 85  ? 81.601  37.829  19.577  1.00 3.79  ? 85  TRP D CE2 1 
ATOM   5568 C  CE3 . TRP D 1 85  ? 81.674  39.210  21.565  1.00 3.81  ? 85  TRP D CE3 1 
ATOM   5569 C  CZ2 . TRP D 1 85  ? 82.355  36.816  20.187  1.00 3.74  ? 85  TRP D CZ2 1 
ATOM   5570 C  CZ3 . TRP D 1 85  ? 82.449  38.199  22.168  1.00 2.90  ? 85  TRP D CZ3 1 
ATOM   5571 C  CH2 . TRP D 1 85  ? 82.767  37.021  21.479  1.00 3.78  ? 85  TRP D CH2 1 
ATOM   5572 N  N   . LYS D 1 86  ? 77.218  42.844  20.238  1.00 5.72  ? 86  LYS D N   1 
ATOM   5573 C  CA  . LYS D 1 86  ? 76.524  44.121  20.063  1.00 6.12  ? 86  LYS D CA  1 
ATOM   5574 C  C   . LYS D 1 86  ? 75.862  44.487  21.366  1.00 6.76  ? 86  LYS D C   1 
ATOM   5575 O  O   . LYS D 1 86  ? 75.479  45.635  21.593  1.00 6.17  ? 86  LYS D O   1 
ATOM   5576 C  CB  . LYS D 1 86  ? 75.465  44.031  18.955  1.00 6.25  ? 86  LYS D CB  1 
ATOM   5577 C  CG  . LYS D 1 86  ? 76.010  43.851  17.551  1.00 8.51  ? 86  LYS D CG  1 
ATOM   5578 C  CD  . LYS D 1 86  ? 76.622  45.114  16.977  1.00 10.98 ? 86  LYS D CD  1 
ATOM   5579 C  CE  . LYS D 1 86  ? 76.748  44.970  15.455  1.00 12.44 ? 86  LYS D CE  1 
ATOM   5580 N  NZ  . LYS D 1 86  ? 78.118  45.240  14.903  1.00 11.81 ? 86  LYS D NZ  1 
ATOM   5581 N  N   . GLY D 1 87  ? 75.739  43.487  22.229  1.00 6.47  ? 87  GLY D N   1 
ATOM   5582 C  CA  . GLY D 1 87  ? 74.966  43.629  23.447  1.00 6.86  ? 87  GLY D CA  1 
ATOM   5583 C  C   . GLY D 1 87  ? 75.867  43.974  24.617  1.00 7.39  ? 87  GLY D C   1 
ATOM   5584 O  O   . GLY D 1 87  ? 75.435  43.916  25.771  1.00 8.29  ? 87  GLY D O   1 
ATOM   5585 N  N   . LEU D 1 88  ? 77.123  44.302  24.301  1.00 7.50  ? 88  LEU D N   1 
ATOM   5586 C  CA  . LEU D 1 88  ? 78.137  44.718  25.276  1.00 7.54  ? 88  LEU D CA  1 
ATOM   5587 C  C   . LEU D 1 88  ? 78.681  46.095  24.907  1.00 7.90  ? 88  LEU D C   1 
ATOM   5588 O  O   . LEU D 1 88  ? 79.135  46.327  23.774  1.00 8.33  ? 88  LEU D O   1 
ATOM   5589 C  CB  . LEU D 1 88  ? 79.310  43.743  25.304  1.00 7.63  ? 88  LEU D CB  1 
ATOM   5590 C  CG  . LEU D 1 88  ? 79.040  42.288  25.669  1.00 6.92  ? 88  LEU D CG  1 
ATOM   5591 C  CD1 . LEU D 1 88  ? 80.298  41.442  25.492  1.00 4.72  ? 88  LEU D CD1 1 
ATOM   5592 C  CD2 . LEU D 1 88  ? 78.485  42.205  27.084  1.00 6.04  ? 88  LEU D CD2 1 
ATOM   5593 N  N   . LYS D 1 89  ? 78.666  46.993  25.884  1.00 8.86  ? 89  LYS D N   1 
ATOM   5594 C  CA  . LYS D 1 89  ? 79.192  48.336  25.712  1.00 8.59  ? 89  LYS D CA  1 
ATOM   5595 C  C   . LYS D 1 89  ? 79.307  48.897  27.119  1.00 9.25  ? 89  LYS D C   1 
ATOM   5596 O  O   . LYS D 1 89  ? 78.522  48.518  27.992  1.00 9.61  ? 89  LYS D O   1 
ATOM   5597 C  CB  . LYS D 1 89  ? 78.249  49.187  24.858  1.00 8.84  ? 89  LYS D CB  1 
ATOM   5598 C  CG  . LYS D 1 89  ? 78.885  50.503  24.381  1.00 9.49  ? 89  LYS D CG  1 
ATOM   5599 C  CD  . LYS D 1 89  ? 77.922  51.348  23.561  1.00 9.71  ? 89  LYS D CD  1 
ATOM   5600 C  CE  . LYS D 1 89  ? 78.642  52.618  23.048  1.00 10.93 ? 89  LYS D CE  1 
ATOM   5601 N  NZ  . LYS D 1 89  ? 77.684  53.733  22.701  1.00 13.51 ? 89  LYS D NZ  1 
ATOM   5602 N  N   . LYS D 1 90  ? 80.308  49.739  27.357  1.00 9.09  ? 90  LYS D N   1 
ATOM   5603 C  CA  . LYS D 1 90  ? 80.452  50.427  28.648  1.00 9.85  ? 90  LYS D CA  1 
ATOM   5604 C  C   . LYS D 1 90  ? 79.780  51.794  28.554  1.00 9.80  ? 90  LYS D C   1 
ATOM   5605 O  O   . LYS D 1 90  ? 79.591  52.318  27.459  1.00 10.61 ? 90  LYS D O   1 
ATOM   5606 C  CB  . LYS D 1 90  ? 81.924  50.619  29.017  1.00 9.90  ? 90  LYS D CB  1 
ATOM   5607 C  CG  . LYS D 1 90  ? 82.663  49.345  29.428  1.00 11.47 ? 90  LYS D CG  1 
ATOM   5608 C  CD  . LYS D 1 90  ? 84.145  49.600  29.709  1.00 12.04 ? 90  LYS D CD  1 
ATOM   5609 C  CE  . LYS D 1 90  ? 84.322  50.459  30.963  1.00 12.29 ? 90  LYS D CE  1 
ATOM   5610 N  NZ  . LYS D 1 90  ? 85.649  51.154  30.973  1.00 11.95 ? 90  LYS D NZ  1 
ATOM   5611 N  N   . GLY D 1 91  ? 79.397  52.355  29.694  1.00 9.59  ? 91  GLY D N   1 
ATOM   5612 C  CA  . GLY D 1 91  ? 78.876  53.726  29.719  1.00 9.30  ? 91  GLY D CA  1 
ATOM   5613 C  C   . GLY D 1 91  ? 77.423  53.899  29.323  1.00 9.13  ? 91  GLY D C   1 
ATOM   5614 O  O   . GLY D 1 91  ? 76.972  55.011  29.059  1.00 8.73  ? 91  GLY D O   1 
ATOM   5615 N  N   . THR D 1 92  ? 76.673  52.803  29.319  1.00 9.19  ? 92  THR D N   1 
ATOM   5616 C  CA  . THR D 1 92  ? 75.238  52.862  29.107  1.00 9.54  ? 92  THR D CA  1 
ATOM   5617 C  C   . THR D 1 92  ? 74.495  52.966  30.448  1.00 9.91  ? 92  THR D C   1 
ATOM   5618 O  O   . THR D 1 92  ? 75.021  52.581  31.492  1.00 10.99 ? 92  THR D O   1 
ATOM   5619 C  CB  . THR D 1 92  ? 74.738  51.644  28.268  1.00 9.64  ? 92  THR D CB  1 
ATOM   5620 O  OG1 . THR D 1 92  ? 74.659  50.461  29.081  1.00 10.31 ? 92  THR D OG1 1 
ATOM   5621 C  CG2 . THR D 1 92  ? 75.692  51.379  27.112  1.00 9.73  ? 92  THR D CG2 1 
ATOM   5622 N  N   . THR D 1 93  ? 73.289  53.521  30.423  1.00 10.73 ? 93  THR D N   1 
ATOM   5623 C  CA  . THR D 1 93  ? 72.433  53.490  31.609  1.00 10.68 ? 93  THR D CA  1 
ATOM   5624 C  C   . THR D 1 93  ? 71.037  52.983  31.232  1.00 10.80 ? 93  THR D C   1 
ATOM   5625 O  O   . THR D 1 93  ? 70.432  53.455  30.266  1.00 12.10 ? 93  THR D O   1 
ATOM   5626 C  CB  . THR D 1 93  ? 72.359  54.860  32.317  1.00 10.99 ? 93  THR D CB  1 
ATOM   5627 O  OG1 . THR D 1 93  ? 73.682  55.389  32.484  1.00 12.43 ? 93  THR D OG1 1 
ATOM   5628 C  CG2 . THR D 1 93  ? 71.742  54.701  33.689  1.00 10.02 ? 93  THR D CG2 1 
ATOM   5629 N  N   . LEU D 1 94  ? 70.523  52.006  31.977  1.00 10.65 ? 94  LEU D N   1 
ATOM   5630 C  CA  . LEU D 1 94  ? 69.155  51.537  31.746  1.00 10.38 ? 94  LEU D CA  1 
ATOM   5631 C  C   . LEU D 1 94  ? 68.127  52.672  31.957  1.00 10.86 ? 94  LEU D C   1 
ATOM   5632 O  O   . LEU D 1 94  ? 68.132  53.350  32.989  1.00 12.11 ? 94  LEU D O   1 
ATOM   5633 C  CB  . LEU D 1 94  ? 68.873  50.306  32.614  1.00 10.28 ? 94  LEU D CB  1 
ATOM   5634 C  CG  . LEU D 1 94  ? 67.466  49.726  32.733  1.00 9.19  ? 94  LEU D CG  1 
ATOM   5635 C  CD1 . LEU D 1 94  ? 67.002  49.150  31.421  1.00 10.49 ? 94  LEU D CD1 1 
ATOM   5636 C  CD2 . LEU D 1 94  ? 67.465  48.698  33.816  1.00 9.70  ? 94  LEU D CD2 1 
ATOM   5637 N  N   . GLN D 1 95  ? 67.259  52.891  30.969  1.00 10.90 ? 95  GLN D N   1 
ATOM   5638 C  CA  . GLN D 1 95  ? 66.308  54.009  31.020  1.00 11.24 ? 95  GLN D CA  1 
ATOM   5639 C  C   . GLN D 1 95  ? 65.025  53.779  30.219  1.00 11.53 ? 95  GLN D C   1 
ATOM   5640 O  O   . GLN D 1 95  ? 64.855  52.735  29.577  1.00 12.15 ? 95  GLN D O   1 
ATOM   5641 C  CB  . GLN D 1 95  ? 66.997  55.302  30.551  1.00 11.51 ? 95  GLN D CB  1 
ATOM   5642 C  CG  . GLN D 1 95  ? 68.278  55.088  29.741  1.00 12.44 ? 95  GLN D CG  1 
ATOM   5643 C  CD  . GLN D 1 95  ? 68.899  56.387  29.260  1.00 13.97 ? 95  GLN D CD  1 
ATOM   5644 O  OE1 . GLN D 1 95  ? 70.125  56.556  29.298  1.00 15.85 ? 95  GLN D OE1 1 
ATOM   5645 N  NE2 . GLN D 1 95  ? 68.063  57.310  28.805  1.00 14.52 ? 95  GLN D NE2 1 
ATOM   5646 N  N   . GLY D 1 96  ? 64.120  54.759  30.279  1.00 11.60 ? 96  GLY D N   1 
ATOM   5647 C  CA  . GLY D 1 96  ? 62.948  54.813  29.404  1.00 11.09 ? 96  GLY D CA  1 
ATOM   5648 C  C   . GLY D 1 96  ? 62.000  53.633  29.493  1.00 11.08 ? 96  GLY D C   1 
ATOM   5649 O  O   . GLY D 1 96  ? 61.853  53.019  30.557  1.00 11.25 ? 96  GLY D O   1 
ATOM   5650 N  N   . ASP D 1 97  ? 61.355  53.324  28.369  1.00 10.78 ? 97  ASP D N   1 
ATOM   5651 C  CA  . ASP D 1 97  ? 60.356  52.283  28.335  1.00 11.12 ? 97  ASP D CA  1 
ATOM   5652 C  C   . ASP D 1 97  ? 60.921  50.985  28.879  1.00 11.10 ? 97  ASP D C   1 
ATOM   5653 O  O   . ASP D 1 97  ? 60.265  50.308  29.668  1.00 12.17 ? 97  ASP D O   1 
ATOM   5654 C  CB  . ASP D 1 97  ? 59.835  52.079  26.906  1.00 11.27 ? 97  ASP D CB  1 
ATOM   5655 C  CG  . ASP D 1 97  ? 59.512  53.394  26.213  1.00 12.67 ? 97  ASP D CG  1 
ATOM   5656 O  OD1 . ASP D 1 97  ? 59.566  54.442  26.898  1.00 15.20 ? 97  ASP D OD1 1 
ATOM   5657 O  OD2 . ASP D 1 97  ? 59.218  53.393  24.991  1.00 14.68 ? 97  ASP D OD2 1 
ATOM   5658 N  N   . LEU D 1 98  ? 62.134  50.632  28.456  1.00 10.89 ? 98  LEU D N   1 
ATOM   5659 C  CA  . LEU D 1 98  ? 62.702  49.322  28.819  1.00 10.61 ? 98  LEU D CA  1 
ATOM   5660 C  C   . LEU D 1 98  ? 62.884  49.217  30.329  1.00 10.74 ? 98  LEU D C   1 
ATOM   5661 O  O   . LEU D 1 98  ? 62.465  48.235  30.945  1.00 11.51 ? 98  LEU D O   1 
ATOM   5662 C  CB  . LEU D 1 98  ? 64.026  49.064  28.095  1.00 10.66 ? 98  LEU D CB  1 
ATOM   5663 C  CG  . LEU D 1 98  ? 64.886  47.895  28.587  1.00 11.39 ? 98  LEU D CG  1 
ATOM   5664 C  CD1 . LEU D 1 98  ? 64.136  46.579  28.538  1.00 11.00 ? 98  LEU D CD1 1 
ATOM   5665 C  CD2 . LEU D 1 98  ? 66.213  47.803  27.799  1.00 12.42 ? 98  LEU D CD2 1 
ATOM   5666 N  N   . LYS D 1 99  ? 63.486  50.230  30.935  1.00 10.73 ? 99  LYS D N   1 
ATOM   5667 C  CA  . LYS D 1 99  ? 63.546  50.280  32.393  1.00 11.13 ? 99  LYS D CA  1 
ATOM   5668 C  C   . LYS D 1 99  ? 62.148  50.160  32.999  1.00 10.61 ? 99  LYS D C   1 
ATOM   5669 O  O   . LYS D 1 99  ? 61.895  49.309  33.852  1.00 11.66 ? 99  LYS D O   1 
ATOM   5670 C  CB  . LYS D 1 99  ? 64.209  51.570  32.884  1.00 11.39 ? 99  LYS D CB  1 
ATOM   5671 C  CG  . LYS D 1 99  ? 64.273  51.652  34.406  1.00 12.26 ? 99  LYS D CG  1 
ATOM   5672 C  CD  . LYS D 1 99  ? 65.103  52.846  34.868  1.00 12.80 ? 99  LYS D CD  1 
ATOM   5673 C  CE  . LYS D 1 99  ? 65.400  52.794  36.354  1.00 13.39 ? 99  LYS D CE  1 
ATOM   5674 N  NZ  . LYS D 1 99  ? 66.132  54.009  36.773  1.00 14.68 ? 99  LYS D NZ  1 
ATOM   5675 N  N   . ALA D 1 100 ? 61.250  51.025  32.542  1.00 10.50 ? 100 ALA D N   1 
ATOM   5676 C  CA  . ALA D 1 100 ? 59.846  50.989  32.927  1.00 10.11 ? 100 ALA D CA  1 
ATOM   5677 C  C   . ALA D 1 100 ? 59.220  49.597  32.770  1.00 10.31 ? 100 ALA D C   1 
ATOM   5678 O  O   . ALA D 1 100 ? 58.551  49.112  33.671  1.00 11.45 ? 100 ALA D O   1 
ATOM   5679 C  CB  . ALA D 1 100 ? 59.072  52.012  32.120  1.00 10.49 ? 100 ALA D CB  1 
ATOM   5680 N  N   . ALA D 1 101 ? 59.446  48.953  31.633  1.00 9.77  ? 101 ALA D N   1 
ATOM   5681 C  CA  . ALA D 1 101 ? 58.921  47.605  31.404  1.00 9.15  ? 101 ALA D CA  1 
ATOM   5682 C  C   . ALA D 1 101 ? 59.469  46.600  32.421  1.00 9.43  ? 101 ALA D C   1 
ATOM   5683 O  O   . ALA D 1 101 ? 58.739  45.726  32.932  1.00 9.30  ? 101 ALA D O   1 
ATOM   5684 C  CB  . ALA D 1 101 ? 59.226  47.155  29.978  1.00 9.39  ? 101 ALA D CB  1 
ATOM   5685 N  N   . ILE D 1 102 ? 60.757  46.733  32.711  1.00 9.54  ? 102 ILE D N   1 
ATOM   5686 C  CA  . ILE D 1 102 ? 61.438  45.839  33.631  1.00 10.11 ? 102 ILE D CA  1 
ATOM   5687 C  C   . ILE D 1 102 ? 60.834  45.972  35.018  1.00 10.06 ? 102 ILE D C   1 
ATOM   5688 O  O   . ILE D 1 102 ? 60.627  44.978  35.723  1.00 10.39 ? 102 ILE D O   1 
ATOM   5689 C  CB  . ILE D 1 102 ? 62.944  46.148  33.705  1.00 10.24 ? 102 ILE D CB  1 
ATOM   5690 C  CG1 . ILE D 1 102 ? 63.676  45.476  32.545  1.00 10.72 ? 102 ILE D CG1 1 
ATOM   5691 C  CG2 . ILE D 1 102 ? 63.527  45.689  35.038  1.00 11.10 ? 102 ILE D CG2 1 
ATOM   5692 C  CD1 . ILE D 1 102 ? 65.047  46.083  32.223  1.00 9.68  ? 102 ILE D CD1 1 
ATOM   5693 N  N   . GLU D 1 103 ? 60.573  47.216  35.404  1.00 9.98  ? 103 GLU D N   1 
ATOM   5694 C  CA  . GLU D 1 103 ? 59.997  47.526  36.703  1.00 10.16 ? 103 GLU D CA  1 
ATOM   5695 C  C   . GLU D 1 103 ? 58.541  47.068  36.759  1.00 10.22 ? 103 GLU D C   1 
ATOM   5696 O  O   . GLU D 1 103 ? 58.110  46.500  37.769  1.00 11.49 ? 103 GLU D O   1 
ATOM   5697 C  CB  . GLU D 1 103 ? 60.142  49.024  37.018  1.00 10.02 ? 103 GLU D CB  1 
ATOM   5698 C  CG  . GLU D 1 103 ? 61.609  49.465  37.223  1.00 12.05 ? 103 GLU D CG  1 
ATOM   5699 C  CD  . GLU D 1 103 ? 61.767  50.957  37.537  1.00 13.92 ? 103 GLU D CD  1 
ATOM   5700 O  OE1 . GLU D 1 103 ? 60.979  51.750  36.993  1.00 15.21 ? 103 GLU D OE1 1 
ATOM   5701 O  OE2 . GLU D 1 103 ? 62.679  51.331  38.324  1.00 14.51 ? 103 GLU D OE2 1 
ATOM   5702 N  N   . ARG D 1 104 ? 57.791  47.285  35.671  1.00 10.58 ? 104 ARG D N   1 
ATOM   5703 C  CA  . ARG D 1 104 ? 56.431  46.748  35.555  1.00 10.19 ? 104 ARG D CA  1 
ATOM   5704 C  C   . ARG D 1 104 ? 56.433  45.238  35.734  1.00 10.43 ? 104 ARG D C   1 
ATOM   5705 O  O   . ARG D 1 104 ? 55.675  44.707  36.536  1.00 10.55 ? 104 ARG D O   1 
ATOM   5706 C  CB  . ARG D 1 104 ? 55.760  47.099  34.212  1.00 10.37 ? 104 ARG D CB  1 
ATOM   5707 C  CG  . ARG D 1 104 ? 54.520  46.199  33.876  1.00 11.13 ? 104 ARG D CG  1 
ATOM   5708 C  CD  . ARG D 1 104 ? 53.892  46.454  32.497  1.00 12.66 ? 104 ARG D CD  1 
ATOM   5709 N  NE  . ARG D 1 104 ? 54.679  45.843  31.427  1.00 14.34 ? 104 ARG D NE  1 
ATOM   5710 C  CZ  . ARG D 1 104 ? 55.382  46.521  30.529  1.00 14.97 ? 104 ARG D CZ  1 
ATOM   5711 N  NH1 . ARG D 1 104 ? 55.384  47.846  30.555  1.00 16.74 ? 104 ARG D NH1 1 
ATOM   5712 N  NH2 . ARG D 1 104 ? 56.070  45.874  29.591  1.00 16.66 ? 104 ARG D NH2 1 
ATOM   5713 N  N   . ASP D 1 105 ? 57.318  44.566  35.008  1.00 10.56 ? 105 ASP D N   1 
ATOM   5714 C  CA  . ASP D 1 105 ? 57.263  43.117  34.847  1.00 10.96 ? 105 ASP D CA  1 
ATOM   5715 C  C   . ASP D 1 105 ? 57.971  42.310  35.938  1.00 10.90 ? 105 ASP D C   1 
ATOM   5716 O  O   . ASP D 1 105 ? 57.597  41.158  36.203  1.00 11.70 ? 105 ASP D O   1 
ATOM   5717 C  CB  . ASP D 1 105 ? 57.817  42.738  33.473  1.00 11.42 ? 105 ASP D CB  1 
ATOM   5718 C  CG  . ASP D 1 105 ? 56.807  42.968  32.358  1.00 12.12 ? 105 ASP D CG  1 
ATOM   5719 O  OD1 . ASP D 1 105 ? 55.592  43.045  32.666  1.00 15.35 ? 105 ASP D OD1 1 
ATOM   5720 O  OD2 . ASP D 1 105 ? 57.213  43.063  31.179  1.00 13.14 ? 105 ASP D OD2 1 
ATOM   5721 N  N   . PHE D 1 106 ? 58.981  42.895  36.568  1.00 10.75 ? 106 PHE D N   1 
ATOM   5722 C  CA  . PHE D 1 106 ? 59.740  42.181  37.592  1.00 10.74 ? 106 PHE D CA  1 
ATOM   5723 C  C   . PHE D 1 106 ? 59.546  42.752  38.990  1.00 10.57 ? 106 PHE D C   1 
ATOM   5724 O  O   . PHE D 1 106 ? 60.034  42.197  39.970  1.00 11.02 ? 106 PHE D O   1 
ATOM   5725 C  CB  . PHE D 1 106 ? 61.227  42.149  37.243  1.00 11.37 ? 106 PHE D CB  1 
ATOM   5726 C  CG  . PHE D 1 106 ? 61.542  41.296  36.050  1.00 11.68 ? 106 PHE D CG  1 
ATOM   5727 C  CD1 . PHE D 1 106 ? 61.785  39.941  36.196  1.00 12.35 ? 106 PHE D CD1 1 
ATOM   5728 C  CD2 . PHE D 1 106 ? 61.572  41.853  34.777  1.00 12.22 ? 106 PHE D CD2 1 
ATOM   5729 C  CE1 . PHE D 1 106 ? 62.066  39.159  35.098  1.00 12.15 ? 106 PHE D CE1 1 
ATOM   5730 C  CE2 . PHE D 1 106 ? 61.857  41.083  33.678  1.00 12.06 ? 106 PHE D CE2 1 
ATOM   5731 C  CZ  . PHE D 1 106 ? 62.109  39.730  33.833  1.00 12.16 ? 106 PHE D CZ  1 
ATOM   5732 N  N   . GLY D 1 107 ? 58.845  43.872  39.069  1.00 10.37 ? 107 GLY D N   1 
ATOM   5733 C  CA  . GLY D 1 107 ? 58.642  44.556  40.335  1.00 10.76 ? 107 GLY D CA  1 
ATOM   5734 C  C   . GLY D 1 107 ? 59.615  45.707  40.461  1.00 10.71 ? 107 GLY D C   1 
ATOM   5735 O  O   . GLY D 1 107 ? 59.222  46.825  40.846  1.00 11.22 ? 107 GLY D O   1 
ATOM   5736 N  N   . SER D 1 108 ? 60.873  45.443  40.102  1.00 10.21 ? 108 SER D N   1 
ATOM   5737 C  CA  . SER D 1 108 ? 61.957  46.422  40.210  1.00 10.07 ? 108 SER D CA  1 
ATOM   5738 C  C   . SER D 1 108 ? 63.201  45.923  39.466  1.00 9.93  ? 108 SER D C   1 
ATOM   5739 O  O   . SER D 1 108 ? 63.252  44.751  39.058  1.00 10.65 ? 108 SER D O   1 
ATOM   5740 C  CB  . SER D 1 108 ? 62.344  46.581  41.671  1.00 10.20 ? 108 SER D CB  1 
ATOM   5741 O  OG  . SER D 1 108 ? 63.008  45.405  42.097  1.00 11.60 ? 108 SER D OG  1 
ATOM   5742 N  N   . VAL D 1 109 ? 64.216  46.778  39.341  1.00 10.02 ? 109 VAL D N   1 
ATOM   5743 C  CA  . VAL D 1 109 ? 65.458  46.393  38.640  1.00 10.27 ? 109 VAL D CA  1 
ATOM   5744 C  C   . VAL D 1 109 ? 66.334  45.423  39.475  1.00 10.35 ? 109 VAL D C   1 
ATOM   5745 O  O   . VAL D 1 109 ? 66.817  44.400  38.976  1.00 10.32 ? 109 VAL D O   1 
ATOM   5746 C  CB  . VAL D 1 109 ? 66.295  47.624  38.160  1.00 10.65 ? 109 VAL D CB  1 
ATOM   5747 C  CG1 . VAL D 1 109 ? 67.577  47.149  37.516  1.00 11.16 ? 109 VAL D CG1 1 
ATOM   5748 C  CG2 . VAL D 1 109 ? 65.510  48.488  37.172  1.00 10.37 ? 109 VAL D CG2 1 
ATOM   5749 N  N   . ASP D 1 110 ? 66.539  45.740  40.746  1.00 10.85 ? 110 ASP D N   1 
ATOM   5750 C  CA  . ASP D 1 110 ? 67.193  44.791  41.640  1.00 11.26 ? 110 ASP D CA  1 
ATOM   5751 C  C   . ASP D 1 110 ? 66.503  43.427  41.543  1.00 10.65 ? 110 ASP D C   1 
ATOM   5752 O  O   . ASP D 1 110 ? 67.172  42.390  41.478  1.00 11.51 ? 110 ASP D O   1 
ATOM   5753 C  CB  . ASP D 1 110 ? 67.225  45.310  43.084  1.00 11.86 ? 110 ASP D CB  1 
ATOM   5754 C  CG  . ASP D 1 110 ? 68.520  46.038  43.415  1.00 13.73 ? 110 ASP D CG  1 
ATOM   5755 O  OD1 . ASP D 1 110 ? 69.151  46.574  42.478  1.00 16.37 ? 110 ASP D OD1 1 
ATOM   5756 O  OD2 . ASP D 1 110 ? 68.908  46.090  44.604  1.00 15.87 ? 110 ASP D OD2 1 
ATOM   5757 N  N   . ASN D 1 111 ? 65.174  43.435  41.502  1.00 10.60 ? 111 ASN D N   1 
ATOM   5758 C  CA  . ASN D 1 111 ? 64.382  42.220  41.316  1.00 10.21 ? 111 ASN D CA  1 
ATOM   5759 C  C   . ASN D 1 111 ? 64.829  41.455  40.074  1.00 9.78  ? 111 ASN D C   1 
ATOM   5760 O  O   . ASN D 1 111 ? 65.275  40.307  40.171  1.00 9.94  ? 111 ASN D O   1 
ATOM   5761 C  CB  . ASN D 1 111 ? 62.895  42.561  41.193  1.00 10.71 ? 111 ASN D CB  1 
ATOM   5762 C  CG  . ASN D 1 111 ? 62.161  42.497  42.526  1.00 12.63 ? 111 ASN D CG  1 
ATOM   5763 O  OD1 . ASN D 1 111 ? 62.774  42.577  43.604  1.00 15.07 ? 111 ASN D OD1 1 
ATOM   5764 N  ND2 . ASN D 1 111 ? 60.837  42.349  42.461  1.00 13.40 ? 111 ASN D ND2 1 
ATOM   5765 N  N   . PHE D 1 112 ? 64.714  42.119  38.924  1.00 9.12  ? 112 PHE D N   1 
ATOM   5766 C  CA  . PHE D 1 112 ? 65.122  41.559  37.652  1.00 8.78  ? 112 PHE D CA  1 
ATOM   5767 C  C   . PHE D 1 112 ? 66.562  41.042  37.716  1.00 8.59  ? 112 PHE D C   1 
ATOM   5768 O  O   . PHE D 1 112 ? 66.852  39.907  37.314  1.00 7.83  ? 112 PHE D O   1 
ATOM   5769 C  CB  . PHE D 1 112 ? 65.016  42.618  36.562  1.00 8.38  ? 112 PHE D CB  1 
ATOM   5770 C  CG  . PHE D 1 112 ? 65.996  42.416  35.453  1.00 8.60  ? 112 PHE D CG  1 
ATOM   5771 C  CD1 . PHE D 1 112 ? 65.793  41.425  34.508  1.00 7.52  ? 112 PHE D CD1 1 
ATOM   5772 C  CD2 . PHE D 1 112 ? 67.142  43.202  35.370  1.00 8.99  ? 112 PHE D CD2 1 
ATOM   5773 C  CE1 . PHE D 1 112 ? 66.731  41.230  33.485  1.00 9.44  ? 112 PHE D CE1 1 
ATOM   5774 C  CE2 . PHE D 1 112 ? 68.065  43.004  34.357  1.00 9.55  ? 112 PHE D CE2 1 
ATOM   5775 C  CZ  . PHE D 1 112 ? 67.860  42.021  33.424  1.00 9.47  ? 112 PHE D CZ  1 
ATOM   5776 N  N   . LYS D 1 113 ? 67.466  41.888  38.207  1.00 8.56  ? 113 LYS D N   1 
ATOM   5777 C  CA  . LYS D 1 113 ? 68.888  41.537  38.263  1.00 8.93  ? 113 LYS D CA  1 
ATOM   5778 C  C   . LYS D 1 113 ? 69.119  40.241  39.030  1.00 8.73  ? 113 LYS D C   1 
ATOM   5779 O  O   . LYS D 1 113 ? 69.914  39.393  38.620  1.00 8.75  ? 113 LYS D O   1 
ATOM   5780 C  CB  . LYS D 1 113 ? 69.712  42.675  38.889  1.00 9.60  ? 113 LYS D CB  1 
ATOM   5781 C  CG  . LYS D 1 113 ? 69.754  43.937  38.045  1.00 9.14  ? 113 LYS D CG  1 
ATOM   5782 C  CD  . LYS D 1 113 ? 70.438  45.106  38.761  1.00 10.57 ? 113 LYS D CD  1 
ATOM   5783 C  CE  . LYS D 1 113 ? 71.932  44.915  38.797  1.00 11.24 ? 113 LYS D CE  1 
ATOM   5784 N  NZ  . LYS D 1 113 ? 72.620  45.979  39.588  1.00 11.39 ? 113 LYS D NZ  1 
ATOM   5785 N  N   . ALA D 1 114 ? 68.431  40.103  40.160  1.00 8.38  ? 114 ALA D N   1 
ATOM   5786 C  CA  . ALA D 1 114 ? 68.577  38.919  40.980  1.00 8.30  ? 114 ALA D CA  1 
ATOM   5787 C  C   . ALA D 1 114 ? 68.158  37.644  40.254  1.00 7.77  ? 114 ALA D C   1 
ATOM   5788 O  O   . ALA D 1 114 ? 68.836  36.630  40.372  1.00 7.10  ? 114 ALA D O   1 
ATOM   5789 C  CB  . ALA D 1 114 ? 67.788  39.079  42.278  1.00 8.65  ? 114 ALA D CB  1 
ATOM   5790 N  N   . GLU D 1 115 ? 67.048  37.705  39.515  1.00 7.44  ? 115 GLU D N   1 
ATOM   5791 C  CA  . GLU D 1 115 ? 66.523  36.566  38.754  1.00 7.43  ? 115 GLU D CA  1 
ATOM   5792 C  C   . GLU D 1 115 ? 67.518  36.172  37.652  1.00 6.87  ? 115 GLU D C   1 
ATOM   5793 O  O   . GLU D 1 115 ? 67.795  34.994  37.438  1.00 6.37  ? 115 GLU D O   1 
ATOM   5794 C  CB  . GLU D 1 115 ? 65.145  36.918  38.160  1.00 7.13  ? 115 GLU D CB  1 
ATOM   5795 C  CG  . GLU D 1 115 ? 64.210  35.729  37.789  1.00 9.52  ? 115 GLU D CG  1 
ATOM   5796 C  CD  . GLU D 1 115 ? 62.799  36.178  37.349  1.00 10.08 ? 115 GLU D CD  1 
ATOM   5797 O  OE1 . GLU D 1 115 ? 62.230  37.145  37.928  1.00 11.95 ? 115 GLU D OE1 1 
ATOM   5798 O  OE2 . GLU D 1 115 ? 62.250  35.565  36.409  1.00 13.05 ? 115 GLU D OE2 1 
ATOM   5799 N  N   . PHE D 1 116 ? 68.071  37.182  36.986  1.00 6.93  ? 116 PHE D N   1 
ATOM   5800 C  CA  . PHE D 1 116 ? 69.016  36.992  35.885  1.00 6.32  ? 116 PHE D CA  1 
ATOM   5801 C  C   . PHE D 1 116 ? 70.269  36.267  36.355  1.00 6.35  ? 116 PHE D C   1 
ATOM   5802 O  O   . PHE D 1 116 ? 70.682  35.284  35.735  1.00 6.08  ? 116 PHE D O   1 
ATOM   5803 C  CB  . PHE D 1 116 ? 69.384  38.338  35.236  1.00 6.59  ? 116 PHE D CB  1 
ATOM   5804 C  CG  . PHE D 1 116 ? 70.171  38.184  33.971  1.00 7.01  ? 116 PHE D CG  1 
ATOM   5805 C  CD1 . PHE D 1 116 ? 69.525  38.081  32.754  1.00 6.37  ? 116 PHE D CD1 1 
ATOM   5806 C  CD2 . PHE D 1 116 ? 71.550  38.098  34.010  1.00 5.78  ? 116 PHE D CD2 1 
ATOM   5807 C  CE1 . PHE D 1 116 ? 70.246  37.909  31.580  1.00 7.63  ? 116 PHE D CE1 1 
ATOM   5808 C  CE2 . PHE D 1 116 ? 72.286  37.921  32.845  1.00 6.17  ? 116 PHE D CE2 1 
ATOM   5809 C  CZ  . PHE D 1 116 ? 71.632  37.842  31.626  1.00 7.22  ? 116 PHE D CZ  1 
ATOM   5810 N  N   . GLU D 1 117 ? 70.878  36.748  37.443  1.00 6.38  ? 117 GLU D N   1 
ATOM   5811 C  CA  . GLU D 1 117 ? 72.063  36.091  38.010  1.00 7.12  ? 117 GLU D CA  1 
ATOM   5812 C  C   . GLU D 1 117 ? 71.763  34.656  38.391  1.00 6.63  ? 117 GLU D C   1 
ATOM   5813 O  O   . GLU D 1 117 ? 72.588  33.769  38.214  1.00 6.50  ? 117 GLU D O   1 
ATOM   5814 C  CB  . GLU D 1 117 ? 72.599  36.849  39.232  1.00 7.57  ? 117 GLU D CB  1 
ATOM   5815 C  CG  . GLU D 1 117 ? 72.869  38.290  38.943  1.00 9.39  ? 117 GLU D CG  1 
ATOM   5816 C  CD  . GLU D 1 117 ? 73.152  39.080  40.187  1.00 11.98 ? 117 GLU D CD  1 
ATOM   5817 O  OE1 . GLU D 1 117 ? 72.556  38.767  41.251  1.00 13.64 ? 117 GLU D OE1 1 
ATOM   5818 O  OE2 . GLU D 1 117 ? 73.971  40.013  40.101  1.00 12.64 ? 117 GLU D OE2 1 
ATOM   5819 N  N   . LYS D 1 118 ? 70.570  34.426  38.927  1.00 6.43  ? 118 LYS D N   1 
ATOM   5820 C  CA  . LYS D 1 118 ? 70.195  33.089  39.358  1.00 6.21  ? 118 LYS D CA  1 
ATOM   5821 C  C   . LYS D 1 118 ? 70.148  32.128  38.161  1.00 5.88  ? 118 LYS D C   1 
ATOM   5822 O  O   . LYS D 1 118 ? 70.533  30.959  38.249  1.00 6.79  ? 118 LYS D O   1 
ATOM   5823 C  CB  . LYS D 1 118 ? 68.851  33.150  40.078  1.00 6.19  ? 118 LYS D CB  1 
ATOM   5824 C  CG  . LYS D 1 118 ? 68.330  31.828  40.527  1.00 7.92  ? 118 LYS D CG  1 
ATOM   5825 C  CD  . LYS D 1 118 ? 67.089  32.039  41.383  1.00 9.96  ? 118 LYS D CD  1 
ATOM   5826 C  CE  . LYS D 1 118 ? 66.962  30.947  42.422  1.00 12.45 ? 118 LYS D CE  1 
ATOM   5827 N  NZ  . LYS D 1 118 ? 65.564  30.755  42.837  1.00 13.66 ? 118 LYS D NZ  1 
ATOM   5828 N  N   . ALA D 1 119 ? 69.675  32.639  37.035  1.00 6.34  ? 119 ALA D N   1 
ATOM   5829 C  CA  . ALA D 1 119 ? 69.614  31.865  35.811  1.00 5.85  ? 119 ALA D CA  1 
ATOM   5830 C  C   . ALA D 1 119 ? 71.030  31.623  35.332  1.00 5.77  ? 119 ALA D C   1 
ATOM   5831 O  O   . ALA D 1 119 ? 71.370  30.528  34.891  1.00 5.99  ? 119 ALA D O   1 
ATOM   5832 C  CB  . ALA D 1 119 ? 68.837  32.605  34.764  1.00 6.31  ? 119 ALA D CB  1 
ATOM   5833 N  N   . ALA D 1 120 ? 71.856  32.647  35.452  1.00 5.70  ? 120 ALA D N   1 
ATOM   5834 C  CA  . ALA D 1 120 ? 73.215  32.586  34.950  1.00 5.40  ? 120 ALA D CA  1 
ATOM   5835 C  C   . ALA D 1 120 ? 74.124  31.676  35.783  1.00 5.15  ? 120 ALA D C   1 
ATOM   5836 O  O   . ALA D 1 120 ? 74.988  30.978  35.247  1.00 4.97  ? 120 ALA D O   1 
ATOM   5837 C  CB  . ALA D 1 120 ? 73.788  34.013  34.837  1.00 4.91  ? 120 ALA D CB  1 
ATOM   5838 N  N   . ALA D 1 121 ? 73.920  31.690  37.099  1.00 5.74  ? 121 ALA D N   1 
ATOM   5839 C  CA  . ALA D 1 121 ? 74.689  30.875  38.034  1.00 5.66  ? 121 ALA D CA  1 
ATOM   5840 C  C   . ALA D 1 121 ? 74.251  29.398  38.013  1.00 6.21  ? 121 ALA D C   1 
ATOM   5841 O  O   . ALA D 1 121 ? 75.085  28.486  38.177  1.00 6.82  ? 121 ALA D O   1 
ATOM   5842 C  CB  . ALA D 1 121 ? 74.541  31.448  39.456  1.00 5.75  ? 121 ALA D CB  1 
ATOM   5843 N  N   . SER D 1 122 ? 72.958  29.167  37.796  1.00 6.94  ? 122 SER D N   1 
ATOM   5844 C  CA  . SER D 1 122 ? 72.388  27.826  37.926  1.00 7.52  ? 122 SER D CA  1 
ATOM   5845 C  C   . SER D 1 122 ? 72.505  26.964  36.661  1.00 7.26  ? 122 SER D C   1 
ATOM   5846 O  O   . SER D 1 122 ? 72.267  25.753  36.706  1.00 8.08  ? 122 SER D O   1 
ATOM   5847 C  CB  . SER D 1 122 ? 70.927  27.906  38.409  1.00 7.81  ? 122 SER D CB  1 
ATOM   5848 O  OG  . SER D 1 122 ? 70.069  28.517  37.459  1.00 8.58  ? 122 SER D OG  1 
ATOM   5849 N  N   . ARG D 1 123 ? 72.884  27.593  35.543  1.00 6.31  ? 123 ARG D N   1 
ATOM   5850 C  CA  . ARG D 1 123 ? 73.063  26.881  34.293  1.00 5.65  ? 123 ARG D CA  1 
ATOM   5851 C  C   . ARG D 1 123 ? 74.206  25.892  34.475  1.00 4.98  ? 123 ARG D C   1 
ATOM   5852 O  O   . ARG D 1 123 ? 75.356  26.296  34.569  1.00 4.89  ? 123 ARG D O   1 
ATOM   5853 C  CB  . ARG D 1 123 ? 73.385  27.890  33.184  1.00 5.71  ? 123 ARG D CB  1 
ATOM   5854 C  CG  . ARG D 1 123 ? 73.829  27.260  31.855  1.00 5.79  ? 123 ARG D CG  1 
ATOM   5855 C  CD  . ARG D 1 123 ? 72.997  26.060  31.447  1.00 5.21  ? 123 ARG D CD  1 
ATOM   5856 N  NE  . ARG D 1 123 ? 71.587  26.373  31.240  1.00 4.47  ? 123 ARG D NE  1 
ATOM   5857 C  CZ  . ARG D 1 123 ? 70.712  25.510  30.750  1.00 2.93  ? 123 ARG D CZ  1 
ATOM   5858 N  NH1 . ARG D 1 123 ? 71.113  24.287  30.428  1.00 3.50  ? 123 ARG D NH1 1 
ATOM   5859 N  NH2 . ARG D 1 123 ? 69.435  25.861  30.599  1.00 4.65  ? 123 ARG D NH2 1 
ATOM   5860 N  N   . PHE D 1 124 ? 73.899  24.601  34.554  1.00 4.05  ? 124 PHE D N   1 
ATOM   5861 C  CA  . PHE D 1 124 ? 74.920  23.578  34.784  1.00 3.42  ? 124 PHE D CA  1 
ATOM   5862 C  C   . PHE D 1 124 ? 75.466  23.097  33.451  1.00 3.31  ? 124 PHE D C   1 
ATOM   5863 O  O   . PHE D 1 124 ? 74.699  22.693  32.581  1.00 3.44  ? 124 PHE D O   1 
ATOM   5864 C  CB  . PHE D 1 124 ? 74.334  22.374  35.560  1.00 2.97  ? 124 PHE D CB  1 
ATOM   5865 C  CG  . PHE D 1 124 ? 75.384  21.387  36.058  1.00 2.27  ? 124 PHE D CG  1 
ATOM   5866 C  CD1 . PHE D 1 124 ? 76.116  21.656  37.215  1.00 1.67  ? 124 PHE D CD1 1 
ATOM   5867 C  CD2 . PHE D 1 124 ? 75.649  20.197  35.379  1.00 1.08  ? 124 PHE D CD2 1 
ATOM   5868 C  CE1 . PHE D 1 124 ? 77.093  20.770  37.681  1.00 3.34  ? 124 PHE D CE1 1 
ATOM   5869 C  CE2 . PHE D 1 124 ? 76.612  19.297  35.851  1.00 1.48  ? 124 PHE D CE2 1 
ATOM   5870 C  CZ  . PHE D 1 124 ? 77.338  19.585  37.001  1.00 3.02  ? 124 PHE D CZ  1 
ATOM   5871 N  N   . GLY D 1 125 ? 76.788  23.154  33.281  1.00 2.43  ? 125 GLY D N   1 
ATOM   5872 C  CA  . GLY D 1 125 ? 77.378  22.912  31.969  1.00 2.49  ? 125 GLY D CA  1 
ATOM   5873 C  C   . GLY D 1 125 ? 77.444  24.204  31.179  1.00 2.87  ? 125 GLY D C   1 
ATOM   5874 O  O   . GLY D 1 125 ? 77.403  25.283  31.748  1.00 2.91  ? 125 GLY D O   1 
ATOM   5875 N  N   . SER D 1 126 ? 77.501  24.076  29.857  1.00 2.35  ? 126 SER D N   1 
ATOM   5876 C  CA  . SER D 1 126 ? 77.551  25.248  28.963  1.00 2.90  ? 126 SER D CA  1 
ATOM   5877 C  C   . SER D 1 126 ? 76.163  25.815  28.659  1.00 3.27  ? 126 SER D C   1 
ATOM   5878 O  O   . SER D 1 126 ? 75.171  25.074  28.569  1.00 3.04  ? 126 SER D O   1 
ATOM   5879 C  CB  . SER D 1 126 ? 78.203  24.867  27.629  1.00 2.99  ? 126 SER D CB  1 
ATOM   5880 O  OG  . SER D 1 126 ? 79.414  24.140  27.808  1.00 2.12  ? 126 SER D OG  1 
ATOM   5881 N  N   . GLY D 1 127 ? 76.091  27.125  28.459  1.00 2.92  ? 127 GLY D N   1 
ATOM   5882 C  CA  . GLY D 1 127 ? 74.840  27.755  28.029  1.00 2.09  ? 127 GLY D CA  1 
ATOM   5883 C  C   . GLY D 1 127 ? 74.828  29.273  28.118  1.00 2.65  ? 127 GLY D C   1 
ATOM   5884 O  O   . GLY D 1 127 ? 75.891  29.930  28.178  1.00 1.28  ? 127 GLY D O   1 
ATOM   5885 N  N   . TRP D 1 128 ? 73.608  29.808  28.119  1.00 3.25  ? 128 TRP D N   1 
ATOM   5886 C  CA  . TRP D 1 128 ? 73.350  31.237  28.074  1.00 3.74  ? 128 TRP D CA  1 
ATOM   5887 C  C   . TRP D 1 128 ? 72.251  31.579  29.059  1.00 4.60  ? 128 TRP D C   1 
ATOM   5888 O  O   . TRP D 1 128 ? 71.342  30.776  29.303  1.00 5.53  ? 128 TRP D O   1 
ATOM   5889 C  CB  . TRP D 1 128 ? 72.892  31.650  26.667  1.00 3.48  ? 128 TRP D CB  1 
ATOM   5890 C  CG  . TRP D 1 128 ? 73.953  31.541  25.614  1.00 3.55  ? 128 TRP D CG  1 
ATOM   5891 C  CD1 . TRP D 1 128 ? 74.361  30.415  24.953  1.00 1.29  ? 128 TRP D CD1 1 
ATOM   5892 C  CD2 . TRP D 1 128 ? 74.736  32.620  25.090  1.00 2.83  ? 128 TRP D CD2 1 
ATOM   5893 N  NE1 . TRP D 1 128 ? 75.354  30.738  24.040  1.00 1.68  ? 128 TRP D NE1 1 
ATOM   5894 C  CE2 . TRP D 1 128 ? 75.603  32.082  24.125  1.00 3.97  ? 128 TRP D CE2 1 
ATOM   5895 C  CE3 . TRP D 1 128 ? 74.777  33.995  25.339  1.00 3.41  ? 128 TRP D CE3 1 
ATOM   5896 C  CZ2 . TRP D 1 128 ? 76.507  32.876  23.405  1.00 2.78  ? 128 TRP D CZ2 1 
ATOM   5897 C  CZ3 . TRP D 1 128 ? 75.675  34.770  24.637  1.00 3.19  ? 128 TRP D CZ3 1 
ATOM   5898 C  CH2 . TRP D 1 128 ? 76.522  34.215  23.675  1.00 3.64  ? 128 TRP D CH2 1 
ATOM   5899 N  N   . ALA D 1 129 ? 72.336  32.766  29.630  1.00 4.81  ? 129 ALA D N   1 
ATOM   5900 C  CA  . ALA D 1 129 ? 71.200  33.340  30.341  1.00 5.35  ? 129 ALA D CA  1 
ATOM   5901 C  C   . ALA D 1 129 ? 70.644  34.500  29.534  1.00 5.67  ? 129 ALA D C   1 
ATOM   5902 O  O   . ALA D 1 129 ? 71.404  35.292  28.946  1.00 4.71  ? 129 ALA D O   1 
ATOM   5903 C  CB  . ALA D 1 129 ? 71.577  33.769  31.731  1.00 5.70  ? 129 ALA D CB  1 
ATOM   5904 N  N   . TRP D 1 130 ? 69.321  34.596  29.501  1.00 5.78  ? 130 TRP D N   1 
ATOM   5905 C  CA  . TRP D 1 130 ? 68.651  35.543  28.613  1.00 5.90  ? 130 TRP D CA  1 
ATOM   5906 C  C   . TRP D 1 130 ? 67.577  36.409  29.279  1.00 6.24  ? 130 TRP D C   1 
ATOM   5907 O  O   . TRP D 1 130 ? 66.882  35.986  30.224  1.00 5.79  ? 130 TRP D O   1 
ATOM   5908 C  CB  . TRP D 1 130 ? 67.914  34.788  27.516  1.00 6.29  ? 130 TRP D CB  1 
ATOM   5909 C  CG  . TRP D 1 130 ? 68.729  33.878  26.663  1.00 5.75  ? 130 TRP D CG  1 
ATOM   5910 C  CD1 . TRP D 1 130 ? 68.786  32.525  26.749  1.00 3.87  ? 130 TRP D CD1 1 
ATOM   5911 C  CD2 . TRP D 1 130 ? 69.539  34.249  25.538  1.00 5.42  ? 130 TRP D CD2 1 
ATOM   5912 N  NE1 . TRP D 1 130 ? 69.606  32.021  25.767  1.00 4.25  ? 130 TRP D NE1 1 
ATOM   5913 C  CE2 . TRP D 1 130 ? 70.075  33.063  25.008  1.00 4.88  ? 130 TRP D CE2 1 
ATOM   5914 C  CE3 . TRP D 1 130 ? 69.886  35.471  24.950  1.00 5.78  ? 130 TRP D CE3 1 
ATOM   5915 C  CZ2 . TRP D 1 130 ? 70.932  33.059  23.914  1.00 6.22  ? 130 TRP D CZ2 1 
ATOM   5916 C  CZ3 . TRP D 1 130 ? 70.736  35.463  23.861  1.00 6.52  ? 130 TRP D CZ3 1 
ATOM   5917 C  CH2 . TRP D 1 130 ? 71.250  34.264  23.358  1.00 5.84  ? 130 TRP D CH2 1 
ATOM   5918 N  N   . LEU D 1 131 ? 67.446  37.619  28.755  1.00 6.02  ? 131 LEU D N   1 
ATOM   5919 C  CA  . LEU D 1 131 ? 66.275  38.457  28.972  1.00 6.53  ? 131 LEU D CA  1 
ATOM   5920 C  C   . LEU D 1 131 ? 65.499  38.516  27.663  1.00 6.82  ? 131 LEU D C   1 
ATOM   5921 O  O   . LEU D 1 131 ? 66.000  39.035  26.642  1.00 7.21  ? 131 LEU D O   1 
ATOM   5922 C  CB  . LEU D 1 131 ? 66.688  39.859  29.432  1.00 7.04  ? 131 LEU D CB  1 
ATOM   5923 C  CG  . LEU D 1 131 ? 65.515  40.842  29.448  1.00 7.15  ? 131 LEU D CG  1 
ATOM   5924 C  CD1 . LEU D 1 131 ? 64.473  40.400  30.488  1.00 6.90  ? 131 LEU D CD1 1 
ATOM   5925 C  CD2 . LEU D 1 131 ? 65.985  42.285  29.720  1.00 10.17 ? 131 LEU D CD2 1 
ATOM   5926 N  N   . VAL D 1 132 ? 64.302  37.932  27.679  1.00 7.06  ? 132 VAL D N   1 
ATOM   5927 C  CA  . VAL D 1 132 ? 63.481  37.816  26.476  1.00 6.98  ? 132 VAL D CA  1 
ATOM   5928 C  C   . VAL D 1 132 ? 62.172  38.586  26.559  1.00 7.37  ? 132 VAL D C   1 
ATOM   5929 O  O   . VAL D 1 132 ? 61.696  38.939  27.630  1.00 6.94  ? 132 VAL D O   1 
ATOM   5930 C  CB  . VAL D 1 132 ? 63.159  36.351  26.117  1.00 6.80  ? 132 VAL D CB  1 
ATOM   5931 C  CG1 . VAL D 1 132 ? 64.455  35.530  25.922  1.00 6.04  ? 132 VAL D CG1 1 
ATOM   5932 C  CG2 . VAL D 1 132 ? 62.230  35.718  27.180  1.00 7.52  ? 132 VAL D CG2 1 
ATOM   5933 N  N   . LEU D 1 133 ? 61.588  38.827  25.399  1.00 8.23  ? 133 LEU D N   1 
ATOM   5934 C  CA  . LEU D 1 133 ? 60.294  39.485  25.336  1.00 9.04  ? 133 LEU D CA  1 
ATOM   5935 C  C   . LEU D 1 133 ? 59.277  38.523  24.766  1.00 9.47  ? 133 LEU D C   1 
ATOM   5936 O  O   . LEU D 1 133 ? 59.324  38.156  23.585  1.00 9.90  ? 133 LEU D O   1 
ATOM   5937 C  CB  . LEU D 1 133 ? 60.360  40.748  24.493  1.00 9.50  ? 133 LEU D CB  1 
ATOM   5938 C  CG  . LEU D 1 133 ? 59.056  41.540  24.489  1.00 10.44 ? 133 LEU D CG  1 
ATOM   5939 C  CD1 . LEU D 1 133 ? 58.710  41.975  25.915  1.00 11.91 ? 133 LEU D CD1 1 
ATOM   5940 C  CD2 . LEU D 1 133 ? 59.154  42.757  23.550  1.00 10.57 ? 133 LEU D CD2 1 
ATOM   5941 N  N   . LYS D 1 134 ? 58.362  38.090  25.621  1.00 9.72  ? 134 LYS D N   1 
ATOM   5942 C  CA  . LYS D 1 134 ? 57.298  37.217  25.199  1.00 10.39 ? 134 LYS D CA  1 
ATOM   5943 C  C   . LYS D 1 134 ? 56.080  38.086  25.014  1.00 10.67 ? 134 LYS D C   1 
ATOM   5944 O  O   . LYS D 1 134 ? 55.428  38.452  25.989  1.00 11.44 ? 134 LYS D O   1 
ATOM   5945 C  CB  . LYS D 1 134 ? 57.046  36.159  26.266  1.00 10.52 ? 134 LYS D CB  1 
ATOM   5946 C  CG  . LYS D 1 134 ? 58.295  35.354  26.646  1.00 10.80 ? 134 LYS D CG  1 
ATOM   5947 C  CD  . LYS D 1 134 ? 57.922  34.174  27.539  1.00 12.56 ? 134 LYS D CD  1 
ATOM   5948 C  CE  . LYS D 1 134 ? 59.029  33.131  27.574  1.00 13.78 ? 134 LYS D CE  1 
ATOM   5949 N  NZ  . LYS D 1 134 ? 58.732  32.022  28.528  1.00 14.51 ? 134 LYS D NZ  1 
ATOM   5950 N  N   . GLY D 1 135 ? 55.801  38.434  23.763  1.00 11.20 ? 135 GLY D N   1 
ATOM   5951 C  CA  . GLY D 1 135 ? 54.699  39.332  23.437  1.00 11.23 ? 135 GLY D CA  1 
ATOM   5952 C  C   . GLY D 1 135 ? 54.739  40.529  24.356  1.00 11.16 ? 135 GLY D C   1 
ATOM   5953 O  O   . GLY D 1 135 ? 55.643  41.359  24.257  1.00 11.62 ? 135 GLY D O   1 
ATOM   5954 N  N   . ASP D 1 136 ? 53.770  40.586  25.267  1.00 11.92 ? 136 ASP D N   1 
ATOM   5955 C  CA  . ASP D 1 136 ? 53.580  41.693  26.213  1.00 12.61 ? 136 ASP D CA  1 
ATOM   5956 C  C   . ASP D 1 136 ? 54.697  41.789  27.270  1.00 12.21 ? 136 ASP D C   1 
ATOM   5957 O  O   . ASP D 1 136 ? 55.103  42.895  27.646  1.00 13.75 ? 136 ASP D O   1 
ATOM   5958 C  CB  . ASP D 1 136 ? 52.224  41.505  26.924  1.00 12.98 ? 136 ASP D CB  1 
ATOM   5959 C  CG  . ASP D 1 136 ? 51.493  42.821  27.200  1.00 14.92 ? 136 ASP D CG  1 
ATOM   5960 O  OD1 . ASP D 1 136 ? 52.136  43.897  27.204  1.00 19.10 ? 136 ASP D OD1 1 
ATOM   5961 O  OD2 . ASP D 1 136 ? 50.256  42.772  27.422  1.00 16.61 ? 136 ASP D OD2 1 
ATOM   5962 N  N   . LYS D 1 137 ? 55.201  40.640  27.727  1.00 12.25 ? 137 LYS D N   1 
ATOM   5963 C  CA  . LYS D 1 137 ? 55.919  40.534  29.009  1.00 11.32 ? 137 LYS D CA  1 
ATOM   5964 C  C   . LYS D 1 137 ? 57.398  40.135  28.904  1.00 10.89 ? 137 LYS D C   1 
ATOM   5965 O  O   . LYS D 1 137 ? 57.733  39.194  28.180  1.00 12.01 ? 137 LYS D O   1 
ATOM   5966 C  CB  . LYS D 1 137 ? 55.194  39.502  29.890  1.00 11.73 ? 137 LYS D CB  1 
ATOM   5967 C  CG  . LYS D 1 137 ? 55.777  39.306  31.278  1.00 11.70 ? 137 LYS D CG  1 
ATOM   5968 C  CD  . LYS D 1 137 ? 54.784  38.572  32.166  1.00 13.60 ? 137 LYS D CD  1 
ATOM   5969 C  CE  . LYS D 1 137 ? 55.272  38.534  33.603  1.00 15.37 ? 137 LYS D CE  1 
ATOM   5970 N  NZ  . LYS D 1 137 ? 54.250  37.949  34.509  1.00 17.02 ? 137 LYS D NZ  1 
ATOM   5971 N  N   . LEU D 1 138 ? 58.266  40.821  29.649  1.00 10.21 ? 138 LEU D N   1 
ATOM   5972 C  CA  . LEU D 1 138 ? 59.679  40.408  29.786  1.00 9.28  ? 138 LEU D CA  1 
ATOM   5973 C  C   . LEU D 1 138 ? 59.834  39.173  30.681  1.00 8.55  ? 138 LEU D C   1 
ATOM   5974 O  O   . LEU D 1 138 ? 59.042  38.965  31.612  1.00 9.12  ? 138 LEU D O   1 
ATOM   5975 C  CB  . LEU D 1 138 ? 60.539  41.558  30.319  1.00 9.50  ? 138 LEU D CB  1 
ATOM   5976 C  CG  . LEU D 1 138 ? 60.615  42.809  29.437  1.00 10.21 ? 138 LEU D CG  1 
ATOM   5977 C  CD1 . LEU D 1 138 ? 61.271  43.965  30.186  1.00 10.27 ? 138 LEU D CD1 1 
ATOM   5978 C  CD2 . LEU D 1 138 ? 61.375  42.501  28.142  1.00 11.03 ? 138 LEU D CD2 1 
ATOM   5979 N  N   . ALA D 1 139 ? 60.857  38.359  30.404  1.00 7.91  ? 139 ALA D N   1 
ATOM   5980 C  CA  . ALA D 1 139 ? 61.123  37.144  31.183  1.00 7.43  ? 139 ALA D CA  1 
ATOM   5981 C  C   . ALA D 1 139 ? 62.611  36.782  31.196  1.00 7.42  ? 139 ALA D C   1 
ATOM   5982 O  O   . ALA D 1 139 ? 63.333  37.053  30.238  1.00 7.85  ? 139 ALA D O   1 
ATOM   5983 C  CB  . ALA D 1 139 ? 60.311  35.977  30.627  1.00 7.51  ? 139 ALA D CB  1 
ATOM   5984 N  N   . VAL D 1 140 ? 63.062  36.172  32.284  1.00 7.80  ? 140 VAL D N   1 
ATOM   5985 C  CA  . VAL D 1 140 ? 64.398  35.598  32.337  1.00 7.46  ? 140 VAL D CA  1 
ATOM   5986 C  C   . VAL D 1 140 ? 64.336  34.117  32.044  1.00 7.49  ? 140 VAL D C   1 
ATOM   5987 O  O   . VAL D 1 140 ? 63.600  33.377  32.702  1.00 7.72  ? 140 VAL D O   1 
ATOM   5988 C  CB  . VAL D 1 140 ? 65.058  35.822  33.704  1.00 7.17  ? 140 VAL D CB  1 
ATOM   5989 C  CG1 . VAL D 1 140 ? 66.250  34.868  33.911  1.00 8.07  ? 140 VAL D CG1 1 
ATOM   5990 C  CG2 . VAL D 1 140 ? 65.489  37.238  33.818  1.00 7.27  ? 140 VAL D CG2 1 
ATOM   5991 N  N   . VAL D 1 141 ? 65.108  33.687  31.052  1.00 7.24  ? 141 VAL D N   1 
ATOM   5992 C  CA  . VAL D 1 141 ? 65.166  32.281  30.720  1.00 6.64  ? 141 VAL D CA  1 
ATOM   5993 C  C   . VAL D 1 141 ? 66.622  31.882  30.488  1.00 6.74  ? 141 VAL D C   1 
ATOM   5994 O  O   . VAL D 1 141 ? 67.519  32.736  30.516  1.00 6.63  ? 141 VAL D O   1 
ATOM   5995 C  CB  . VAL D 1 141 ? 64.281  31.945  29.507  1.00 6.31  ? 141 VAL D CB  1 
ATOM   5996 C  CG1 . VAL D 1 141 ? 62.800  32.194  29.854  1.00 5.55  ? 141 VAL D CG1 1 
ATOM   5997 C  CG2 . VAL D 1 141 ? 64.703  32.740  28.287  1.00 6.39  ? 141 VAL D CG2 1 
ATOM   5998 N  N   . SER D 1 142 ? 66.870  30.591  30.312  1.00 7.21  ? 142 SER D N   1 
ATOM   5999 C  CA  . SER D 1 142 ? 68.233  30.109  30.108  1.00 7.17  ? 142 SER D CA  1 
ATOM   6000 C  C   . SER D 1 142 ? 68.231  28.959  29.108  1.00 6.47  ? 142 SER D C   1 
ATOM   6001 O  O   . SER D 1 142 ? 67.229  28.268  28.962  1.00 7.40  ? 142 SER D O   1 
ATOM   6002 C  CB  . SER D 1 142 ? 68.852  29.679  31.440  1.00 7.90  ? 142 SER D CB  1 
ATOM   6003 O  OG  . SER D 1 142 ? 68.591  28.334  31.763  1.00 9.61  ? 142 SER D OG  1 
ATOM   6004 N  N   . THR D 1 143 ? 69.332  28.768  28.386  1.00 5.69  ? 143 THR D N   1 
ATOM   6005 C  CA  . THR D 1 143 ? 69.404  27.680  27.426  1.00 4.50  ? 143 THR D CA  1 
ATOM   6006 C  C   . THR D 1 143 ? 70.739  26.972  27.558  1.00 3.93  ? 143 THR D C   1 
ATOM   6007 O  O   . THR D 1 143 ? 71.686  27.534  28.118  1.00 2.43  ? 143 THR D O   1 
ATOM   6008 C  CB  . THR D 1 143 ? 69.269  28.185  25.979  1.00 4.82  ? 143 THR D CB  1 
ATOM   6009 O  OG1 . THR D 1 143 ? 70.247  29.201  25.745  1.00 4.11  ? 143 THR D OG1 1 
ATOM   6010 C  CG2 . THR D 1 143 ? 67.874  28.771  25.717  1.00 5.14  ? 143 THR D CG2 1 
ATOM   6011 N  N   . ALA D 1 144 ? 70.799  25.747  27.039  1.00 3.52  ? 144 ALA D N   1 
ATOM   6012 C  CA  . ALA D 1 144 ? 72.006  24.924  27.055  1.00 3.26  ? 144 ALA D CA  1 
ATOM   6013 C  C   . ALA D 1 144 ? 72.795  25.146  25.780  1.00 2.80  ? 144 ALA D C   1 
ATOM   6014 O  O   . ALA D 1 144 ? 72.228  25.377  24.730  1.00 3.07  ? 144 ALA D O   1 
ATOM   6015 C  CB  . ALA D 1 144 ? 71.626  23.452  27.152  1.00 3.26  ? 144 ALA D CB  1 
ATOM   6016 N  N   . ASN D 1 145 ? 74.113  25.057  25.894  1.00 2.25  ? 145 ASN D N   1 
ATOM   6017 C  CA  . ASN D 1 145 ? 74.989  25.045  24.735  1.00 1.70  ? 145 ASN D CA  1 
ATOM   6018 C  C   . ASN D 1 145 ? 74.766  26.275  23.848  1.00 2.03  ? 145 ASN D C   1 
ATOM   6019 O  O   . ASN D 1 145 ? 74.911  27.406  24.318  1.00 2.68  ? 145 ASN D O   1 
ATOM   6020 C  CB  . ASN D 1 145 ? 74.807  23.713  24.006  1.00 1.48  ? 145 ASN D CB  1 
ATOM   6021 C  CG  . ASN D 1 145 ? 75.032  22.514  24.925  1.00 2.31  ? 145 ASN D CG  1 
ATOM   6022 O  OD1 . ASN D 1 145 ? 75.962  22.497  25.755  1.00 2.56  ? 145 ASN D OD1 1 
ATOM   6023 N  ND2 . ASN D 1 145 ? 74.170  21.512  24.795  1.00 3.59  ? 145 ASN D ND2 1 
ATOM   6024 N  N   . GLN D 1 146 ? 74.431  26.078  22.575  1.00 2.21  ? 146 GLN D N   1 
ATOM   6025 C  CA  . GLN D 1 146 ? 74.216  27.222  21.696  1.00 2.78  ? 146 GLN D CA  1 
ATOM   6026 C  C   . GLN D 1 146 ? 72.743  27.335  21.293  1.00 2.62  ? 146 GLN D C   1 
ATOM   6027 O  O   . GLN D 1 146 ? 72.389  28.016  20.332  1.00 2.26  ? 146 GLN D O   1 
ATOM   6028 C  CB  . GLN D 1 146 ? 75.122  27.166  20.454  1.00 3.17  ? 146 GLN D CB  1 
ATOM   6029 C  CG  . GLN D 1 146 ? 76.601  27.248  20.783  1.00 3.21  ? 146 GLN D CG  1 
ATOM   6030 C  CD  . GLN D 1 146 ? 77.015  28.521  21.523  1.00 3.90  ? 146 GLN D CD  1 
ATOM   6031 O  OE1 . GLN D 1 146 ? 76.247  29.485  21.644  1.00 3.71  ? 146 GLN D OE1 1 
ATOM   6032 N  NE2 . GLN D 1 146 ? 78.234  28.522  22.027  1.00 4.28  ? 146 GLN D NE2 1 
ATOM   6033 N  N   . ASP D 1 147 ? 71.876  26.694  22.059  1.00 2.68  ? 147 ASP D N   1 
ATOM   6034 C  CA  . ASP D 1 147 ? 70.442  26.875  21.826  1.00 3.47  ? 147 ASP D CA  1 
ATOM   6035 C  C   . ASP D 1 147 ? 70.037  28.319  22.121  1.00 3.91  ? 147 ASP D C   1 
ATOM   6036 O  O   . ASP D 1 147 ? 70.654  28.984  22.960  1.00 4.67  ? 147 ASP D O   1 
ATOM   6037 C  CB  . ASP D 1 147 ? 69.646  25.931  22.719  1.00 3.08  ? 147 ASP D CB  1 
ATOM   6038 C  CG  . ASP D 1 147 ? 69.887  24.472  22.375  1.00 2.95  ? 147 ASP D CG  1 
ATOM   6039 O  OD1 . ASP D 1 147 ? 70.505  24.197  21.333  1.00 2.53  ? 147 ASP D OD1 1 
ATOM   6040 O  OD2 . ASP D 1 147 ? 69.461  23.586  23.145  1.00 6.13  ? 147 ASP D OD2 1 
ATOM   6041 N  N   . SER D 1 148 ? 68.999  28.798  21.432  1.00 4.12  ? 148 SER D N   1 
ATOM   6042 C  CA  . SER D 1 148 ? 68.479  30.149  21.607  1.00 4.86  ? 148 SER D CA  1 
ATOM   6043 C  C   . SER D 1 148 ? 66.964  30.077  21.824  1.00 4.34  ? 148 SER D C   1 
ATOM   6044 O  O   . SER D 1 148 ? 66.294  29.243  21.227  1.00 5.21  ? 148 SER D O   1 
ATOM   6045 C  CB  . SER D 1 148 ? 68.761  31.011  20.369  1.00 5.11  ? 148 SER D CB  1 
ATOM   6046 O  OG  . SER D 1 148 ? 67.920  32.161  20.330  1.00 5.84  ? 148 SER D OG  1 
ATOM   6047 N  N   . PRO D 1 149 ? 66.419  30.999  22.620  1.00 4.52  ? 149 PRO D N   1 
ATOM   6048 C  CA  . PRO D 1 149 ? 64.967  31.038  22.782  1.00 4.65  ? 149 PRO D CA  1 
ATOM   6049 C  C   . PRO D 1 149 ? 64.236  31.126  21.434  1.00 5.00  ? 149 PRO D C   1 
ATOM   6050 O  O   . PRO D 1 149 ? 63.087  30.717  21.332  1.00 5.51  ? 149 PRO D O   1 
ATOM   6051 C  CB  . PRO D 1 149 ? 64.723  32.325  23.578  1.00 5.56  ? 149 PRO D CB  1 
ATOM   6052 C  CG  . PRO D 1 149 ? 66.041  32.707  24.149  1.00 5.45  ? 149 PRO D CG  1 
ATOM   6053 C  CD  . PRO D 1 149 ? 67.115  32.072  23.357  1.00 4.31  ? 149 PRO D CD  1 
ATOM   6054 N  N   . LEU D 1 150 ? 64.903  31.663  20.412  1.00 5.47  ? 150 LEU D N   1 
ATOM   6055 C  CA  . LEU D 1 150 ? 64.280  31.796  19.092  1.00 5.61  ? 150 LEU D CA  1 
ATOM   6056 C  C   . LEU D 1 150 ? 63.969  30.442  18.460  1.00 5.67  ? 150 LEU D C   1 
ATOM   6057 O  O   . LEU D 1 150 ? 63.186  30.367  17.499  1.00 5.77  ? 150 LEU D O   1 
ATOM   6058 C  CB  . LEU D 1 150 ? 65.182  32.584  18.148  1.00 6.03  ? 150 LEU D CB  1 
ATOM   6059 C  CG  . LEU D 1 150 ? 65.395  34.050  18.486  1.00 4.86  ? 150 LEU D CG  1 
ATOM   6060 C  CD1 . LEU D 1 150 ? 66.553  34.582  17.675  1.00 5.35  ? 150 LEU D CD1 1 
ATOM   6061 C  CD2 . LEU D 1 150 ? 64.127  34.903  18.280  1.00 4.35  ? 150 LEU D CD2 1 
ATOM   6062 N  N   . MET D 1 151 ? 64.586  29.379  18.972  1.00 4.83  ? 151 MET D N   1 
ATOM   6063 C  CA  . MET D 1 151 ? 64.328  28.018  18.477  1.00 4.89  ? 151 MET D CA  1 
ATOM   6064 C  C   . MET D 1 151 ? 63.066  27.432  19.084  1.00 5.30  ? 151 MET D C   1 
ATOM   6065 O  O   . MET D 1 151 ? 62.650  26.351  18.698  1.00 5.79  ? 151 MET D O   1 
ATOM   6066 C  CB  . MET D 1 151 ? 65.498  27.087  18.795  1.00 3.79  ? 151 MET D CB  1 
ATOM   6067 C  CG  . MET D 1 151 ? 66.858  27.585  18.283  1.00 3.14  ? 151 MET D CG  1 
ATOM   6068 S  SD  . MET D 1 151 ? 68.223  26.521  18.837  1.00 2.59  ? 151 MET D SD  1 
ATOM   6069 C  CE  . MET D 1 151 ? 69.582  27.108  17.819  1.00 0.83  ? 151 MET D CE  1 
ATOM   6070 N  N   . GLY D 1 152 ? 62.474  28.134  20.048  1.00 5.40  ? 152 GLY D N   1 
ATOM   6071 C  CA  . GLY D 1 152 ? 61.253  27.643  20.706  1.00 6.04  ? 152 GLY D CA  1 
ATOM   6072 C  C   . GLY D 1 152 ? 61.444  26.639  21.829  1.00 5.72  ? 152 GLY D C   1 
ATOM   6073 O  O   . GLY D 1 152 ? 62.553  26.179  22.101  1.00 6.37  ? 152 GLY D O   1 
ATOM   6074 N  N   . GLU D 1 153 ? 60.338  26.288  22.489  1.00 5.73  ? 153 GLU D N   1 
ATOM   6075 C  CA  . GLU D 1 153 ? 60.416  25.550  23.738  1.00 5.26  ? 153 GLU D CA  1 
ATOM   6076 C  C   . GLU D 1 153 ? 60.862  24.108  23.550  1.00 4.90  ? 153 GLU D C   1 
ATOM   6077 O  O   . GLU D 1 153 ? 61.672  23.596  24.322  1.00 3.75  ? 153 GLU D O   1 
ATOM   6078 C  CB  . GLU D 1 153 ? 59.062  25.587  24.459  1.00 5.93  ? 153 GLU D CB  1 
ATOM   6079 C  CG  . GLU D 1 153 ? 58.697  26.970  24.969  1.00 7.58  ? 153 GLU D CG  1 
ATOM   6080 C  CD  . GLU D 1 153 ? 59.326  27.289  26.319  1.00 8.66  ? 153 GLU D CD  1 
ATOM   6081 O  OE1 . GLU D 1 153 ? 59.155  28.427  26.786  1.00 12.42 ? 153 GLU D OE1 1 
ATOM   6082 O  OE2 . GLU D 1 153 ? 59.977  26.405  26.911  1.00 10.31 ? 153 GLU D OE2 1 
ATOM   6083 N  N   . ALA D 1 154 ? 60.320  23.434  22.539  1.00 6.55  ? 154 ALA D N   1 
ATOM   6084 C  CA  . ALA D 1 154 ? 60.604  22.011  22.391  1.00 6.08  ? 154 ALA D CA  1 
ATOM   6085 C  C   . ALA D 1 154 ? 62.095  21.790  22.138  1.00 6.27  ? 154 ALA D C   1 
ATOM   6086 O  O   . ALA D 1 154 ? 62.696  20.869  22.695  1.00 6.46  ? 154 ALA D O   1 
ATOM   6087 C  CB  . ALA D 1 154 ? 59.757  21.377  21.272  1.00 6.70  ? 154 ALA D CB  1 
ATOM   6088 N  N   . ILE D 1 155 ? 62.708  22.638  21.313  1.00 6.07  ? 155 ILE D N   1 
ATOM   6089 C  CA  . ILE D 1 155 ? 64.144  22.497  21.094  1.00 5.89  ? 155 ILE D CA  1 
ATOM   6090 C  C   . ILE D 1 155 ? 64.988  23.021  22.248  1.00 5.50  ? 155 ILE D C   1 
ATOM   6091 O  O   . ILE D 1 155 ? 65.885  22.320  22.698  1.00 4.99  ? 155 ILE D O   1 
ATOM   6092 C  CB  . ILE D 1 155 ? 64.617  23.141  19.776  1.00 6.45  ? 155 ILE D CB  1 
ATOM   6093 C  CG1 . ILE D 1 155 ? 64.109  22.302  18.612  1.00 7.02  ? 155 ILE D CG1 1 
ATOM   6094 C  CG2 . ILE D 1 155 ? 66.151  23.219  19.739  1.00 5.77  ? 155 ILE D CG2 1 
ATOM   6095 C  CD1 . ILE D 1 155 ? 64.340  22.909  17.280  1.00 7.63  ? 155 ILE D CD1 1 
ATOM   6096 N  N   . SER D 1 156 ? 64.701  24.245  22.704  1.00 4.73  ? 156 SER D N   1 
ATOM   6097 C  CA  . SER D 1 156 ? 65.626  24.974  23.594  1.00 4.77  ? 156 SER D CA  1 
ATOM   6098 C  C   . SER D 1 156 ? 65.212  24.988  25.050  1.00 5.04  ? 156 SER D C   1 
ATOM   6099 O  O   . SER D 1 156 ? 66.027  25.268  25.927  1.00 5.35  ? 156 SER D O   1 
ATOM   6100 C  CB  . SER D 1 156 ? 65.866  26.419  23.131  1.00 4.15  ? 156 SER D CB  1 
ATOM   6101 O  OG  . SER D 1 156 ? 64.814  27.302  23.517  1.00 2.74  ? 156 SER D OG  1 
ATOM   6102 N  N   . GLY D 1 157 ? 63.951  24.686  25.305  1.00 5.62  ? 157 GLY D N   1 
ATOM   6103 C  CA  . GLY D 1 157 ? 63.461  24.680  26.671  1.00 6.35  ? 157 GLY D CA  1 
ATOM   6104 C  C   . GLY D 1 157 ? 63.095  26.083  27.100  1.00 6.23  ? 157 GLY D C   1 
ATOM   6105 O  O   . GLY D 1 157 ? 62.708  26.312  28.246  1.00 7.93  ? 157 GLY D O   1 
ATOM   6106 N  N   . ALA D 1 158 ? 63.221  27.029  26.173  1.00 6.23  ? 158 ALA D N   1 
ATOM   6107 C  CA  . ALA D 1 158 ? 62.855  28.429  26.427  1.00 5.42  ? 158 ALA D CA  1 
ATOM   6108 C  C   . ALA D 1 158 ? 62.200  29.006  25.182  1.00 5.46  ? 158 ALA D C   1 
ATOM   6109 O  O   . ALA D 1 158 ? 62.147  28.361  24.146  1.00 4.60  ? 158 ALA D O   1 
ATOM   6110 C  CB  . ALA D 1 158 ? 64.102  29.261  26.804  1.00 5.23  ? 158 ALA D CB  1 
ATOM   6111 N  N   . SER D 1 159 ? 61.677  30.220  25.297  1.00 6.59  ? 159 SER D N   1 
ATOM   6112 C  CA  . SER D 1 159 ? 61.123  30.903  24.145  1.00 7.09  ? 159 SER D CA  1 
ATOM   6113 C  C   . SER D 1 159 ? 61.132  32.407  24.345  1.00 7.22  ? 159 SER D C   1 
ATOM   6114 O  O   . SER D 1 159 ? 61.455  32.903  25.419  1.00 8.08  ? 159 SER D O   1 
ATOM   6115 C  CB  . SER D 1 159 ? 59.700  30.411  23.853  1.00 7.01  ? 159 SER D CB  1 
ATOM   6116 O  OG  . SER D 1 159 ? 58.842  30.621  24.960  1.00 8.65  ? 159 SER D OG  1 
ATOM   6117 N  N   . GLY D 1 160 ? 60.747  33.139  23.308  1.00 7.18  ? 160 GLY D N   1 
ATOM   6118 C  CA  . GLY D 1 160 ? 60.658  34.580  23.429  1.00 7.32  ? 160 GLY D CA  1 
ATOM   6119 C  C   . GLY D 1 160 ? 61.721  35.203  22.556  1.00 7.89  ? 160 GLY D C   1 
ATOM   6120 O  O   . GLY D 1 160 ? 62.612  34.507  22.065  1.00 7.42  ? 160 GLY D O   1 
ATOM   6121 N  N   . PHE D 1 161 ? 61.602  36.505  22.338  1.00 7.77  ? 161 PHE D N   1 
ATOM   6122 C  CA  . PHE D 1 161 ? 62.543  37.254  21.521  1.00 7.93  ? 161 PHE D CA  1 
ATOM   6123 C  C   . PHE D 1 161 ? 63.611  37.826  22.434  1.00 7.77  ? 161 PHE D C   1 
ATOM   6124 O  O   . PHE D 1 161 ? 63.302  38.526  23.401  1.00 8.50  ? 161 PHE D O   1 
ATOM   6125 C  CB  . PHE D 1 161 ? 61.783  38.367  20.808  1.00 8.03  ? 161 PHE D CB  1 
ATOM   6126 C  CG  . PHE D 1 161 ? 62.660  39.376  20.112  1.00 8.39  ? 161 PHE D CG  1 
ATOM   6127 C  CD1 . PHE D 1 161 ? 63.450  39.015  19.034  1.00 9.92  ? 161 PHE D CD1 1 
ATOM   6128 C  CD2 . PHE D 1 161 ? 62.664  40.698  20.522  1.00 9.47  ? 161 PHE D CD2 1 
ATOM   6129 C  CE1 . PHE D 1 161 ? 64.239  39.955  18.378  1.00 10.43 ? 161 PHE D CE1 1 
ATOM   6130 C  CE2 . PHE D 1 161 ? 63.429  41.643  19.867  1.00 10.73 ? 161 PHE D CE2 1 
ATOM   6131 C  CZ  . PHE D 1 161 ? 64.224  41.277  18.804  1.00 10.64 ? 161 PHE D CZ  1 
ATOM   6132 N  N   . PRO D 1 162 ? 64.882  37.510  22.143  1.00 8.24  ? 162 PRO D N   1 
ATOM   6133 C  CA  . PRO D 1 162 ? 65.965  37.902  23.008  1.00 8.16  ? 162 PRO D CA  1 
ATOM   6134 C  C   . PRO D 1 162 ? 66.166  39.400  23.000  1.00 8.26  ? 162 PRO D C   1 
ATOM   6135 O  O   . PRO D 1 162 ? 66.188  40.015  21.932  1.00 8.47  ? 162 PRO D O   1 
ATOM   6136 C  CB  . PRO D 1 162 ? 67.183  37.188  22.394  1.00 8.09  ? 162 PRO D CB  1 
ATOM   6137 C  CG  . PRO D 1 162 ? 66.590  36.011  21.707  1.00 8.40  ? 162 PRO D CG  1 
ATOM   6138 C  CD  . PRO D 1 162 ? 65.342  36.592  21.093  1.00 8.15  ? 162 PRO D CD  1 
ATOM   6139 N  N   . ILE D 1 163 ? 66.285  39.967  24.196  1.00 8.18  ? 163 ILE D N   1 
ATOM   6140 C  CA  . ILE D 1 163 ? 66.544  41.378  24.377  1.00 7.91  ? 163 ILE D CA  1 
ATOM   6141 C  C   . ILE D 1 163 ? 68.051  41.544  24.619  1.00 7.46  ? 163 ILE D C   1 
ATOM   6142 O  O   . ILE D 1 163 ? 68.706  42.332  23.959  1.00 6.74  ? 163 ILE D O   1 
ATOM   6143 C  CB  . ILE D 1 163 ? 65.715  41.977  25.542  1.00 7.59  ? 163 ILE D CB  1 
ATOM   6144 C  CG1 . ILE D 1 163 ? 64.203  41.889  25.251  1.00 7.85  ? 163 ILE D CG1 1 
ATOM   6145 C  CG2 . ILE D 1 163 ? 66.103  43.429  25.780  1.00 8.52  ? 163 ILE D CG2 1 
ATOM   6146 C  CD1 . ILE D 1 163 ? 63.770  42.461  23.913  1.00 8.27  ? 163 ILE D CD1 1 
ATOM   6147 N  N   . MET D 1 164 ? 68.585  40.742  25.535  1.00 7.19  ? 164 MET D N   1 
ATOM   6148 C  CA  . MET D 1 164 ? 70.012  40.695  25.815  1.00 6.93  ? 164 MET D CA  1 
ATOM   6149 C  C   . MET D 1 164 ? 70.380  39.335  26.407  1.00 6.47  ? 164 MET D C   1 
ATOM   6150 O  O   . MET D 1 164 ? 69.501  38.532  26.701  1.00 6.37  ? 164 MET D O   1 
ATOM   6151 C  CB  . MET D 1 164 ? 70.396  41.856  26.736  1.00 7.51  ? 164 MET D CB  1 
ATOM   6152 C  CG  . MET D 1 164 ? 71.431  41.543  27.791  1.00 9.05  ? 164 MET D CG  1 
ATOM   6153 S  SD  . MET D 1 164 ? 70.770  40.599  29.192  1.00 8.27  ? 164 MET D SD  1 
ATOM   6154 C  CE  . MET D 1 164 ? 70.113  41.806  30.352  1.00 7.86  ? 164 MET D CE  1 
ATOM   6155 N  N   . GLY D 1 165 ? 71.672  39.056  26.537  1.00 5.69  ? 165 GLY D N   1 
ATOM   6156 C  CA  . GLY D 1 165 ? 72.108  37.802  27.138  1.00 5.87  ? 165 GLY D CA  1 
ATOM   6157 C  C   . GLY D 1 165 ? 73.563  37.692  27.558  1.00 5.18  ? 165 GLY D C   1 
ATOM   6158 O  O   . GLY D 1 165 ? 74.425  38.446  27.114  1.00 5.51  ? 165 GLY D O   1 
ATOM   6159 N  N   . LEU D 1 166 ? 73.840  36.701  28.390  1.00 4.77  ? 166 LEU D N   1 
ATOM   6160 C  CA  . LEU D 1 166 ? 75.181  36.451  28.886  1.00 4.13  ? 166 LEU D CA  1 
ATOM   6161 C  C   . LEU D 1 166 ? 75.592  35.013  28.560  1.00 4.22  ? 166 LEU D C   1 
ATOM   6162 O  O   . LEU D 1 166 ? 74.882  34.062  28.879  1.00 4.00  ? 166 LEU D O   1 
ATOM   6163 C  CB  . LEU D 1 166 ? 75.230  36.675  30.403  1.00 4.11  ? 166 LEU D CB  1 
ATOM   6164 C  CG  . LEU D 1 166 ? 76.529  36.378  31.154  1.00 4.44  ? 166 LEU D CG  1 
ATOM   6165 C  CD1 . LEU D 1 166 ? 77.648  37.308  30.750  1.00 4.85  ? 166 LEU D CD1 1 
ATOM   6166 C  CD2 . LEU D 1 166 ? 76.278  36.478  32.651  1.00 2.24  ? 166 LEU D CD2 1 
ATOM   6167 N  N   . ASP D 1 167 ? 76.735  34.886  27.896  1.00 4.26  ? 167 ASP D N   1 
ATOM   6168 C  CA  . ASP D 1 167 ? 77.397  33.628  27.585  1.00 3.32  ? 167 ASP D CA  1 
ATOM   6169 C  C   . ASP D 1 167 ? 78.015  33.033  28.848  1.00 3.37  ? 167 ASP D C   1 
ATOM   6170 O  O   . ASP D 1 167 ? 78.925  33.613  29.435  1.00 3.44  ? 167 ASP D O   1 
ATOM   6171 C  CB  . ASP D 1 167 ? 78.504  33.949  26.565  1.00 3.63  ? 167 ASP D CB  1 
ATOM   6172 C  CG  . ASP D 1 167 ? 79.136  32.707  25.942  1.00 3.96  ? 167 ASP D CG  1 
ATOM   6173 O  OD1 . ASP D 1 167 ? 78.760  31.562  26.330  1.00 2.79  ? 167 ASP D OD1 1 
ATOM   6174 O  OD2 . ASP D 1 167 ? 80.035  32.868  25.053  1.00 2.21  ? 167 ASP D OD2 1 
ATOM   6175 N  N   . VAL D 1 168 ? 77.504  31.901  29.309  1.00 2.73  ? 168 VAL D N   1 
ATOM   6176 C  CA  . VAL D 1 168 ? 78.132  31.272  30.477  1.00 3.23  ? 168 VAL D CA  1 
ATOM   6177 C  C   . VAL D 1 168 ? 78.914  29.992  30.180  1.00 3.01  ? 168 VAL D C   1 
ATOM   6178 O  O   . VAL D 1 168 ? 79.195  29.221  31.088  1.00 3.03  ? 168 VAL D O   1 
ATOM   6179 C  CB  . VAL D 1 168 ? 77.119  31.099  31.656  1.00 2.48  ? 168 VAL D CB  1 
ATOM   6180 C  CG1 . VAL D 1 168 ? 76.592  32.477  32.080  1.00 5.17  ? 168 VAL D CG1 1 
ATOM   6181 C  CG2 . VAL D 1 168 ? 75.983  30.163  31.250  1.00 2.89  ? 168 VAL D CG2 1 
ATOM   6182 N  N   . TRP D 1 169 ? 79.287  29.774  28.911  1.00 3.07  ? 169 TRP D N   1 
ATOM   6183 C  CA  . TRP D 1 169 ? 80.275  28.749  28.590  1.00 2.14  ? 169 TRP D CA  1 
ATOM   6184 C  C   . TRP D 1 169 ? 81.582  29.107  29.281  1.00 2.68  ? 169 TRP D C   1 
ATOM   6185 O  O   . TRP D 1 169 ? 81.945  30.285  29.354  1.00 2.42  ? 169 TRP D O   1 
ATOM   6186 C  CB  . TRP D 1 169 ? 80.566  28.740  27.094  1.00 2.36  ? 169 TRP D CB  1 
ATOM   6187 C  CG  . TRP D 1 169 ? 79.520  28.051  26.223  1.00 2.10  ? 169 TRP D CG  1 
ATOM   6188 C  CD1 . TRP D 1 169 ? 78.201  28.354  26.139  1.00 2.34  ? 169 TRP D CD1 1 
ATOM   6189 C  CD2 . TRP D 1 169 ? 79.750  26.975  25.301  1.00 0.79  ? 169 TRP D CD2 1 
ATOM   6190 N  NE1 . TRP D 1 169 ? 77.581  27.540  25.220  1.00 1.29  ? 169 TRP D NE1 1 
ATOM   6191 C  CE2 . TRP D 1 169 ? 78.514  26.684  24.686  1.00 1.29  ? 169 TRP D CE2 1 
ATOM   6192 C  CE3 . TRP D 1 169 ? 80.885  26.220  24.939  1.00 1.13  ? 169 TRP D CE3 1 
ATOM   6193 C  CZ2 . TRP D 1 169 ? 78.381  25.697  23.731  1.00 1.48  ? 169 TRP D CZ2 1 
ATOM   6194 C  CZ3 . TRP D 1 169 ? 80.748  25.216  24.008  1.00 0.98  ? 169 TRP D CZ3 1 
ATOM   6195 C  CH2 . TRP D 1 169 ? 79.505  24.965  23.404  1.00 1.70  ? 169 TRP D CH2 1 
ATOM   6196 N  N   . GLU D 1 170 ? 82.316  28.106  29.737  1.00 2.11  ? 170 GLU D N   1 
ATOM   6197 C  CA  . GLU D 1 170 ? 83.515  28.388  30.518  1.00 2.63  ? 170 GLU D CA  1 
ATOM   6198 C  C   . GLU D 1 170 ? 84.495  29.227  29.698  1.00 3.35  ? 170 GLU D C   1 
ATOM   6199 O  O   . GLU D 1 170 ? 85.229  30.061  30.263  1.00 2.70  ? 170 GLU D O   1 
ATOM   6200 C  CB  . GLU D 1 170 ? 84.124  27.083  31.059  1.00 1.89  ? 170 GLU D CB  1 
ATOM   6201 C  CG  . GLU D 1 170 ? 83.370  26.600  32.301  1.00 2.42  ? 170 GLU D CG  1 
ATOM   6202 C  CD  . GLU D 1 170 ? 83.742  25.194  32.781  1.00 2.50  ? 170 GLU D CD  1 
ATOM   6203 O  OE1 . GLU D 1 170 ? 84.123  24.342  31.954  1.00 3.01  ? 170 GLU D OE1 1 
ATOM   6204 O  OE2 . GLU D 1 170 ? 83.661  24.952  34.008  1.00 3.75  ? 170 GLU D OE2 1 
ATOM   6205 N  N   . HIS D 1 171 ? 84.487  29.055  28.371  1.00 3.96  ? 171 HIS D N   1 
ATOM   6206 C  CA  . HIS D 1 171 ? 85.437  29.806  27.535  1.00 4.36  ? 171 HIS D CA  1 
ATOM   6207 C  C   . HIS D 1 171 ? 85.263  31.323  27.659  1.00 5.23  ? 171 HIS D C   1 
ATOM   6208 O  O   . HIS D 1 171 ? 86.220  32.092  27.431  1.00 5.70  ? 171 HIS D O   1 
ATOM   6209 C  CB  . HIS D 1 171 ? 85.414  29.342  26.057  1.00 4.29  ? 171 HIS D CB  1 
ATOM   6210 C  CG  . HIS D 1 171 ? 84.135  29.641  25.312  1.00 2.99  ? 171 HIS D CG  1 
ATOM   6211 N  ND1 . HIS D 1 171 ? 83.398  28.655  24.685  1.00 3.15  ? 171 HIS D ND1 1 
ATOM   6212 C  CD2 . HIS D 1 171 ? 83.487  30.810  25.060  1.00 3.03  ? 171 HIS D CD2 1 
ATOM   6213 C  CE1 . HIS D 1 171 ? 82.356  29.203  24.081  1.00 2.89  ? 171 HIS D CE1 1 
ATOM   6214 N  NE2 . HIS D 1 171 ? 82.380  30.510  24.297  1.00 3.42  ? 171 HIS D NE2 1 
ATOM   6215 N  N   . ALA D 1 172 ? 84.071  31.751  28.063  1.00 4.50  ? 172 ALA D N   1 
ATOM   6216 C  CA  . ALA D 1 172 ? 83.741  33.165  28.189  1.00 4.44  ? 172 ALA D CA  1 
ATOM   6217 C  C   . ALA D 1 172 ? 84.364  33.789  29.428  1.00 4.62  ? 172 ALA D C   1 
ATOM   6218 O  O   . ALA D 1 172 ? 84.403  35.014  29.536  1.00 4.81  ? 172 ALA D O   1 
ATOM   6219 C  CB  . ALA D 1 172 ? 82.218  33.348  28.250  1.00 4.13  ? 172 ALA D CB  1 
ATOM   6220 N  N   . TYR D 1 173 ? 84.833  32.968  30.367  1.00 4.33  ? 173 TYR D N   1 
ATOM   6221 C  CA  . TYR D 1 173 ? 85.247  33.516  31.648  1.00 4.35  ? 173 TYR D CA  1 
ATOM   6222 C  C   . TYR D 1 173 ? 86.406  32.820  32.338  1.00 3.65  ? 173 TYR D C   1 
ATOM   6223 O  O   . TYR D 1 173 ? 86.875  33.276  33.389  1.00 4.10  ? 173 TYR D O   1 
ATOM   6224 C  CB  . TYR D 1 173 ? 84.051  33.653  32.592  1.00 4.57  ? 173 TYR D CB  1 
ATOM   6225 C  CG  . TYR D 1 173 ? 83.391  32.364  33.039  1.00 4.42  ? 173 TYR D CG  1 
ATOM   6226 C  CD1 . TYR D 1 173 ? 83.969  31.585  34.035  1.00 5.03  ? 173 TYR D CD1 1 
ATOM   6227 C  CD2 . TYR D 1 173 ? 82.163  31.951  32.504  1.00 4.73  ? 173 TYR D CD2 1 
ATOM   6228 C  CE1 . TYR D 1 173 ? 83.358  30.421  34.494  1.00 5.12  ? 173 TYR D CE1 1 
ATOM   6229 C  CE2 . TYR D 1 173 ? 81.568  30.780  32.952  1.00 3.54  ? 173 TYR D CE2 1 
ATOM   6230 C  CZ  . TYR D 1 173 ? 82.170  30.025  33.942  1.00 3.54  ? 173 TYR D CZ  1 
ATOM   6231 O  OH  . TYR D 1 173 ? 81.582  28.863  34.413  1.00 2.22  ? 173 TYR D OH  1 
ATOM   6232 N  N   . TYR D 1 174 ? 86.879  31.717  31.775  1.00 3.90  ? 174 TYR D N   1 
ATOM   6233 C  CA  . TYR D 1 174 ? 87.848  30.929  32.517  1.00 4.08  ? 174 TYR D CA  1 
ATOM   6234 C  C   . TYR D 1 174 ? 89.256  31.526  32.630  1.00 4.38  ? 174 TYR D C   1 
ATOM   6235 O  O   . TYR D 1 174 ? 89.962  31.299  33.614  1.00 4.01  ? 174 TYR D O   1 
ATOM   6236 C  CB  . TYR D 1 174 ? 87.888  29.480  32.027  1.00 4.42  ? 174 TYR D CB  1 
ATOM   6237 C  CG  . TYR D 1 174 ? 88.099  28.528  33.178  1.00 3.77  ? 174 TYR D CG  1 
ATOM   6238 C  CD1 . TYR D 1 174 ? 87.086  28.291  34.078  1.00 3.05  ? 174 TYR D CD1 1 
ATOM   6239 C  CD2 . TYR D 1 174 ? 89.332  27.940  33.412  1.00 3.98  ? 174 TYR D CD2 1 
ATOM   6240 C  CE1 . TYR D 1 174 ? 87.274  27.441  35.147  1.00 3.15  ? 174 TYR D CE1 1 
ATOM   6241 C  CE2 . TYR D 1 174 ? 89.544  27.097  34.470  1.00 3.43  ? 174 TYR D CE2 1 
ATOM   6242 C  CZ  . TYR D 1 174 ? 88.515  26.850  35.338  1.00 3.17  ? 174 TYR D CZ  1 
ATOM   6243 O  OH  . TYR D 1 174 ? 88.734  26.005  36.386  1.00 2.95  ? 174 TYR D OH  1 
ATOM   6244 N  N   . LEU D 1 175 ? 89.679  32.294  31.635  1.00 4.17  ? 175 LEU D N   1 
ATOM   6245 C  CA  . LEU D 1 175 ? 91.039  32.834  31.694  1.00 5.04  ? 175 LEU D CA  1 
ATOM   6246 C  C   . LEU D 1 175 ? 91.211  33.810  32.868  1.00 5.03  ? 175 LEU D C   1 
ATOM   6247 O  O   . LEU D 1 175 ? 92.228  33.782  33.561  1.00 5.49  ? 175 LEU D O   1 
ATOM   6248 C  CB  . LEU D 1 175 ? 91.426  33.493  30.372  1.00 4.69  ? 175 LEU D CB  1 
ATOM   6249 C  CG  . LEU D 1 175 ? 91.506  32.559  29.157  1.00 4.70  ? 175 LEU D CG  1 
ATOM   6250 C  CD1 . LEU D 1 175 ? 91.962  33.326  27.941  1.00 2.90  ? 175 LEU D CD1 1 
ATOM   6251 C  CD2 . LEU D 1 175 ? 92.407  31.361  29.401  1.00 4.28  ? 175 LEU D CD2 1 
ATOM   6252 N  N   . LYS D 1 176 ? 90.211  34.652  33.090  1.00 4.99  ? 176 LYS D N   1 
ATOM   6253 C  CA  . LYS D 1 176 ? 90.284  35.648  34.149  1.00 4.87  ? 176 LYS D CA  1 
ATOM   6254 C  C   . LYS D 1 176 ? 89.667  35.151  35.450  1.00 5.27  ? 176 LYS D C   1 
ATOM   6255 O  O   . LYS D 1 176 ? 90.197  35.413  36.537  1.00 5.85  ? 176 LYS D O   1 
ATOM   6256 C  CB  . LYS D 1 176 ? 89.606  36.943  33.706  1.00 5.13  ? 176 LYS D CB  1 
ATOM   6257 C  CG  . LYS D 1 176 ? 89.285  37.929  34.834  1.00 5.57  ? 176 LYS D CG  1 
ATOM   6258 C  CD  . LYS D 1 176 ? 88.937  39.301  34.252  1.00 7.05  ? 176 LYS D CD  1 
ATOM   6259 C  CE  . LYS D 1 176 ? 88.626  40.333  35.319  1.00 8.64  ? 176 LYS D CE  1 
ATOM   6260 N  NZ  . LYS D 1 176 ? 87.920  41.516  34.743  1.00 10.33 ? 176 LYS D NZ  1 
ATOM   6261 N  N   . PHE D 1 177 ? 88.539  34.444  35.344  1.00 4.88  ? 177 PHE D N   1 
ATOM   6262 C  CA  . PHE D 1 177 ? 87.767  34.100  36.540  1.00 4.73  ? 177 PHE D CA  1 
ATOM   6263 C  C   . PHE D 1 177 ? 87.915  32.635  36.981  1.00 4.68  ? 177 PHE D C   1 
ATOM   6264 O  O   . PHE D 1 177 ? 87.450  32.281  38.062  1.00 4.69  ? 177 PHE D O   1 
ATOM   6265 C  CB  . PHE D 1 177 ? 86.288  34.405  36.292  1.00 4.61  ? 177 PHE D CB  1 
ATOM   6266 C  CG  . PHE D 1 177 ? 86.009  35.840  35.936  1.00 4.35  ? 177 PHE D CG  1 
ATOM   6267 C  CD1 . PHE D 1 177 ? 86.064  36.268  34.620  1.00 5.24  ? 177 PHE D CD1 1 
ATOM   6268 C  CD2 . PHE D 1 177 ? 85.665  36.759  36.921  1.00 5.41  ? 177 PHE D CD2 1 
ATOM   6269 C  CE1 . PHE D 1 177 ? 85.792  37.607  34.295  1.00 4.12  ? 177 PHE D CE1 1 
ATOM   6270 C  CE2 . PHE D 1 177 ? 85.395  38.073  36.617  1.00 4.83  ? 177 PHE D CE2 1 
ATOM   6271 C  CZ  . PHE D 1 177 ? 85.466  38.512  35.299  1.00 5.87  ? 177 PHE D CZ  1 
ATOM   6272 N  N   . GLN D 1 178 ? 88.578  31.801  36.171  1.00 5.42  ? 178 GLN D N   1 
ATOM   6273 C  CA  . GLN D 1 178 ? 88.513  30.346  36.337  1.00 5.15  ? 178 GLN D CA  1 
ATOM   6274 C  C   . GLN D 1 178 ? 87.101  29.990  36.827  1.00 5.40  ? 178 GLN D C   1 
ATOM   6275 O  O   . GLN D 1 178 ? 86.115  30.406  36.216  1.00 4.42  ? 178 GLN D O   1 
ATOM   6276 C  CB  . GLN D 1 178 ? 89.628  29.815  37.256  1.00 5.40  ? 178 GLN D CB  1 
ATOM   6277 C  CG  . GLN D 1 178 ? 91.050  30.164  36.759  1.00 6.49  ? 178 GLN D CG  1 
ATOM   6278 C  CD  . GLN D 1 178 ? 91.441  31.622  36.943  1.00 8.02  ? 178 GLN D CD  1 
ATOM   6279 O  OE1 . GLN D 1 178 ? 91.864  32.291  35.991  1.00 11.99 ? 178 GLN D OE1 1 
ATOM   6280 N  NE2 . GLN D 1 178 ? 91.325  32.119  38.150  1.00 5.43  ? 178 GLN D NE2 1 
ATOM   6281 N  N   . ASN D 1 179 ? 86.999  29.258  37.931  1.00 5.72  ? 179 ASN D N   1 
ATOM   6282 C  CA  . ASN D 1 179 ? 85.715  28.669  38.338  1.00 6.61  ? 179 ASN D CA  1 
ATOM   6283 C  C   . ASN D 1 179 ? 84.733  29.651  38.984  1.00 6.60  ? 179 ASN D C   1 
ATOM   6284 O  O   . ASN D 1 179 ? 83.631  29.259  39.366  1.00 6.68  ? 179 ASN D O   1 
ATOM   6285 C  CB  . ASN D 1 179 ? 85.976  27.563  39.347  1.00 6.62  ? 179 ASN D CB  1 
ATOM   6286 C  CG  . ASN D 1 179 ? 86.506  28.119  40.639  1.00 8.03  ? 179 ASN D CG  1 
ATOM   6287 O  OD1 . ASN D 1 179 ? 87.637  28.618  40.697  1.00 9.52  ? 179 ASN D OD1 1 
ATOM   6288 N  ND2 . ASN D 1 179 ? 85.682  28.094  41.673  1.00 11.96 ? 179 ASN D ND2 1 
ATOM   6289 N  N   . ARG D 1 180 ? 85.129  30.917  39.116  1.00 6.45  ? 180 ARG D N   1 
ATOM   6290 C  CA  . ARG D 1 180 ? 84.351  31.896  39.863  1.00 6.23  ? 180 ARG D CA  1 
ATOM   6291 C  C   . ARG D 1 180 ? 83.352  32.613  38.959  1.00 5.67  ? 180 ARG D C   1 
ATOM   6292 O  O   . ARG D 1 180 ? 83.357  33.845  38.837  1.00 5.88  ? 180 ARG D O   1 
ATOM   6293 C  CB  . ARG D 1 180 ? 85.273  32.902  40.584  1.00 7.15  ? 180 ARG D CB  1 
ATOM   6294 C  CG  . ARG D 1 180 ? 86.419  32.270  41.384  1.00 7.40  ? 180 ARG D CG  1 
ATOM   6295 C  CD  . ARG D 1 180 ? 87.386  33.319  41.993  1.00 8.22  ? 180 ARG D CD  1 
ATOM   6296 N  NE  . ARG D 1 180 ? 88.167  34.015  40.964  1.00 5.35  ? 180 ARG D NE  1 
ATOM   6297 C  CZ  . ARG D 1 180 ? 89.240  33.509  40.386  1.00 4.81  ? 180 ARG D CZ  1 
ATOM   6298 N  NH1 . ARG D 1 180 ? 89.659  32.311  40.740  1.00 6.07  ? 180 ARG D NH1 1 
ATOM   6299 N  NH2 . ARG D 1 180 ? 89.872  34.181  39.426  1.00 5.43  ? 180 ARG D NH2 1 
ATOM   6300 N  N   . ARG D 1 181 ? 82.481  31.839  38.321  1.00 5.10  ? 181 ARG D N   1 
ATOM   6301 C  CA  . ARG D 1 181 ? 81.453  32.408  37.449  1.00 5.53  ? 181 ARG D CA  1 
ATOM   6302 C  C   . ARG D 1 181 ? 80.607  33.525  38.091  1.00 5.68  ? 181 ARG D C   1 
ATOM   6303 O  O   . ARG D 1 181 ? 80.269  34.508  37.433  1.00 7.17  ? 181 ARG D O   1 
ATOM   6304 C  CB  . ARG D 1 181 ? 80.551  31.279  36.909  1.00 4.98  ? 181 ARG D CB  1 
ATOM   6305 C  CG  . ARG D 1 181 ? 79.621  31.675  35.766  1.00 5.09  ? 181 ARG D CG  1 
ATOM   6306 C  CD  . ARG D 1 181 ? 78.465  30.666  35.631  1.00 3.61  ? 181 ARG D CD  1 
ATOM   6307 N  NE  . ARG D 1 181 ? 78.891  29.392  35.062  1.00 3.41  ? 181 ARG D NE  1 
ATOM   6308 C  CZ  . ARG D 1 181 ? 78.046  28.409  34.762  1.00 5.98  ? 181 ARG D CZ  1 
ATOM   6309 N  NH1 . ARG D 1 181 ? 76.745  28.557  34.986  1.00 7.23  ? 181 ARG D NH1 1 
ATOM   6310 N  NH2 . ARG D 1 181 ? 78.495  27.273  34.263  1.00 7.44  ? 181 ARG D NH2 1 
ATOM   6311 N  N   . PRO D 1 182 ? 80.241  33.385  39.379  1.00 6.43  ? 182 PRO D N   1 
ATOM   6312 C  CA  . PRO D 1 182 ? 79.450  34.468  39.979  1.00 6.03  ? 182 PRO D CA  1 
ATOM   6313 C  C   . PRO D 1 182 ? 80.080  35.885  39.902  1.00 6.50  ? 182 PRO D C   1 
ATOM   6314 O  O   . PRO D 1 182 ? 79.355  36.881  39.842  1.00 6.47  ? 182 PRO D O   1 
ATOM   6315 C  CB  . PRO D 1 182 ? 79.272  34.016  41.442  1.00 6.49  ? 182 PRO D CB  1 
ATOM   6316 C  CG  . PRO D 1 182 ? 79.449  32.499  41.403  1.00 6.17  ? 182 PRO D CG  1 
ATOM   6317 C  CD  . PRO D 1 182 ? 80.399  32.215  40.272  1.00 6.32  ? 182 PRO D CD  1 
ATOM   6318 N  N   . ASP D 1 183 ? 81.406  35.969  39.928  1.00 6.81  ? 183 ASP D N   1 
ATOM   6319 C  CA  . ASP D 1 183 ? 82.079  37.260  39.807  1.00 7.46  ? 183 ASP D CA  1 
ATOM   6320 C  C   . ASP D 1 183 ? 81.997  37.773  38.373  1.00 7.11  ? 183 ASP D C   1 
ATOM   6321 O  O   . ASP D 1 183 ? 81.907  38.968  38.124  1.00 7.82  ? 183 ASP D O   1 
ATOM   6322 C  CB  . ASP D 1 183 ? 83.554  37.142  40.205  1.00 7.89  ? 183 ASP D CB  1 
ATOM   6323 C  CG  . ASP D 1 183 ? 83.746  36.769  41.657  1.00 9.37  ? 183 ASP D CG  1 
ATOM   6324 O  OD1 . ASP D 1 183 ? 82.784  36.919  42.437  1.00 10.28 ? 183 ASP D OD1 1 
ATOM   6325 O  OD2 . ASP D 1 183 ? 84.874  36.358  42.010  1.00 10.12 ? 183 ASP D OD2 1 
ATOM   6326 N  N   . TYR D 1 184 ? 82.033  36.848  37.425  1.00 6.90  ? 184 TYR D N   1 
ATOM   6327 C  CA  . TYR D 1 184 ? 81.869  37.171  36.017  1.00 5.92  ? 184 TYR D CA  1 
ATOM   6328 C  C   . TYR D 1 184 ? 80.459  37.681  35.771  1.00 6.02  ? 184 TYR D C   1 
ATOM   6329 O  O   . TYR D 1 184 ? 80.254  38.675  35.104  1.00 5.41  ? 184 TYR D O   1 
ATOM   6330 C  CB  . TYR D 1 184 ? 82.147  35.906  35.210  1.00 5.95  ? 184 TYR D CB  1 
ATOM   6331 C  CG  . TYR D 1 184 ? 81.711  35.902  33.761  1.00 4.93  ? 184 TYR D CG  1 
ATOM   6332 C  CD1 . TYR D 1 184 ? 82.320  36.733  32.827  1.00 5.89  ? 184 TYR D CD1 1 
ATOM   6333 C  CD2 . TYR D 1 184 ? 80.721  35.017  33.312  1.00 3.11  ? 184 TYR D CD2 1 
ATOM   6334 C  CE1 . TYR D 1 184 ? 81.956  36.706  31.511  1.00 6.12  ? 184 TYR D CE1 1 
ATOM   6335 C  CE2 . TYR D 1 184 ? 80.336  35.007  31.995  1.00 4.29  ? 184 TYR D CE2 1 
ATOM   6336 C  CZ  . TYR D 1 184 ? 80.959  35.839  31.095  1.00 4.63  ? 184 TYR D CZ  1 
ATOM   6337 O  OH  . TYR D 1 184 ? 80.584  35.807  29.769  1.00 4.44  ? 184 TYR D OH  1 
ATOM   6338 N  N   . ILE D 1 185 ? 79.480  36.971  36.305  1.00 5.55  ? 185 ILE D N   1 
ATOM   6339 C  CA  . ILE D 1 185 ? 78.096  37.429  36.266  1.00 6.13  ? 185 ILE D CA  1 
ATOM   6340 C  C   . ILE D 1 185 ? 77.969  38.869  36.832  1.00 6.32  ? 185 ILE D C   1 
ATOM   6341 O  O   . ILE D 1 185 ? 77.299  39.743  36.244  1.00 6.46  ? 185 ILE D O   1 
ATOM   6342 C  CB  . ILE D 1 185 ? 77.205  36.428  37.040  1.00 5.93  ? 185 ILE D CB  1 
ATOM   6343 C  CG1 . ILE D 1 185 ? 77.255  35.038  36.392  1.00 5.32  ? 185 ILE D CG1 1 
ATOM   6344 C  CG2 . ILE D 1 185 ? 75.781  36.951  37.162  1.00 5.78  ? 185 ILE D CG2 1 
ATOM   6345 C  CD1 . ILE D 1 185 ? 76.733  33.952  37.295  1.00 4.82  ? 185 ILE D CD1 1 
ATOM   6346 N  N   . LYS D 1 186 ? 78.635  39.108  37.954  1.00 6.63  ? 186 LYS D N   1 
ATOM   6347 C  CA  . LYS D 1 186 ? 78.770  40.448  38.547  1.00 7.31  ? 186 LYS D CA  1 
ATOM   6348 C  C   . LYS D 1 186 ? 79.323  41.495  37.574  1.00 7.32  ? 186 LYS D C   1 
ATOM   6349 O  O   . LYS D 1 186 ? 78.728  42.558  37.398  1.00 8.50  ? 186 LYS D O   1 
ATOM   6350 C  CB  . LYS D 1 186 ? 79.656  40.359  39.791  1.00 7.86  ? 186 LYS D CB  1 
ATOM   6351 C  CG  . LYS D 1 186 ? 78.902  40.396  41.121  1.00 9.49  ? 186 LYS D CG  1 
ATOM   6352 C  CD  . LYS D 1 186 ? 77.475  39.878  41.010  1.00 10.42 ? 186 LYS D CD  1 
ATOM   6353 C  CE  . LYS D 1 186 ? 76.943  39.464  42.387  1.00 10.59 ? 186 LYS D CE  1 
ATOM   6354 N  NZ  . LYS D 1 186 ? 75.457  39.304  42.401  1.00 10.19 ? 186 LYS D NZ  1 
ATOM   6355 N  N   . GLU D 1 187 ? 80.445  41.174  36.935  1.00 7.29  ? 187 GLU D N   1 
ATOM   6356 C  CA  . GLU D 1 187 ? 81.061  42.044  35.911  1.00 6.97  ? 187 GLU D CA  1 
ATOM   6357 C  C   . GLU D 1 187 ? 80.167  42.396  34.701  1.00 7.15  ? 187 GLU D C   1 
ATOM   6358 O  O   . GLU D 1 187 ? 80.227  43.522  34.193  1.00 7.72  ? 187 GLU D O   1 
ATOM   6359 C  CB  . GLU D 1 187 ? 82.424  41.486  35.474  1.00 6.38  ? 187 GLU D CB  1 
ATOM   6360 C  CG  . GLU D 1 187 ? 83.535  41.601  36.537  1.00 7.51  ? 187 GLU D CG  1 
ATOM   6361 C  CD  . GLU D 1 187 ? 83.889  43.049  36.905  1.00 8.31  ? 187 GLU D CD  1 
ATOM   6362 O  OE1 . GLU D 1 187 ? 84.654  43.236  37.866  1.00 11.78 ? 187 GLU D OE1 1 
ATOM   6363 O  OE2 . GLU D 1 187 ? 83.393  43.993  36.260  1.00 9.27  ? 187 GLU D OE2 1 
ATOM   6364 N  N   . PHE D 1 188 ? 79.340  41.445  34.251  1.00 6.21  ? 188 PHE D N   1 
ATOM   6365 C  CA  . PHE D 1 188 ? 78.344  41.678  33.199  1.00 6.23  ? 188 PHE D CA  1 
ATOM   6366 C  C   . PHE D 1 188 ? 77.517  42.982  33.316  1.00 6.70  ? 188 PHE D C   1 
ATOM   6367 O  O   . PHE D 1 188 ? 77.316  43.662  32.315  1.00 7.99  ? 188 PHE D O   1 
ATOM   6368 C  CB  . PHE D 1 188 ? 77.427  40.437  33.023  1.00 6.01  ? 188 PHE D CB  1 
ATOM   6369 C  CG  . PHE D 1 188 ? 76.356  40.587  31.952  1.00 6.79  ? 188 PHE D CG  1 
ATOM   6370 C  CD1 . PHE D 1 188 ? 76.693  40.687  30.605  1.00 6.10  ? 188 PHE D CD1 1 
ATOM   6371 C  CD2 . PHE D 1 188 ? 75.000  40.601  32.297  1.00 6.40  ? 188 PHE D CD2 1 
ATOM   6372 C  CE1 . PHE D 1 188 ? 75.705  40.821  29.630  1.00 6.68  ? 188 PHE D CE1 1 
ATOM   6373 C  CE2 . PHE D 1 188 ? 74.018  40.714  31.328  1.00 5.73  ? 188 PHE D CE2 1 
ATOM   6374 C  CZ  . PHE D 1 188 ? 74.380  40.823  29.982  1.00 5.32  ? 188 PHE D CZ  1 
ATOM   6375 N  N   . TRP D 1 189 ? 77.014  43.318  34.503  1.00 7.89  ? 189 TRP D N   1 
ATOM   6376 C  CA  . TRP D 1 189 ? 76.196  44.528  34.656  1.00 7.58  ? 189 TRP D CA  1 
ATOM   6377 C  C   . TRP D 1 189 ? 76.928  45.805  34.250  1.00 8.15  ? 189 TRP D C   1 
ATOM   6378 O  O   . TRP D 1 189 ? 76.291  46.799  33.887  1.00 9.05  ? 189 TRP D O   1 
ATOM   6379 C  CB  . TRP D 1 189 ? 75.640  44.682  36.085  1.00 7.93  ? 189 TRP D CB  1 
ATOM   6380 C  CG  . TRP D 1 189 ? 74.802  43.522  36.542  1.00 7.97  ? 189 TRP D CG  1 
ATOM   6381 C  CD1 . TRP D 1 189 ? 75.021  42.721  37.628  1.00 9.09  ? 189 TRP D CD1 1 
ATOM   6382 C  CD2 . TRP D 1 189 ? 73.628  43.020  35.900  1.00 9.29  ? 189 TRP D CD2 1 
ATOM   6383 N  NE1 . TRP D 1 189 ? 74.044  41.752  37.707  1.00 8.17  ? 189 TRP D NE1 1 
ATOM   6384 C  CE2 . TRP D 1 189 ? 73.181  41.912  36.656  1.00 8.41  ? 189 TRP D CE2 1 
ATOM   6385 C  CE3 . TRP D 1 189 ? 72.917  43.394  34.755  1.00 10.06 ? 189 TRP D CE3 1 
ATOM   6386 C  CZ2 . TRP D 1 189 ? 72.054  41.188  36.312  1.00 9.16  ? 189 TRP D CZ2 1 
ATOM   6387 C  CZ3 . TRP D 1 189 ? 71.801  42.670  34.410  1.00 11.83 ? 189 TRP D CZ3 1 
ATOM   6388 C  CH2 . TRP D 1 189 ? 71.378  41.579  35.184  1.00 11.00 ? 189 TRP D CH2 1 
ATOM   6389 N  N   . ASN D 1 190 ? 78.253  45.774  34.335  1.00 8.27  ? 190 ASN D N   1 
ATOM   6390 C  CA  . ASN D 1 190 ? 79.091  46.898  33.946  1.00 8.42  ? 190 ASN D CA  1 
ATOM   6391 C  C   . ASN D 1 190 ? 79.283  47.011  32.446  1.00 8.48  ? 190 ASN D C   1 
ATOM   6392 O  O   . ASN D 1 190 ? 79.702  48.062  31.959  1.00 9.15  ? 190 ASN D O   1 
ATOM   6393 C  CB  . ASN D 1 190 ? 80.451  46.807  34.640  1.00 8.68  ? 190 ASN D CB  1 
ATOM   6394 C  CG  . ASN D 1 190 ? 80.339  46.957  36.147  1.00 10.08 ? 190 ASN D CG  1 
ATOM   6395 O  OD1 . ASN D 1 190 ? 79.609  47.822  36.647  1.00 10.56 ? 190 ASN D OD1 1 
ATOM   6396 N  ND2 . ASN D 1 190 ? 81.065  46.132  36.871  1.00 10.03 ? 190 ASN D ND2 1 
ATOM   6397 N  N   . VAL D 1 191 ? 78.977  45.942  31.715  1.00 8.11  ? 191 VAL D N   1 
ATOM   6398 C  CA  . VAL D 1 191 ? 79.196  45.935  30.262  1.00 7.69  ? 191 VAL D CA  1 
ATOM   6399 C  C   . VAL D 1 191 ? 77.954  45.613  29.423  1.00 7.75  ? 191 VAL D C   1 
ATOM   6400 O  O   . VAL D 1 191 ? 77.999  45.706  28.188  1.00 7.83  ? 191 VAL D O   1 
ATOM   6401 C  CB  . VAL D 1 191 ? 80.381  45.029  29.842  1.00 7.53  ? 191 VAL D CB  1 
ATOM   6402 C  CG1 . VAL D 1 191 ? 81.712  45.639  30.274  1.00 8.20  ? 191 VAL D CG1 1 
ATOM   6403 C  CG2 . VAL D 1 191 ? 80.197  43.612  30.402  1.00 6.90  ? 191 VAL D CG2 1 
ATOM   6404 N  N   . VAL D 1 192 ? 76.839  45.240  30.065  1.00 7.43  ? 192 VAL D N   1 
ATOM   6405 C  CA  . VAL D 1 192 ? 75.603  45.051  29.311  1.00 8.48  ? 192 VAL D CA  1 
ATOM   6406 C  C   . VAL D 1 192 ? 75.139  46.355  28.641  1.00 8.39  ? 192 VAL D C   1 
ATOM   6407 O  O   . VAL D 1 192 ? 74.886  47.370  29.292  1.00 9.78  ? 192 VAL D O   1 
ATOM   6408 C  CB  . VAL D 1 192 ? 74.453  44.409  30.129  1.00 8.29  ? 192 VAL D CB  1 
ATOM   6409 C  CG1 . VAL D 1 192 ? 74.018  45.318  31.274  1.00 7.59  ? 192 VAL D CG1 1 
ATOM   6410 C  CG2 . VAL D 1 192 ? 73.282  44.086  29.199  1.00 9.50  ? 192 VAL D CG2 1 
ATOM   6411 N  N   . ASN D 1 193 ? 75.047  46.302  27.320  1.00 9.08  ? 193 ASN D N   1 
ATOM   6412 C  CA  . ASN D 1 193 ? 74.681  47.447  26.495  1.00 8.81  ? 193 ASN D CA  1 
ATOM   6413 C  C   . ASN D 1 193 ? 73.187  47.766  26.551  1.00 8.93  ? 193 ASN D C   1 
ATOM   6414 O  O   . ASN D 1 193 ? 72.384  47.220  25.792  1.00 9.06  ? 193 ASN D O   1 
ATOM   6415 C  CB  . ASN D 1 193 ? 75.127  47.180  25.047  1.00 9.21  ? 193 ASN D CB  1 
ATOM   6416 C  CG  . ASN D 1 193 ? 75.040  48.417  24.173  1.00 9.37  ? 193 ASN D CG  1 
ATOM   6417 O  OD1 . ASN D 1 193 ? 74.556  49.455  24.605  1.00 12.38 ? 193 ASN D OD1 1 
ATOM   6418 N  ND2 . ASN D 1 193 ? 75.509  48.305  22.931  1.00 10.13 ? 193 ASN D ND2 1 
ATOM   6419 N  N   . TRP D 1 194 ? 72.803  48.651  27.463  1.00 9.56  ? 194 TRP D N   1 
ATOM   6420 C  CA  . TRP D 1 194 ? 71.387  48.962  27.630  1.00 9.85  ? 194 TRP D CA  1 
ATOM   6421 C  C   . TRP D 1 194 ? 70.800  49.670  26.403  1.00 10.20 ? 194 TRP D C   1 
ATOM   6422 O  O   . TRP D 1 194 ? 69.593  49.577  26.122  1.00 10.98 ? 194 TRP D O   1 
ATOM   6423 C  CB  . TRP D 1 194 ? 71.125  49.718  28.943  1.00 10.22 ? 194 TRP D CB  1 
ATOM   6424 C  CG  . TRP D 1 194 ? 71.275  48.814  30.126  1.00 10.09 ? 194 TRP D CG  1 
ATOM   6425 C  CD1 . TRP D 1 194 ? 72.188  48.915  31.132  1.00 11.54 ? 194 TRP D CD1 1 
ATOM   6426 C  CD2 . TRP D 1 194 ? 70.510  47.627  30.396  1.00 10.39 ? 194 TRP D CD2 1 
ATOM   6427 N  NE1 . TRP D 1 194 ? 72.027  47.875  32.024  1.00 10.99 ? 194 TRP D NE1 1 
ATOM   6428 C  CE2 . TRP D 1 194 ? 71.001  47.074  31.596  1.00 10.63 ? 194 TRP D CE2 1 
ATOM   6429 C  CE3 . TRP D 1 194 ? 69.444  46.995  29.746  1.00 9.92  ? 194 TRP D CE3 1 
ATOM   6430 C  CZ2 . TRP D 1 194 ? 70.465  45.907  32.160  1.00 10.13 ? 194 TRP D CZ2 1 
ATOM   6431 C  CZ3 . TRP D 1 194 ? 68.916  45.840  30.303  1.00 10.78 ? 194 TRP D CZ3 1 
ATOM   6432 C  CH2 . TRP D 1 194 ? 69.432  45.304  31.492  1.00 10.06 ? 194 TRP D CH2 1 
ATOM   6433 N  N   . ASP D 1 195 ? 71.670  50.341  25.654  1.00 10.78 ? 195 ASP D N   1 
ATOM   6434 C  CA  . ASP D 1 195 ? 71.264  51.074  24.471  1.00 10.32 ? 195 ASP D CA  1 
ATOM   6435 C  C   . ASP D 1 195 ? 70.752  50.120  23.414  1.00 10.08 ? 195 ASP D C   1 
ATOM   6436 O  O   . ASP D 1 195 ? 69.693  50.342  22.821  1.00 10.89 ? 195 ASP D O   1 
ATOM   6437 C  CB  . ASP D 1 195 ? 72.460  51.869  23.944  1.00 10.88 ? 195 ASP D CB  1 
ATOM   6438 C  CG  . ASP D 1 195 ? 73.022  52.813  24.986  1.00 12.05 ? 195 ASP D CG  1 
ATOM   6439 O  OD1 . ASP D 1 195 ? 72.248  53.230  25.875  1.00 14.24 ? 195 ASP D OD1 1 
ATOM   6440 O  OD2 . ASP D 1 195 ? 74.223  53.136  24.933  1.00 14.25 ? 195 ASP D OD2 1 
ATOM   6441 N  N   . GLU D 1 196 ? 71.522  49.066  23.164  1.00 9.73  ? 196 GLU D N   1 
ATOM   6442 C  CA  . GLU D 1 196 ? 71.139  48.052  22.190  1.00 9.36  ? 196 GLU D CA  1 
ATOM   6443 C  C   . GLU D 1 196 ? 69.954  47.266  22.744  1.00 8.94  ? 196 GLU D C   1 
ATOM   6444 O  O   . GLU D 1 196 ? 69.026  46.911  22.017  1.00 9.52  ? 196 GLU D O   1 
ATOM   6445 C  CB  . GLU D 1 196 ? 72.307  47.110  21.896  1.00 9.18  ? 196 GLU D CB  1 
ATOM   6446 C  CG  . GLU D 1 196 ? 72.026  46.057  20.815  1.00 10.50 ? 196 GLU D CG  1 
ATOM   6447 C  CD  . GLU D 1 196 ? 71.857  46.643  19.416  1.00 11.98 ? 196 GLU D CD  1 
ATOM   6448 O  OE1 . GLU D 1 196 ? 72.246  47.807  19.211  1.00 13.97 ? 196 GLU D OE1 1 
ATOM   6449 O  OE2 . GLU D 1 196 ? 71.362  45.928  18.511  1.00 12.09 ? 196 GLU D OE2 1 
ATOM   6450 N  N   . ALA D 1 197 ? 69.990  47.018  24.044  1.00 9.27  ? 197 ALA D N   1 
ATOM   6451 C  CA  . ALA D 1 197 ? 68.901  46.310  24.711  1.00 9.28  ? 197 ALA D CA  1 
ATOM   6452 C  C   . ALA D 1 197 ? 67.575  47.045  24.489  1.00 9.25  ? 197 ALA D C   1 
ATOM   6453 O  O   . ALA D 1 197 ? 66.547  46.425  24.175  1.00 9.65  ? 197 ALA D O   1 
ATOM   6454 C  CB  . ALA D 1 197 ? 69.202  46.190  26.191  1.00 8.94  ? 197 ALA D CB  1 
ATOM   6455 N  N   . ALA D 1 198 ? 67.610  48.364  24.655  1.00 9.51  ? 198 ALA D N   1 
ATOM   6456 C  CA  . ALA D 1 198 ? 66.454  49.226  24.382  1.00 9.84  ? 198 ALA D CA  1 
ATOM   6457 C  C   . ALA D 1 198 ? 66.052  49.261  22.907  1.00 9.66  ? 198 ALA D C   1 
ATOM   6458 O  O   . ALA D 1 198 ? 64.864  49.265  22.569  1.00 10.41 ? 198 ALA D O   1 
ATOM   6459 C  CB  . ALA D 1 198 ? 66.713  50.627  24.887  1.00 10.21 ? 198 ALA D CB  1 
ATOM   6460 N  N   . ALA D 1 199 ? 67.050  49.268  22.031  1.00 9.72  ? 199 ALA D N   1 
ATOM   6461 C  CA  . ALA D 1 199 ? 66.786  49.285  20.608  1.00 9.97  ? 199 ALA D CA  1 
ATOM   6462 C  C   . ALA D 1 199 ? 66.034  48.017  20.254  1.00 9.76  ? 199 ALA D C   1 
ATOM   6463 O  O   . ALA D 1 199 ? 65.057  48.048  19.497  1.00 10.70 ? 199 ALA D O   1 
ATOM   6464 C  CB  . ALA D 1 199 ? 68.085  49.391  19.824  1.00 9.84  ? 199 ALA D CB  1 
ATOM   6465 N  N   . ARG D 1 200 ? 66.460  46.904  20.842  1.00 9.73  ? 200 ARG D N   1 
ATOM   6466 C  CA  . ARG D 1 200 ? 65.785  45.649  20.600  1.00 9.37  ? 200 ARG D CA  1 
ATOM   6467 C  C   . ARG D 1 200 ? 64.389  45.630  21.224  1.00 9.00  ? 200 ARG D C   1 
ATOM   6468 O  O   . ARG D 1 200 ? 63.455  45.083  20.636  1.00 9.25  ? 200 ARG D O   1 
ATOM   6469 C  CB  . ARG D 1 200 ? 66.625  44.458  21.088  1.00 8.67  ? 200 ARG D CB  1 
ATOM   6470 C  CG  . ARG D 1 200 ? 67.955  44.271  20.337  1.00 8.48  ? 200 ARG D CG  1 
ATOM   6471 C  CD  . ARG D 1 200 ? 68.706  43.047  20.876  1.00 6.91  ? 200 ARG D CD  1 
ATOM   6472 N  NE  . ARG D 1 200 ? 68.037  41.797  20.517  1.00 9.03  ? 200 ARG D NE  1 
ATOM   6473 C  CZ  . ARG D 1 200 ? 68.284  41.060  19.439  1.00 8.42  ? 200 ARG D CZ  1 
ATOM   6474 N  NH1 . ARG D 1 200 ? 69.221  41.413  18.550  1.00 9.20  ? 200 ARG D NH1 1 
ATOM   6475 N  NH2 . ARG D 1 200 ? 67.582  39.949  19.251  1.00 8.16  ? 200 ARG D NH2 1 
ATOM   6476 N  N   . PHE D 1 201 ? 64.220  46.247  22.389  1.00 9.30  ? 201 PHE D N   1 
ATOM   6477 C  CA  . PHE D 1 201 ? 62.894  46.241  23.010  1.00 9.93  ? 201 PHE D CA  1 
ATOM   6478 C  C   . PHE D 1 201 ? 61.906  47.064  22.194  1.00 10.29 ? 201 PHE D C   1 
ATOM   6479 O  O   . PHE D 1 201 ? 60.745  46.705  22.071  1.00 11.24 ? 201 PHE D O   1 
ATOM   6480 C  CB  . PHE D 1 201 ? 62.931  46.736  24.458  1.00 10.17 ? 201 PHE D CB  1 
ATOM   6481 C  CG  . PHE D 1 201 ? 61.581  46.747  25.122  1.00 11.26 ? 201 PHE D CG  1 
ATOM   6482 C  CD1 . PHE D 1 201 ? 61.001  45.568  25.560  1.00 10.83 ? 201 PHE D CD1 1 
ATOM   6483 C  CD2 . PHE D 1 201 ? 60.878  47.932  25.279  1.00 10.81 ? 201 PHE D CD2 1 
ATOM   6484 C  CE1 . PHE D 1 201 ? 59.756  45.566  26.176  1.00 11.40 ? 201 PHE D CE1 1 
ATOM   6485 C  CE2 . PHE D 1 201 ? 59.620  47.944  25.883  1.00 12.47 ? 201 PHE D CE2 1 
ATOM   6486 C  CZ  . PHE D 1 201 ? 59.057  46.763  26.326  1.00 12.06 ? 201 PHE D CZ  1 
ATOM   6487 N  N   . ALA D 1 202 ? 62.376  48.165  21.623  1.00 11.01 ? 202 ALA D N   1 
ATOM   6488 C  CA  . ALA D 1 202 ? 61.489  49.023  20.845  1.00 11.14 ? 202 ALA D CA  1 
ATOM   6489 C  C   . ALA D 1 202 ? 61.072  48.367  19.515  1.00 11.02 ? 202 ALA D C   1 
ATOM   6490 O  O   . ALA D 1 202 ? 59.923  48.491  19.078  1.00 11.89 ? 202 ALA D O   1 
ATOM   6491 C  CB  . ALA D 1 202 ? 62.119  50.385  20.620  1.00 10.95 ? 202 ALA D CB  1 
ATOM   6492 N  N   . ALA D 1 203 ? 61.995  47.643  18.890  1.00 10.96 ? 203 ALA D N   1 
ATOM   6493 C  CA  . ALA D 1 203 ? 61.686  46.928  17.654  1.00 10.98 ? 203 ALA D CA  1 
ATOM   6494 C  C   . ALA D 1 203 ? 60.776  45.730  17.921  1.00 11.13 ? 203 ALA D C   1 
ATOM   6495 O  O   . ALA D 1 203 ? 59.801  45.508  17.196  1.00 12.33 ? 203 ALA D O   1 
ATOM   6496 C  CB  . ALA D 1 203 ? 62.971  46.484  16.968  1.00 10.87 ? 203 ALA D CB  1 
ATOM   6497 N  N   . LYS D 1 204 ? 61.099  44.958  18.956  1.00 11.44 ? 204 LYS D N   1 
ATOM   6498 C  CA  . LYS D 1 204 ? 60.241  43.866  19.408  1.00 11.50 ? 204 LYS D CA  1 
ATOM   6499 C  C   . LYS D 1 204 ? 60.324  42.737  18.394  1.00 11.51 ? 204 LYS D C   1 
ATOM   6500 O  O   . LYS D 1 204 ? 59.722  41.669  18.537  1.00 12.38 ? 204 LYS D O   1 
ATOM   6501 C  CB  . LYS D 1 204 ? 58.815  44.368  19.595  1.00 12.01 ? 204 LYS D CB  1 
ATOM   6502 C  CG  . LYS D 1 204 ? 58.732  45.490  20.611  1.00 12.78 ? 204 LYS D CG  1 
ATOM   6503 C  CD  . LYS D 1 204 ? 58.783  46.851  19.937  1.00 13.82 ? 204 LYS D CD  1 
ATOM   6504 C  CE  . LYS D 1 204 ? 58.744  47.952  20.984  1.00 14.94 ? 204 LYS D CE  1 
ATOM   6505 N  NZ  . LYS D 1 204 ? 57.919  47.557  22.177  1.00 16.48 ? 204 LYS D NZ  1 
ATOM   6506 N  N   . LYS D 1 205 ? 61.130  42.987  17.374  1.00 11.92 ? 205 LYS D N   1 
ATOM   6507 C  CA  . LYS D 1 205 ? 61.523  41.965  16.441  1.00 12.03 ? 205 LYS D CA  1 
ATOM   6508 C  C   . LYS D 1 205 ? 62.901  42.410  15.980  1.00 12.62 ? 205 LYS D C   1 
ATOM   6509 O  O   . LYS D 1 205 ? 63.390  43.434  16.483  1.00 13.15 ? 205 LYS D O   1 
ATOM   6510 C  CB  . LYS D 1 205 ? 60.513  41.855  15.288  1.00 11.67 ? 205 LYS D CB  1 
ATOM   6511 C  CG  . LYS D 1 205 ? 60.303  43.131  14.449  1.00 12.24 ? 205 LYS D CG  1 
ATOM   6512 C  CD  . LYS D 1 205 ? 59.093  42.990  13.517  1.00 12.65 ? 205 LYS D CD  1 
ATOM   6513 C  CE  . LYS D 1 205 ? 59.128  44.025  12.372  1.00 13.26 ? 205 LYS D CE  1 
ATOM   6514 N  NZ  . LYS D 1 205 ? 59.047  45.448  12.838  1.00 14.31 ? 205 LYS D NZ  1 
ATOM   6515 O  OXT . LYS D 1 205 ? 63.567  41.791  15.151  1.00 13.64 ? 205 LYS D OXT 1 
HETATM 6516 MN MN  . MN  E 2 .   ? 34.806  14.896  9.558   1.00 0.85  ? 206 MN  A MN  1 
HETATM 6517 MN MN  . MN  F 2 .   ? 22.165  21.045  21.404  1.00 1.63  ? 206 MN  B MN  1 
HETATM 6518 O  O1  . PEO G 3 .   ? 23.719  22.282  20.761  0.50 2.82  ? 207 PEO B O1  1 
HETATM 6519 O  O2  . PEO G 3 .   ? 24.620  21.741  21.796  0.50 6.39  ? 207 PEO B O2  1 
HETATM 6520 MN MN  . MN  H 2 .   ? 85.921  18.469  35.338  1.00 2.42  ? 206 MN  C MN  1 
HETATM 6521 O  O1  . PEO I 3 .   ? 84.125  18.689  34.298  0.50 0.89  ? 207 PEO C O1  1 
HETATM 6522 O  O2  . PEO I 3 .   ? 84.317  17.293  34.651  0.50 3.00  ? 207 PEO C O2  1 
HETATM 6523 MN MN  . MN  J 2 .   ? 80.895  31.807  23.667  1.00 2.53  ? 206 MN  D MN  1 
HETATM 6524 O  O1  . PEO K 3 .   ? 79.402  30.427  24.147  0.50 2.04  ? 208 PEO D O1  1 
HETATM 6525 O  O2  . PEO K 3 .   ? 79.917  29.598  23.050  0.50 5.02  ? 208 PEO D O2  1 
HETATM 6526 O  O   . HOH L 4 .   ? 33.778  15.551  7.694   0.70 3.04  ? 207 HOH A O   1 
HETATM 6527 O  O   . HOH L 4 .   ? 35.273  17.021  10.490  1.00 2.86  ? 208 HOH A O   1 
HETATM 6528 O  O   . HOH L 4 .   ? 67.834  19.314  16.953  1.00 10.60 ? 209 HOH A O   1 
HETATM 6529 O  O   . HOH L 4 .   ? 30.287  18.675  14.999  1.00 0.84  ? 210 HOH A O   1 
HETATM 6530 O  O   . HOH L 4 .   ? 35.630  23.808  18.695  1.00 2.55  ? 211 HOH A O   1 
HETATM 6531 O  O   . HOH L 4 .   ? 39.231  25.665  -8.390  1.00 2.96  ? 212 HOH A O   1 
HETATM 6532 O  O   . HOH L 4 .   ? 32.516  24.063  16.471  1.00 3.21  ? 213 HOH A O   1 
HETATM 6533 O  O   . HOH L 4 .   ? 41.698  26.084  16.040  1.00 1.89  ? 214 HOH A O   1 
HETATM 6534 O  O   . HOH L 4 .   ? 33.534  27.515  15.872  1.00 1.67  ? 215 HOH A O   1 
HETATM 6535 O  O   . HOH L 4 .   ? 46.037  18.503  8.400   1.00 11.63 ? 216 HOH A O   1 
HETATM 6536 O  O   . HOH L 4 .   ? 57.750  19.800  13.111  1.00 7.69  ? 217 HOH A O   1 
HETATM 6537 O  O   . HOH L 4 .   ? 31.040  19.016  4.632   1.00 2.01  ? 218 HOH A O   1 
HETATM 6538 O  O   . HOH L 4 .   ? 38.173  25.420  10.261  1.00 1.60  ? 219 HOH A O   1 
HETATM 6539 O  O   . HOH L 4 .   ? 38.337  25.591  -12.817 1.00 17.95 ? 220 HOH A O   1 
HETATM 6540 O  O   . HOH L 4 .   ? 35.843  14.870  -6.105  1.00 1.14  ? 221 HOH A O   1 
HETATM 6541 O  O   . HOH L 4 .   ? 27.674  -0.389  14.099  1.00 14.61 ? 222 HOH A O   1 
HETATM 6542 O  O   . HOH L 4 .   ? 56.578  29.558  -2.267  1.00 12.50 ? 223 HOH A O   1 
HETATM 6543 O  O   . HOH L 4 .   ? 46.552  15.856  4.120   1.00 7.69  ? 224 HOH A O   1 
HETATM 6544 O  O   . HOH L 4 .   ? 47.665  9.726   7.705   1.00 3.79  ? 225 HOH A O   1 
HETATM 6545 O  O   . HOH L 4 .   ? 31.450  19.448  22.720  1.00 4.39  ? 226 HOH A O   1 
HETATM 6546 O  O   . HOH L 4 .   ? 40.688  1.030   23.510  1.00 11.11 ? 227 HOH A O   1 
HETATM 6547 O  O   . HOH L 4 .   ? 43.720  14.117  -1.007  1.00 4.53  ? 228 HOH A O   1 
HETATM 6548 O  O   . HOH L 4 .   ? 47.765  7.038   11.753  1.00 6.70  ? 229 HOH A O   1 
HETATM 6549 O  O   . HOH L 4 .   ? 28.154  9.009   12.781  1.00 5.39  ? 230 HOH A O   1 
HETATM 6550 O  O   . HOH L 4 .   ? 45.678  -1.151  13.824  1.00 7.49  ? 231 HOH A O   1 
HETATM 6551 O  O   . HOH L 4 .   ? 28.663  14.564  21.342  1.00 2.42  ? 232 HOH A O   1 
HETATM 6552 O  O   . HOH L 4 .   ? 34.540  20.628  -7.664  1.00 1.85  ? 233 HOH A O   1 
HETATM 6553 O  O   . HOH L 4 .   ? 42.805  17.145  -4.163  1.00 2.23  ? 234 HOH A O   1 
HETATM 6554 O  O   . HOH L 4 .   ? 56.704  19.475  20.682  1.00 9.73  ? 235 HOH A O   1 
HETATM 6555 O  O   . HOH L 4 .   ? 31.736  17.680  18.151  1.00 3.30  ? 236 HOH A O   1 
HETATM 6556 O  O   . HOH L 4 .   ? 34.779  8.125   9.733   1.00 3.33  ? 237 HOH A O   1 
HETATM 6557 O  O   . HOH L 4 .   ? 30.248  17.765  20.599  1.00 3.51  ? 238 HOH A O   1 
HETATM 6558 O  O   . HOH L 4 .   ? 26.932  0.920   9.774   1.00 10.57 ? 239 HOH A O   1 
HETATM 6559 O  O   . HOH L 4 .   ? 41.056  23.937  -6.973  1.00 6.33  ? 240 HOH A O   1 
HETATM 6560 O  O   . HOH L 4 .   ? 28.980  6.791   14.448  1.00 5.41  ? 241 HOH A O   1 
HETATM 6561 O  O   . HOH L 4 .   ? 28.693  1.498   4.220   1.00 9.67  ? 242 HOH A O   1 
HETATM 6562 O  O   . HOH L 4 .   ? 43.226  10.342  1.649   1.00 3.47  ? 243 HOH A O   1 
HETATM 6563 O  O   . HOH L 4 .   ? 37.881  27.714  13.223  1.00 5.69  ? 244 HOH A O   1 
HETATM 6564 O  O   . HOH L 4 .   ? 66.216  16.484  14.913  1.00 31.66 ? 245 HOH A O   1 
HETATM 6565 O  O   . HOH L 4 .   ? 48.574  9.270   10.303  1.00 3.67  ? 246 HOH A O   1 
HETATM 6566 O  O   . HOH L 4 .   ? 42.723  13.827  -3.545  1.00 7.33  ? 247 HOH A O   1 
HETATM 6567 O  O   . HOH L 4 .   ? 38.861  3.101   -2.879  1.00 7.32  ? 248 HOH A O   1 
HETATM 6568 O  O   . HOH L 4 .   ? 38.089  10.591  26.307  1.00 6.65  ? 249 HOH A O   1 
HETATM 6569 O  O   . HOH L 4 .   ? 37.716  23.313  23.236  1.00 8.08  ? 250 HOH A O   1 
HETATM 6570 O  O   . HOH L 4 .   ? 51.478  17.269  24.890  1.00 8.73  ? 251 HOH A O   1 
HETATM 6571 O  O   . HOH L 4 .   ? 35.691  33.369  3.030   1.00 10.08 ? 252 HOH A O   1 
HETATM 6572 O  O   . HOH L 4 .   ? 42.688  7.478   0.844   1.00 5.73  ? 253 HOH A O   1 
HETATM 6573 O  O   . HOH L 4 .   ? 50.131  14.469  4.326   1.00 8.15  ? 254 HOH A O   1 
HETATM 6574 O  O   . HOH L 4 .   ? 45.243  0.654   16.132  1.00 10.87 ? 255 HOH A O   1 
HETATM 6575 O  O   . HOH L 4 .   ? 53.072  28.549  14.122  1.00 10.43 ? 256 HOH A O   1 
HETATM 6576 O  O   . HOH L 4 .   ? 45.662  24.245  -10.735 1.00 9.16  ? 257 HOH A O   1 
HETATM 6577 O  O   . HOH L 4 .   ? 33.264  18.070  -7.642  1.00 2.05  ? 258 HOH A O   1 
HETATM 6578 O  O   . HOH L 4 .   ? 37.024  35.403  4.606   1.00 5.82  ? 259 HOH A O   1 
HETATM 6579 O  O   . HOH L 4 .   ? 32.304  5.632   14.026  1.00 6.58  ? 260 HOH A O   1 
HETATM 6580 O  O   . HOH L 4 .   ? 30.988  11.798  -3.317  1.00 7.03  ? 261 HOH A O   1 
HETATM 6581 O  O   . HOH L 4 .   ? 35.648  31.396  -7.194  1.00 5.30  ? 262 HOH A O   1 
HETATM 6582 O  O   . HOH L 4 .   ? 49.632  10.268  5.759   1.00 6.27  ? 263 HOH A O   1 
HETATM 6583 O  O   . HOH L 4 .   ? 27.880  -1.115  11.612  1.00 6.76  ? 264 HOH A O   1 
HETATM 6584 O  O   . HOH L 4 .   ? 28.928  14.542  23.796  1.00 11.70 ? 265 HOH A O   1 
HETATM 6585 O  O   . HOH L 4 .   ? 46.916  4.018   4.858   1.00 9.15  ? 266 HOH A O   1 
HETATM 6586 O  O   . HOH L 4 .   ? 52.832  24.065  12.369  1.00 12.89 ? 267 HOH A O   1 
HETATM 6587 O  O   . HOH L 4 .   ? 47.192  12.936  3.415   1.00 10.52 ? 268 HOH A O   1 
HETATM 6588 O  O   . HOH L 4 .   ? 48.922  30.791  11.738  1.00 7.87  ? 269 HOH A O   1 
HETATM 6589 O  O   . HOH L 4 .   ? 44.391  24.983  19.316  1.00 8.15  ? 270 HOH A O   1 
HETATM 6590 O  O   . HOH L 4 .   ? 36.900  28.769  10.861  1.00 9.77  ? 271 HOH A O   1 
HETATM 6591 O  O   . HOH L 4 .   ? 44.811  11.621  -0.158  1.00 4.75  ? 272 HOH A O   1 
HETATM 6592 O  O   . HOH L 4 .   ? 61.593  2.133   13.983  1.00 14.50 ? 273 HOH A O   1 
HETATM 6593 O  O   . HOH L 4 .   ? 38.136  8.208   26.007  1.00 6.13  ? 274 HOH A O   1 
HETATM 6594 O  O   . HOH L 4 .   ? 25.181  -0.291  7.899   1.00 8.16  ? 275 HOH A O   1 
HETATM 6595 O  O   . HOH L 4 .   ? 38.901  40.622  -0.154  1.00 13.69 ? 276 HOH A O   1 
HETATM 6596 O  O   . HOH L 4 .   ? 33.221  18.174  24.342  1.00 12.29 ? 277 HOH A O   1 
HETATM 6597 O  O   . HOH L 4 .   ? 52.227  1.925   28.877  1.00 11.49 ? 278 HOH A O   1 
HETATM 6598 O  O   . HOH L 4 .   ? 38.732  26.642  19.802  1.00 22.65 ? 279 HOH A O   1 
HETATM 6599 O  O   . HOH L 4 .   ? 34.218  0.351   8.856   1.00 4.91  ? 280 HOH A O   1 
HETATM 6600 O  O   . HOH L 4 .   ? 25.906  2.918   11.828  1.00 8.36  ? 281 HOH A O   1 
HETATM 6601 O  O   . HOH L 4 .   ? 45.339  25.001  -3.553  1.00 5.95  ? 282 HOH A O   1 
HETATM 6602 O  O   . HOH L 4 .   ? 55.053  2.195   27.290  1.00 10.43 ? 283 HOH A O   1 
HETATM 6603 O  O   . HOH L 4 .   ? 30.428  -0.492  14.203  1.00 8.35  ? 284 HOH A O   1 
HETATM 6604 O  O   . HOH L 4 .   ? 33.223  -0.299  0.444   0.50 1.76  ? 285 HOH A O   1 
HETATM 6605 O  O   . HOH L 4 .   ? 49.463  1.711   6.026   1.00 7.97  ? 286 HOH A O   1 
HETATM 6606 O  O   . HOH L 4 .   ? 34.049  12.481  -6.262  1.00 9.10  ? 287 HOH A O   1 
HETATM 6607 O  O   . HOH L 4 .   ? 48.005  29.474  7.157   1.00 6.09  ? 288 HOH A O   1 
HETATM 6608 O  O   . HOH L 4 .   ? 44.185  21.651  -7.446  1.00 8.42  ? 289 HOH A O   1 
HETATM 6609 O  O   . HOH L 4 .   ? 31.019  18.439  7.313   1.00 7.64  ? 292 HOH A O   1 
HETATM 6610 O  O   . HOH L 4 .   ? 47.007  -1.086  17.614  1.00 7.40  ? 293 HOH A O   1 
HETATM 6611 O  O   . HOH L 4 .   ? 32.881  28.485  5.217   1.00 7.22  ? 294 HOH A O   1 
HETATM 6612 O  O   . HOH L 4 .   ? 45.999  20.417  -5.541  1.00 11.90 ? 295 HOH A O   1 
HETATM 6613 O  O   . HOH L 4 .   ? 44.837  2.159   5.521   1.00 10.92 ? 304 HOH A O   1 
HETATM 6614 O  O   . HOH L 4 .   ? 53.604  0.046   13.181  1.00 11.43 ? 306 HOH A O   1 
HETATM 6615 O  O   . HOH L 4 .   ? 54.493  22.978  10.450  1.00 11.05 ? 307 HOH A O   1 
HETATM 6616 O  O   . HOH L 4 .   ? 35.919  25.420  22.055  1.00 8.97  ? 308 HOH A O   1 
HETATM 6617 O  O   . HOH L 4 .   ? 36.889  28.397  18.743  1.00 12.51 ? 309 HOH A O   1 
HETATM 6618 O  O   . HOH L 4 .   ? 52.118  21.449  4.406   1.00 13.81 ? 311 HOH A O   1 
HETATM 6619 O  O   . HOH L 4 .   ? 38.512  -2.121  22.421  1.00 9.70  ? 312 HOH A O   1 
HETATM 6620 O  O   . HOH L 4 .   ? 31.771  26.466  3.625   1.00 8.93  ? 315 HOH A O   1 
HETATM 6621 O  O   . HOH L 4 .   ? 47.392  17.453  6.289   1.00 11.27 ? 322 HOH A O   1 
HETATM 6622 O  O   . HOH L 4 .   ? 42.084  32.397  14.130  1.00 12.55 ? 323 HOH A O   1 
HETATM 6623 O  O   . HOH L 4 .   ? 34.642  8.317   12.493  1.00 9.17  ? 327 HOH A O   1 
HETATM 6624 O  O   . HOH L 4 .   ? 51.780  3.058   5.721   1.00 9.11  ? 336 HOH A O   1 
HETATM 6625 O  O   . HOH L 4 .   ? 41.357  -1.981  8.169   1.00 10.07 ? 339 HOH A O   1 
HETATM 6626 O  O   . HOH L 4 .   ? 45.031  22.238  22.368  1.00 12.64 ? 341 HOH A O   1 
HETATM 6627 O  O   . HOH L 4 .   ? 36.612  5.595   -2.486  1.00 16.63 ? 345 HOH A O   1 
HETATM 6628 O  O   . HOH L 4 .   ? 32.706  27.815  -1.755  1.00 10.54 ? 346 HOH A O   1 
HETATM 6629 O  O   . HOH L 4 .   ? 38.656  23.223  -10.044 1.00 9.99  ? 350 HOH A O   1 
HETATM 6630 O  O   . HOH L 4 .   ? 58.207  3.655   14.203  1.00 12.56 ? 354 HOH A O   1 
HETATM 6631 O  O   . HOH L 4 .   ? 28.419  18.553  4.527   1.00 9.77  ? 362 HOH A O   1 
HETATM 6632 O  O   . HOH L 4 .   ? 62.657  7.346   18.728  1.00 14.00 ? 364 HOH A O   1 
HETATM 6633 O  O   . HOH L 4 .   ? 45.850  16.211  27.041  1.00 18.56 ? 368 HOH A O   1 
HETATM 6634 O  O   . HOH L 4 .   ? 28.845  26.780  -0.233  1.00 7.38  ? 373 HOH A O   1 
HETATM 6635 O  O   . HOH L 4 .   ? 43.075  19.184  -11.225 1.00 23.67 ? 395 HOH A O   1 
HETATM 6636 O  O   . HOH L 4 .   ? 49.547  32.759  9.848   1.00 10.45 ? 400 HOH A O   1 
HETATM 6637 O  O   . HOH L 4 .   ? 46.412  1.756   19.388  1.00 12.53 ? 405 HOH A O   1 
HETATM 6638 O  O   . HOH L 4 .   ? 54.474  18.668  19.225  1.00 11.21 ? 407 HOH A O   1 
HETATM 6639 O  O   . HOH L 4 .   ? 57.913  19.690  10.658  1.00 14.34 ? 410 HOH A O   1 
HETATM 6640 O  O   . HOH L 4 .   ? 29.781  -2.783  16.818  1.00 17.53 ? 411 HOH A O   1 
HETATM 6641 O  O   . HOH L 4 .   ? 50.162  16.541  6.278   1.00 12.26 ? 415 HOH A O   1 
HETATM 6642 O  O   . HOH L 4 .   ? 41.009  27.814  17.925  1.00 9.25  ? 418 HOH A O   1 
HETATM 6643 O  O   . HOH L 4 .   ? 29.780  2.770   27.235  1.00 24.27 ? 419 HOH A O   1 
HETATM 6644 O  O   . HOH L 4 .   ? 28.653  4.146   23.323  1.00 17.18 ? 422 HOH A O   1 
HETATM 6645 O  O   . HOH L 4 .   ? 42.725  23.736  -11.045 1.00 11.23 ? 423 HOH A O   1 
HETATM 6646 O  O   . HOH L 4 .   ? 32.808  29.970  -3.043  1.00 12.08 ? 424 HOH A O   1 
HETATM 6647 O  O   . HOH L 4 .   ? 55.065  20.569  9.540   1.00 13.13 ? 426 HOH A O   1 
HETATM 6648 O  O   . HOH L 4 .   ? 59.218  5.836   12.152  1.00 11.75 ? 436 HOH A O   1 
HETATM 6649 O  O   . HOH L 4 .   ? 50.625  23.209  19.401  1.00 17.61 ? 442 HOH A O   1 
HETATM 6650 O  O   . HOH L 4 .   ? 41.347  19.793  23.832  1.00 7.97  ? 446 HOH A O   1 
HETATM 6651 O  O   . HOH L 4 .   ? 33.817  -2.662  19.121  1.00 16.74 ? 448 HOH A O   1 
HETATM 6652 O  O   . HOH L 4 .   ? 34.021  29.829  10.092  1.00 11.01 ? 462 HOH A O   1 
HETATM 6653 O  O   . HOH M 4 .   ? 23.830  22.297  21.066  0.50 9.23  ? 208 HOH B O   1 
HETATM 6654 O  O   . HOH M 4 .   ? 30.306  28.239  23.714  1.00 1.62  ? 209 HOH B O   1 
HETATM 6655 O  O   . HOH M 4 .   ? 26.738  18.076  26.661  1.00 3.95  ? 210 HOH B O   1 
HETATM 6656 O  O   . HOH M 4 .   ? 28.196  19.674  16.430  1.00 2.89  ? 211 HOH B O   1 
HETATM 6657 O  O   . HOH M 4 .   ? 4.110   19.848  19.622  1.00 9.07  ? 212 HOH B O   1 
HETATM 6658 O  O   . HOH M 4 .   ? 18.141  13.705  14.291  1.00 3.58  ? 213 HOH B O   1 
HETATM 6659 O  O   . HOH M 4 .   ? 15.040  9.123   12.913  1.00 16.58 ? 214 HOH B O   1 
HETATM 6660 O  O   . HOH M 4 .   ? 35.075  26.388  17.923  1.00 3.04  ? 215 HOH B O   1 
HETATM 6661 O  O   . HOH M 4 .   ? 9.422   14.476  18.659  1.00 4.18  ? 216 HOH B O   1 
HETATM 6662 O  O   . HOH M 4 .   ? 31.182  27.267  14.752  1.00 1.65  ? 217 HOH B O   1 
HETATM 6663 O  O   . HOH M 4 .   ? 30.381  20.687  29.004  1.00 7.46  ? 218 HOH B O   1 
HETATM 6664 O  O   . HOH M 4 .   ? 15.802  26.548  32.456  1.00 7.32  ? 219 HOH B O   1 
HETATM 6665 O  O   . HOH M 4 .   ? 20.303  13.531  16.329  1.00 4.33  ? 220 HOH B O   1 
HETATM 6666 O  O   . HOH M 4 .   ? 3.271   22.734  12.728  1.00 6.09  ? 221 HOH B O   1 
HETATM 6667 O  O   . HOH M 4 .   ? 13.271  24.915  28.973  1.00 6.62  ? 222 HOH B O   1 
HETATM 6668 O  O   . HOH M 4 .   ? 10.024  29.851  19.241  1.00 4.03  ? 223 HOH B O   1 
HETATM 6669 O  O   . HOH M 4 .   ? 13.488  8.441   16.826  1.00 3.19  ? 224 HOH B O   1 
HETATM 6670 O  O   . HOH M 4 .   ? 27.254  21.321  13.370  1.00 3.60  ? 225 HOH B O   1 
HETATM 6671 O  O   . HOH M 4 .   ? 29.415  10.847  9.005   1.00 6.79  ? 226 HOH B O   1 
HETATM 6672 O  O   . HOH M 4 .   ? 19.159  13.431  32.674  1.00 3.86  ? 227 HOH B O   1 
HETATM 6673 O  O   . HOH M 4 .   ? 32.345  18.034  35.332  1.00 12.69 ? 228 HOH B O   1 
HETATM 6674 O  O   . HOH M 4 .   ? 30.238  32.871  18.692  1.00 2.91  ? 229 HOH B O   1 
HETATM 6675 O  O   . HOH M 4 .   ? 15.930  8.613   15.630  1.00 6.04  ? 230 HOH B O   1 
HETATM 6676 O  O   . HOH M 4 .   ? 26.016  39.325  13.629  1.00 12.40 ? 231 HOH B O   1 
HETATM 6677 O  O   . HOH M 4 .   ? 11.016  11.905  12.715  1.00 7.88  ? 232 HOH B O   1 
HETATM 6678 O  O   . HOH M 4 .   ? 38.561  30.533  31.387  1.00 6.83  ? 233 HOH B O   1 
HETATM 6679 O  O   . HOH M 4 .   ? 25.931  36.696  13.058  1.00 12.02 ? 234 HOH B O   1 
HETATM 6680 O  O   . HOH M 4 .   ? 29.190  19.792  24.196  1.00 12.09 ? 235 HOH B O   1 
HETATM 6681 O  O   . HOH M 4 .   ? 4.302   25.074  15.142  1.00 5.29  ? 236 HOH B O   1 
HETATM 6682 O  O   . HOH M 4 .   ? 32.719  22.361  35.425  1.00 4.83  ? 237 HOH B O   1 
HETATM 6683 O  O   . HOH M 4 .   ? 30.469  29.680  10.590  1.00 5.21  ? 238 HOH B O   1 
HETATM 6684 O  O   . HOH M 4 .   ? 28.854  38.358  28.666  1.00 7.78  ? 239 HOH B O   1 
HETATM 6685 O  O   . HOH M 4 .   ? 8.718   46.934  9.455   1.00 13.06 ? 240 HOH B O   1 
HETATM 6686 O  O   . HOH M 4 .   ? 29.409  22.887  9.486   1.00 3.65  ? 241 HOH B O   1 
HETATM 6687 O  O   . HOH M 4 .   ? 32.702  28.744  12.133  1.00 12.15 ? 242 HOH B O   1 
HETATM 6688 O  O   . HOH M 4 .   ? 13.728  25.586  4.400   1.00 13.69 ? 243 HOH B O   1 
HETATM 6689 O  O   . HOH M 4 .   ? 37.183  33.981  35.256  1.00 9.59  ? 244 HOH B O   1 
HETATM 6690 O  O   . HOH M 4 .   ? 21.503  35.674  7.009   1.00 10.83 ? 245 HOH B O   1 
HETATM 6691 O  O   . HOH M 4 .   ? 18.493  29.883  35.882  1.00 8.42  ? 246 HOH B O   1 
HETATM 6692 O  O   . HOH M 4 .   ? 4.084   27.708  11.725  1.00 9.07  ? 247 HOH B O   1 
HETATM 6693 O  O   . HOH M 4 .   ? 11.637  29.819  23.766  1.00 7.29  ? 248 HOH B O   1 
HETATM 6694 O  O   . HOH M 4 .   ? 33.743  21.284  32.817  1.00 4.52  ? 249 HOH B O   1 
HETATM 6695 O  O   . HOH M 4 .   ? 13.185  26.538  31.192  1.00 7.30  ? 250 HOH B O   1 
HETATM 6696 O  O   . HOH M 4 .   ? 18.434  19.369  37.530  1.00 3.42  ? 251 HOH B O   1 
HETATM 6697 O  O   . HOH M 4 .   ? 17.666  28.706  1.610   1.00 9.59  ? 252 HOH B O   1 
HETATM 6698 O  O   . HOH M 4 .   ? 11.126  23.451  28.950  1.00 5.11  ? 253 HOH B O   1 
HETATM 6699 O  O   . HOH M 4 .   ? 3.387   29.991  10.457  1.00 5.18  ? 254 HOH B O   1 
HETATM 6700 O  O   . HOH M 4 .   ? 29.380  18.929  26.922  1.00 7.82  ? 255 HOH B O   1 
HETATM 6701 O  O   . HOH M 4 .   ? 9.336   23.881  6.009   1.00 9.80  ? 256 HOH B O   1 
HETATM 6702 O  O   . HOH M 4 .   ? 20.871  14.716  20.572  1.00 5.94  ? 257 HOH B O   1 
HETATM 6703 O  O   . HOH M 4 .   ? 26.358  17.914  9.336   1.00 2.41  ? 258 HOH B O   1 
HETATM 6704 O  O   . HOH M 4 .   ? 19.072  40.566  9.571   1.00 8.73  ? 259 HOH B O   1 
HETATM 6705 O  O   . HOH M 4 .   ? 32.909  22.068  29.975  1.00 10.71 ? 260 HOH B O   1 
HETATM 6706 O  O   . HOH M 4 .   ? 26.569  18.651  6.617   1.00 2.72  ? 261 HOH B O   1 
HETATM 6707 O  O   . HOH M 4 .   ? 11.207  31.130  21.231  1.00 9.00  ? 262 HOH B O   1 
HETATM 6708 O  O   . HOH M 4 .   ? 17.206  30.861  28.051  1.00 8.56  ? 263 HOH B O   1 
HETATM 6709 O  O   . HOH M 4 .   ? 17.153  37.527  28.581  1.00 9.40  ? 264 HOH B O   1 
HETATM 6710 O  O   . HOH M 4 .   ? 18.240  27.437  35.746  1.00 11.05 ? 265 HOH B O   1 
HETATM 6711 O  O   . HOH M 4 .   ? 2.047   34.336  22.154  1.00 12.85 ? 266 HOH B O   1 
HETATM 6712 O  O   . HOH M 4 .   ? 13.625  14.309  29.376  1.00 8.65  ? 267 HOH B O   1 
HETATM 6713 O  O   . HOH M 4 .   ? 16.679  18.666  16.989  1.00 5.99  ? 268 HOH B O   1 
HETATM 6714 O  O   . HOH M 4 .   ? 11.193  8.683   15.052  1.00 6.14  ? 269 HOH B O   1 
HETATM 6715 O  O   . HOH M 4 .   ? 0.502   40.386  10.852  1.00 15.64 ? 270 HOH B O   1 
HETATM 6716 O  O   . HOH M 4 .   ? 32.726  29.631  21.398  1.00 6.57  ? 271 HOH B O   1 
HETATM 6717 O  O   . HOH M 4 .   ? 28.284  20.355  10.729  1.00 7.19  ? 272 HOH B O   1 
HETATM 6718 O  O   . HOH M 4 .   ? 4.688   45.009  8.560   1.00 9.92  ? 275 HOH B O   1 
HETATM 6719 O  O   . HOH M 4 .   ? 4.169   39.670  19.835  1.00 15.20 ? 279 HOH B O   1 
HETATM 6720 O  O   . HOH M 4 .   ? 23.047  11.722  3.071   1.00 10.83 ? 282 HOH B O   1 
HETATM 6721 O  O   . HOH M 4 .   ? 26.143  31.443  9.956   1.00 5.59  ? 284 HOH B O   1 
HETATM 6722 O  O   . HOH M 4 .   ? 27.670  22.451  45.861  1.00 9.65  ? 285 HOH B O   1 
HETATM 6723 O  O   . HOH M 4 .   ? 18.451  32.605  26.450  1.00 8.01  ? 286 HOH B O   1 
HETATM 6724 O  O   . HOH M 4 .   ? 32.606  33.359  17.360  1.00 10.43 ? 288 HOH B O   1 
HETATM 6725 O  O   . HOH M 4 .   ? 5.127   37.847  4.149   1.00 13.64 ? 290 HOH B O   1 
HETATM 6726 O  O   . HOH M 4 .   ? 16.698  17.112  37.088  1.00 8.85  ? 296 HOH B O   1 
HETATM 6727 O  O   . HOH M 4 .   ? 34.004  24.112  28.808  1.00 12.65 ? 297 HOH B O   1 
HETATM 6728 O  O   . HOH M 4 .   ? 12.653  8.933   22.816  1.00 9.31  ? 300 HOH B O   1 
HETATM 6729 O  O   . HOH M 4 .   ? 6.271   24.220  23.592  1.00 11.89 ? 301 HOH B O   1 
HETATM 6730 O  O   . HOH M 4 .   ? 12.269  9.773   12.399  1.00 8.59  ? 302 HOH B O   1 
HETATM 6731 O  O   . HOH M 4 .   ? 2.487   19.702  26.198  1.00 17.05 ? 303 HOH B O   1 
HETATM 6732 O  O   . HOH M 4 .   ? 16.818  14.307  5.228   1.00 7.25  ? 310 HOH B O   1 
HETATM 6733 O  O   . HOH M 4 .   ? 7.996   11.210  26.482  1.00 8.21  ? 314 HOH B O   1 
HETATM 6734 O  O   . HOH M 4 .   ? 37.362  28.356  32.089  1.00 7.60  ? 316 HOH B O   1 
HETATM 6735 O  O   . HOH M 4 .   ? 20.808  32.183  24.975  1.00 6.96  ? 318 HOH B O   1 
HETATM 6736 O  O   . HOH M 4 .   ? 6.690   29.280  6.996   1.00 12.81 ? 325 HOH B O   1 
HETATM 6737 O  O   . HOH M 4 .   ? 14.645  17.766  35.119  1.00 9.79  ? 328 HOH B O   1 
HETATM 6738 O  O   . HOH M 4 .   ? 1.147   24.930  12.096  1.00 13.33 ? 342 HOH B O   1 
HETATM 6739 O  O   . HOH M 4 .   ? 35.778  26.733  24.469  1.00 8.43  ? 344 HOH B O   1 
HETATM 6740 O  O   . HOH M 4 .   ? 3.029   34.976  15.597  1.00 9.00  ? 347 HOH B O   1 
HETATM 6741 O  O   . HOH M 4 .   ? 13.230  28.022  18.753  1.00 8.96  ? 352 HOH B O   1 
HETATM 6742 O  O   . HOH M 4 .   ? 4.106   30.275  24.493  1.00 17.32 ? 355 HOH B O   1 
HETATM 6743 O  O   . HOH M 4 .   ? 1.745   32.638  17.008  1.00 12.22 ? 357 HOH B O   1 
HETATM 6744 O  O   . HOH M 4 .   ? 6.635   26.448  25.175  1.00 12.71 ? 369 HOH B O   1 
HETATM 6745 O  O   . HOH M 4 .   ? 35.933  36.854  32.887  1.00 15.12 ? 371 HOH B O   1 
HETATM 6746 O  O   . HOH M 4 .   ? 26.448  17.457  2.843   1.00 15.30 ? 376 HOH B O   1 
HETATM 6747 O  O   . HOH M 4 .   ? 16.387  31.419  34.368  1.00 11.38 ? 378 HOH B O   1 
HETATM 6748 O  O   . HOH M 4 .   ? 22.359  11.621  32.063  1.00 12.37 ? 382 HOH B O   1 
HETATM 6749 O  O   . HOH M 4 .   ? 11.273  16.210  30.275  1.00 12.02 ? 383 HOH B O   1 
HETATM 6750 O  O   . HOH M 4 .   ? 26.806  18.603  23.814  1.00 12.34 ? 384 HOH B O   1 
HETATM 6751 O  O   . HOH M 4 .   ? 7.463   10.220  23.643  1.00 13.67 ? 385 HOH B O   1 
HETATM 6752 O  O   . HOH M 4 .   ? 23.841  32.214  37.598  1.00 13.15 ? 389 HOH B O   1 
HETATM 6753 O  O   . HOH M 4 .   ? 3.793   25.550  9.445   1.00 11.24 ? 394 HOH B O   1 
HETATM 6754 O  O   . HOH M 4 .   ? 24.645  23.616  6.315   1.00 12.97 ? 406 HOH B O   1 
HETATM 6755 O  O   . HOH M 4 .   ? 28.814  35.183  15.692  1.00 9.79  ? 408 HOH B O   1 
HETATM 6756 O  O   . HOH M 4 .   ? 14.298  30.497  28.069  1.00 10.03 ? 414 HOH B O   1 
HETATM 6757 O  O   . HOH M 4 .   ? 36.401  40.286  20.449  1.00 12.99 ? 417 HOH B O   1 
HETATM 6758 O  O   . HOH M 4 .   ? 26.762  25.312  42.164  1.00 7.12  ? 425 HOH B O   1 
HETATM 6759 O  O   . HOH M 4 .   ? 8.305   16.745  30.841  1.00 9.56  ? 431 HOH B O   1 
HETATM 6760 O  O   . HOH M 4 .   ? 1.708   33.013  8.337   1.00 14.72 ? 433 HOH B O   1 
HETATM 6761 O  O   . HOH M 4 .   ? 33.998  28.616  23.465  1.00 14.87 ? 438 HOH B O   1 
HETATM 6762 O  O   . HOH M 4 .   ? 30.429  21.167  49.308  1.00 13.21 ? 439 HOH B O   1 
HETATM 6763 O  O   . HOH M 4 .   ? 24.232  23.963  3.101   1.00 16.27 ? 441 HOH B O   1 
HETATM 6764 O  O   . HOH M 4 .   ? 36.350  24.819  29.684  1.00 13.27 ? 451 HOH B O   1 
HETATM 6765 O  O   . HOH M 4 .   ? 24.882  41.751  35.927  1.00 15.56 ? 452 HOH B O   1 
HETATM 6766 O  O   . HOH M 4 .   ? 13.017  7.034   21.184  1.00 17.56 ? 453 HOH B O   1 
HETATM 6767 O  O   . HOH M 4 .   ? 7.175   28.360  10.503  1.00 6.29  ? 455 HOH B O   1 
HETATM 6768 O  O   . HOH M 4 .   ? 5.956   26.234  13.068  1.00 5.37  ? 456 HOH B O   1 
HETATM 6769 O  O   . HOH M 4 .   ? 27.223  15.495  26.184  1.00 9.24  ? 458 HOH B O   1 
HETATM 6770 O  O   . HOH M 4 .   ? 6.899   18.284  33.302  1.00 11.58 ? 460 HOH B O   1 
HETATM 6771 O  O   . HOH M 4 .   ? 0.319   34.714  18.425  1.00 9.52  ? 461 HOH B O   1 
HETATM 6772 O  O   . HOH M 4 .   ? 7.825   42.501  14.139  1.00 12.27 ? 468 HOH B O   1 
HETATM 6773 O  O   . HOH M 4 .   ? 3.559   27.875  23.727  1.00 15.09 ? 470 HOH B O   1 
HETATM 6774 O  O   . HOH M 4 .   ? 3.657   38.261  11.416  1.00 18.22 ? 471 HOH B O   1 
HETATM 6775 O  O   . HOH M 4 .   ? 16.145  18.424  19.795  1.00 7.53  ? 473 HOH B O   1 
HETATM 6776 O  O   . HOH N 4 .   ? 84.790  19.607  37.050  0.50 1.49  ? 208 HOH C O   1 
HETATM 6777 O  O   . HOH N 4 .   ? 84.040  18.143  34.149  0.50 0.50  ? 209 HOH C O   1 
HETATM 6778 O  O   . HOH N 4 .   ? 74.498  12.536  28.537  1.00 1.31  ? 210 HOH C O   1 
HETATM 6779 O  O   . HOH N 4 .   ? 77.615  19.624  51.912  1.00 4.20  ? 211 HOH C O   1 
HETATM 6780 O  O   . HOH N 4 .   ? 77.194  18.617  25.988  1.00 2.24  ? 212 HOH C O   1 
HETATM 6781 O  O   . HOH N 4 .   ? 100.475 18.044  36.305  1.00 6.43  ? 213 HOH C O   1 
HETATM 6782 O  O   . HOH N 4 .   ? 82.620  23.301  29.876  1.00 3.45  ? 214 HOH C O   1 
HETATM 6783 O  O   . HOH N 4 .   ? 91.516  -5.854  38.531  1.00 17.61 ? 215 HOH C O   1 
HETATM 6784 O  O   . HOH N 4 .   ? 73.053  16.395  31.608  1.00 3.35  ? 216 HOH C O   1 
HETATM 6785 O  O   . HOH N 4 .   ? 89.921  9.559   42.903  1.00 6.06  ? 217 HOH C O   1 
HETATM 6786 O  O   . HOH N 4 .   ? 92.084  24.864  32.280  1.00 6.80  ? 218 HOH C O   1 
HETATM 6787 O  O   . HOH N 4 .   ? 83.499  21.933  26.661  1.00 3.19  ? 219 HOH C O   1 
HETATM 6788 O  O   . HOH N 4 .   ? 93.106  5.089   33.033  1.00 3.93  ? 220 HOH C O   1 
HETATM 6789 O  O   . HOH N 4 .   ? 75.183  16.031  34.446  1.00 2.42  ? 221 HOH C O   1 
HETATM 6790 O  O   . HOH N 4 .   ? 81.945  22.340  22.354  1.00 1.55  ? 222 HOH C O   1 
HETATM 6791 O  O   . HOH N 4 .   ? 94.431  23.776  30.902  1.00 3.13  ? 223 HOH C O   1 
HETATM 6792 O  O   . HOH N 4 .   ? 99.287  23.894  41.163  1.00 7.37  ? 224 HOH C O   1 
HETATM 6793 O  O   . HOH N 4 .   ? 82.807  -0.524  19.450  1.00 10.37 ? 225 HOH C O   1 
HETATM 6794 O  O   . HOH N 4 .   ? 73.033  20.754  46.671  1.00 8.74  ? 226 HOH C O   1 
HETATM 6795 O  O   . HOH N 4 .   ? 79.859  18.035  52.482  1.00 1.69  ? 227 HOH C O   1 
HETATM 6796 O  O   . HOH N 4 .   ? 100.261 25.478  35.450  1.00 9.72  ? 228 HOH C O   1 
HETATM 6797 O  O   . HOH N 4 .   ? 81.719  25.678  28.476  1.00 2.74  ? 229 HOH C O   1 
HETATM 6798 O  O   . HOH N 4 .   ? 102.332 24.562  33.704  1.00 8.44  ? 230 HOH C O   1 
HETATM 6799 O  O   . HOH N 4 .   ? 86.755  24.932  23.818  1.00 2.81  ? 231 HOH C O   1 
HETATM 6800 O  O   . HOH N 4 .   ? 74.926  13.349  52.721  1.00 8.51  ? 232 HOH C O   1 
HETATM 6801 O  O   . HOH N 4 .   ? 87.878  18.264  50.920  1.00 22.78 ? 233 HOH C O   1 
HETATM 6802 O  O   . HOH N 4 .   ? 99.441  12.316  21.506  1.00 7.21  ? 234 HOH C O   1 
HETATM 6803 O  O   . HOH N 4 .   ? 70.755  5.914   37.149  1.00 5.50  ? 235 HOH C O   1 
HETATM 6804 O  O   . HOH N 4 .   ? 81.228  7.346   36.028  1.00 3.47  ? 236 HOH C O   1 
HETATM 6805 O  O   . HOH N 4 .   ? 76.427  11.781  51.138  1.00 5.53  ? 237 HOH C O   1 
HETATM 6806 O  O   . HOH N 4 .   ? 67.387  18.233  41.783  1.00 10.09 ? 238 HOH C O   1 
HETATM 6807 O  O   . HOH N 4 .   ? 98.160  3.096   38.612  1.00 11.94 ? 239 HOH C O   1 
HETATM 6808 O  O   . HOH N 4 .   ? 70.605  19.802  48.374  1.00 15.54 ? 240 HOH C O   1 
HETATM 6809 O  O   . HOH N 4 .   ? 65.116  16.955  40.077  1.00 7.41  ? 241 HOH C O   1 
HETATM 6810 O  O   . HOH N 4 .   ? 73.331  20.710  28.653  1.00 0.87  ? 242 HOH C O   1 
HETATM 6811 O  O   . HOH N 4 .   ? 98.316  6.100   25.144  1.00 8.77  ? 243 HOH C O   1 
HETATM 6812 O  O   . HOH N 4 .   ? 102.246 -0.225  31.968  1.00 8.54  ? 244 HOH C O   1 
HETATM 6813 O  O   . HOH N 4 .   ? 92.681  18.237  35.162  1.00 7.52  ? 245 HOH C O   1 
HETATM 6814 O  O   . HOH N 4 .   ? 75.314  10.378  25.286  1.00 4.31  ? 246 HOH C O   1 
HETATM 6815 O  O   . HOH N 4 .   ? 90.642  4.314   34.281  1.00 4.32  ? 247 HOH C O   1 
HETATM 6816 O  O   . HOH N 4 .   ? 98.987  18.239  21.619  1.00 7.97  ? 248 HOH C O   1 
HETATM 6817 O  O   . HOH N 4 .   ? 98.807  10.156  19.540  1.00 7.98  ? 249 HOH C O   1 
HETATM 6818 O  O   . HOH N 4 .   ? 98.397  27.031  33.553  1.00 10.80 ? 250 HOH C O   1 
HETATM 6819 O  O   . HOH N 4 .   ? 99.307  -0.999  31.258  1.00 4.43  ? 251 HOH C O   1 
HETATM 6820 O  O   . HOH N 4 .   ? 79.986  18.694  17.533  1.00 8.14  ? 252 HOH C O   1 
HETATM 6821 O  O   . HOH N 4 .   ? 69.025  17.207  52.033  1.00 6.36  ? 253 HOH C O   1 
HETATM 6822 O  O   . HOH N 4 .   ? 82.553  22.259  37.614  1.00 10.86 ? 254 HOH C O   1 
HETATM 6823 O  O   . HOH N 4 .   ? 100.770 2.983   25.305  1.00 7.86  ? 255 HOH C O   1 
HETATM 6824 O  O   . HOH N 4 .   ? 89.569  3.497   38.778  1.00 12.12 ? 256 HOH C O   1 
HETATM 6825 O  O   . HOH N 4 .   ? 96.159  30.933  31.188  1.00 20.49 ? 257 HOH C O   1 
HETATM 6826 O  O   . HOH N 4 .   ? 83.158  2.805   38.236  1.00 8.59  ? 258 HOH C O   1 
HETATM 6827 O  O   . HOH N 4 .   ? 69.031  5.452   32.269  1.00 7.21  ? 259 HOH C O   1 
HETATM 6828 O  O   . HOH N 4 .   ? 59.011  12.205  44.049  1.00 13.17 ? 260 HOH C O   1 
HETATM 6829 O  O   . HOH N 4 .   ? 90.353  5.196   37.017  1.00 7.28  ? 261 HOH C O   1 
HETATM 6830 O  O   . HOH N 4 .   ? 99.488  6.832   28.585  1.00 5.36  ? 262 HOH C O   1 
HETATM 6831 O  O   . HOH N 4 .   ? 87.481  32.710  24.891  1.00 5.35  ? 263 HOH C O   1 
HETATM 6832 O  O   . HOH N 4 .   ? 92.862  15.108  18.982  1.00 10.79 ? 264 HOH C O   1 
HETATM 6833 O  O   . HOH N 4 .   ? 77.546  16.380  21.364  1.00 4.28  ? 265 HOH C O   1 
HETATM 6834 O  O   . HOH N 4 .   ? 81.326  7.113   47.680  1.00 10.34 ? 266 HOH C O   1 
HETATM 6835 O  O   . HOH N 4 .   ? 81.999  22.228  40.313  1.00 6.17  ? 267 HOH C O   1 
HETATM 6836 O  O   . HOH N 4 .   ? 70.979  17.373  29.778  1.00 10.75 ? 268 HOH C O   1 
HETATM 6837 O  O   . HOH N 4 .   ? 100.986 6.567   30.985  1.00 10.15 ? 269 HOH C O   1 
HETATM 6838 O  O   . HOH N 4 .   ? 88.466  8.003   44.687  1.00 11.28 ? 270 HOH C O   1 
HETATM 6839 O  O   . HOH N 4 .   ? 80.830  12.728  20.977  1.00 9.96  ? 271 HOH C O   1 
HETATM 6840 O  O   . HOH N 4 .   ? 83.681  23.513  24.532  1.00 10.34 ? 272 HOH C O   1 
HETATM 6841 O  O   . HOH N 4 .   ? 84.137  6.671   40.117  1.00 6.37  ? 273 HOH C O   1 
HETATM 6842 O  O   . HOH N 4 .   ? 92.396  9.541   43.604  1.00 10.94 ? 274 HOH C O   1 
HETATM 6843 O  O   . HOH N 4 .   ? 81.350  -13.427 24.834  1.00 9.39  ? 275 HOH C O   1 
HETATM 6844 O  O   . HOH N 4 .   ? 82.668  2.415   19.510  1.00 8.85  ? 276 HOH C O   1 
HETATM 6845 O  O   . HOH N 4 .   ? 77.142  21.679  41.123  1.00 7.08  ? 289 HOH C O   1 
HETATM 6846 O  O   . HOH N 4 .   ? 62.968  8.228   47.033  1.00 14.52 ? 299 HOH C O   1 
HETATM 6847 O  O   . HOH N 4 .   ? 101.975 21.672  30.923  1.00 8.16  ? 305 HOH C O   1 
HETATM 6848 O  O   . HOH N 4 .   ? 86.885  5.184   40.696  1.00 11.71 ? 317 HOH C O   1 
HETATM 6849 O  O   . HOH N 4 .   ? 71.020  1.150   29.915  1.00 16.32 ? 320 HOH C O   1 
HETATM 6850 O  O   . HOH N 4 .   ? 95.117  20.150  31.423  1.00 13.22 ? 321 HOH C O   1 
HETATM 6851 O  O   . HOH N 4 .   ? 71.090  20.255  34.771  1.00 9.04  ? 324 HOH C O   1 
HETATM 6852 O  O   . HOH N 4 .   ? 96.161  0.291   38.485  1.00 11.71 ? 326 HOH C O   1 
HETATM 6853 O  O   . HOH N 4 .   ? 85.675  16.774  50.958  1.00 7.44  ? 329 HOH C O   1 
HETATM 6854 O  O   . HOH N 4 .   ? 92.403  18.009  32.591  1.00 7.86  ? 333 HOH C O   1 
HETATM 6855 O  O   . HOH N 4 .   ? 94.125  9.915   14.897  1.00 15.08 ? 334 HOH C O   1 
HETATM 6856 O  O   . HOH N 4 .   ? 63.788  10.500  40.093  1.00 12.14 ? 335 HOH C O   1 
HETATM 6857 O  O   . HOH N 4 .   ? 86.259  26.446  19.183  1.00 8.19  ? 337 HOH C O   1 
HETATM 6858 O  O   . HOH N 4 .   ? 72.817  2.223   34.791  1.00 14.17 ? 338 HOH C O   1 
HETATM 6859 O  O   . HOH N 4 .   ? 101.466 -0.535  23.653  1.00 11.25 ? 340 HOH C O   1 
HETATM 6860 O  O   . HOH N 4 .   ? 101.632 24.946  31.223  1.00 9.26  ? 349 HOH C O   1 
HETATM 6861 O  O   . HOH N 4 .   ? 79.947  22.713  37.535  1.00 13.90 ? 353 HOH C O   1 
HETATM 6862 O  O   . HOH N 4 .   ? 95.501  -5.600  29.984  1.00 18.34 ? 359 HOH C O   1 
HETATM 6863 O  O   . HOH N 4 .   ? 76.112  3.523   24.536  1.00 9.24  ? 360 HOH C O   1 
HETATM 6864 O  O   . HOH N 4 .   ? 103.322 14.111  22.628  1.00 14.01 ? 363 HOH C O   1 
HETATM 6865 O  O   . HOH N 4 .   ? 79.236  23.069  39.679  1.00 7.66  ? 366 HOH C O   1 
HETATM 6866 O  O   . HOH N 4 .   ? 99.420  5.391   21.837  1.00 12.21 ? 367 HOH C O   1 
HETATM 6867 O  O   . HOH N 4 .   ? 88.320  26.463  17.632  1.00 14.79 ? 372 HOH C O   1 
HETATM 6868 O  O   . HOH N 4 .   ? 102.456 10.533  36.596  1.00 12.45 ? 374 HOH C O   1 
HETATM 6869 O  O   . HOH N 4 .   ? 86.628  20.007  20.056  1.00 11.22 ? 379 HOH C O   1 
HETATM 6870 O  O   . HOH N 4 .   ? 74.745  22.701  47.753  1.00 9.35  ? 381 HOH C O   1 
HETATM 6871 O  O   . HOH N 4 .   ? 77.758  24.808  43.337  1.00 11.89 ? 388 HOH C O   1 
HETATM 6872 O  O   . HOH N 4 .   ? 98.062  13.420  47.560  1.00 7.83  ? 390 HOH C O   1 
HETATM 6873 O  O   . HOH N 4 .   ? 98.193  7.549   39.297  1.00 8.98  ? 391 HOH C O   1 
HETATM 6874 O  O   . HOH N 4 .   ? 72.259  21.074  39.513  1.00 10.81 ? 393 HOH C O   1 
HETATM 6875 O  O   . HOH N 4 .   ? 102.891 20.419  42.006  1.00 10.45 ? 396 HOH C O   1 
HETATM 6876 O  O   . HOH N 4 .   ? 74.190  11.891  55.010  1.00 9.56  ? 397 HOH C O   1 
HETATM 6877 O  O   . HOH N 4 .   ? 99.229  26.437  31.377  1.00 10.77 ? 399 HOH C O   1 
HETATM 6878 O  O   . HOH N 4 .   ? 78.355  0.932   39.305  1.00 8.14  ? 401 HOH C O   1 
HETATM 6879 O  O   . HOH N 4 .   ? 75.569  1.199   31.751  1.00 11.76 ? 402 HOH C O   1 
HETATM 6880 O  O   . HOH N 4 .   ? 104.088 6.326   28.685  1.00 14.50 ? 403 HOH C O   1 
HETATM 6881 O  O   . HOH N 4 .   ? 75.630  18.238  22.720  1.00 11.89 ? 404 HOH C O   1 
HETATM 6882 O  O   . HOH N 4 .   ? 59.641  16.246  47.430  1.00 14.50 ? 412 HOH C O   1 
HETATM 6883 O  O   . HOH N 4 .   ? 104.810 11.988  37.657  1.00 13.67 ? 413 HOH C O   1 
HETATM 6884 O  O   . HOH N 4 .   ? 93.370  -6.379  32.206  1.00 9.40  ? 416 HOH C O   1 
HETATM 6885 O  O   . HOH N 4 .   ? 75.471  7.665   48.055  1.00 11.49 ? 420 HOH C O   1 
HETATM 6886 O  O   . HOH N 4 .   ? 67.166  5.110   34.412  1.00 12.79 ? 429 HOH C O   1 
HETATM 6887 O  O   . HOH N 4 .   ? 82.794  24.786  40.406  1.00 14.33 ? 430 HOH C O   1 
HETATM 6888 O  O   . HOH N 4 .   ? 76.258  9.591   55.331  1.00 12.84 ? 434 HOH C O   1 
HETATM 6889 O  O   . HOH N 4 .   ? 78.031  8.548   22.713  1.00 14.21 ? 440 HOH C O   1 
HETATM 6890 O  O   . HOH N 4 .   ? 100.646 1.936   37.836  1.00 16.61 ? 444 HOH C O   1 
HETATM 6891 O  O   . HOH N 4 .   ? 101.470 23.373  45.007  1.00 11.70 ? 447 HOH C O   1 
HETATM 6892 O  O   . HOH N 4 .   ? 72.913  0.757   31.602  1.00 16.47 ? 454 HOH C O   1 
HETATM 6893 O  O   . HOH N 4 .   ? 89.670  11.155  14.749  1.00 16.97 ? 463 HOH C O   1 
HETATM 6894 O  O   . HOH N 4 .   ? 90.898  8.472   32.459  1.00 11.61 ? 465 HOH C O   1 
HETATM 6895 O  O   . HOH N 4 .   ? 87.506  20.883  17.594  1.00 12.27 ? 466 HOH C O   1 
HETATM 6896 O  O   . HOH N 4 .   ? 97.131  -2.281  29.401  1.00 12.17 ? 467 HOH C O   1 
HETATM 6897 O  O   . HOH N 4 .   ? 83.921  9.606   50.413  1.00 6.90  ? 469 HOH C O   1 
HETATM 6898 O  O   . HOH N 4 .   ? 78.483  14.551  20.748  1.00 13.90 ? 472 HOH C O   1 
HETATM 6899 O  O   . HOH O 4 .   ? 79.408  30.214  24.060  0.50 0.50  ? 209 HOH D O   1 
HETATM 6900 O  O   . HOH O 4 .   ? 75.885  48.339  31.710  1.00 6.10  ? 210 HOH D O   1 
HETATM 6901 O  O   . HOH O 4 .   ? 72.247  21.372  32.738  1.00 8.09  ? 211 HOH D O   1 
HETATM 6902 O  O   . HOH O 4 .   ? 73.338  24.210  20.831  1.00 2.07  ? 212 HOH D O   1 
HETATM 6903 O  O   . HOH O 4 .   ? 73.708  47.524  34.427  1.00 10.78 ? 213 HOH D O   1 
HETATM 6904 O  O   . HOH O 4 .   ? 76.939  21.652  28.257  1.00 0.99  ? 214 HOH D O   1 
HETATM 6905 O  O   . HOH O 4 .   ? 74.623  19.192  26.667  1.00 1.21  ? 215 HOH D O   1 
HETATM 6906 O  O   . HOH O 4 .   ? 83.694  27.398  18.516  1.00 2.32  ? 216 HOH D O   1 
HETATM 6907 O  O   . HOH O 4 .   ? 68.630  24.325  25.609  1.00 6.24  ? 217 HOH D O   1 
HETATM 6908 O  O   . HOH O 4 .   ? 88.187  33.101  29.207  1.00 4.25  ? 218 HOH D O   1 
HETATM 6909 O  O   . HOH O 4 .   ? 81.307  23.640  15.888  1.00 9.45  ? 219 HOH D O   1 
HETATM 6910 O  O   . HOH O 4 .   ? 88.221  35.102  31.135  1.00 4.19  ? 220 HOH D O   1 
HETATM 6911 O  O   . HOH O 4 .   ? 85.529  39.351  10.184  1.00 7.00  ? 221 HOH D O   1 
HETATM 6912 O  O   . HOH O 4 .   ? 73.825  23.125  29.898  1.00 3.27  ? 222 HOH D O   1 
HETATM 6913 O  O   . HOH O 4 .   ? 72.592  44.380  25.545  1.00 6.25  ? 223 HOH D O   1 
HETATM 6914 O  O   . HOH O 4 .   ? 83.312  27.084  35.784  1.00 5.13  ? 224 HOH D O   1 
HETATM 6915 O  O   . HOH O 4 .   ? 93.591  39.935  28.925  1.00 5.96  ? 225 HOH D O   1 
HETATM 6916 O  O   . HOH O 4 .   ? 79.883  21.393  14.662  1.00 10.16 ? 226 HOH D O   1 
HETATM 6917 O  O   . HOH O 4 .   ? 87.969  35.713  9.272   1.00 1.75  ? 227 HOH D O   1 
HETATM 6918 O  O   . HOH O 4 .   ? 90.197  41.963  32.916  1.00 9.02  ? 228 HOH D O   1 
HETATM 6919 O  O   . HOH O 4 .   ? 80.508  25.556  34.131  1.00 5.02  ? 229 HOH D O   1 
HETATM 6920 O  O   . HOH O 4 .   ? 90.185  23.611  36.178  1.00 3.54  ? 230 HOH D O   1 
HETATM 6921 O  O   . HOH O 4 .   ? 83.407  30.705  7.004   1.00 2.48  ? 231 HOH D O   1 
HETATM 6922 O  O   . HOH O 4 .   ? 77.989  38.972  9.848   1.00 9.36  ? 232 HOH D O   1 
HETATM 6923 O  O   . HOH O 4 .   ? 72.649  36.405  9.072   1.00 11.57 ? 233 HOH D O   1 
HETATM 6924 O  O   . HOH O 4 .   ? 96.110  40.004  27.869  1.00 14.58 ? 234 HOH D O   1 
HETATM 6925 O  O   . HOH O 4 .   ? 60.718  29.961  28.316  1.00 13.00 ? 235 HOH D O   1 
HETATM 6926 O  O   . HOH O 4 .   ? 71.209  16.086  12.373  1.00 11.38 ? 236 HOH D O   1 
HETATM 6927 O  O   . HOH O 4 .   ? 71.797  21.805  23.147  1.00 3.78  ? 237 HOH D O   1 
HETATM 6928 O  O   . HOH O 4 .   ? 79.884  21.691  9.589   1.00 5.67  ? 238 HOH D O   1 
HETATM 6929 O  O   . HOH O 4 .   ? 71.173  23.727  33.993  1.00 6.79  ? 239 HOH D O   1 
HETATM 6930 O  O   . HOH O 4 .   ? 71.893  37.338  16.332  1.00 9.74  ? 240 HOH D O   1 
HETATM 6931 O  O   . HOH O 4 .   ? 76.479  21.239  2.695   1.00 10.62 ? 241 HOH D O   1 
HETATM 6932 O  O   . HOH O 4 .   ? 87.815  44.293  26.898  1.00 6.91  ? 242 HOH D O   1 
HETATM 6933 O  O   . HOH O 4 .   ? 89.257  34.469  12.867  1.00 4.26  ? 243 HOH D O   1 
HETATM 6934 O  O   . HOH O 4 .   ? 76.173  40.912  13.559  1.00 12.61 ? 244 HOH D O   1 
HETATM 6935 O  O   . HOH O 4 .   ? 74.659  27.266  0.157   1.00 5.34  ? 245 HOH D O   1 
HETATM 6936 O  O   . HOH O 4 .   ? 67.592  37.744  17.444  1.00 8.50  ? 246 HOH D O   1 
HETATM 6937 O  O   . HOH O 4 .   ? 86.984  42.439  15.520  1.00 6.11  ? 247 HOH D O   1 
HETATM 6938 O  O   . HOH O 4 .   ? 71.339  43.387  18.535  1.00 7.42  ? 248 HOH D O   1 
HETATM 6939 O  O   . HOH O 4 .   ? 74.369  24.746  -3.345  1.00 8.45  ? 249 HOH D O   1 
HETATM 6940 O  O   . HOH O 4 .   ? 78.828  47.939  21.187  1.00 11.12 ? 250 HOH D O   1 
HETATM 6941 O  O   . HOH O 4 .   ? 69.305  22.586  -1.775  1.00 5.86  ? 251 HOH D O   1 
HETATM 6942 O  O   . HOH O 4 .   ? 77.852  41.035  15.978  1.00 7.76  ? 252 HOH D O   1 
HETATM 6943 O  O   . HOH O 4 .   ? 67.646  24.619  0.781   1.00 12.42 ? 253 HOH D O   1 
HETATM 6944 O  O   . HOH O 4 .   ? 85.801  37.386  8.383   1.00 1.38  ? 254 HOH D O   1 
HETATM 6945 O  O   . HOH O 4 .   ? 82.742  24.611  18.196  1.00 4.40  ? 255 HOH D O   1 
HETATM 6946 O  O   . HOH O 4 .   ? 77.013  49.979  29.883  1.00 9.68  ? 256 HOH D O   1 
HETATM 6947 O  O   . HOH O 4 .   ? 70.558  31.165  7.067   1.00 7.43  ? 257 HOH D O   1 
HETATM 6948 O  O   . HOH O 4 .   ? 80.092  26.412  31.585  1.00 4.75  ? 258 HOH D O   1 
HETATM 6949 O  O   . HOH O 4 .   ? 77.586  20.250  16.068  1.00 7.12  ? 259 HOH D O   1 
HETATM 6950 O  O   . HOH O 4 .   ? 78.351  24.291  35.364  1.00 4.37  ? 260 HOH D O   1 
HETATM 6951 O  O   . HOH O 4 .   ? 83.008  36.829  28.093  1.00 9.50  ? 261 HOH D O   1 
HETATM 6952 O  O   . HOH O 4 .   ? 75.307  27.437  -2.415  1.00 9.29  ? 262 HOH D O   1 
HETATM 6953 O  O   . HOH O 4 .   ? 65.241  20.087  14.139  1.00 13.01 ? 263 HOH D O   1 
HETATM 6954 O  O   . HOH O 4 .   ? 77.700  29.578  38.885  1.00 7.75  ? 264 HOH D O   1 
HETATM 6955 O  O   . HOH O 4 .   ? 66.450  25.615  28.712  1.00 12.95 ? 265 HOH D O   1 
HETATM 6956 O  O   . HOH O 4 .   ? 63.763  26.173  15.010  1.00 13.17 ? 266 HOH D O   1 
HETATM 6957 O  O   . HOH O 4 .   ? 61.065  24.473  19.504  1.00 6.83  ? 267 HOH D O   1 
HETATM 6958 O  O   . HOH O 4 .   ? 72.319  51.105  34.200  1.00 11.88 ? 268 HOH D O   1 
HETATM 6959 O  O   . HOH O 4 .   ? 83.884  37.507  25.681  1.00 3.68  ? 269 HOH D O   1 
HETATM 6960 O  O   . HOH O 4 .   ? 79.469  42.923  16.181  1.00 10.59 ? 270 HOH D O   1 
HETATM 6961 O  O   . HOH O 4 .   ? 74.584  18.714  19.919  1.00 9.10  ? 271 HOH D O   1 
HETATM 6962 O  O   . HOH O 4 .   ? 62.067  28.587  29.874  1.00 13.58 ? 272 HOH D O   1 
HETATM 6963 O  O   . HOH O 4 .   ? 86.985  50.375  20.622  1.00 12.98 ? 273 HOH D O   1 
HETATM 6964 O  O   . HOH O 4 .   ? 75.842  29.581  4.710   1.00 14.37 ? 274 HOH D O   1 
HETATM 6965 O  O   . HOH O 4 .   ? 73.522  17.439  12.053  1.00 10.54 ? 275 HOH D O   1 
HETATM 6966 O  O   . HOH O 4 .   ? 72.610  17.728  25.628  1.00 11.29 ? 280 HOH D O   1 
HETATM 6967 O  O   . HOH O 4 .   ? 93.124  37.294  30.129  1.00 6.08  ? 283 HOH D O   1 
HETATM 6968 O  O   . HOH O 4 .   ? 93.570  40.740  22.836  1.00 11.13 ? 291 HOH D O   1 
HETATM 6969 O  O   . HOH O 4 .   ? 70.797  19.394  24.401  1.00 5.32  ? 298 HOH D O   1 
HETATM 6970 O  O   . HOH O 4 .   ? 81.644  26.228  -0.970  1.00 14.60 ? 313 HOH D O   1 
HETATM 6971 O  O   . HOH O 4 .   ? 71.378  15.856  27.215  1.00 10.38 ? 319 HOH D O   1 
HETATM 6972 O  O   . HOH O 4 .   ? 56.714  22.508  21.397  1.00 8.00  ? 330 HOH D O   1 
HETATM 6973 O  O   . HOH O 4 .   ? 61.647  24.674  13.894  1.00 10.90 ? 331 HOH D O   1 
HETATM 6974 O  O   . HOH O 4 .   ? 82.708  49.789  25.637  1.00 6.61  ? 332 HOH D O   1 
HETATM 6975 O  O   . HOH O 4 .   ? 73.990  41.104  25.884  1.00 9.23  ? 343 HOH D O   1 
HETATM 6976 O  O   . HOH O 4 .   ? 80.779  20.634  12.084  1.00 15.29 ? 348 HOH D O   1 
HETATM 6977 O  O   . HOH O 4 .   ? 77.065  47.264  19.215  1.00 19.02 ? 351 HOH D O   1 
HETATM 6978 O  O   . HOH O 4 .   ? 75.105  50.290  33.329  1.00 13.48 ? 356 HOH D O   1 
HETATM 6979 O  O   . HOH O 4 .   ? 66.006  19.613  22.686  1.00 10.58 ? 358 HOH D O   1 
HETATM 6980 O  O   . HOH O 4 .   ? 71.400  43.182  23.292  1.00 13.42 ? 361 HOH D O   1 
HETATM 6981 O  O   . HOH O 4 .   ? 83.822  36.205  15.431  1.00 17.55 ? 365 HOH D O   1 
HETATM 6982 O  O   . HOH O 4 .   ? 78.659  57.293  29.824  1.00 15.44 ? 370 HOH D O   1 
HETATM 6983 O  O   . HOH O 4 .   ? 81.759  26.247  37.957  1.00 12.52 ? 375 HOH D O   1 
HETATM 6984 O  O   . HOH O 4 .   ? 92.731  40.782  33.231  1.00 13.68 ? 377 HOH D O   1 
HETATM 6985 O  O   . HOH O 4 .   ? 65.234  14.941  6.158   1.00 12.64 ? 380 HOH D O   1 
HETATM 6986 O  O   . HOH O 4 .   ? 72.846  30.703  -0.733  1.00 14.95 ? 386 HOH D O   1 
HETATM 6987 O  O   . HOH O 4 .   ? 80.735  22.021  2.728   1.00 11.03 ? 387 HOH D O   1 
HETATM 6988 O  O   . HOH O 4 .   ? 89.123  37.017  11.618  1.00 11.83 ? 392 HOH D O   1 
HETATM 6989 O  O   . HOH O 4 .   ? 88.545  40.098  15.670  1.00 8.06  ? 398 HOH D O   1 
HETATM 6990 O  O   . HOH O 4 .   ? 78.449  27.969  2.517   1.00 11.02 ? 409 HOH D O   1 
HETATM 6991 O  O   . HOH O 4 .   ? 58.486  24.279  20.422  1.00 7.44  ? 421 HOH D O   1 
HETATM 6992 O  O   . HOH O 4 .   ? 53.804  22.683  20.673  1.00 11.15 ? 427 HOH D O   1 
HETATM 6993 O  O   . HOH O 4 .   ? 82.574  51.076  22.669  1.00 13.59 ? 428 HOH D O   1 
HETATM 6994 O  O   . HOH O 4 .   ? 80.172  50.853  32.009  1.00 7.22  ? 432 HOH D O   1 
HETATM 6995 O  O   . HOH O 4 .   ? 89.760  37.242  39.597  1.00 14.17 ? 435 HOH D O   1 
HETATM 6996 O  O   . HOH O 4 .   ? 72.146  35.654  6.269   1.00 15.26 ? 437 HOH D O   1 
HETATM 6997 O  O   . HOH O 4 .   ? 69.764  33.920  19.751  1.00 10.71 ? 443 HOH D O   1 
HETATM 6998 O  O   . HOH O 4 .   ? 76.106  38.465  12.591  1.00 12.92 ? 445 HOH D O   1 
HETATM 6999 O  O   . HOH O 4 .   ? 59.095  22.013  9.126   1.00 15.14 ? 449 HOH D O   1 
HETATM 7000 O  O   . HOH O 4 .   ? 64.215  35.165  14.606  1.00 17.28 ? 450 HOH D O   1 
HETATM 7001 O  O   . HOH O 4 .   ? 54.629  25.569  20.237  1.00 12.47 ? 457 HOH D O   1 
HETATM 7002 O  O   . HOH O 4 .   ? 77.471  44.651  39.271  1.00 10.15 ? 459 HOH D O   1 
HETATM 7003 O  O   . HOH O 4 .   ? 72.563  42.426  20.793  1.00 10.61 ? 464 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 1   ? 0.0521 0.0572 0.0514 0.0031  0.0075  0.0181  1   SER A N   
2    C  CA  . SER A 1   ? 0.0415 0.0339 0.0339 0.0083  0.0064  0.0126  1   SER A CA  
3    C  C   . SER A 1   ? 0.0509 0.0497 0.0452 0.0111  0.0041  0.0099  1   SER A C   
4    O  O   . SER A 1   ? 0.0501 0.0284 0.0453 0.0203  0.0206  0.0124  1   SER A O   
5    C  CB  . SER A 1   ? 0.0427 0.0371 0.0407 0.0040  0.0045  0.0169  1   SER A CB  
6    O  OG  . SER A 1   ? 0.0417 0.0260 0.0336 0.0117  -0.0072 0.0177  1   SER A OG  
7    N  N   . TYR A 2   ? 0.0406 0.0521 0.0367 0.0068  0.0057  0.0105  2   TYR A N   
8    C  CA  . TYR A 2   ? 0.0436 0.0476 0.0417 0.0066  0.0015  0.0098  2   TYR A CA  
9    C  C   . TYR A 2   ? 0.0483 0.0548 0.0455 0.0067  0.0053  0.0124  2   TYR A C   
10   O  O   . TYR A 2   ? 0.0320 0.0568 0.0202 0.0110  -0.0029 0.0180  2   TYR A O   
11   C  CB  . TYR A 2   ? 0.0485 0.0478 0.0422 0.0054  0.0006  0.0050  2   TYR A CB  
12   C  CG  . TYR A 2   ? 0.0406 0.0346 0.0424 0.0034  0.0025  0.0087  2   TYR A CG  
13   C  CD1 . TYR A 2   ? 0.0458 0.0366 0.0556 0.0014  0.0063  -0.0183 2   TYR A CD1 
14   C  CD2 . TYR A 2   ? 0.0363 0.0367 0.0347 -0.0015 0.0001  0.0071  2   TYR A CD2 
15   C  CE1 . TYR A 2   ? 0.0516 0.0433 0.0274 -0.0119 -0.0015 -0.0003 2   TYR A CE1 
16   C  CE2 . TYR A 2   ? 0.0352 0.0396 0.0515 -0.0021 -0.0114 0.0065  2   TYR A CE2 
17   C  CZ  . TYR A 2   ? 0.0369 0.0336 0.0542 0.0014  0.0038  0.0008  2   TYR A CZ  
18   O  OH  . TYR A 2   ? 0.0723 0.0444 0.0445 -0.0187 -0.0067 -0.0018 2   TYR A OH  
19   N  N   . THR A 3   ? 0.0431 0.0466 0.0529 0.0070  0.0059  0.0156  3   THR A N   
20   C  CA  . THR A 3   ? 0.0528 0.0463 0.0563 0.0052  0.0048  0.0168  3   THR A CA  
21   C  C   . THR A 3   ? 0.0379 0.0325 0.0399 0.0035  0.0044  0.0162  3   THR A C   
22   O  O   . THR A 3   ? 0.0324 0.0201 0.0504 -0.0051 0.0056  0.0223  3   THR A O   
23   C  CB  . THR A 3   ? 0.0459 0.0465 0.0658 0.0035  0.0036  0.0141  3   THR A CB  
24   O  OG1 . THR A 3   ? 0.1338 0.1184 0.1432 -0.0036 -0.0041 0.0066  3   THR A OG1 
25   C  CG2 . THR A 3   ? 0.0319 0.0228 0.0255 0.0190  0.0127  0.0150  3   THR A CG2 
26   N  N   . LEU A 4   ? 0.0414 0.0206 0.0424 0.0033  -0.0024 0.0139  4   LEU A N   
27   C  CA  . LEU A 4   ? 0.0515 0.0363 0.0388 0.0047  0.0037  0.0045  4   LEU A CA  
28   C  C   . LEU A 4   ? 0.0571 0.0421 0.0489 0.0056  0.0014  0.0027  4   LEU A C   
29   O  O   . LEU A 4   ? 0.0865 0.0533 0.0685 0.0053  0.0075  0.0031  4   LEU A O   
30   C  CB  . LEU A 4   ? 0.0530 0.0341 0.0318 -0.0086 -0.0020 0.0104  4   LEU A CB  
31   C  CG  . LEU A 4   ? 0.0415 0.0235 0.0075 -0.0126 0.0003  -0.0040 4   LEU A CG  
32   C  CD1 . LEU A 4   ? 0.0371 0.0331 0.0157 0.0044  0.0060  -0.0138 4   LEU A CD1 
33   C  CD2 . LEU A 4   ? 0.0439 0.0212 0.0163 -0.0158 0.0011  -0.0054 4   LEU A CD2 
34   N  N   . PRO A 5   ? 0.0547 0.0353 0.0528 0.0077  0.0046  0.0052  5   PRO A N   
35   C  CA  . PRO A 5   ? 0.0525 0.0555 0.0567 0.0089  0.0034  0.0021  5   PRO A CA  
36   C  C   . PRO A 5   ? 0.0610 0.0576 0.0596 0.0121  0.0072  0.0074  5   PRO A C   
37   O  O   . PRO A 5   ? 0.0501 0.0714 0.0903 0.0136  0.0136  0.0079  5   PRO A O   
38   C  CB  . PRO A 5   ? 0.0585 0.0554 0.0477 0.0156  0.0028  0.0092  5   PRO A CB  
39   C  CG  . PRO A 5   ? 0.0299 0.0348 0.0426 -0.0019 -0.0010 0.0021  5   PRO A CG  
40   C  CD  . PRO A 5   ? 0.0542 0.0430 0.0486 0.0065  -0.0007 0.0088  5   PRO A CD  
41   N  N   . SER A 6   ? 0.0752 0.0682 0.0602 0.0007  0.0031  0.0051  6   SER A N   
42   C  CA  . SER A 6   ? 0.0875 0.0680 0.0691 -0.0008 0.0037  -0.0012 6   SER A CA  
43   C  C   . SER A 6   ? 0.0848 0.0716 0.0665 -0.0030 0.0037  -0.0020 6   SER A C   
44   O  O   . SER A 6   ? 0.0975 0.0856 0.0803 -0.0045 0.0103  0.0053  6   SER A O   
45   C  CB  . SER A 6   ? 0.0768 0.0659 0.0647 -0.0010 0.0044  -0.0020 6   SER A CB  
46   O  OG  . SER A 6   ? 0.0855 0.0574 0.0677 0.0000  0.0079  -0.0091 6   SER A OG  
47   N  N   . LEU A 7   ? 0.0906 0.0665 0.0686 -0.0046 0.0034  -0.0021 7   LEU A N   
48   C  CA  . LEU A 7   ? 0.0833 0.0673 0.0657 -0.0017 -0.0022 -0.0029 7   LEU A CA  
49   C  C   . LEU A 7   ? 0.0884 0.0641 0.0679 -0.0030 -0.0009 -0.0011 7   LEU A C   
50   O  O   . LEU A 7   ? 0.1004 0.0669 0.0509 0.0015  -0.0058 -0.0062 7   LEU A O   
51   C  CB  . LEU A 7   ? 0.0710 0.0719 0.0686 -0.0035 -0.0054 -0.0058 7   LEU A CB  
52   C  CG  . LEU A 7   ? 0.0875 0.0460 0.0778 0.0103  -0.0027 -0.0010 7   LEU A CG  
53   C  CD1 . LEU A 7   ? 0.0705 0.0573 0.0847 0.0165  -0.0136 -0.0035 7   LEU A CD1 
54   C  CD2 . LEU A 7   ? 0.0495 0.0728 0.0971 0.0180  -0.0077 0.0012  7   LEU A CD2 
55   N  N   . PRO A 8   ? 0.0799 0.0601 0.0667 -0.0075 -0.0024 -0.0005 8   PRO A N   
56   C  CA  . PRO A 8   ? 0.0849 0.0578 0.0704 -0.0068 -0.0019 -0.0012 8   PRO A CA  
57   C  C   . PRO A 8   ? 0.0871 0.0590 0.0669 -0.0041 0.0000  -0.0041 8   PRO A C   
58   O  O   . PRO A 8   ? 0.0997 0.0393 0.0605 -0.0044 -0.0027 -0.0059 8   PRO A O   
59   C  CB  . PRO A 8   ? 0.0747 0.0578 0.0721 -0.0041 -0.0047 0.0036  8   PRO A CB  
60   C  CG  . PRO A 8   ? 0.0895 0.0767 0.0864 -0.0076 -0.0042 0.0009  8   PRO A CG  
61   C  CD  . PRO A 8   ? 0.0813 0.0560 0.0736 -0.0020 -0.0021 0.0002  8   PRO A CD  
62   N  N   . TYR A 9   ? 0.0867 0.0573 0.0587 -0.0069 -0.0020 -0.0098 9   TYR A N   
63   C  CA  . TYR A 9   ? 0.0892 0.0517 0.0535 -0.0011 0.0001  -0.0044 9   TYR A CA  
64   C  C   . TYR A 9   ? 0.0909 0.0553 0.0539 -0.0014 -0.0002 -0.0065 9   TYR A C   
65   O  O   . TYR A 9   ? 0.0960 0.0511 0.0520 0.0068  -0.0028 0.0012  9   TYR A O   
66   C  CB  . TYR A 9   ? 0.0903 0.0475 0.0567 -0.0050 -0.0007 -0.0073 9   TYR A CB  
67   C  CG  . TYR A 9   ? 0.0695 0.0400 0.0426 -0.0001 -0.0014 -0.0036 9   TYR A CG  
68   C  CD1 . TYR A 9   ? 0.0591 0.0314 0.0514 -0.0088 0.0037  -0.0066 9   TYR A CD1 
69   C  CD2 . TYR A 9   ? 0.0543 0.0248 0.0276 0.0028  0.0000  -0.0098 9   TYR A CD2 
70   C  CE1 . TYR A 9   ? 0.0914 0.0544 0.0723 0.0007  -0.0032 -0.0113 9   TYR A CE1 
71   C  CE2 . TYR A 9   ? 0.0908 0.0427 0.0339 0.0106  -0.0040 -0.0046 9   TYR A CE2 
72   C  CZ  . TYR A 9   ? 0.0826 0.0519 0.0414 0.0011  0.0000  -0.0086 9   TYR A CZ  
73   O  OH  . TYR A 9   ? 0.1057 0.0373 0.0545 -0.0038 0.0018  -0.0094 9   TYR A OH  
74   N  N   . ALA A 10  ? 0.0742 0.0475 0.0491 -0.0015 0.0028  -0.0084 10  ALA A N   
75   C  CA  . ALA A 10  ? 0.0725 0.0520 0.0562 -0.0091 0.0004  -0.0061 10  ALA A CA  
76   C  C   . ALA A 10  ? 0.0634 0.0415 0.0534 -0.0098 0.0020  -0.0084 10  ALA A C   
77   O  O   . ALA A 10  ? 0.0495 0.0473 0.0659 -0.0237 -0.0054 -0.0061 10  ALA A O   
78   C  CB  . ALA A 10  ? 0.0704 0.0587 0.0644 -0.0074 0.0054  -0.0085 10  ALA A CB  
79   N  N   . TYR A 11  ? 0.0638 0.0385 0.0528 -0.0118 0.0003  -0.0160 11  TYR A N   
80   C  CA  . TYR A 11  ? 0.0750 0.0435 0.0572 -0.0112 0.0052  -0.0116 11  TYR A CA  
81   C  C   . TYR A 11  ? 0.0871 0.0533 0.0621 -0.0098 0.0058  -0.0136 11  TYR A C   
82   O  O   . TYR A 11  ? 0.0906 0.0406 0.0545 -0.0149 0.0099  -0.0180 11  TYR A O   
83   C  CB  . TYR A 11  ? 0.0762 0.0475 0.0653 -0.0109 0.0085  -0.0145 11  TYR A CB  
84   C  CG  . TYR A 11  ? 0.0969 0.0592 0.0674 0.0010  -0.0040 -0.0060 11  TYR A CG  
85   C  CD1 . TYR A 11  ? 0.1075 0.0727 0.0944 -0.0075 0.0008  0.0016  11  TYR A CD1 
86   C  CD2 . TYR A 11  ? 0.1237 0.0785 0.0890 0.0094  0.0085  -0.0066 11  TYR A CD2 
87   C  CE1 . TYR A 11  ? 0.1117 0.0544 0.0842 -0.0013 0.0016  -0.0023 11  TYR A CE1 
88   C  CE2 . TYR A 11  ? 0.1032 0.0638 0.1024 -0.0026 0.0059  -0.0091 11  TYR A CE2 
89   C  CZ  . TYR A 11  ? 0.1115 0.0774 0.0941 -0.0014 -0.0042 -0.0069 11  TYR A CZ  
90   O  OH  . TYR A 11  ? 0.1363 0.0900 0.1100 0.0033  -0.0048 -0.0040 11  TYR A OH  
91   N  N   . ASP A 12  ? 0.0924 0.0527 0.0647 -0.0045 0.0041  -0.0144 12  ASP A N   
92   C  CA  . ASP A 12  ? 0.0928 0.0640 0.0764 -0.0126 0.0065  -0.0098 12  ASP A CA  
93   C  C   . ASP A 12  ? 0.0935 0.0637 0.0720 -0.0068 0.0066  -0.0044 12  ASP A C   
94   O  O   . ASP A 12  ? 0.1044 0.0709 0.0761 -0.0162 0.0083  -0.0051 12  ASP A O   
95   C  CB  . ASP A 12  ? 0.0993 0.0720 0.0776 -0.0129 0.0075  -0.0148 12  ASP A CB  
96   C  CG  . ASP A 12  ? 0.1075 0.0908 0.1205 -0.0088 0.0037  -0.0161 12  ASP A CG  
97   O  OD1 . ASP A 12  ? 0.1421 0.1431 0.1751 -0.0233 0.0103  -0.0048 12  ASP A OD1 
98   O  OD2 . ASP A 12  ? 0.1334 0.0483 0.1171 -0.0131 0.0151  -0.0041 12  ASP A OD2 
99   N  N   . ALA A 13  ? 0.0821 0.0606 0.0642 -0.0093 -0.0002 -0.0050 13  ALA A N   
100  C  CA  . ALA A 13  ? 0.0845 0.0633 0.0724 -0.0015 0.0058  0.0009  13  ALA A CA  
101  C  C   . ALA A 13  ? 0.0818 0.0648 0.0771 -0.0040 -0.0002 0.0037  13  ALA A C   
102  O  O   . ALA A 13  ? 0.1048 0.0745 0.0898 0.0014  0.0000  0.0073  13  ALA A O   
103  C  CB  . ALA A 13  ? 0.0830 0.0612 0.0850 -0.0090 0.0008  0.0019  13  ALA A CB  
104  N  N   . LEU A 14  ? 0.0868 0.0628 0.0682 -0.0093 0.0030  0.0020  14  LEU A N   
105  C  CA  . LEU A 14  ? 0.0914 0.0731 0.0735 -0.0125 -0.0006 0.0031  14  LEU A CA  
106  C  C   . LEU A 14  ? 0.0954 0.0757 0.0751 -0.0106 -0.0021 0.0059  14  LEU A C   
107  O  O   . LEU A 14  ? 0.1197 0.0942 0.0911 -0.0109 0.0088  0.0104  14  LEU A O   
108  C  CB  . LEU A 14  ? 0.0869 0.0644 0.0715 -0.0078 -0.0035 0.0013  14  LEU A CB  
109  C  CG  . LEU A 14  ? 0.0845 0.0568 0.0691 -0.0062 0.0002  -0.0069 14  LEU A CG  
110  C  CD1 . LEU A 14  ? 0.0591 0.0370 0.0660 -0.0048 0.0007  0.0086  14  LEU A CD1 
111  C  CD2 . LEU A 14  ? 0.0577 0.0522 0.0583 -0.0226 0.0004  0.0097  14  LEU A CD2 
112  N  N   . GLU A 15  ? 0.0860 0.0674 0.0774 -0.0183 0.0012  0.0110  15  GLU A N   
113  C  CA  . GLU A 15  ? 0.0848 0.0649 0.0749 -0.0173 0.0028  0.0020  15  GLU A CA  
114  C  C   . GLU A 15  ? 0.0823 0.0554 0.0752 -0.0182 -0.0002 -0.0035 15  GLU A C   
115  O  O   . GLU A 15  ? 0.0840 0.0512 0.0733 -0.0298 -0.0002 -0.0050 15  GLU A O   
116  C  CB  . GLU A 15  ? 0.0886 0.0672 0.0756 -0.0141 -0.0016 -0.0011 15  GLU A CB  
117  C  CG  . GLU A 15  ? 0.0901 0.0469 0.0768 -0.0227 0.0007  0.0010  15  GLU A CG  
118  C  CD  . GLU A 15  ? 0.1025 0.0413 0.0994 -0.0268 0.0014  -0.0049 15  GLU A CD  
119  O  OE1 . GLU A 15  ? 0.1301 0.0497 0.0955 -0.0236 -0.0130 -0.0081 15  GLU A OE1 
120  O  OE2 . GLU A 15  ? 0.1133 0.0586 0.1066 -0.0219 0.0075  -0.0086 15  GLU A OE2 
121  N  N   . PRO A 16  ? 0.0855 0.0517 0.0744 -0.0175 -0.0015 -0.0013 16  PRO A N   
122  C  CA  . PRO A 16  ? 0.0899 0.0527 0.0745 -0.0152 -0.0005 0.0006  16  PRO A CA  
123  C  C   . PRO A 16  ? 0.0863 0.0492 0.0696 -0.0138 -0.0011 -0.0010 16  PRO A C   
124  O  O   . PRO A 16  ? 0.1053 0.0279 0.0804 -0.0275 0.0003  0.0006  16  PRO A O   
125  C  CB  . PRO A 16  ? 0.0902 0.0582 0.0790 -0.0149 -0.0017 0.0061  16  PRO A CB  
126  C  CG  . PRO A 16  ? 0.0849 0.0575 0.0732 -0.0056 -0.0018 0.0000  16  PRO A CG  
127  C  CD  . PRO A 16  ? 0.0952 0.0624 0.0825 -0.0165 -0.0026 -0.0029 16  PRO A CD  
128  N  N   . HIS A 17  ? 0.0900 0.0454 0.0582 -0.0141 -0.0026 0.0032  17  HIS A N   
129  C  CA  . HIS A 17  ? 0.0854 0.0563 0.0543 -0.0126 0.0005  -0.0004 17  HIS A CA  
130  C  C   . HIS A 17  ? 0.0819 0.0533 0.0520 -0.0152 0.0043  0.0037  17  HIS A C   
131  O  O   . HIS A 17  ? 0.0897 0.0567 0.0572 -0.0232 0.0040  0.0082  17  HIS A O   
132  C  CB  . HIS A 17  ? 0.0816 0.0594 0.0611 -0.0100 -0.0068 -0.0023 17  HIS A CB  
133  C  CG  . HIS A 17  ? 0.1030 0.0800 0.0919 -0.0108 -0.0009 0.0008  17  HIS A CG  
134  N  ND1 . HIS A 17  ? 0.1062 0.0971 0.0894 -0.0018 -0.0001 0.0059  17  HIS A ND1 
135  C  CD2 . HIS A 17  ? 0.1178 0.0995 0.0918 -0.0056 0.0083  0.0033  17  HIS A CD2 
136  C  CE1 . HIS A 17  ? 0.1346 0.1149 0.1068 -0.0011 0.0050  -0.0023 17  HIS A CE1 
137  N  NE2 . HIS A 17  ? 0.1483 0.1325 0.1138 -0.0026 0.0006  0.0017  17  HIS A NE2 
138  N  N   . PHE A 18  ? 0.0858 0.0631 0.0519 -0.0151 0.0053  0.0042  18  PHE A N   
139  C  CA  . PHE A 18  ? 0.0772 0.0594 0.0548 -0.0153 0.0053  0.0060  18  PHE A CA  
140  C  C   . PHE A 18  ? 0.0850 0.0607 0.0568 -0.0152 0.0066  0.0060  18  PHE A C   
141  O  O   . PHE A 18  ? 0.0951 0.0820 0.0698 -0.0166 0.0014  -0.0023 18  PHE A O   
142  C  CB  . PHE A 18  ? 0.0837 0.0476 0.0552 -0.0197 0.0082  0.0062  18  PHE A CB  
143  C  CG  . PHE A 18  ? 0.0898 0.0682 0.0540 -0.0175 0.0008  0.0016  18  PHE A CG  
144  C  CD1 . PHE A 18  ? 0.1174 0.0526 0.0634 -0.0167 -0.0018 -0.0021 18  PHE A CD1 
145  C  CD2 . PHE A 18  ? 0.1062 0.0511 0.0423 -0.0221 0.0032  0.0010  18  PHE A CD2 
146  C  CE1 . PHE A 18  ? 0.0970 0.0790 0.0807 -0.0113 -0.0002 0.0061  18  PHE A CE1 
147  C  CE2 . PHE A 18  ? 0.0928 0.0571 0.0660 -0.0171 -0.0077 0.0127  18  PHE A CE2 
148  C  CZ  . PHE A 18  ? 0.0993 0.0724 0.0741 -0.0106 0.0006  -0.0083 18  PHE A CZ  
149  N  N   . ASP A 19  ? 0.0799 0.0530 0.0515 -0.0152 0.0025  0.0031  19  ASP A N   
150  C  CA  . ASP A 19  ? 0.0819 0.0495 0.0445 -0.0147 0.0003  0.0024  19  ASP A CA  
151  C  C   . ASP A 19  ? 0.0853 0.0533 0.0424 -0.0141 0.0014  -0.0009 19  ASP A C   
152  O  O   . ASP A 19  ? 0.0835 0.0602 0.0270 -0.0239 0.0116  -0.0059 19  ASP A O   
153  C  CB  . ASP A 19  ? 0.0826 0.0383 0.0566 -0.0184 -0.0031 -0.0013 19  ASP A CB  
154  C  CG  . ASP A 19  ? 0.0691 0.0399 0.0571 -0.0101 -0.0055 0.0001  19  ASP A CG  
155  O  OD1 . ASP A 19  ? 0.1194 0.0271 0.0218 -0.0262 0.0045  -0.0160 19  ASP A OD1 
156  O  OD2 . ASP A 19  ? 0.0669 0.0269 0.0297 -0.0345 0.0057  -0.0078 19  ASP A OD2 
157  N  N   . LYS A 20  ? 0.0891 0.0581 0.0385 -0.0153 0.0048  -0.0055 20  LYS A N   
158  C  CA  . LYS A 20  ? 0.0867 0.0638 0.0432 -0.0139 -0.0037 -0.0050 20  LYS A CA  
159  C  C   . LYS A 20  ? 0.0788 0.0596 0.0482 -0.0163 -0.0040 -0.0103 20  LYS A C   
160  O  O   . LYS A 20  ? 0.0826 0.0736 0.0429 -0.0226 -0.0063 -0.0129 20  LYS A O   
161  C  CB  . LYS A 20  ? 0.0899 0.0624 0.0572 -0.0039 0.0020  -0.0003 20  LYS A CB  
162  C  CG  . LYS A 20  ? 0.1001 0.0852 0.0653 -0.0108 -0.0067 -0.0061 20  LYS A CG  
163  C  CD  . LYS A 20  ? 0.1305 0.0940 0.1192 0.0030  0.0037  -0.0070 20  LYS A CD  
164  C  CE  . LYS A 20  ? 0.1508 0.1165 0.1438 -0.0073 0.0104  -0.0086 20  LYS A CE  
165  N  NZ  . LYS A 20  ? 0.1786 0.1444 0.1607 -0.0031 -0.0217 -0.0017 20  LYS A NZ  
166  N  N   . GLN A 21  ? 0.0803 0.0575 0.0472 -0.0195 -0.0023 -0.0100 21  GLN A N   
167  C  CA  . GLN A 21  ? 0.0757 0.0598 0.0498 -0.0183 -0.0020 -0.0043 21  GLN A CA  
168  C  C   . GLN A 21  ? 0.0745 0.0648 0.0566 -0.0158 -0.0024 -0.0068 21  GLN A C   
169  O  O   . GLN A 21  ? 0.0775 0.0556 0.0585 -0.0247 0.0037  -0.0153 21  GLN A O   
170  C  CB  . GLN A 21  ? 0.0855 0.0652 0.0524 -0.0109 0.0009  -0.0031 21  GLN A CB  
171  C  CG  . GLN A 21  ? 0.0900 0.0850 0.0741 -0.0100 -0.0072 0.0001  21  GLN A CG  
172  C  CD  . GLN A 21  ? 0.1206 0.1274 0.1234 -0.0106 -0.0013 -0.0001 21  GLN A CD  
173  O  OE1 . GLN A 21  ? 0.1512 0.1784 0.1714 -0.0062 -0.0008 -0.0072 21  GLN A OE1 
174  N  NE2 . GLN A 21  ? 0.1430 0.1384 0.1426 -0.0135 -0.0119 0.0021  21  GLN A NE2 
175  N  N   . THR A 22  ? 0.0762 0.0673 0.0473 -0.0208 0.0017  -0.0095 22  THR A N   
176  C  CA  . THR A 22  ? 0.0715 0.0674 0.0491 -0.0177 -0.0011 -0.0033 22  THR A CA  
177  C  C   . THR A 22  ? 0.0744 0.0667 0.0477 -0.0131 -0.0018 -0.0058 22  THR A C   
178  O  O   . THR A 22  ? 0.0736 0.0599 0.0471 -0.0313 -0.0006 -0.0032 22  THR A O   
179  C  CB  . THR A 22  ? 0.0749 0.0762 0.0491 -0.0138 -0.0005 -0.0056 22  THR A CB  
180  O  OG1 . THR A 22  ? 0.0514 0.0611 0.0332 -0.0133 -0.0017 -0.0062 22  THR A OG1 
181  C  CG2 . THR A 22  ? 0.0923 0.0711 0.0524 -0.0099 0.0012  -0.0099 22  THR A CG2 
182  N  N   . MET A 23  ? 0.0688 0.0663 0.0500 -0.0171 -0.0068 -0.0010 23  MET A N   
183  C  CA  . MET A 23  ? 0.0731 0.0627 0.0548 -0.0085 -0.0035 -0.0054 23  MET A CA  
184  C  C   . MET A 23  ? 0.0742 0.0670 0.0552 -0.0112 -0.0026 -0.0027 23  MET A C   
185  O  O   . MET A 23  ? 0.0724 0.0713 0.0466 -0.0149 0.0055  -0.0045 23  MET A O   
186  C  CB  . MET A 23  ? 0.0800 0.0599 0.0652 -0.0091 -0.0049 -0.0030 23  MET A CB  
187  C  CG  . MET A 23  ? 0.0699 0.0227 0.0564 -0.0263 -0.0097 -0.0123 23  MET A CG  
188  S  SD  . MET A 23  ? 0.0711 0.0382 0.0488 -0.0406 0.0043  -0.0190 23  MET A SD  
189  C  CE  . MET A 23  ? 0.0750 0.0286 0.0582 -0.0386 0.0054  -0.0084 23  MET A CE  
190  N  N   . GLU A 24  ? 0.0689 0.0549 0.0526 -0.0145 -0.0001 -0.0055 24  GLU A N   
191  C  CA  . GLU A 24  ? 0.0709 0.0610 0.0603 -0.0143 -0.0040 -0.0012 24  GLU A CA  
192  C  C   . GLU A 24  ? 0.0641 0.0593 0.0508 -0.0170 -0.0056 -0.0063 24  GLU A C   
193  O  O   . GLU A 24  ? 0.0730 0.0507 0.0520 -0.0225 -0.0099 -0.0056 24  GLU A O   
194  C  CB  . GLU A 24  ? 0.0763 0.0562 0.0648 -0.0174 -0.0061 -0.0037 24  GLU A CB  
195  C  CG  . GLU A 24  ? 0.0858 0.0804 0.0817 0.0031  -0.0048 0.0002  24  GLU A CG  
196  C  CD  . GLU A 24  ? 0.1163 0.1046 0.0974 -0.0039 -0.0054 -0.0003 24  GLU A CD  
197  O  OE1 . GLU A 24  ? 0.1554 0.0808 0.1193 -0.0064 -0.0060 -0.0175 24  GLU A OE1 
198  O  OE2 . GLU A 24  ? 0.1560 0.1453 0.1203 0.0037  -0.0138 -0.0079 24  GLU A OE2 
199  N  N   . ILE A 25  ? 0.0451 0.0534 0.0450 -0.0134 0.0013  -0.0019 25  ILE A N   
200  C  CA  . ILE A 25  ? 0.0410 0.0553 0.0342 -0.0151 0.0027  -0.0048 25  ILE A CA  
201  C  C   . ILE A 25  ? 0.0488 0.0514 0.0368 -0.0112 0.0005  -0.0058 25  ILE A C   
202  O  O   . ILE A 25  ? 0.0303 0.0437 0.0161 -0.0184 0.0022  -0.0117 25  ILE A O   
203  C  CB  . ILE A 25  ? 0.0408 0.0602 0.0466 -0.0173 0.0059  -0.0032 25  ILE A CB  
204  C  CG1 . ILE A 25  ? 0.0471 0.0580 0.0521 -0.0130 -0.0013 -0.0078 25  ILE A CG1 
205  C  CG2 . ILE A 25  ? 0.0394 0.0748 0.0403 -0.0178 -0.0024 0.0115  25  ILE A CG2 
206  C  CD1 . ILE A 25  ? 0.0862 0.0557 0.0690 -0.0073 0.0211  0.0019  25  ILE A CD1 
207  N  N   . HIS A 26  ? 0.0410 0.0482 0.0328 -0.0148 -0.0035 -0.0024 26  HIS A N   
208  C  CA  . HIS A 26  ? 0.0493 0.0538 0.0389 -0.0117 0.0037  0.0007  26  HIS A CA  
209  C  C   . HIS A 26  ? 0.0424 0.0453 0.0261 -0.0062 0.0015  0.0012  26  HIS A C   
210  O  O   . HIS A 26  ? 0.0337 0.0434 0.0258 -0.0096 0.0047  0.0030  26  HIS A O   
211  C  CB  . HIS A 26  ? 0.0577 0.0491 0.0322 -0.0126 -0.0027 0.0021  26  HIS A CB  
212  C  CG  . HIS A 26  ? 0.0469 0.0423 0.0378 -0.0079 0.0032  0.0014  26  HIS A CG  
213  N  ND1 . HIS A 26  ? 0.0597 0.0452 0.0413 -0.0141 0.0026  -0.0006 26  HIS A ND1 
214  C  CD2 . HIS A 26  ? 0.0286 0.0336 0.0231 -0.0071 0.0126  0.0032  26  HIS A CD2 
215  C  CE1 . HIS A 26  ? 0.0321 0.0255 0.0254 -0.0192 -0.0010 -0.0001 26  HIS A CE1 
216  N  NE2 . HIS A 26  ? 0.0412 0.0149 0.0323 -0.0154 0.0022  -0.0077 26  HIS A NE2 
217  N  N   . HIS A 27  ? 0.0301 0.0254 0.0184 -0.0003 -0.0016 0.0050  27  HIS A N   
218  C  CA  . HIS A 27  ? 0.0152 0.0190 0.0141 -0.0039 -0.0024 -0.0013 27  HIS A CA  
219  C  C   . HIS A 27  ? 0.0222 0.0249 0.0164 -0.0040 -0.0029 -0.0006 27  HIS A C   
220  O  O   . HIS A 27  ? 0.0181 0.0193 0.0179 -0.0094 -0.0061 -0.0017 27  HIS A O   
221  C  CB  . HIS A 27  ? 0.0198 0.0127 0.0081 -0.0045 -0.0044 0.0028  27  HIS A CB  
222  C  CG  . HIS A 27  ? 0.0161 0.0145 0.0139 -0.0072 -0.0003 -0.0043 27  HIS A CG  
223  N  ND1 . HIS A 27  ? 0.0443 0.0111 0.0171 -0.0125 0.0076  -0.0050 27  HIS A ND1 
224  C  CD2 . HIS A 27  ? 0.0070 0.0063 0.0067 0.0001  0.0005  0.0000  27  HIS A CD2 
225  C  CE1 . HIS A 27  ? 0.0274 0.0098 0.0143 0.0072  -0.0090 -0.0051 27  HIS A CE1 
226  N  NE2 . HIS A 27  ? 0.0512 0.0106 0.0256 0.0023  -0.0092 0.0080  27  HIS A NE2 
227  N  N   . THR A 28  ? 0.0195 0.0172 0.0152 -0.0082 -0.0020 -0.0057 28  THR A N   
228  C  CA  . THR A 28  ? 0.0295 0.0332 0.0137 -0.0023 -0.0021 -0.0017 28  THR A CA  
229  C  C   . THR A 28  ? 0.0287 0.0351 0.0165 -0.0037 -0.0020 -0.0011 28  THR A C   
230  O  O   . THR A 28  ? 0.0361 0.0531 0.0089 -0.0066 -0.0055 -0.0071 28  THR A O   
231  C  CB  . THR A 28  ? 0.0279 0.0204 0.0150 0.0000  -0.0041 0.0035  28  THR A CB  
232  O  OG1 . THR A 28  ? 0.0559 0.0611 0.0187 -0.0003 0.0017  -0.0193 28  THR A OG1 
233  C  CG2 . THR A 28  ? 0.0555 0.0437 0.0306 0.0139  -0.0144 -0.0092 28  THR A CG2 
234  N  N   . LYS A 29  ? 0.0190 0.0488 0.0150 -0.0127 -0.0010 0.0003  29  LYS A N   
235  C  CA  . LYS A 29  ? 0.0271 0.0462 0.0167 -0.0138 0.0010  0.0005  29  LYS A CA  
236  C  C   . LYS A 29  ? 0.0228 0.0465 0.0267 -0.0149 -0.0024 0.0046  29  LYS A C   
237  O  O   . LYS A 29  ? 0.0171 0.0386 0.0249 -0.0131 -0.0114 0.0035  29  LYS A O   
238  C  CB  . LYS A 29  ? 0.0312 0.0580 0.0280 -0.0161 0.0036  0.0050  29  LYS A CB  
239  C  CG  . LYS A 29  ? 0.0455 0.0568 0.0236 -0.0144 -0.0009 0.0012  29  LYS A CG  
240  C  CD  . LYS A 29  ? 0.0746 0.0966 0.0647 -0.0126 -0.0065 0.0160  29  LYS A CD  
241  C  CE  . LYS A 29  ? 0.0955 0.0919 0.0948 0.0020  -0.0026 -0.0016 29  LYS A CE  
242  N  NZ  . LYS A 29  ? 0.1608 0.1592 0.1215 -0.0147 -0.0201 0.0005  29  LYS A NZ  
243  N  N   . HIS A 30  ? 0.0188 0.0333 0.0184 -0.0163 -0.0003 0.0007  30  HIS A N   
244  C  CA  . HIS A 30  ? 0.0148 0.0419 0.0241 -0.0125 -0.0020 0.0036  30  HIS A CA  
245  C  C   . HIS A 30  ? 0.0231 0.0435 0.0287 -0.0091 -0.0018 0.0002  30  HIS A C   
246  O  O   . HIS A 30  ? 0.0145 0.0423 0.0192 -0.0171 -0.0059 0.0137  30  HIS A O   
247  C  CB  . HIS A 30  ? 0.0182 0.0335 0.0142 -0.0101 0.0069  0.0024  30  HIS A CB  
248  C  CG  . HIS A 30  ? 0.0073 0.0348 0.0234 -0.0040 0.0030  -0.0035 30  HIS A CG  
249  N  ND1 . HIS A 30  ? 0.0110 0.0095 0.0420 -0.0037 0.0071  -0.0036 30  HIS A ND1 
250  C  CD2 . HIS A 30  ? 0.0329 0.0174 0.0127 -0.0047 -0.0124 0.0046  30  HIS A CD2 
251  C  CE1 . HIS A 30  ? 0.0369 0.0189 0.0141 0.0075  0.0154  0.0034  30  HIS A CE1 
252  N  NE2 . HIS A 30  ? 0.0221 0.0207 0.0063 -0.0150 -0.0002 0.0002  30  HIS A NE2 
253  N  N   . HIS A 31  ? 0.0121 0.0375 0.0195 -0.0077 -0.0066 -0.0019 31  HIS A N   
254  C  CA  . HIS A 31  ? 0.0222 0.0390 0.0131 -0.0038 -0.0041 0.0000  31  HIS A CA  
255  C  C   . HIS A 31  ? 0.0183 0.0388 0.0167 -0.0009 -0.0040 -0.0013 31  HIS A C   
256  O  O   . HIS A 31  ? 0.0130 0.0347 0.0070 0.0016  -0.0021 -0.0009 31  HIS A O   
257  C  CB  . HIS A 31  ? 0.0073 0.0416 0.0196 -0.0048 -0.0012 -0.0064 31  HIS A CB  
258  C  CG  . HIS A 31  ? 0.0163 0.0236 0.0137 -0.0074 0.0030  0.0064  31  HIS A CG  
259  N  ND1 . HIS A 31  ? 0.0137 0.0312 0.0109 -0.0135 -0.0058 0.0107  31  HIS A ND1 
260  C  CD2 . HIS A 31  ? 0.0131 0.0270 0.0136 -0.0117 -0.0045 0.0090  31  HIS A CD2 
261  C  CE1 . HIS A 31  ? 0.0186 0.0317 0.0150 -0.0019 0.0047  0.0124  31  HIS A CE1 
262  N  NE2 . HIS A 31  ? 0.0111 0.0164 0.0076 0.0069  0.0024  0.0036  31  HIS A NE2 
263  N  N   . GLN A 32  ? 0.0069 0.0303 0.0067 0.0039  -0.0005 -0.0031 32  GLN A N   
264  C  CA  . GLN A 32  ? 0.0063 0.0145 0.0097 0.0006  0.0000  0.0003  32  GLN A CA  
265  C  C   . GLN A 32  ? 0.0064 0.0228 0.0157 0.0006  0.0006  -0.0037 32  GLN A C   
266  O  O   . GLN A 32  ? 0.0111 0.0105 0.0104 0.0034  -0.0027 0.0001  32  GLN A O   
267  C  CB  . GLN A 32  ? 0.0108 0.0186 0.0063 -0.0074 -0.0001 0.0002  32  GLN A CB  
268  C  CG  . GLN A 32  ? 0.0149 0.0183 0.0106 0.0101  0.0005  0.0006  32  GLN A CG  
269  C  CD  . GLN A 32  ? 0.0151 0.0347 0.0142 0.0035  -0.0024 0.0129  32  GLN A CD  
270  O  OE1 . GLN A 32  ? 0.0357 0.0136 0.0191 -0.0113 -0.0145 0.0015  32  GLN A OE1 
271  N  NE2 . GLN A 32  ? 0.0267 0.0167 0.0083 -0.0145 -0.0063 0.0045  32  GLN A NE2 
272  N  N   . THR A 33  ? 0.0078 0.0245 0.0144 0.0011  -0.0034 -0.0026 33  THR A N   
273  C  CA  . THR A 33  ? 0.0126 0.0271 0.0256 -0.0003 0.0064  -0.0104 33  THR A CA  
274  C  C   . THR A 33  ? 0.0082 0.0263 0.0236 0.0002  0.0024  -0.0068 33  THR A C   
275  O  O   . THR A 33  ? 0.0125 0.0345 0.0099 -0.0132 0.0047  -0.0100 33  THR A O   
276  C  CB  . THR A 33  ? 0.0095 0.0289 0.0298 -0.0033 0.0086  -0.0051 33  THR A CB  
277  O  OG1 . THR A 33  ? 0.0152 0.0391 0.0544 -0.0055 0.0114  -0.0201 33  THR A OG1 
278  C  CG2 . THR A 33  ? 0.0209 0.0382 0.0354 0.0101  0.0161  -0.0055 33  THR A CG2 
279  N  N   . TYR A 34  ? 0.0181 0.0315 0.0184 -0.0002 -0.0037 0.0010  34  TYR A N   
280  C  CA  . TYR A 34  ? 0.0228 0.0312 0.0199 0.0000  -0.0017 0.0011  34  TYR A CA  
281  C  C   . TYR A 34  ? 0.0099 0.0321 0.0136 -0.0037 -0.0039 0.0013  34  TYR A C   
282  O  O   . TYR A 34  ? 0.0087 0.0222 0.0088 0.0032  0.0000  0.0053  34  TYR A O   
283  C  CB  . TYR A 34  ? 0.0203 0.0373 0.0242 -0.0041 -0.0033 -0.0018 34  TYR A CB  
284  C  CG  . TYR A 34  ? 0.0242 0.0148 0.0261 -0.0092 -0.0027 -0.0005 34  TYR A CG  
285  C  CD1 . TYR A 34  ? 0.0422 0.0145 0.0145 -0.0169 0.0059  -0.0014 34  TYR A CD1 
286  C  CD2 . TYR A 34  ? 0.0487 0.0385 0.0107 -0.0149 -0.0134 0.0065  34  TYR A CD2 
287  C  CE1 . TYR A 34  ? 0.0486 0.0576 0.0431 -0.0127 0.0010  -0.0016 34  TYR A CE1 
288  C  CE2 . TYR A 34  ? 0.0387 0.0770 0.0241 -0.0082 0.0049  -0.0069 34  TYR A CE2 
289  C  CZ  . TYR A 34  ? 0.0441 0.0563 0.0250 -0.0043 -0.0015 0.0001  34  TYR A CZ  
290  O  OH  . TYR A 34  ? 0.0300 0.0830 0.0308 -0.0330 0.0005  0.0231  34  TYR A OH  
291  N  N   . VAL A 35  ? 0.0081 0.0152 0.0089 -0.0035 -0.0008 0.0037  35  VAL A N   
292  C  CA  . VAL A 35  ? 0.0127 0.0207 0.0120 0.0001  0.0028  -0.0002 35  VAL A CA  
293  C  C   . VAL A 35  ? 0.0136 0.0192 0.0134 -0.0006 -0.0006 -0.0006 35  VAL A C   
294  O  O   . VAL A 35  ? 0.0126 0.0219 0.0164 0.0027  0.0067  -0.0035 35  VAL A O   
295  C  CB  . VAL A 35  ? 0.0066 0.0171 0.0071 -0.0017 -0.0004 0.0030  35  VAL A CB  
296  C  CG1 . VAL A 35  ? 0.0304 0.0215 0.0171 0.0093  0.0155  0.0090  35  VAL A CG1 
297  C  CG2 . VAL A 35  ? 0.0081 0.0082 0.0244 0.0018  0.0057  0.0059  35  VAL A CG2 
298  N  N   . ASN A 36  ? 0.0136 0.0290 0.0260 0.0074  0.0112  0.0053  36  ASN A N   
299  C  CA  . ASN A 36  ? 0.0127 0.0415 0.0195 0.0004  0.0062  0.0044  36  ASN A CA  
300  C  C   . ASN A 36  ? 0.0160 0.0380 0.0258 0.0037  0.0076  0.0053  36  ASN A C   
301  O  O   . ASN A 36  ? 0.0160 0.0363 0.0221 -0.0031 0.0122  -0.0001 36  ASN A O   
302  C  CB  . ASN A 36  ? 0.0069 0.0366 0.0216 0.0042  0.0021  0.0091  36  ASN A CB  
303  C  CG  . ASN A 36  ? 0.0064 0.0478 0.0170 -0.0023 -0.0002 -0.0032 36  ASN A CG  
304  O  OD1 . ASN A 36  ? 0.0162 0.0341 0.0242 -0.0055 -0.0014 -0.0200 36  ASN A OD1 
305  N  ND2 . ASN A 36  ? 0.0063 0.0063 0.0063 0.0000  0.0000  0.0000  36  ASN A ND2 
306  N  N   . ASN A 37  ? 0.0192 0.0340 0.0264 -0.0016 0.0005  0.0021  37  ASN A N   
307  C  CA  . ASN A 37  ? 0.0384 0.0514 0.0397 -0.0004 -0.0016 -0.0006 37  ASN A CA  
308  C  C   . ASN A 37  ? 0.0308 0.0431 0.0380 0.0008  -0.0005 0.0000  37  ASN A C   
309  O  O   . ASN A 37  ? 0.0333 0.0388 0.0467 -0.0094 -0.0118 0.0006  37  ASN A O   
310  C  CB  . ASN A 37  ? 0.0414 0.0648 0.0478 0.0020  0.0045  -0.0057 37  ASN A CB  
311  C  CG  . ASN A 37  ? 0.0670 0.0728 0.0766 -0.0035 0.0012  -0.0050 37  ASN A CG  
312  O  OD1 . ASN A 37  ? 0.0448 0.1002 0.1079 0.0019  -0.0171 -0.0182 37  ASN A OD1 
313  N  ND2 . ASN A 37  ? 0.1039 0.0812 0.0900 -0.0015 0.0128  0.0096  37  ASN A ND2 
314  N  N   . ALA A 38  ? 0.0270 0.0395 0.0339 -0.0005 -0.0043 0.0081  38  ALA A N   
315  C  CA  . ALA A 38  ? 0.0181 0.0355 0.0246 0.0086  0.0007  0.0093  38  ALA A CA  
316  C  C   . ALA A 38  ? 0.0161 0.0378 0.0260 0.0081  0.0020  0.0046  38  ALA A C   
317  O  O   . ALA A 38  ? 0.0133 0.0370 0.0226 0.0088  0.0022  0.0098  38  ALA A O   
318  C  CB  . ALA A 38  ? 0.0167 0.0297 0.0238 0.0042  -0.0043 0.0166  38  ALA A CB  
319  N  N   . ASN A 39  ? 0.0176 0.0364 0.0239 0.0036  0.0093  0.0063  39  ASN A N   
320  C  CA  . ASN A 39  ? 0.0096 0.0382 0.0203 0.0071  0.0060  0.0060  39  ASN A CA  
321  C  C   . ASN A 39  ? 0.0148 0.0333 0.0211 0.0069  0.0058  0.0053  39  ASN A C   
322  O  O   . ASN A 39  ? 0.0127 0.0346 0.0256 0.0088  0.0103  0.0077  39  ASN A O   
323  C  CB  . ASN A 39  ? 0.0127 0.0415 0.0162 0.0083  0.0043  -0.0013 39  ASN A CB  
324  C  CG  . ASN A 39  ? 0.0201 0.0481 0.0128 0.0065  -0.0079 0.0047  39  ASN A CG  
325  O  OD1 . ASN A 39  ? 0.0104 0.0556 0.0220 -0.0099 0.0011  0.0171  39  ASN A OD1 
326  N  ND2 . ASN A 39  ? 0.0072 0.0185 0.0130 0.0032  0.0024  0.0090  39  ASN A ND2 
327  N  N   . ALA A 40  ? 0.0091 0.0255 0.0242 0.0067  0.0043  0.0045  40  ALA A N   
328  C  CA  . ALA A 40  ? 0.0167 0.0367 0.0218 0.0045  0.0001  0.0079  40  ALA A CA  
329  C  C   . ALA A 40  ? 0.0267 0.0445 0.0349 0.0040  0.0006  0.0085  40  ALA A C   
330  O  O   . ALA A 40  ? 0.0178 0.0361 0.0319 0.0017  -0.0018 0.0118  40  ALA A O   
331  C  CB  . ALA A 40  ? 0.0116 0.0373 0.0241 0.0108  0.0078  0.0086  40  ALA A CB  
332  N  N   . ALA A 41  ? 0.0332 0.0456 0.0363 0.0028  -0.0037 0.0046  41  ALA A N   
333  C  CA  . ALA A 41  ? 0.0365 0.0512 0.0443 -0.0044 0.0019  0.0079  41  ALA A CA  
334  C  C   . ALA A 41  ? 0.0462 0.0548 0.0550 -0.0048 0.0011  0.0068  41  ALA A C   
335  O  O   . ALA A 41  ? 0.0692 0.0428 0.0639 -0.0089 0.0057  0.0152  41  ALA A O   
336  C  CB  . ALA A 41  ? 0.0388 0.0483 0.0506 -0.0047 -0.0021 0.0117  41  ALA A CB  
337  N  N   . LEU A 42  ? 0.0337 0.0484 0.0503 -0.0082 0.0088  0.0048  42  LEU A N   
338  C  CA  . LEU A 42  ? 0.0475 0.0617 0.0476 -0.0054 0.0095  0.0071  42  LEU A CA  
339  C  C   . LEU A 42  ? 0.0504 0.0627 0.0518 -0.0029 0.0044  0.0050  42  LEU A C   
340  O  O   . LEU A 42  ? 0.0425 0.0555 0.0337 0.0045  0.0131  0.0101  42  LEU A O   
341  C  CB  . LEU A 42  ? 0.0422 0.0587 0.0464 -0.0079 0.0116  -0.0005 42  LEU A CB  
342  C  CG  . LEU A 42  ? 0.0381 0.0399 0.0460 0.0030  -0.0036 0.0166  42  LEU A CG  
343  C  CD1 . LEU A 42  ? 0.0440 0.0230 0.0445 -0.0011 -0.0038 0.0119  42  LEU A CD1 
344  C  CD2 . LEU A 42  ? 0.0500 0.0624 0.0721 -0.0015 0.0150  0.0176  42  LEU A CD2 
345  N  N   . GLU A 43  ? 0.0539 0.0775 0.0556 -0.0070 0.0050  0.0034  43  GLU A N   
346  C  CA  . GLU A 43  ? 0.0670 0.0788 0.0696 -0.0026 -0.0007 0.0082  43  GLU A CA  
347  C  C   . GLU A 43  ? 0.0768 0.0741 0.0759 -0.0017 -0.0003 0.0037  43  GLU A C   
348  O  O   . GLU A 43  ? 0.0733 0.0638 0.0799 0.0011  -0.0017 0.0041  43  GLU A O   
349  C  CB  . GLU A 43  ? 0.0601 0.0857 0.0679 0.0006  -0.0008 0.0040  43  GLU A CB  
350  C  CG  . GLU A 43  ? 0.0910 0.0897 0.0677 0.0019  -0.0013 0.0048  43  GLU A CG  
351  C  CD  . GLU A 43  ? 0.0789 0.0797 0.0793 0.0203  0.0111  0.0198  43  GLU A CD  
352  O  OE1 . GLU A 43  ? 0.0867 0.0366 0.0461 -0.0037 0.0132  0.0189  43  GLU A OE1 
353  O  OE2 . GLU A 43  ? 0.1119 0.0780 0.0461 0.0231  0.0103  0.0226  43  GLU A OE2 
354  N  N   . SER A 44  ? 0.0948 0.0754 0.0831 0.0001  -0.0003 0.0109  44  SER A N   
355  C  CA  . SER A 44  ? 0.0988 0.0806 0.0991 -0.0016 0.0002  0.0066  44  SER A CA  
356  C  C   . SER A 44  ? 0.1001 0.0876 0.1029 -0.0009 0.0008  0.0077  44  SER A C   
357  O  O   . SER A 44  ? 0.1201 0.1037 0.1207 0.0044  0.0023  0.0006  44  SER A O   
358  C  CB  . SER A 44  ? 0.1012 0.0739 0.0907 -0.0009 0.0020  0.0068  44  SER A CB  
359  O  OG  . SER A 44  ? 0.1264 0.0741 0.1089 0.0078  0.0019  0.0043  44  SER A OG  
360  N  N   . LEU A 45  ? 0.1023 0.0944 0.1004 -0.0014 0.0025  0.0114  45  LEU A N   
361  C  CA  . LEU A 45  ? 0.0996 0.0916 0.0989 -0.0024 0.0020  0.0088  45  LEU A CA  
362  C  C   . LEU A 45  ? 0.1036 0.0985 0.0995 -0.0035 0.0023  0.0075  45  LEU A C   
363  O  O   . LEU A 45  ? 0.1027 0.0863 0.1017 -0.0102 0.0023  0.0112  45  LEU A O   
364  C  CB  . LEU A 45  ? 0.1003 0.0982 0.0948 0.0014  0.0031  0.0078  45  LEU A CB  
365  C  CG  . LEU A 45  ? 0.0981 0.1076 0.0996 0.0005  0.0004  0.0063  45  LEU A CG  
366  C  CD1 . LEU A 45  ? 0.1181 0.1285 0.0979 0.0038  0.0063  0.0058  45  LEU A CD1 
367  C  CD2 . LEU A 45  ? 0.1132 0.1281 0.1392 0.0001  0.0072  0.0017  45  LEU A CD2 
368  N  N   . PRO A 46  ? 0.1099 0.1026 0.1027 -0.0027 0.0064  0.0091  46  PRO A N   
369  C  CA  . PRO A 46  ? 0.1193 0.1035 0.1037 -0.0025 0.0096  0.0107  46  PRO A CA  
370  C  C   . PRO A 46  ? 0.1167 0.1010 0.0964 -0.0043 0.0100  0.0087  46  PRO A C   
371  O  O   . PRO A 46  ? 0.1286 0.1014 0.1118 -0.0047 0.0096  0.0152  46  PRO A O   
372  C  CB  . PRO A 46  ? 0.1307 0.1073 0.1052 0.0006  0.0096  0.0098  46  PRO A CB  
373  C  CG  . PRO A 46  ? 0.1225 0.1057 0.1108 -0.0011 0.0090  0.0069  46  PRO A CG  
374  C  CD  . PRO A 46  ? 0.1058 0.0997 0.1086 -0.0048 0.0044  0.0066  46  PRO A CD  
375  N  N   . GLU A 47  ? 0.1151 0.1046 0.1038 -0.0098 0.0103  0.0121  47  GLU A N   
376  C  CA  . GLU A 47  ? 0.1092 0.1064 0.1075 -0.0069 0.0069  0.0051  47  GLU A CA  
377  C  C   . GLU A 47  ? 0.1035 0.1123 0.1094 -0.0033 0.0063  0.0039  47  GLU A C   
378  O  O   . GLU A 47  ? 0.1184 0.1378 0.1282 -0.0119 0.0083  0.0105  47  GLU A O   
379  C  CB  . GLU A 47  ? 0.1173 0.1158 0.1254 -0.0105 0.0064  0.0072  47  GLU A CB  
380  C  CG  . GLU A 47  ? 0.1417 0.1365 0.1251 -0.0118 0.0046  0.0003  47  GLU A CG  
381  C  CD  . GLU A 47  ? 0.1632 0.1506 0.1729 -0.0026 -0.0009 -0.0021 47  GLU A CD  
382  O  OE1 . GLU A 47  ? 0.1765 0.1617 0.1787 0.0048  -0.0068 -0.0085 47  GLU A OE1 
383  O  OE2 . GLU A 47  ? 0.2036 0.1768 0.1991 -0.0034 0.0059  -0.0108 47  GLU A OE2 
384  N  N   . PHE A 48  ? 0.0988 0.1086 0.1032 -0.0087 0.0055  0.0051  48  PHE A N   
385  C  CA  . PHE A 48  ? 0.0909 0.1021 0.0924 -0.0011 0.0024  0.0001  48  PHE A CA  
386  C  C   . PHE A 48  ? 0.0835 0.1002 0.0903 -0.0001 0.0038  0.0016  48  PHE A C   
387  O  O   . PHE A 48  ? 0.0722 0.1078 0.0892 0.0064  0.0043  -0.0035 48  PHE A O   
388  C  CB  . PHE A 48  ? 0.0839 0.0936 0.0921 -0.0015 0.0084  0.0079  48  PHE A CB  
389  C  CG  . PHE A 48  ? 0.1063 0.1129 0.1024 -0.0011 0.0014  0.0032  48  PHE A CG  
390  C  CD1 . PHE A 48  ? 0.0993 0.1309 0.1259 -0.0088 0.0057  0.0111  48  PHE A CD1 
391  C  CD2 . PHE A 48  ? 0.1142 0.1133 0.1301 -0.0081 0.0044  0.0005  48  PHE A CD2 
392  C  CE1 . PHE A 48  ? 0.1349 0.1346 0.1447 -0.0033 0.0009  0.0072  48  PHE A CE1 
393  C  CE2 . PHE A 48  ? 0.1176 0.1109 0.1277 -0.0052 0.0020  0.0063  48  PHE A CE2 
394  C  CZ  . PHE A 48  ? 0.1122 0.1148 0.1454 -0.0073 0.0000  0.0009  48  PHE A CZ  
395  N  N   . ALA A 49  ? 0.0868 0.1038 0.0877 -0.0020 0.0053  0.0026  49  ALA A N   
396  C  CA  . ALA A 49  ? 0.0794 0.1005 0.0874 -0.0014 0.0070  0.0029  49  ALA A CA  
397  C  C   . ALA A 49  ? 0.0897 0.0998 0.0900 -0.0038 0.0089  0.0006  49  ALA A C   
398  O  O   . ALA A 49  ? 0.0754 0.1132 0.1006 -0.0044 0.0148  0.0078  49  ALA A O   
399  C  CB  . ALA A 49  ? 0.0848 0.0954 0.0830 -0.0035 0.0166  0.0090  49  ALA A CB  
400  N  N   . ASN A 50  ? 0.0820 0.1079 0.0951 -0.0010 0.0018  0.0019  50  ASN A N   
401  C  CA  . ASN A 50  ? 0.1000 0.1087 0.1001 0.0006  0.0040  0.0014  50  ASN A CA  
402  C  C   . ASN A 50  ? 0.0853 0.0987 0.0952 0.0002  0.0059  0.0008  50  ASN A C   
403  O  O   . ASN A 50  ? 0.0804 0.1075 0.1046 0.0044  0.0087  0.0013  50  ASN A O   
404  C  CB  . ASN A 50  ? 0.1125 0.1237 0.1147 -0.0016 0.0069  -0.0009 50  ASN A CB  
405  C  CG  . ASN A 50  ? 0.1461 0.1321 0.1545 -0.0049 0.0071  -0.0027 50  ASN A CG  
406  O  OD1 . ASN A 50  ? 0.1857 0.1806 0.2039 -0.0023 0.0092  -0.0057 50  ASN A OD1 
407  N  ND2 . ASN A 50  ? 0.1598 0.1458 0.1448 0.0039  0.0145  -0.0082 50  ASN A ND2 
408  N  N   . LEU A 51  ? 0.0721 0.0824 0.0836 -0.0039 0.0108  0.0067  51  LEU A N   
409  C  CA  . LEU A 51  ? 0.0637 0.0833 0.0799 -0.0011 0.0134  0.0068  51  LEU A CA  
410  C  C   . LEU A 51  ? 0.0572 0.0768 0.0817 0.0005  0.0086  0.0107  51  LEU A C   
411  O  O   . LEU A 51  ? 0.0397 0.0839 0.0647 0.0060  0.0100  0.0117  51  LEU A O   
412  C  CB  . LEU A 51  ? 0.0658 0.0678 0.0862 -0.0038 0.0135  0.0075  51  LEU A CB  
413  C  CG  . LEU A 51  ? 0.0793 0.0844 0.0959 -0.0059 0.0144  0.0063  51  LEU A CG  
414  C  CD1 . LEU A 51  ? 0.0194 0.0761 0.0964 -0.0116 0.0172  0.0033  51  LEU A CD1 
415  C  CD2 . LEU A 51  ? 0.0529 0.0631 0.1131 0.0070  0.0085  -0.0023 51  LEU A CD2 
416  N  N   . PRO A 52  ? 0.0434 0.0878 0.0770 0.0023  0.0080  0.0096  52  PRO A N   
417  C  CA  . PRO A 52  ? 0.0466 0.0726 0.0710 0.0040  0.0033  0.0042  52  PRO A CA  
418  C  C   . PRO A 52  ? 0.0371 0.0628 0.0547 -0.0025 0.0057  0.0048  52  PRO A C   
419  O  O   . PRO A 52  ? 0.0296 0.0616 0.0403 0.0119  0.0110  0.0031  52  PRO A O   
420  C  CB  . PRO A 52  ? 0.0539 0.0860 0.0709 0.0024  -0.0013 0.0050  52  PRO A CB  
421  C  CG  . PRO A 52  ? 0.0565 0.0787 0.0784 0.0015  0.0047  0.0058  52  PRO A CG  
422  C  CD  . PRO A 52  ? 0.0406 0.0793 0.0805 0.0066  0.0080  0.0069  52  PRO A CD  
423  N  N   . VAL A 53  ? 0.0287 0.0598 0.0376 0.0003  0.0103  0.0014  53  VAL A N   
424  C  CA  . VAL A 53  ? 0.0365 0.0461 0.0481 -0.0018 0.0032  -0.0101 53  VAL A CA  
425  C  C   . VAL A 53  ? 0.0315 0.0437 0.0415 -0.0053 0.0054  0.0008  53  VAL A C   
426  O  O   . VAL A 53  ? 0.0213 0.0435 0.0476 -0.0095 0.0019  -0.0038 53  VAL A O   
427  C  CB  . VAL A 53  ? 0.0332 0.0345 0.0382 -0.0038 0.0131  -0.0071 53  VAL A CB  
428  C  CG1 . VAL A 53  ? 0.0629 0.0601 0.0555 0.0113  -0.0002 -0.0060 53  VAL A CG1 
429  C  CG2 . VAL A 53  ? 0.0288 0.0189 0.0432 0.0065  -0.0045 -0.0209 53  VAL A CG2 
430  N  N   . GLU A 54  ? 0.0488 0.0555 0.0546 -0.0077 0.0041  0.0007  54  GLU A N   
431  C  CA  . GLU A 54  ? 0.0590 0.0557 0.0619 0.0004  0.0040  0.0057  54  GLU A CA  
432  C  C   . GLU A 54  ? 0.0572 0.0601 0.0677 0.0020  0.0045  0.0020  54  GLU A C   
433  O  O   . GLU A 54  ? 0.0687 0.0741 0.0792 0.0029  0.0067  0.0058  54  GLU A O   
434  C  CB  . GLU A 54  ? 0.0460 0.0516 0.0541 -0.0017 0.0034  0.0062  54  GLU A CB  
435  C  CG  . GLU A 54  ? 0.0420 0.0367 0.0525 0.0052  0.0037  0.0090  54  GLU A CG  
436  C  CD  . GLU A 54  ? 0.0437 0.0193 0.0446 0.0047  0.0027  0.0066  54  GLU A CD  
437  O  OE1 . GLU A 54  ? 0.0608 0.0136 0.0396 0.0143  0.0075  -0.0087 54  GLU A OE1 
438  O  OE2 . GLU A 54  ? 0.0296 0.0638 0.0540 0.0000  0.0020  -0.0001 54  GLU A OE2 
439  N  N   . GLU A 55  ? 0.0680 0.0629 0.0766 0.0075  0.0065  0.0058  55  GLU A N   
440  C  CA  . GLU A 55  ? 0.0612 0.0634 0.0761 0.0033  0.0091  0.0051  55  GLU A CA  
441  C  C   . GLU A 55  ? 0.0645 0.0683 0.0723 0.0010  0.0069  0.0072  55  GLU A C   
442  O  O   . GLU A 55  ? 0.0542 0.0501 0.0546 0.0002  0.0109  0.0078  55  GLU A O   
443  C  CB  . GLU A 55  ? 0.0629 0.0542 0.0729 0.0093  0.0110  0.0017  55  GLU A CB  
444  C  CG  . GLU A 55  ? 0.0818 0.0865 0.1113 0.0060  0.0164  0.0017  55  GLU A CG  
445  C  CD  . GLU A 55  ? 0.1192 0.1108 0.1306 -0.0010 0.0193  0.0111  55  GLU A CD  
446  O  OE1 . GLU A 55  ? 0.1156 0.1396 0.1589 -0.0144 0.0322  -0.0101 55  GLU A OE1 
447  O  OE2 . GLU A 55  ? 0.0844 0.0965 0.1406 -0.0101 0.0383  0.0188  55  GLU A OE2 
448  N  N   . LEU A 56  ? 0.0508 0.0655 0.0755 -0.0014 0.0064  0.0092  56  LEU A N   
449  C  CA  . LEU A 56  ? 0.0524 0.0688 0.0823 -0.0020 0.0038  0.0019  56  LEU A CA  
450  C  C   . LEU A 56  ? 0.0390 0.0607 0.0755 -0.0026 -0.0009 0.0011  56  LEU A C   
451  O  O   . LEU A 56  ? 0.0402 0.0624 0.0901 -0.0112 0.0001  -0.0058 56  LEU A O   
452  C  CB  . LEU A 56  ? 0.0535 0.0705 0.0825 -0.0054 0.0059  0.0044  56  LEU A CB  
453  C  CG  . LEU A 56  ? 0.0960 0.0994 0.1189 0.0047  0.0069  0.0080  56  LEU A CG  
454  C  CD1 . LEU A 56  ? 0.1082 0.0808 0.1323 0.0070  0.0062  0.0015  56  LEU A CD1 
455  C  CD2 . LEU A 56  ? 0.1222 0.1308 0.1311 -0.0020 0.0054  -0.0075 56  LEU A CD2 
456  N  N   . ILE A 57  ? 0.0354 0.0564 0.0713 -0.0048 -0.0044 -0.0022 57  ILE A N   
457  C  CA  . ILE A 57  ? 0.0302 0.0463 0.0572 -0.0013 -0.0027 -0.0015 57  ILE A CA  
458  C  C   . ILE A 57  ? 0.0452 0.0526 0.0633 -0.0049 -0.0024 -0.0045 57  ILE A C   
459  O  O   . ILE A 57  ? 0.0379 0.0494 0.0617 -0.0104 0.0056  -0.0009 57  ILE A O   
460  C  CB  . ILE A 57  ? 0.0194 0.0364 0.0528 -0.0027 -0.0051 -0.0022 57  ILE A CB  
461  C  CG1 . ILE A 57  ? 0.0248 0.0500 0.0345 0.0051  -0.0133 -0.0123 57  ILE A CG1 
462  C  CG2 . ILE A 57  ? 0.0064 0.0267 0.0260 0.0012  -0.0005 -0.0180 57  ILE A CG2 
463  C  CD1 . ILE A 57  ? 0.0548 0.0810 0.0378 0.0124  0.0103  -0.0135 57  ILE A CD1 
464  N  N   . THR A 58  ? 0.0570 0.0686 0.0707 -0.0106 0.0007  -0.0014 58  THR A N   
465  C  CA  . THR A 58  ? 0.0739 0.0847 0.0804 -0.0100 -0.0013 -0.0049 58  THR A CA  
466  C  C   . THR A 58  ? 0.0797 0.0857 0.0842 -0.0131 0.0010  -0.0047 58  THR A C   
467  O  O   . THR A 58  ? 0.0901 0.0863 0.1128 -0.0220 0.0063  -0.0030 58  THR A O   
468  C  CB  . THR A 58  ? 0.0674 0.0853 0.0719 -0.0169 -0.0004 -0.0038 58  THR A CB  
469  O  OG1 . THR A 58  ? 0.0928 0.1259 0.0836 -0.0215 0.0051  -0.0129 58  THR A OG1 
470  C  CG2 . THR A 58  ? 0.0692 0.1029 0.0841 -0.0039 -0.0056 -0.0004 58  THR A CG2 
471  N  N   . LYS A 59  ? 0.0838 0.0749 0.0867 -0.0083 0.0033  0.0013  59  LYS A N   
472  C  CA  . LYS A 59  ? 0.0829 0.0796 0.0841 -0.0065 0.0011  0.0008  59  LYS A CA  
473  C  C   . LYS A 59  ? 0.0774 0.0765 0.0778 -0.0088 0.0019  0.0011  59  LYS A C   
474  O  O   . LYS A 59  ? 0.0828 0.0797 0.0889 -0.0089 0.0085  0.0028  59  LYS A O   
475  C  CB  . LYS A 59  ? 0.0861 0.0868 0.0971 -0.0065 0.0036  0.0036  59  LYS A CB  
476  C  CG  . LYS A 59  ? 0.0919 0.0972 0.0995 -0.0054 -0.0017 0.0000  59  LYS A CG  
477  C  CD  . LYS A 59  ? 0.0877 0.1057 0.1101 -0.0074 0.0048  0.0037  59  LYS A CD  
478  C  CE  . LYS A 59  ? 0.1104 0.1051 0.1157 -0.0019 0.0144  0.0010  59  LYS A CE  
479  N  NZ  . LYS A 59  ? 0.1129 0.0651 0.1348 -0.0166 0.0054  0.0127  59  LYS A NZ  
480  N  N   . LEU A 60  ? 0.0740 0.0718 0.0839 -0.0116 0.0033  0.0036  60  LEU A N   
481  C  CA  . LEU A 60  ? 0.0712 0.0689 0.0758 -0.0132 0.0063  0.0043  60  LEU A CA  
482  C  C   . LEU A 60  ? 0.0766 0.0771 0.0830 -0.0090 0.0071  0.0073  60  LEU A C   
483  O  O   . LEU A 60  ? 0.0688 0.0622 0.0810 -0.0164 0.0113  0.0152  60  LEU A O   
484  C  CB  . LEU A 60  ? 0.0729 0.0710 0.0751 -0.0106 0.0085  0.0020  60  LEU A CB  
485  C  CG  . LEU A 60  ? 0.0666 0.0662 0.0511 -0.0059 0.0079  -0.0022 60  LEU A CG  
486  C  CD1 . LEU A 60  ? 0.0557 0.0618 0.0578 -0.0125 -0.0018 0.0171  60  LEU A CD1 
487  C  CD2 . LEU A 60  ? 0.0479 0.0284 0.0379 -0.0056 -0.0018 0.0246  60  LEU A CD2 
488  N  N   . ASP A 61  ? 0.0896 0.0726 0.0881 -0.0162 0.0015  0.0068  61  ASP A N   
489  C  CA  . ASP A 61  ? 0.1045 0.0864 0.1057 -0.0071 -0.0005 0.0051  61  ASP A CA  
490  C  C   . ASP A 61  ? 0.1088 0.0883 0.1057 -0.0066 0.0010  0.0038  61  ASP A C   
491  O  O   . ASP A 61  ? 0.1257 0.0988 0.1135 -0.0101 -0.0012 0.0089  61  ASP A O   
492  C  CB  . ASP A 61  ? 0.1182 0.0949 0.1094 -0.0150 -0.0030 -0.0009 61  ASP A CB  
493  C  CG  . ASP A 61  ? 0.1615 0.1463 0.1530 -0.0023 -0.0028 -0.0011 61  ASP A CG  
494  O  OD1 . ASP A 61  ? 0.2266 0.2173 0.1830 -0.0060 -0.0156 -0.0005 61  ASP A OD1 
495  O  OD2 . ASP A 61  ? 0.1722 0.2058 0.1651 -0.0012 0.0131  -0.0071 61  ASP A OD2 
496  N  N   . GLN A 62  ? 0.1034 0.0961 0.1045 -0.0132 0.0034  0.0082  62  GLN A N   
497  C  CA  . GLN A 62  ? 0.1013 0.0929 0.1060 -0.0109 0.0023  0.0095  62  GLN A CA  
498  C  C   . GLN A 62  ? 0.1029 0.1017 0.1067 -0.0126 0.0042  0.0145  62  GLN A C   
499  O  O   . GLN A 62  ? 0.1245 0.0843 0.1153 -0.0142 0.0111  0.0183  62  GLN A O   
500  C  CB  . GLN A 62  ? 0.0976 0.1085 0.1124 -0.0103 0.0035  0.0131  62  GLN A CB  
501  C  CG  . GLN A 62  ? 0.1058 0.0958 0.1014 -0.0127 0.0011  0.0195  62  GLN A CG  
502  C  CD  . GLN A 62  ? 0.1403 0.1368 0.1298 -0.0026 0.0000  0.0084  62  GLN A CD  
503  O  OE1 . GLN A 62  ? 0.1791 0.1948 0.1596 -0.0095 -0.0053 0.0021  62  GLN A OE1 
504  N  NE2 . GLN A 62  ? 0.1393 0.1619 0.1532 -0.0098 -0.0049 0.0023  62  GLN A NE2 
505  N  N   . LEU A 63  ? 0.0940 0.0920 0.1069 -0.0131 0.0096  0.0137  63  LEU A N   
506  C  CA  . LEU A 63  ? 0.0845 0.0833 0.1021 -0.0147 0.0100  0.0131  63  LEU A CA  
507  C  C   . LEU A 63  ? 0.0863 0.0911 0.1073 -0.0097 0.0092  0.0090  63  LEU A C   
508  O  O   . LEU A 63  ? 0.0714 0.0929 0.1173 -0.0156 0.0149  0.0045  63  LEU A O   
509  C  CB  . LEU A 63  ? 0.0723 0.0853 0.1044 -0.0112 0.0084  0.0143  63  LEU A CB  
510  C  CG  . LEU A 63  ? 0.0929 0.0902 0.1016 -0.0151 0.0109  0.0045  63  LEU A CG  
511  C  CD1 . LEU A 63  ? 0.0941 0.0856 0.0851 -0.0187 0.0046  0.0106  63  LEU A CD1 
512  C  CD2 . LEU A 63  ? 0.0942 0.0994 0.1111 0.0004  0.0052  0.0033  63  LEU A CD2 
513  N  N   . PRO A 64  ? 0.0994 0.0920 0.1134 -0.0071 0.0074  0.0092  64  PRO A N   
514  C  CA  . PRO A 64  ? 0.1053 0.0861 0.1141 -0.0038 0.0053  0.0070  64  PRO A CA  
515  C  C   . PRO A 64  ? 0.1118 0.0837 0.1127 -0.0044 0.0051  0.0033  64  PRO A C   
516  O  O   . PRO A 64  ? 0.1141 0.0613 0.1137 -0.0044 0.0055  0.0083  64  PRO A O   
517  C  CB  . PRO A 64  ? 0.1159 0.0891 0.1181 -0.0017 0.0019  0.0072  64  PRO A CB  
518  C  CG  . PRO A 64  ? 0.1046 0.0988 0.1098 -0.0062 0.0086  0.0084  64  PRO A CG  
519  C  CD  . PRO A 64  ? 0.1019 0.0919 0.1155 -0.0078 0.0064  0.0086  64  PRO A CD  
520  N  N   . ALA A 65  ? 0.1144 0.0795 0.1177 -0.0081 0.0065  -0.0004 65  ALA A N   
521  C  CA  . ALA A 65  ? 0.1205 0.0887 0.1156 -0.0020 0.0063  -0.0029 65  ALA A CA  
522  C  C   . ALA A 65  ? 0.1189 0.0872 0.1108 -0.0004 0.0024  -0.0009 65  ALA A C   
523  O  O   . ALA A 65  ? 0.1285 0.0871 0.1185 0.0004  0.0075  -0.0027 65  ALA A O   
524  C  CB  . ALA A 65  ? 0.1186 0.0889 0.1223 -0.0068 0.0045  -0.0039 65  ALA A CB  
525  N  N   . ASP A 66  ? 0.1145 0.0851 0.1063 0.0009  0.0015  -0.0024 66  ASP A N   
526  C  CA  . ASP A 66  ? 0.1139 0.0917 0.1068 0.0008  -0.0004 -0.0006 66  ASP A CA  
527  C  C   . ASP A 66  ? 0.0973 0.0766 0.0928 0.0002  -0.0016 0.0044  66  ASP A C   
528  O  O   . ASP A 66  ? 0.0996 0.0830 0.1009 0.0048  -0.0051 0.0013  66  ASP A O   
529  C  CB  . ASP A 66  ? 0.1215 0.0993 0.1142 0.0001  -0.0006 0.0050  66  ASP A CB  
530  C  CG  . ASP A 66  ? 0.1394 0.1322 0.1271 0.0027  -0.0016 0.0006  66  ASP A CG  
531  O  OD1 . ASP A 66  ? 0.1680 0.1499 0.1670 0.0081  -0.0160 0.0098  66  ASP A OD1 
532  O  OD2 . ASP A 66  ? 0.1670 0.1240 0.1603 0.0154  -0.0074 0.0019  66  ASP A OD2 
533  N  N   . LYS A 67  ? 0.0858 0.0709 0.0853 -0.0054 -0.0011 0.0033  67  LYS A N   
534  C  CA  . LYS A 67  ? 0.0725 0.0598 0.0829 -0.0025 0.0043  0.0046  67  LYS A CA  
535  C  C   . LYS A 67  ? 0.0690 0.0632 0.0820 -0.0029 0.0050  0.0005  67  LYS A C   
536  O  O   . LYS A 67  ? 0.0668 0.0417 0.0879 -0.0024 0.0166  0.0091  67  LYS A O   
537  C  CB  . LYS A 67  ? 0.0832 0.0659 0.0778 -0.0009 -0.0003 0.0049  67  LYS A CB  
538  C  CG  . LYS A 67  ? 0.0760 0.0819 0.0849 -0.0045 -0.0075 0.0095  67  LYS A CG  
539  C  CD  . LYS A 67  ? 0.1055 0.0710 0.0959 -0.0038 -0.0085 0.0012  67  LYS A CD  
540  C  CE  . LYS A 67  ? 0.1197 0.0925 0.1052 0.0086  -0.0106 -0.0016 67  LYS A CE  
541  N  NZ  . LYS A 67  ? 0.0862 0.0898 0.1596 0.0131  -0.0180 0.0152  67  LYS A NZ  
542  N  N   . LYS A 68  ? 0.0636 0.0650 0.0838 -0.0041 0.0062  0.0019  68  LYS A N   
543  C  CA  . LYS A 68  ? 0.0654 0.0647 0.0781 -0.0033 0.0081  0.0045  68  LYS A CA  
544  C  C   . LYS A 68  ? 0.0574 0.0561 0.0700 -0.0016 0.0056  0.0051  68  LYS A C   
545  O  O   . LYS A 68  ? 0.0635 0.0673 0.0754 -0.0058 0.0116  0.0070  68  LYS A O   
546  C  CB  . LYS A 68  ? 0.0686 0.0689 0.0746 -0.0076 -0.0019 0.0062  68  LYS A CB  
547  C  CG  . LYS A 68  ? 0.0974 0.1085 0.1306 -0.0072 0.0035  0.0052  68  LYS A CG  
548  C  CD  . LYS A 68  ? 0.1532 0.1452 0.1239 -0.0011 0.0044  0.0065  68  LYS A CD  
549  C  CE  . LYS A 68  ? 0.1593 0.1432 0.1581 -0.0046 0.0090  -0.0070 68  LYS A CE  
550  N  NZ  . LYS A 68  ? 0.1711 0.1563 0.1702 -0.0083 -0.0010 -0.0052 68  LYS A NZ  
551  N  N   . THR A 69  ? 0.0521 0.0452 0.0549 -0.0018 0.0115  0.0055  69  THR A N   
552  C  CA  . THR A 69  ? 0.0445 0.0393 0.0395 -0.0009 0.0060  -0.0007 69  THR A CA  
553  C  C   . THR A 69  ? 0.0389 0.0385 0.0481 0.0035  0.0071  -0.0010 69  THR A C   
554  O  O   . THR A 69  ? 0.0444 0.0334 0.0521 0.0130  0.0132  -0.0099 69  THR A O   
555  C  CB  . THR A 69  ? 0.0382 0.0344 0.0403 -0.0041 0.0038  0.0039  69  THR A CB  
556  O  OG1 . THR A 69  ? 0.0208 0.0256 0.0092 0.0070  0.0060  0.0055  69  THR A OG1 
557  C  CG2 . THR A 69  ? 0.0428 0.0496 0.0362 -0.0074 0.0116  0.0015  69  THR A CG2 
558  N  N   . VAL A 70  ? 0.0341 0.0469 0.0506 0.0091  0.0073  -0.0025 70  VAL A N   
559  C  CA  . VAL A 70  ? 0.0336 0.0347 0.0567 0.0089  0.0019  0.0010  70  VAL A CA  
560  C  C   . VAL A 70  ? 0.0230 0.0334 0.0498 0.0065  0.0056  0.0012  70  VAL A C   
561  O  O   . VAL A 70  ? 0.0069 0.0308 0.0464 0.0007  0.0050  -0.0004 70  VAL A O   
562  C  CB  . VAL A 70  ? 0.0450 0.0435 0.0567 0.0086  -0.0024 -0.0016 70  VAL A CB  
563  C  CG1 . VAL A 70  ? 0.0549 0.0408 0.0814 0.0011  -0.0017 -0.0013 70  VAL A CG1 
564  C  CG2 . VAL A 70  ? 0.0705 0.0426 0.0751 0.0089  0.0005  0.0117  70  VAL A CG2 
565  N  N   . LEU A 71  ? 0.0173 0.0225 0.0359 0.0034  0.0084  0.0045  71  LEU A N   
566  C  CA  . LEU A 71  ? 0.0170 0.0218 0.0303 -0.0022 0.0063  0.0063  71  LEU A CA  
567  C  C   . LEU A 71  ? 0.0162 0.0268 0.0281 -0.0042 0.0065  0.0073  71  LEU A C   
568  O  O   . LEU A 71  ? 0.0101 0.0369 0.0307 -0.0046 0.0035  0.0049  71  LEU A O   
569  C  CB  . LEU A 71  ? 0.0103 0.0154 0.0245 0.0012  0.0071  -0.0048 71  LEU A CB  
570  C  CG  . LEU A 71  ? 0.0122 0.0139 0.0172 0.0053  0.0067  0.0091  71  LEU A CG  
571  C  CD1 . LEU A 71  ? 0.0427 0.0147 0.0326 0.0067  0.0209  0.0139  71  LEU A CD1 
572  C  CD2 . LEU A 71  ? 0.0222 0.0389 0.0261 -0.0115 0.0106  0.0097  71  LEU A CD2 
573  N  N   . ARG A 72  ? 0.0133 0.0203 0.0257 0.0000  0.0089  0.0106  72  ARG A N   
574  C  CA  . ARG A 72  ? 0.0199 0.0290 0.0243 -0.0068 0.0062  0.0024  72  ARG A CA  
575  C  C   . ARG A 72  ? 0.0194 0.0331 0.0237 -0.0056 0.0083  0.0014  72  ARG A C   
576  O  O   . ARG A 72  ? 0.0277 0.0279 0.0211 -0.0113 0.0118  0.0051  72  ARG A O   
577  C  CB  . ARG A 72  ? 0.0320 0.0327 0.0297 -0.0036 0.0083  0.0066  72  ARG A CB  
578  C  CG  . ARG A 72  ? 0.0439 0.0408 0.0309 -0.0071 -0.0101 -0.0071 72  ARG A CG  
579  C  CD  . ARG A 72  ? 0.0816 0.0552 0.0534 0.0019  -0.0067 -0.0003 72  ARG A CD  
580  N  NE  . ARG A 72  ? 0.0902 0.0391 0.0514 -0.0234 -0.0001 -0.0057 72  ARG A NE  
581  C  CZ  . ARG A 72  ? 0.0886 0.0346 0.0625 -0.0036 -0.0019 -0.0057 72  ARG A CZ  
582  N  NH1 . ARG A 72  ? 0.0839 0.0483 0.0919 -0.0183 0.0160  0.0041  72  ARG A NH1 
583  N  NH2 . ARG A 72  ? 0.0356 0.0083 0.0443 -0.0075 0.0168  -0.0044 72  ARG A NH2 
584  N  N   . ASN A 73  ? 0.0174 0.0280 0.0258 -0.0070 0.0114  0.0042  73  ASN A N   
585  C  CA  . ASN A 73  ? 0.0180 0.0283 0.0342 -0.0047 0.0069  0.0006  73  ASN A CA  
586  C  C   . ASN A 73  ? 0.0087 0.0277 0.0317 -0.0002 0.0077  0.0016  73  ASN A C   
587  O  O   . ASN A 73  ? 0.0078 0.0312 0.0410 -0.0014 0.0072  -0.0007 73  ASN A O   
588  C  CB  . ASN A 73  ? 0.0137 0.0220 0.0264 -0.0031 0.0095  0.0064  73  ASN A CB  
589  C  CG  . ASN A 73  ? 0.0224 0.0112 0.0410 -0.0086 0.0068  -0.0008 73  ASN A CG  
590  O  OD1 . ASN A 73  ? 0.0254 0.0078 0.0272 -0.0054 0.0200  -0.0056 73  ASN A OD1 
591  N  ND2 . ASN A 73  ? 0.0148 0.0089 0.0659 -0.0041 0.0119  -0.0004 73  ASN A ND2 
592  N  N   . ASN A 74  ? 0.0070 0.0308 0.0337 0.0006  0.0043  0.0065  74  ASN A N   
593  C  CA  . ASN A 74  ? 0.0116 0.0366 0.0296 0.0015  0.0013  0.0050  74  ASN A CA  
594  C  C   . ASN A 74  ? 0.0157 0.0406 0.0276 0.0004  0.0062  0.0026  74  ASN A C   
595  O  O   . ASN A 74  ? 0.0168 0.0512 0.0297 0.0042  -0.0062 0.0006  74  ASN A O   
596  C  CB  . ASN A 74  ? 0.0192 0.0356 0.0302 0.0043  0.0034  0.0128  74  ASN A CB  
597  C  CG  . ASN A 74  ? 0.0168 0.0471 0.0535 -0.0034 -0.0016 0.0075  74  ASN A CG  
598  O  OD1 . ASN A 74  ? 0.0225 0.0202 0.0796 0.0098  0.0044  -0.0038 74  ASN A OD1 
599  N  ND2 . ASN A 74  ? 0.0169 0.0580 0.0845 -0.0062 0.0045  -0.0046 74  ASN A ND2 
600  N  N   . ALA A 75  ? 0.0200 0.0442 0.0348 0.0027  0.0054  -0.0009 75  ALA A N   
601  C  CA  . ALA A 75  ? 0.0095 0.0329 0.0291 -0.0002 0.0055  0.0020  75  ALA A CA  
602  C  C   . ALA A 75  ? 0.0094 0.0346 0.0275 -0.0077 0.0038  0.0030  75  ALA A C   
603  O  O   . ALA A 75  ? 0.0095 0.0320 0.0229 -0.0079 0.0008  0.0081  75  ALA A O   
604  C  CB  . ALA A 75  ? 0.0268 0.0447 0.0349 0.0025  0.0100  0.0091  75  ALA A CB  
605  N  N   . GLY A 76  ? 0.0110 0.0282 0.0210 -0.0101 -0.0009 0.0016  76  GLY A N   
606  C  CA  . GLY A 76  ? 0.0118 0.0197 0.0168 -0.0082 -0.0033 0.0079  76  GLY A CA  
607  C  C   . GLY A 76  ? 0.0214 0.0332 0.0313 -0.0077 -0.0029 0.0024  76  GLY A C   
608  O  O   . GLY A 76  ? 0.0256 0.0204 0.0219 -0.0151 -0.0024 0.0078  76  GLY A O   
609  N  N   . GLY A 77  ? 0.0220 0.0359 0.0196 -0.0170 0.0004  0.0024  77  GLY A N   
610  C  CA  . GLY A 77  ? 0.0157 0.0246 0.0101 -0.0130 0.0027  -0.0031 77  GLY A CA  
611  C  C   . GLY A 77  ? 0.0162 0.0339 0.0199 -0.0080 0.0002  -0.0017 77  GLY A C   
612  O  O   . GLY A 77  ? 0.0078 0.0108 0.0086 -0.0025 -0.0018 0.0032  77  GLY A O   
613  N  N   . HIS A 78  ? 0.0118 0.0282 0.0115 -0.0073 -0.0053 0.0062  78  HIS A N   
614  C  CA  . HIS A 78  ? 0.0138 0.0348 0.0116 0.0000  0.0022  0.0060  78  HIS A CA  
615  C  C   . HIS A 78  ? 0.0135 0.0315 0.0170 0.0002  0.0045  0.0028  78  HIS A C   
616  O  O   . HIS A 78  ? 0.0128 0.0308 0.0154 -0.0069 0.0063  0.0003  78  HIS A O   
617  C  CB  . HIS A 78  ? 0.0323 0.0337 0.0165 0.0041  0.0045  0.0067  78  HIS A CB  
618  C  CG  . HIS A 78  ? 0.0135 0.0303 0.0250 0.0034  -0.0028 -0.0092 78  HIS A CG  
619  N  ND1 . HIS A 78  ? 0.0113 0.0159 0.0099 -0.0069 -0.0042 0.0059  78  HIS A ND1 
620  C  CD2 . HIS A 78  ? 0.0066 0.0090 0.0114 -0.0008 -0.0011 0.0037  78  HIS A CD2 
621  C  CE1 . HIS A 78  ? 0.0246 0.0116 0.0376 0.0033  -0.0023 0.0116  78  HIS A CE1 
622  N  NE2 . HIS A 78  ? 0.0111 0.0301 0.0206 -0.0071 0.0028  0.0087  78  HIS A NE2 
623  N  N   . ALA A 79  ? 0.0139 0.0370 0.0209 -0.0014 0.0017  0.0056  79  ALA A N   
624  C  CA  . ALA A 79  ? 0.0189 0.0197 0.0205 -0.0007 -0.0039 0.0126  79  ALA A CA  
625  C  C   . ALA A 79  ? 0.0286 0.0410 0.0157 0.0007  -0.0021 0.0089  79  ALA A C   
626  O  O   . ALA A 79  ? 0.0262 0.0339 0.0150 -0.0036 -0.0131 0.0041  79  ALA A O   
627  C  CB  . ALA A 79  ? 0.0118 0.0225 0.0189 -0.0062 -0.0083 0.0107  79  ALA A CB  
628  N  N   . ASN A 80  ? 0.0226 0.0343 0.0171 -0.0015 -0.0006 0.0125  80  ASN A N   
629  C  CA  . ASN A 80  ? 0.0228 0.0380 0.0095 0.0027  0.0005  0.0055  80  ASN A CA  
630  C  C   . ASN A 80  ? 0.0203 0.0434 0.0178 -0.0002 0.0060  0.0038  80  ASN A C   
631  O  O   . ASN A 80  ? 0.0168 0.0494 0.0148 -0.0090 0.0084  0.0004  80  ASN A O   
632  C  CB  . ASN A 80  ? 0.0166 0.0329 0.0094 0.0047  0.0050  0.0063  80  ASN A CB  
633  C  CG  . ASN A 80  ? 0.0233 0.0424 0.0223 0.0018  0.0072  0.0061  80  ASN A CG  
634  O  OD1 . ASN A 80  ? 0.0132 0.0313 0.0063 -0.0131 -0.0002 0.0003  80  ASN A OD1 
635  N  ND2 . ASN A 80  ? 0.0207 0.0158 0.0399 0.0065  0.0073  0.0077  80  ASN A ND2 
636  N  N   . HIS A 81  ? 0.0198 0.0468 0.0273 -0.0067 0.0022  -0.0022 81  HIS A N   
637  C  CA  . HIS A 81  ? 0.0220 0.0422 0.0346 -0.0046 -0.0044 0.0021  81  HIS A CA  
638  C  C   . HIS A 81  ? 0.0134 0.0313 0.0256 -0.0061 -0.0102 0.0006  81  HIS A C   
639  O  O   . HIS A 81  ? 0.0095 0.0264 0.0292 -0.0023 -0.0078 0.0137  81  HIS A O   
640  C  CB  . HIS A 81  ? 0.0166 0.0343 0.0295 -0.0012 -0.0021 -0.0014 81  HIS A CB  
641  C  CG  . HIS A 81  ? 0.0350 0.0279 0.0222 -0.0170 0.0131  0.0028  81  HIS A CG  
642  N  ND1 . HIS A 81  ? 0.0099 0.0258 0.0304 -0.0053 0.0063  0.0026  81  HIS A ND1 
643  C  CD2 . HIS A 81  ? 0.0222 0.0349 0.0179 -0.0081 0.0129  -0.0014 81  HIS A CD2 
644  C  CE1 . HIS A 81  ? 0.0506 0.0466 0.0141 -0.0057 0.0123  -0.0108 81  HIS A CE1 
645  N  NE2 . HIS A 81  ? 0.0456 0.0100 0.0152 -0.0120 0.0187  -0.0057 81  HIS A NE2 
646  N  N   . SER A 82  ? 0.0177 0.0278 0.0221 -0.0043 -0.0109 0.0024  82  SER A N   
647  C  CA  . SER A 82  ? 0.0232 0.0263 0.0267 -0.0057 -0.0104 0.0016  82  SER A CA  
648  C  C   . SER A 82  ? 0.0310 0.0236 0.0236 -0.0032 -0.0068 0.0045  82  SER A C   
649  O  O   . SER A 82  ? 0.0298 0.0176 0.0204 0.0061  -0.0179 -0.0025 82  SER A O   
650  C  CB  . SER A 82  ? 0.0205 0.0194 0.0142 -0.0011 -0.0095 0.0051  82  SER A CB  
651  O  OG  . SER A 82  ? 0.0259 0.0412 0.0216 0.0009  0.0011  -0.0001 82  SER A OG  
652  N  N   . LEU A 83  ? 0.0432 0.0192 0.0286 -0.0019 -0.0115 0.0066  83  LEU A N   
653  C  CA  . LEU A 83  ? 0.0407 0.0257 0.0368 -0.0060 -0.0091 0.0046  83  LEU A CA  
654  C  C   . LEU A 83  ? 0.0437 0.0252 0.0336 -0.0047 -0.0113 0.0032  83  LEU A C   
655  O  O   . LEU A 83  ? 0.0399 0.0072 0.0244 -0.0054 -0.0247 0.0040  83  LEU A O   
656  C  CB  . LEU A 83  ? 0.0466 0.0127 0.0347 -0.0035 -0.0023 0.0089  83  LEU A CB  
657  C  CG  . LEU A 83  ? 0.0318 0.0230 0.0436 -0.0200 -0.0103 0.0024  83  LEU A CG  
658  C  CD1 . LEU A 83  ? 0.0836 0.0423 0.0924 -0.0241 -0.0155 -0.0115 83  LEU A CD1 
659  C  CD2 . LEU A 83  ? 0.0793 0.0589 0.0592 -0.0045 -0.0058 0.0106  83  LEU A CD2 
660  N  N   . PHE A 84  ? 0.0415 0.0133 0.0308 -0.0073 -0.0098 -0.0046 84  PHE A N   
661  C  CA  . PHE A 84  ? 0.0537 0.0421 0.0385 -0.0056 -0.0028 0.0006  84  PHE A CA  
662  C  C   . PHE A 84  ? 0.0474 0.0404 0.0344 -0.0043 -0.0001 -0.0018 84  PHE A C   
663  O  O   . PHE A 84  ? 0.0585 0.0489 0.0274 -0.0037 0.0044  -0.0029 84  PHE A O   
664  C  CB  . PHE A 84  ? 0.0498 0.0419 0.0546 -0.0100 -0.0018 -0.0007 84  PHE A CB  
665  C  CG  . PHE A 84  ? 0.0525 0.0292 0.0398 -0.0075 -0.0021 0.0038  84  PHE A CG  
666  C  CD1 . PHE A 84  ? 0.0389 0.0295 0.0469 -0.0263 -0.0023 -0.0069 84  PHE A CD1 
667  C  CD2 . PHE A 84  ? 0.0545 0.0198 0.0614 -0.0042 0.0027  0.0004  84  PHE A CD2 
668  C  CE1 . PHE A 84  ? 0.0507 0.0395 0.0491 -0.0183 -0.0113 -0.0027 84  PHE A CE1 
669  C  CE2 . PHE A 84  ? 0.0458 0.0209 0.0459 -0.0024 0.0053  0.0078  84  PHE A CE2 
670  C  CZ  . PHE A 84  ? 0.0406 0.0220 0.0580 -0.0124 0.0018  -0.0042 84  PHE A CZ  
671  N  N   . TRP A 85  ? 0.0460 0.0479 0.0448 -0.0030 -0.0055 -0.0013 85  TRP A N   
672  C  CA  . TRP A 85  ? 0.0443 0.0387 0.0323 -0.0036 -0.0034 0.0009  85  TRP A CA  
673  C  C   . TRP A 85  ? 0.0500 0.0429 0.0407 -0.0022 -0.0036 0.0053  85  TRP A C   
674  O  O   . TRP A 85  ? 0.0524 0.0282 0.0324 -0.0063 -0.0019 0.0143  85  TRP A O   
675  C  CB  . TRP A 85  ? 0.0330 0.0258 0.0245 -0.0036 -0.0114 0.0088  85  TRP A CB  
676  C  CG  . TRP A 85  ? 0.0348 0.0302 0.0135 -0.0008 0.0032  -0.0025 85  TRP A CG  
677  C  CD1 . TRP A 85  ? 0.0330 0.0210 0.0094 -0.0091 -0.0042 -0.0038 85  TRP A CD1 
678  C  CD2 . TRP A 85  ? 0.0508 0.0345 0.0287 -0.0044 -0.0029 0.0009  85  TRP A CD2 
679  N  NE1 . TRP A 85  ? 0.0579 0.0088 0.0186 0.0007  -0.0067 -0.0053 85  TRP A NE1 
680  C  CE2 . TRP A 85  ? 0.0400 0.0273 0.0237 -0.0074 -0.0061 -0.0076 85  TRP A CE2 
681  C  CE3 . TRP A 85  ? 0.0182 0.0263 0.0095 -0.0095 0.0000  -0.0063 85  TRP A CE3 
682  C  CZ2 . TRP A 85  ? 0.0611 0.0287 0.0426 -0.0081 -0.0038 -0.0019 85  TRP A CZ2 
683  C  CZ3 . TRP A 85  ? 0.0242 0.0587 0.0416 0.0016  0.0035  0.0036  85  TRP A CZ3 
684  C  CH2 . TRP A 85  ? 0.0458 0.0302 0.0215 -0.0035 0.0080  -0.0004 85  TRP A CH2 
685  N  N   . LYS A 86  ? 0.0509 0.0523 0.0483 -0.0019 -0.0010 0.0054  86  LYS A N   
686  C  CA  . LYS A 86  ? 0.0569 0.0522 0.0558 0.0014  -0.0009 0.0030  86  LYS A CA  
687  C  C   . LYS A 86  ? 0.0485 0.0491 0.0598 0.0006  -0.0035 0.0042  86  LYS A C   
688  O  O   . LYS A 86  ? 0.0453 0.0324 0.0601 0.0039  -0.0010 0.0011  86  LYS A O   
689  C  CB  . LYS A 86  ? 0.0613 0.0591 0.0601 0.0023  -0.0026 0.0063  86  LYS A CB  
690  C  CG  . LYS A 86  ? 0.0854 0.0679 0.0675 -0.0020 0.0016  0.0024  86  LYS A CG  
691  C  CD  . LYS A 86  ? 0.1070 0.0714 0.0953 0.0005  0.0136  0.0051  86  LYS A CD  
692  C  CE  . LYS A 86  ? 0.1236 0.0950 0.1137 -0.0048 0.0010  -0.0068 86  LYS A CE  
693  N  NZ  . LYS A 86  ? 0.1312 0.0796 0.1519 0.0022  0.0176  -0.0068 86  LYS A NZ  
694  N  N   . GLY A 87  ? 0.0427 0.0448 0.0564 0.0027  -0.0002 0.0053  87  GLY A N   
695  C  CA  . GLY A 87  ? 0.0490 0.0389 0.0569 -0.0030 -0.0023 0.0080  87  GLY A CA  
696  C  C   . GLY A 87  ? 0.0484 0.0454 0.0540 -0.0058 0.0000  0.0060  87  GLY A C   
697  O  O   . GLY A 87  ? 0.0466 0.0265 0.0503 -0.0106 0.0024  0.0270  87  GLY A O   
698  N  N   . LEU A 88  ? 0.0561 0.0488 0.0564 -0.0025 -0.0022 0.0066  88  LEU A N   
699  C  CA  . LEU A 88  ? 0.0629 0.0520 0.0518 -0.0018 -0.0059 0.0025  88  LEU A CA  
700  C  C   . LEU A 88  ? 0.0725 0.0607 0.0578 0.0028  -0.0043 0.0010  88  LEU A C   
701  O  O   . LEU A 88  ? 0.0662 0.0680 0.0454 0.0014  -0.0122 0.0078  88  LEU A O   
702  C  CB  . LEU A 88  ? 0.0584 0.0378 0.0510 0.0080  0.0013  0.0007  88  LEU A CB  
703  C  CG  . LEU A 88  ? 0.0652 0.0478 0.0446 0.0031  0.0056  -0.0116 88  LEU A CG  
704  C  CD1 . LEU A 88  ? 0.0751 0.0468 0.0536 -0.0036 -0.0037 -0.0055 88  LEU A CD1 
705  C  CD2 . LEU A 88  ? 0.0602 0.0308 0.0394 -0.0092 0.0044  0.0086  88  LEU A CD2 
706  N  N   . LYS A 89  ? 0.0758 0.0549 0.0586 -0.0039 -0.0012 0.0064  89  LYS A N   
707  C  CA  . LYS A 89  ? 0.0865 0.0673 0.0727 0.0000  0.0017  -0.0005 89  LYS A CA  
708  C  C   . LYS A 89  ? 0.0813 0.0656 0.0744 -0.0001 -0.0022 0.0032  89  LYS A C   
709  O  O   . LYS A 89  ? 0.0912 0.0757 0.0871 0.0012  0.0071  0.0036  89  LYS A O   
710  C  CB  . LYS A 89  ? 0.0866 0.0610 0.0778 0.0052  -0.0023 -0.0087 89  LYS A CB  
711  C  CG  . LYS A 89  ? 0.0968 0.0606 0.0807 -0.0003 -0.0029 -0.0126 89  LYS A CG  
712  C  CD  . LYS A 89  ? 0.1060 0.0943 0.1004 -0.0088 -0.0055 -0.0128 89  LYS A CD  
713  C  CE  . LYS A 89  ? 0.1039 0.1103 0.1113 -0.0039 -0.0004 -0.0056 89  LYS A CE  
714  N  NZ  . LYS A 89  ? 0.1210 0.1159 0.1311 -0.0118 0.0034  0.0102  89  LYS A NZ  
715  N  N   . LYS A 90  ? 0.0921 0.0668 0.0806 -0.0016 -0.0005 0.0049  90  LYS A N   
716  C  CA  . LYS A 90  ? 0.0968 0.0736 0.0882 -0.0054 -0.0046 0.0039  90  LYS A CA  
717  C  C   . LYS A 90  ? 0.1033 0.0754 0.0900 -0.0008 0.0036  0.0019  90  LYS A C   
718  O  O   . LYS A 90  ? 0.1183 0.0709 0.0967 0.0036  0.0049  0.0034  90  LYS A O   
719  C  CB  . LYS A 90  ? 0.0984 0.0825 0.0888 -0.0074 -0.0056 0.0001  90  LYS A CB  
720  C  CG  . LYS A 90  ? 0.0980 0.1055 0.1174 -0.0056 -0.0087 0.0036  90  LYS A CG  
721  C  CD  . LYS A 90  ? 0.1186 0.1250 0.1414 -0.0044 0.0014  -0.0004 90  LYS A CD  
722  C  CE  . LYS A 90  ? 0.1383 0.1393 0.1541 0.0063  0.0121  -0.0033 90  LYS A CE  
723  N  NZ  . LYS A 90  ? 0.1439 0.1282 0.1483 -0.0020 0.0002  -0.0040 90  LYS A NZ  
724  N  N   . GLY A 91  ? 0.0984 0.0798 0.0985 0.0024  -0.0010 0.0011  91  GLY A N   
725  C  CA  . GLY A 91  ? 0.1093 0.0764 0.1017 0.0045  0.0000  0.0000  91  GLY A CA  
726  C  C   . GLY A 91  ? 0.1081 0.0772 0.1029 0.0027  0.0037  0.0010  91  GLY A C   
727  O  O   . GLY A 91  ? 0.1099 0.0710 0.1129 0.0018  0.0008  0.0005  91  GLY A O   
728  N  N   . THR A 92  ? 0.1107 0.0737 0.1017 0.0030  0.0034  0.0020  92  THR A N   
729  C  CA  . THR A 92  ? 0.1085 0.0796 0.0995 0.0023  -0.0017 0.0051  92  THR A CA  
730  C  C   . THR A 92  ? 0.1064 0.0811 0.1016 0.0026  -0.0040 0.0060  92  THR A C   
731  O  O   . THR A 92  ? 0.1084 0.0879 0.1056 0.0108  -0.0088 0.0072  92  THR A O   
732  C  CB  . THR A 92  ? 0.1093 0.0836 0.1028 0.0028  -0.0030 0.0098  92  THR A CB  
733  O  OG1 . THR A 92  ? 0.1215 0.1103 0.1169 0.0008  0.0108  0.0080  92  THR A OG1 
734  C  CG2 . THR A 92  ? 0.0993 0.0524 0.0845 -0.0125 -0.0059 0.0008  92  THR A CG2 
735  N  N   . THR A 93  ? 0.1070 0.0754 0.1101 0.0022  -0.0008 0.0073  93  THR A N   
736  C  CA  . THR A 93  ? 0.1040 0.0761 0.1063 0.0049  -0.0030 0.0026  93  THR A CA  
737  C  C   . THR A 93  ? 0.0967 0.0724 0.0996 0.0066  -0.0051 0.0055  93  THR A C   
738  O  O   . THR A 93  ? 0.1067 0.0638 0.0899 0.0189  -0.0137 0.0071  93  THR A O   
739  C  CB  . THR A 93  ? 0.1033 0.0743 0.1043 0.0067  -0.0028 0.0068  93  THR A CB  
740  O  OG1 . THR A 93  ? 0.1220 0.1050 0.1228 0.0042  -0.0009 0.0056  93  THR A OG1 
741  C  CG2 . THR A 93  ? 0.1118 0.0841 0.1142 -0.0072 -0.0009 -0.0022 93  THR A CG2 
742  N  N   . LEU A 94  ? 0.1075 0.0861 0.1125 0.0090  -0.0104 0.0033  94  LEU A N   
743  C  CA  . LEU A 94  ? 0.1025 0.0881 0.1106 0.0013  -0.0073 0.0058  94  LEU A CA  
744  C  C   . LEU A 94  ? 0.1067 0.0976 0.1116 0.0001  -0.0097 0.0044  94  LEU A C   
745  O  O   . LEU A 94  ? 0.1127 0.0937 0.1162 -0.0005 -0.0211 0.0082  94  LEU A O   
746  C  CB  . LEU A 94  ? 0.1117 0.1019 0.1218 0.0008  -0.0085 0.0047  94  LEU A CB  
747  C  CG  . LEU A 94  ? 0.1222 0.1112 0.1218 -0.0008 -0.0047 0.0023  94  LEU A CG  
748  C  CD1 . LEU A 94  ? 0.1357 0.1365 0.1386 -0.0086 0.0036  0.0065  94  LEU A CD1 
749  C  CD2 . LEU A 94  ? 0.0978 0.1184 0.1233 -0.0029 0.0007  0.0103  94  LEU A CD2 
750  N  N   . GLN A 95  ? 0.1090 0.1044 0.1237 0.0032  -0.0118 0.0025  95  GLN A N   
751  C  CA  . GLN A 95  ? 0.1146 0.1175 0.1337 0.0029  -0.0073 0.0066  95  GLN A CA  
752  C  C   . GLN A 95  ? 0.1151 0.1186 0.1386 0.0031  -0.0114 0.0052  95  GLN A C   
753  O  O   . GLN A 95  ? 0.1306 0.1178 0.1462 0.0013  -0.0167 0.0090  95  GLN A O   
754  C  CB  . GLN A 95  ? 0.1207 0.1272 0.1346 0.0013  -0.0080 0.0056  95  GLN A CB  
755  C  CG  . GLN A 95  ? 0.1289 0.1481 0.1400 -0.0007 -0.0032 0.0059  95  GLN A CG  
756  C  CD  . GLN A 95  ? 0.1553 0.1649 0.1515 0.0059  -0.0072 0.0017  95  GLN A CD  
757  O  OE1 . GLN A 95  ? 0.1547 0.1640 0.1529 0.0014  -0.0095 0.0050  95  GLN A OE1 
758  N  NE2 . GLN A 95  ? 0.1713 0.1903 0.1759 0.0179  -0.0068 0.0092  95  GLN A NE2 
759  N  N   . GLY A 96  ? 0.1150 0.1210 0.1397 0.0032  -0.0102 0.0054  96  GLY A N   
760  C  CA  . GLY A 96  ? 0.1154 0.1181 0.1322 0.0081  -0.0072 0.0055  96  GLY A CA  
761  C  C   . GLY A 96  ? 0.1055 0.1163 0.1250 0.0063  -0.0061 0.0030  96  GLY A C   
762  O  O   . GLY A 96  ? 0.1091 0.1244 0.1358 0.0110  -0.0152 0.0035  96  GLY A O   
763  N  N   . ASP A 97  ? 0.1132 0.1215 0.1219 0.0081  -0.0061 0.0038  97  ASP A N   
764  C  CA  . ASP A 97  ? 0.1158 0.1230 0.1165 0.0046  -0.0020 0.0047  97  ASP A CA  
765  C  C   . ASP A 97  ? 0.1067 0.1179 0.1080 0.0055  -0.0055 0.0032  97  ASP A C   
766  O  O   . ASP A 97  ? 0.1088 0.1293 0.1098 0.0065  -0.0107 0.0044  97  ASP A O   
767  C  CB  . ASP A 97  ? 0.1307 0.1320 0.1215 0.0028  0.0007  0.0039  97  ASP A CB  
768  C  CG  . ASP A 97  ? 0.1463 0.1490 0.1489 0.0076  0.0006  0.0064  97  ASP A CG  
769  O  OD1 . ASP A 97  ? 0.1781 0.1689 0.1747 0.0012  0.0024  0.0145  97  ASP A OD1 
770  O  OD2 . ASP A 97  ? 0.1849 0.1672 0.1745 0.0104  -0.0076 0.0187  97  ASP A OD2 
771  N  N   . LEU A 98  ? 0.1055 0.1126 0.1038 0.0068  -0.0068 0.0040  98  LEU A N   
772  C  CA  . LEU A 98  ? 0.0923 0.1023 0.0950 0.0075  -0.0064 0.0031  98  LEU A CA  
773  C  C   . LEU A 98  ? 0.0959 0.1011 0.0959 0.0058  -0.0073 0.0008  98  LEU A C   
774  O  O   . LEU A 98  ? 0.1009 0.1040 0.0968 0.0126  -0.0065 0.0064  98  LEU A O   
775  C  CB  . LEU A 98  ? 0.0972 0.0889 0.0934 0.0109  -0.0096 0.0008  98  LEU A CB  
776  C  CG  . LEU A 98  ? 0.0877 0.0929 0.0960 0.0013  -0.0116 -0.0074 98  LEU A CG  
777  C  CD1 . LEU A 98  ? 0.0922 0.0846 0.0784 0.0061  -0.0108 -0.0037 98  LEU A CD1 
778  C  CD2 . LEU A 98  ? 0.0863 0.0584 0.0926 0.0036  -0.0219 -0.0075 98  LEU A CD2 
779  N  N   . LYS A 99  ? 0.0959 0.1016 0.0965 0.0059  -0.0041 0.0022  99  LYS A N   
780  C  CA  . LYS A 99  ? 0.1099 0.1017 0.1000 0.0032  -0.0079 0.0048  99  LYS A CA  
781  C  C   . LYS A 99  ? 0.1072 0.1054 0.1019 0.0068  -0.0075 0.0046  99  LYS A C   
782  O  O   . LYS A 99  ? 0.1139 0.1144 0.1087 0.0094  -0.0109 0.0089  99  LYS A O   
783  C  CB  . LYS A 99  ? 0.1151 0.1053 0.1056 0.0052  -0.0007 -0.0004 99  LYS A CB  
784  C  CG  . LYS A 99  ? 0.1240 0.1030 0.1093 0.0092  -0.0056 -0.0017 99  LYS A CG  
785  C  CD  . LYS A 99  ? 0.1297 0.1368 0.1393 -0.0012 0.0015  0.0178  99  LYS A CD  
786  C  CE  . LYS A 99  ? 0.1628 0.1558 0.1412 -0.0022 -0.0072 0.0126  99  LYS A CE  
787  N  NZ  . LYS A 99  ? 0.1650 0.1474 0.1635 -0.0110 -0.0058 0.0013  99  LYS A NZ  
788  N  N   . ALA A 100 ? 0.1052 0.1067 0.1063 0.0014  -0.0112 0.0045  100 ALA A N   
789  C  CA  . ALA A 100 ? 0.1106 0.1139 0.1096 0.0026  -0.0085 -0.0011 100 ALA A CA  
790  C  C   . ALA A 100 ? 0.1043 0.1041 0.0986 0.0047  -0.0092 -0.0009 100 ALA A C   
791  O  O   . ALA A 100 ? 0.0954 0.1116 0.0924 0.0128  -0.0193 -0.0089 100 ALA A O   
792  C  CB  . ALA A 100 ? 0.1115 0.1128 0.1133 0.0011  -0.0034 0.0017  100 ALA A CB  
793  N  N   . ALA A 101 ? 0.0984 0.0939 0.0850 0.0021  -0.0081 0.0021  101 ALA A N   
794  C  CA  . ALA A 101 ? 0.1024 0.0903 0.0795 0.0019  -0.0080 0.0046  101 ALA A CA  
795  C  C   . ALA A 101 ? 0.1016 0.0854 0.0764 -0.0017 -0.0080 0.0078  101 ALA A C   
796  O  O   . ALA A 101 ? 0.1017 0.0944 0.0569 0.0095  -0.0051 0.0066  101 ALA A O   
797  C  CB  . ALA A 101 ? 0.0959 0.0778 0.0687 -0.0019 -0.0095 -0.0011 101 ALA A CB  
798  N  N   . ILE A 102 ? 0.0894 0.0821 0.0742 -0.0031 -0.0093 0.0092  102 ILE A N   
799  C  CA  . ILE A 102 ? 0.0892 0.0848 0.0857 -0.0057 -0.0093 0.0096  102 ILE A CA  
800  C  C   . ILE A 102 ? 0.0862 0.0809 0.0815 -0.0065 -0.0064 0.0091  102 ILE A C   
801  O  O   . ILE A 102 ? 0.0854 0.0872 0.0782 -0.0073 -0.0028 0.0173  102 ILE A O   
802  C  CB  . ILE A 102 ? 0.0930 0.0842 0.0807 -0.0101 -0.0117 0.0052  102 ILE A CB  
803  C  CG1 . ILE A 102 ? 0.0854 0.0769 0.0922 -0.0025 -0.0106 0.0089  102 ILE A CG1 
804  C  CG2 . ILE A 102 ? 0.0828 0.0966 0.1014 0.0035  -0.0117 0.0048  102 ILE A CG2 
805  C  CD1 . ILE A 102 ? 0.1058 0.0974 0.1054 0.0005  -0.0183 -0.0066 102 ILE A CD1 
806  N  N   . GLU A 103 ? 0.0884 0.0891 0.0917 -0.0013 -0.0069 0.0064  103 GLU A N   
807  C  CA  . GLU A 103 ? 0.0959 0.0871 0.0971 -0.0011 -0.0103 0.0038  103 GLU A CA  
808  C  C   . GLU A 103 ? 0.0997 0.0831 0.0991 0.0038  -0.0089 0.0012  103 GLU A C   
809  O  O   . GLU A 103 ? 0.1137 0.0968 0.1091 0.0104  -0.0058 0.0046  103 GLU A O   
810  C  CB  . GLU A 103 ? 0.0941 0.0938 0.0915 0.0032  -0.0110 0.0050  103 GLU A CB  
811  C  CG  . GLU A 103 ? 0.1208 0.1023 0.1118 -0.0060 -0.0076 0.0108  103 GLU A CG  
812  C  CD  . GLU A 103 ? 0.1304 0.1180 0.1438 0.0074  0.0005  0.0038  103 GLU A CD  
813  O  OE1 . GLU A 103 ? 0.1437 0.1235 0.1580 -0.0006 -0.0005 0.0155  103 GLU A OE1 
814  O  OE2 . GLU A 103 ? 0.1502 0.1583 0.1667 0.0030  -0.0008 0.0164  103 GLU A OE2 
815  N  N   . ARG A 104 ? 0.1023 0.0844 0.1018 0.0069  -0.0061 -0.0005 104 ARG A N   
816  C  CA  . ARG A 104 ? 0.1109 0.1002 0.1118 0.0026  -0.0073 -0.0010 104 ARG A CA  
817  C  C   . ARG A 104 ? 0.1130 0.0973 0.1036 0.0029  -0.0079 0.0017  104 ARG A C   
818  O  O   . ARG A 104 ? 0.1261 0.0901 0.1137 0.0034  -0.0028 0.0039  104 ARG A O   
819  C  CB  . ARG A 104 ? 0.1249 0.1115 0.1190 -0.0019 -0.0014 -0.0013 104 ARG A CB  
820  C  CG  . ARG A 104 ? 0.1488 0.1249 0.1471 -0.0004 -0.0011 -0.0020 104 ARG A CG  
821  C  CD  . ARG A 104 ? 0.1656 0.1460 0.1617 0.0074  0.0088  -0.0067 104 ARG A CD  
822  N  NE  . ARG A 104 ? 0.1896 0.1728 0.1836 0.0063  -0.0034 -0.0037 104 ARG A NE  
823  C  CZ  . ARG A 104 ? 0.2035 0.1827 0.1839 0.0070  -0.0017 -0.0033 104 ARG A CZ  
824  N  NH1 . ARG A 104 ? 0.2071 0.1813 0.1943 0.0071  0.0049  0.0072  104 ARG A NH1 
825  N  NH2 . ARG A 104 ? 0.1745 0.1717 0.1931 0.0034  -0.0085 0.0008  104 ARG A NH2 
826  N  N   . ASP A 105 ? 0.1042 0.1020 0.1135 0.0048  -0.0079 0.0025  105 ASP A N   
827  C  CA  . ASP A 105 ? 0.1002 0.0934 0.0995 0.0069  -0.0090 -0.0006 105 ASP A CA  
828  C  C   . ASP A 105 ? 0.1006 0.0926 0.0954 0.0020  -0.0120 0.0026  105 ASP A C   
829  O  O   . ASP A 105 ? 0.1059 0.0997 0.1022 0.0102  -0.0177 -0.0003 105 ASP A O   
830  C  CB  . ASP A 105 ? 0.1056 0.0982 0.1018 0.0059  -0.0042 -0.0002 105 ASP A CB  
831  C  CG  . ASP A 105 ? 0.1147 0.1090 0.1120 -0.0005 -0.0075 0.0066  105 ASP A CG  
832  O  OD1 . ASP A 105 ? 0.1563 0.1574 0.1366 -0.0077 -0.0238 0.0197  105 ASP A OD1 
833  O  OD2 . ASP A 105 ? 0.1166 0.1354 0.1233 0.0125  -0.0100 0.0060  105 ASP A OD2 
834  N  N   . PHE A 106 ? 0.0960 0.0805 0.0920 0.0034  -0.0123 0.0027  106 PHE A N   
835  C  CA  . PHE A 106 ? 0.1019 0.0905 0.0972 0.0005  -0.0088 0.0041  106 PHE A CA  
836  C  C   . PHE A 106 ? 0.1054 0.1035 0.0994 0.0009  -0.0039 0.0046  106 PHE A C   
837  O  O   . PHE A 106 ? 0.1033 0.1119 0.1061 0.0060  -0.0017 0.0027  106 PHE A O   
838  C  CB  . PHE A 106 ? 0.0910 0.0905 0.0923 -0.0042 -0.0085 0.0082  106 PHE A CB  
839  C  CG  . PHE A 106 ? 0.0986 0.0960 0.0912 -0.0067 -0.0038 0.0040  106 PHE A CG  
840  C  CD1 . PHE A 106 ? 0.0699 0.0983 0.0749 -0.0107 -0.0204 0.0078  106 PHE A CD1 
841  C  CD2 . PHE A 106 ? 0.0742 0.0865 0.0859 -0.0056 -0.0144 -0.0040 106 PHE A CD2 
842  C  CE1 . PHE A 106 ? 0.0943 0.0969 0.0956 -0.0130 -0.0065 0.0103  106 PHE A CE1 
843  C  CE2 . PHE A 106 ? 0.1055 0.0914 0.1002 -0.0084 0.0017  0.0046  106 PHE A CE2 
844  C  CZ  . PHE A 106 ? 0.0717 0.0901 0.0956 -0.0216 -0.0023 0.0023  106 PHE A CZ  
845  N  N   . GLY A 107 ? 0.1069 0.1053 0.1074 0.0055  -0.0058 0.0065  107 GLY A N   
846  C  CA  . GLY A 107 ? 0.1240 0.1173 0.1153 0.0030  -0.0041 0.0076  107 GLY A CA  
847  C  C   . GLY A 107 ? 0.1236 0.1169 0.1231 0.0045  -0.0037 0.0079  107 GLY A C   
848  O  O   . GLY A 107 ? 0.1387 0.1343 0.1261 0.0087  -0.0041 0.0128  107 GLY A O   
849  N  N   . SER A 108 ? 0.1314 0.1235 0.1200 0.0009  -0.0061 0.0077  108 SER A N   
850  C  CA  . SER A 108 ? 0.1282 0.1230 0.1186 0.0012  -0.0071 0.0097  108 SER A CA  
851  C  C   . SER A 108 ? 0.1239 0.1155 0.1164 0.0018  -0.0089 0.0070  108 SER A C   
852  O  O   . SER A 108 ? 0.1268 0.1178 0.1224 -0.0007 -0.0103 0.0135  108 SER A O   
853  C  CB  . SER A 108 ? 0.1263 0.1278 0.1175 0.0044  -0.0046 0.0091  108 SER A CB  
854  O  OG  . SER A 108 ? 0.1437 0.1546 0.1325 0.0063  -0.0137 0.0129  108 SER A OG  
855  N  N   . VAL A 109 ? 0.1258 0.1180 0.1154 0.0020  -0.0082 0.0057  109 VAL A N   
856  C  CA  . VAL A 109 ? 0.1168 0.1091 0.1095 0.0013  -0.0053 0.0055  109 VAL A CA  
857  C  C   . VAL A 109 ? 0.1243 0.1147 0.1059 0.0025  -0.0001 0.0061  109 VAL A C   
858  O  O   . VAL A 109 ? 0.1245 0.1090 0.0847 0.0045  -0.0004 0.0069  109 VAL A O   
859  C  CB  . VAL A 109 ? 0.1173 0.1105 0.1090 0.0024  -0.0035 0.0044  109 VAL A CB  
860  C  CG1 . VAL A 109 ? 0.1179 0.1164 0.1184 -0.0047 -0.0013 0.0112  109 VAL A CG1 
861  C  CG2 . VAL A 109 ? 0.0930 0.0928 0.1108 -0.0026 -0.0124 0.0086  109 VAL A CG2 
862  N  N   . ASP A 110 ? 0.1240 0.1189 0.0997 0.0005  0.0049  0.0027  110 ASP A N   
863  C  CA  . ASP A 110 ? 0.1265 0.1230 0.1127 -0.0053 0.0006  0.0051  110 ASP A CA  
864  C  C   . ASP A 110 ? 0.1183 0.1208 0.1118 -0.0063 0.0010  0.0040  110 ASP A C   
865  O  O   . ASP A 110 ? 0.1259 0.1205 0.1172 -0.0072 -0.0068 0.0022  110 ASP A O   
866  C  CB  . ASP A 110 ? 0.1416 0.1299 0.1212 -0.0018 0.0004  0.0081  110 ASP A CB  
867  C  CG  . ASP A 110 ? 0.1806 0.1484 0.1558 -0.0087 -0.0016 0.0008  110 ASP A CG  
868  O  OD1 . ASP A 110 ? 0.2302 0.1805 0.1832 -0.0128 -0.0086 0.0106  110 ASP A OD1 
869  O  OD2 . ASP A 110 ? 0.2426 0.1918 0.2024 -0.0066 -0.0145 0.0080  110 ASP A OD2 
870  N  N   . ASN A 111 ? 0.1153 0.1118 0.0972 -0.0138 -0.0031 0.0042  111 ASN A N   
871  C  CA  . ASN A 111 ? 0.1123 0.1126 0.0964 -0.0049 0.0004  0.0058  111 ASN A CA  
872  C  C   . ASN A 111 ? 0.1073 0.1001 0.0940 -0.0081 -0.0060 0.0056  111 ASN A C   
873  O  O   . ASN A 111 ? 0.1093 0.1047 0.0984 -0.0086 -0.0074 -0.0034 111 ASN A O   
874  C  CB  . ASN A 111 ? 0.1170 0.1195 0.1026 -0.0017 -0.0024 0.0045  111 ASN A CB  
875  C  CG  . ASN A 111 ? 0.1367 0.1415 0.1172 -0.0001 0.0025  0.0089  111 ASN A CG  
876  O  OD1 . ASN A 111 ? 0.1703 0.1298 0.1405 -0.0019 0.0025  -0.0006 111 ASN A OD1 
877  N  ND2 . ASN A 111 ? 0.1757 0.1856 0.1629 -0.0010 -0.0115 -0.0087 111 ASN A ND2 
878  N  N   . PHE A 112 ? 0.1020 0.0880 0.0876 -0.0070 -0.0045 0.0042  112 PHE A N   
879  C  CA  . PHE A 112 ? 0.1081 0.0937 0.0840 -0.0057 -0.0036 0.0055  112 PHE A CA  
880  C  C   . PHE A 112 ? 0.1094 0.0945 0.0841 -0.0025 -0.0042 0.0029  112 PHE A C   
881  O  O   . PHE A 112 ? 0.1233 0.0892 0.0685 0.0015  0.0012  -0.0012 112 PHE A O   
882  C  CB  . PHE A 112 ? 0.1042 0.0848 0.0902 -0.0045 -0.0059 0.0096  112 PHE A CB  
883  C  CG  . PHE A 112 ? 0.1089 0.1076 0.0947 -0.0006 -0.0019 0.0101  112 PHE A CG  
884  C  CD1 . PHE A 112 ? 0.1073 0.0943 0.1044 -0.0076 -0.0013 0.0117  112 PHE A CD1 
885  C  CD2 . PHE A 112 ? 0.1306 0.1038 0.0942 0.0055  -0.0075 0.0112  112 PHE A CD2 
886  C  CE1 . PHE A 112 ? 0.1166 0.1078 0.1149 -0.0047 0.0001  0.0090  112 PHE A CE1 
887  C  CE2 . PHE A 112 ? 0.1426 0.1173 0.1056 0.0055  -0.0108 0.0069  112 PHE A CE2 
888  C  CZ  . PHE A 112 ? 0.1342 0.1143 0.1170 0.0020  -0.0095 0.0057  112 PHE A CZ  
889  N  N   . LYS A 113 ? 0.1021 0.0909 0.0726 -0.0082 0.0001  0.0020  113 LYS A N   
890  C  CA  . LYS A 113 ? 0.0951 0.0846 0.0744 -0.0042 -0.0055 0.0039  113 LYS A CA  
891  C  C   . LYS A 113 ? 0.0869 0.0788 0.0672 -0.0115 -0.0036 0.0042  113 LYS A C   
892  O  O   . LYS A 113 ? 0.0891 0.0757 0.0624 -0.0132 -0.0069 0.0050  113 LYS A O   
893  C  CB  . LYS A 113 ? 0.0927 0.0867 0.0713 -0.0089 -0.0052 0.0062  113 LYS A CB  
894  C  CG  . LYS A 113 ? 0.0964 0.0829 0.0956 -0.0002 -0.0020 0.0001  113 LYS A CG  
895  C  CD  . LYS A 113 ? 0.1105 0.0764 0.1065 0.0071  -0.0066 0.0055  113 LYS A CD  
896  C  CE  . LYS A 113 ? 0.1424 0.1078 0.1468 -0.0057 -0.0043 0.0096  113 LYS A CE  
897  N  NZ  . LYS A 113 ? 0.1501 0.1025 0.1493 -0.0061 -0.0017 0.0093  113 LYS A NZ  
898  N  N   . ALA A 114 ? 0.0831 0.0778 0.0633 -0.0116 -0.0106 0.0005  114 ALA A N   
899  C  CA  . ALA A 114 ? 0.0832 0.0899 0.0666 -0.0033 -0.0080 -0.0011 114 ALA A CA  
900  C  C   . ALA A 114 ? 0.0853 0.0946 0.0723 -0.0047 -0.0075 -0.0001 114 ALA A C   
901  O  O   . ALA A 114 ? 0.0944 0.0919 0.0737 -0.0020 -0.0145 -0.0021 114 ALA A O   
902  C  CB  . ALA A 114 ? 0.0841 0.0907 0.0630 -0.0055 -0.0092 -0.0055 114 ALA A CB  
903  N  N   . GLU A 115 ? 0.0837 0.0901 0.0717 -0.0098 -0.0065 0.0000  115 GLU A N   
904  C  CA  . GLU A 115 ? 0.0887 0.0932 0.0792 -0.0058 -0.0074 0.0043  115 GLU A CA  
905  C  C   . GLU A 115 ? 0.0793 0.0836 0.0574 -0.0099 -0.0020 0.0052  115 GLU A C   
906  O  O   . GLU A 115 ? 0.0830 0.0806 0.0502 -0.0120 0.0038  0.0045  115 GLU A O   
907  C  CB  . GLU A 115 ? 0.0966 0.0986 0.0887 -0.0051 -0.0030 -0.0024 115 GLU A CB  
908  C  CG  . GLU A 115 ? 0.1429 0.1133 0.1561 -0.0063 -0.0031 0.0024  115 GLU A CG  
909  C  CD  . GLU A 115 ? 0.1628 0.1542 0.1938 -0.0122 -0.0052 0.0035  115 GLU A CD  
910  O  OE1 . GLU A 115 ? 0.1945 0.1533 0.2192 -0.0063 -0.0095 0.0053  115 GLU A OE1 
911  O  OE2 . GLU A 115 ? 0.1937 0.1914 0.2424 -0.0053 -0.0172 0.0005  115 GLU A OE2 
912  N  N   . PHE A 116 ? 0.0746 0.0907 0.0585 -0.0030 -0.0129 0.0044  116 PHE A N   
913  C  CA  . PHE A 116 ? 0.0786 0.0746 0.0515 -0.0042 -0.0156 0.0082  116 PHE A CA  
914  C  C   . PHE A 116 ? 0.0751 0.0644 0.0461 -0.0020 -0.0112 0.0056  116 PHE A C   
915  O  O   . PHE A 116 ? 0.0685 0.0678 0.0421 -0.0087 -0.0284 -0.0010 116 PHE A O   
916  C  CB  . PHE A 116 ? 0.0667 0.0880 0.0393 -0.0005 -0.0134 0.0069  116 PHE A CB  
917  C  CG  . PHE A 116 ? 0.0863 0.0748 0.0425 -0.0084 -0.0070 0.0075  116 PHE A CG  
918  C  CD1 . PHE A 116 ? 0.0794 0.0545 0.0312 -0.0008 -0.0020 0.0057  116 PHE A CD1 
919  C  CD2 . PHE A 116 ? 0.0898 0.0987 0.0483 0.0093  -0.0211 0.0036  116 PHE A CD2 
920  C  CE1 . PHE A 116 ? 0.0546 0.0588 0.0465 0.0005  -0.0155 0.0030  116 PHE A CE1 
921  C  CE2 . PHE A 116 ? 0.0550 0.0538 0.0146 0.0047  -0.0122 0.0013  116 PHE A CE2 
922  C  CZ  . PHE A 116 ? 0.0499 0.0430 0.0386 0.0009  -0.0107 0.0117  116 PHE A CZ  
923  N  N   . GLU A 117 ? 0.0813 0.0594 0.0405 -0.0010 -0.0153 0.0086  117 GLU A N   
924  C  CA  . GLU A 117 ? 0.0962 0.0585 0.0554 0.0002  -0.0038 0.0083  117 GLU A CA  
925  C  C   . GLU A 117 ? 0.0865 0.0550 0.0533 -0.0021 -0.0048 0.0074  117 GLU A C   
926  O  O   . GLU A 117 ? 0.0972 0.0544 0.0540 -0.0054 -0.0068 0.0106  117 GLU A O   
927  C  CB  . GLU A 117 ? 0.0907 0.0640 0.0463 -0.0013 -0.0039 0.0132  117 GLU A CB  
928  C  CG  . GLU A 117 ? 0.1049 0.0814 0.0732 -0.0029 -0.0045 -0.0009 117 GLU A CG  
929  C  CD  . GLU A 117 ? 0.1443 0.0929 0.1050 0.0033  0.0044  -0.0028 117 GLU A CD  
930  O  OE1 . GLU A 117 ? 0.1960 0.1486 0.1180 0.0130  0.0108  0.0034  117 GLU A OE1 
931  O  OE2 . GLU A 117 ? 0.1456 0.0847 0.1080 0.0082  0.0109  -0.0110 117 GLU A OE2 
932  N  N   . LYS A 118 ? 0.0943 0.0543 0.0535 -0.0013 -0.0074 0.0047  118 LYS A N   
933  C  CA  . LYS A 118 ? 0.0847 0.0622 0.0608 -0.0016 -0.0051 -0.0045 118 LYS A CA  
934  C  C   . LYS A 118 ? 0.0738 0.0607 0.0579 -0.0074 -0.0086 -0.0059 118 LYS A C   
935  O  O   . LYS A 118 ? 0.0826 0.0571 0.0612 -0.0187 -0.0076 -0.0132 118 LYS A O   
936  C  CB  . LYS A 118 ? 0.0812 0.0604 0.0623 -0.0047 -0.0055 -0.0027 118 LYS A CB  
937  C  CG  . LYS A 118 ? 0.1017 0.0881 0.0865 0.0149  0.0011  -0.0039 118 LYS A CG  
938  C  CD  . LYS A 118 ? 0.1312 0.0995 0.1238 -0.0061 0.0034  -0.0112 118 LYS A CD  
939  C  CE  . LYS A 118 ? 0.1572 0.1200 0.1601 0.0125  -0.0044 -0.0113 118 LYS A CE  
940  N  NZ  . LYS A 118 ? 0.1513 0.1321 0.1776 -0.0095 -0.0140 -0.0033 118 LYS A NZ  
941  N  N   . ALA A 119 ? 0.0832 0.0640 0.0618 -0.0044 -0.0099 -0.0050 119 ALA A N   
942  C  CA  . ALA A 119 ? 0.0782 0.0660 0.0662 -0.0091 -0.0041 -0.0034 119 ALA A CA  
943  C  C   . ALA A 119 ? 0.0766 0.0693 0.0676 -0.0056 -0.0036 -0.0006 119 ALA A C   
944  O  O   . ALA A 119 ? 0.0816 0.0749 0.0757 -0.0075 -0.0047 -0.0002 119 ALA A O   
945  C  CB  . ALA A 119 ? 0.0717 0.0537 0.0737 -0.0061 -0.0048 -0.0034 119 ALA A CB  
946  N  N   . ALA A 120 ? 0.0783 0.0708 0.0656 -0.0084 -0.0011 0.0008  120 ALA A N   
947  C  CA  . ALA A 120 ? 0.0780 0.0674 0.0633 -0.0060 -0.0031 0.0011  120 ALA A CA  
948  C  C   . ALA A 120 ? 0.0872 0.0652 0.0663 -0.0033 -0.0046 0.0038  120 ALA A C   
949  O  O   . ALA A 120 ? 0.0877 0.0541 0.0622 -0.0026 -0.0085 0.0033  120 ALA A O   
950  C  CB  . ALA A 120 ? 0.0894 0.0799 0.0720 0.0004  -0.0055 -0.0049 120 ALA A CB  
951  N  N   . ALA A 121 ? 0.0892 0.0601 0.0513 -0.0022 0.0002  0.0093  121 ALA A N   
952  C  CA  . ALA A 121 ? 0.0947 0.0685 0.0606 0.0015  -0.0034 0.0099  121 ALA A CA  
953  C  C   . ALA A 121 ? 0.0884 0.0657 0.0506 0.0009  0.0002  -0.0016 121 ALA A C   
954  O  O   . ALA A 121 ? 0.1052 0.0826 0.0607 0.0001  0.0002  -0.0093 121 ALA A O   
955  C  CB  . ALA A 121 ? 0.0926 0.0522 0.0523 0.0042  0.0019  0.0155  121 ALA A CB  
956  N  N   . SER A 122 ? 0.0917 0.0663 0.0591 -0.0002 0.0007  0.0030  122 SER A N   
957  C  CA  . SER A 122 ? 0.0961 0.0743 0.0699 -0.0021 -0.0046 -0.0074 122 SER A CA  
958  C  C   . SER A 122 ? 0.0927 0.0651 0.0655 -0.0030 -0.0022 -0.0087 122 SER A C   
959  O  O   . SER A 122 ? 0.1127 0.0785 0.0779 0.0024  -0.0072 -0.0177 122 SER A O   
960  C  CB  . SER A 122 ? 0.0895 0.0699 0.0756 -0.0050 -0.0050 -0.0048 122 SER A CB  
961  O  OG  . SER A 122 ? 0.1133 0.0871 0.0885 -0.0030 0.0046  0.0073  122 SER A OG  
962  N  N   . ARG A 123 ? 0.0676 0.0392 0.0389 -0.0051 -0.0015 -0.0131 123 ARG A N   
963  C  CA  . ARG A 123 ? 0.0598 0.0369 0.0391 -0.0100 0.0007  -0.0146 123 ARG A CA  
964  C  C   . ARG A 123 ? 0.0555 0.0387 0.0322 -0.0112 -0.0044 -0.0085 123 ARG A C   
965  O  O   . ARG A 123 ? 0.0488 0.0355 0.0365 -0.0212 -0.0115 -0.0103 123 ARG A O   
966  C  CB  . ARG A 123 ? 0.0659 0.0427 0.0364 -0.0132 0.0018  -0.0089 123 ARG A CB  
967  C  CG  . ARG A 123 ? 0.0505 0.0199 0.0304 -0.0136 -0.0112 -0.0106 123 ARG A CG  
968  C  CD  . ARG A 123 ? 0.0421 0.0095 0.0153 0.0028  -0.0007 0.0051  123 ARG A CD  
969  N  NE  . ARG A 123 ? 0.0539 0.0553 0.0491 -0.0025 0.0080  -0.0051 123 ARG A NE  
970  C  CZ  . ARG A 123 ? 0.0391 0.0562 0.0366 -0.0027 0.0123  0.0019  123 ARG A CZ  
971  N  NH1 . ARG A 123 ? 0.0544 0.0534 0.0493 -0.0068 -0.0099 0.0116  123 ARG A NH1 
972  N  NH2 . ARG A 123 ? 0.0603 0.0665 0.0398 -0.0080 -0.0020 -0.0119 123 ARG A NH2 
973  N  N   . PHE A 124 ? 0.0354 0.0276 0.0308 -0.0120 0.0003  -0.0076 124 PHE A N   
974  C  CA  . PHE A 124 ? 0.0413 0.0253 0.0283 -0.0074 0.0024  -0.0129 124 PHE A CA  
975  C  C   . PHE A 124 ? 0.0314 0.0220 0.0355 -0.0036 0.0014  -0.0054 124 PHE A C   
976  O  O   . PHE A 124 ? 0.0310 0.0133 0.0404 -0.0127 -0.0019 -0.0026 124 PHE A O   
977  C  CB  . PHE A 124 ? 0.0513 0.0382 0.0273 -0.0119 0.0029  -0.0161 124 PHE A CB  
978  C  CG  . PHE A 124 ? 0.0302 0.0182 0.0126 -0.0097 0.0021  -0.0078 124 PHE A CG  
979  C  CD1 . PHE A 124 ? 0.0382 0.0153 0.0158 -0.0161 0.0010  -0.0033 124 PHE A CD1 
980  C  CD2 . PHE A 124 ? 0.0312 0.0199 0.0088 -0.0180 -0.0020 0.0004  124 PHE A CD2 
981  C  CE1 . PHE A 124 ? 0.0331 0.0068 0.0256 0.0017  -0.0048 -0.0031 124 PHE A CE1 
982  C  CE2 . PHE A 124 ? 0.0471 0.0100 0.0111 -0.0114 0.0105  -0.0039 124 PHE A CE2 
983  C  CZ  . PHE A 124 ? 0.0400 0.0172 0.0115 -0.0099 0.0014  0.0019  124 PHE A CZ  
984  N  N   . GLY A 125 ? 0.0140 0.0114 0.0240 -0.0024 0.0012  -0.0062 125 GLY A N   
985  C  CA  . GLY A 125 ? 0.0141 0.0184 0.0178 -0.0032 0.0038  -0.0096 125 GLY A CA  
986  C  C   . GLY A 125 ? 0.0073 0.0159 0.0232 -0.0025 0.0033  -0.0032 125 GLY A C   
987  O  O   . GLY A 125 ? 0.0144 0.0315 0.0239 -0.0138 0.0057  -0.0056 125 GLY A O   
988  N  N   . SER A 126 ? 0.0170 0.0174 0.0158 -0.0025 0.0087  -0.0053 126 SER A N   
989  C  CA  . SER A 126 ? 0.0211 0.0236 0.0174 -0.0081 0.0043  -0.0038 126 SER A CA  
990  C  C   . SER A 126 ? 0.0226 0.0290 0.0150 -0.0060 -0.0005 0.0015  126 SER A C   
991  O  O   . SER A 126 ? 0.0281 0.0324 0.0085 -0.0088 -0.0057 -0.0015 126 SER A O   
992  C  CB  . SER A 126 ? 0.0264 0.0346 0.0314 -0.0118 0.0018  -0.0015 126 SER A CB  
993  O  OG  . SER A 126 ? 0.0262 0.0266 0.0096 -0.0201 0.0080  -0.0081 126 SER A OG  
994  N  N   . GLY A 127 ? 0.0179 0.0417 0.0149 -0.0080 -0.0044 0.0031  127 GLY A N   
995  C  CA  . GLY A 127 ? 0.0146 0.0351 0.0150 0.0041  0.0032  0.0035  127 GLY A CA  
996  C  C   . GLY A 127 ? 0.0155 0.0390 0.0162 0.0029  0.0005  0.0017  127 GLY A C   
997  O  O   . GLY A 127 ? 0.0113 0.0183 0.0084 0.0077  0.0032  0.0050  127 GLY A O   
998  N  N   . TRP A 128 ? 0.0116 0.0410 0.0194 -0.0021 0.0025  0.0051  128 TRP A N   
999  C  CA  . TRP A 128 ? 0.0176 0.0331 0.0232 -0.0036 0.0005  0.0029  128 TRP A CA  
1000 C  C   . TRP A 128 ? 0.0226 0.0375 0.0193 -0.0025 0.0024  0.0053  128 TRP A C   
1001 O  O   . TRP A 128 ? 0.0156 0.0441 0.0255 -0.0075 -0.0021 0.0032  128 TRP A O   
1002 C  CB  . TRP A 128 ? 0.0089 0.0257 0.0204 0.0001  0.0036  0.0080  128 TRP A CB  
1003 C  CG  . TRP A 128 ? 0.0268 0.0218 0.0132 0.0049  0.0071  -0.0034 128 TRP A CG  
1004 C  CD1 . TRP A 128 ? 0.0160 0.0440 0.0083 0.0000  0.0006  0.0086  128 TRP A CD1 
1005 C  CD2 . TRP A 128 ? 0.0115 0.0160 0.0153 -0.0063 0.0062  -0.0058 128 TRP A CD2 
1006 N  NE1 . TRP A 128 ? 0.0159 0.0091 0.0097 -0.0052 0.0056  -0.0031 128 TRP A NE1 
1007 C  CE2 . TRP A 128 ? 0.0122 0.0076 0.0119 -0.0003 0.0055  0.0003  128 TRP A CE2 
1008 C  CE3 . TRP A 128 ? 0.0364 0.0203 0.0071 0.0048  -0.0007 -0.0033 128 TRP A CE3 
1009 C  CZ2 . TRP A 128 ? 0.0161 0.0236 0.0106 -0.0130 0.0065  -0.0086 128 TRP A CZ2 
1010 C  CZ3 . TRP A 128 ? 0.0479 0.0312 0.0118 -0.0245 0.0059  0.0034  128 TRP A CZ3 
1011 C  CH2 . TRP A 128 ? 0.0135 0.0130 0.0118 -0.0069 0.0061  -0.0056 128 TRP A CH2 
1012 N  N   . ALA A 129 ? 0.0294 0.0461 0.0370 -0.0026 0.0013  0.0006  129 ALA A N   
1013 C  CA  . ALA A 129 ? 0.0366 0.0405 0.0305 0.0012  0.0045  0.0051  129 ALA A CA  
1014 C  C   . ALA A 129 ? 0.0291 0.0370 0.0313 -0.0007 0.0038  0.0049  129 ALA A C   
1015 O  O   . ALA A 129 ? 0.0187 0.0245 0.0252 -0.0133 0.0032  0.0049  129 ALA A O   
1016 C  CB  . ALA A 129 ? 0.0414 0.0469 0.0407 -0.0004 0.0116  0.0092  129 ALA A CB  
1017 N  N   . TRP A 130 ? 0.0189 0.0262 0.0219 -0.0068 -0.0016 -0.0054 130 TRP A N   
1018 C  CA  . TRP A 130 ? 0.0257 0.0375 0.0273 -0.0026 -0.0032 0.0043  130 TRP A CA  
1019 C  C   . TRP A 130 ? 0.0258 0.0331 0.0368 -0.0040 -0.0029 0.0060  130 TRP A C   
1020 O  O   . TRP A 130 ? 0.0287 0.0360 0.0363 -0.0032 -0.0014 0.0164  130 TRP A O   
1021 C  CB  . TRP A 130 ? 0.0251 0.0236 0.0353 -0.0060 -0.0072 0.0020  130 TRP A CB  
1022 C  CG  . TRP A 130 ? 0.0097 0.0286 0.0124 -0.0082 -0.0018 0.0006  130 TRP A CG  
1023 C  CD1 . TRP A 130 ? 0.0194 0.0177 0.0063 -0.0122 -0.0004 0.0003  130 TRP A CD1 
1024 C  CD2 . TRP A 130 ? 0.0178 0.0177 0.0065 -0.0074 -0.0016 0.0012  130 TRP A CD2 
1025 N  NE1 . TRP A 130 ? 0.0139 0.0201 0.0243 -0.0101 -0.0001 0.0030  130 TRP A NE1 
1026 C  CE2 . TRP A 130 ? 0.0121 0.0124 0.0067 -0.0059 0.0015  -0.0015 130 TRP A CE2 
1027 C  CE3 . TRP A 130 ? 0.0217 0.0393 0.0146 0.0059  0.0112  0.0037  130 TRP A CE3 
1028 C  CZ2 . TRP A 130 ? 0.0379 0.0224 0.0213 0.0043  -0.0018 -0.0076 130 TRP A CZ2 
1029 C  CZ3 . TRP A 130 ? 0.0221 0.0523 0.0352 -0.0005 -0.0024 -0.0055 130 TRP A CZ3 
1030 C  CH2 . TRP A 130 ? 0.0421 0.0342 0.0287 0.0160  0.0026  -0.0161 130 TRP A CH2 
1031 N  N   . LEU A 131 ? 0.0313 0.0544 0.0533 -0.0048 -0.0010 0.0080  131 LEU A N   
1032 C  CA  . LEU A 131 ? 0.0475 0.0606 0.0522 -0.0010 -0.0029 0.0076  131 LEU A CA  
1033 C  C   . LEU A 131 ? 0.0531 0.0684 0.0521 -0.0035 0.0000  0.0056  131 LEU A C   
1034 O  O   . LEU A 131 ? 0.0474 0.0547 0.0380 0.0034  0.0014  -0.0024 131 LEU A O   
1035 C  CB  . LEU A 131 ? 0.0469 0.0688 0.0581 0.0017  0.0033  0.0050  131 LEU A CB  
1036 C  CG  . LEU A 131 ? 0.0666 0.0587 0.0671 0.0069  -0.0057 0.0068  131 LEU A CG  
1037 C  CD1 . LEU A 131 ? 0.0419 0.0557 0.0583 -0.0007 -0.0036 0.0247  131 LEU A CD1 
1038 C  CD2 . LEU A 131 ? 0.0939 0.0610 0.0720 0.0123  -0.0101 0.0147  131 LEU A CD2 
1039 N  N   . VAL A 132 ? 0.0469 0.0681 0.0422 -0.0069 -0.0012 0.0031  132 VAL A N   
1040 C  CA  . VAL A 132 ? 0.0494 0.0681 0.0478 -0.0065 -0.0029 0.0047  132 VAL A CA  
1041 C  C   . VAL A 132 ? 0.0494 0.0747 0.0520 -0.0137 -0.0030 0.0043  132 VAL A C   
1042 O  O   . VAL A 132 ? 0.0444 0.0781 0.0402 -0.0269 0.0022  0.0115  132 VAL A O   
1043 C  CB  . VAL A 132 ? 0.0610 0.0777 0.0498 -0.0085 -0.0024 0.0051  132 VAL A CB  
1044 C  CG1 . VAL A 132 ? 0.0698 0.0755 0.0435 0.0000  -0.0088 0.0116  132 VAL A CG1 
1045 C  CG2 . VAL A 132 ? 0.0674 0.0646 0.0630 -0.0164 -0.0085 -0.0032 132 VAL A CG2 
1046 N  N   . LEU A 133 ? 0.0398 0.0687 0.0539 -0.0104 -0.0016 -0.0002 133 LEU A N   
1047 C  CA  . LEU A 133 ? 0.0498 0.0681 0.0625 -0.0049 -0.0020 -0.0022 133 LEU A CA  
1048 C  C   . LEU A 133 ? 0.0465 0.0700 0.0638 -0.0077 0.0016  0.0013  133 LEU A C   
1049 O  O   . LEU A 133 ? 0.0517 0.0650 0.0729 -0.0010 -0.0083 -0.0011 133 LEU A O   
1050 C  CB  . LEU A 133 ? 0.0491 0.0699 0.0761 0.0032  0.0015  -0.0024 133 LEU A CB  
1051 C  CG  . LEU A 133 ? 0.0667 0.0931 0.0831 -0.0143 -0.0038 -0.0064 133 LEU A CG  
1052 C  CD1 . LEU A 133 ? 0.0929 0.1138 0.0985 0.0039  -0.0041 0.0048  133 LEU A CD1 
1053 C  CD2 . LEU A 133 ? 0.0686 0.0885 0.1116 0.0033  0.0054  -0.0076 133 LEU A CD2 
1054 N  N   . LYS A 134 ? 0.0485 0.0658 0.0616 -0.0081 -0.0069 0.0040  134 LYS A N   
1055 C  CA  . LYS A 134 ? 0.0611 0.0900 0.0746 -0.0139 -0.0079 0.0059  134 LYS A CA  
1056 C  C   . LYS A 134 ? 0.0659 0.1085 0.0816 -0.0159 -0.0060 0.0040  134 LYS A C   
1057 O  O   . LYS A 134 ? 0.0572 0.1172 0.0840 -0.0177 -0.0079 0.0065  134 LYS A O   
1058 C  CB  . LYS A 134 ? 0.0764 0.0779 0.0790 -0.0196 -0.0054 -0.0021 134 LYS A CB  
1059 C  CG  . LYS A 134 ? 0.0826 0.0797 0.0859 -0.0147 -0.0091 0.0123  134 LYS A CG  
1060 C  CD  . LYS A 134 ? 0.0998 0.1136 0.1108 -0.0122 -0.0076 0.0012  134 LYS A CD  
1061 C  CE  . LYS A 134 ? 0.1148 0.1170 0.1139 -0.0150 -0.0152 0.0013  134 LYS A CE  
1062 N  NZ  . LYS A 134 ? 0.1468 0.1624 0.1361 -0.0099 0.0107  0.0092  134 LYS A NZ  
1063 N  N   . GLY A 135 ? 0.0665 0.1074 0.0858 -0.0142 -0.0027 0.0014  135 GLY A N   
1064 C  CA  . GLY A 135 ? 0.0735 0.1249 0.1041 -0.0090 -0.0012 0.0077  135 GLY A CA  
1065 C  C   . GLY A 135 ? 0.0771 0.1224 0.1031 -0.0142 0.0024  0.0101  135 GLY A C   
1066 O  O   . GLY A 135 ? 0.0716 0.1441 0.1058 -0.0121 -0.0008 0.0203  135 GLY A O   
1067 N  N   . ASP A 136 ? 0.0854 0.1250 0.1203 -0.0063 0.0033  0.0104  136 ASP A N   
1068 C  CA  . ASP A 136 ? 0.1027 0.1271 0.1244 -0.0009 0.0013  0.0084  136 ASP A CA  
1069 C  C   . ASP A 136 ? 0.1001 0.1228 0.1224 0.0030  0.0007  0.0083  136 ASP A C   
1070 O  O   . ASP A 136 ? 0.1003 0.1261 0.1288 0.0076  -0.0017 0.0109  136 ASP A O   
1071 C  CB  . ASP A 136 ? 0.1062 0.1320 0.1298 -0.0002 0.0012  0.0085  136 ASP A CB  
1072 C  CG  . ASP A 136 ? 0.1258 0.1514 0.1442 -0.0100 0.0022  0.0039  136 ASP A CG  
1073 O  OD1 . ASP A 136 ? 0.1379 0.1550 0.1633 -0.0190 -0.0059 0.0030  136 ASP A OD1 
1074 O  OD2 . ASP A 136 ? 0.1440 0.1815 0.1558 -0.0071 0.0129  -0.0074 136 ASP A OD2 
1075 N  N   . LYS A 137 ? 0.0937 0.1180 0.1013 0.0058  0.0012  0.0063  137 LYS A N   
1076 C  CA  . LYS A 137 ? 0.0980 0.1199 0.1091 -0.0012 -0.0039 0.0040  137 LYS A CA  
1077 C  C   . LYS A 137 ? 0.0929 0.1079 0.0999 -0.0022 -0.0002 0.0069  137 LYS A C   
1078 O  O   . LYS A 137 ? 0.1052 0.1140 0.0986 -0.0018 -0.0077 0.0124  137 LYS A O   
1079 C  CB  . LYS A 137 ? 0.0978 0.1238 0.1082 -0.0003 0.0025  0.0021  137 LYS A CB  
1080 C  CG  . LYS A 137 ? 0.1084 0.1336 0.1245 -0.0006 -0.0014 -0.0057 137 LYS A CG  
1081 C  CD  . LYS A 137 ? 0.1320 0.1221 0.1416 -0.0025 0.0083  -0.0119 137 LYS A CD  
1082 C  CE  . LYS A 137 ? 0.1430 0.1119 0.1331 0.0025  -0.0036 -0.0113 137 LYS A CE  
1083 N  NZ  . LYS A 137 ? 0.1445 0.1115 0.1441 -0.0117 -0.0062 -0.0071 137 LYS A NZ  
1084 N  N   . LEU A 138 ? 0.0966 0.1051 0.0916 -0.0053 -0.0032 0.0059  138 LEU A N   
1085 C  CA  . LEU A 138 ? 0.0820 0.0899 0.0761 -0.0057 0.0013  0.0056  138 LEU A CA  
1086 C  C   . LEU A 138 ? 0.0888 0.0957 0.0833 -0.0064 -0.0005 0.0041  138 LEU A C   
1087 O  O   . LEU A 138 ? 0.0966 0.1014 0.0785 -0.0088 0.0020  0.0063  138 LEU A O   
1088 C  CB  . LEU A 138 ? 0.0665 0.0787 0.0695 -0.0071 0.0018  0.0017  138 LEU A CB  
1089 C  CG  . LEU A 138 ? 0.0703 0.0656 0.0587 -0.0072 -0.0099 0.0032  138 LEU A CG  
1090 C  CD1 . LEU A 138 ? 0.0694 0.0625 0.0552 0.0009  -0.0227 -0.0015 138 LEU A CD1 
1091 C  CD2 . LEU A 138 ? 0.0521 0.0669 0.0657 -0.0254 -0.0191 0.0228  138 LEU A CD2 
1092 N  N   . ALA A 139 ? 0.0842 0.0805 0.0757 -0.0033 0.0002  0.0091  139 ALA A N   
1093 C  CA  . ALA A 139 ? 0.0768 0.0734 0.0792 -0.0094 -0.0012 0.0030  139 ALA A CA  
1094 C  C   . ALA A 139 ? 0.0760 0.0664 0.0691 -0.0028 -0.0067 0.0017  139 ALA A C   
1095 O  O   . ALA A 139 ? 0.0700 0.0653 0.0626 -0.0159 -0.0019 0.0013  139 ALA A O   
1096 C  CB  . ALA A 139 ? 0.0856 0.0700 0.0733 -0.0041 0.0003  -0.0002 139 ALA A CB  
1097 N  N   . VAL A 140 ? 0.0727 0.0700 0.0668 -0.0080 -0.0061 -0.0003 140 VAL A N   
1098 C  CA  . VAL A 140 ? 0.0662 0.0669 0.0657 0.0023  -0.0086 0.0010  140 VAL A CA  
1099 C  C   . VAL A 140 ? 0.0790 0.0732 0.0687 0.0065  -0.0097 -0.0024 140 VAL A C   
1100 O  O   . VAL A 140 ? 0.0727 0.0661 0.0636 0.0126  -0.0138 -0.0054 140 VAL A O   
1101 C  CB  . VAL A 140 ? 0.0715 0.0719 0.0765 0.0014  -0.0112 0.0056  140 VAL A CB  
1102 C  CG1 . VAL A 140 ? 0.0620 0.0796 0.0868 -0.0065 0.0012  0.0034  140 VAL A CG1 
1103 C  CG2 . VAL A 140 ? 0.0887 0.0741 0.0984 0.0031  -0.0115 -0.0042 140 VAL A CG2 
1104 N  N   . VAL A 141 ? 0.0782 0.0715 0.0629 0.0086  -0.0100 0.0003  141 VAL A N   
1105 C  CA  . VAL A 141 ? 0.0746 0.0782 0.0717 0.0046  -0.0061 0.0016  141 VAL A CA  
1106 C  C   . VAL A 141 ? 0.0743 0.0712 0.0660 -0.0013 -0.0016 0.0044  141 VAL A C   
1107 O  O   . VAL A 141 ? 0.0782 0.0811 0.0725 -0.0023 0.0052  0.0065  141 VAL A O   
1108 C  CB  . VAL A 141 ? 0.0795 0.0658 0.0663 0.0065  -0.0068 0.0003  141 VAL A CB  
1109 C  CG1 . VAL A 141 ? 0.1054 0.1073 0.0949 -0.0004 -0.0017 -0.0007 141 VAL A CG1 
1110 C  CG2 . VAL A 141 ? 0.0801 0.0896 0.0907 0.0193  -0.0083 0.0034  141 VAL A CG2 
1111 N  N   . SER A 142 ? 0.0688 0.0696 0.0688 -0.0014 -0.0041 0.0027  142 SER A N   
1112 C  CA  . SER A 142 ? 0.0517 0.0462 0.0541 -0.0018 -0.0003 0.0025  142 SER A CA  
1113 C  C   . SER A 142 ? 0.0516 0.0526 0.0524 -0.0016 -0.0017 0.0000  142 SER A C   
1114 O  O   . SER A 142 ? 0.0544 0.0470 0.0519 -0.0046 -0.0134 -0.0002 142 SER A O   
1115 C  CB  . SER A 142 ? 0.0702 0.0442 0.0513 -0.0006 0.0034  0.0000  142 SER A CB  
1116 O  OG  . SER A 142 ? 0.0468 0.0206 0.0417 0.0023  0.0062  0.0174  142 SER A OG  
1117 N  N   . THR A 143 ? 0.0297 0.0413 0.0376 -0.0003 -0.0007 -0.0010 143 THR A N   
1118 C  CA  . THR A 143 ? 0.0200 0.0363 0.0374 -0.0006 0.0019  -0.0044 143 THR A CA  
1119 C  C   . THR A 143 ? 0.0183 0.0290 0.0293 -0.0037 0.0003  -0.0040 143 THR A C   
1120 O  O   . THR A 143 ? 0.0073 0.0206 0.0418 0.0000  -0.0053 -0.0102 143 THR A O   
1121 C  CB  . THR A 143 ? 0.0127 0.0421 0.0316 -0.0082 -0.0030 -0.0031 143 THR A CB  
1122 O  OG1 . THR A 143 ? 0.0336 0.0325 0.0261 -0.0048 0.0173  -0.0151 143 THR A OG1 
1123 C  CG2 . THR A 143 ? 0.0082 0.0655 0.0594 -0.0013 0.0023  -0.0138 143 THR A CG2 
1124 N  N   . ALA A 144 ? 0.0102 0.0178 0.0201 -0.0028 -0.0009 -0.0073 144 ALA A N   
1125 C  CA  . ALA A 144 ? 0.0197 0.0225 0.0326 -0.0093 0.0063  -0.0064 144 ALA A CA  
1126 C  C   . ALA A 144 ? 0.0256 0.0331 0.0333 -0.0123 0.0061  -0.0009 144 ALA A C   
1127 O  O   . ALA A 144 ? 0.0247 0.0439 0.0393 -0.0211 0.0164  -0.0030 144 ALA A O   
1128 C  CB  . ALA A 144 ? 0.0234 0.0288 0.0407 -0.0050 0.0058  -0.0110 144 ALA A CB  
1129 N  N   . ASN A 145 ? 0.0129 0.0273 0.0216 -0.0085 0.0036  -0.0013 145 ASN A N   
1130 C  CA  . ASN A 145 ? 0.0134 0.0280 0.0268 -0.0090 0.0000  -0.0008 145 ASN A CA  
1131 C  C   . ASN A 145 ? 0.0147 0.0274 0.0178 -0.0123 -0.0015 -0.0031 145 ASN A C   
1132 O  O   . ASN A 145 ? 0.0064 0.0209 0.0172 -0.0014 0.0012  -0.0126 145 ASN A O   
1133 C  CB  . ASN A 145 ? 0.0128 0.0291 0.0289 -0.0023 -0.0016 -0.0058 145 ASN A CB  
1134 C  CG  . ASN A 145 ? 0.0153 0.0279 0.0238 -0.0092 0.0093  0.0000  145 ASN A CG  
1135 O  OD1 . ASN A 145 ? 0.0452 0.0135 0.0123 -0.0150 0.0134  -0.0038 145 ASN A OD1 
1136 N  ND2 . ASN A 145 ? 0.0376 0.0498 0.0853 -0.0180 0.0129  -0.0066 145 ASN A ND2 
1137 N  N   . GLN A 146 ? 0.0130 0.0274 0.0162 -0.0094 -0.0046 -0.0006 146 GLN A N   
1138 C  CA  . GLN A 146 ? 0.0125 0.0226 0.0208 -0.0065 -0.0034 0.0014  146 GLN A CA  
1139 C  C   . GLN A 146 ? 0.0114 0.0106 0.0200 -0.0046 -0.0003 0.0007  146 GLN A C   
1140 O  O   . GLN A 146 ? 0.0137 0.0111 0.0119 -0.0059 -0.0026 0.0022  146 GLN A O   
1141 C  CB  . GLN A 146 ? 0.0087 0.0207 0.0162 -0.0057 -0.0021 0.0077  146 GLN A CB  
1142 C  CG  . GLN A 146 ? 0.0124 0.0180 0.0161 -0.0083 -0.0038 0.0040  146 GLN A CG  
1143 C  CD  . GLN A 146 ? 0.0071 0.0238 0.0148 -0.0036 -0.0025 0.0122  146 GLN A CD  
1144 O  OE1 . GLN A 146 ? 0.0322 0.0330 0.0304 -0.0229 -0.0002 0.0127  146 GLN A OE1 
1145 N  NE2 . GLN A 146 ? 0.0372 0.0253 0.0231 -0.0242 0.0041  -0.0029 146 GLN A NE2 
1146 N  N   . ASP A 147 ? 0.0129 0.0194 0.0294 -0.0093 0.0001  0.0001  147 ASP A N   
1147 C  CA  . ASP A 147 ? 0.0114 0.0328 0.0293 -0.0116 0.0008  -0.0001 147 ASP A CA  
1148 C  C   . ASP A 147 ? 0.0206 0.0293 0.0306 -0.0147 -0.0038 -0.0028 147 ASP A C   
1149 O  O   . ASP A 147 ? 0.0169 0.0278 0.0334 -0.0113 -0.0024 0.0012  147 ASP A O   
1150 C  CB  . ASP A 147 ? 0.0206 0.0288 0.0402 -0.0103 -0.0053 -0.0023 147 ASP A CB  
1151 C  CG  . ASP A 147 ? 0.0208 0.0425 0.0264 -0.0050 0.0074  0.0030  147 ASP A CG  
1152 O  OD1 . ASP A 147 ? 0.0313 0.0187 0.0324 -0.0164 -0.0048 -0.0031 147 ASP A OD1 
1153 O  OD2 . ASP A 147 ? 0.0274 0.0156 0.0101 -0.0135 -0.0017 -0.0003 147 ASP A OD2 
1154 N  N   . SER A 148 ? 0.0249 0.0307 0.0381 -0.0148 0.0007  -0.0049 148 SER A N   
1155 C  CA  . SER A 148 ? 0.0330 0.0297 0.0423 -0.0152 -0.0044 0.0026  148 SER A CA  
1156 C  C   . SER A 148 ? 0.0364 0.0353 0.0528 -0.0133 -0.0071 0.0025  148 SER A C   
1157 O  O   . SER A 148 ? 0.0217 0.0086 0.0463 -0.0022 -0.0108 0.0095  148 SER A O   
1158 C  CB  . SER A 148 ? 0.0435 0.0231 0.0407 -0.0142 0.0082  -0.0002 148 SER A CB  
1159 O  OG  . SER A 148 ? 0.0441 0.0236 0.0510 -0.0254 -0.0278 0.0163  148 SER A OG  
1160 N  N   . PRO A 149 ? 0.0354 0.0270 0.0576 -0.0089 -0.0026 0.0068  149 PRO A N   
1161 C  CA  . PRO A 149 ? 0.0352 0.0258 0.0574 -0.0105 -0.0057 0.0048  149 PRO A CA  
1162 C  C   . PRO A 149 ? 0.0391 0.0396 0.0473 -0.0079 -0.0014 -0.0017 149 PRO A C   
1163 O  O   . PRO A 149 ? 0.0423 0.0259 0.0418 -0.0128 -0.0076 -0.0052 149 PRO A O   
1164 C  CB  . PRO A 149 ? 0.0325 0.0417 0.0683 -0.0072 -0.0040 0.0057  149 PRO A CB  
1165 C  CG  . PRO A 149 ? 0.0542 0.0351 0.0832 -0.0098 0.0009  0.0096  149 PRO A CG  
1166 C  CD  . PRO A 149 ? 0.0420 0.0245 0.0521 -0.0065 0.0003  0.0095  149 PRO A CD  
1167 N  N   . LEU A 150 ? 0.0334 0.0398 0.0401 -0.0122 -0.0030 -0.0003 150 LEU A N   
1168 C  CA  . LEU A 150 ? 0.0275 0.0438 0.0396 -0.0138 -0.0002 0.0010  150 LEU A CA  
1169 C  C   . LEU A 150 ? 0.0410 0.0486 0.0408 -0.0091 -0.0005 0.0005  150 LEU A C   
1170 O  O   . LEU A 150 ? 0.0557 0.0527 0.0673 -0.0211 -0.0014 0.0038  150 LEU A O   
1171 C  CB  . LEU A 150 ? 0.0281 0.0440 0.0406 -0.0113 0.0058  -0.0023 150 LEU A CB  
1172 C  CG  . LEU A 150 ? 0.0070 0.0507 0.0403 -0.0040 -0.0004 0.0053  150 LEU A CG  
1173 C  CD1 . LEU A 150 ? 0.0201 0.0298 0.0420 -0.0029 0.0169  -0.0030 150 LEU A CD1 
1174 C  CD2 . LEU A 150 ? 0.0092 0.0396 0.0103 -0.0024 -0.0033 0.0046  150 LEU A CD2 
1175 N  N   . MET A 151 ? 0.0416 0.0474 0.0431 -0.0089 -0.0037 0.0072  151 MET A N   
1176 C  CA  . MET A 151 ? 0.0363 0.0360 0.0326 -0.0075 0.0028  0.0000  151 MET A CA  
1177 C  C   . MET A 151 ? 0.0484 0.0491 0.0524 -0.0090 -0.0027 0.0047  151 MET A C   
1178 O  O   . MET A 151 ? 0.0423 0.0249 0.0493 -0.0110 -0.0060 -0.0153 151 MET A O   
1179 C  CB  . MET A 151 ? 0.0487 0.0571 0.0402 -0.0091 0.0045  0.0063  151 MET A CB  
1180 C  CG  . MET A 151 ? 0.0215 0.0495 0.0247 -0.0068 0.0142  0.0078  151 MET A CG  
1181 S  SD  . MET A 151 ? 0.0203 0.0428 0.0251 -0.0216 -0.0022 0.0111  151 MET A SD  
1182 C  CE  . MET A 151 ? 0.0449 0.0713 0.0147 -0.0143 -0.0112 0.0176  151 MET A CE  
1183 N  N   . GLY A 152 ? 0.0488 0.0473 0.0537 -0.0091 -0.0050 0.0038  152 GLY A N   
1184 C  CA  . GLY A 152 ? 0.0492 0.0545 0.0545 -0.0037 -0.0071 0.0027  152 GLY A CA  
1185 C  C   . GLY A 152 ? 0.0606 0.0566 0.0634 -0.0043 -0.0054 0.0024  152 GLY A C   
1186 O  O   . GLY A 152 ? 0.0551 0.0497 0.0563 -0.0036 -0.0072 0.0002  152 GLY A O   
1187 N  N   . GLU A 153 ? 0.0674 0.0664 0.0694 0.0002  -0.0104 0.0008  153 GLU A N   
1188 C  CA  . GLU A 153 ? 0.0737 0.0770 0.0917 0.0013  -0.0063 0.0000  153 GLU A CA  
1189 C  C   . GLU A 153 ? 0.0795 0.0772 0.0956 -0.0007 -0.0040 0.0007  153 GLU A C   
1190 O  O   . GLU A 153 ? 0.0722 0.0750 0.0964 0.0077  -0.0020 -0.0042 153 GLU A O   
1191 C  CB  . GLU A 153 ? 0.0897 0.0773 0.0966 0.0002  -0.0105 -0.0011 153 GLU A CB  
1192 C  CG  . GLU A 153 ? 0.0984 0.1100 0.1212 -0.0031 -0.0072 -0.0055 153 GLU A CG  
1193 C  CD  . GLU A 153 ? 0.1489 0.1509 0.1504 -0.0041 -0.0124 -0.0085 153 GLU A CD  
1194 O  OE1 . GLU A 153 ? 0.1412 0.1734 0.1876 -0.0109 -0.0157 -0.0121 153 GLU A OE1 
1195 O  OE2 . GLU A 153 ? 0.2038 0.1895 0.1865 -0.0013 -0.0048 -0.0144 153 GLU A OE2 
1196 N  N   . ALA A 154 ? 0.0759 0.0798 0.0972 0.0020  -0.0063 0.0034  154 ALA A N   
1197 C  CA  . ALA A 154 ? 0.0786 0.0755 0.0918 -0.0006 -0.0030 0.0045  154 ALA A CA  
1198 C  C   . ALA A 154 ? 0.0714 0.0756 0.0923 -0.0029 0.0023  0.0042  154 ALA A C   
1199 O  O   . ALA A 154 ? 0.0849 0.0813 0.1004 -0.0047 0.0012  0.0017  154 ALA A O   
1200 C  CB  . ALA A 154 ? 0.0780 0.0710 0.1016 -0.0011 0.0011  0.0061  154 ALA A CB  
1201 N  N   . ILE A 155 ? 0.0655 0.0835 0.0853 -0.0092 -0.0035 0.0059  155 ILE A N   
1202 C  CA  . ILE A 155 ? 0.0621 0.0702 0.0756 -0.0072 -0.0030 0.0073  155 ILE A CA  
1203 C  C   . ILE A 155 ? 0.0595 0.0724 0.0766 -0.0045 0.0015  0.0041  155 ILE A C   
1204 O  O   . ILE A 155 ? 0.0633 0.0668 0.0768 -0.0088 0.0144  0.0056  155 ILE A O   
1205 C  CB  . ILE A 155 ? 0.0669 0.0682 0.0885 -0.0049 -0.0025 0.0040  155 ILE A CB  
1206 C  CG1 . ILE A 155 ? 0.0766 0.0724 0.0729 -0.0196 0.0018  0.0025  155 ILE A CG1 
1207 C  CG2 . ILE A 155 ? 0.0704 0.0773 0.0660 -0.0145 -0.0140 0.0057  155 ILE A CG2 
1208 C  CD1 . ILE A 155 ? 0.0769 0.0838 0.0899 -0.0106 0.0015  0.0054  155 ILE A CD1 
1209 N  N   . SER A 156 ? 0.0569 0.0627 0.0641 -0.0051 0.0038  0.0062  156 SER A N   
1210 C  CA  . SER A 156 ? 0.0449 0.0657 0.0639 -0.0077 0.0012  0.0076  156 SER A CA  
1211 C  C   . SER A 156 ? 0.0518 0.0631 0.0699 -0.0036 0.0008  0.0050  156 SER A C   
1212 O  O   . SER A 156 ? 0.0303 0.0566 0.0578 0.0044  0.0068  0.0091  156 SER A O   
1213 C  CB  . SER A 156 ? 0.0485 0.0713 0.0640 -0.0065 -0.0018 0.0129  156 SER A CB  
1214 O  OG  . SER A 156 ? 0.0146 0.0802 0.0556 -0.0227 0.0048  0.0097  156 SER A OG  
1215 N  N   . GLY A 157 ? 0.0546 0.0701 0.0756 -0.0077 -0.0046 0.0008  157 GLY A N   
1216 C  CA  . GLY A 157 ? 0.0694 0.0786 0.0843 -0.0087 -0.0051 0.0000  157 GLY A CA  
1217 C  C   . GLY A 157 ? 0.0759 0.0687 0.0872 -0.0141 -0.0045 0.0016  157 GLY A C   
1218 O  O   . GLY A 157 ? 0.0826 0.0778 0.0903 -0.0120 -0.0042 0.0094  157 GLY A O   
1219 N  N   . ALA A 158 ? 0.0796 0.0725 0.0870 -0.0163 -0.0043 0.0000  158 ALA A N   
1220 C  CA  . ALA A 158 ? 0.0748 0.0727 0.0779 -0.0164 -0.0078 0.0011  158 ALA A CA  
1221 C  C   . ALA A 158 ? 0.0730 0.0654 0.0714 -0.0143 -0.0089 0.0016  158 ALA A C   
1222 O  O   . ALA A 158 ? 0.0864 0.0627 0.0797 -0.0243 -0.0144 0.0039  158 ALA A O   
1223 C  CB  . ALA A 158 ? 0.0836 0.0692 0.0749 -0.0125 -0.0039 0.0041  158 ALA A CB  
1224 N  N   . SER A 159 ? 0.0667 0.0642 0.0631 -0.0170 -0.0085 0.0040  159 SER A N   
1225 C  CA  . SER A 159 ? 0.0599 0.0630 0.0711 -0.0082 -0.0090 -0.0024 159 SER A CA  
1226 C  C   . SER A 159 ? 0.0662 0.0656 0.0757 -0.0098 -0.0082 0.0023  159 SER A C   
1227 O  O   . SER A 159 ? 0.0717 0.0647 0.0841 -0.0029 -0.0110 0.0068  159 SER A O   
1228 C  CB  . SER A 159 ? 0.0660 0.0584 0.0778 -0.0062 -0.0076 0.0067  159 SER A CB  
1229 O  OG  . SER A 159 ? 0.0691 0.0281 0.0729 -0.0094 -0.0055 -0.0162 159 SER A OG  
1230 N  N   . GLY A 160 ? 0.0658 0.0747 0.0901 -0.0068 -0.0139 -0.0039 160 GLY A N   
1231 C  CA  . GLY A 160 ? 0.0657 0.0768 0.0887 -0.0022 -0.0092 0.0011  160 GLY A CA  
1232 C  C   . GLY A 160 ? 0.0679 0.0772 0.0818 -0.0034 -0.0077 0.0056  160 GLY A C   
1233 O  O   . GLY A 160 ? 0.0748 0.0946 0.1047 0.0023  -0.0112 0.0126  160 GLY A O   
1234 N  N   . PHE A 161 ? 0.0584 0.0768 0.0755 -0.0014 -0.0005 0.0072  161 PHE A N   
1235 C  CA  . PHE A 161 ? 0.0531 0.0610 0.0683 -0.0032 -0.0015 0.0049  161 PHE A CA  
1236 C  C   . PHE A 161 ? 0.0591 0.0585 0.0642 -0.0051 -0.0033 0.0035  161 PHE A C   
1237 O  O   . PHE A 161 ? 0.0563 0.0401 0.0568 -0.0127 -0.0072 -0.0003 161 PHE A O   
1238 C  CB  . PHE A 161 ? 0.0577 0.0697 0.0718 0.0012  0.0006  0.0046  161 PHE A CB  
1239 C  CG  . PHE A 161 ? 0.0697 0.0714 0.0779 -0.0019 0.0033  0.0088  161 PHE A CG  
1240 C  CD1 . PHE A 161 ? 0.0789 0.0879 0.0916 -0.0103 -0.0069 -0.0017 161 PHE A CD1 
1241 C  CD2 . PHE A 161 ? 0.0926 0.0951 0.0887 0.0042  0.0018  0.0020  161 PHE A CD2 
1242 C  CE1 . PHE A 161 ? 0.0847 0.0977 0.0905 0.0051  0.0060  -0.0091 161 PHE A CE1 
1243 C  CE2 . PHE A 161 ? 0.1048 0.1025 0.0886 0.0006  0.0087  0.0040  161 PHE A CE2 
1244 C  CZ  . PHE A 161 ? 0.0903 0.0930 0.0918 0.0091  0.0007  0.0033  161 PHE A CZ  
1245 N  N   . PRO A 162 ? 0.0585 0.0579 0.0627 -0.0081 -0.0058 0.0087  162 PRO A N   
1246 C  CA  . PRO A 162 ? 0.0639 0.0588 0.0658 -0.0099 -0.0083 0.0091  162 PRO A CA  
1247 C  C   . PRO A 162 ? 0.0657 0.0671 0.0613 -0.0052 -0.0039 0.0043  162 PRO A C   
1248 O  O   . PRO A 162 ? 0.0769 0.0776 0.0752 -0.0106 -0.0082 0.0010  162 PRO A O   
1249 C  CB  . PRO A 162 ? 0.0603 0.0549 0.0657 0.0012  -0.0041 0.0077  162 PRO A CB  
1250 C  CG  . PRO A 162 ? 0.0595 0.0466 0.0685 -0.0083 -0.0087 0.0078  162 PRO A CG  
1251 C  CD  . PRO A 162 ? 0.0685 0.0659 0.0687 -0.0034 -0.0067 0.0079  162 PRO A CD  
1252 N  N   . ILE A 163 ? 0.0630 0.0644 0.0676 -0.0112 -0.0068 0.0061  163 ILE A N   
1253 C  CA  . ILE A 163 ? 0.0590 0.0651 0.0565 -0.0047 -0.0062 0.0069  163 ILE A CA  
1254 C  C   . ILE A 163 ? 0.0583 0.0576 0.0586 -0.0084 -0.0004 0.0086  163 ILE A C   
1255 O  O   . ILE A 163 ? 0.0714 0.0435 0.0601 0.0053  0.0106  0.0128  163 ILE A O   
1256 C  CB  . ILE A 163 ? 0.0493 0.0699 0.0501 -0.0054 -0.0045 0.0057  163 ILE A CB  
1257 C  CG1 . ILE A 163 ? 0.0513 0.0594 0.0347 -0.0053 0.0078  0.0116  163 ILE A CG1 
1258 C  CG2 . ILE A 163 ? 0.0553 0.0813 0.0690 -0.0051 -0.0098 -0.0033 163 ILE A CG2 
1259 C  CD1 . ILE A 163 ? 0.0480 0.0690 0.0447 0.0039  0.0279  -0.0057 163 ILE A CD1 
1260 N  N   . MET A 164 ? 0.0658 0.0592 0.0679 -0.0038 -0.0045 -0.0022 164 MET A N   
1261 C  CA  . MET A 164 ? 0.0608 0.0636 0.0744 -0.0042 -0.0001 0.0040  164 MET A CA  
1262 C  C   . MET A 164 ? 0.0561 0.0591 0.0692 -0.0071 0.0021  0.0017  164 MET A C   
1263 O  O   . MET A 164 ? 0.0443 0.0704 0.0579 -0.0032 0.0022  -0.0031 164 MET A O   
1264 C  CB  . MET A 164 ? 0.0734 0.0589 0.0968 -0.0100 0.0014  0.0038  164 MET A CB  
1265 C  CG  . MET A 164 ? 0.1176 0.1120 0.1226 0.0030  0.0104  0.0046  164 MET A CG  
1266 S  SD  . MET A 164 ? 0.0960 0.0775 0.0792 -0.0219 -0.0156 0.0270  164 MET A SD  
1267 C  CE  . MET A 164 ? 0.1203 0.0894 0.0732 -0.0047 -0.0108 0.0109  164 MET A CE  
1268 N  N   . GLY A 165 ? 0.0361 0.0515 0.0605 0.0023  0.0012  0.0029  165 GLY A N   
1269 C  CA  . GLY A 165 ? 0.0378 0.0452 0.0511 -0.0014 0.0036  -0.0009 165 GLY A CA  
1270 C  C   . GLY A 165 ? 0.0454 0.0460 0.0446 -0.0028 0.0021  0.0057  165 GLY A C   
1271 O  O   . GLY A 165 ? 0.0638 0.0567 0.0413 -0.0106 0.0059  0.0077  165 GLY A O   
1272 N  N   . LEU A 166 ? 0.0287 0.0448 0.0365 -0.0046 0.0007  0.0084  166 LEU A N   
1273 C  CA  . LEU A 166 ? 0.0448 0.0496 0.0400 -0.0019 0.0004  0.0084  166 LEU A CA  
1274 C  C   . LEU A 166 ? 0.0327 0.0420 0.0327 -0.0003 -0.0021 0.0100  166 LEU A C   
1275 O  O   . LEU A 166 ? 0.0403 0.0300 0.0365 0.0058  -0.0111 0.0173  166 LEU A O   
1276 C  CB  . LEU A 166 ? 0.0449 0.0384 0.0342 -0.0008 -0.0061 0.0130  166 LEU A CB  
1277 C  CG  . LEU A 166 ? 0.0575 0.0536 0.0387 -0.0005 -0.0032 -0.0028 166 LEU A CG  
1278 C  CD1 . LEU A 166 ? 0.0507 0.0165 0.0132 0.0134  -0.0084 0.0031  166 LEU A CD1 
1279 C  CD2 . LEU A 166 ? 0.0723 0.0557 0.0482 0.0116  -0.0149 0.0147  166 LEU A CD2 
1280 N  N   . ASP A 167 ? 0.0332 0.0360 0.0283 -0.0059 0.0011  0.0107  167 ASP A N   
1281 C  CA  . ASP A 167 ? 0.0189 0.0319 0.0228 -0.0068 0.0028  0.0011  167 ASP A CA  
1282 C  C   . ASP A 167 ? 0.0287 0.0345 0.0203 -0.0084 -0.0014 0.0040  167 ASP A C   
1283 O  O   . ASP A 167 ? 0.0183 0.0256 0.0096 -0.0112 -0.0008 -0.0046 167 ASP A O   
1284 C  CB  . ASP A 167 ? 0.0092 0.0358 0.0274 -0.0084 -0.0054 0.0084  167 ASP A CB  
1285 C  CG  . ASP A 167 ? 0.0080 0.0232 0.0302 -0.0048 0.0012  0.0045  167 ASP A CG  
1286 O  OD1 . ASP A 167 ? 0.0141 0.0595 0.0213 -0.0201 -0.0048 0.0092  167 ASP A OD1 
1287 O  OD2 . ASP A 167 ? 0.0139 0.0247 0.0340 -0.0102 -0.0001 0.0117  167 ASP A OD2 
1288 N  N   . VAL A 168 ? 0.0266 0.0277 0.0168 -0.0124 0.0043  0.0064  168 VAL A N   
1289 C  CA  . VAL A 168 ? 0.0295 0.0278 0.0193 -0.0139 0.0035  -0.0020 168 VAL A CA  
1290 C  C   . VAL A 168 ? 0.0340 0.0191 0.0237 -0.0144 0.0066  -0.0016 168 VAL A C   
1291 O  O   . VAL A 168 ? 0.0380 0.0210 0.0219 -0.0204 0.0083  -0.0008 168 VAL A O   
1292 C  CB  . VAL A 168 ? 0.0234 0.0326 0.0221 -0.0182 0.0045  0.0027  168 VAL A CB  
1293 C  CG1 . VAL A 168 ? 0.0153 0.0276 0.0192 -0.0128 0.0047  -0.0122 168 VAL A CG1 
1294 C  CG2 . VAL A 168 ? 0.0390 0.0148 0.0241 -0.0062 0.0019  -0.0117 168 VAL A CG2 
1295 N  N   . TRP A 169 ? 0.0350 0.0192 0.0142 -0.0150 0.0019  -0.0072 169 TRP A N   
1296 C  CA  . TRP A 169 ? 0.0423 0.0240 0.0165 -0.0155 0.0016  -0.0019 169 TRP A CA  
1297 C  C   . TRP A 169 ? 0.0388 0.0239 0.0197 -0.0134 0.0014  -0.0010 169 TRP A C   
1298 O  O   . TRP A 169 ? 0.0379 0.0252 0.0375 -0.0202 0.0092  0.0002  169 TRP A O   
1299 C  CB  . TRP A 169 ? 0.0482 0.0193 0.0184 -0.0230 -0.0009 0.0024  169 TRP A CB  
1300 C  CG  . TRP A 169 ? 0.0386 0.0224 0.0202 -0.0134 0.0085  0.0054  169 TRP A CG  
1301 C  CD1 . TRP A 169 ? 0.0403 0.0076 0.0122 -0.0066 -0.0141 0.0027  169 TRP A CD1 
1302 C  CD2 . TRP A 169 ? 0.0223 0.0317 0.0182 -0.0135 0.0020  0.0082  169 TRP A CD2 
1303 N  NE1 . TRP A 169 ? 0.0112 0.0134 0.0138 -0.0058 -0.0060 0.0072  169 TRP A NE1 
1304 C  CE2 . TRP A 169 ? 0.0218 0.0180 0.0214 -0.0118 -0.0040 -0.0029 169 TRP A CE2 
1305 C  CE3 . TRP A 169 ? 0.0147 0.0197 0.0190 -0.0094 -0.0027 -0.0026 169 TRP A CE3 
1306 C  CZ2 . TRP A 169 ? 0.0182 0.0111 0.0063 -0.0075 0.0002  -0.0001 169 TRP A CZ2 
1307 C  CZ3 . TRP A 169 ? 0.0176 0.0364 0.0218 -0.0096 0.0049  -0.0213 169 TRP A CZ3 
1308 C  CH2 . TRP A 169 ? 0.0124 0.0064 0.0093 -0.0008 0.0042  -0.0005 169 TRP A CH2 
1309 N  N   . GLU A 170 ? 0.0370 0.0287 0.0255 -0.0195 -0.0014 0.0021  170 GLU A N   
1310 C  CA  . GLU A 170 ? 0.0409 0.0391 0.0275 -0.0162 0.0005  -0.0037 170 GLU A CA  
1311 C  C   . GLU A 170 ? 0.0393 0.0406 0.0226 -0.0123 -0.0013 -0.0044 170 GLU A C   
1312 O  O   . GLU A 170 ? 0.0505 0.0477 0.0116 -0.0094 -0.0026 -0.0136 170 GLU A O   
1313 C  CB  . GLU A 170 ? 0.0435 0.0281 0.0246 -0.0105 -0.0008 -0.0023 170 GLU A CB  
1314 C  CG  . GLU A 170 ? 0.0341 0.0234 0.0380 -0.0206 0.0038  -0.0102 170 GLU A CG  
1315 C  CD  . GLU A 170 ? 0.0337 0.0418 0.0431 -0.0167 0.0025  -0.0039 170 GLU A CD  
1316 O  OE1 . GLU A 170 ? 0.0339 0.0718 0.0196 -0.0224 0.0025  -0.0129 170 GLU A OE1 
1317 O  OE2 . GLU A 170 ? 0.0540 0.0545 0.0298 -0.0069 0.0289  0.0125  170 GLU A OE2 
1318 N  N   . HIS A 171 ? 0.0313 0.0394 0.0169 -0.0169 0.0023  -0.0081 171 HIS A N   
1319 C  CA  . HIS A 171 ? 0.0285 0.0341 0.0143 -0.0154 0.0016  -0.0057 171 HIS A CA  
1320 C  C   . HIS A 171 ? 0.0309 0.0418 0.0177 -0.0152 0.0073  -0.0068 171 HIS A C   
1321 O  O   . HIS A 171 ? 0.0218 0.0442 0.0290 -0.0238 0.0043  -0.0118 171 HIS A O   
1322 C  CB  . HIS A 171 ? 0.0274 0.0264 0.0102 -0.0125 0.0009  -0.0075 171 HIS A CB  
1323 C  CG  . HIS A 171 ? 0.0253 0.0341 0.0173 -0.0141 -0.0048 -0.0093 171 HIS A CG  
1324 N  ND1 . HIS A 171 ? 0.0374 0.0495 0.0234 -0.0064 -0.0191 0.0072  171 HIS A ND1 
1325 C  CD2 . HIS A 171 ? 0.0419 0.0470 0.0141 -0.0069 0.0001  -0.0175 171 HIS A CD2 
1326 C  CE1 . HIS A 171 ? 0.0245 0.0550 0.0262 -0.0050 0.0042  -0.0062 171 HIS A CE1 
1327 N  NE2 . HIS A 171 ? 0.0175 0.0313 0.0153 -0.0055 0.0036  -0.0150 171 HIS A NE2 
1328 N  N   . ALA A 172 ? 0.0203 0.0250 0.0073 -0.0162 0.0038  -0.0044 172 ALA A N   
1329 C  CA  . ALA A 172 ? 0.0284 0.0344 0.0131 -0.0144 -0.0026 -0.0021 172 ALA A CA  
1330 C  C   . ALA A 172 ? 0.0288 0.0281 0.0076 -0.0142 -0.0004 -0.0038 172 ALA A C   
1331 O  O   . ALA A 172 ? 0.0367 0.0346 0.0078 -0.0178 -0.0045 -0.0011 172 ALA A O   
1332 C  CB  . ALA A 172 ? 0.0170 0.0232 0.0069 -0.0134 0.0024  -0.0031 172 ALA A CB  
1333 N  N   . TYR A 173 ? 0.0302 0.0336 0.0127 -0.0238 -0.0037 -0.0008 173 TYR A N   
1334 C  CA  . TYR A 173 ? 0.0427 0.0364 0.0216 -0.0183 0.0015  -0.0029 173 TYR A CA  
1335 C  C   . TYR A 173 ? 0.0408 0.0345 0.0241 -0.0215 0.0010  -0.0081 173 TYR A C   
1336 O  O   . TYR A 173 ? 0.0540 0.0265 0.0165 -0.0270 -0.0037 -0.0047 173 TYR A O   
1337 C  CB  . TYR A 173 ? 0.0352 0.0184 0.0220 -0.0186 0.0070  -0.0056 173 TYR A CB  
1338 C  CG  . TYR A 173 ? 0.0416 0.0430 0.0373 -0.0211 0.0087  -0.0148 173 TYR A CG  
1339 C  CD1 . TYR A 173 ? 0.0312 0.0273 0.0176 -0.0154 0.0099  -0.0153 173 TYR A CD1 
1340 C  CD2 . TYR A 173 ? 0.0292 0.0301 0.0274 -0.0145 0.0022  -0.0027 173 TYR A CD2 
1341 C  CE1 . TYR A 173 ? 0.0188 0.0106 0.0076 -0.0070 0.0013  0.0000  173 TYR A CE1 
1342 C  CE2 . TYR A 173 ? 0.0156 0.0085 0.0066 -0.0045 0.0017  -0.0008 173 TYR A CE2 
1343 C  CZ  . TYR A 173 ? 0.0329 0.0296 0.0302 -0.0090 0.0095  -0.0041 173 TYR A CZ  
1344 O  OH  . TYR A 173 ? 0.0221 0.0132 0.0068 -0.0104 0.0029  -0.0019 173 TYR A OH  
1345 N  N   . TYR A 174 ? 0.0482 0.0347 0.0304 -0.0231 0.0073  -0.0040 174 TYR A N   
1346 C  CA  . TYR A 174 ? 0.0478 0.0478 0.0410 -0.0199 0.0065  -0.0019 174 TYR A CA  
1347 C  C   . TYR A 174 ? 0.0537 0.0548 0.0456 -0.0210 0.0094  -0.0027 174 TYR A C   
1348 O  O   . TYR A 174 ? 0.0674 0.0646 0.0387 -0.0252 0.0139  0.0109  174 TYR A O   
1349 C  CB  . TYR A 174 ? 0.0412 0.0378 0.0420 -0.0208 0.0100  -0.0129 174 TYR A CB  
1350 C  CG  . TYR A 174 ? 0.0344 0.0454 0.0309 -0.0149 0.0058  0.0011  174 TYR A CG  
1351 C  CD1 . TYR A 174 ? 0.0416 0.0146 0.0443 -0.0061 0.0028  -0.0170 174 TYR A CD1 
1352 C  CD2 . TYR A 174 ? 0.0283 0.0388 0.0412 -0.0130 -0.0011 -0.0055 174 TYR A CD2 
1353 C  CE1 . TYR A 174 ? 0.0252 0.0342 0.0218 -0.0230 -0.0019 0.0019  174 TYR A CE1 
1354 C  CE2 . TYR A 174 ? 0.0171 0.0269 0.0150 -0.0089 0.0037  -0.0116 174 TYR A CE2 
1355 C  CZ  . TYR A 174 ? 0.0364 0.0523 0.0405 -0.0105 0.0070  -0.0012 174 TYR A CZ  
1356 O  OH  . TYR A 174 ? 0.0801 0.0280 0.0194 -0.0232 0.0100  -0.0008 174 TYR A OH  
1357 N  N   . LEU A 175 ? 0.0619 0.0569 0.0429 -0.0215 0.0055  -0.0003 175 LEU A N   
1358 C  CA  . LEU A 175 ? 0.0746 0.0674 0.0480 -0.0156 0.0054  -0.0083 175 LEU A CA  
1359 C  C   . LEU A 175 ? 0.0731 0.0644 0.0602 -0.0163 0.0075  -0.0089 175 LEU A C   
1360 O  O   . LEU A 175 ? 0.0794 0.0638 0.0669 -0.0272 0.0144  -0.0091 175 LEU A O   
1361 C  CB  . LEU A 175 ? 0.0822 0.0727 0.0485 -0.0131 0.0051  -0.0129 175 LEU A CB  
1362 C  CG  . LEU A 175 ? 0.0740 0.0867 0.0598 0.0010  -0.0018 -0.0101 175 LEU A CG  
1363 C  CD1 . LEU A 175 ? 0.0772 0.0716 0.0465 -0.0053 0.0017  -0.0151 175 LEU A CD1 
1364 C  CD2 . LEU A 175 ? 0.0897 0.0693 0.0649 0.0062  0.0058  -0.0205 175 LEU A CD2 
1365 N  N   . LYS A 176 ? 0.0755 0.0617 0.0569 -0.0233 0.0009  -0.0071 176 LYS A N   
1366 C  CA  . LYS A 176 ? 0.0662 0.0511 0.0475 -0.0240 0.0007  -0.0072 176 LYS A CA  
1367 C  C   . LYS A 176 ? 0.0752 0.0567 0.0505 -0.0207 0.0074  -0.0033 176 LYS A C   
1368 O  O   . LYS A 176 ? 0.0926 0.0576 0.0319 -0.0318 0.0134  0.0044  176 LYS A O   
1369 C  CB  . LYS A 176 ? 0.0614 0.0529 0.0619 -0.0268 -0.0031 -0.0063 176 LYS A CB  
1370 C  CG  . LYS A 176 ? 0.0631 0.0277 0.0548 -0.0279 0.0044  -0.0095 176 LYS A CG  
1371 C  CD  . LYS A 176 ? 0.0712 0.0537 0.0554 -0.0166 0.0121  -0.0108 176 LYS A CD  
1372 C  CE  . LYS A 176 ? 0.0797 0.0529 0.0710 -0.0196 0.0059  -0.0105 176 LYS A CE  
1373 N  NZ  . LYS A 176 ? 0.1051 0.0443 0.0727 -0.0203 -0.0029 -0.0117 176 LYS A NZ  
1374 N  N   . PHE A 177 ? 0.0467 0.0348 0.0339 -0.0222 0.0049  -0.0027 177 PHE A N   
1375 C  CA  . PHE A 177 ? 0.0559 0.0551 0.0480 -0.0170 0.0051  0.0010  177 PHE A CA  
1376 C  C   . PHE A 177 ? 0.0590 0.0530 0.0459 -0.0176 0.0046  -0.0019 177 PHE A C   
1377 O  O   . PHE A 177 ? 0.0645 0.0522 0.0377 -0.0146 0.0076  0.0068  177 PHE A O   
1378 C  CB  . PHE A 177 ? 0.0550 0.0568 0.0501 -0.0242 0.0040  0.0013  177 PHE A CB  
1379 C  CG  . PHE A 177 ? 0.0700 0.0439 0.0531 -0.0171 0.0010  -0.0014 177 PHE A CG  
1380 C  CD1 . PHE A 177 ? 0.0545 0.0279 0.0539 -0.0321 0.0048  -0.0001 177 PHE A CD1 
1381 C  CD2 . PHE A 177 ? 0.0637 0.0557 0.0615 -0.0189 0.0007  0.0037  177 PHE A CD2 
1382 C  CE1 . PHE A 177 ? 0.0554 0.0418 0.0625 -0.0238 -0.0043 0.0004  177 PHE A CE1 
1383 C  CE2 . PHE A 177 ? 0.0851 0.0677 0.0571 -0.0098 0.0085  -0.0026 177 PHE A CE2 
1384 C  CZ  . PHE A 177 ? 0.0829 0.0736 0.0638 -0.0149 0.0034  0.0122  177 PHE A CZ  
1385 N  N   . GLN A 178 ? 0.0676 0.0509 0.0410 -0.0169 0.0072  0.0014  178 GLN A N   
1386 C  CA  . GLN A 178 ? 0.0717 0.0605 0.0496 -0.0157 0.0051  -0.0013 178 GLN A CA  
1387 C  C   . GLN A 178 ? 0.0745 0.0616 0.0495 -0.0124 0.0064  -0.0037 178 GLN A C   
1388 O  O   . GLN A 178 ? 0.0743 0.0561 0.0324 -0.0202 -0.0010 -0.0049 178 GLN A O   
1389 C  CB  . GLN A 178 ? 0.0720 0.0581 0.0603 -0.0204 -0.0025 -0.0059 178 GLN A CB  
1390 C  CG  . GLN A 178 ? 0.0796 0.0529 0.0652 -0.0174 -0.0034 0.0023  178 GLN A CG  
1391 C  CD  . GLN A 178 ? 0.0646 0.0507 0.0614 -0.0029 0.0023  -0.0009 178 GLN A CD  
1392 O  OE1 . GLN A 178 ? 0.1471 0.0856 0.1056 -0.0127 -0.0149 0.0157  178 GLN A OE1 
1393 N  NE2 . GLN A 178 ? 0.0747 0.0322 0.0635 -0.0419 0.0031  -0.0056 178 GLN A NE2 
1394 N  N   . ASN A 179 ? 0.0881 0.0664 0.0523 -0.0127 0.0091  -0.0039 179 ASN A N   
1395 C  CA  . ASN A 179 ? 0.0744 0.0731 0.0501 -0.0082 0.0146  0.0013  179 ASN A CA  
1396 C  C   . ASN A 179 ? 0.0732 0.0720 0.0471 -0.0103 0.0152  -0.0018 179 ASN A C   
1397 O  O   . ASN A 179 ? 0.0732 0.0594 0.0623 -0.0159 0.0168  -0.0020 179 ASN A O   
1398 C  CB  . ASN A 179 ? 0.0890 0.0844 0.0647 0.0002  0.0111  -0.0070 179 ASN A CB  
1399 C  CG  . ASN A 179 ? 0.0984 0.0987 0.0738 -0.0049 0.0124  -0.0010 179 ASN A CG  
1400 O  OD1 . ASN A 179 ? 0.1490 0.1545 0.1286 -0.0256 0.0221  -0.0007 179 ASN A OD1 
1401 N  ND2 . ASN A 179 ? 0.1377 0.1250 0.1102 0.0088  0.0165  -0.0063 179 ASN A ND2 
1402 N  N   . ARG A 180 ? 0.0533 0.0510 0.0390 -0.0159 0.0175  0.0051  180 ARG A N   
1403 C  CA  . ARG A 180 ? 0.0586 0.0498 0.0358 -0.0176 0.0109  -0.0013 180 ARG A CA  
1404 C  C   . ARG A 180 ? 0.0557 0.0477 0.0357 -0.0136 0.0088  -0.0002 180 ARG A C   
1405 O  O   . ARG A 180 ? 0.0486 0.0497 0.0250 -0.0224 0.0157  -0.0011 180 ARG A O   
1406 C  CB  . ARG A 180 ? 0.0675 0.0488 0.0348 -0.0122 0.0106  -0.0017 180 ARG A CB  
1407 C  CG  . ARG A 180 ? 0.0734 0.0405 0.0418 -0.0195 0.0081  -0.0098 180 ARG A CG  
1408 C  CD  . ARG A 180 ? 0.0954 0.0447 0.0332 -0.0217 0.0228  -0.0112 180 ARG A CD  
1409 N  NE  . ARG A 180 ? 0.0913 0.0707 0.0461 -0.0354 -0.0068 -0.0035 180 ARG A NE  
1410 C  CZ  . ARG A 180 ? 0.0837 0.0635 0.0796 0.0072  0.0044  0.0000  180 ARG A CZ  
1411 N  NH1 . ARG A 180 ? 0.0774 0.0998 0.1099 -0.0091 0.0278  -0.0034 180 ARG A NH1 
1412 N  NH2 . ARG A 180 ? 0.0842 0.0911 0.1038 0.0011  -0.0010 -0.0055 180 ARG A NH2 
1413 N  N   . ARG A 181 ? 0.0555 0.0458 0.0320 -0.0148 0.0057  -0.0050 181 ARG A N   
1414 C  CA  . ARG A 181 ? 0.0498 0.0320 0.0386 -0.0160 0.0033  -0.0006 181 ARG A CA  
1415 C  C   . ARG A 181 ? 0.0531 0.0316 0.0416 -0.0131 0.0028  0.0011  181 ARG A C   
1416 O  O   . ARG A 181 ? 0.0553 0.0332 0.0410 -0.0157 0.0004  0.0079  181 ARG A O   
1417 C  CB  . ARG A 181 ? 0.0538 0.0285 0.0363 -0.0058 0.0046  0.0000  181 ARG A CB  
1418 C  CG  . ARG A 181 ? 0.0566 0.0227 0.0466 -0.0176 0.0036  0.0055  181 ARG A CG  
1419 C  CD  . ARG A 181 ? 0.0783 0.0277 0.0533 -0.0191 -0.0023 0.0035  181 ARG A CD  
1420 N  NE  . ARG A 181 ? 0.0233 0.0229 0.0323 -0.0094 0.0013  -0.0115 181 ARG A NE  
1421 C  CZ  . ARG A 181 ? 0.0373 0.0326 0.0524 -0.0078 -0.0005 -0.0041 181 ARG A CZ  
1422 N  NH1 . ARG A 181 ? 0.0612 0.0317 0.0407 0.0081  -0.0053 -0.0075 181 ARG A NH1 
1423 N  NH2 . ARG A 181 ? 0.0255 0.0097 0.0320 -0.0032 0.0050  -0.0092 181 ARG A NH2 
1424 N  N   . PRO A 182 ? 0.0515 0.0261 0.0454 -0.0135 0.0042  0.0046  182 PRO A N   
1425 C  CA  . PRO A 182 ? 0.0484 0.0312 0.0349 -0.0165 0.0003  0.0027  182 PRO A CA  
1426 C  C   . PRO A 182 ? 0.0514 0.0299 0.0297 -0.0088 -0.0017 0.0051  182 PRO A C   
1427 O  O   . PRO A 182 ? 0.0495 0.0204 0.0090 -0.0214 -0.0031 0.0044  182 PRO A O   
1428 C  CB  . PRO A 182 ? 0.0581 0.0367 0.0463 -0.0090 -0.0018 0.0062  182 PRO A CB  
1429 C  CG  . PRO A 182 ? 0.0666 0.0426 0.0546 -0.0160 -0.0017 -0.0002 182 PRO A CG  
1430 C  CD  . PRO A 182 ? 0.0650 0.0357 0.0476 -0.0160 0.0069  0.0065  182 PRO A CD  
1431 N  N   . ASP A 183 ? 0.0559 0.0373 0.0313 -0.0096 -0.0048 0.0038  183 ASP A N   
1432 C  CA  . ASP A 183 ? 0.0726 0.0651 0.0496 -0.0113 0.0029  0.0000  183 ASP A CA  
1433 C  C   . ASP A 183 ? 0.0728 0.0617 0.0481 -0.0059 -0.0011 -0.0040 183 ASP A C   
1434 O  O   . ASP A 183 ? 0.0641 0.0567 0.0433 -0.0108 -0.0052 -0.0132 183 ASP A O   
1435 C  CB  . ASP A 183 ? 0.0775 0.0740 0.0573 -0.0147 0.0031  -0.0039 183 ASP A CB  
1436 C  CG  . ASP A 183 ? 0.0975 0.0844 0.0786 -0.0109 0.0000  0.0007  183 ASP A CG  
1437 O  OD1 . ASP A 183 ? 0.1351 0.1131 0.1192 -0.0165 -0.0087 -0.0074 183 ASP A OD1 
1438 O  OD2 . ASP A 183 ? 0.1064 0.1074 0.1141 -0.0085 0.0099  -0.0017 183 ASP A OD2 
1439 N  N   . TYR A 184 ? 0.0692 0.0569 0.0311 -0.0097 0.0053  0.0018  184 TYR A N   
1440 C  CA  . TYR A 184 ? 0.0641 0.0473 0.0336 -0.0056 0.0069  0.0066  184 TYR A CA  
1441 C  C   . TYR A 184 ? 0.0572 0.0294 0.0271 -0.0079 0.0070  0.0129  184 TYR A C   
1442 O  O   . TYR A 184 ? 0.0402 0.0191 0.0347 -0.0036 0.0104  0.0166  184 TYR A O   
1443 C  CB  . TYR A 184 ? 0.0517 0.0314 0.0165 -0.0076 0.0055  0.0003  184 TYR A CB  
1444 C  CG  . TYR A 184 ? 0.0569 0.0530 0.0400 -0.0088 0.0117  0.0001  184 TYR A CG  
1445 C  CD1 . TYR A 184 ? 0.0513 0.0441 0.0497 -0.0170 -0.0064 -0.0015 184 TYR A CD1 
1446 C  CD2 . TYR A 184 ? 0.0463 0.0444 0.0301 -0.0039 -0.0033 0.0121  184 TYR A CD2 
1447 C  CE1 . TYR A 184 ? 0.0314 0.0293 0.0487 -0.0231 0.0051  -0.0063 184 TYR A CE1 
1448 C  CE2 . TYR A 184 ? 0.0414 0.0448 0.0282 -0.0127 0.0059  0.0042  184 TYR A CE2 
1449 C  CZ  . TYR A 184 ? 0.0412 0.0238 0.0419 -0.0108 0.0032  0.0028  184 TYR A CZ  
1450 O  OH  . TYR A 184 ? 0.0264 0.0399 0.0218 -0.0242 -0.0052 -0.0016 184 TYR A OH  
1451 N  N   . ILE A 185 ? 0.0705 0.0422 0.0289 -0.0021 -0.0011 0.0185  185 ILE A N   
1452 C  CA  . ILE A 185 ? 0.0612 0.0336 0.0253 -0.0102 0.0041  0.0069  185 ILE A CA  
1453 C  C   . ILE A 185 ? 0.0674 0.0509 0.0367 -0.0090 0.0009  0.0094  185 ILE A C   
1454 O  O   . ILE A 185 ? 0.0805 0.0462 0.0499 -0.0103 -0.0023 0.0117  185 ILE A O   
1455 C  CB  . ILE A 185 ? 0.0557 0.0498 0.0314 -0.0086 0.0002  0.0071  185 ILE A CB  
1456 C  CG1 . ILE A 185 ? 0.0715 0.0361 0.0550 -0.0152 0.0081  -0.0094 185 ILE A CG1 
1457 C  CG2 . ILE A 185 ? 0.0555 0.0346 0.0216 -0.0029 -0.0133 0.0027  185 ILE A CG2 
1458 C  CD1 . ILE A 185 ? 0.1068 0.0609 0.0775 -0.0070 0.0093  -0.0160 185 ILE A CD1 
1459 N  N   . LYS A 186 ? 0.0865 0.0540 0.0522 -0.0129 0.0073  0.0071  186 LYS A N   
1460 C  CA  . LYS A 186 ? 0.0872 0.0554 0.0532 -0.0064 0.0080  0.0083  186 LYS A CA  
1461 C  C   . LYS A 186 ? 0.0829 0.0533 0.0581 -0.0069 0.0110  0.0075  186 LYS A C   
1462 O  O   . LYS A 186 ? 0.0895 0.0432 0.0592 -0.0054 0.0073  0.0168  186 LYS A O   
1463 C  CB  . LYS A 186 ? 0.1005 0.0581 0.0644 -0.0071 0.0113  0.0066  186 LYS A CB  
1464 C  CG  . LYS A 186 ? 0.1038 0.0722 0.0716 -0.0026 0.0150  0.0038  186 LYS A CG  
1465 C  CD  . LYS A 186 ? 0.1436 0.1185 0.1285 -0.0041 -0.0002 -0.0038 186 LYS A CD  
1466 C  CE  . LYS A 186 ? 0.1603 0.1230 0.1258 -0.0104 0.0079  0.0004  186 LYS A CE  
1467 N  NZ  . LYS A 186 ? 0.1647 0.1536 0.1835 0.0028  0.0051  -0.0043 186 LYS A NZ  
1468 N  N   . GLU A 187 ? 0.0771 0.0423 0.0558 -0.0091 0.0102  0.0105  187 GLU A N   
1469 C  CA  . GLU A 187 ? 0.0806 0.0548 0.0655 -0.0123 0.0027  0.0052  187 GLU A CA  
1470 C  C   . GLU A 187 ? 0.0747 0.0471 0.0596 -0.0117 0.0034  0.0056  187 GLU A C   
1471 O  O   . GLU A 187 ? 0.0894 0.0453 0.0559 -0.0218 -0.0036 0.0086  187 GLU A O   
1472 C  CB  . GLU A 187 ? 0.0778 0.0584 0.0718 -0.0041 0.0059  0.0043  187 GLU A CB  
1473 C  CG  . GLU A 187 ? 0.0783 0.0508 0.0807 -0.0080 0.0103  0.0118  187 GLU A CG  
1474 C  CD  . GLU A 187 ? 0.0955 0.0589 0.0830 0.0006  0.0099  0.0117  187 GLU A CD  
1475 O  OE1 . GLU A 187 ? 0.1442 0.1114 0.1570 -0.0295 0.0057  0.0086  187 GLU A OE1 
1476 O  OE2 . GLU A 187 ? 0.1172 0.0691 0.0676 -0.0039 0.0154  0.0258  187 GLU A OE2 
1477 N  N   . PHE A 188 ? 0.0780 0.0500 0.0553 -0.0147 -0.0032 0.0041  188 PHE A N   
1478 C  CA  . PHE A 188 ? 0.0703 0.0402 0.0489 -0.0152 -0.0023 0.0061  188 PHE A CA  
1479 C  C   . PHE A 188 ? 0.0793 0.0385 0.0547 -0.0159 -0.0017 0.0023  188 PHE A C   
1480 O  O   . PHE A 188 ? 0.0698 0.0201 0.0544 -0.0265 -0.0037 0.0048  188 PHE A O   
1481 C  CB  . PHE A 188 ? 0.0682 0.0432 0.0429 -0.0129 0.0029  0.0031  188 PHE A CB  
1482 C  CG  . PHE A 188 ? 0.0473 0.0336 0.0284 -0.0098 -0.0001 -0.0019 188 PHE A CG  
1483 C  CD1 . PHE A 188 ? 0.0388 0.0127 0.0378 0.0064  0.0050  0.0049  188 PHE A CD1 
1484 C  CD2 . PHE A 188 ? 0.0331 0.0081 0.0286 -0.0050 0.0012  -0.0040 188 PHE A CD2 
1485 C  CE1 . PHE A 188 ? 0.0257 0.0079 0.0240 0.0021  -0.0107 -0.0052 188 PHE A CE1 
1486 C  CE2 . PHE A 188 ? 0.0389 0.0215 0.0341 -0.0101 -0.0024 -0.0175 188 PHE A CE2 
1487 C  CZ  . PHE A 188 ? 0.0202 0.0159 0.0310 0.0025  -0.0053 0.0134  188 PHE A CZ  
1488 N  N   . TRP A 189 ? 0.0856 0.0451 0.0588 -0.0099 -0.0090 0.0076  189 TRP A N   
1489 C  CA  . TRP A 189 ? 0.0887 0.0564 0.0541 -0.0069 -0.0035 0.0052  189 TRP A CA  
1490 C  C   . TRP A 189 ? 0.0860 0.0580 0.0563 -0.0044 -0.0028 0.0089  189 TRP A C   
1491 O  O   . TRP A 189 ? 0.1090 0.0724 0.0622 -0.0047 0.0037  0.0073  189 TRP A O   
1492 C  CB  . TRP A 189 ? 0.0935 0.0561 0.0542 -0.0068 -0.0082 0.0024  189 TRP A CB  
1493 C  CG  . TRP A 189 ? 0.0652 0.0619 0.0473 -0.0090 -0.0079 0.0005  189 TRP A CG  
1494 C  CD1 . TRP A 189 ? 0.0959 0.0620 0.0683 -0.0045 -0.0062 -0.0073 189 TRP A CD1 
1495 C  CD2 . TRP A 189 ? 0.0857 0.0667 0.0696 -0.0079 -0.0109 0.0011  189 TRP A CD2 
1496 N  NE1 . TRP A 189 ? 0.0508 0.0369 0.0564 -0.0130 -0.0201 0.0055  189 TRP A NE1 
1497 C  CE2 . TRP A 189 ? 0.0738 0.0561 0.0752 -0.0015 0.0016  0.0006  189 TRP A CE2 
1498 C  CE3 . TRP A 189 ? 0.0923 0.0840 0.0729 -0.0049 -0.0118 -0.0069 189 TRP A CE3 
1499 C  CZ2 . TRP A 189 ? 0.0549 0.0636 0.0655 0.0004  -0.0162 0.0061  189 TRP A CZ2 
1500 C  CZ3 . TRP A 189 ? 0.0892 0.0771 0.0731 -0.0032 -0.0116 0.0120  189 TRP A CZ3 
1501 C  CH2 . TRP A 189 ? 0.0755 0.0717 0.0730 -0.0002 -0.0120 0.0066  189 TRP A CH2 
1502 N  N   . ASN A 190 ? 0.0997 0.0717 0.0676 -0.0012 -0.0018 0.0070  190 ASN A N   
1503 C  CA  . ASN A 190 ? 0.0921 0.0736 0.0636 -0.0070 -0.0013 0.0072  190 ASN A CA  
1504 C  C   . ASN A 190 ? 0.0940 0.0688 0.0635 -0.0045 0.0003  0.0081  190 ASN A C   
1505 O  O   . ASN A 190 ? 0.0937 0.0588 0.0631 -0.0156 0.0032  0.0148  190 ASN A O   
1506 C  CB  . ASN A 190 ? 0.0915 0.0729 0.0597 -0.0090 -0.0058 0.0041  190 ASN A CB  
1507 C  CG  . ASN A 190 ? 0.0907 0.0742 0.0763 -0.0080 0.0015  0.0087  190 ASN A CG  
1508 O  OD1 . ASN A 190 ? 0.1198 0.0745 0.0760 0.0034  0.0113  0.0186  190 ASN A OD1 
1509 N  ND2 . ASN A 190 ? 0.1029 0.0912 0.0985 -0.0129 -0.0059 -0.0055 190 ASN A ND2 
1510 N  N   . VAL A 191 ? 0.0938 0.0702 0.0656 -0.0050 0.0003  0.0084  191 VAL A N   
1511 C  CA  . VAL A 191 ? 0.0885 0.0640 0.0633 -0.0047 0.0000  0.0028  191 VAL A CA  
1512 C  C   . VAL A 191 ? 0.0777 0.0504 0.0644 -0.0035 -0.0040 -0.0015 191 VAL A C   
1513 O  O   . VAL A 191 ? 0.0785 0.0289 0.0653 -0.0056 -0.0024 -0.0050 191 VAL A O   
1514 C  CB  . VAL A 191 ? 0.0836 0.0565 0.0682 -0.0053 0.0004  0.0008  191 VAL A CB  
1515 C  CG1 . VAL A 191 ? 0.1128 0.0852 0.0849 -0.0198 -0.0013 0.0058  191 VAL A CG1 
1516 C  CG2 . VAL A 191 ? 0.0868 0.0620 0.0604 -0.0009 0.0069  0.0029  191 VAL A CG2 
1517 N  N   . VAL A 192 ? 0.0802 0.0463 0.0628 -0.0027 -0.0046 -0.0038 192 VAL A N   
1518 C  CA  . VAL A 192 ? 0.0667 0.0440 0.0577 -0.0028 -0.0016 -0.0022 192 VAL A CA  
1519 C  C   . VAL A 192 ? 0.0662 0.0417 0.0550 -0.0023 -0.0031 -0.0015 192 VAL A C   
1520 O  O   . VAL A 192 ? 0.0445 0.0364 0.0478 0.0015  -0.0057 -0.0032 192 VAL A O   
1521 C  CB  . VAL A 192 ? 0.0610 0.0279 0.0575 -0.0041 0.0014  -0.0022 192 VAL A CB  
1522 C  CG1 . VAL A 192 ? 0.0701 0.0296 0.0551 -0.0108 -0.0059 -0.0040 192 VAL A CG1 
1523 C  CG2 . VAL A 192 ? 0.0673 0.0262 0.0690 -0.0157 0.0031  -0.0147 192 VAL A CG2 
1524 N  N   . ASN A 193 ? 0.0577 0.0336 0.0540 -0.0115 -0.0030 0.0030  193 ASN A N   
1525 C  CA  . ASN A 193 ? 0.0732 0.0391 0.0604 -0.0031 -0.0006 0.0065  193 ASN A CA  
1526 C  C   . ASN A 193 ? 0.0739 0.0482 0.0726 -0.0030 -0.0034 0.0072  193 ASN A C   
1527 O  O   . ASN A 193 ? 0.0861 0.0374 0.0891 0.0085  -0.0010 0.0082  193 ASN A O   
1528 C  CB  . ASN A 193 ? 0.0786 0.0358 0.0621 -0.0043 -0.0041 0.0031  193 ASN A CB  
1529 C  CG  . ASN A 193 ? 0.0692 0.0370 0.0626 -0.0088 0.0039  0.0005  193 ASN A CG  
1530 O  OD1 . ASN A 193 ? 0.0990 0.0636 0.0913 0.0016  -0.0061 0.0120  193 ASN A OD1 
1531 N  ND2 . ASN A 193 ? 0.1113 0.0413 0.0727 -0.0136 0.0049  0.0173  193 ASN A ND2 
1532 N  N   . TRP A 194 ? 0.0729 0.0452 0.0701 -0.0009 -0.0074 0.0074  194 TRP A N   
1533 C  CA  . TRP A 194 ? 0.0782 0.0583 0.0738 0.0035  -0.0067 0.0100  194 TRP A CA  
1534 C  C   . TRP A 194 ? 0.0796 0.0570 0.0783 0.0016  -0.0068 0.0118  194 TRP A C   
1535 O  O   . TRP A 194 ? 0.0713 0.0470 0.0837 0.0076  -0.0139 0.0236  194 TRP A O   
1536 C  CB  . TRP A 194 ? 0.0800 0.0687 0.0656 0.0015  -0.0048 0.0106  194 TRP A CB  
1537 C  CG  . TRP A 194 ? 0.0764 0.0652 0.0784 0.0051  -0.0024 0.0035  194 TRP A CG  
1538 C  CD1 . TRP A 194 ? 0.0869 0.0645 0.0800 0.0046  0.0063  -0.0004 194 TRP A CD1 
1539 C  CD2 . TRP A 194 ? 0.0737 0.0625 0.0556 0.0007  -0.0139 0.0030  194 TRP A CD2 
1540 N  NE1 . TRP A 194 ? 0.0765 0.0627 0.0531 0.0102  -0.0159 0.0075  194 TRP A NE1 
1541 C  CE2 . TRP A 194 ? 0.0653 0.0735 0.0632 0.0006  -0.0139 -0.0004 194 TRP A CE2 
1542 C  CE3 . TRP A 194 ? 0.0536 0.0728 0.0462 0.0015  -0.0212 0.0028  194 TRP A CE3 
1543 C  CZ2 . TRP A 194 ? 0.0925 0.0883 0.0742 -0.0014 -0.0104 0.0039  194 TRP A CZ2 
1544 C  CZ3 . TRP A 194 ? 0.0523 0.0465 0.0479 0.0034  -0.0189 0.0061  194 TRP A CZ3 
1545 C  CH2 . TRP A 194 ? 0.0737 0.0804 0.0667 -0.0025 -0.0131 0.0034  194 TRP A CH2 
1546 N  N   . ASP A 195 ? 0.0854 0.0625 0.0742 0.0057  -0.0056 0.0142  195 ASP A N   
1547 C  CA  . ASP A 195 ? 0.0950 0.0692 0.0830 0.0050  -0.0071 0.0112  195 ASP A CA  
1548 C  C   . ASP A 195 ? 0.0867 0.0668 0.0819 0.0013  -0.0040 0.0123  195 ASP A C   
1549 O  O   . ASP A 195 ? 0.0913 0.0660 0.0954 0.0076  -0.0141 0.0154  195 ASP A O   
1550 C  CB  . ASP A 195 ? 0.0997 0.0753 0.0973 -0.0003 -0.0036 0.0089  195 ASP A CB  
1551 C  CG  . ASP A 195 ? 0.1230 0.0885 0.1053 0.0002  -0.0091 0.0072  195 ASP A CG  
1552 O  OD1 . ASP A 195 ? 0.1191 0.0988 0.1176 0.0078  -0.0250 0.0171  195 ASP A OD1 
1553 O  OD2 . ASP A 195 ? 0.1223 0.0799 0.1297 -0.0004 -0.0099 -0.0024 195 ASP A OD2 
1554 N  N   . GLU A 196 ? 0.0881 0.0640 0.0801 0.0009  -0.0074 0.0078  196 GLU A N   
1555 C  CA  . GLU A 196 ? 0.0841 0.0664 0.0825 0.0000  -0.0074 0.0049  196 GLU A CA  
1556 C  C   . GLU A 196 ? 0.0735 0.0602 0.0698 0.0032  -0.0078 0.0034  196 GLU A C   
1557 O  O   . GLU A 196 ? 0.0727 0.0601 0.0579 0.0029  -0.0115 0.0094  196 GLU A O   
1558 C  CB  . GLU A 196 ? 0.0840 0.0603 0.0881 -0.0039 -0.0125 0.0044  196 GLU A CB  
1559 C  CG  . GLU A 196 ? 0.0961 0.0868 0.0762 0.0023  -0.0054 0.0075  196 GLU A CG  
1560 C  CD  . GLU A 196 ? 0.1093 0.0962 0.0950 0.0025  0.0068  0.0068  196 GLU A CD  
1561 O  OE1 . GLU A 196 ? 0.1322 0.1253 0.1256 0.0042  0.0108  0.0094  196 GLU A OE1 
1562 O  OE2 . GLU A 196 ? 0.1335 0.0956 0.1067 0.0259  0.0200  0.0060  196 GLU A OE2 
1563 N  N   . ALA A 197 ? 0.0671 0.0525 0.0676 0.0006  -0.0066 0.0017  197 ALA A N   
1564 C  CA  . ALA A 197 ? 0.0679 0.0544 0.0684 0.0023  -0.0064 0.0000  197 ALA A CA  
1565 C  C   . ALA A 197 ? 0.0712 0.0645 0.0762 0.0021  -0.0053 -0.0054 197 ALA A C   
1566 O  O   . ALA A 197 ? 0.0633 0.0680 0.0797 0.0015  -0.0099 -0.0011 197 ALA A O   
1567 C  CB  . ALA A 197 ? 0.0671 0.0415 0.0607 0.0058  -0.0018 -0.0045 197 ALA A CB  
1568 N  N   . ALA A 198 ? 0.0755 0.0846 0.0785 0.0023  -0.0099 0.0027  198 ALA A N   
1569 C  CA  . ALA A 198 ? 0.0800 0.0844 0.0831 0.0040  -0.0071 -0.0043 198 ALA A CA  
1570 C  C   . ALA A 198 ? 0.0804 0.0807 0.0839 0.0028  -0.0077 -0.0014 198 ALA A C   
1571 O  O   . ALA A 198 ? 0.0842 0.0793 0.0946 0.0035  -0.0066 -0.0014 198 ALA A O   
1572 C  CB  . ALA A 198 ? 0.0700 0.0824 0.0745 0.0036  -0.0086 -0.0051 198 ALA A CB  
1573 N  N   . ALA A 199 ? 0.0824 0.0838 0.0827 0.0009  -0.0062 0.0001  199 ALA A N   
1574 C  CA  . ALA A 199 ? 0.0807 0.0764 0.0797 0.0012  -0.0073 0.0021  199 ALA A CA  
1575 C  C   . ALA A 199 ? 0.0885 0.0834 0.0813 -0.0037 -0.0048 -0.0058 199 ALA A C   
1576 O  O   . ALA A 199 ? 0.0767 0.0787 0.0879 -0.0041 -0.0012 -0.0039 199 ALA A O   
1577 C  CB  . ALA A 199 ? 0.0890 0.0787 0.0749 0.0036  -0.0010 -0.0038 199 ALA A CB  
1578 N  N   . ARG A 200 ? 0.0758 0.0876 0.0823 -0.0044 -0.0114 -0.0003 200 ARG A N   
1579 C  CA  . ARG A 200 ? 0.0828 0.0847 0.0841 -0.0035 -0.0123 0.0066  200 ARG A CA  
1580 C  C   . ARG A 200 ? 0.0859 0.0897 0.0931 -0.0066 -0.0132 0.0062  200 ARG A C   
1581 O  O   . ARG A 200 ? 0.0779 0.0939 0.1032 -0.0085 -0.0233 0.0104  200 ARG A O   
1582 C  CB  . ARG A 200 ? 0.0863 0.0926 0.0824 -0.0044 -0.0082 0.0042  200 ARG A CB  
1583 C  CG  . ARG A 200 ? 0.0699 0.0704 0.0538 0.0054  0.0000  0.0127  200 ARG A CG  
1584 C  CD  . ARG A 200 ? 0.0695 0.0670 0.0355 -0.0057 -0.0050 0.0059  200 ARG A CD  
1585 N  NE  . ARG A 200 ? 0.0868 0.0642 0.0525 -0.0078 -0.0041 0.0259  200 ARG A NE  
1586 C  CZ  . ARG A 200 ? 0.0877 0.0660 0.0557 0.0035  -0.0158 0.0132  200 ARG A CZ  
1587 N  NH1 . ARG A 200 ? 0.0705 0.0322 0.0697 0.0009  0.0006  -0.0079 200 ARG A NH1 
1588 N  NH2 . ARG A 200 ? 0.0717 0.0652 0.0545 0.0034  -0.0013 0.0110  200 ARG A NH2 
1589 N  N   . PHE A 201 ? 0.0797 0.0898 0.0927 -0.0072 -0.0134 0.0024  201 PHE A N   
1590 C  CA  . PHE A 201 ? 0.0783 0.0963 0.0954 -0.0045 -0.0098 0.0015  201 PHE A CA  
1591 C  C   . PHE A 201 ? 0.0833 0.0977 0.0996 -0.0064 -0.0054 0.0019  201 PHE A C   
1592 O  O   . PHE A 201 ? 0.0797 0.1044 0.1092 -0.0054 -0.0152 0.0034  201 PHE A O   
1593 C  CB  . PHE A 201 ? 0.0834 0.0968 0.0937 0.0005  -0.0056 0.0001  201 PHE A CB  
1594 C  CG  . PHE A 201 ? 0.0744 0.0862 0.0944 -0.0066 -0.0053 -0.0001 201 PHE A CG  
1595 C  CD1 . PHE A 201 ? 0.1026 0.0886 0.1068 0.0066  -0.0073 0.0061  201 PHE A CD1 
1596 C  CD2 . PHE A 201 ? 0.0946 0.0795 0.0912 0.0085  -0.0123 -0.0024 201 PHE A CD2 
1597 C  CE1 . PHE A 201 ? 0.0986 0.1084 0.1106 0.0050  -0.0059 -0.0079 201 PHE A CE1 
1598 C  CE2 . PHE A 201 ? 0.0670 0.0846 0.1068 0.0030  -0.0014 -0.0041 201 PHE A CE2 
1599 C  CZ  . PHE A 201 ? 0.0753 0.0742 0.0837 -0.0060 -0.0167 0.0043  201 PHE A CZ  
1600 N  N   . ALA A 202 ? 0.0838 0.1082 0.1035 -0.0085 -0.0074 0.0041  202 ALA A N   
1601 C  CA  . ALA A 202 ? 0.1009 0.1145 0.1140 -0.0052 -0.0047 0.0035  202 ALA A CA  
1602 C  C   . ALA A 202 ? 0.1040 0.1182 0.1198 -0.0101 -0.0054 0.0061  202 ALA A C   
1603 O  O   . ALA A 202 ? 0.1207 0.1373 0.1346 -0.0159 -0.0096 0.0037  202 ALA A O   
1604 C  CB  . ALA A 202 ? 0.0995 0.1180 0.1098 -0.0092 -0.0083 0.0007  202 ALA A CB  
1605 N  N   . ALA A 203 ? 0.1081 0.1207 0.1223 -0.0052 -0.0036 0.0071  203 ALA A N   
1606 C  CA  . ALA A 203 ? 0.1036 0.1179 0.1204 -0.0005 -0.0026 0.0044  203 ALA A CA  
1607 C  C   . ALA A 203 ? 0.1034 0.1141 0.1253 -0.0022 0.0003  0.0060  203 ALA A C   
1608 O  O   . ALA A 203 ? 0.0922 0.1195 0.1287 -0.0042 -0.0019 0.0084  203 ALA A O   
1609 C  CB  . ALA A 203 ? 0.1121 0.1289 0.1289 -0.0010 -0.0043 -0.0009 203 ALA A CB  
1610 N  N   . LYS A 204 ? 0.1145 0.1128 0.1268 0.0003  -0.0017 0.0018  204 LYS A N   
1611 C  CA  . LYS A 204 ? 0.1115 0.1071 0.1279 -0.0014 -0.0048 0.0032  204 LYS A CA  
1612 C  C   . LYS A 204 ? 0.1156 0.1133 0.1340 0.0038  -0.0063 0.0014  204 LYS A C   
1613 O  O   . LYS A 204 ? 0.1229 0.1125 0.1527 0.0062  -0.0100 0.0021  204 LYS A O   
1614 C  CB  . LYS A 204 ? 0.1092 0.1090 0.1306 0.0033  -0.0059 0.0027  204 LYS A CB  
1615 C  CG  . LYS A 204 ? 0.0960 0.0837 0.1035 -0.0107 -0.0017 0.0000  204 LYS A CG  
1616 C  CD  . LYS A 204 ? 0.1000 0.1039 0.1111 -0.0016 -0.0122 -0.0076 204 LYS A CD  
1617 C  CE  . LYS A 204 ? 0.1026 0.1052 0.1312 -0.0004 -0.0131 -0.0001 204 LYS A CE  
1618 N  NZ  . LYS A 204 ? 0.1367 0.1222 0.1760 0.0028  -0.0230 -0.0029 204 LYS A NZ  
1619 N  N   . LYS A 205 ? 0.1190 0.1138 0.1376 -0.0002 -0.0022 0.0072  205 LYS A N   
1620 C  CA  . LYS A 205 ? 0.1230 0.1245 0.1421 0.0012  -0.0003 0.0052  205 LYS A CA  
1621 C  C   . LYS A 205 ? 0.1275 0.1260 0.1365 0.0022  0.0000  0.0057  205 LYS A C   
1622 O  O   . LYS A 205 ? 0.1400 0.1461 0.1530 0.0063  0.0002  0.0122  205 LYS A O   
1623 C  CB  . LYS A 205 ? 0.1323 0.1224 0.1415 -0.0007 0.0036  0.0079  205 LYS A CB  
1624 C  CG  . LYS A 205 ? 0.1476 0.1438 0.1652 -0.0008 0.0097  -0.0026 205 LYS A CG  
1625 C  CD  . LYS A 205 ? 0.1559 0.1525 0.1820 -0.0089 0.0099  0.0033  205 LYS A CD  
1626 C  CE  . LYS A 205 ? 0.1780 0.1588 0.1816 -0.0057 0.0056  -0.0018 205 LYS A CE  
1627 N  NZ  . LYS A 205 ? 0.1800 0.1800 0.2093 0.0029  -0.0072 0.0024  205 LYS A NZ  
1628 O  OXT . LYS A 205 ? 0.1319 0.1345 0.1408 -0.0053 -0.0010 0.0045  205 LYS A OXT 
1629 N  N   . SER B 1   ? 0.1101 0.1056 0.1260 0.0069  -0.0102 -0.0095 1   SER B N   
1630 C  CA  . SER B 1   ? 0.1035 0.0978 0.0994 0.0056  -0.0049 -0.0098 1   SER B CA  
1631 C  C   . SER B 1   ? 0.0798 0.0888 0.0840 0.0064  0.0001  -0.0048 1   SER B C   
1632 O  O   . SER B 1   ? 0.0727 0.0714 0.0837 0.0177  -0.0040 -0.0109 1   SER B O   
1633 C  CB  . SER B 1   ? 0.1126 0.1090 0.1096 0.0023  -0.0018 -0.0013 1   SER B CB  
1634 O  OG  . SER B 1   ? 0.1210 0.1205 0.1089 0.0087  -0.0076 -0.0148 1   SER B OG  
1635 N  N   . TYR B 2   ? 0.0616 0.0694 0.0609 0.0059  0.0027  -0.0071 2   TYR B N   
1636 C  CA  . TYR B 2   ? 0.0489 0.0699 0.0473 0.0025  0.0078  -0.0047 2   TYR B CA  
1637 C  C   . TYR B 2   ? 0.0451 0.0661 0.0428 0.0044  0.0102  0.0004  2   TYR B C   
1638 O  O   . TYR B 2   ? 0.0338 0.0630 0.0374 -0.0057 0.0158  0.0061  2   TYR B O   
1639 C  CB  . TYR B 2   ? 0.0490 0.0573 0.0358 0.0025  0.0069  -0.0008 2   TYR B CB  
1640 C  CG  . TYR B 2   ? 0.0575 0.0678 0.0456 -0.0056 -0.0066 -0.0131 2   TYR B CG  
1641 C  CD1 . TYR B 2   ? 0.0745 0.0718 0.0586 -0.0028 0.0047  -0.0092 2   TYR B CD1 
1642 C  CD2 . TYR B 2   ? 0.0699 0.0697 0.0297 -0.0033 -0.0112 -0.0087 2   TYR B CD2 
1643 C  CE1 . TYR B 2   ? 0.0961 0.0850 0.0854 0.0000  0.0054  -0.0066 2   TYR B CE1 
1644 C  CE2 . TYR B 2   ? 0.1250 0.1009 0.1147 -0.0044 -0.0025 -0.0076 2   TYR B CE2 
1645 C  CZ  . TYR B 2   ? 0.0938 0.0952 0.0992 0.0012  0.0052  -0.0115 2   TYR B CZ  
1646 O  OH  . TYR B 2   ? 0.0909 0.0810 0.0888 0.0219  0.0217  -0.0035 2   TYR B OH  
1647 N  N   . THR B 3   ? 0.0434 0.0636 0.0462 0.0000  0.0034  -0.0025 3   THR B N   
1648 C  CA  . THR B 3   ? 0.0460 0.0743 0.0438 0.0038  0.0028  -0.0038 3   THR B CA  
1649 C  C   . THR B 3   ? 0.0358 0.0627 0.0394 -0.0032 0.0059  -0.0052 3   THR B C   
1650 O  O   . THR B 3   ? 0.0538 0.0478 0.0359 0.0010  0.0041  -0.0114 3   THR B O   
1651 C  CB  . THR B 3   ? 0.0452 0.0783 0.0392 0.0030  -0.0011 -0.0047 3   THR B CB  
1652 O  OG1 . THR B 3   ? 0.0514 0.0779 0.0429 0.0131  0.0083  -0.0047 3   THR B OG1 
1653 C  CG2 . THR B 3   ? 0.0550 0.0830 0.0655 0.0113  -0.0040 0.0048  3   THR B CG2 
1654 N  N   . LEU B 4   ? 0.0315 0.0467 0.0333 -0.0085 0.0048  0.0001  4   LEU B N   
1655 C  CA  . LEU B 4   ? 0.0300 0.0536 0.0348 -0.0090 0.0032  0.0004  4   LEU B CA  
1656 C  C   . LEU B 4   ? 0.0396 0.0630 0.0433 -0.0097 0.0025  0.0015  4   LEU B C   
1657 O  O   . LEU B 4   ? 0.0422 0.0517 0.0298 -0.0152 0.0112  0.0102  4   LEU B O   
1658 C  CB  . LEU B 4   ? 0.0326 0.0452 0.0333 -0.0150 0.0047  -0.0032 4   LEU B CB  
1659 C  CG  . LEU B 4   ? 0.0248 0.0578 0.0262 -0.0083 -0.0082 0.0102  4   LEU B CG  
1660 C  CD1 . LEU B 4   ? 0.0403 0.0735 0.0359 0.0074  0.0050  0.0032  4   LEU B CD1 
1661 C  CD2 . LEU B 4   ? 0.0176 0.0553 0.0406 -0.0158 -0.0042 -0.0085 4   LEU B CD2 
1662 N  N   . PRO B 5   ? 0.0401 0.0744 0.0525 -0.0094 -0.0002 -0.0026 5   PRO B N   
1663 C  CA  . PRO B 5   ? 0.0407 0.0751 0.0645 -0.0082 -0.0007 -0.0042 5   PRO B CA  
1664 C  C   . PRO B 5   ? 0.0477 0.0738 0.0671 -0.0115 0.0010  -0.0036 5   PRO B C   
1665 O  O   . PRO B 5   ? 0.0473 0.0737 0.0666 -0.0158 0.0010  -0.0018 5   PRO B O   
1666 C  CB  . PRO B 5   ? 0.0371 0.0767 0.0620 -0.0146 -0.0001 0.0026  5   PRO B CB  
1667 C  CG  . PRO B 5   ? 0.0568 0.0789 0.0590 -0.0085 -0.0014 -0.0053 5   PRO B CG  
1668 C  CD  . PRO B 5   ? 0.0374 0.0607 0.0544 -0.0106 -0.0050 -0.0019 5   PRO B CD  
1669 N  N   . SER B 6   ? 0.0545 0.0821 0.0639 -0.0096 0.0033  -0.0001 6   SER B N   
1670 C  CA  A SER B 6   ? 0.0594 0.0757 0.0702 -0.0062 0.0024  0.0018  6   SER B CA  
1671 C  CA  B SER B 6   ? 0.0556 0.0726 0.0681 -0.0063 0.0040  0.0020  6   SER B CA  
1672 C  C   . SER B 6   ? 0.0604 0.0748 0.0686 -0.0053 0.0063  0.0049  6   SER B C   
1673 O  O   . SER B 6   ? 0.0649 0.0653 0.0706 0.0000  0.0030  0.0006  6   SER B O   
1674 C  CB  A SER B 6   ? 0.0582 0.0748 0.0682 -0.0082 0.0028  0.0009  6   SER B CB  
1675 C  CB  B SER B 6   ? 0.0538 0.0692 0.0641 -0.0075 0.0051  0.0012  6   SER B CB  
1676 O  OG  A SER B 6   ? 0.0741 0.0700 0.0763 -0.0101 -0.0017 0.0073  6   SER B OG  
1677 O  OG  B SER B 6   ? 0.0453 0.0486 0.0631 -0.0132 0.0094  0.0084  6   SER B OG  
1678 N  N   . LEU B 7   ? 0.0586 0.0709 0.0677 -0.0077 0.0001  0.0068  7   LEU B N   
1679 C  CA  . LEU B 7   ? 0.0617 0.0704 0.0631 -0.0074 0.0000  0.0043  7   LEU B CA  
1680 C  C   . LEU B 7   ? 0.0609 0.0708 0.0607 -0.0082 0.0029  0.0048  7   LEU B C   
1681 O  O   . LEU B 7   ? 0.0471 0.0751 0.0481 -0.0144 0.0078  0.0176  7   LEU B O   
1682 C  CB  . LEU B 7   ? 0.0691 0.0758 0.0661 -0.0006 -0.0030 0.0012  7   LEU B CB  
1683 C  CG  . LEU B 7   ? 0.0731 0.0640 0.0691 -0.0073 0.0070  0.0009  7   LEU B CG  
1684 C  CD1 . LEU B 7   ? 0.0882 0.0635 0.0784 -0.0213 0.0024  -0.0090 7   LEU B CD1 
1685 C  CD2 . LEU B 7   ? 0.0920 0.0842 0.1164 -0.0331 -0.0050 0.0040  7   LEU B CD2 
1686 N  N   . PRO B 8   ? 0.0533 0.0774 0.0543 -0.0128 0.0055  0.0106  8   PRO B N   
1687 C  CA  . PRO B 8   ? 0.0698 0.0858 0.0677 -0.0098 -0.0001 0.0110  8   PRO B CA  
1688 C  C   . PRO B 8   ? 0.0659 0.0871 0.0720 -0.0120 0.0009  0.0077  8   PRO B C   
1689 O  O   . PRO B 8   ? 0.0776 0.1001 0.0977 -0.0037 0.0000  0.0126  8   PRO B O   
1690 C  CB  . PRO B 8   ? 0.0674 0.0968 0.0742 -0.0105 0.0032  0.0135  8   PRO B CB  
1691 C  CG  . PRO B 8   ? 0.0415 0.0692 0.0553 -0.0140 -0.0004 0.0074  8   PRO B CG  
1692 C  CD  . PRO B 8   ? 0.0718 0.0763 0.0612 -0.0160 0.0001  0.0122  8   PRO B CD  
1693 N  N   . TYR B 9   ? 0.0628 0.0894 0.0583 -0.0134 0.0003  0.0110  9   TYR B N   
1694 C  CA  . TYR B 9   ? 0.0783 0.0853 0.0584 -0.0144 0.0049  0.0073  9   TYR B CA  
1695 C  C   . TYR B 9   ? 0.0730 0.0886 0.0530 -0.0110 0.0062  0.0082  9   TYR B C   
1696 O  O   . TYR B 9   ? 0.0753 0.0958 0.0555 -0.0209 0.0141  0.0022  9   TYR B O   
1697 C  CB  . TYR B 9   ? 0.0744 0.0929 0.0537 -0.0132 0.0025  0.0107  9   TYR B CB  
1698 C  CG  . TYR B 9   ? 0.0772 0.0785 0.0594 -0.0137 -0.0066 0.0073  9   TYR B CG  
1699 C  CD1 . TYR B 9   ? 0.0755 0.0921 0.0635 -0.0230 0.0215  0.0002  9   TYR B CD1 
1700 C  CD2 . TYR B 9   ? 0.0810 0.0797 0.0555 -0.0187 0.0002  0.0153  9   TYR B CD2 
1701 C  CE1 . TYR B 9   ? 0.0581 0.0696 0.0578 -0.0263 0.0070  -0.0061 9   TYR B CE1 
1702 C  CE2 . TYR B 9   ? 0.0602 0.0724 0.0312 -0.0205 -0.0039 0.0067  9   TYR B CE2 
1703 C  CZ  . TYR B 9   ? 0.0760 0.0778 0.0500 -0.0116 0.0111  0.0012  9   TYR B CZ  
1704 O  OH  . TYR B 9   ? 0.0763 0.0650 0.0662 -0.0229 0.0070  0.0049  9   TYR B OH  
1705 N  N   . ALA B 10  ? 0.0673 0.0812 0.0524 -0.0187 0.0105  0.0088  10  ALA B N   
1706 C  CA  . ALA B 10  ? 0.0581 0.0746 0.0585 -0.0147 0.0080  0.0028  10  ALA B CA  
1707 C  C   . ALA B 10  ? 0.0570 0.0717 0.0618 -0.0150 0.0080  0.0028  10  ALA B C   
1708 O  O   . ALA B 10  ? 0.0507 0.0642 0.0619 -0.0226 0.0058  -0.0001 10  ALA B O   
1709 C  CB  . ALA B 10  ? 0.0635 0.0867 0.0718 -0.0167 0.0098  0.0081  10  ALA B CB  
1710 N  N   . TYR B 11  ? 0.0553 0.0723 0.0611 -0.0146 0.0024  0.0055  11  TYR B N   
1711 C  CA  . TYR B 11  ? 0.0614 0.0716 0.0612 -0.0155 0.0028  0.0052  11  TYR B CA  
1712 C  C   . TYR B 11  ? 0.0708 0.0808 0.0645 -0.0188 0.0014  0.0066  11  TYR B C   
1713 O  O   . TYR B 11  ? 0.0577 0.0758 0.0440 -0.0241 0.0029  0.0049  11  TYR B O   
1714 C  CB  . TYR B 11  ? 0.0605 0.0736 0.0629 -0.0172 0.0001  0.0074  11  TYR B CB  
1715 C  CG  . TYR B 11  ? 0.0828 0.0902 0.0837 -0.0099 -0.0062 0.0013  11  TYR B CG  
1716 C  CD1 . TYR B 11  ? 0.0479 0.0632 0.0608 -0.0102 -0.0019 0.0073  11  TYR B CD1 
1717 C  CD2 . TYR B 11  ? 0.0872 0.1035 0.0868 -0.0086 -0.0161 0.0181  11  TYR B CD2 
1718 C  CE1 . TYR B 11  ? 0.1212 0.1227 0.0906 -0.0030 -0.0182 0.0021  11  TYR B CE1 
1719 C  CE2 . TYR B 11  ? 0.1006 0.1301 0.0858 -0.0118 -0.0130 -0.0025 11  TYR B CE2 
1720 C  CZ  . TYR B 11  ? 0.1104 0.1069 0.0816 0.0010  -0.0104 0.0000  11  TYR B CZ  
1721 O  OH  . TYR B 11  ? 0.1197 0.1372 0.0789 -0.0025 -0.0161 -0.0124 11  TYR B OH  
1722 N  N   . ASP B 12  ? 0.0647 0.0818 0.0594 -0.0178 -0.0024 0.0075  12  ASP B N   
1723 C  CA  . ASP B 12  ? 0.0846 0.1006 0.0803 -0.0201 0.0043  0.0024  12  ASP B CA  
1724 C  C   . ASP B 12  ? 0.0712 0.0917 0.0697 -0.0226 0.0096  0.0057  12  ASP B C   
1725 O  O   . ASP B 12  ? 0.0783 0.1077 0.0651 -0.0320 0.0132  0.0043  12  ASP B O   
1726 C  CB  . ASP B 12  ? 0.0921 0.0993 0.0860 -0.0162 0.0070  0.0025  12  ASP B CB  
1727 C  CG  . ASP B 12  ? 0.0934 0.1195 0.1159 -0.0136 0.0027  -0.0048 12  ASP B CG  
1728 O  OD1 . ASP B 12  ? 0.0539 0.1314 0.1074 -0.0179 0.0179  -0.0090 12  ASP B OD1 
1729 O  OD2 . ASP B 12  ? 0.1655 0.1620 0.1656 -0.0397 -0.0046 0.0006  12  ASP B OD2 
1730 N  N   . ALA B 13  ? 0.0647 0.0947 0.0654 -0.0247 0.0124  0.0055  13  ALA B N   
1731 C  CA  . ALA B 13  ? 0.0618 0.0755 0.0558 -0.0192 0.0112  0.0082  13  ALA B CA  
1732 C  C   . ALA B 13  ? 0.0533 0.0762 0.0517 -0.0151 0.0093  0.0074  13  ALA B C   
1733 O  O   . ALA B 13  ? 0.0449 0.0838 0.0602 -0.0208 0.0183  0.0107  13  ALA B O   
1734 C  CB  . ALA B 13  ? 0.0517 0.0820 0.0545 -0.0185 0.0098  0.0036  13  ALA B CB  
1735 N  N   . LEU B 14  ? 0.0495 0.0751 0.0428 -0.0169 0.0028  0.0023  14  LEU B N   
1736 C  CA  . LEU B 14  ? 0.0484 0.0658 0.0498 -0.0152 0.0017  0.0026  14  LEU B CA  
1737 C  C   . LEU B 14  ? 0.0627 0.0714 0.0521 -0.0171 0.0018  0.0009  14  LEU B C   
1738 O  O   . LEU B 14  ? 0.0576 0.0707 0.0631 -0.0327 0.0013  0.0108  14  LEU B O   
1739 C  CB  . LEU B 14  ? 0.0487 0.0596 0.0420 -0.0175 0.0077  0.0031  14  LEU B CB  
1740 C  CG  . LEU B 14  ? 0.0219 0.0493 0.0452 -0.0230 -0.0086 -0.0049 14  LEU B CG  
1741 C  CD1 . LEU B 14  ? 0.0147 0.0521 0.0442 -0.0118 0.0029  -0.0113 14  LEU B CD1 
1742 C  CD2 . LEU B 14  ? 0.0305 0.0325 0.0150 -0.0161 0.0015  0.0105  14  LEU B CD2 
1743 N  N   . GLU B 15  ? 0.0634 0.0785 0.0639 -0.0171 0.0033  0.0006  15  GLU B N   
1744 C  CA  . GLU B 15  ? 0.0683 0.0773 0.0740 -0.0158 -0.0039 0.0011  15  GLU B CA  
1745 C  C   . GLU B 15  ? 0.0594 0.0742 0.0678 -0.0180 -0.0069 -0.0018 15  GLU B C   
1746 O  O   . GLU B 15  ? 0.0554 0.0826 0.0658 -0.0308 -0.0118 -0.0100 15  GLU B O   
1747 C  CB  . GLU B 15  ? 0.0650 0.0729 0.0768 -0.0131 -0.0026 0.0005  15  GLU B CB  
1748 C  CG  . GLU B 15  ? 0.0644 0.0803 0.0688 -0.0231 -0.0015 0.0043  15  GLU B CG  
1749 C  CD  . GLU B 15  ? 0.0746 0.0737 0.0674 -0.0074 -0.0071 -0.0033 15  GLU B CD  
1750 O  OE1 . GLU B 15  ? 0.0709 0.0929 0.0634 -0.0492 -0.0010 0.0134  15  GLU B OE1 
1751 O  OE2 . GLU B 15  ? 0.0455 0.0573 0.0695 -0.0327 -0.0203 -0.0071 15  GLU B OE2 
1752 N  N   . PRO B 16  ? 0.0540 0.0740 0.0612 -0.0188 -0.0046 -0.0002 16  PRO B N   
1753 C  CA  . PRO B 16  ? 0.0504 0.0623 0.0571 -0.0161 -0.0049 -0.0001 16  PRO B CA  
1754 C  C   . PRO B 16  ? 0.0509 0.0743 0.0562 -0.0121 0.0002  0.0012  16  PRO B C   
1755 O  O   . PRO B 16  ? 0.0473 0.0748 0.0488 -0.0187 0.0001  -0.0009 16  PRO B O   
1756 C  CB  . PRO B 16  ? 0.0605 0.0638 0.0586 -0.0113 -0.0030 -0.0021 16  PRO B CB  
1757 C  CG  . PRO B 16  ? 0.0425 0.0586 0.0522 -0.0203 -0.0062 -0.0014 16  PRO B CG  
1758 C  CD  . PRO B 16  ? 0.0494 0.0694 0.0591 -0.0105 0.0002  0.0046  16  PRO B CD  
1759 N  N   . HIS B 17  ? 0.0396 0.0626 0.0367 -0.0182 0.0031  0.0043  17  HIS B N   
1760 C  CA  . HIS B 17  ? 0.0491 0.0700 0.0451 -0.0209 0.0018  0.0066  17  HIS B CA  
1761 C  C   . HIS B 17  ? 0.0460 0.0592 0.0429 -0.0183 0.0005  0.0048  17  HIS B C   
1762 O  O   . HIS B 17  ? 0.0454 0.0456 0.0251 -0.0349 0.0032  0.0093  17  HIS B O   
1763 C  CB  . HIS B 17  ? 0.0479 0.0807 0.0460 -0.0187 0.0025  0.0109  17  HIS B CB  
1764 C  CG  . HIS B 17  ? 0.0448 0.0978 0.0393 -0.0104 0.0030  0.0077  17  HIS B CG  
1765 N  ND1 . HIS B 17  ? 0.0517 0.1045 0.0465 -0.0213 0.0014  0.0135  17  HIS B ND1 
1766 C  CD2 . HIS B 17  ? 0.0260 0.0896 0.0578 -0.0178 -0.0044 0.0037  17  HIS B CD2 
1767 C  CE1 . HIS B 17  ? 0.0664 0.1219 0.0709 -0.0114 0.0000  0.0033  17  HIS B CE1 
1768 N  NE2 . HIS B 17  ? 0.0341 0.1083 0.0393 -0.0002 -0.0071 -0.0001 17  HIS B NE2 
1769 N  N   . PHE B 18  ? 0.0540 0.0665 0.0445 -0.0194 0.0084  0.0059  18  PHE B N   
1770 C  CA  . PHE B 18  ? 0.0621 0.0677 0.0500 -0.0188 0.0023  -0.0015 18  PHE B CA  
1771 C  C   . PHE B 18  ? 0.0608 0.0652 0.0487 -0.0178 0.0006  -0.0022 18  PHE B C   
1772 O  O   . PHE B 18  ? 0.0666 0.0665 0.0546 -0.0313 0.0058  0.0049  18  PHE B O   
1773 C  CB  . PHE B 18  ? 0.0698 0.0661 0.0536 -0.0167 0.0033  -0.0084 18  PHE B CB  
1774 C  CG  . PHE B 18  ? 0.0877 0.0656 0.0438 -0.0196 -0.0037 0.0009  18  PHE B CG  
1775 C  CD1 . PHE B 18  ? 0.0735 0.0674 0.0558 -0.0332 0.0133  -0.0016 18  PHE B CD1 
1776 C  CD2 . PHE B 18  ? 0.0783 0.0628 0.0547 -0.0238 0.0081  -0.0085 18  PHE B CD2 
1777 C  CE1 . PHE B 18  ? 0.0813 0.0615 0.0340 -0.0155 0.0103  0.0105  18  PHE B CE1 
1778 C  CE2 . PHE B 18  ? 0.0409 0.0475 0.0307 -0.0066 -0.0071 0.0080  18  PHE B CE2 
1779 C  CZ  . PHE B 18  ? 0.0555 0.0919 0.0485 -0.0146 -0.0020 -0.0005 18  PHE B CZ  
1780 N  N   . ASP B 19  ? 0.0592 0.0676 0.0458 -0.0196 -0.0052 0.0009  19  ASP B N   
1781 C  CA  . ASP B 19  ? 0.0514 0.0616 0.0438 -0.0206 -0.0047 0.0018  19  ASP B CA  
1782 C  C   . ASP B 19  ? 0.0605 0.0688 0.0544 -0.0217 0.0013  -0.0006 19  ASP B C   
1783 O  O   . ASP B 19  ? 0.0441 0.0597 0.0597 -0.0295 0.0021  -0.0090 19  ASP B O   
1784 C  CB  . ASP B 19  ? 0.0442 0.0621 0.0433 -0.0222 -0.0029 0.0022  19  ASP B CB  
1785 C  CG  . ASP B 19  ? 0.0546 0.0446 0.0427 -0.0178 -0.0108 0.0019  19  ASP B CG  
1786 O  OD1 . ASP B 19  ? 0.0424 0.0378 0.0175 -0.0336 -0.0169 0.0150  19  ASP B OD1 
1787 O  OD2 . ASP B 19  ? 0.0211 0.0572 0.0597 -0.0233 -0.0100 -0.0098 19  ASP B OD2 
1788 N  N   . LYS B 20  ? 0.0631 0.0685 0.0528 -0.0280 0.0064  0.0020  20  LYS B N   
1789 C  CA  . LYS B 20  ? 0.0606 0.0612 0.0521 -0.0234 0.0070  0.0068  20  LYS B CA  
1790 C  C   . LYS B 20  ? 0.0561 0.0592 0.0510 -0.0258 0.0080  0.0051  20  LYS B C   
1791 O  O   . LYS B 20  ? 0.0502 0.0615 0.0477 -0.0283 0.0110  0.0095  20  LYS B O   
1792 C  CB  . LYS B 20  ? 0.0652 0.0657 0.0593 -0.0224 0.0123  0.0056  20  LYS B CB  
1793 C  CG  . LYS B 20  ? 0.0782 0.0720 0.0687 -0.0152 0.0109  0.0023  20  LYS B CG  
1794 C  CD  . LYS B 20  ? 0.0810 0.1027 0.1076 -0.0149 0.0111  -0.0021 20  LYS B CD  
1795 C  CE  . LYS B 20  ? 0.1039 0.1197 0.1290 -0.0069 0.0096  0.0020  20  LYS B CE  
1796 N  NZ  . LYS B 20  ? 0.1438 0.1721 0.1637 0.0088  0.0095  -0.0144 20  LYS B NZ  
1797 N  N   . GLN B 21  ? 0.0484 0.0482 0.0398 -0.0186 -0.0002 0.0072  21  GLN B N   
1798 C  CA  . GLN B 21  ? 0.0489 0.0486 0.0450 -0.0181 0.0073  0.0027  21  GLN B CA  
1799 C  C   . GLN B 21  ? 0.0553 0.0470 0.0435 -0.0173 0.0039  0.0025  21  GLN B C   
1800 O  O   . GLN B 21  ? 0.0673 0.0564 0.0399 -0.0252 0.0091  0.0140  21  GLN B O   
1801 C  CB  . GLN B 21  ? 0.0446 0.0421 0.0518 -0.0200 0.0069  0.0006  21  GLN B CB  
1802 C  CG  . GLN B 21  ? 0.0700 0.0720 0.0752 -0.0148 0.0017  0.0125  21  GLN B CG  
1803 C  CD  . GLN B 21  ? 0.1086 0.1039 0.1163 -0.0081 0.0033  -0.0012 21  GLN B CD  
1804 O  OE1 . GLN B 21  ? 0.1276 0.1105 0.1629 -0.0058 0.0131  -0.0005 21  GLN B OE1 
1805 N  NE2 . GLN B 21  ? 0.1347 0.1474 0.1294 -0.0099 0.0103  0.0045  21  GLN B NE2 
1806 N  N   . THR B 22  ? 0.0646 0.0422 0.0402 -0.0169 0.0023  0.0004  22  THR B N   
1807 C  CA  . THR B 22  ? 0.0520 0.0515 0.0456 -0.0179 0.0051  -0.0012 22  THR B CA  
1808 C  C   . THR B 22  ? 0.0447 0.0410 0.0450 -0.0137 0.0033  0.0006  22  THR B C   
1809 O  O   . THR B 22  ? 0.0344 0.0482 0.0327 -0.0225 0.0040  0.0080  22  THR B O   
1810 C  CB  . THR B 22  ? 0.0665 0.0556 0.0527 -0.0163 0.0061  -0.0061 22  THR B CB  
1811 O  OG1 . THR B 22  ? 0.0426 0.0560 0.0468 -0.0256 0.0240  -0.0144 22  THR B OG1 
1812 C  CG2 . THR B 22  ? 0.0483 0.0554 0.0423 -0.0199 0.0170  -0.0059 22  THR B CG2 
1813 N  N   . MET B 23  ? 0.0338 0.0282 0.0342 -0.0227 0.0107  -0.0002 23  MET B N   
1814 C  CA  . MET B 23  ? 0.0363 0.0365 0.0356 -0.0188 0.0071  0.0062  23  MET B CA  
1815 C  C   . MET B 23  ? 0.0387 0.0454 0.0331 -0.0192 0.0056  0.0048  23  MET B C   
1816 O  O   . MET B 23  ? 0.0492 0.0402 0.0206 -0.0206 0.0096  0.0124  23  MET B O   
1817 C  CB  . MET B 23  ? 0.0217 0.0336 0.0239 -0.0172 0.0063  0.0000  23  MET B CB  
1818 C  CG  . MET B 23  ? 0.0623 0.0457 0.0560 -0.0248 -0.0024 0.0051  23  MET B CG  
1819 S  SD  . MET B 23  ? 0.0628 0.0630 0.0683 -0.0373 0.0163  0.0147  23  MET B SD  
1820 C  CE  . MET B 23  ? 0.0791 0.0924 0.0618 -0.0241 0.0098  -0.0040 23  MET B CE  
1821 N  N   . GLU B 24  ? 0.0366 0.0425 0.0300 -0.0225 0.0004  0.0095  24  GLU B N   
1822 C  CA  . GLU B 24  ? 0.0509 0.0547 0.0372 -0.0212 0.0013  0.0070  24  GLU B CA  
1823 C  C   . GLU B 24  ? 0.0518 0.0584 0.0315 -0.0201 0.0052  0.0063  24  GLU B C   
1824 O  O   . GLU B 24  ? 0.0512 0.0655 0.0186 -0.0381 0.0037  0.0147  24  GLU B O   
1825 C  CB  . GLU B 24  ? 0.0693 0.0626 0.0505 -0.0176 0.0029  0.0120  24  GLU B CB  
1826 C  CG  . GLU B 24  ? 0.0693 0.0867 0.0680 -0.0103 -0.0019 0.0097  24  GLU B CG  
1827 C  CD  . GLU B 24  ? 0.1106 0.1037 0.0978 -0.0141 -0.0021 0.0022  24  GLU B CD  
1828 O  OE1 . GLU B 24  ? 0.1069 0.1498 0.1264 -0.0580 0.0098  0.0210  24  GLU B OE1 
1829 O  OE2 . GLU B 24  ? 0.1445 0.1235 0.1292 -0.0167 -0.0028 0.0016  24  GLU B OE2 
1830 N  N   . ILE B 25  ? 0.0508 0.0607 0.0365 -0.0129 0.0056  0.0098  25  ILE B N   
1831 C  CA  . ILE B 25  ? 0.0471 0.0543 0.0337 -0.0139 0.0027  0.0088  25  ILE B CA  
1832 C  C   . ILE B 25  ? 0.0435 0.0474 0.0347 -0.0079 0.0038  0.0093  25  ILE B C   
1833 O  O   . ILE B 25  ? 0.0356 0.0516 0.0313 -0.0109 0.0020  0.0204  25  ILE B O   
1834 C  CB  . ILE B 25  ? 0.0454 0.0364 0.0440 -0.0076 0.0006  0.0070  25  ILE B CB  
1835 C  CG1 . ILE B 25  ? 0.0601 0.0486 0.0389 -0.0034 -0.0073 0.0005  25  ILE B CG1 
1836 C  CG2 . ILE B 25  ? 0.0666 0.0585 0.0439 -0.0169 -0.0006 -0.0023 25  ILE B CG2 
1837 C  CD1 . ILE B 25  ? 0.1055 0.0948 0.0840 -0.0024 0.0078  -0.0142 25  ILE B CD1 
1838 N  N   . HIS B 26  ? 0.0447 0.0634 0.0281 -0.0149 0.0084  0.0100  26  HIS B N   
1839 C  CA  . HIS B 26  ? 0.0449 0.0583 0.0185 -0.0088 0.0050  0.0058  26  HIS B CA  
1840 C  C   . HIS B 26  ? 0.0520 0.0637 0.0274 -0.0136 0.0032  0.0035  26  HIS B C   
1841 O  O   . HIS B 26  ? 0.0341 0.0684 0.0063 -0.0180 0.0006  0.0002  26  HIS B O   
1842 C  CB  . HIS B 26  ? 0.0449 0.0551 0.0337 -0.0034 0.0059  0.0121  26  HIS B CB  
1843 C  CG  . HIS B 26  ? 0.0241 0.0603 0.0182 -0.0170 0.0077  0.0098  26  HIS B CG  
1844 N  ND1 . HIS B 26  ? 0.0454 0.0193 0.0461 -0.0057 0.0121  0.0102  26  HIS B ND1 
1845 C  CD2 . HIS B 26  ? 0.0476 0.0353 0.0249 -0.0109 0.0140  -0.0047 26  HIS B CD2 
1846 C  CE1 . HIS B 26  ? 0.0310 0.0242 0.0460 -0.0204 0.0042  0.0026  26  HIS B CE1 
1847 N  NE2 . HIS B 26  ? 0.0144 0.0296 0.0241 -0.0074 0.0042  0.0121  26  HIS B NE2 
1848 N  N   . HIS B 27  ? 0.0445 0.0681 0.0357 -0.0088 0.0018  -0.0052 27  HIS B N   
1849 C  CA  . HIS B 27  ? 0.0489 0.0765 0.0494 -0.0108 0.0044  0.0036  27  HIS B CA  
1850 C  C   . HIS B 27  ? 0.0617 0.0744 0.0502 -0.0114 0.0022  0.0005  27  HIS B C   
1851 O  O   . HIS B 27  ? 0.0621 0.0792 0.0451 -0.0173 0.0047  0.0073  27  HIS B O   
1852 C  CB  . HIS B 27  ? 0.0460 0.0698 0.0461 -0.0137 0.0015  0.0010  27  HIS B CB  
1853 C  CG  . HIS B 27  ? 0.0425 0.0668 0.0492 -0.0104 0.0077  0.0056  27  HIS B CG  
1854 N  ND1 . HIS B 27  ? 0.0657 0.0688 0.0512 -0.0105 0.0039  0.0116  27  HIS B ND1 
1855 C  CD2 . HIS B 27  ? 0.0512 0.0605 0.0260 0.0077  -0.0030 0.0068  27  HIS B CD2 
1856 C  CE1 . HIS B 27  ? 0.0559 0.0519 0.0346 -0.0020 0.0275  0.0117  27  HIS B CE1 
1857 N  NE2 . HIS B 27  ? 0.0385 0.0659 0.0370 -0.0021 0.0060  -0.0001 27  HIS B NE2 
1858 N  N   . THR B 28  ? 0.0688 0.0748 0.0515 -0.0129 0.0004  0.0106  28  THR B N   
1859 C  CA  . THR B 28  ? 0.0627 0.0693 0.0509 -0.0049 -0.0023 0.0048  28  THR B CA  
1860 C  C   . THR B 28  ? 0.0520 0.0631 0.0448 -0.0140 0.0023  0.0051  28  THR B C   
1861 O  O   . THR B 28  ? 0.0221 0.0623 0.0406 -0.0132 -0.0012 0.0069  28  THR B O   
1862 C  CB  . THR B 28  ? 0.0632 0.0727 0.0577 -0.0113 0.0009  0.0031  28  THR B CB  
1863 O  OG1 . THR B 28  ? 0.0731 0.0617 0.0563 -0.0061 0.0016  -0.0047 28  THR B OG1 
1864 C  CG2 . THR B 28  ? 0.0559 0.0446 0.0263 0.0014  0.0147  0.0074  28  THR B CG2 
1865 N  N   . LYS B 29  ? 0.0440 0.0599 0.0400 -0.0126 0.0009  -0.0009 29  LYS B N   
1866 C  CA  . LYS B 29  ? 0.0493 0.0432 0.0399 -0.0129 0.0037  0.0024  29  LYS B CA  
1867 C  C   . LYS B 29  ? 0.0470 0.0384 0.0293 -0.0138 0.0036  0.0065  29  LYS B C   
1868 O  O   . LYS B 29  ? 0.0566 0.0359 0.0140 -0.0115 0.0106  0.0083  29  LYS B O   
1869 C  CB  . LYS B 29  ? 0.0404 0.0449 0.0349 -0.0151 0.0076  0.0032  29  LYS B CB  
1870 C  CG  . LYS B 29  ? 0.0577 0.0558 0.0632 -0.0183 -0.0042 -0.0034 29  LYS B CG  
1871 C  CD  . LYS B 29  ? 0.1056 0.0609 0.0814 -0.0132 0.0032  0.0075  29  LYS B CD  
1872 C  CE  . LYS B 29  ? 0.1291 0.0750 0.1205 -0.0136 0.0013  0.0060  29  LYS B CE  
1873 N  NZ  . LYS B 29  ? 0.1291 0.0690 0.1344 0.0061  -0.0125 0.0213  29  LYS B NZ  
1874 N  N   . HIS B 30  ? 0.0505 0.0279 0.0278 -0.0078 0.0015  0.0024  30  HIS B N   
1875 C  CA  . HIS B 30  ? 0.0357 0.0272 0.0280 -0.0079 0.0026  0.0008  30  HIS B CA  
1876 C  C   . HIS B 30  ? 0.0379 0.0290 0.0293 -0.0087 0.0024  0.0038  30  HIS B C   
1877 O  O   . HIS B 30  ? 0.0267 0.0374 0.0245 -0.0127 0.0073  0.0063  30  HIS B O   
1878 C  CB  . HIS B 30  ? 0.0467 0.0200 0.0215 -0.0105 0.0003  -0.0044 30  HIS B CB  
1879 C  CG  . HIS B 30  ? 0.0209 0.0454 0.0482 -0.0049 0.0092  -0.0038 30  HIS B CG  
1880 N  ND1 . HIS B 30  ? 0.0381 0.0577 0.0429 -0.0121 0.0263  -0.0039 30  HIS B ND1 
1881 C  CD2 . HIS B 30  ? 0.0177 0.0302 0.0480 -0.0021 0.0109  -0.0058 30  HIS B CD2 
1882 C  CE1 . HIS B 30  ? 0.0386 0.0429 0.0556 -0.0129 0.0034  -0.0013 30  HIS B CE1 
1883 N  NE2 . HIS B 30  ? 0.0407 0.0338 0.0223 -0.0170 0.0186  0.0013  30  HIS B NE2 
1884 N  N   . HIS B 31  ? 0.0320 0.0199 0.0337 -0.0122 0.0068  0.0068  31  HIS B N   
1885 C  CA  . HIS B 31  ? 0.0335 0.0406 0.0382 0.0004  0.0031  0.0035  31  HIS B CA  
1886 C  C   . HIS B 31  ? 0.0360 0.0327 0.0347 -0.0004 0.0047  0.0044  31  HIS B C   
1887 O  O   . HIS B 31  ? 0.0369 0.0145 0.0148 0.0159  0.0044  0.0025  31  HIS B O   
1888 C  CB  . HIS B 31  ? 0.0356 0.0445 0.0384 0.0016  0.0009  0.0043  31  HIS B CB  
1889 C  CG  . HIS B 31  ? 0.0333 0.0499 0.0360 -0.0036 0.0040  -0.0033 31  HIS B CG  
1890 N  ND1 . HIS B 31  ? 0.0148 0.0361 0.0070 -0.0025 0.0024  0.0003  31  HIS B ND1 
1891 C  CD2 . HIS B 31  ? 0.0424 0.0468 0.0331 -0.0030 0.0019  -0.0073 31  HIS B CD2 
1892 C  CE1 . HIS B 31  ? 0.0249 0.0324 0.0148 -0.0144 0.0107  -0.0025 31  HIS B CE1 
1893 N  NE2 . HIS B 31  ? 0.0157 0.0185 0.0064 -0.0060 -0.0011 0.0004  31  HIS B NE2 
1894 N  N   . GLN B 32  ? 0.0363 0.0285 0.0294 0.0063  0.0038  0.0086  32  GLN B N   
1895 C  CA  . GLN B 32  ? 0.0314 0.0364 0.0294 -0.0055 0.0026  -0.0026 32  GLN B CA  
1896 C  C   . GLN B 32  ? 0.0374 0.0488 0.0309 -0.0019 0.0015  -0.0072 32  GLN B C   
1897 O  O   . GLN B 32  ? 0.0560 0.0456 0.0241 -0.0132 0.0059  -0.0111 32  GLN B O   
1898 C  CB  . GLN B 32  ? 0.0280 0.0258 0.0243 -0.0001 0.0072  -0.0041 32  GLN B CB  
1899 C  CG  . GLN B 32  ? 0.0131 0.0146 0.0297 0.0032  0.0038  -0.0101 32  GLN B CG  
1900 C  CD  . GLN B 32  ? 0.0247 0.0617 0.0211 -0.0071 0.0135  -0.0134 32  GLN B CD  
1901 O  OE1 . GLN B 32  ? 0.0643 0.0483 0.0647 -0.0342 -0.0020 -0.0069 32  GLN B OE1 
1902 N  NE2 . GLN B 32  ? 0.0107 0.0415 0.0448 -0.0097 0.0110  -0.0122 32  GLN B NE2 
1903 N  N   . THR B 33  ? 0.0258 0.0469 0.0203 -0.0130 0.0064  -0.0082 33  THR B N   
1904 C  CA  . THR B 33  ? 0.0240 0.0405 0.0278 -0.0017 0.0078  -0.0054 33  THR B CA  
1905 C  C   . THR B 33  ? 0.0222 0.0361 0.0201 -0.0033 0.0042  -0.0016 33  THR B C   
1906 O  O   . THR B 33  ? 0.0089 0.0116 0.0157 -0.0034 -0.0002 0.0031  33  THR B O   
1907 C  CB  . THR B 33  ? 0.0216 0.0385 0.0251 -0.0069 0.0129  -0.0058 33  THR B CB  
1908 O  OG1 . THR B 33  ? 0.0360 0.0455 0.0579 -0.0065 0.0145  -0.0137 33  THR B OG1 
1909 C  CG2 . THR B 33  ? 0.0162 0.0490 0.0322 -0.0034 0.0044  -0.0067 33  THR B CG2 
1910 N  N   . TYR B 34  ? 0.0238 0.0351 0.0295 0.0034  0.0052  -0.0013 34  TYR B N   
1911 C  CA  . TYR B 34  ? 0.0277 0.0341 0.0237 -0.0002 0.0055  -0.0066 34  TYR B CA  
1912 C  C   . TYR B 34  ? 0.0330 0.0431 0.0287 -0.0011 0.0102  -0.0029 34  TYR B C   
1913 O  O   . TYR B 34  ? 0.0368 0.0334 0.0184 -0.0047 0.0165  -0.0116 34  TYR B O   
1914 C  CB  . TYR B 34  ? 0.0165 0.0310 0.0223 0.0048  0.0078  -0.0031 34  TYR B CB  
1915 C  CG  . TYR B 34  ? 0.0553 0.0455 0.0385 0.0018  -0.0044 -0.0106 34  TYR B CG  
1916 C  CD1 . TYR B 34  ? 0.0756 0.0602 0.0641 -0.0061 0.0054  -0.0065 34  TYR B CD1 
1917 C  CD2 . TYR B 34  ? 0.0721 0.0586 0.0604 -0.0149 -0.0029 -0.0072 34  TYR B CD2 
1918 C  CE1 . TYR B 34  ? 0.0888 0.0728 0.0661 0.0050  0.0023  -0.0050 34  TYR B CE1 
1919 C  CE2 . TYR B 34  ? 0.1071 0.0646 0.0712 -0.0213 -0.0034 -0.0186 34  TYR B CE2 
1920 C  CZ  . TYR B 34  ? 0.0931 0.0617 0.0519 0.0043  0.0033  -0.0227 34  TYR B CZ  
1921 O  OH  . TYR B 34  ? 0.1188 0.0829 0.0744 0.0059  0.0195  -0.0124 34  TYR B OH  
1922 N  N   . VAL B 35  ? 0.0343 0.0429 0.0291 -0.0027 0.0177  -0.0055 35  VAL B N   
1923 C  CA  . VAL B 35  ? 0.0446 0.0597 0.0288 -0.0034 0.0102  -0.0020 35  VAL B CA  
1924 C  C   . VAL B 35  ? 0.0401 0.0588 0.0287 -0.0048 0.0097  -0.0017 35  VAL B C   
1925 O  O   . VAL B 35  ? 0.0614 0.0575 0.0368 -0.0017 0.0195  -0.0083 35  VAL B O   
1926 C  CB  . VAL B 35  ? 0.0442 0.0609 0.0209 -0.0072 0.0083  -0.0035 35  VAL B CB  
1927 C  CG1 . VAL B 35  ? 0.0425 0.0515 0.0168 0.0036  0.0192  -0.0018 35  VAL B CG1 
1928 C  CG2 . VAL B 35  ? 0.0388 0.0537 0.0236 -0.0014 0.0097  -0.0006 35  VAL B CG2 
1929 N  N   . ASN B 36  ? 0.0353 0.0601 0.0220 -0.0004 0.0152  -0.0057 36  ASN B N   
1930 C  CA  . ASN B 36  ? 0.0321 0.0515 0.0257 -0.0005 0.0080  -0.0037 36  ASN B CA  
1931 C  C   . ASN B 36  ? 0.0405 0.0558 0.0420 -0.0021 0.0058  -0.0048 36  ASN B C   
1932 O  O   . ASN B 36  ? 0.0240 0.0618 0.0549 0.0012  0.0018  -0.0117 36  ASN B O   
1933 C  CB  . ASN B 36  ? 0.0344 0.0521 0.0256 -0.0009 0.0085  0.0009  36  ASN B CB  
1934 C  CG  . ASN B 36  ? 0.0328 0.0341 0.0353 0.0023  -0.0011 0.0006  36  ASN B CG  
1935 O  OD1 . ASN B 36  ? 0.0616 0.0363 0.0283 -0.0032 0.0232  -0.0007 36  ASN B OD1 
1936 N  ND2 . ASN B 36  ? 0.0271 0.0439 0.0571 -0.0063 -0.0029 -0.0080 36  ASN B ND2 
1937 N  N   . ASN B 37  ? 0.0426 0.0398 0.0408 -0.0045 0.0081  -0.0153 37  ASN B N   
1938 C  CA  . ASN B 37  ? 0.0410 0.0518 0.0391 -0.0098 0.0116  -0.0111 37  ASN B CA  
1939 C  C   . ASN B 37  ? 0.0421 0.0506 0.0430 -0.0084 0.0080  -0.0050 37  ASN B C   
1940 O  O   . ASN B 37  ? 0.0444 0.0635 0.0498 -0.0152 0.0119  -0.0032 37  ASN B O   
1941 C  CB  . ASN B 37  ? 0.0409 0.0320 0.0396 -0.0074 0.0151  -0.0116 37  ASN B CB  
1942 C  CG  . ASN B 37  ? 0.0457 0.0400 0.0372 -0.0100 0.0071  -0.0138 37  ASN B CG  
1943 O  OD1 . ASN B 37  ? 0.0612 0.0380 0.0400 -0.0076 0.0016  -0.0301 37  ASN B OD1 
1944 N  ND2 . ASN B 37  ? 0.0183 0.0464 0.0114 -0.0219 0.0078  -0.0142 37  ASN B ND2 
1945 N  N   . ALA B 38  ? 0.0463 0.0637 0.0437 -0.0120 0.0066  -0.0023 38  ALA B N   
1946 C  CA  . ALA B 38  ? 0.0375 0.0683 0.0292 -0.0017 0.0025  -0.0035 38  ALA B CA  
1947 C  C   . ALA B 38  ? 0.0374 0.0668 0.0297 -0.0037 0.0045  -0.0074 38  ALA B C   
1948 O  O   . ALA B 38  ? 0.0330 0.0832 0.0471 -0.0053 0.0072  -0.0124 38  ALA B O   
1949 C  CB  . ALA B 38  ? 0.0332 0.0757 0.0212 -0.0011 0.0094  -0.0035 38  ALA B CB  
1950 N  N   . ASN B 39  ? 0.0335 0.0601 0.0192 -0.0062 0.0040  -0.0079 39  ASN B N   
1951 C  CA  . ASN B 39  ? 0.0340 0.0574 0.0267 -0.0019 0.0015  -0.0077 39  ASN B CA  
1952 C  C   . ASN B 39  ? 0.0431 0.0612 0.0356 0.0008  0.0003  -0.0101 39  ASN B C   
1953 O  O   . ASN B 39  ? 0.0477 0.0882 0.0396 -0.0058 -0.0025 -0.0045 39  ASN B O   
1954 C  CB  . ASN B 39  ? 0.0270 0.0546 0.0294 -0.0007 0.0035  0.0020  39  ASN B CB  
1955 C  CG  . ASN B 39  ? 0.0234 0.0389 0.0141 -0.0032 -0.0079 -0.0049 39  ASN B CG  
1956 O  OD1 . ASN B 39  ? 0.0103 0.0601 0.0412 0.0024  -0.0067 0.0307  39  ASN B OD1 
1957 N  ND2 . ASN B 39  ? 0.0065 0.0469 0.0206 -0.0018 0.0007  0.0079  39  ASN B ND2 
1958 N  N   . ALA B 40  ? 0.0312 0.0693 0.0448 0.0071  -0.0035 -0.0150 40  ALA B N   
1959 C  CA  . ALA B 40  ? 0.0477 0.0640 0.0503 0.0082  -0.0022 -0.0136 40  ALA B CA  
1960 C  C   . ALA B 40  ? 0.0417 0.0645 0.0586 0.0083  -0.0022 -0.0128 40  ALA B C   
1961 O  O   . ALA B 40  ? 0.0585 0.0796 0.0535 0.0064  -0.0051 -0.0228 40  ALA B O   
1962 C  CB  . ALA B 40  ? 0.0406 0.0637 0.0513 0.0114  0.0068  -0.0124 40  ALA B CB  
1963 N  N   . ALA B 41  ? 0.0432 0.0728 0.0709 0.0099  0.0021  -0.0127 41  ALA B N   
1964 C  CA  . ALA B 41  ? 0.0536 0.0641 0.0697 0.0096  0.0026  -0.0108 41  ALA B CA  
1965 C  C   . ALA B 41  ? 0.0618 0.0776 0.0843 0.0068  0.0034  -0.0095 41  ALA B C   
1966 O  O   . ALA B 41  ? 0.0763 0.0822 0.0865 0.0067  0.0034  -0.0187 41  ALA B O   
1967 C  CB  . ALA B 41  ? 0.0630 0.0742 0.0782 0.0106  -0.0029 -0.0055 41  ALA B CB  
1968 N  N   . LEU B 42  ? 0.0612 0.0782 0.0848 0.0026  0.0051  -0.0069 42  LEU B N   
1969 C  CA  . LEU B 42  ? 0.0666 0.0831 0.0806 0.0019  -0.0002 -0.0074 42  LEU B CA  
1970 C  C   . LEU B 42  ? 0.0804 0.0853 0.0838 0.0007  -0.0021 -0.0050 42  LEU B C   
1971 O  O   . LEU B 42  ? 0.0850 0.0972 0.0837 -0.0001 -0.0052 -0.0087 42  LEU B O   
1972 C  CB  . LEU B 42  ? 0.0620 0.0752 0.0783 0.0042  -0.0007 -0.0035 42  LEU B CB  
1973 C  CG  . LEU B 42  ? 0.0507 0.0607 0.0789 0.0035  -0.0145 -0.0033 42  LEU B CG  
1974 C  CD1 . LEU B 42  ? 0.0392 0.0484 0.0756 0.0004  -0.0150 -0.0099 42  LEU B CD1 
1975 C  CD2 . LEU B 42  ? 0.0878 0.0710 0.1007 -0.0029 -0.0054 0.0008  42  LEU B CD2 
1976 N  N   . GLU B 43  ? 0.0942 0.1037 0.0951 0.0047  -0.0023 -0.0031 43  GLU B N   
1977 C  CA  . GLU B 43  ? 0.1092 0.1020 0.1009 0.0008  0.0007  -0.0080 43  GLU B CA  
1978 C  C   . GLU B 43  ? 0.1087 0.1127 0.1021 -0.0013 0.0024  -0.0083 43  GLU B C   
1979 O  O   . GLU B 43  ? 0.1185 0.1126 0.0959 0.0026  0.0029  -0.0110 43  GLU B O   
1980 C  CB  . GLU B 43  ? 0.1222 0.1025 0.1077 0.0049  -0.0029 -0.0064 43  GLU B CB  
1981 C  CG  . GLU B 43  ? 0.1554 0.1420 0.1455 -0.0028 0.0096  -0.0045 43  GLU B CG  
1982 C  CD  . GLU B 43  ? 0.1800 0.1818 0.1802 -0.0068 -0.0049 -0.0028 43  GLU B CD  
1983 O  OE1 . GLU B 43  ? 0.1895 0.2210 0.2392 -0.0076 0.0018  0.0041  43  GLU B OE1 
1984 O  OE2 . GLU B 43  ? 0.2019 0.1595 0.1757 -0.0067 -0.0136 -0.0011 43  GLU B OE2 
1985 N  N   . SER B 44  ? 0.1016 0.1006 0.1033 -0.0073 0.0008  -0.0085 44  SER B N   
1986 C  CA  . SER B 44  ? 0.1032 0.1159 0.1014 -0.0064 -0.0005 -0.0074 44  SER B CA  
1987 C  C   . SER B 44  ? 0.0980 0.1124 0.1055 -0.0038 0.0019  -0.0123 44  SER B C   
1988 O  O   . SER B 44  ? 0.1055 0.1202 0.1211 -0.0026 0.0031  -0.0205 44  SER B O   
1989 C  CB  . SER B 44  ? 0.1074 0.1140 0.1042 -0.0022 -0.0003 -0.0036 44  SER B CB  
1990 O  OG  . SER B 44  ? 0.1180 0.1390 0.1069 -0.0050 0.0005  -0.0033 44  SER B OG  
1991 N  N   . LEU B 45  ? 0.1042 0.1170 0.1030 -0.0030 -0.0018 -0.0108 45  LEU B N   
1992 C  CA  . LEU B 45  ? 0.1040 0.1210 0.1037 -0.0036 -0.0024 -0.0081 45  LEU B CA  
1993 C  C   . LEU B 45  ? 0.1073 0.1153 0.1028 0.0029  -0.0024 -0.0063 45  LEU B C   
1994 O  O   . LEU B 45  ? 0.1162 0.1245 0.1108 0.0077  0.0003  -0.0073 45  LEU B O   
1995 C  CB  . LEU B 45  ? 0.1095 0.1322 0.1110 -0.0022 0.0001  -0.0057 45  LEU B CB  
1996 C  CG  . LEU B 45  ? 0.1080 0.1321 0.1136 0.0008  -0.0028 -0.0123 45  LEU B CG  
1997 C  CD1 . LEU B 45  ? 0.1125 0.1363 0.1154 -0.0032 -0.0022 -0.0100 45  LEU B CD1 
1998 C  CD2 . LEU B 45  ? 0.1199 0.1379 0.1319 -0.0041 -0.0047 -0.0098 45  LEU B CD2 
1999 N  N   . PRO B 46  ? 0.1088 0.1176 0.1063 0.0034  -0.0029 -0.0088 46  PRO B N   
2000 C  CA  . PRO B 46  ? 0.1126 0.1184 0.1070 0.0067  -0.0024 -0.0087 46  PRO B CA  
2001 C  C   . PRO B 46  ? 0.1223 0.1276 0.1182 0.0041  -0.0005 -0.0072 46  PRO B C   
2002 O  O   . PRO B 46  ? 0.1321 0.1399 0.1261 0.0156  -0.0065 -0.0087 46  PRO B O   
2003 C  CB  . PRO B 46  ? 0.1086 0.1248 0.1119 0.0073  0.0023  -0.0035 46  PRO B CB  
2004 C  CG  . PRO B 46  ? 0.1200 0.1129 0.1124 0.0032  0.0000  0.0026  46  PRO B CG  
2005 C  CD  . PRO B 46  ? 0.1109 0.1139 0.1028 0.0063  0.0007  -0.0096 46  PRO B CD  
2006 N  N   . GLU B 47  ? 0.1417 0.1329 0.1294 0.0044  -0.0004 -0.0077 47  GLU B N   
2007 C  CA  . GLU B 47  ? 0.1370 0.1298 0.1262 0.0048  -0.0023 -0.0063 47  GLU B CA  
2008 C  C   . GLU B 47  ? 0.1329 0.1222 0.1269 0.0073  -0.0045 -0.0047 47  GLU B C   
2009 O  O   . GLU B 47  ? 0.1365 0.1132 0.1376 0.0143  -0.0014 -0.0113 47  GLU B O   
2010 C  CB  . GLU B 47  ? 0.1526 0.1444 0.1396 0.0010  -0.0034 -0.0054 47  GLU B CB  
2011 C  CG  . GLU B 47  ? 0.1581 0.1544 0.1621 0.0051  0.0013  -0.0034 47  GLU B CG  
2012 C  CD  . GLU B 47  ? 0.1911 0.1964 0.2012 -0.0069 0.0030  0.0037  47  GLU B CD  
2013 O  OE1 . GLU B 47  ? 0.1792 0.1975 0.2064 -0.0060 0.0240  -0.0047 47  GLU B OE1 
2014 O  OE2 . GLU B 47  ? 0.2047 0.2148 0.2269 -0.0038 -0.0005 0.0057  47  GLU B OE2 
2015 N  N   . PHE B 48  ? 0.1153 0.1077 0.1062 0.0066  -0.0048 -0.0073 48  PHE B N   
2016 C  CA  . PHE B 48  ? 0.1076 0.1004 0.1020 -0.0007 -0.0054 -0.0074 48  PHE B CA  
2017 C  C   . PHE B 48  ? 0.1078 0.1035 0.1034 -0.0013 -0.0035 -0.0041 48  PHE B C   
2018 O  O   . PHE B 48  ? 0.0978 0.0962 0.1010 0.0032  -0.0022 -0.0079 48  PHE B O   
2019 C  CB  . PHE B 48  ? 0.1005 0.0997 0.0987 -0.0016 -0.0060 -0.0039 48  PHE B CB  
2020 C  CG  . PHE B 48  ? 0.1165 0.1088 0.1061 0.0001  -0.0004 -0.0051 48  PHE B CG  
2021 C  CD1 . PHE B 48  ? 0.1204 0.1030 0.1217 -0.0102 -0.0076 0.0041  48  PHE B CD1 
2022 C  CD2 . PHE B 48  ? 0.1019 0.1027 0.1129 -0.0060 0.0031  -0.0017 48  PHE B CD2 
2023 C  CE1 . PHE B 48  ? 0.1180 0.1210 0.1345 -0.0104 -0.0152 -0.0064 48  PHE B CE1 
2024 C  CE2 . PHE B 48  ? 0.0957 0.0987 0.1213 -0.0062 -0.0054 -0.0056 48  PHE B CE2 
2025 C  CZ  . PHE B 48  ? 0.1072 0.0903 0.1327 -0.0047 -0.0147 0.0002  48  PHE B CZ  
2026 N  N   . ALA B 49  ? 0.1099 0.0992 0.1020 -0.0044 -0.0043 -0.0029 49  ALA B N   
2027 C  CA  . ALA B 49  ? 0.1128 0.1075 0.1082 -0.0041 -0.0047 0.0029  49  ALA B CA  
2028 C  C   . ALA B 49  ? 0.1154 0.1140 0.1112 -0.0028 -0.0023 0.0017  49  ALA B C   
2029 O  O   . ALA B 49  ? 0.1256 0.1390 0.1222 -0.0039 -0.0054 0.0049  49  ALA B O   
2030 C  CB  . ALA B 49  ? 0.1183 0.1087 0.1100 0.0003  -0.0033 -0.0009 49  ALA B CB  
2031 N  N   . ASN B 50  ? 0.1234 0.1292 0.1221 0.0032  0.0014  0.0023  50  ASN B N   
2032 C  CA  . ASN B 50  ? 0.1297 0.1371 0.1302 0.0028  -0.0002 0.0032  50  ASN B CA  
2033 C  C   . ASN B 50  ? 0.1235 0.1320 0.1236 0.0003  0.0005  0.0049  50  ASN B C   
2034 O  O   . ASN B 50  ? 0.1297 0.1370 0.1261 0.0050  0.0024  0.0068  50  ASN B O   
2035 C  CB  . ASN B 50  ? 0.1428 0.1460 0.1409 0.0055  0.0023  0.0025  50  ASN B CB  
2036 C  CG  . ASN B 50  ? 0.1756 0.1681 0.1608 0.0069  0.0080  0.0042  50  ASN B CG  
2037 O  OD1 . ASN B 50  ? 0.2267 0.1814 0.1993 0.0097  0.0058  0.0149  50  ASN B OD1 
2038 N  ND2 . ASN B 50  ? 0.1962 0.1963 0.1959 -0.0007 0.0177  -0.0069 50  ASN B ND2 
2039 N  N   . LEU B 51  ? 0.1160 0.1226 0.1145 -0.0011 0.0019  0.0005  51  LEU B N   
2040 C  CA  . LEU B 51  ? 0.1117 0.1075 0.1132 -0.0003 -0.0002 -0.0001 51  LEU B CA  
2041 C  C   . LEU B 51  ? 0.1071 0.1029 0.1007 0.0002  -0.0003 -0.0014 51  LEU B C   
2042 O  O   . LEU B 51  ? 0.1136 0.1147 0.1177 0.0009  -0.0034 0.0000  51  LEU B O   
2043 C  CB  . LEU B 51  ? 0.1116 0.1022 0.1089 0.0040  -0.0003 0.0008  51  LEU B CB  
2044 C  CG  . LEU B 51  ? 0.1256 0.1054 0.1137 0.0014  -0.0011 0.0007  51  LEU B CG  
2045 C  CD1 . LEU B 51  ? 0.1386 0.1217 0.1391 0.0056  0.0117  -0.0019 51  LEU B CD1 
2046 C  CD2 . LEU B 51  ? 0.1470 0.1255 0.1328 0.0126  -0.0047 -0.0012 51  LEU B CD2 
2047 N  N   . PRO B 52  ? 0.1001 0.1011 0.1041 -0.0007 0.0023  -0.0042 52  PRO B N   
2048 C  CA  . PRO B 52  ? 0.0915 0.0947 0.0914 -0.0002 0.0052  -0.0063 52  PRO B CA  
2049 C  C   . PRO B 52  ? 0.0852 0.0861 0.0909 0.0011  0.0051  -0.0054 52  PRO B C   
2050 O  O   . PRO B 52  ? 0.0837 0.0725 0.0748 0.0081  0.0037  -0.0040 52  PRO B O   
2051 C  CB  . PRO B 52  ? 0.0955 0.0940 0.0916 -0.0029 0.0019  -0.0105 52  PRO B CB  
2052 C  CG  . PRO B 52  ? 0.1025 0.1072 0.0958 -0.0003 0.0084  -0.0069 52  PRO B CG  
2053 C  CD  . PRO B 52  ? 0.0988 0.0994 0.0964 -0.0006 0.0064  -0.0071 52  PRO B CD  
2054 N  N   . VAL B 53  ? 0.0707 0.0878 0.0823 0.0012  0.0133  -0.0095 53  VAL B N   
2055 C  CA  . VAL B 53  ? 0.0747 0.0896 0.0876 0.0025  0.0100  -0.0074 53  VAL B CA  
2056 C  C   . VAL B 53  ? 0.0730 0.0922 0.0855 -0.0011 0.0054  -0.0044 53  VAL B C   
2057 O  O   . VAL B 53  ? 0.0672 0.0935 0.0818 0.0053  0.0079  -0.0059 53  VAL B O   
2058 C  CB  . VAL B 53  ? 0.0711 0.0912 0.0816 0.0000  0.0116  -0.0102 53  VAL B CB  
2059 C  CG1 . VAL B 53  ? 0.0743 0.1122 0.0940 0.0072  0.0070  -0.0055 53  VAL B CG1 
2060 C  CG2 . VAL B 53  ? 0.0477 0.0695 0.0843 0.0100  0.0161  -0.0127 53  VAL B CG2 
2061 N  N   . GLU B 54  ? 0.0802 0.0906 0.0827 -0.0024 0.0014  -0.0082 54  GLU B N   
2062 C  CA  . GLU B 54  ? 0.0834 0.0951 0.0853 -0.0064 -0.0014 -0.0070 54  GLU B CA  
2063 C  C   . GLU B 54  ? 0.0843 0.0957 0.0852 -0.0050 -0.0011 -0.0038 54  GLU B C   
2064 O  O   . GLU B 54  ? 0.0693 0.1054 0.0859 -0.0141 -0.0043 -0.0011 54  GLU B O   
2065 C  CB  . GLU B 54  ? 0.0942 0.1070 0.0919 -0.0050 -0.0011 -0.0052 54  GLU B CB  
2066 C  CG  . GLU B 54  ? 0.1103 0.1032 0.1124 -0.0049 0.0017  -0.0096 54  GLU B CG  
2067 C  CD  . GLU B 54  ? 0.1232 0.1211 0.1186 -0.0011 0.0003  -0.0059 54  GLU B CD  
2068 O  OE1 . GLU B 54  ? 0.1109 0.1280 0.1188 -0.0009 -0.0048 -0.0029 54  GLU B OE1 
2069 O  OE2 . GLU B 54  ? 0.1087 0.1339 0.1402 0.0023  -0.0029 -0.0089 54  GLU B OE2 
2070 N  N   . GLU B 55  ? 0.0808 0.0945 0.0776 -0.0062 -0.0009 -0.0118 55  GLU B N   
2071 C  CA  . GLU B 55  ? 0.0873 0.0845 0.0752 -0.0039 0.0071  -0.0070 55  GLU B CA  
2072 C  C   . GLU B 55  ? 0.0826 0.0816 0.0730 -0.0070 0.0033  -0.0106 55  GLU B C   
2073 O  O   . GLU B 55  ? 0.0884 0.0848 0.0712 -0.0004 0.0162  -0.0169 55  GLU B O   
2074 C  CB  . GLU B 55  ? 0.0874 0.0963 0.0758 -0.0034 0.0071  -0.0086 55  GLU B CB  
2075 C  CG  . GLU B 55  ? 0.1155 0.1012 0.1096 -0.0102 0.0019  -0.0016 55  GLU B CG  
2076 C  CD  . GLU B 55  ? 0.1514 0.1215 0.1435 0.0000  0.0050  -0.0027 55  GLU B CD  
2077 O  OE1 . GLU B 55  ? 0.1596 0.1277 0.1824 0.0097  0.0074  0.0038  55  GLU B OE1 
2078 O  OE2 . GLU B 55  ? 0.1936 0.1765 0.1943 -0.0060 -0.0063 -0.0049 55  GLU B OE2 
2079 N  N   . LEU B 56  ? 0.0791 0.0850 0.0604 -0.0057 0.0003  -0.0036 56  LEU B N   
2080 C  CA  . LEU B 56  ? 0.0814 0.0888 0.0672 -0.0063 -0.0027 -0.0072 56  LEU B CA  
2081 C  C   . LEU B 56  ? 0.0741 0.0876 0.0651 -0.0050 -0.0009 -0.0091 56  LEU B C   
2082 O  O   . LEU B 56  ? 0.0897 0.0993 0.0683 -0.0081 0.0051  -0.0061 56  LEU B O   
2083 C  CB  . LEU B 56  ? 0.0731 0.0776 0.0603 -0.0072 -0.0074 -0.0094 56  LEU B CB  
2084 C  CG  . LEU B 56  ? 0.0898 0.1082 0.0969 -0.0142 -0.0113 -0.0019 56  LEU B CG  
2085 C  CD1 . LEU B 56  ? 0.0975 0.0885 0.0919 -0.0019 -0.0104 -0.0169 56  LEU B CD1 
2086 C  CD2 . LEU B 56  ? 0.1024 0.1031 0.1123 -0.0029 -0.0154 -0.0002 56  LEU B CD2 
2087 N  N   . ILE B 57  ? 0.0830 0.0937 0.0801 -0.0044 0.0015  -0.0120 57  ILE B N   
2088 C  CA  . ILE B 57  ? 0.0830 0.0792 0.0748 -0.0042 0.0006  -0.0086 57  ILE B CA  
2089 C  C   . ILE B 57  ? 0.0881 0.0763 0.0772 -0.0051 -0.0002 -0.0112 57  ILE B C   
2090 O  O   . ILE B 57  ? 0.0867 0.0575 0.0896 -0.0130 0.0027  -0.0180 57  ILE B O   
2091 C  CB  . ILE B 57  ? 0.0872 0.0793 0.0745 -0.0036 -0.0018 -0.0095 57  ILE B CB  
2092 C  CG1 . ILE B 57  ? 0.0947 0.0800 0.0782 -0.0085 -0.0107 -0.0071 57  ILE B CG1 
2093 C  CG2 . ILE B 57  ? 0.0760 0.0604 0.0710 0.0032  0.0107  -0.0133 57  ILE B CG2 
2094 C  CD1 . ILE B 57  ? 0.1126 0.0967 0.0739 -0.0175 -0.0033 -0.0122 57  ILE B CD1 
2095 N  N   . THR B 58  ? 0.0867 0.0845 0.0893 0.0009  -0.0014 -0.0085 58  THR B N   
2096 C  CA  . THR B 58  ? 0.0979 0.0979 0.0918 -0.0061 0.0048  -0.0069 58  THR B CA  
2097 C  C   . THR B 58  ? 0.1069 0.0998 0.0988 -0.0046 0.0041  -0.0076 58  THR B C   
2098 O  O   . THR B 58  ? 0.1144 0.1061 0.1056 -0.0187 0.0143  -0.0016 58  THR B O   
2099 C  CB  . THR B 58  ? 0.0981 0.1012 0.0895 -0.0045 0.0064  -0.0058 58  THR B CB  
2100 O  OG1 . THR B 58  ? 0.1134 0.1247 0.0845 0.0037  0.0026  -0.0218 58  THR B OG1 
2101 C  CG2 . THR B 58  ? 0.0889 0.1024 0.0956 -0.0052 0.0105  -0.0094 58  THR B CG2 
2102 N  N   . LYS B 59  ? 0.1033 0.1028 0.0985 -0.0067 0.0038  -0.0093 59  LYS B N   
2103 C  CA  . LYS B 59  ? 0.1031 0.1071 0.0969 -0.0020 -0.0018 -0.0094 59  LYS B CA  
2104 C  C   . LYS B 59  ? 0.0968 0.1067 0.0932 -0.0029 0.0007  -0.0123 59  LYS B C   
2105 O  O   . LYS B 59  ? 0.0821 0.1009 0.0807 -0.0041 -0.0017 -0.0110 59  LYS B O   
2106 C  CB  . LYS B 59  ? 0.1087 0.1105 0.1035 -0.0054 0.0033  -0.0112 59  LYS B CB  
2107 C  CG  . LYS B 59  ? 0.1162 0.1177 0.1180 -0.0033 -0.0079 -0.0043 59  LYS B CG  
2108 C  CD  . LYS B 59  ? 0.1345 0.1194 0.1354 -0.0026 0.0125  -0.0026 59  LYS B CD  
2109 C  CE  . LYS B 59  ? 0.1591 0.1491 0.1521 0.0008  0.0000  0.0022  59  LYS B CE  
2110 N  NZ  . LYS B 59  ? 0.1792 0.1713 0.1608 -0.0041 -0.0148 -0.0185 59  LYS B NZ  
2111 N  N   . LEU B 60  ? 0.0939 0.1006 0.0884 -0.0049 -0.0017 -0.0131 60  LEU B N   
2112 C  CA  . LEU B 60  ? 0.0830 0.0930 0.0929 -0.0035 -0.0016 -0.0107 60  LEU B CA  
2113 C  C   . LEU B 60  ? 0.0933 0.1044 0.1030 -0.0029 -0.0028 -0.0105 60  LEU B C   
2114 O  O   . LEU B 60  ? 0.0986 0.1105 0.1195 -0.0021 -0.0063 -0.0167 60  LEU B O   
2115 C  CB  . LEU B 60  ? 0.0739 0.0905 0.0841 -0.0052 -0.0086 -0.0089 60  LEU B CB  
2116 C  CG  . LEU B 60  ? 0.0704 0.0753 0.0623 -0.0053 0.0045  -0.0127 60  LEU B CG  
2117 C  CD1 . LEU B 60  ? 0.0852 0.0949 0.0644 -0.0058 -0.0050 -0.0278 60  LEU B CD1 
2118 C  CD2 . LEU B 60  ? 0.0621 0.0876 0.0772 -0.0107 0.0009  -0.0045 60  LEU B CD2 
2119 N  N   . ASP B 61  ? 0.0977 0.0994 0.1048 -0.0025 0.0022  -0.0120 61  ASP B N   
2120 C  CA  . ASP B 61  ? 0.1202 0.1190 0.1267 -0.0057 -0.0026 -0.0094 61  ASP B CA  
2121 C  C   . ASP B 61  ? 0.1117 0.1093 0.1249 -0.0026 -0.0047 -0.0089 61  ASP B C   
2122 O  O   . ASP B 61  ? 0.1212 0.1020 0.1392 -0.0107 -0.0178 -0.0183 61  ASP B O   
2123 C  CB  . ASP B 61  ? 0.1383 0.1297 0.1431 -0.0017 0.0008  -0.0071 61  ASP B CB  
2124 C  CG  . ASP B 61  ? 0.1691 0.1741 0.1763 -0.0097 -0.0001 -0.0090 61  ASP B CG  
2125 O  OD1 . ASP B 61  ? 0.2272 0.2448 0.1950 -0.0088 -0.0092 -0.0003 61  ASP B OD1 
2126 O  OD2 . ASP B 61  ? 0.2152 0.2072 0.2286 -0.0132 0.0058  0.0066  61  ASP B OD2 
2127 N  N   . GLN B 62  ? 0.1222 0.1157 0.1193 -0.0075 -0.0074 -0.0077 62  GLN B N   
2128 C  CA  . GLN B 62  ? 0.1166 0.1168 0.1181 -0.0065 -0.0083 -0.0091 62  GLN B CA  
2129 C  C   . GLN B 62  ? 0.1176 0.1150 0.1158 -0.0068 -0.0059 -0.0097 62  GLN B C   
2130 O  O   . GLN B 62  ? 0.1187 0.1234 0.1243 -0.0110 -0.0092 -0.0081 62  GLN B O   
2131 C  CB  . GLN B 62  ? 0.1260 0.1223 0.1180 -0.0145 -0.0094 -0.0085 62  GLN B CB  
2132 C  CG  . GLN B 62  ? 0.1523 0.1290 0.1455 -0.0063 -0.0037 -0.0099 62  GLN B CG  
2133 C  CD  . GLN B 62  ? 0.1787 0.1835 0.1776 0.0024  -0.0003 -0.0067 62  GLN B CD  
2134 O  OE1 . GLN B 62  ? 0.2305 0.2007 0.1999 0.0024  -0.0091 0.0060  62  GLN B OE1 
2135 N  NE2 . GLN B 62  ? 0.1964 0.1734 0.1830 0.0072  -0.0058 0.0029  62  GLN B NE2 
2136 N  N   . LEU B 63  ? 0.1077 0.1059 0.1210 -0.0077 -0.0109 -0.0110 63  LEU B N   
2137 C  CA  . LEU B 63  ? 0.0991 0.0972 0.1134 -0.0039 -0.0062 -0.0143 63  LEU B CA  
2138 C  C   . LEU B 63  ? 0.1011 0.0959 0.1112 -0.0047 -0.0006 -0.0160 63  LEU B C   
2139 O  O   . LEU B 63  ? 0.1184 0.1003 0.1095 -0.0068 0.0066  -0.0231 63  LEU B O   
2140 C  CB  . LEU B 63  ? 0.0915 0.0956 0.1076 -0.0049 -0.0116 -0.0114 63  LEU B CB  
2141 C  CG  . LEU B 63  ? 0.0749 0.0681 0.0996 -0.0021 -0.0046 -0.0170 63  LEU B CG  
2142 C  CD1 . LEU B 63  ? 0.0812 0.0826 0.0687 0.0128  -0.0148 0.0032  63  LEU B CD1 
2143 C  CD2 . LEU B 63  ? 0.0930 0.0850 0.1027 -0.0138 -0.0202 -0.0061 63  LEU B CD2 
2144 N  N   . PRO B 64  ? 0.1087 0.1007 0.1117 -0.0033 0.0013  -0.0134 64  PRO B N   
2145 C  CA  . PRO B 64  ? 0.1114 0.1038 0.1198 -0.0026 -0.0002 -0.0100 64  PRO B CA  
2146 C  C   . PRO B 64  ? 0.1295 0.1108 0.1286 -0.0027 0.0000  -0.0050 64  PRO B C   
2147 O  O   . PRO B 64  ? 0.1442 0.1166 0.1503 0.0003  0.0007  -0.0043 64  PRO B O   
2148 C  CB  . PRO B 64  ? 0.1137 0.1084 0.1219 -0.0004 -0.0003 -0.0109 64  PRO B CB  
2149 C  CG  . PRO B 64  ? 0.1043 0.1031 0.1054 -0.0041 0.0013  -0.0124 64  PRO B CG  
2150 C  CD  . PRO B 64  ? 0.1151 0.1000 0.1105 -0.0009 -0.0040 -0.0105 64  PRO B CD  
2151 N  N   . ALA B 65  ? 0.1169 0.1114 0.1189 -0.0038 0.0041  -0.0045 65  ALA B N   
2152 C  CA  . ALA B 65  ? 0.1067 0.1081 0.1194 -0.0046 0.0022  -0.0052 65  ALA B CA  
2153 C  C   . ALA B 65  ? 0.0983 0.1026 0.1113 -0.0029 0.0009  -0.0040 65  ALA B C   
2154 O  O   . ALA B 65  ? 0.1034 0.1085 0.1255 -0.0054 0.0020  -0.0063 65  ALA B O   
2155 C  CB  . ALA B 65  ? 0.1025 0.1094 0.1142 -0.0036 0.0052  -0.0048 65  ALA B CB  
2156 N  N   . ASP B 66  ? 0.0990 0.1043 0.1183 -0.0051 0.0049  -0.0048 66  ASP B N   
2157 C  CA  . ASP B 66  ? 0.1028 0.1054 0.1218 -0.0093 0.0007  0.0019  66  ASP B CA  
2158 C  C   . ASP B 66  ? 0.1014 0.1025 0.1205 -0.0085 0.0001  -0.0020 66  ASP B C   
2159 O  O   . ASP B 66  ? 0.1160 0.1002 0.1158 -0.0137 -0.0001 -0.0013 66  ASP B O   
2160 C  CB  . ASP B 66  ? 0.1030 0.1144 0.1274 -0.0065 -0.0015 -0.0007 66  ASP B CB  
2161 C  CG  . ASP B 66  ? 0.1259 0.1308 0.1364 -0.0098 -0.0070 0.0018  66  ASP B CG  
2162 O  OD1 . ASP B 66  ? 0.1361 0.1471 0.1285 0.0015  -0.0024 -0.0068 66  ASP B OD1 
2163 O  OD2 . ASP B 66  ? 0.1554 0.1472 0.1778 -0.0103 -0.0162 0.0125  66  ASP B OD2 
2164 N  N   . LYS B 67  ? 0.0965 0.1038 0.1151 -0.0119 -0.0020 -0.0060 67  LYS B N   
2165 C  CA  . LYS B 67  ? 0.0858 0.0978 0.1041 -0.0057 0.0032  -0.0091 67  LYS B CA  
2166 C  C   . LYS B 67  ? 0.0852 0.0865 0.0918 -0.0061 0.0041  -0.0135 67  LYS B C   
2167 O  O   . LYS B 67  ? 0.0753 0.0928 0.1022 -0.0062 0.0004  -0.0220 67  LYS B O   
2168 C  CB  . LYS B 67  ? 0.0882 0.0920 0.0929 -0.0083 0.0021  -0.0079 67  LYS B CB  
2169 C  CG  . LYS B 67  ? 0.0971 0.0933 0.0967 -0.0013 0.0019  -0.0021 67  LYS B CG  
2170 C  CD  . LYS B 67  ? 0.0828 0.0819 0.0915 0.0011  -0.0003 0.0039  67  LYS B CD  
2171 C  CE  . LYS B 67  ? 0.0915 0.0869 0.1013 -0.0035 -0.0035 0.0012  67  LYS B CE  
2172 N  NZ  . LYS B 67  ? 0.0846 0.0659 0.1127 0.0029  -0.0089 0.0032  67  LYS B NZ  
2173 N  N   . LYS B 68  ? 0.0794 0.0813 0.0935 -0.0085 0.0004  -0.0155 68  LYS B N   
2174 C  CA  . LYS B 68  ? 0.0806 0.0721 0.0770 -0.0097 0.0030  -0.0131 68  LYS B CA  
2175 C  C   . LYS B 68  ? 0.0769 0.0702 0.0836 -0.0101 -0.0053 -0.0134 68  LYS B C   
2176 O  O   . LYS B 68  ? 0.0744 0.0665 0.1003 0.0030  -0.0020 -0.0132 68  LYS B O   
2177 C  CB  . LYS B 68  ? 0.0847 0.0828 0.0839 -0.0094 0.0033  -0.0063 68  LYS B CB  
2178 C  CG  . LYS B 68  ? 0.1104 0.1073 0.1017 -0.0020 0.0032  -0.0049 68  LYS B CG  
2179 C  CD  . LYS B 68  ? 0.1115 0.1198 0.1199 -0.0123 0.0074  0.0065  68  LYS B CD  
2180 C  CE  . LYS B 68  ? 0.1174 0.1424 0.1312 -0.0045 -0.0040 0.0003  68  LYS B CE  
2181 N  NZ  . LYS B 68  ? 0.1560 0.1593 0.1698 -0.0073 0.0077  -0.0035 68  LYS B NZ  
2182 N  N   . THR B 69  ? 0.0644 0.0614 0.0676 -0.0106 -0.0050 -0.0209 69  THR B N   
2183 C  CA  . THR B 69  ? 0.0697 0.0625 0.0731 -0.0094 -0.0044 -0.0156 69  THR B CA  
2184 C  C   . THR B 69  ? 0.0702 0.0647 0.0682 -0.0093 -0.0001 -0.0103 69  THR B C   
2185 O  O   . THR B 69  ? 0.0559 0.0554 0.0676 -0.0174 0.0013  -0.0056 69  THR B O   
2186 C  CB  . THR B 69  ? 0.0741 0.0729 0.0675 -0.0118 -0.0031 -0.0207 69  THR B CB  
2187 O  OG1 . THR B 69  ? 0.0823 0.0733 0.1131 -0.0089 -0.0060 -0.0078 69  THR B OG1 
2188 C  CG2 . THR B 69  ? 0.0398 0.0314 0.0696 -0.0096 0.0007  -0.0240 69  THR B CG2 
2189 N  N   . VAL B 70  ? 0.0657 0.0531 0.0600 -0.0110 0.0022  -0.0140 70  VAL B N   
2190 C  CA  . VAL B 70  ? 0.0651 0.0589 0.0696 -0.0044 0.0037  -0.0102 70  VAL B CA  
2191 C  C   . VAL B 70  ? 0.0577 0.0589 0.0647 -0.0036 0.0055  -0.0152 70  VAL B C   
2192 O  O   . VAL B 70  ? 0.0541 0.0380 0.0433 -0.0049 0.0087  -0.0226 70  VAL B O   
2193 C  CB  . VAL B 70  ? 0.0568 0.0555 0.0719 -0.0032 0.0090  -0.0080 70  VAL B CB  
2194 C  CG1 . VAL B 70  ? 0.0927 0.0850 0.0797 -0.0140 -0.0054 -0.0124 70  VAL B CG1 
2195 C  CG2 . VAL B 70  ? 0.0472 0.0477 0.0710 -0.0135 -0.0004 -0.0021 70  VAL B CG2 
2196 N  N   . LEU B 71  ? 0.0570 0.0554 0.0581 -0.0107 0.0006  -0.0160 71  LEU B N   
2197 C  CA  . LEU B 71  ? 0.0541 0.0569 0.0622 -0.0084 0.0014  -0.0195 71  LEU B CA  
2198 C  C   . LEU B 71  ? 0.0511 0.0516 0.0621 -0.0065 0.0044  -0.0112 71  LEU B C   
2199 O  O   . LEU B 71  ? 0.0290 0.0365 0.0577 -0.0072 0.0060  -0.0196 71  LEU B O   
2200 C  CB  . LEU B 71  ? 0.0463 0.0594 0.0607 -0.0093 0.0014  -0.0130 71  LEU B CB  
2201 C  CG  . LEU B 71  ? 0.0582 0.0689 0.0682 -0.0141 -0.0053 -0.0244 71  LEU B CG  
2202 C  CD1 . LEU B 71  ? 0.0827 0.0889 0.0625 -0.0017 -0.0226 -0.0253 71  LEU B CD1 
2203 C  CD2 . LEU B 71  ? 0.0635 0.0753 0.0769 -0.0087 -0.0052 -0.0148 71  LEU B CD2 
2204 N  N   . ARG B 72  ? 0.0451 0.0628 0.0632 -0.0081 0.0043  -0.0161 72  ARG B N   
2205 C  CA  . ARG B 72  ? 0.0427 0.0401 0.0453 -0.0126 0.0079  -0.0150 72  ARG B CA  
2206 C  C   . ARG B 72  ? 0.0363 0.0442 0.0389 -0.0117 0.0063  -0.0171 72  ARG B C   
2207 O  O   . ARG B 72  ? 0.0473 0.0251 0.0237 -0.0083 -0.0002 -0.0171 72  ARG B O   
2208 C  CB  . ARG B 72  ? 0.0427 0.0571 0.0528 -0.0128 0.0078  -0.0172 72  ARG B CB  
2209 C  CG  . ARG B 72  ? 0.0155 0.0177 0.0285 -0.0102 0.0109  -0.0123 72  ARG B CG  
2210 C  CD  . ARG B 72  ? 0.0151 0.0575 0.0513 -0.0165 0.0154  -0.0097 72  ARG B CD  
2211 N  NE  . ARG B 72  ? 0.0400 0.0596 0.0793 -0.0263 0.0097  -0.0024 72  ARG B NE  
2212 C  CZ  . ARG B 72  ? 0.0419 0.0655 0.0521 -0.0156 0.0162  -0.0200 72  ARG B CZ  
2213 N  NH1 . ARG B 72  ? 0.0624 0.0691 0.0915 -0.0202 -0.0020 -0.0190 72  ARG B NH1 
2214 N  NH2 . ARG B 72  ? 0.0454 0.0189 0.0559 -0.0157 -0.0136 -0.0113 72  ARG B NH2 
2215 N  N   . ASN B 73  ? 0.0320 0.0339 0.0204 -0.0160 0.0034  -0.0135 73  ASN B N   
2216 C  CA  . ASN B 73  ? 0.0275 0.0342 0.0288 -0.0112 0.0071  -0.0132 73  ASN B CA  
2217 C  C   . ASN B 73  ? 0.0319 0.0360 0.0283 -0.0128 0.0054  -0.0090 73  ASN B C   
2218 O  O   . ASN B 73  ? 0.0207 0.0375 0.0288 -0.0151 0.0138  -0.0027 73  ASN B O   
2219 C  CB  . ASN B 73  ? 0.0231 0.0378 0.0212 -0.0075 0.0028  -0.0094 73  ASN B CB  
2220 C  CG  . ASN B 73  ? 0.0278 0.0301 0.0326 -0.0106 -0.0039 -0.0097 73  ASN B CG  
2221 O  OD1 . ASN B 73  ? 0.0279 0.0139 0.0723 -0.0093 0.0229  -0.0221 73  ASN B OD1 
2222 N  ND2 . ASN B 73  ? 0.0199 0.0427 0.0565 -0.0221 0.0086  -0.0166 73  ASN B ND2 
2223 N  N   . ASN B 74  ? 0.0256 0.0329 0.0241 -0.0101 0.0011  -0.0083 74  ASN B N   
2224 C  CA  . ASN B 74  ? 0.0258 0.0365 0.0317 -0.0095 0.0037  -0.0089 74  ASN B CA  
2225 C  C   . ASN B 74  ? 0.0429 0.0357 0.0418 -0.0052 -0.0001 -0.0151 74  ASN B C   
2226 O  O   . ASN B 74  ? 0.0338 0.0366 0.0236 -0.0069 0.0140  -0.0201 74  ASN B O   
2227 C  CB  . ASN B 74  ? 0.0176 0.0449 0.0360 -0.0084 -0.0035 -0.0146 74  ASN B CB  
2228 C  CG  . ASN B 74  ? 0.0375 0.0459 0.0285 -0.0014 -0.0047 -0.0149 74  ASN B CG  
2229 O  OD1 . ASN B 74  ? 0.0391 0.0421 0.0450 -0.0321 0.0103  0.0022  74  ASN B OD1 
2230 N  ND2 . ASN B 74  ? 0.0274 0.0581 0.0295 -0.0151 0.0184  -0.0153 74  ASN B ND2 
2231 N  N   . ALA B 75  ? 0.0467 0.0324 0.0315 -0.0072 -0.0041 -0.0148 75  ALA B N   
2232 C  CA  . ALA B 75  ? 0.0426 0.0243 0.0392 -0.0023 -0.0047 -0.0159 75  ALA B CA  
2233 C  C   . ALA B 75  ? 0.0430 0.0295 0.0379 -0.0048 0.0001  -0.0158 75  ALA B C   
2234 O  O   . ALA B 75  ? 0.0299 0.0214 0.0333 -0.0010 -0.0033 -0.0198 75  ALA B O   
2235 C  CB  . ALA B 75  ? 0.0405 0.0181 0.0367 -0.0066 -0.0120 -0.0142 75  ALA B CB  
2236 N  N   . GLY B 76  ? 0.0331 0.0292 0.0408 -0.0021 0.0057  -0.0127 76  GLY B N   
2237 C  CA  . GLY B 76  ? 0.0367 0.0210 0.0400 -0.0077 0.0087  -0.0156 76  GLY B CA  
2238 C  C   . GLY B 76  ? 0.0310 0.0361 0.0423 -0.0089 0.0044  -0.0126 76  GLY B C   
2239 O  O   . GLY B 76  ? 0.0298 0.0412 0.0358 -0.0014 0.0175  -0.0224 76  GLY B O   
2240 N  N   . GLY B 77  ? 0.0267 0.0207 0.0372 -0.0116 0.0088  -0.0181 77  GLY B N   
2241 C  CA  . GLY B 77  ? 0.0330 0.0372 0.0370 -0.0110 0.0014  -0.0156 77  GLY B CA  
2242 C  C   . GLY B 77  ? 0.0364 0.0409 0.0327 -0.0135 0.0003  -0.0068 77  GLY B C   
2243 O  O   . GLY B 77  ? 0.0404 0.0451 0.0322 -0.0278 -0.0020 -0.0133 77  GLY B O   
2244 N  N   . HIS B 78  ? 0.0312 0.0406 0.0228 -0.0092 -0.0015 -0.0091 78  HIS B N   
2245 C  CA  . HIS B 78  ? 0.0332 0.0399 0.0297 -0.0063 0.0000  -0.0030 78  HIS B CA  
2246 C  C   . HIS B 78  ? 0.0369 0.0409 0.0289 -0.0053 0.0029  -0.0024 78  HIS B C   
2247 O  O   . HIS B 78  ? 0.0340 0.0462 0.0245 -0.0031 0.0123  0.0032  78  HIS B O   
2248 C  CB  . HIS B 78  ? 0.0275 0.0357 0.0232 -0.0008 0.0038  0.0000  78  HIS B CB  
2249 C  CG  . HIS B 78  ? 0.0326 0.0310 0.0297 -0.0145 0.0013  0.0011  78  HIS B CG  
2250 N  ND1 . HIS B 78  ? 0.0257 0.0478 0.0373 -0.0209 0.0030  -0.0087 78  HIS B ND1 
2251 C  CD2 . HIS B 78  ? 0.0355 0.0374 0.0282 -0.0127 0.0040  -0.0098 78  HIS B CD2 
2252 C  CE1 . HIS B 78  ? 0.0328 0.0405 0.0134 -0.0190 0.0100  -0.0154 78  HIS B CE1 
2253 N  NE2 . HIS B 78  ? 0.0179 0.0305 0.0113 -0.0141 -0.0007 -0.0049 78  HIS B NE2 
2254 N  N   . ALA B 79  ? 0.0431 0.0427 0.0292 -0.0026 0.0052  -0.0077 79  ALA B N   
2255 C  CA  . ALA B 79  ? 0.0436 0.0477 0.0277 -0.0071 0.0016  -0.0029 79  ALA B CA  
2256 C  C   . ALA B 79  ? 0.0450 0.0489 0.0328 -0.0066 0.0017  -0.0124 79  ALA B C   
2257 O  O   . ALA B 79  ? 0.0398 0.0439 0.0206 -0.0019 0.0132  -0.0139 79  ALA B O   
2258 C  CB  . ALA B 79  ? 0.0470 0.0441 0.0436 -0.0103 0.0041  -0.0096 79  ALA B CB  
2259 N  N   . ASN B 80  ? 0.0316 0.0497 0.0308 -0.0063 0.0027  -0.0063 80  ASN B N   
2260 C  CA  . ASN B 80  ? 0.0349 0.0365 0.0314 -0.0125 -0.0026 -0.0088 80  ASN B CA  
2261 C  C   . ASN B 80  ? 0.0344 0.0401 0.0367 -0.0118 0.0006  -0.0083 80  ASN B C   
2262 O  O   . ASN B 80  ? 0.0370 0.0213 0.0161 -0.0048 -0.0073 -0.0095 80  ASN B O   
2263 C  CB  . ASN B 80  ? 0.0257 0.0334 0.0198 -0.0139 -0.0024 -0.0132 80  ASN B CB  
2264 C  CG  . ASN B 80  ? 0.0287 0.0219 0.0111 -0.0104 0.0067  -0.0009 80  ASN B CG  
2265 O  OD1 . ASN B 80  ? 0.0117 0.0282 0.0079 -0.0108 0.0029  -0.0058 80  ASN B OD1 
2266 N  ND2 . ASN B 80  ? 0.0263 0.0178 0.0185 -0.0052 -0.0119 -0.0040 80  ASN B ND2 
2267 N  N   . HIS B 81  ? 0.0353 0.0386 0.0348 -0.0146 0.0000  -0.0078 81  HIS B N   
2268 C  CA  . HIS B 81  ? 0.0303 0.0466 0.0326 -0.0143 0.0045  -0.0057 81  HIS B CA  
2269 C  C   . HIS B 81  ? 0.0420 0.0518 0.0324 -0.0099 0.0055  -0.0034 81  HIS B C   
2270 O  O   . HIS B 81  ? 0.0412 0.0530 0.0174 -0.0162 0.0050  0.0110  81  HIS B O   
2271 C  CB  . HIS B 81  ? 0.0204 0.0350 0.0179 -0.0145 0.0062  -0.0125 81  HIS B CB  
2272 C  CG  . HIS B 81  ? 0.0250 0.0693 0.0356 -0.0088 0.0101  -0.0033 81  HIS B CG  
2273 N  ND1 . HIS B 81  ? 0.0187 0.0587 0.0306 -0.0142 -0.0057 0.0025  81  HIS B ND1 
2274 C  CD2 . HIS B 81  ? 0.0150 0.0272 0.0415 -0.0133 0.0009  0.0030  81  HIS B CD2 
2275 C  CE1 . HIS B 81  ? 0.0065 0.0355 0.0232 0.0005  0.0018  0.0054  81  HIS B CE1 
2276 N  NE2 . HIS B 81  ? 0.0094 0.0448 0.0174 -0.0081 0.0050  -0.0203 81  HIS B NE2 
2277 N  N   . SER B 82  ? 0.0446 0.0591 0.0326 -0.0003 0.0039  -0.0010 82  SER B N   
2278 C  CA  . SER B 82  ? 0.0351 0.0491 0.0374 -0.0076 0.0052  0.0012  82  SER B CA  
2279 C  C   . SER B 82  ? 0.0391 0.0567 0.0415 -0.0081 0.0050  0.0013  82  SER B C   
2280 O  O   . SER B 82  ? 0.0168 0.0568 0.0357 -0.0166 0.0111  0.0017  82  SER B O   
2281 C  CB  . SER B 82  ? 0.0428 0.0611 0.0388 0.0055  0.0037  0.0040  82  SER B CB  
2282 O  OG  . SER B 82  ? 0.0350 0.0293 0.0213 -0.0034 -0.0043 0.0101  82  SER B OG  
2283 N  N   . LEU B 83  ? 0.0412 0.0476 0.0360 -0.0113 0.0137  -0.0031 83  LEU B N   
2284 C  CA  . LEU B 83  ? 0.0563 0.0555 0.0487 -0.0109 0.0083  -0.0006 83  LEU B CA  
2285 C  C   . LEU B 83  ? 0.0553 0.0581 0.0435 -0.0100 0.0046  0.0030  83  LEU B C   
2286 O  O   . LEU B 83  ? 0.0565 0.0596 0.0545 -0.0077 0.0080  -0.0020 83  LEU B O   
2287 C  CB  . LEU B 83  ? 0.0624 0.0669 0.0602 -0.0080 0.0113  -0.0013 83  LEU B CB  
2288 C  CG  . LEU B 83  ? 0.0724 0.0770 0.0687 -0.0095 0.0059  0.0015  83  LEU B CG  
2289 C  CD1 . LEU B 83  ? 0.1075 0.0797 0.1025 -0.0056 0.0036  -0.0059 83  LEU B CD1 
2290 C  CD2 . LEU B 83  ? 0.1025 0.1014 0.0824 -0.0113 0.0050  0.0061  83  LEU B CD2 
2291 N  N   . PHE B 84  ? 0.0531 0.0688 0.0465 -0.0130 0.0064  0.0009  84  PHE B N   
2292 C  CA  . PHE B 84  ? 0.0511 0.0757 0.0418 -0.0105 -0.0019 0.0004  84  PHE B CA  
2293 C  C   . PHE B 84  ? 0.0596 0.0834 0.0472 -0.0138 -0.0022 0.0073  84  PHE B C   
2294 O  O   . PHE B 84  ? 0.0524 0.0841 0.0284 -0.0206 -0.0029 0.0057  84  PHE B O   
2295 C  CB  . PHE B 84  ? 0.0552 0.0793 0.0543 -0.0086 -0.0033 0.0011  84  PHE B CB  
2296 C  CG  . PHE B 84  ? 0.0102 0.0507 0.0426 -0.0105 0.0050  0.0084  84  PHE B CG  
2297 C  CD1 . PHE B 84  ? 0.0353 0.0733 0.0434 -0.0166 0.0008  0.0041  84  PHE B CD1 
2298 C  CD2 . PHE B 84  ? 0.0090 0.0492 0.0321 -0.0106 -0.0037 0.0100  84  PHE B CD2 
2299 C  CE1 . PHE B 84  ? 0.0274 0.0559 0.0567 -0.0292 0.0131  0.0015  84  PHE B CE1 
2300 C  CE2 . PHE B 84  ? 0.0078 0.0122 0.0267 0.0030  0.0056  0.0109  84  PHE B CE2 
2301 C  CZ  . PHE B 84  ? 0.0117 0.0592 0.0395 -0.0040 0.0070  0.0042  84  PHE B CZ  
2302 N  N   . TRP B 85  ? 0.0572 0.0791 0.0395 -0.0126 0.0019  0.0028  85  TRP B N   
2303 C  CA  . TRP B 85  ? 0.0617 0.0767 0.0474 -0.0121 0.0035  0.0047  85  TRP B CA  
2304 C  C   . TRP B 85  ? 0.0678 0.0778 0.0546 -0.0100 -0.0002 0.0074  85  TRP B C   
2305 O  O   . TRP B 85  ? 0.0613 0.0894 0.0639 -0.0150 0.0013  0.0088  85  TRP B O   
2306 C  CB  . TRP B 85  ? 0.0591 0.0672 0.0481 -0.0078 0.0015  0.0056  85  TRP B CB  
2307 C  CG  . TRP B 85  ? 0.0343 0.0401 0.0330 -0.0251 0.0111  0.0057  85  TRP B CG  
2308 C  CD1 . TRP B 85  ? 0.0481 0.0498 0.0452 -0.0076 0.0020  0.0046  85  TRP B CD1 
2309 C  CD2 . TRP B 85  ? 0.0254 0.0393 0.0412 -0.0235 0.0095  -0.0010 85  TRP B CD2 
2310 N  NE1 . TRP B 85  ? 0.0549 0.0360 0.0395 -0.0204 0.0255  0.0060  85  TRP B NE1 
2311 C  CE2 . TRP B 85  ? 0.0378 0.0184 0.0252 -0.0157 0.0093  0.0036  85  TRP B CE2 
2312 C  CE3 . TRP B 85  ? 0.0463 0.0544 0.0484 -0.0190 0.0144  -0.0008 85  TRP B CE3 
2313 C  CZ2 . TRP B 85  ? 0.0382 0.0448 0.0546 -0.0077 0.0112  0.0061  85  TRP B CZ2 
2314 C  CZ3 . TRP B 85  ? 0.0405 0.0513 0.0486 -0.0130 0.0116  -0.0006 85  TRP B CZ3 
2315 C  CH2 . TRP B 85  ? 0.0401 0.0652 0.0586 -0.0153 0.0096  -0.0002 85  TRP B CH2 
2316 N  N   . LYS B 86  ? 0.0609 0.0773 0.0528 -0.0064 0.0053  0.0091  86  LYS B N   
2317 C  CA  . LYS B 86  ? 0.0661 0.0783 0.0589 -0.0062 0.0035  0.0085  86  LYS B CA  
2318 C  C   . LYS B 86  ? 0.0599 0.0704 0.0601 -0.0062 0.0032  0.0072  86  LYS B C   
2319 O  O   . LYS B 86  ? 0.0616 0.0815 0.0651 -0.0081 -0.0019 0.0106  86  LYS B O   
2320 C  CB  . LYS B 86  ? 0.0556 0.0783 0.0672 -0.0089 0.0029  0.0037  86  LYS B CB  
2321 C  CG  . LYS B 86  ? 0.0671 0.0941 0.0738 0.0016  0.0037  0.0116  86  LYS B CG  
2322 C  CD  . LYS B 86  ? 0.1428 0.1420 0.1118 0.0009  -0.0005 -0.0049 86  LYS B CD  
2323 C  CE  . LYS B 86  ? 0.1760 0.1491 0.1263 -0.0059 0.0119  0.0018  86  LYS B CE  
2324 N  NZ  . LYS B 86  ? 0.1878 0.1782 0.1442 -0.0051 0.0237  0.0013  86  LYS B NZ  
2325 N  N   . GLY B 87  ? 0.0616 0.0734 0.0569 -0.0116 0.0046  0.0100  87  GLY B N   
2326 C  CA  . GLY B 87  ? 0.0487 0.0690 0.0527 -0.0153 0.0014  0.0139  87  GLY B CA  
2327 C  C   . GLY B 87  ? 0.0553 0.0728 0.0538 -0.0106 0.0045  0.0095  87  GLY B C   
2328 O  O   . GLY B 87  ? 0.0442 0.0788 0.0553 -0.0153 0.0048  0.0234  87  GLY B O   
2329 N  N   . LEU B 88  ? 0.0356 0.0625 0.0470 -0.0133 0.0109  0.0077  88  LEU B N   
2330 C  CA  . LEU B 88  ? 0.0319 0.0640 0.0545 -0.0081 0.0077  0.0060  88  LEU B CA  
2331 C  C   . LEU B 88  ? 0.0422 0.0813 0.0601 -0.0107 0.0062  0.0081  88  LEU B C   
2332 O  O   . LEU B 88  ? 0.0584 0.0971 0.0612 -0.0162 0.0010  0.0077  88  LEU B O   
2333 C  CB  . LEU B 88  ? 0.0271 0.0473 0.0547 -0.0087 0.0082  0.0069  88  LEU B CB  
2334 C  CG  . LEU B 88  ? 0.0097 0.0335 0.0365 -0.0068 0.0022  0.0149  88  LEU B CG  
2335 C  CD1 . LEU B 88  ? 0.0131 0.0472 0.0368 -0.0069 0.0086  0.0166  88  LEU B CD1 
2336 C  CD2 . LEU B 88  ? 0.0126 0.0307 0.0488 -0.0122 0.0016  0.0014  88  LEU B CD2 
2337 N  N   . LYS B 89  ? 0.0485 0.0818 0.0687 -0.0157 0.0039  0.0064  89  LYS B N   
2338 C  CA  . LYS B 89  ? 0.0526 0.0847 0.0673 -0.0149 0.0020  0.0100  89  LYS B CA  
2339 C  C   . LYS B 89  ? 0.0534 0.0811 0.0674 -0.0155 -0.0006 0.0102  89  LYS B C   
2340 O  O   . LYS B 89  ? 0.0688 0.0943 0.0652 -0.0191 -0.0102 0.0177  89  LYS B O   
2341 C  CB  . LYS B 89  ? 0.0538 0.0746 0.0753 -0.0145 0.0035  0.0136  89  LYS B CB  
2342 C  CG  . LYS B 89  ? 0.0698 0.0982 0.0941 -0.0168 0.0058  0.0064  89  LYS B CG  
2343 C  CD  . LYS B 89  ? 0.0937 0.1107 0.1042 -0.0220 0.0160  0.0032  89  LYS B CD  
2344 C  CE  . LYS B 89  ? 0.1178 0.1323 0.1138 -0.0083 0.0017  -0.0008 89  LYS B CE  
2345 N  NZ  . LYS B 89  ? 0.1677 0.1369 0.1480 -0.0021 0.0233  0.0031  89  LYS B NZ  
2346 N  N   . LYS B 90  ? 0.0572 0.0832 0.0710 -0.0138 -0.0036 0.0115  90  LYS B N   
2347 C  CA  . LYS B 90  ? 0.0651 0.0864 0.0792 -0.0108 0.0002  0.0069  90  LYS B CA  
2348 C  C   . LYS B 90  ? 0.0547 0.0844 0.0835 -0.0119 0.0005  0.0066  90  LYS B C   
2349 O  O   . LYS B 90  ? 0.0423 0.0988 0.0834 -0.0179 -0.0024 0.0111  90  LYS B O   
2350 C  CB  . LYS B 90  ? 0.0696 0.0856 0.0818 -0.0082 -0.0045 0.0029  90  LYS B CB  
2351 C  CG  . LYS B 90  ? 0.0901 0.0950 0.0909 -0.0011 0.0093  0.0067  90  LYS B CG  
2352 C  CD  . LYS B 90  ? 0.1572 0.1281 0.1372 -0.0057 0.0008  -0.0042 90  LYS B CD  
2353 C  CE  . LYS B 90  ? 0.1693 0.1439 0.1526 -0.0042 -0.0024 0.0094  90  LYS B CE  
2354 N  NZ  . LYS B 90  ? 0.1654 0.1806 0.1722 -0.0009 -0.0012 -0.0021 90  LYS B NZ  
2355 N  N   . GLY B 91  ? 0.0510 0.0892 0.0896 -0.0114 0.0000  0.0068  91  GLY B N   
2356 C  CA  . GLY B 91  ? 0.0596 0.0991 0.0950 -0.0035 0.0038  0.0103  91  GLY B CA  
2357 C  C   . GLY B 91  ? 0.0665 0.1061 0.1056 -0.0046 -0.0011 0.0062  91  GLY B C   
2358 O  O   . GLY B 91  ? 0.0678 0.1115 0.1096 -0.0008 -0.0010 0.0097  91  GLY B O   
2359 N  N   . THR B 92  ? 0.0717 0.1004 0.0946 -0.0070 -0.0004 0.0102  92  THR B N   
2360 C  CA  . THR B 92  ? 0.0691 0.0853 0.0910 -0.0053 -0.0072 0.0147  92  THR B CA  
2361 C  C   . THR B 92  ? 0.0689 0.0892 0.0878 -0.0060 -0.0014 0.0096  92  THR B C   
2362 O  O   . THR B 92  ? 0.0679 0.0882 0.0859 -0.0116 -0.0115 0.0127  92  THR B O   
2363 C  CB  . THR B 92  ? 0.0733 0.0789 0.0856 -0.0006 -0.0031 0.0133  92  THR B CB  
2364 O  OG1 . THR B 92  ? 0.0445 0.0593 0.0803 -0.0223 -0.0209 0.0279  92  THR B OG1 
2365 C  CG2 . THR B 92  ? 0.0773 0.0823 0.0911 -0.0106 -0.0137 0.0161  92  THR B CG2 
2366 N  N   . THR B 93  ? 0.0693 0.0827 0.0985 -0.0084 -0.0038 0.0117  93  THR B N   
2367 C  CA  . THR B 93  ? 0.0845 0.0981 0.0979 -0.0060 -0.0063 0.0097  93  THR B CA  
2368 C  C   . THR B 93  ? 0.0741 0.0949 0.0887 -0.0030 -0.0052 0.0045  93  THR B C   
2369 O  O   . THR B 93  ? 0.0713 0.1021 0.0788 -0.0050 -0.0233 0.0096  93  THR B O   
2370 C  CB  . THR B 93  ? 0.0888 0.0943 0.1036 -0.0025 -0.0033 0.0092  93  THR B CB  
2371 O  OG1 . THR B 93  ? 0.1138 0.1154 0.1510 -0.0081 -0.0144 0.0163  93  THR B OG1 
2372 C  CG2 . THR B 93  ? 0.1042 0.1118 0.0984 -0.0009 -0.0106 0.0072  93  THR B CG2 
2373 N  N   . LEU B 94  ? 0.0849 0.0960 0.0944 -0.0113 -0.0052 0.0112  94  LEU B N   
2374 C  CA  . LEU B 94  ? 0.0858 0.0946 0.0943 -0.0077 -0.0012 0.0055  94  LEU B CA  
2375 C  C   . LEU B 94  ? 0.0929 0.1006 0.1041 -0.0086 0.0026  0.0078  94  LEU B C   
2376 O  O   . LEU B 94  ? 0.0923 0.1144 0.1174 -0.0052 -0.0009 0.0125  94  LEU B O   
2377 C  CB  . LEU B 94  ? 0.0888 0.1003 0.0958 -0.0087 -0.0012 0.0025  94  LEU B CB  
2378 C  CG  . LEU B 94  ? 0.0865 0.1015 0.0956 -0.0065 -0.0043 0.0024  94  LEU B CG  
2379 C  CD1 . LEU B 94  ? 0.0922 0.1048 0.0870 0.0035  0.0021  -0.0034 94  LEU B CD1 
2380 C  CD2 . LEU B 94  ? 0.1112 0.1383 0.1102 -0.0012 0.0023  0.0058  94  LEU B CD2 
2381 N  N   . GLN B 95  ? 0.1024 0.1104 0.1170 -0.0058 0.0028  0.0057  95  GLN B N   
2382 C  CA  . GLN B 95  ? 0.1019 0.1150 0.1218 -0.0058 0.0039  0.0087  95  GLN B CA  
2383 C  C   . GLN B 95  ? 0.0994 0.1200 0.1169 -0.0043 0.0069  0.0077  95  GLN B C   
2384 O  O   . GLN B 95  ? 0.0889 0.1226 0.1179 -0.0035 0.0092  0.0151  95  GLN B O   
2385 C  CB  . GLN B 95  ? 0.1205 0.1317 0.1397 -0.0067 0.0008  0.0063  95  GLN B CB  
2386 C  CG  . GLN B 95  ? 0.1389 0.1361 0.1429 0.0017  -0.0018 0.0097  95  GLN B CG  
2387 C  CD  . GLN B 95  ? 0.1672 0.1798 0.1602 -0.0007 0.0028  0.0060  95  GLN B CD  
2388 O  OE1 . GLN B 95  ? 0.1889 0.2179 0.2151 -0.0249 0.0118  0.0114  95  GLN B OE1 
2389 N  NE2 . GLN B 95  ? 0.1648 0.1806 0.1618 -0.0050 0.0037  -0.0031 95  GLN B NE2 
2390 N  N   . GLY B 96  ? 0.0923 0.1157 0.1212 -0.0045 0.0047  0.0088  96  GLY B N   
2391 C  CA  . GLY B 96  ? 0.1002 0.1186 0.1279 -0.0049 0.0050  0.0007  96  GLY B CA  
2392 C  C   . GLY B 96  ? 0.0957 0.1102 0.1211 -0.0047 0.0010  0.0008  96  GLY B C   
2393 O  O   . GLY B 96  ? 0.1119 0.1139 0.1355 -0.0061 -0.0027 -0.0065 96  GLY B O   
2394 N  N   . ASP B 97  ? 0.1090 0.1194 0.1309 0.0018  0.0039  -0.0006 97  ASP B N   
2395 C  CA  . ASP B 97  ? 0.1128 0.1250 0.1268 0.0029  0.0037  0.0031  97  ASP B CA  
2396 C  C   . ASP B 97  ? 0.1164 0.1258 0.1252 0.0107  0.0052  0.0033  97  ASP B C   
2397 O  O   . ASP B 97  ? 0.1206 0.1365 0.1328 0.0141  0.0129  0.0063  97  ASP B O   
2398 C  CB  . ASP B 97  ? 0.1165 0.1183 0.1271 0.0038  0.0013  -0.0007 97  ASP B CB  
2399 C  CG  . ASP B 97  ? 0.1332 0.1472 0.1519 -0.0003 -0.0035 -0.0012 97  ASP B CG  
2400 O  OD1 . ASP B 97  ? 0.1753 0.1728 0.1914 -0.0116 -0.0272 0.0003  97  ASP B OD1 
2401 O  OD2 . ASP B 97  ? 0.1562 0.1762 0.1447 0.0049  -0.0060 0.0000  97  ASP B OD2 
2402 N  N   . LEU B 98  ? 0.1172 0.1308 0.1216 0.0121  0.0054  0.0045  98  LEU B N   
2403 C  CA  . LEU B 98  ? 0.1136 0.1260 0.1206 0.0126  0.0044  0.0042  98  LEU B CA  
2404 C  C   . LEU B 98  ? 0.1251 0.1353 0.1267 0.0164  0.0003  0.0021  98  LEU B C   
2405 O  O   . LEU B 98  ? 0.1118 0.1461 0.1284 0.0163  0.0039  0.0035  98  LEU B O   
2406 C  CB  . LEU B 98  ? 0.1177 0.1243 0.1193 0.0089  0.0062  0.0039  98  LEU B CB  
2407 C  CG  . LEU B 98  ? 0.1144 0.1121 0.1214 0.0095  0.0010  0.0056  98  LEU B CG  
2408 C  CD1 . LEU B 98  ? 0.1335 0.1300 0.1225 0.0015  0.0026  0.0030  98  LEU B CD1 
2409 C  CD2 . LEU B 98  ? 0.1264 0.1143 0.1350 0.0031  0.0013  0.0111  98  LEU B CD2 
2410 N  N   . LYS B 99  ? 0.1434 0.1420 0.1353 0.0118  0.0055  0.0029  99  LYS B N   
2411 C  CA  . LYS B 99  ? 0.1521 0.1460 0.1423 0.0087  -0.0016 0.0021  99  LYS B CA  
2412 C  C   . LYS B 99  ? 0.1500 0.1418 0.1461 0.0051  -0.0002 0.0006  99  LYS B C   
2413 O  O   . LYS B 99  ? 0.1593 0.1535 0.1652 0.0129  -0.0082 0.0012  99  LYS B O   
2414 C  CB  . LYS B 99  ? 0.1501 0.1478 0.1387 0.0052  -0.0036 -0.0028 99  LYS B CB  
2415 C  CG  . LYS B 99  ? 0.1726 0.1572 0.1535 0.0021  0.0017  -0.0044 99  LYS B CG  
2416 C  CD  . LYS B 99  ? 0.1630 0.1657 0.1644 -0.0040 0.0031  0.0001  99  LYS B CD  
2417 C  CE  . LYS B 99  ? 0.1664 0.1496 0.1463 -0.0055 -0.0024 0.0077  99  LYS B CE  
2418 N  NZ  . LYS B 99  ? 0.1486 0.1536 0.1221 0.0058  -0.0067 0.0254  99  LYS B NZ  
2419 N  N   . ALA B 100 ? 0.1625 0.1473 0.1594 0.0063  -0.0025 0.0024  100 ALA B N   
2420 C  CA  . ALA B 100 ? 0.1625 0.1461 0.1645 0.0025  -0.0010 -0.0011 100 ALA B CA  
2421 C  C   . ALA B 100 ? 0.1645 0.1486 0.1725 0.0028  -0.0019 -0.0011 100 ALA B C   
2422 O  O   . ALA B 100 ? 0.1779 0.1512 0.1885 -0.0040 0.0001  -0.0050 100 ALA B O   
2423 C  CB  . ALA B 100 ? 0.1726 0.1611 0.1700 0.0018  -0.0025 -0.0012 100 ALA B CB  
2424 N  N   . ALA B 101 ? 0.1612 0.1580 0.1733 0.0023  -0.0028 -0.0006 101 ALA B N   
2425 C  CA  . ALA B 101 ? 0.1570 0.1500 0.1643 -0.0007 0.0019  0.0003  101 ALA B CA  
2426 C  C   . ALA B 101 ? 0.1561 0.1509 0.1677 0.0010  0.0001  -0.0012 101 ALA B C   
2427 O  O   . ALA B 101 ? 0.1608 0.1514 0.1780 0.0055  0.0043  -0.0065 101 ALA B O   
2428 C  CB  . ALA B 101 ? 0.1541 0.1531 0.1639 -0.0037 0.0012  0.0001  101 ALA B CB  
2429 N  N   . ILE B 102 ? 0.1604 0.1516 0.1627 0.0055  -0.0011 0.0029  102 ILE B N   
2430 C  CA  . ILE B 102 ? 0.1625 0.1520 0.1589 0.0000  -0.0052 0.0046  102 ILE B CA  
2431 C  C   . ILE B 102 ? 0.1641 0.1537 0.1645 -0.0017 -0.0021 0.0049  102 ILE B C   
2432 O  O   . ILE B 102 ? 0.1849 0.1645 0.1771 -0.0072 -0.0003 0.0071  102 ILE B O   
2433 C  CB  . ILE B 102 ? 0.1546 0.1512 0.1574 0.0014  -0.0043 0.0095  102 ILE B CB  
2434 C  CG1 . ILE B 102 ? 0.1643 0.1592 0.1601 -0.0075 -0.0135 0.0127  102 ILE B CG1 
2435 C  CG2 . ILE B 102 ? 0.1372 0.1351 0.1450 0.0069  -0.0106 0.0117  102 ILE B CG2 
2436 C  CD1 . ILE B 102 ? 0.1596 0.1659 0.1538 -0.0119 -0.0037 0.0111  102 ILE B CD1 
2437 N  N   . GLU B 103 ? 0.1855 0.1605 0.1662 -0.0011 -0.0007 0.0060  103 GLU B N   
2438 C  CA  . GLU B 103 ? 0.1835 0.1641 0.1747 0.0000  -0.0021 0.0047  103 GLU B CA  
2439 C  C   . GLU B 103 ? 0.1778 0.1615 0.1730 -0.0030 -0.0028 0.0069  103 GLU B C   
2440 O  O   . GLU B 103 ? 0.1898 0.1662 0.1920 0.0017  -0.0097 0.0072  103 GLU B O   
2441 C  CB  . GLU B 103 ? 0.1808 0.1744 0.1769 -0.0009 -0.0013 0.0025  103 GLU B CB  
2442 C  CG  . GLU B 103 ? 0.1995 0.1849 0.2040 -0.0032 -0.0045 0.0005  103 GLU B CG  
2443 C  CD  . GLU B 103 ? 0.2223 0.2327 0.2339 -0.0030 -0.0009 0.0000  103 GLU B CD  
2444 O  OE1 . GLU B 103 ? 0.2381 0.2518 0.2544 0.0024  -0.0042 0.0079  103 GLU B OE1 
2445 O  OE2 . GLU B 103 ? 0.2399 0.2384 0.2316 -0.0120 -0.0021 -0.0029 103 GLU B OE2 
2446 N  N   . ARG B 104 ? 0.1795 0.1674 0.1767 -0.0006 0.0006  0.0072  104 ARG B N   
2447 C  CA  . ARG B 104 ? 0.1811 0.1654 0.1811 -0.0025 0.0006  0.0025  104 ARG B CA  
2448 C  C   . ARG B 104 ? 0.1829 0.1700 0.1904 -0.0035 0.0019  0.0029  104 ARG B C   
2449 O  O   . ARG B 104 ? 0.1948 0.1847 0.2029 -0.0108 0.0041  -0.0037 104 ARG B O   
2450 C  CB  . ARG B 104 ? 0.1827 0.1709 0.1821 -0.0030 0.0020  0.0014  104 ARG B CB  
2451 C  CG  . ARG B 104 ? 0.1860 0.1672 0.1861 0.0016  0.0041  0.0091  104 ARG B CG  
2452 C  CD  . ARG B 104 ? 0.1922 0.1772 0.1988 -0.0024 -0.0060 0.0063  104 ARG B CD  
2453 N  NE  . ARG B 104 ? 0.2153 0.2054 0.2148 0.0046  -0.0005 0.0093  104 ARG B NE  
2454 C  CZ  . ARG B 104 ? 0.2176 0.2238 0.2367 0.0000  -0.0005 0.0048  104 ARG B CZ  
2455 N  NH1 . ARG B 104 ? 0.2255 0.2386 0.2632 0.0017  -0.0114 -0.0030 104 ARG B NH1 
2456 N  NH2 . ARG B 104 ? 0.2218 0.2142 0.2380 -0.0007 -0.0011 0.0013  104 ARG B NH2 
2457 N  N   . ASP B 105 ? 0.1926 0.1699 0.1943 0.0012  0.0000  0.0024  105 ASP B N   
2458 C  CA  . ASP B 105 ? 0.1875 0.1741 0.1830 0.0031  -0.0012 0.0002  105 ASP B CA  
2459 C  C   . ASP B 105 ? 0.1776 0.1654 0.1771 0.0012  0.0009  0.0007  105 ASP B C   
2460 O  O   . ASP B 105 ? 0.2061 0.1875 0.1984 0.0046  -0.0020 -0.0007 105 ASP B O   
2461 C  CB  . ASP B 105 ? 0.1979 0.1823 0.1893 0.0079  -0.0039 0.0020  105 ASP B CB  
2462 C  CG  . ASP B 105 ? 0.2066 0.2005 0.2117 -0.0006 -0.0072 -0.0017 105 ASP B CG  
2463 O  OD1 . ASP B 105 ? 0.2330 0.2571 0.2646 0.0009  0.0037  0.0027  105 ASP B OD1 
2464 O  OD2 . ASP B 105 ? 0.2265 0.2420 0.2194 -0.0001 0.0001  -0.0089 105 ASP B OD2 
2465 N  N   . PHE B 106 ? 0.1806 0.1612 0.1716 0.0019  -0.0042 0.0001  106 PHE B N   
2466 C  CA  . PHE B 106 ? 0.1651 0.1492 0.1610 -0.0027 -0.0054 0.0038  106 PHE B CA  
2467 C  C   . PHE B 106 ? 0.1670 0.1464 0.1697 -0.0015 -0.0043 0.0027  106 PHE B C   
2468 O  O   . PHE B 106 ? 0.1962 0.1655 0.1937 -0.0008 -0.0058 0.0009  106 PHE B O   
2469 C  CB  . PHE B 106 ? 0.1437 0.1436 0.1547 -0.0020 -0.0041 0.0037  106 PHE B CB  
2470 C  CG  . PHE B 106 ? 0.1307 0.1171 0.1400 -0.0046 0.0050  0.0063  106 PHE B CG  
2471 C  CD1 . PHE B 106 ? 0.1025 0.1055 0.1226 0.0020  0.0067  0.0115  106 PHE B CD1 
2472 C  CD2 . PHE B 106 ? 0.1275 0.1050 0.1258 -0.0023 0.0018  -0.0029 106 PHE B CD2 
2473 C  CE1 . PHE B 106 ? 0.1130 0.0920 0.1121 0.0010  0.0071  0.0028  106 PHE B CE1 
2474 C  CE2 . PHE B 106 ? 0.1191 0.0843 0.1225 0.0063  0.0072  -0.0017 106 PHE B CE2 
2475 C  CZ  . PHE B 106 ? 0.1160 0.1100 0.1305 -0.0071 0.0043  0.0117  106 PHE B CZ  
2476 N  N   . GLY B 107 ? 0.1688 0.1447 0.1593 -0.0045 -0.0082 0.0059  107 GLY B N   
2477 C  CA  . GLY B 107 ? 0.1451 0.1350 0.1606 0.0009  -0.0065 0.0035  107 GLY B CA  
2478 C  C   . GLY B 107 ? 0.1429 0.1257 0.1560 0.0024  -0.0071 0.0080  107 GLY B C   
2479 O  O   . GLY B 107 ? 0.1411 0.1300 0.1714 0.0038  -0.0115 0.0035  107 GLY B O   
2480 N  N   . SER B 108 ? 0.1344 0.1235 0.1513 0.0027  -0.0051 0.0119  108 SER B N   
2481 C  CA  . SER B 108 ? 0.1249 0.1183 0.1411 0.0037  -0.0077 0.0105  108 SER B CA  
2482 C  C   . SER B 108 ? 0.1116 0.1129 0.1258 -0.0005 -0.0067 0.0137  108 SER B C   
2483 O  O   . SER B 108 ? 0.1073 0.1094 0.1288 -0.0069 -0.0023 0.0195  108 SER B O   
2484 C  CB  . SER B 108 ? 0.1288 0.1270 0.1444 0.0106  -0.0038 0.0087  108 SER B CB  
2485 O  OG  . SER B 108 ? 0.1502 0.1438 0.1742 0.0182  -0.0119 0.0106  108 SER B OG  
2486 N  N   . VAL B 109 ? 0.1047 0.1069 0.1114 -0.0005 -0.0036 0.0143  109 VAL B N   
2487 C  CA  . VAL B 109 ? 0.1042 0.1064 0.1098 0.0032  -0.0053 0.0082  109 VAL B CA  
2488 C  C   . VAL B 109 ? 0.1012 0.1097 0.1082 0.0056  -0.0059 0.0064  109 VAL B C   
2489 O  O   . VAL B 109 ? 0.1060 0.1249 0.1190 0.0072  -0.0114 0.0119  109 VAL B O   
2490 C  CB  . VAL B 109 ? 0.1010 0.1032 0.1121 0.0046  -0.0072 0.0061  109 VAL B CB  
2491 C  CG1 . VAL B 109 ? 0.0792 0.0857 0.0997 -0.0025 -0.0073 0.0190  109 VAL B CG1 
2492 C  CG2 . VAL B 109 ? 0.1245 0.1296 0.1054 0.0122  -0.0055 0.0041  109 VAL B CG2 
2493 N  N   . ASP B 110 ? 0.1047 0.1129 0.1047 0.0088  -0.0055 0.0097  110 ASP B N   
2494 C  CA  . ASP B 110 ? 0.1029 0.1221 0.1010 0.0020  -0.0019 0.0069  110 ASP B CA  
2495 C  C   . ASP B 110 ? 0.1026 0.1204 0.1064 0.0012  -0.0014 0.0069  110 ASP B C   
2496 O  O   . ASP B 110 ? 0.1058 0.1330 0.1251 -0.0034 -0.0014 0.0115  110 ASP B O   
2497 C  CB  . ASP B 110 ? 0.1166 0.1254 0.1081 0.0026  -0.0020 0.0004  110 ASP B CB  
2498 C  CG  . ASP B 110 ? 0.1369 0.1549 0.1400 0.0009  0.0010  0.0012  110 ASP B CG  
2499 O  OD1 . ASP B 110 ? 0.1624 0.1298 0.1483 0.0078  -0.0012 0.0099  110 ASP B OD1 
2500 O  OD2 . ASP B 110 ? 0.1800 0.1842 0.1622 0.0055  -0.0075 -0.0088 110 ASP B OD2 
2501 N  N   . ASN B 111 ? 0.1019 0.1219 0.1021 -0.0037 -0.0006 0.0022  111 ASN B N   
2502 C  CA  . ASN B 111 ? 0.1077 0.1208 0.1073 -0.0047 0.0021  0.0045  111 ASN B CA  
2503 C  C   . ASN B 111 ? 0.1032 0.1168 0.1050 -0.0038 0.0021  0.0052  111 ASN B C   
2504 O  O   . ASN B 111 ? 0.1135 0.1383 0.1122 -0.0134 0.0089  0.0119  111 ASN B O   
2505 C  CB  . ASN B 111 ? 0.1050 0.1207 0.1099 0.0003  0.0021  0.0022  111 ASN B CB  
2506 C  CG  . ASN B 111 ? 0.1330 0.1420 0.1239 -0.0054 0.0067  0.0019  111 ASN B CG  
2507 O  OD1 . ASN B 111 ? 0.1794 0.1690 0.1760 -0.0167 0.0040  -0.0054 111 ASN B OD1 
2508 N  ND2 . ASN B 111 ? 0.1438 0.1486 0.1315 0.0115  0.0008  0.0081  111 ASN B ND2 
2509 N  N   . PHE B 112 ? 0.1042 0.1183 0.0983 -0.0104 0.0013  0.0139  112 PHE B N   
2510 C  CA  . PHE B 112 ? 0.0931 0.1114 0.0923 -0.0095 0.0010  0.0063  112 PHE B CA  
2511 C  C   . PHE B 112 ? 0.0846 0.1021 0.0877 -0.0109 0.0011  0.0098  112 PHE B C   
2512 O  O   . PHE B 112 ? 0.0940 0.0985 0.0849 -0.0173 -0.0004 0.0143  112 PHE B O   
2513 C  CB  . PHE B 112 ? 0.0989 0.1125 0.0903 -0.0086 0.0020  0.0149  112 PHE B CB  
2514 C  CG  . PHE B 112 ? 0.0904 0.1066 0.0810 0.0012  0.0011  0.0139  112 PHE B CG  
2515 C  CD1 . PHE B 112 ? 0.1127 0.1005 0.0882 -0.0088 -0.0066 0.0034  112 PHE B CD1 
2516 C  CD2 . PHE B 112 ? 0.1016 0.0960 0.0728 -0.0004 0.0004  0.0148  112 PHE B CD2 
2517 C  CE1 . PHE B 112 ? 0.0988 0.1029 0.0948 -0.0107 0.0006  0.0129  112 PHE B CE1 
2518 C  CE2 . PHE B 112 ? 0.0726 0.0725 0.0556 -0.0151 0.0062  0.0167  112 PHE B CE2 
2519 C  CZ  . PHE B 112 ? 0.0813 0.0853 0.0582 -0.0101 -0.0015 0.0101  112 PHE B CZ  
2520 N  N   . LYS B 113 ? 0.0787 0.0920 0.0790 -0.0081 0.0039  0.0060  113 LYS B N   
2521 C  CA  . LYS B 113 ? 0.0773 0.0944 0.0806 -0.0100 0.0015  0.0004  113 LYS B CA  
2522 C  C   . LYS B 113 ? 0.0738 0.0848 0.0787 -0.0065 0.0017  0.0056  113 LYS B C   
2523 O  O   . LYS B 113 ? 0.0675 0.0827 0.0773 -0.0074 -0.0008 0.0085  113 LYS B O   
2524 C  CB  . LYS B 113 ? 0.0790 0.0974 0.0852 -0.0080 -0.0033 -0.0012 113 LYS B CB  
2525 C  CG  . LYS B 113 ? 0.0817 0.0987 0.0659 -0.0108 -0.0009 -0.0049 113 LYS B CG  
2526 C  CD  . LYS B 113 ? 0.0864 0.1104 0.0981 -0.0029 -0.0114 -0.0064 113 LYS B CD  
2527 C  CE  . LYS B 113 ? 0.0960 0.0870 0.0839 -0.0158 -0.0059 0.0069  113 LYS B CE  
2528 N  NZ  . LYS B 113 ? 0.1208 0.1375 0.1457 -0.0113 -0.0248 0.0034  113 LYS B NZ  
2529 N  N   . ALA B 114 ? 0.0766 0.0752 0.0786 -0.0049 0.0036  0.0115  114 ALA B N   
2530 C  CA  . ALA B 114 ? 0.0797 0.0781 0.0747 -0.0012 0.0028  0.0130  114 ALA B CA  
2531 C  C   . ALA B 114 ? 0.0764 0.0657 0.0693 -0.0060 0.0061  0.0136  114 ALA B C   
2532 O  O   . ALA B 114 ? 0.0756 0.0545 0.0646 -0.0100 0.0103  0.0193  114 ALA B O   
2533 C  CB  . ALA B 114 ? 0.0735 0.0761 0.0760 0.0016  -0.0013 0.0155  114 ALA B CB  
2534 N  N   . GLU B 115 ? 0.0775 0.0735 0.0722 -0.0062 0.0037  0.0107  115 GLU B N   
2535 C  CA  . GLU B 115 ? 0.0762 0.0775 0.0786 -0.0021 0.0004  0.0081  115 GLU B CA  
2536 C  C   . GLU B 115 ? 0.0667 0.0727 0.0727 -0.0020 0.0069  0.0116  115 GLU B C   
2537 O  O   . GLU B 115 ? 0.0621 0.0719 0.0665 -0.0084 0.0114  0.0141  115 GLU B O   
2538 C  CB  . GLU B 115 ? 0.0888 0.0838 0.0915 0.0008  -0.0021 0.0057  115 GLU B CB  
2539 C  CG  . GLU B 115 ? 0.1091 0.1019 0.1280 -0.0114 -0.0026 0.0005  115 GLU B CG  
2540 C  CD  . GLU B 115 ? 0.1778 0.1255 0.1655 -0.0134 0.0100  0.0022  115 GLU B CD  
2541 O  OE1 . GLU B 115 ? 0.1866 0.1728 0.1951 -0.0176 0.0073  0.0156  115 GLU B OE1 
2542 O  OE2 . GLU B 115 ? 0.1918 0.0808 0.1690 -0.0274 0.0042  -0.0071 115 GLU B OE2 
2543 N  N   . PHE B 116 ? 0.0596 0.0611 0.0730 -0.0021 0.0049  0.0107  116 PHE B N   
2544 C  CA  . PHE B 116 ? 0.0548 0.0775 0.0614 -0.0076 0.0089  0.0085  116 PHE B CA  
2545 C  C   . PHE B 116 ? 0.0541 0.0650 0.0586 -0.0080 0.0039  0.0123  116 PHE B C   
2546 O  O   . PHE B 116 ? 0.0621 0.0890 0.0560 -0.0075 0.0019  0.0071  116 PHE B O   
2547 C  CB  . PHE B 116 ? 0.0372 0.0686 0.0601 -0.0080 0.0086  0.0140  116 PHE B CB  
2548 C  CG  . PHE B 116 ? 0.0302 0.0561 0.0493 -0.0082 0.0087  0.0043  116 PHE B CG  
2549 C  CD1 . PHE B 116 ? 0.0301 0.0417 0.0529 -0.0215 0.0055  0.0162  116 PHE B CD1 
2550 C  CD2 . PHE B 116 ? 0.0383 0.0394 0.0329 -0.0137 0.0090  0.0138  116 PHE B CD2 
2551 C  CE1 . PHE B 116 ? 0.0444 0.0415 0.0423 -0.0133 -0.0092 0.0004  116 PHE B CE1 
2552 C  CE2 . PHE B 116 ? 0.0256 0.0289 0.0175 -0.0197 0.0015  0.0034  116 PHE B CE2 
2553 C  CZ  . PHE B 116 ? 0.0103 0.0254 0.0162 -0.0087 -0.0042 0.0104  116 PHE B CZ  
2554 N  N   . GLU B 117 ? 0.0556 0.0671 0.0563 -0.0115 0.0074  0.0148  117 GLU B N   
2555 C  CA  . GLU B 117 ? 0.0481 0.0592 0.0581 -0.0155 0.0021  0.0129  117 GLU B CA  
2556 C  C   . GLU B 117 ? 0.0441 0.0569 0.0606 -0.0084 0.0018  0.0113  117 GLU B C   
2557 O  O   . GLU B 117 ? 0.0149 0.0439 0.0452 -0.0144 -0.0111 0.0134  117 GLU B O   
2558 C  CB  . GLU B 117 ? 0.0562 0.0617 0.0607 -0.0182 0.0025  0.0100  117 GLU B CB  
2559 C  CG  . GLU B 117 ? 0.0441 0.0465 0.0587 -0.0109 0.0088  0.0060  117 GLU B CG  
2560 C  CD  . GLU B 117 ? 0.0574 0.0462 0.0617 -0.0080 0.0031  0.0074  117 GLU B CD  
2561 O  OE1 . GLU B 117 ? 0.0548 0.0705 0.0692 -0.0171 0.0022  0.0005  117 GLU B OE1 
2562 O  OE2 . GLU B 117 ? 0.0598 0.0932 0.0821 0.0066  0.0226  -0.0245 117 GLU B OE2 
2563 N  N   . LYS B 118 ? 0.0447 0.0555 0.0659 -0.0095 -0.0010 0.0098  118 LYS B N   
2564 C  CA  . LYS B 118 ? 0.0564 0.0586 0.0735 -0.0131 -0.0040 0.0146  118 LYS B CA  
2565 C  C   . LYS B 118 ? 0.0519 0.0423 0.0636 -0.0141 -0.0021 0.0046  118 LYS B C   
2566 O  O   . LYS B 118 ? 0.0367 0.0254 0.0586 -0.0238 -0.0086 0.0021  118 LYS B O   
2567 C  CB  . LYS B 118 ? 0.0621 0.0594 0.0850 -0.0086 -0.0018 0.0143  118 LYS B CB  
2568 C  CG  . LYS B 118 ? 0.1048 0.1029 0.1215 -0.0091 0.0012  0.0093  118 LYS B CG  
2569 C  CD  . LYS B 118 ? 0.1363 0.1066 0.1379 -0.0085 -0.0038 0.0019  118 LYS B CD  
2570 C  CE  . LYS B 118 ? 0.1285 0.1168 0.1257 -0.0058 0.0006  -0.0028 118 LYS B CE  
2571 N  NZ  . LYS B 118 ? 0.1689 0.1339 0.1522 -0.0197 -0.0019 -0.0063 118 LYS B NZ  
2572 N  N   . ALA B 119 ? 0.0430 0.0361 0.0522 -0.0134 0.0041  0.0070  119 ALA B N   
2573 C  CA  . ALA B 119 ? 0.0429 0.0385 0.0416 -0.0102 0.0006  0.0027  119 ALA B CA  
2574 C  C   . ALA B 119 ? 0.0398 0.0467 0.0366 -0.0074 0.0022  0.0047  119 ALA B C   
2575 O  O   . ALA B 119 ? 0.0409 0.0401 0.0266 -0.0088 -0.0076 0.0116  119 ALA B O   
2576 C  CB  . ALA B 119 ? 0.0350 0.0420 0.0346 -0.0028 0.0055  0.0078  119 ALA B CB  
2577 N  N   . ALA B 120 ? 0.0411 0.0483 0.0389 -0.0091 -0.0032 0.0039  120 ALA B N   
2578 C  CA  . ALA B 120 ? 0.0414 0.0519 0.0365 -0.0127 0.0000  0.0055  120 ALA B CA  
2579 C  C   . ALA B 120 ? 0.0359 0.0512 0.0288 -0.0160 0.0023  0.0047  120 ALA B C   
2580 O  O   . ALA B 120 ? 0.0446 0.0751 0.0142 -0.0164 0.0036  -0.0021 120 ALA B O   
2581 C  CB  . ALA B 120 ? 0.0460 0.0579 0.0364 -0.0153 0.0018  0.0006  120 ALA B CB  
2582 N  N   . ALA B 121 ? 0.0399 0.0515 0.0366 -0.0198 0.0013  0.0040  121 ALA B N   
2583 C  CA  . ALA B 121 ? 0.0442 0.0626 0.0415 -0.0150 0.0056  0.0054  121 ALA B CA  
2584 C  C   . ALA B 121 ? 0.0496 0.0680 0.0436 -0.0087 0.0061  0.0086  121 ALA B C   
2585 O  O   . ALA B 121 ? 0.0567 0.0752 0.0430 -0.0129 0.0163  0.0147  121 ALA B O   
2586 C  CB  . ALA B 121 ? 0.0409 0.0695 0.0351 -0.0149 -0.0003 0.0141  121 ALA B CB  
2587 N  N   . SER B 122 ? 0.0549 0.0749 0.0574 -0.0117 0.0056  0.0013  122 SER B N   
2588 C  CA  . SER B 122 ? 0.0682 0.0808 0.0733 -0.0094 0.0100  0.0042  122 SER B CA  
2589 C  C   . SER B 122 ? 0.0524 0.0618 0.0615 -0.0074 0.0050  0.0037  122 SER B C   
2590 O  O   . SER B 122 ? 0.0530 0.0707 0.0644 -0.0152 0.0075  0.0115  122 SER B O   
2591 C  CB  . SER B 122 ? 0.0712 0.0831 0.0796 -0.0041 0.0059  0.0045  122 SER B CB  
2592 O  OG  . SER B 122 ? 0.1550 0.1293 0.1549 -0.0085 0.0226  0.0009  122 SER B OG  
2593 N  N   . ARG B 123 ? 0.0345 0.0544 0.0491 -0.0140 0.0093  -0.0006 123 ARG B N   
2594 C  CA  . ARG B 123 ? 0.0303 0.0424 0.0419 -0.0079 0.0040  0.0000  123 ARG B CA  
2595 C  C   . ARG B 123 ? 0.0346 0.0420 0.0342 -0.0106 0.0026  0.0020  123 ARG B C   
2596 O  O   . ARG B 123 ? 0.0256 0.0438 0.0374 -0.0197 -0.0015 0.0144  123 ARG B O   
2597 C  CB  . ARG B 123 ? 0.0366 0.0459 0.0411 -0.0073 0.0086  0.0006  123 ARG B CB  
2598 C  CG  . ARG B 123 ? 0.0474 0.0539 0.0520 0.0101  0.0075  -0.0103 123 ARG B CG  
2599 C  CD  . ARG B 123 ? 0.0487 0.0334 0.0504 -0.0021 0.0068  -0.0167 123 ARG B CD  
2600 N  NE  . ARG B 123 ? 0.0452 0.0522 0.0681 0.0099  0.0043  0.0038  123 ARG B NE  
2601 C  CZ  . ARG B 123 ? 0.0709 0.0574 0.0911 0.0071  0.0053  0.0004  123 ARG B CZ  
2602 N  NH1 . ARG B 123 ? 0.0673 0.0804 0.0669 0.0022  0.0033  0.0068  123 ARG B NH1 
2603 N  NH2 . ARG B 123 ? 0.0570 0.0366 0.0706 -0.0019 0.0154  0.0029  123 ARG B NH2 
2604 N  N   . PHE B 124 ? 0.0261 0.0296 0.0163 -0.0157 0.0046  0.0061  124 PHE B N   
2605 C  CA  . PHE B 124 ? 0.0334 0.0335 0.0149 -0.0158 0.0049  0.0059  124 PHE B CA  
2606 C  C   . PHE B 124 ? 0.0412 0.0380 0.0178 -0.0166 -0.0011 0.0036  124 PHE B C   
2607 O  O   . PHE B 124 ? 0.0617 0.0538 0.0068 -0.0299 -0.0027 -0.0018 124 PHE B O   
2608 C  CB  . PHE B 124 ? 0.0254 0.0347 0.0138 -0.0111 0.0080  0.0046  124 PHE B CB  
2609 C  CG  . PHE B 124 ? 0.0375 0.0310 0.0208 -0.0201 0.0092  0.0057  124 PHE B CG  
2610 C  CD1 . PHE B 124 ? 0.0377 0.0519 0.0418 -0.0119 0.0064  -0.0020 124 PHE B CD1 
2611 C  CD2 . PHE B 124 ? 0.0153 0.0068 0.0211 0.0021  0.0115  0.0026  124 PHE B CD2 
2612 C  CE1 . PHE B 124 ? 0.0297 0.0376 0.0159 0.0020  -0.0040 0.0013  124 PHE B CE1 
2613 C  CE2 . PHE B 124 ? 0.0169 0.0258 0.0340 -0.0011 0.0148  0.0045  124 PHE B CE2 
2614 C  CZ  . PHE B 124 ? 0.0127 0.0285 0.0191 0.0019  0.0089  0.0049  124 PHE B CZ  
2615 N  N   . GLY B 125 ? 0.0362 0.0290 0.0123 -0.0089 0.0014  -0.0006 125 GLY B N   
2616 C  CA  . GLY B 125 ? 0.0177 0.0138 0.0068 -0.0081 -0.0021 0.0019  125 GLY B CA  
2617 C  C   . GLY B 125 ? 0.0129 0.0221 0.0075 -0.0035 -0.0001 0.0035  125 GLY B C   
2618 O  O   . GLY B 125 ? 0.0290 0.0332 0.0095 -0.0080 0.0063  0.0035  125 GLY B O   
2619 N  N   . SER B 126 ? 0.0103 0.0157 0.0098 -0.0038 0.0024  0.0009  126 SER B N   
2620 C  CA  . SER B 126 ? 0.0150 0.0278 0.0070 -0.0137 -0.0024 0.0038  126 SER B CA  
2621 C  C   . SER B 126 ? 0.0236 0.0437 0.0215 -0.0087 0.0023  0.0036  126 SER B C   
2622 O  O   . SER B 126 ? 0.0318 0.0316 0.0330 -0.0172 -0.0044 -0.0008 126 SER B O   
2623 C  CB  . SER B 126 ? 0.0115 0.0349 0.0155 -0.0096 0.0013  0.0073  126 SER B CB  
2624 O  OG  . SER B 126 ? 0.0205 0.0279 0.0065 -0.0175 -0.0016 0.0019  126 SER B OG  
2625 N  N   . GLY B 127 ? 0.0259 0.0432 0.0206 -0.0098 0.0017  0.0030  127 GLY B N   
2626 C  CA  . GLY B 127 ? 0.0196 0.0393 0.0225 -0.0050 0.0022  0.0067  127 GLY B CA  
2627 C  C   . GLY B 127 ? 0.0259 0.0408 0.0321 -0.0072 0.0101  -0.0004 127 GLY B C   
2628 O  O   . GLY B 127 ? 0.0117 0.0327 0.0363 -0.0103 0.0048  0.0035  127 GLY B O   
2629 N  N   . TRP B 128 ? 0.0200 0.0437 0.0360 -0.0094 0.0034  0.0059  128 TRP B N   
2630 C  CA  . TRP B 128 ? 0.0336 0.0412 0.0455 -0.0111 -0.0002 -0.0011 128 TRP B CA  
2631 C  C   . TRP B 128 ? 0.0269 0.0338 0.0401 -0.0127 0.0008  0.0001  128 TRP B C   
2632 O  O   . TRP B 128 ? 0.0224 0.0250 0.0466 -0.0173 0.0036  -0.0047 128 TRP B O   
2633 C  CB  . TRP B 128 ? 0.0409 0.0296 0.0469 -0.0059 0.0043  0.0081  128 TRP B CB  
2634 C  CG  . TRP B 128 ? 0.0397 0.0371 0.0350 -0.0231 -0.0031 0.0107  128 TRP B CG  
2635 C  CD1 . TRP B 128 ? 0.0399 0.0324 0.0637 -0.0241 0.0070  0.0169  128 TRP B CD1 
2636 C  CD2 . TRP B 128 ? 0.0295 0.0322 0.0234 -0.0020 0.0157  0.0114  128 TRP B CD2 
2637 N  NE1 . TRP B 128 ? 0.0440 0.0430 0.0343 -0.0033 0.0074  0.0095  128 TRP B NE1 
2638 C  CE2 . TRP B 128 ? 0.0344 0.0515 0.0166 -0.0111 0.0125  0.0006  128 TRP B CE2 
2639 C  CE3 . TRP B 128 ? 0.0308 0.0374 0.0160 -0.0239 0.0014  0.0072  128 TRP B CE3 
2640 C  CZ2 . TRP B 128 ? 0.0488 0.0442 0.0294 -0.0221 0.0032  0.0081  128 TRP B CZ2 
2641 C  CZ3 . TRP B 128 ? 0.0314 0.0521 0.0351 -0.0137 0.0163  0.0174  128 TRP B CZ3 
2642 C  CH2 . TRP B 128 ? 0.0385 0.0450 0.0112 -0.0090 -0.0035 -0.0058 128 TRP B CH2 
2643 N  N   . ALA B 129 ? 0.0177 0.0328 0.0448 -0.0159 0.0033  -0.0029 129 ALA B N   
2644 C  CA  . ALA B 129 ? 0.0340 0.0487 0.0440 -0.0086 -0.0013 -0.0025 129 ALA B CA  
2645 C  C   . ALA B 129 ? 0.0368 0.0535 0.0436 -0.0074 -0.0032 -0.0006 129 ALA B C   
2646 O  O   . ALA B 129 ? 0.0545 0.0604 0.0384 -0.0029 -0.0040 0.0006  129 ALA B O   
2647 C  CB  . ALA B 129 ? 0.0220 0.0494 0.0538 -0.0116 -0.0089 -0.0104 129 ALA B CB  
2648 N  N   . TRP B 130 ? 0.0424 0.0512 0.0454 -0.0057 -0.0023 0.0058  130 TRP B N   
2649 C  CA  . TRP B 130 ? 0.0462 0.0513 0.0513 -0.0086 0.0071  0.0049  130 TRP B CA  
2650 C  C   . TRP B 130 ? 0.0606 0.0666 0.0641 -0.0097 0.0056  0.0116  130 TRP B C   
2651 O  O   . TRP B 130 ? 0.0646 0.0485 0.0585 -0.0178 0.0202  0.0095  130 TRP B O   
2652 C  CB  . TRP B 130 ? 0.0451 0.0626 0.0510 -0.0098 0.0027  0.0152  130 TRP B CB  
2653 C  CG  . TRP B 130 ? 0.0245 0.0504 0.0420 -0.0003 0.0045  0.0041  130 TRP B CG  
2654 C  CD1 . TRP B 130 ? 0.0158 0.0455 0.0411 -0.0188 -0.0026 -0.0027 130 TRP B CD1 
2655 C  CD2 . TRP B 130 ? 0.0259 0.0380 0.0508 -0.0052 0.0133  0.0065  130 TRP B CD2 
2656 N  NE1 . TRP B 130 ? 0.0123 0.0479 0.0505 -0.0080 0.0118  0.0095  130 TRP B NE1 
2657 C  CE2 . TRP B 130 ? 0.0293 0.0735 0.0534 -0.0093 0.0097  0.0117  130 TRP B CE2 
2658 C  CE3 . TRP B 130 ? 0.0198 0.0374 0.0415 -0.0102 0.0126  -0.0026 130 TRP B CE3 
2659 C  CZ2 . TRP B 130 ? 0.0395 0.0642 0.0596 -0.0158 0.0085  0.0067  130 TRP B CZ2 
2660 C  CZ3 . TRP B 130 ? 0.0369 0.0308 0.0647 -0.0029 0.0055  -0.0062 130 TRP B CZ3 
2661 C  CH2 . TRP B 130 ? 0.0347 0.0814 0.0688 -0.0019 0.0044  0.0057  130 TRP B CH2 
2662 N  N   . LEU B 131 ? 0.0619 0.0629 0.0594 -0.0036 0.0187  0.0126  131 LEU B N   
2663 C  CA  . LEU B 131 ? 0.0649 0.0833 0.0721 -0.0022 0.0064  0.0123  131 LEU B CA  
2664 C  C   . LEU B 131 ? 0.0727 0.0900 0.0783 0.0012  0.0080  0.0131  131 LEU B C   
2665 O  O   . LEU B 131 ? 0.0753 0.1068 0.0738 0.0023  0.0061  0.0222  131 LEU B O   
2666 C  CB  . LEU B 131 ? 0.0640 0.0742 0.0718 0.0001  0.0081  0.0126  131 LEU B CB  
2667 C  CG  . LEU B 131 ? 0.0670 0.0900 0.0845 0.0033  0.0015  0.0111  131 LEU B CG  
2668 C  CD1 . LEU B 131 ? 0.0930 0.1171 0.0841 0.0004  0.0137  0.0062  131 LEU B CD1 
2669 C  CD2 . LEU B 131 ? 0.0790 0.1208 0.1122 -0.0061 0.0019  0.0100  131 LEU B CD2 
2670 N  N   . VAL B 132 ? 0.0665 0.0875 0.0850 0.0030  0.0035  0.0150  132 VAL B N   
2671 C  CA  . VAL B 132 ? 0.0799 0.0807 0.0935 0.0000  0.0061  0.0092  132 VAL B CA  
2672 C  C   . VAL B 132 ? 0.0879 0.0870 0.1059 0.0018  0.0008  0.0066  132 VAL B C   
2673 O  O   . VAL B 132 ? 0.1021 0.0815 0.1284 -0.0033 -0.0035 0.0076  132 VAL B O   
2674 C  CB  . VAL B 132 ? 0.0824 0.0878 0.0888 0.0047  0.0036  0.0112  132 VAL B CB  
2675 C  CG1 . VAL B 132 ? 0.0723 0.0735 0.0933 0.0044  0.0111  0.0078  132 VAL B CG1 
2676 C  CG2 . VAL B 132 ? 0.0900 0.0753 0.0822 -0.0089 0.0022  0.0070  132 VAL B CG2 
2677 N  N   . LEU B 133 ? 0.0865 0.0901 0.1206 -0.0055 0.0057  0.0028  133 LEU B N   
2678 C  CA  . LEU B 133 ? 0.0990 0.1037 0.1282 -0.0007 0.0024  0.0035  133 LEU B CA  
2679 C  C   . LEU B 133 ? 0.1071 0.1084 0.1223 -0.0011 0.0000  0.0003  133 LEU B C   
2680 O  O   . LEU B 133 ? 0.1194 0.1235 0.1246 0.0008  -0.0028 0.0065  133 LEU B O   
2681 C  CB  . LEU B 133 ? 0.0950 0.1065 0.1276 -0.0004 0.0026  0.0038  133 LEU B CB  
2682 C  CG  . LEU B 133 ? 0.1282 0.1279 0.1528 0.0069  0.0008  -0.0001 133 LEU B CG  
2683 C  CD1 . LEU B 133 ? 0.1198 0.1389 0.1601 0.0054  0.0011  0.0068  133 LEU B CD1 
2684 C  CD2 . LEU B 133 ? 0.1521 0.1668 0.1628 0.0022  0.0081  0.0085  133 LEU B CD2 
2685 N  N   . LYS B 134 ? 0.1182 0.1157 0.1350 0.0039  0.0029  0.0014  134 LYS B N   
2686 C  CA  . LYS B 134 ? 0.1315 0.1195 0.1436 0.0046  0.0016  0.0004  134 LYS B CA  
2687 C  C   . LYS B 134 ? 0.1444 0.1215 0.1442 0.0012  0.0011  0.0023  134 LYS B C   
2688 O  O   . LYS B 134 ? 0.1512 0.1104 0.1508 -0.0025 -0.0059 0.0077  134 LYS B O   
2689 C  CB  . LYS B 134 ? 0.1327 0.1236 0.1459 0.0014  0.0071  0.0000  134 LYS B CB  
2690 C  CG  . LYS B 134 ? 0.1491 0.1479 0.1701 0.0075  0.0044  0.0070  134 LYS B CG  
2691 C  CD  . LYS B 134 ? 0.1823 0.1915 0.1874 -0.0017 0.0110  0.0061  134 LYS B CD  
2692 C  CE  . LYS B 134 ? 0.2098 0.1911 0.2058 -0.0006 0.0036  0.0053  134 LYS B CE  
2693 N  NZ  . LYS B 134 ? 0.2291 0.2035 0.2433 0.0028  0.0024  -0.0066 134 LYS B NZ  
2694 N  N   . GLY B 135 ? 0.1544 0.1247 0.1467 0.0046  0.0047  -0.0022 135 GLY B N   
2695 C  CA  . GLY B 135 ? 0.1560 0.1387 0.1586 0.0068  0.0068  -0.0028 135 GLY B CA  
2696 C  C   . GLY B 135 ? 0.1576 0.1450 0.1592 0.0008  0.0046  -0.0041 135 GLY B C   
2697 O  O   . GLY B 135 ? 0.1688 0.1629 0.1774 0.0004  0.0066  -0.0027 135 GLY B O   
2698 N  N   . ASP B 136 ? 0.1675 0.1503 0.1657 0.0055  0.0011  -0.0034 136 ASP B N   
2699 C  CA  . ASP B 136 ? 0.1694 0.1551 0.1676 0.0012  -0.0014 -0.0054 136 ASP B CA  
2700 C  C   . ASP B 136 ? 0.1653 0.1559 0.1647 -0.0028 0.0020  -0.0010 136 ASP B C   
2701 O  O   . ASP B 136 ? 0.1810 0.1730 0.1795 -0.0091 -0.0008 -0.0003 136 ASP B O   
2702 C  CB  . ASP B 136 ? 0.1768 0.1629 0.1812 0.0028  0.0003  0.0001  136 ASP B CB  
2703 C  CG  . ASP B 136 ? 0.2081 0.1878 0.1981 0.0010  -0.0037 -0.0046 136 ASP B CG  
2704 O  OD1 . ASP B 136 ? 0.2339 0.2341 0.2237 0.0114  -0.0100 -0.0048 136 ASP B OD1 
2705 O  OD2 . ASP B 136 ? 0.2191 0.2033 0.2325 0.0065  0.0045  0.0016  136 ASP B OD2 
2706 N  N   . LYS B 137 ? 0.1563 0.1423 0.1561 0.0000  0.0018  -0.0058 137 LYS B N   
2707 C  CA  . LYS B 137 ? 0.1465 0.1332 0.1481 0.0027  0.0017  -0.0023 137 LYS B CA  
2708 C  C   . LYS B 137 ? 0.1325 0.1225 0.1352 -0.0015 -0.0023 -0.0017 137 LYS B C   
2709 O  O   . LYS B 137 ? 0.1293 0.1078 0.1371 0.0070  -0.0030 -0.0004 137 LYS B O   
2710 C  CB  . LYS B 137 ? 0.1533 0.1420 0.1551 0.0007  0.0050  0.0012  137 LYS B CB  
2711 C  CG  . LYS B 137 ? 0.1618 0.1477 0.1623 0.0035  0.0077  -0.0006 137 LYS B CG  
2712 C  CD  . LYS B 137 ? 0.1771 0.1600 0.1849 0.0080  0.0069  -0.0068 137 LYS B CD  
2713 C  CE  . LYS B 137 ? 0.1723 0.1677 0.1860 0.0062  0.0056  -0.0042 137 LYS B CE  
2714 N  NZ  . LYS B 137 ? 0.1835 0.1758 0.2058 0.0080  0.0008  0.0068  137 LYS B NZ  
2715 N  N   . LEU B 138 ? 0.1226 0.1132 0.1291 0.0001  -0.0011 0.0004  138 LEU B N   
2716 C  CA  . LEU B 138 ? 0.1101 0.1138 0.1229 -0.0025 -0.0012 0.0010  138 LEU B CA  
2717 C  C   . LEU B 138 ? 0.1032 0.1092 0.1146 -0.0053 -0.0026 0.0047  138 LEU B C   
2718 O  O   . LEU B 138 ? 0.1090 0.1291 0.1221 -0.0091 -0.0068 0.0080  138 LEU B O   
2719 C  CB  . LEU B 138 ? 0.1068 0.1214 0.1249 -0.0011 -0.0019 -0.0018 138 LEU B CB  
2720 C  CG  . LEU B 138 ? 0.1180 0.1260 0.1279 0.0062  0.0071  0.0018  138 LEU B CG  
2721 C  CD1 . LEU B 138 ? 0.1154 0.1138 0.1385 0.0029  0.0052  -0.0054 138 LEU B CD1 
2722 C  CD2 . LEU B 138 ? 0.1113 0.1134 0.1309 0.0071  0.0067  -0.0038 138 LEU B CD2 
2723 N  N   . ALA B 139 ? 0.0966 0.1067 0.1121 -0.0042 -0.0010 0.0031  139 ALA B N   
2724 C  CA  . ALA B 139 ? 0.0962 0.0994 0.1095 -0.0058 0.0026  0.0021  139 ALA B CA  
2725 C  C   . ALA B 139 ? 0.0926 0.0951 0.1059 -0.0014 0.0033  0.0071  139 ALA B C   
2726 O  O   . ALA B 139 ? 0.0911 0.0947 0.1081 -0.0006 0.0118  0.0086  139 ALA B O   
2727 C  CB  . ALA B 139 ? 0.0968 0.1053 0.1258 -0.0080 -0.0006 -0.0005 139 ALA B CB  
2728 N  N   . VAL B 140 ? 0.0848 0.0926 0.0993 -0.0053 0.0009  0.0102  140 VAL B N   
2729 C  CA  . VAL B 140 ? 0.0739 0.0877 0.0910 -0.0030 -0.0026 0.0104  140 VAL B CA  
2730 C  C   . VAL B 140 ? 0.0711 0.0888 0.0905 -0.0072 -0.0005 0.0140  140 VAL B C   
2731 O  O   . VAL B 140 ? 0.0775 0.0811 0.0961 -0.0074 0.0018  0.0132  140 VAL B O   
2732 C  CB  . VAL B 140 ? 0.0650 0.0875 0.0972 -0.0075 0.0011  0.0069  140 VAL B CB  
2733 C  CG1 . VAL B 140 ? 0.0607 0.0607 0.0795 -0.0161 -0.0014 0.0040  140 VAL B CG1 
2734 C  CG2 . VAL B 140 ? 0.0711 0.0770 0.0841 0.0038  -0.0151 0.0113  140 VAL B CG2 
2735 N  N   . VAL B 141 ? 0.0640 0.0822 0.0855 -0.0063 -0.0059 0.0144  141 VAL B N   
2736 C  CA  . VAL B 141 ? 0.0684 0.0838 0.0842 -0.0070 -0.0021 0.0087  141 VAL B CA  
2737 C  C   . VAL B 141 ? 0.0624 0.0787 0.0872 -0.0085 -0.0040 0.0071  141 VAL B C   
2738 O  O   . VAL B 141 ? 0.0690 0.0836 0.0876 -0.0109 -0.0090 0.0110  141 VAL B O   
2739 C  CB  . VAL B 141 ? 0.0668 0.0763 0.0916 -0.0098 -0.0040 0.0084  141 VAL B CB  
2740 C  CG1 . VAL B 141 ? 0.1027 0.1127 0.1179 -0.0084 -0.0012 0.0086  141 VAL B CG1 
2741 C  CG2 . VAL B 141 ? 0.0536 0.0863 0.0715 -0.0114 0.0017  0.0044  141 VAL B CG2 
2742 N  N   . SER B 142 ? 0.0581 0.0705 0.0807 -0.0088 -0.0036 0.0052  142 SER B N   
2743 C  CA  . SER B 142 ? 0.0580 0.0658 0.0778 -0.0097 -0.0028 -0.0041 142 SER B CA  
2744 C  C   . SER B 142 ? 0.0525 0.0663 0.0761 -0.0104 0.0052  0.0006  142 SER B C   
2745 O  O   . SER B 142 ? 0.0619 0.0574 0.0811 -0.0173 0.0067  0.0007  142 SER B O   
2746 C  CB  . SER B 142 ? 0.0670 0.0755 0.0783 -0.0056 0.0041  -0.0011 142 SER B CB  
2747 O  OG  . SER B 142 ? 0.0762 0.0740 0.1032 -0.0151 -0.0024 -0.0126 142 SER B OG  
2748 N  N   . THR B 143 ? 0.0247 0.0501 0.0649 0.0017  0.0049  -0.0039 143 THR B N   
2749 C  CA  . THR B 143 ? 0.0313 0.0397 0.0527 -0.0092 0.0033  -0.0023 143 THR B CA  
2750 C  C   . THR B 143 ? 0.0220 0.0357 0.0419 -0.0074 0.0026  -0.0060 143 THR B C   
2751 O  O   . THR B 143 ? 0.0174 0.0071 0.0385 -0.0025 0.0124  -0.0048 143 THR B O   
2752 C  CB  . THR B 143 ? 0.0262 0.0326 0.0491 -0.0160 0.0056  -0.0002 143 THR B CB  
2753 O  OG1 . THR B 143 ? 0.0255 0.0369 0.0532 -0.0212 0.0034  0.0143  143 THR B OG1 
2754 C  CG2 . THR B 143 ? 0.0441 0.0464 0.0721 -0.0041 0.0046  -0.0036 143 THR B CG2 
2755 N  N   . ALA B 144 ? 0.0155 0.0277 0.0430 -0.0032 0.0030  -0.0034 144 ALA B N   
2756 C  CA  . ALA B 144 ? 0.0212 0.0277 0.0313 -0.0049 -0.0005 -0.0059 144 ALA B CA  
2757 C  C   . ALA B 144 ? 0.0113 0.0317 0.0286 -0.0070 0.0013  -0.0069 144 ALA B C   
2758 O  O   . ALA B 144 ? 0.0082 0.0232 0.0242 -0.0050 0.0040  -0.0164 144 ALA B O   
2759 C  CB  . ALA B 144 ? 0.0175 0.0190 0.0272 -0.0112 0.0008  -0.0062 144 ALA B CB  
2760 N  N   . ASN B 145 ? 0.0094 0.0209 0.0210 -0.0008 -0.0026 -0.0127 145 ASN B N   
2761 C  CA  . ASN B 145 ? 0.0097 0.0179 0.0269 -0.0057 0.0018  -0.0093 145 ASN B CA  
2762 C  C   . ASN B 145 ? 0.0182 0.0175 0.0296 -0.0029 0.0024  -0.0070 145 ASN B C   
2763 O  O   . ASN B 145 ? 0.0077 0.0198 0.0224 -0.0043 0.0026  -0.0069 145 ASN B O   
2764 C  CB  . ASN B 145 ? 0.0124 0.0223 0.0265 -0.0019 0.0009  -0.0114 145 ASN B CB  
2765 C  CG  . ASN B 145 ? 0.0165 0.0254 0.0288 -0.0088 0.0071  -0.0055 145 ASN B CG  
2766 O  OD1 . ASN B 145 ? 0.0172 0.0229 0.0087 -0.0134 0.0051  -0.0063 145 ASN B OD1 
2767 N  ND2 . ASN B 145 ? 0.0074 0.0161 0.0243 -0.0032 0.0043  -0.0132 145 ASN B ND2 
2768 N  N   . GLN B 146 ? 0.0134 0.0083 0.0233 -0.0037 0.0076  -0.0047 146 GLN B N   
2769 C  CA  . GLN B 146 ? 0.0256 0.0292 0.0287 -0.0042 0.0063  -0.0037 146 GLN B CA  
2770 C  C   . GLN B 146 ? 0.0267 0.0354 0.0330 -0.0071 0.0090  -0.0057 146 GLN B C   
2771 O  O   . GLN B 146 ? 0.0319 0.0355 0.0347 -0.0070 0.0157  -0.0181 146 GLN B O   
2772 C  CB  . GLN B 146 ? 0.0155 0.0199 0.0202 -0.0065 0.0001  -0.0016 146 GLN B CB  
2773 C  CG  . GLN B 146 ? 0.0327 0.0181 0.0387 -0.0005 0.0022  -0.0041 146 GLN B CG  
2774 C  CD  . GLN B 146 ? 0.0249 0.0216 0.0281 -0.0020 0.0088  0.0153  146 GLN B CD  
2775 O  OE1 . GLN B 146 ? 0.0238 0.0134 0.0507 0.0023  0.0268  -0.0012 146 GLN B OE1 
2776 N  NE2 . GLN B 146 ? 0.0097 0.0394 0.0268 -0.0082 0.0026  0.0092  146 GLN B NE2 
2777 N  N   . ASP B 147 ? 0.0355 0.0513 0.0401 -0.0059 0.0109  -0.0072 147 ASP B N   
2778 C  CA  . ASP B 147 ? 0.0317 0.0536 0.0452 -0.0069 0.0104  -0.0053 147 ASP B CA  
2779 C  C   . ASP B 147 ? 0.0329 0.0567 0.0525 -0.0066 0.0069  -0.0096 147 ASP B C   
2780 O  O   . ASP B 147 ? 0.0100 0.0428 0.0409 -0.0116 0.0061  -0.0163 147 ASP B O   
2781 C  CB  . ASP B 147 ? 0.0293 0.0392 0.0478 -0.0144 0.0090  -0.0043 147 ASP B CB  
2782 C  CG  . ASP B 147 ? 0.0307 0.0411 0.0263 -0.0044 -0.0065 0.0036  147 ASP B CG  
2783 O  OD1 . ASP B 147 ? 0.0462 0.0335 0.0691 -0.0156 -0.0086 0.0070  147 ASP B OD1 
2784 O  OD2 . ASP B 147 ? 0.0423 0.0224 0.0578 -0.0228 -0.0110 -0.0019 147 ASP B OD2 
2785 N  N   . SER B 148 ? 0.0292 0.0553 0.0635 -0.0046 0.0083  -0.0125 148 SER B N   
2786 C  CA  . SER B 148 ? 0.0362 0.0576 0.0640 -0.0008 0.0045  -0.0053 148 SER B CA  
2787 C  C   . SER B 148 ? 0.0448 0.0672 0.0658 -0.0026 0.0061  -0.0057 148 SER B C   
2788 O  O   . SER B 148 ? 0.0412 0.0486 0.0658 -0.0105 0.0033  -0.0123 148 SER B O   
2789 C  CB  . SER B 148 ? 0.0425 0.0597 0.0609 0.0008  0.0046  -0.0050 148 SER B CB  
2790 O  OG  . SER B 148 ? 0.0316 0.0570 0.0693 0.0093  0.0074  0.0039  148 SER B OG  
2791 N  N   . PRO B 149 ? 0.0494 0.0696 0.0674 -0.0053 0.0048  -0.0030 149 PRO B N   
2792 C  CA  . PRO B 149 ? 0.0564 0.0750 0.0742 0.0023  0.0055  -0.0026 149 PRO B CA  
2793 C  C   . PRO B 149 ? 0.0643 0.0740 0.0750 0.0019  0.0037  -0.0019 149 PRO B C   
2794 O  O   . PRO B 149 ? 0.0638 0.0756 0.0781 0.0127  0.0036  -0.0098 149 PRO B O   
2795 C  CB  . PRO B 149 ? 0.0665 0.0816 0.0709 -0.0007 -0.0004 -0.0037 149 PRO B CB  
2796 C  CG  . PRO B 149 ? 0.0594 0.0781 0.0934 -0.0044 0.0024  -0.0037 149 PRO B CG  
2797 C  CD  . PRO B 149 ? 0.0512 0.0854 0.0586 0.0029  0.0022  -0.0029 149 PRO B CD  
2798 N  N   . LEU B 150 ? 0.0696 0.0703 0.0693 0.0055  0.0082  -0.0049 150 LEU B N   
2799 C  CA  . LEU B 150 ? 0.0759 0.0782 0.0760 0.0010  0.0030  -0.0020 150 LEU B CA  
2800 C  C   . LEU B 150 ? 0.0764 0.0758 0.0805 -0.0053 0.0062  -0.0073 150 LEU B C   
2801 O  O   . LEU B 150 ? 0.0720 0.0581 0.0744 -0.0144 0.0122  -0.0104 150 LEU B O   
2802 C  CB  . LEU B 150 ? 0.0839 0.0902 0.0774 0.0007  0.0018  -0.0007 150 LEU B CB  
2803 C  CG  . LEU B 150 ? 0.0693 0.0818 0.0736 0.0081  0.0102  0.0057  150 LEU B CG  
2804 C  CD1 . LEU B 150 ? 0.0252 0.0658 0.0601 0.0012  -0.0053 0.0030  150 LEU B CD1 
2805 C  CD2 . LEU B 150 ? 0.0622 0.0887 0.0819 0.0019  0.0111  0.0013  150 LEU B CD2 
2806 N  N   . MET B 151 ? 0.0715 0.0724 0.0768 -0.0060 0.0067  -0.0108 151 MET B N   
2807 C  CA  . MET B 151 ? 0.0792 0.0824 0.0896 0.0005  0.0015  -0.0058 151 MET B CA  
2808 C  C   . MET B 151 ? 0.0841 0.0838 0.0925 -0.0028 -0.0020 -0.0051 151 MET B C   
2809 O  O   . MET B 151 ? 0.0772 0.0841 0.1014 -0.0078 -0.0045 -0.0099 151 MET B O   
2810 C  CB  . MET B 151 ? 0.0841 0.0647 0.0844 -0.0018 0.0014  -0.0091 151 MET B CB  
2811 C  CG  . MET B 151 ? 0.0772 0.0588 0.0927 0.0005  0.0111  -0.0032 151 MET B CG  
2812 S  SD  . MET B 151 ? 0.0341 0.0251 0.0428 -0.0228 0.0242  -0.0199 151 MET B SD  
2813 C  CE  . MET B 151 ? 0.0651 0.0525 0.0329 -0.0342 0.0197  0.0027  151 MET B CE  
2814 N  N   . GLY B 152 ? 0.0801 0.0851 0.0956 -0.0006 -0.0056 -0.0082 152 GLY B N   
2815 C  CA  . GLY B 152 ? 0.0799 0.0829 0.0926 0.0004  -0.0005 -0.0094 152 GLY B CA  
2816 C  C   . GLY B 152 ? 0.0853 0.0833 0.0899 -0.0056 -0.0018 -0.0066 152 GLY B C   
2817 O  O   . GLY B 152 ? 0.0683 0.0713 0.0860 0.0027  0.0029  -0.0018 152 GLY B O   
2818 N  N   . GLU B 153 ? 0.1020 0.0866 0.1016 -0.0038 -0.0029 -0.0077 153 GLU B N   
2819 C  CA  . GLU B 153 ? 0.1051 0.0870 0.0999 -0.0048 -0.0008 -0.0026 153 GLU B CA  
2820 C  C   . GLU B 153 ? 0.1031 0.0826 0.0984 -0.0058 0.0020  -0.0030 153 GLU B C   
2821 O  O   . GLU B 153 ? 0.1060 0.0631 0.0977 -0.0144 -0.0007 -0.0109 153 GLU B O   
2822 C  CB  . GLU B 153 ? 0.1202 0.0946 0.1242 -0.0041 -0.0040 -0.0004 153 GLU B CB  
2823 C  CG  . GLU B 153 ? 0.1615 0.1332 0.1494 -0.0012 0.0028  -0.0054 153 GLU B CG  
2824 C  CD  . GLU B 153 ? 0.1994 0.1854 0.2025 -0.0043 -0.0152 0.0015  153 GLU B CD  
2825 O  OE1 . GLU B 153 ? 0.2075 0.1758 0.2135 -0.0189 -0.0050 -0.0014 153 GLU B OE1 
2826 O  OE2 . GLU B 153 ? 0.2357 0.2049 0.2398 -0.0014 0.0024  0.0098  153 GLU B OE2 
2827 N  N   . ALA B 154 ? 0.0958 0.0752 0.1045 -0.0094 0.0005  -0.0073 154 ALA B N   
2828 C  CA  . ALA B 154 ? 0.0966 0.0822 0.1055 -0.0070 0.0049  -0.0008 154 ALA B CA  
2829 C  C   . ALA B 154 ? 0.0912 0.0723 0.1088 -0.0073 0.0084  -0.0012 154 ALA B C   
2830 O  O   . ALA B 154 ? 0.0930 0.0739 0.1202 -0.0121 0.0084  0.0000  154 ALA B O   
2831 C  CB  . ALA B 154 ? 0.0903 0.0717 0.0976 -0.0056 0.0096  -0.0070 154 ALA B CB  
2832 N  N   . ILE B 155 ? 0.0994 0.0768 0.1102 -0.0039 0.0046  0.0003  155 ILE B N   
2833 C  CA  . ILE B 155 ? 0.0860 0.0606 0.0965 -0.0077 0.0042  -0.0012 155 ILE B CA  
2834 C  C   . ILE B 155 ? 0.0847 0.0606 0.0933 -0.0055 0.0045  -0.0017 155 ILE B C   
2835 O  O   . ILE B 155 ? 0.0849 0.0575 0.0988 -0.0168 0.0085  -0.0086 155 ILE B O   
2836 C  CB  . ILE B 155 ? 0.0994 0.0703 0.0994 -0.0051 0.0034  -0.0023 155 ILE B CB  
2837 C  CG1 . ILE B 155 ? 0.0954 0.0821 0.0922 0.0029  -0.0015 -0.0020 155 ILE B CG1 
2838 C  CG2 . ILE B 155 ? 0.0741 0.0582 0.1026 -0.0171 0.0086  -0.0005 155 ILE B CG2 
2839 C  CD1 . ILE B 155 ? 0.0613 0.0998 0.0979 0.0076  0.0065  -0.0140 155 ILE B CD1 
2840 N  N   . SER B 156 ? 0.0791 0.0464 0.0757 -0.0140 -0.0044 -0.0041 156 SER B N   
2841 C  CA  . SER B 156 ? 0.0726 0.0583 0.0709 -0.0087 0.0002  0.0000  156 SER B CA  
2842 C  C   . SER B 156 ? 0.0681 0.0490 0.0660 -0.0078 0.0025  -0.0027 156 SER B C   
2843 O  O   . SER B 156 ? 0.0726 0.0360 0.0365 -0.0104 -0.0002 -0.0008 156 SER B O   
2844 C  CB  . SER B 156 ? 0.0687 0.0515 0.0775 -0.0131 -0.0022 0.0024  156 SER B CB  
2845 O  OG  . SER B 156 ? 0.0595 0.0804 0.0921 -0.0078 -0.0013 -0.0095 156 SER B OG  
2846 N  N   . GLY B 157 ? 0.0670 0.0554 0.0673 -0.0057 0.0083  0.0035  157 GLY B N   
2847 C  CA  . GLY B 157 ? 0.0820 0.0702 0.0805 -0.0023 0.0036  -0.0026 157 GLY B CA  
2848 C  C   . GLY B 157 ? 0.0796 0.0702 0.0780 -0.0054 0.0033  -0.0031 157 GLY B C   
2849 O  O   . GLY B 157 ? 0.0884 0.0568 0.0792 -0.0027 0.0107  0.0086  157 GLY B O   
2850 N  N   . ALA B 158 ? 0.0788 0.0673 0.0811 -0.0075 0.0073  -0.0038 158 ALA B N   
2851 C  CA  . ALA B 158 ? 0.0829 0.0750 0.0855 -0.0112 0.0038  -0.0006 158 ALA B CA  
2852 C  C   . ALA B 158 ? 0.0802 0.0721 0.0904 -0.0105 0.0004  0.0003  158 ALA B C   
2853 O  O   . ALA B 158 ? 0.0852 0.0817 0.0977 -0.0097 -0.0021 0.0075  158 ALA B O   
2854 C  CB  . ALA B 158 ? 0.0892 0.0789 0.0860 -0.0095 0.0046  -0.0058 158 ALA B CB  
2855 N  N   . SER B 159 ? 0.0782 0.0666 0.0925 -0.0103 0.0049  0.0021  159 SER B N   
2856 C  CA  . SER B 159 ? 0.0745 0.0741 0.0993 -0.0039 0.0021  0.0000  159 SER B CA  
2857 C  C   . SER B 159 ? 0.0766 0.0818 0.0983 -0.0028 0.0045  0.0017  159 SER B C   
2858 O  O   . SER B 159 ? 0.0787 0.0957 0.1017 -0.0047 0.0143  0.0032  159 SER B O   
2859 C  CB  . SER B 159 ? 0.0761 0.0718 0.1009 -0.0037 0.0042  -0.0010 159 SER B CB  
2860 O  OG  . SER B 159 ? 0.0881 0.1050 0.1217 0.0054  -0.0011 -0.0031 159 SER B OG  
2861 N  N   . GLY B 160 ? 0.0862 0.0851 0.1038 0.0003  0.0053  0.0061  160 GLY B N   
2862 C  CA  . GLY B 160 ? 0.0770 0.0803 0.1073 0.0053  0.0007  0.0081  160 GLY B CA  
2863 C  C   . GLY B 160 ? 0.0844 0.0841 0.1093 0.0023  0.0021  0.0057  160 GLY B C   
2864 O  O   . GLY B 160 ? 0.0729 0.0742 0.1130 0.0025  0.0047  0.0149  160 GLY B O   
2865 N  N   . PHE B 161 ? 0.0796 0.0802 0.1097 0.0022  0.0000  0.0041  161 PHE B N   
2866 C  CA  . PHE B 161 ? 0.0814 0.0848 0.1004 0.0051  0.0038  -0.0043 161 PHE B CA  
2867 C  C   . PHE B 161 ? 0.0819 0.0792 0.0902 -0.0020 0.0014  0.0002  161 PHE B C   
2868 O  O   . PHE B 161 ? 0.0853 0.0738 0.0894 -0.0031 -0.0027 -0.0018 161 PHE B O   
2869 C  CB  . PHE B 161 ? 0.0936 0.0907 0.1069 0.0052  0.0064  -0.0057 161 PHE B CB  
2870 C  CG  . PHE B 161 ? 0.0842 0.0851 0.1010 0.0094  0.0067  -0.0061 161 PHE B CG  
2871 C  CD1 . PHE B 161 ? 0.1038 0.1049 0.0832 -0.0069 0.0066  -0.0060 161 PHE B CD1 
2872 C  CD2 . PHE B 161 ? 0.0658 0.0741 0.0829 -0.0009 0.0102  -0.0099 161 PHE B CD2 
2873 C  CE1 . PHE B 161 ? 0.0990 0.0850 0.1114 -0.0100 -0.0040 -0.0084 161 PHE B CE1 
2874 C  CE2 . PHE B 161 ? 0.0749 0.0920 0.1058 -0.0033 0.0041  -0.0045 161 PHE B CE2 
2875 C  CZ  . PHE B 161 ? 0.0871 0.0957 0.1208 -0.0074 0.0038  0.0016  161 PHE B CZ  
2876 N  N   . PRO B 162 ? 0.0819 0.0797 0.0871 -0.0015 -0.0007 -0.0067 162 PRO B N   
2877 C  CA  . PRO B 162 ? 0.0732 0.0818 0.0816 -0.0038 0.0005  -0.0019 162 PRO B CA  
2878 C  C   . PRO B 162 ? 0.0780 0.0917 0.0830 -0.0029 0.0016  0.0000  162 PRO B C   
2879 O  O   . PRO B 162 ? 0.0705 0.1013 0.0943 -0.0036 0.0047  0.0013  162 PRO B O   
2880 C  CB  . PRO B 162 ? 0.0749 0.0795 0.0736 -0.0066 0.0016  -0.0039 162 PRO B CB  
2881 C  CG  . PRO B 162 ? 0.0761 0.0782 0.0893 -0.0016 -0.0042 -0.0044 162 PRO B CG  
2882 C  CD  . PRO B 162 ? 0.0835 0.0733 0.0805 -0.0043 0.0017  0.0005  162 PRO B CD  
2883 N  N   . ILE B 163 ? 0.0672 0.0945 0.0835 0.0001  0.0009  0.0072  163 ILE B N   
2884 C  CA  . ILE B 163 ? 0.0754 0.0853 0.0857 -0.0051 -0.0029 0.0081  163 ILE B CA  
2885 C  C   . ILE B 163 ? 0.0746 0.0865 0.0868 -0.0051 0.0011  0.0024  163 ILE B C   
2886 O  O   . ILE B 163 ? 0.0753 0.0843 0.0861 -0.0144 0.0017  0.0114  163 ILE B O   
2887 C  CB  . ILE B 163 ? 0.0752 0.1008 0.0916 -0.0033 -0.0025 0.0071  163 ILE B CB  
2888 C  CG1 . ILE B 163 ? 0.1061 0.1037 0.1073 -0.0051 0.0045  0.0120  163 ILE B CG1 
2889 C  CG2 . ILE B 163 ? 0.0718 0.0865 0.0812 -0.0067 -0.0102 0.0135  163 ILE B CG2 
2890 C  CD1 . ILE B 163 ? 0.1083 0.1150 0.1132 0.0072  -0.0070 0.0019  163 ILE B CD1 
2891 N  N   . MET B 164 ? 0.0662 0.0790 0.0843 -0.0060 -0.0008 0.0034  164 MET B N   
2892 C  CA  . MET B 164 ? 0.0556 0.0730 0.0727 -0.0028 -0.0040 -0.0065 164 MET B CA  
2893 C  C   . MET B 164 ? 0.0549 0.0678 0.0721 -0.0038 -0.0030 0.0004  164 MET B C   
2894 O  O   . MET B 164 ? 0.0385 0.0555 0.0710 -0.0073 -0.0216 -0.0053 164 MET B O   
2895 C  CB  . MET B 164 ? 0.0584 0.0891 0.0863 -0.0002 0.0010  -0.0061 164 MET B CB  
2896 C  CG  . MET B 164 ? 0.0787 0.1024 0.1050 -0.0069 0.0028  -0.0106 164 MET B CG  
2897 S  SD  . MET B 164 ? 0.0500 0.1110 0.0957 -0.0249 -0.0029 0.0165  164 MET B SD  
2898 C  CE  . MET B 164 ? 0.0873 0.1067 0.0888 -0.0078 0.0017  0.0042  164 MET B CE  
2899 N  N   . GLY B 165 ? 0.0358 0.0499 0.0597 -0.0019 0.0000  -0.0065 165 GLY B N   
2900 C  CA  . GLY B 165 ? 0.0314 0.0533 0.0574 -0.0083 0.0030  0.0025  165 GLY B CA  
2901 C  C   . GLY B 165 ? 0.0377 0.0644 0.0570 -0.0057 0.0034  -0.0003 165 GLY B C   
2902 O  O   . GLY B 165 ? 0.0468 0.0502 0.0706 -0.0052 0.0111  0.0033  165 GLY B O   
2903 N  N   . LEU B 166 ? 0.0263 0.0580 0.0488 -0.0041 0.0017  -0.0029 166 LEU B N   
2904 C  CA  . LEU B 166 ? 0.0334 0.0572 0.0340 -0.0080 -0.0053 0.0030  166 LEU B CA  
2905 C  C   . LEU B 166 ? 0.0364 0.0569 0.0329 -0.0084 -0.0036 0.0006  166 LEU B C   
2906 O  O   . LEU B 166 ? 0.0400 0.0712 0.0184 -0.0188 -0.0051 0.0082  166 LEU B O   
2907 C  CB  . LEU B 166 ? 0.0343 0.0490 0.0257 -0.0104 0.0059  0.0038  166 LEU B CB  
2908 C  CG  . LEU B 166 ? 0.0502 0.0526 0.0209 -0.0213 0.0000  0.0112  166 LEU B CG  
2909 C  CD1 . LEU B 166 ? 0.0116 0.0549 0.0189 -0.0160 -0.0025 0.0073  166 LEU B CD1 
2910 C  CD2 . LEU B 166 ? 0.0340 0.0269 0.0113 -0.0238 -0.0117 0.0101  166 LEU B CD2 
2911 N  N   . ASP B 167 ? 0.0319 0.0395 0.0183 -0.0112 -0.0059 0.0017  167 ASP B N   
2912 C  CA  . ASP B 167 ? 0.0207 0.0234 0.0191 -0.0083 0.0006  -0.0073 167 ASP B CA  
2913 C  C   . ASP B 167 ? 0.0230 0.0241 0.0203 -0.0109 0.0057  -0.0016 167 ASP B C   
2914 O  O   . ASP B 167 ? 0.0082 0.0316 0.0206 -0.0065 0.0036  -0.0169 167 ASP B O   
2915 C  CB  . ASP B 167 ? 0.0250 0.0298 0.0083 -0.0125 0.0034  -0.0068 167 ASP B CB  
2916 C  CG  . ASP B 167 ? 0.0230 0.0201 0.0113 -0.0010 0.0025  -0.0081 167 ASP B CG  
2917 O  OD1 . ASP B 167 ? 0.0179 0.0158 0.0075 -0.0105 0.0038  -0.0034 167 ASP B OD1 
2918 O  OD2 . ASP B 167 ? 0.0145 0.0241 0.0325 -0.0112 0.0041  0.0017  167 ASP B OD2 
2919 N  N   . VAL B 168 ? 0.0177 0.0230 0.0228 -0.0120 0.0015  -0.0042 168 VAL B N   
2920 C  CA  . VAL B 168 ? 0.0250 0.0199 0.0106 -0.0159 -0.0001 0.0000  168 VAL B CA  
2921 C  C   . VAL B 168 ? 0.0271 0.0148 0.0184 -0.0132 -0.0003 -0.0011 168 VAL B C   
2922 O  O   . VAL B 168 ? 0.0388 0.0251 0.0108 -0.0247 -0.0014 0.0011  168 VAL B O   
2923 C  CB  . VAL B 168 ? 0.0240 0.0148 0.0127 -0.0121 -0.0078 0.0060  168 VAL B CB  
2924 C  CG1 . VAL B 168 ? 0.0270 0.0288 0.0076 -0.0215 -0.0053 0.0055  168 VAL B CG1 
2925 C  CG2 . VAL B 168 ? 0.0450 0.0232 0.0240 -0.0221 -0.0043 -0.0059 168 VAL B CG2 
2926 N  N   . TRP B 169 ? 0.0223 0.0206 0.0219 -0.0105 0.0016  0.0011  169 TRP B N   
2927 C  CA  . TRP B 169 ? 0.0129 0.0161 0.0183 -0.0061 0.0030  0.0008  169 TRP B CA  
2928 C  C   . TRP B 169 ? 0.0121 0.0216 0.0249 -0.0067 0.0013  0.0021  169 TRP B C   
2929 O  O   . TRP B 169 ? 0.0122 0.0115 0.0330 -0.0044 0.0018  0.0054  169 TRP B O   
2930 C  CB  . TRP B 169 ? 0.0169 0.0233 0.0247 -0.0049 -0.0042 -0.0007 169 TRP B CB  
2931 C  CG  . TRP B 169 ? 0.0199 0.0287 0.0127 -0.0047 0.0072  0.0012  169 TRP B CG  
2932 C  CD1 . TRP B 169 ? 0.0369 0.0419 0.0301 -0.0014 0.0117  -0.0141 169 TRP B CD1 
2933 C  CD2 . TRP B 169 ? 0.0118 0.0275 0.0154 -0.0107 0.0069  -0.0137 169 TRP B CD2 
2934 N  NE1 . TRP B 169 ? 0.0158 0.0367 0.0124 -0.0138 -0.0002 0.0082  169 TRP B NE1 
2935 C  CE2 . TRP B 169 ? 0.0110 0.0077 0.0202 -0.0025 0.0081  -0.0044 169 TRP B CE2 
2936 C  CE3 . TRP B 169 ? 0.0190 0.0202 0.0091 -0.0133 0.0059  -0.0062 169 TRP B CE3 
2937 C  CZ2 . TRP B 169 ? 0.0165 0.0107 0.0064 -0.0066 0.0008  -0.0005 169 TRP B CZ2 
2938 C  CZ3 . TRP B 169 ? 0.0315 0.0298 0.0135 -0.0223 0.0130  -0.0102 169 TRP B CZ3 
2939 C  CH2 . TRP B 169 ? 0.0140 0.0107 0.0156 -0.0058 0.0084  -0.0063 169 TRP B CH2 
2940 N  N   . GLU B 170 ? 0.0240 0.0244 0.0205 -0.0064 0.0077  -0.0028 170 GLU B N   
2941 C  CA  . GLU B 170 ? 0.0232 0.0260 0.0228 -0.0143 0.0060  0.0052  170 GLU B CA  
2942 C  C   . GLU B 170 ? 0.0306 0.0358 0.0204 -0.0160 0.0122  0.0042  170 GLU B C   
2943 O  O   . GLU B 170 ? 0.0283 0.0402 0.0187 -0.0178 0.0084  0.0064  170 GLU B O   
2944 C  CB  . GLU B 170 ? 0.0268 0.0308 0.0123 -0.0141 0.0081  0.0004  170 GLU B CB  
2945 C  CG  . GLU B 170 ? 0.0277 0.0127 0.0113 -0.0079 -0.0017 0.0047  170 GLU B CG  
2946 C  CD  . GLU B 170 ? 0.0185 0.0232 0.0171 -0.0143 -0.0001 0.0002  170 GLU B CD  
2947 O  OE1 . GLU B 170 ? 0.0316 0.0138 0.0175 -0.0135 0.0084  -0.0030 170 GLU B OE1 
2948 O  OE2 . GLU B 170 ? 0.0276 0.0364 0.0283 -0.0169 0.0066  -0.0235 170 GLU B OE2 
2949 N  N   . HIS B 171 ? 0.0302 0.0334 0.0211 -0.0214 0.0058  0.0050  171 HIS B N   
2950 C  CA  . HIS B 171 ? 0.0283 0.0369 0.0247 -0.0240 0.0065  0.0000  171 HIS B CA  
2951 C  C   . HIS B 171 ? 0.0389 0.0397 0.0343 -0.0150 0.0089  -0.0012 171 HIS B C   
2952 O  O   . HIS B 171 ? 0.0453 0.0507 0.0327 -0.0254 0.0120  -0.0057 171 HIS B O   
2953 C  CB  . HIS B 171 ? 0.0340 0.0273 0.0140 -0.0156 0.0110  0.0001  171 HIS B CB  
2954 C  CG  . HIS B 171 ? 0.0252 0.0288 0.0158 -0.0202 0.0076  -0.0056 171 HIS B CG  
2955 N  ND1 . HIS B 171 ? 0.0138 0.0341 0.0066 -0.0115 -0.0012 0.0009  171 HIS B ND1 
2956 C  CD2 . HIS B 171 ? 0.0354 0.0232 0.0063 -0.0221 0.0008  -0.0006 171 HIS B CD2 
2957 C  CE1 . HIS B 171 ? 0.0341 0.0349 0.0085 -0.0148 -0.0057 -0.0017 171 HIS B CE1 
2958 N  NE2 . HIS B 171 ? 0.0456 0.0284 0.0165 -0.0192 0.0016  0.0077  171 HIS B NE2 
2959 N  N   . ALA B 172 ? 0.0401 0.0494 0.0260 -0.0150 0.0093  -0.0029 172 ALA B N   
2960 C  CA  . ALA B 172 ? 0.0384 0.0453 0.0280 -0.0148 0.0019  -0.0023 172 ALA B CA  
2961 C  C   . ALA B 172 ? 0.0353 0.0506 0.0243 -0.0143 0.0029  0.0018  172 ALA B C   
2962 O  O   . ALA B 172 ? 0.0388 0.0520 0.0241 -0.0249 0.0074  0.0114  172 ALA B O   
2963 C  CB  . ALA B 172 ? 0.0519 0.0634 0.0372 -0.0027 0.0076  0.0020  172 ALA B CB  
2964 N  N   . TYR B 173 ? 0.0316 0.0406 0.0252 -0.0191 0.0001  -0.0056 173 TYR B N   
2965 C  CA  . TYR B 173 ? 0.0404 0.0461 0.0302 -0.0240 -0.0027 -0.0056 173 TYR B CA  
2966 C  C   . TYR B 173 ? 0.0419 0.0512 0.0325 -0.0187 0.0000  -0.0022 173 TYR B C   
2967 O  O   . TYR B 173 ? 0.0438 0.0411 0.0276 -0.0329 -0.0003 -0.0109 173 TYR B O   
2968 C  CB  . TYR B 173 ? 0.0441 0.0509 0.0400 -0.0182 0.0002  -0.0097 173 TYR B CB  
2969 C  CG  . TYR B 173 ? 0.0458 0.0501 0.0346 -0.0248 0.0054  -0.0193 173 TYR B CG  
2970 C  CD1 . TYR B 173 ? 0.0364 0.0455 0.0262 -0.0177 0.0115  -0.0090 173 TYR B CD1 
2971 C  CD2 . TYR B 173 ? 0.0610 0.0473 0.0593 -0.0251 0.0060  0.0010  173 TYR B CD2 
2972 C  CE1 . TYR B 173 ? 0.0330 0.0545 0.0345 -0.0246 0.0044  -0.0168 173 TYR B CE1 
2973 C  CE2 . TYR B 173 ? 0.0457 0.0722 0.0399 -0.0055 -0.0027 -0.0044 173 TYR B CE2 
2974 C  CZ  . TYR B 173 ? 0.0554 0.0631 0.0622 -0.0159 0.0116  -0.0100 173 TYR B CZ  
2975 O  OH  . TYR B 173 ? 0.0430 0.0233 0.0063 -0.0250 -0.0009 0.0006  173 TYR B OH  
2976 N  N   . TYR B 174 ? 0.0260 0.0458 0.0303 -0.0274 0.0057  -0.0024 174 TYR B N   
2977 C  CA  . TYR B 174 ? 0.0324 0.0361 0.0291 -0.0237 0.0030  -0.0024 174 TYR B CA  
2978 C  C   . TYR B 174 ? 0.0443 0.0373 0.0290 -0.0232 0.0059  -0.0071 174 TYR B C   
2979 O  O   . TYR B 174 ? 0.0499 0.0615 0.0385 -0.0305 0.0019  -0.0173 174 TYR B O   
2980 C  CB  . TYR B 174 ? 0.0350 0.0322 0.0301 -0.0238 0.0080  0.0048  174 TYR B CB  
2981 C  CG  . TYR B 174 ? 0.0298 0.0284 0.0169 -0.0180 -0.0047 -0.0053 174 TYR B CG  
2982 C  CD1 . TYR B 174 ? 0.0367 0.0371 0.0086 -0.0306 0.0083  -0.0084 174 TYR B CD1 
2983 C  CD2 . TYR B 174 ? 0.0378 0.0423 0.0398 -0.0206 0.0025  -0.0140 174 TYR B CD2 
2984 C  CE1 . TYR B 174 ? 0.0161 0.0225 0.0086 -0.0126 0.0047  -0.0061 174 TYR B CE1 
2985 C  CE2 . TYR B 174 ? 0.0589 0.0385 0.0356 -0.0292 0.0114  -0.0086 174 TYR B CE2 
2986 C  CZ  . TYR B 174 ? 0.0319 0.0426 0.0194 -0.0287 0.0045  -0.0120 174 TYR B CZ  
2987 O  OH  . TYR B 174 ? 0.0408 0.0317 0.0192 -0.0295 0.0168  -0.0142 174 TYR B OH  
2988 N  N   . LEU B 175 ? 0.0544 0.0458 0.0259 -0.0219 0.0061  -0.0124 175 LEU B N   
2989 C  CA  . LEU B 175 ? 0.0524 0.0466 0.0265 -0.0238 0.0087  -0.0020 175 LEU B CA  
2990 C  C   . LEU B 175 ? 0.0443 0.0491 0.0322 -0.0213 0.0087  -0.0006 175 LEU B C   
2991 O  O   . LEU B 175 ? 0.0391 0.0356 0.0254 -0.0309 0.0031  -0.0019 175 LEU B O   
2992 C  CB  . LEU B 175 ? 0.0530 0.0478 0.0277 -0.0185 0.0146  -0.0002 175 LEU B CB  
2993 C  CG  . LEU B 175 ? 0.0566 0.0493 0.0346 -0.0146 0.0120  -0.0041 175 LEU B CG  
2994 C  CD1 . LEU B 175 ? 0.0811 0.0638 0.0278 -0.0206 0.0100  0.0040  175 LEU B CD1 
2995 C  CD2 . LEU B 175 ? 0.1018 0.0895 0.0832 0.0082  0.0049  -0.0029 175 LEU B CD2 
2996 N  N   . LYS B 176 ? 0.0361 0.0350 0.0258 -0.0266 0.0050  0.0050  176 LYS B N   
2997 C  CA  . LYS B 176 ? 0.0366 0.0420 0.0367 -0.0285 -0.0011 0.0001  176 LYS B CA  
2998 C  C   . LYS B 176 ? 0.0457 0.0485 0.0340 -0.0206 0.0008  -0.0032 176 LYS B C   
2999 O  O   . LYS B 176 ? 0.0480 0.0396 0.0334 -0.0363 -0.0024 -0.0046 176 LYS B O   
3000 C  CB  . LYS B 176 ? 0.0486 0.0526 0.0413 -0.0202 -0.0043 -0.0049 176 LYS B CB  
3001 C  CG  . LYS B 176 ? 0.0480 0.0693 0.0575 -0.0177 -0.0033 0.0048  176 LYS B CG  
3002 C  CD  . LYS B 176 ? 0.0693 0.0785 0.0692 -0.0139 -0.0034 -0.0010 176 LYS B CD  
3003 C  CE  . LYS B 176 ? 0.0743 0.0759 0.0641 -0.0052 -0.0007 0.0074  176 LYS B CE  
3004 N  NZ  . LYS B 176 ? 0.0443 0.1142 0.0296 -0.0164 0.0112  -0.0047 176 LYS B NZ  
3005 N  N   . PHE B 177 ? 0.0420 0.0518 0.0461 -0.0191 0.0059  -0.0029 177 PHE B N   
3006 C  CA  . PHE B 177 ? 0.0406 0.0583 0.0415 -0.0090 0.0056  -0.0014 177 PHE B CA  
3007 C  C   . PHE B 177 ? 0.0447 0.0584 0.0448 -0.0149 0.0077  -0.0010 177 PHE B C   
3008 O  O   . PHE B 177 ? 0.0602 0.0747 0.0421 -0.0188 0.0008  -0.0076 177 PHE B O   
3009 C  CB  . PHE B 177 ? 0.0409 0.0571 0.0419 -0.0125 0.0052  0.0052  177 PHE B CB  
3010 C  CG  . PHE B 177 ? 0.0474 0.0775 0.0473 -0.0111 0.0031  0.0025  177 PHE B CG  
3011 C  CD1 . PHE B 177 ? 0.0377 0.0690 0.0575 -0.0077 -0.0077 -0.0020 177 PHE B CD1 
3012 C  CD2 . PHE B 177 ? 0.0379 0.0529 0.0218 -0.0121 -0.0066 -0.0128 177 PHE B CD2 
3013 C  CE1 . PHE B 177 ? 0.0593 0.0564 0.0569 -0.0184 0.0005  -0.0119 177 PHE B CE1 
3014 C  CE2 . PHE B 177 ? 0.0578 0.0905 0.0607 -0.0095 -0.0047 -0.0015 177 PHE B CE2 
3015 C  CZ  . PHE B 177 ? 0.0480 0.0720 0.0750 -0.0115 0.0034  0.0111  177 PHE B CZ  
3016 N  N   . GLN B 178 ? 0.0425 0.0591 0.0420 -0.0129 0.0081  -0.0081 178 GLN B N   
3017 C  CA  . GLN B 178 ? 0.0403 0.0417 0.0440 -0.0191 0.0085  -0.0024 178 GLN B CA  
3018 C  C   . GLN B 178 ? 0.0471 0.0517 0.0460 -0.0181 0.0115  -0.0044 178 GLN B C   
3019 O  O   . GLN B 178 ? 0.0426 0.0530 0.0552 -0.0230 0.0151  -0.0086 178 GLN B O   
3020 C  CB  . GLN B 178 ? 0.0484 0.0474 0.0415 -0.0186 0.0092  0.0016  178 GLN B CB  
3021 C  CG  . GLN B 178 ? 0.0492 0.0300 0.0386 -0.0256 0.0105  -0.0025 178 GLN B CG  
3022 C  CD  . GLN B 178 ? 0.0600 0.0765 0.0306 -0.0386 0.0047  -0.0093 178 GLN B CD  
3023 O  OE1 . GLN B 178 ? 0.0694 0.1061 0.0490 -0.0413 -0.0210 -0.0058 178 GLN B OE1 
3024 N  NE2 . GLN B 178 ? 0.0601 0.0343 0.0360 -0.0329 0.0019  -0.0054 178 GLN B NE2 
3025 N  N   . ASN B 179 ? 0.0327 0.0490 0.0382 -0.0192 0.0108  -0.0080 179 ASN B N   
3026 C  CA  . ASN B 179 ? 0.0506 0.0663 0.0463 -0.0172 0.0082  -0.0068 179 ASN B CA  
3027 C  C   . ASN B 179 ? 0.0399 0.0600 0.0401 -0.0141 0.0076  -0.0127 179 ASN B C   
3028 O  O   . ASN B 179 ? 0.0342 0.0663 0.0261 -0.0204 0.0079  -0.0143 179 ASN B O   
3029 C  CB  . ASN B 179 ? 0.0481 0.0705 0.0431 -0.0034 0.0079  -0.0077 179 ASN B CB  
3030 C  CG  . ASN B 179 ? 0.0961 0.1072 0.0778 -0.0155 0.0009  -0.0080 179 ASN B CG  
3031 O  OD1 . ASN B 179 ? 0.1123 0.1452 0.1086 -0.0035 -0.0007 0.0168  179 ASN B OD1 
3032 N  ND2 . ASN B 179 ? 0.0655 0.1058 0.0290 -0.0207 0.0279  0.0033  179 ASN B ND2 
3033 N  N   . ARG B 180 ? 0.0361 0.0583 0.0504 -0.0241 0.0048  -0.0109 180 ARG B N   
3034 C  CA  . ARG B 180 ? 0.0456 0.0595 0.0546 -0.0195 0.0032  -0.0115 180 ARG B CA  
3035 C  C   . ARG B 180 ? 0.0418 0.0609 0.0565 -0.0166 0.0046  -0.0116 180 ARG B C   
3036 O  O   . ARG B 180 ? 0.0398 0.0641 0.0472 -0.0197 0.0087  -0.0114 180 ARG B O   
3037 C  CB  . ARG B 180 ? 0.0488 0.0697 0.0622 -0.0226 0.0085  -0.0123 180 ARG B CB  
3038 C  CG  . ARG B 180 ? 0.0657 0.0657 0.0682 -0.0163 -0.0031 -0.0026 180 ARG B CG  
3039 C  CD  . ARG B 180 ? 0.1062 0.0607 0.0693 -0.0217 -0.0056 -0.0139 180 ARG B CD  
3040 N  NE  . ARG B 180 ? 0.1071 0.1017 0.0713 -0.0180 -0.0053 -0.0163 180 ARG B NE  
3041 C  CZ  . ARG B 180 ? 0.1155 0.0968 0.0955 -0.0089 -0.0033 -0.0113 180 ARG B CZ  
3042 N  NH1 . ARG B 180 ? 0.1218 0.1102 0.1165 -0.0117 -0.0064 -0.0075 180 ARG B NH1 
3043 N  NH2 . ARG B 180 ? 0.1321 0.0925 0.1070 -0.0177 0.0129  -0.0208 180 ARG B NH2 
3044 N  N   . ARG B 181 ? 0.0378 0.0585 0.0506 -0.0183 0.0056  -0.0070 181 ARG B N   
3045 C  CA  . ARG B 181 ? 0.0304 0.0455 0.0435 -0.0212 0.0001  -0.0062 181 ARG B CA  
3046 C  C   . ARG B 181 ? 0.0346 0.0485 0.0378 -0.0169 -0.0010 0.0009  181 ARG B C   
3047 O  O   . ARG B 181 ? 0.0318 0.0303 0.0230 -0.0181 -0.0101 -0.0028 181 ARG B O   
3048 C  CB  . ARG B 181 ? 0.0135 0.0483 0.0402 -0.0173 -0.0002 -0.0045 181 ARG B CB  
3049 C  CG  . ARG B 181 ? 0.0414 0.0431 0.0399 -0.0316 -0.0039 -0.0128 181 ARG B CG  
3050 C  CD  . ARG B 181 ? 0.0184 0.0460 0.0284 -0.0202 0.0066  -0.0004 181 ARG B CD  
3051 N  NE  . ARG B 181 ? 0.0329 0.0439 0.0164 -0.0179 0.0107  -0.0194 181 ARG B NE  
3052 C  CZ  . ARG B 181 ? 0.0258 0.0208 0.0186 -0.0167 -0.0012 0.0001  181 ARG B CZ  
3053 N  NH1 . ARG B 181 ? 0.0311 0.0311 0.0778 -0.0140 -0.0020 -0.0004 181 ARG B NH1 
3054 N  NH2 . ARG B 181 ? 0.0331 0.0181 0.0476 -0.0152 0.0042  -0.0138 181 ARG B NH2 
3055 N  N   . PRO B 182 ? 0.0352 0.0559 0.0387 -0.0180 0.0010  0.0042  182 PRO B N   
3056 C  CA  . PRO B 182 ? 0.0403 0.0611 0.0426 -0.0142 0.0072  0.0070  182 PRO B CA  
3057 C  C   . PRO B 182 ? 0.0365 0.0593 0.0484 -0.0144 0.0027  -0.0003 182 PRO B C   
3058 O  O   . PRO B 182 ? 0.0274 0.0713 0.0582 -0.0248 0.0145  -0.0053 182 PRO B O   
3059 C  CB  . PRO B 182 ? 0.0416 0.0567 0.0303 -0.0043 0.0030  0.0069  182 PRO B CB  
3060 C  CG  . PRO B 182 ? 0.0390 0.0585 0.0434 -0.0120 0.0026  0.0122  182 PRO B CG  
3061 C  CD  . PRO B 182 ? 0.0367 0.0411 0.0384 -0.0192 -0.0011 0.0036  182 PRO B CD  
3062 N  N   . ASP B 183 ? 0.0476 0.0751 0.0536 -0.0132 0.0036  -0.0014 183 ASP B N   
3063 C  CA  . ASP B 183 ? 0.0444 0.0666 0.0472 -0.0113 0.0071  0.0010  183 ASP B CA  
3064 C  C   . ASP B 183 ? 0.0474 0.0753 0.0457 -0.0129 0.0014  0.0028  183 ASP B C   
3065 O  O   . ASP B 183 ? 0.0451 0.0801 0.0350 -0.0155 0.0138  0.0012  183 ASP B O   
3066 C  CB  . ASP B 183 ? 0.0535 0.0743 0.0488 -0.0087 0.0031  -0.0033 183 ASP B CB  
3067 C  CG  . ASP B 183 ? 0.0706 0.0646 0.0580 0.0023  0.0042  -0.0047 183 ASP B CG  
3068 O  OD1 . ASP B 183 ? 0.1087 0.0361 0.0772 -0.0327 0.0070  -0.0067 183 ASP B OD1 
3069 O  OD2 . ASP B 183 ? 0.0962 0.0845 0.0329 -0.0181 0.0048  -0.0057 183 ASP B OD2 
3070 N  N   . TYR B 184 ? 0.0480 0.0743 0.0324 -0.0251 0.0037  0.0025  184 TYR B N   
3071 C  CA  . TYR B 184 ? 0.0458 0.0703 0.0370 -0.0225 0.0048  0.0003  184 TYR B CA  
3072 C  C   . TYR B 184 ? 0.0466 0.0695 0.0392 -0.0185 0.0031  -0.0008 184 TYR B C   
3073 O  O   . TYR B 184 ? 0.0492 0.0651 0.0273 -0.0282 0.0019  -0.0102 184 TYR B O   
3074 C  CB  . TYR B 184 ? 0.0476 0.0772 0.0341 -0.0209 0.0030  0.0063  184 TYR B CB  
3075 C  CG  . TYR B 184 ? 0.0651 0.0669 0.0453 -0.0193 0.0027  -0.0007 184 TYR B CG  
3076 C  CD1 . TYR B 184 ? 0.0623 0.0946 0.0593 -0.0147 0.0065  0.0017  184 TYR B CD1 
3077 C  CD2 . TYR B 184 ? 0.0600 0.0847 0.0546 -0.0288 -0.0051 0.0050  184 TYR B CD2 
3078 C  CE1 . TYR B 184 ? 0.0647 0.0760 0.0476 -0.0203 -0.0027 0.0057  184 TYR B CE1 
3079 C  CE2 . TYR B 184 ? 0.0532 0.0769 0.0428 -0.0262 0.0082  0.0026  184 TYR B CE2 
3080 C  CZ  . TYR B 184 ? 0.0479 0.0645 0.0172 -0.0254 0.0044  -0.0026 184 TYR B CZ  
3081 O  OH  . TYR B 184 ? 0.0278 0.0415 0.0112 -0.0116 0.0074  -0.0017 184 TYR B OH  
3082 N  N   . ILE B 185 ? 0.0593 0.0655 0.0414 -0.0158 0.0018  0.0025  185 ILE B N   
3083 C  CA  . ILE B 185 ? 0.0639 0.0735 0.0614 -0.0168 0.0047  0.0052  185 ILE B CA  
3084 C  C   . ILE B 185 ? 0.0776 0.0829 0.0656 -0.0080 0.0020  0.0051  185 ILE B C   
3085 O  O   . ILE B 185 ? 0.0876 0.0856 0.0670 -0.0055 -0.0031 0.0043  185 ILE B O   
3086 C  CB  . ILE B 185 ? 0.0590 0.0760 0.0595 -0.0144 0.0110  0.0094  185 ILE B CB  
3087 C  CG1 . ILE B 185 ? 0.0375 0.0524 0.0362 -0.0332 0.0085  0.0081  185 ILE B CG1 
3088 C  CG2 . ILE B 185 ? 0.0667 0.0831 0.0822 -0.0191 0.0128  0.0052  185 ILE B CG2 
3089 C  CD1 . ILE B 185 ? 0.0576 0.0340 0.0394 -0.0252 0.0202  0.0096  185 ILE B CD1 
3090 N  N   . LYS B 186 ? 0.0846 0.0896 0.0704 -0.0118 -0.0009 0.0057  186 LYS B N   
3091 C  CA  . LYS B 186 ? 0.0822 0.0991 0.0822 -0.0078 0.0029  0.0056  186 LYS B CA  
3092 C  C   . LYS B 186 ? 0.0722 0.0895 0.0769 -0.0136 0.0004  0.0062  186 LYS B C   
3093 O  O   . LYS B 186 ? 0.0602 0.1143 0.0635 -0.0216 0.0084  0.0068  186 LYS B O   
3094 C  CB  . LYS B 186 ? 0.0949 0.1140 0.0983 -0.0039 -0.0034 0.0037  186 LYS B CB  
3095 C  CG  . LYS B 186 ? 0.1157 0.1399 0.1324 -0.0129 -0.0034 0.0068  186 LYS B CG  
3096 C  CD  . LYS B 186 ? 0.1497 0.1719 0.1657 0.0043  0.0005  -0.0014 186 LYS B CD  
3097 C  CE  . LYS B 186 ? 0.1659 0.1805 0.1886 -0.0060 -0.0048 0.0100  186 LYS B CE  
3098 N  NZ  . LYS B 186 ? 0.1919 0.1999 0.2096 -0.0005 -0.0084 0.0093  186 LYS B NZ  
3099 N  N   . GLU B 187 ? 0.0697 0.1003 0.0712 -0.0163 0.0034  0.0095  187 GLU B N   
3100 C  CA  . GLU B 187 ? 0.0552 0.0856 0.0642 -0.0148 0.0024  0.0112  187 GLU B CA  
3101 C  C   . GLU B 187 ? 0.0428 0.0828 0.0672 -0.0135 -0.0020 0.0083  187 GLU B C   
3102 O  O   . GLU B 187 ? 0.0135 0.0809 0.0353 -0.0232 -0.0020 0.0084  187 GLU B O   
3103 C  CB  . GLU B 187 ? 0.0695 0.0911 0.0769 -0.0073 0.0027  0.0103  187 GLU B CB  
3104 C  CG  . GLU B 187 ? 0.1021 0.1113 0.0848 -0.0051 -0.0020 0.0074  187 GLU B CG  
3105 C  CD  . GLU B 187 ? 0.1185 0.1405 0.1316 -0.0107 -0.0065 0.0006  187 GLU B CD  
3106 O  OE1 . GLU B 187 ? 0.1616 0.1662 0.1565 -0.0114 -0.0090 0.0000  187 GLU B OE1 
3107 O  OE2 . GLU B 187 ? 0.1135 0.1467 0.1408 -0.0228 -0.0134 -0.0082 187 GLU B OE2 
3108 N  N   . PHE B 188 ? 0.0308 0.0642 0.0569 -0.0190 -0.0057 0.0055  188 PHE B N   
3109 C  CA  . PHE B 188 ? 0.0408 0.0760 0.0725 -0.0150 0.0007  0.0008  188 PHE B CA  
3110 C  C   . PHE B 188 ? 0.0498 0.0739 0.0675 -0.0157 -0.0008 0.0053  188 PHE B C   
3111 O  O   . PHE B 188 ? 0.0504 0.0859 0.0680 -0.0189 0.0028  0.0055  188 PHE B O   
3112 C  CB  . PHE B 188 ? 0.0284 0.0674 0.0613 -0.0188 0.0009  0.0010  188 PHE B CB  
3113 C  CG  . PHE B 188 ? 0.0403 0.0895 0.0595 -0.0118 0.0012  -0.0005 188 PHE B CG  
3114 C  CD1 . PHE B 188 ? 0.0306 0.1140 0.0539 -0.0224 0.0086  -0.0018 188 PHE B CD1 
3115 C  CD2 . PHE B 188 ? 0.0589 0.0954 0.0738 -0.0112 -0.0029 0.0002  188 PHE B CD2 
3116 C  CE1 . PHE B 188 ? 0.0427 0.0776 0.0661 -0.0029 0.0088  0.0008  188 PHE B CE1 
3117 C  CE2 . PHE B 188 ? 0.0765 0.1164 0.0835 -0.0074 0.0100  0.0000  188 PHE B CE2 
3118 C  CZ  . PHE B 188 ? 0.0657 0.0951 0.0626 -0.0124 0.0009  0.0018  188 PHE B CZ  
3119 N  N   . TRP B 189 ? 0.0555 0.0760 0.0652 -0.0215 -0.0019 0.0051  189 TRP B N   
3120 C  CA  . TRP B 189 ? 0.0487 0.0770 0.0600 -0.0181 0.0021  0.0057  189 TRP B CA  
3121 C  C   . TRP B 189 ? 0.0479 0.0834 0.0547 -0.0139 -0.0025 0.0037  189 TRP B C   
3122 O  O   . TRP B 189 ? 0.0408 0.0812 0.0543 -0.0143 -0.0111 0.0010  189 TRP B O   
3123 C  CB  . TRP B 189 ? 0.0499 0.0803 0.0594 -0.0171 -0.0071 0.0085  189 TRP B CB  
3124 C  CG  . TRP B 189 ? 0.0448 0.0738 0.0601 -0.0089 -0.0027 0.0024  189 TRP B CG  
3125 C  CD1 . TRP B 189 ? 0.0684 0.0640 0.0724 -0.0073 -0.0008 0.0164  189 TRP B CD1 
3126 C  CD2 . TRP B 189 ? 0.0562 0.0779 0.0785 -0.0063 -0.0093 0.0042  189 TRP B CD2 
3127 N  NE1 . TRP B 189 ? 0.0658 0.0796 0.0846 -0.0163 -0.0212 0.0056  189 TRP B NE1 
3128 C  CE2 . TRP B 189 ? 0.0652 0.0722 0.0753 -0.0027 -0.0011 0.0069  189 TRP B CE2 
3129 C  CE3 . TRP B 189 ? 0.0752 0.0966 0.1010 -0.0028 -0.0018 -0.0018 189 TRP B CE3 
3130 C  CZ2 . TRP B 189 ? 0.0671 0.0672 0.0716 -0.0019 -0.0057 0.0039  189 TRP B CZ2 
3131 C  CZ3 . TRP B 189 ? 0.0612 0.0784 0.0679 -0.0070 -0.0055 0.0060  189 TRP B CZ3 
3132 C  CH2 . TRP B 189 ? 0.0539 0.0807 0.0613 0.0132  0.0033  0.0087  189 TRP B CH2 
3133 N  N   . ASN B 190 ? 0.0435 0.0801 0.0413 -0.0171 0.0000  0.0121  190 ASN B N   
3134 C  CA  . ASN B 190 ? 0.0617 0.0863 0.0541 -0.0154 0.0000  0.0135  190 ASN B CA  
3135 C  C   . ASN B 190 ? 0.0607 0.0884 0.0570 -0.0138 0.0017  0.0076  190 ASN B C   
3136 O  O   . ASN B 190 ? 0.0661 0.0901 0.0595 -0.0201 0.0091  0.0170  190 ASN B O   
3137 C  CB  . ASN B 190 ? 0.0691 0.0912 0.0579 -0.0092 -0.0030 0.0069  190 ASN B CB  
3138 C  CG  . ASN B 190 ? 0.1277 0.1084 0.0862 -0.0118 -0.0098 0.0077  190 ASN B CG  
3139 O  OD1 . ASN B 190 ? 0.1431 0.1108 0.1027 0.0115  -0.0193 0.0145  190 ASN B OD1 
3140 N  ND2 . ASN B 190 ? 0.1659 0.1461 0.1500 -0.0133 0.0023  0.0009  190 ASN B ND2 
3141 N  N   . VAL B 191 ? 0.0633 0.0802 0.0526 -0.0118 -0.0019 0.0067  191 VAL B N   
3142 C  CA  . VAL B 191 ? 0.0609 0.0682 0.0573 -0.0106 -0.0011 0.0086  191 VAL B CA  
3143 C  C   . VAL B 191 ? 0.0543 0.0701 0.0584 -0.0119 0.0002  0.0095  191 VAL B C   
3144 O  O   . VAL B 191 ? 0.0293 0.0718 0.0573 -0.0221 -0.0134 0.0139  191 VAL B O   
3145 C  CB  . VAL B 191 ? 0.0708 0.0786 0.0638 -0.0040 -0.0014 0.0012  191 VAL B CB  
3146 C  CG1 . VAL B 191 ? 0.0711 0.0703 0.0730 -0.0140 0.0057  0.0093  191 VAL B CG1 
3147 C  CG2 . VAL B 191 ? 0.0657 0.0629 0.0581 -0.0111 0.0028  0.0030  191 VAL B CG2 
3148 N  N   . VAL B 192 ? 0.0553 0.0616 0.0469 -0.0060 -0.0042 0.0184  192 VAL B N   
3149 C  CA  . VAL B 192 ? 0.0568 0.0536 0.0520 -0.0042 -0.0003 0.0163  192 VAL B CA  
3150 C  C   . VAL B 192 ? 0.0576 0.0636 0.0524 -0.0044 -0.0002 0.0184  192 VAL B C   
3151 O  O   . VAL B 192 ? 0.0576 0.0543 0.0347 0.0008  -0.0079 0.0233  192 VAL B O   
3152 C  CB  . VAL B 192 ? 0.0641 0.0561 0.0556 -0.0081 0.0012  0.0139  192 VAL B CB  
3153 C  CG1 . VAL B 192 ? 0.0755 0.0786 0.0771 0.0044  0.0002  0.0197  192 VAL B CG1 
3154 C  CG2 . VAL B 192 ? 0.0694 0.0425 0.0489 0.0021  -0.0128 0.0126  192 VAL B CG2 
3155 N  N   . ASN B 193 ? 0.0619 0.0642 0.0623 -0.0022 0.0078  0.0101  193 ASN B N   
3156 C  CA  . ASN B 193 ? 0.0611 0.0858 0.0653 -0.0078 0.0032  0.0123  193 ASN B CA  
3157 C  C   . ASN B 193 ? 0.0613 0.0883 0.0644 -0.0032 0.0064  0.0111  193 ASN B C   
3158 O  O   . ASN B 193 ? 0.0515 0.0839 0.0598 -0.0046 0.0053  0.0142  193 ASN B O   
3159 C  CB  . ASN B 193 ? 0.0625 0.0839 0.0627 -0.0133 0.0022  0.0050  193 ASN B CB  
3160 C  CG  . ASN B 193 ? 0.0720 0.0974 0.0716 -0.0132 0.0037  0.0101  193 ASN B CG  
3161 O  OD1 . ASN B 193 ? 0.0525 0.1184 0.0831 -0.0300 0.0025  0.0114  193 ASN B OD1 
3162 N  ND2 . ASN B 193 ? 0.0883 0.1134 0.0799 -0.0217 -0.0071 0.0181  193 ASN B ND2 
3163 N  N   . TRP B 194 ? 0.0656 0.0935 0.0826 -0.0004 0.0040  0.0106  194 TRP B N   
3164 C  CA  . TRP B 194 ? 0.0694 0.0795 0.0762 -0.0007 0.0032  0.0105  194 TRP B CA  
3165 C  C   . TRP B 194 ? 0.0766 0.0850 0.0799 -0.0017 0.0015  0.0084  194 TRP B C   
3166 O  O   . TRP B 194 ? 0.0672 0.0777 0.0659 0.0081  -0.0027 0.0115  194 TRP B O   
3167 C  CB  . TRP B 194 ? 0.0732 0.0862 0.0727 -0.0015 0.0010  0.0065  194 TRP B CB  
3168 C  CG  . TRP B 194 ? 0.0667 0.0806 0.0806 0.0018  0.0095  0.0081  194 TRP B CG  
3169 C  CD1 . TRP B 194 ? 0.0761 0.1067 0.0817 -0.0104 0.0093  0.0144  194 TRP B CD1 
3170 C  CD2 . TRP B 194 ? 0.0864 0.0787 0.0822 -0.0040 0.0027  0.0040  194 TRP B CD2 
3171 N  NE1 . TRP B 194 ? 0.0889 0.0878 0.0741 -0.0006 0.0072  0.0071  194 TRP B NE1 
3172 C  CE2 . TRP B 194 ? 0.0771 0.1014 0.0573 -0.0117 0.0049  0.0109  194 TRP B CE2 
3173 C  CE3 . TRP B 194 ? 0.0893 0.1061 0.0798 -0.0140 -0.0032 0.0084  194 TRP B CE3 
3174 C  CZ2 . TRP B 194 ? 0.0566 0.0809 0.0675 -0.0040 0.0029  0.0064  194 TRP B CZ2 
3175 C  CZ3 . TRP B 194 ? 0.0676 0.1025 0.0729 -0.0022 -0.0054 0.0087  194 TRP B CZ3 
3176 C  CH2 . TRP B 194 ? 0.0670 0.1042 0.0625 -0.0099 0.0006  0.0018  194 TRP B CH2 
3177 N  N   . ASP B 195 ? 0.0857 0.0927 0.0867 0.0004  0.0038  0.0108  195 ASP B N   
3178 C  CA  . ASP B 195 ? 0.0891 0.0930 0.0938 -0.0014 0.0031  0.0055  195 ASP B CA  
3179 C  C   . ASP B 195 ? 0.0900 0.0944 0.0947 -0.0008 0.0024  0.0066  195 ASP B C   
3180 O  O   . ASP B 195 ? 0.0998 0.1081 0.0980 -0.0080 0.0043  0.0072  195 ASP B O   
3181 C  CB  . ASP B 195 ? 0.0929 0.0860 0.0927 0.0018  0.0082  0.0086  195 ASP B CB  
3182 C  CG  . ASP B 195 ? 0.0972 0.1019 0.1211 0.0013  0.0073  0.0101  195 ASP B CG  
3183 O  OD1 . ASP B 195 ? 0.1288 0.1534 0.1410 -0.0010 0.0122  0.0183  195 ASP B OD1 
3184 O  OD2 . ASP B 195 ? 0.0923 0.1201 0.1550 -0.0299 -0.0045 -0.0047 195 ASP B OD2 
3185 N  N   . GLU B 196 ? 0.0788 0.0962 0.0850 -0.0016 -0.0040 0.0031  196 GLU B N   
3186 C  CA  . GLU B 196 ? 0.0728 0.0840 0.0884 -0.0016 -0.0032 0.0064  196 GLU B CA  
3187 C  C   . GLU B 196 ? 0.0648 0.0792 0.0793 0.0008  -0.0033 0.0053  196 GLU B C   
3188 O  O   . GLU B 196 ? 0.0673 0.0632 0.0824 0.0034  0.0052  0.0143  196 GLU B O   
3189 C  CB  . GLU B 196 ? 0.0671 0.0899 0.0869 -0.0014 -0.0049 0.0025  196 GLU B CB  
3190 C  CG  . GLU B 196 ? 0.0614 0.0859 0.0871 -0.0046 -0.0152 0.0070  196 GLU B CG  
3191 C  CD  . GLU B 196 ? 0.0979 0.1211 0.1149 -0.0033 -0.0132 0.0003  196 GLU B CD  
3192 O  OE1 . GLU B 196 ? 0.1182 0.1128 0.1426 -0.0001 0.0112  -0.0002 196 GLU B OE1 
3193 O  OE2 . GLU B 196 ? 0.1265 0.1167 0.1312 -0.0121 -0.0137 -0.0028 196 GLU B OE2 
3194 N  N   . ALA B 197 ? 0.0670 0.0747 0.0871 0.0034  0.0028  0.0025  197 ALA B N   
3195 C  CA  . ALA B 197 ? 0.0753 0.0807 0.0884 -0.0002 0.0026  0.0028  197 ALA B CA  
3196 C  C   . ALA B 197 ? 0.0781 0.0829 0.0970 -0.0007 0.0019  -0.0028 197 ALA B C   
3197 O  O   . ALA B 197 ? 0.0852 0.1002 0.1276 0.0029  0.0027  -0.0013 197 ALA B O   
3198 C  CB  . ALA B 197 ? 0.0822 0.0833 0.0924 -0.0007 0.0028  0.0014  197 ALA B CB  
3199 N  N   . ALA B 198 ? 0.0762 0.0851 0.0990 -0.0005 0.0070  -0.0012 198 ALA B N   
3200 C  CA  . ALA B 198 ? 0.0745 0.0821 0.1007 -0.0021 0.0043  -0.0019 198 ALA B CA  
3201 C  C   . ALA B 198 ? 0.0843 0.0869 0.1100 -0.0011 0.0022  -0.0037 198 ALA B C   
3202 O  O   . ALA B 198 ? 0.0686 0.0810 0.1272 0.0016  0.0055  -0.0061 198 ALA B O   
3203 C  CB  . ALA B 198 ? 0.0754 0.0786 0.0963 -0.0052 0.0033  -0.0011 198 ALA B CB  
3204 N  N   . ALA B 199 ? 0.0801 0.0935 0.1018 -0.0001 0.0088  -0.0024 199 ALA B N   
3205 C  CA  . ALA B 199 ? 0.0955 0.0948 0.1080 -0.0017 0.0056  -0.0046 199 ALA B CA  
3206 C  C   . ALA B 199 ? 0.1043 0.1071 0.1140 -0.0015 0.0021  -0.0086 199 ALA B C   
3207 O  O   . ALA B 199 ? 0.1177 0.1162 0.1341 -0.0080 0.0033  -0.0138 199 ALA B O   
3208 C  CB  . ALA B 199 ? 0.0974 0.1003 0.1035 -0.0005 0.0079  -0.0084 199 ALA B CB  
3209 N  N   . ARG B 200 ? 0.1016 0.1087 0.1162 -0.0041 0.0056  -0.0098 200 ARG B N   
3210 C  CA  . ARG B 200 ? 0.1106 0.1164 0.1268 -0.0012 0.0076  -0.0032 200 ARG B CA  
3211 C  C   . ARG B 200 ? 0.1146 0.1225 0.1334 -0.0013 0.0073  -0.0051 200 ARG B C   
3212 O  O   . ARG B 200 ? 0.1342 0.1262 0.1386 0.0070  0.0183  -0.0118 200 ARG B O   
3213 C  CB  . ARG B 200 ? 0.1082 0.1087 0.1237 -0.0034 0.0054  -0.0017 200 ARG B CB  
3214 C  CG  . ARG B 200 ? 0.0960 0.0977 0.0963 -0.0020 0.0039  0.0023  200 ARG B CG  
3215 C  CD  . ARG B 200 ? 0.0771 0.0816 0.0997 -0.0127 0.0071  -0.0058 200 ARG B CD  
3216 N  NE  . ARG B 200 ? 0.0568 0.0892 0.1060 -0.0144 0.0152  0.0082  200 ARG B NE  
3217 C  CZ  . ARG B 200 ? 0.0701 0.0956 0.1039 -0.0075 0.0130  0.0111  200 ARG B CZ  
3218 N  NH1 . ARG B 200 ? 0.0681 0.0755 0.0961 0.0050  0.0292  0.0175  200 ARG B NH1 
3219 N  NH2 . ARG B 200 ? 0.0678 0.0964 0.1324 -0.0046 0.0170  -0.0031 200 ARG B NH2 
3220 N  N   . PHE B 201 ? 0.1246 0.1217 0.1365 0.0002  0.0100  -0.0006 201 PHE B N   
3221 C  CA  . PHE B 201 ? 0.1342 0.1263 0.1435 0.0050  0.0063  0.0016  201 PHE B CA  
3222 C  C   . PHE B 201 ? 0.1512 0.1300 0.1495 0.0046  0.0095  0.0003  201 PHE B C   
3223 O  O   . PHE B 201 ? 0.1628 0.1385 0.1592 0.0112  0.0095  -0.0006 201 PHE B O   
3224 C  CB  . PHE B 201 ? 0.1339 0.1214 0.1443 0.0038  0.0089  -0.0003 201 PHE B CB  
3225 C  CG  . PHE B 201 ? 0.1398 0.1306 0.1553 0.0023  0.0031  0.0087  201 PHE B CG  
3226 C  CD1 . PHE B 201 ? 0.1586 0.1426 0.1698 0.0021  0.0025  0.0107  201 PHE B CD1 
3227 C  CD2 . PHE B 201 ? 0.1514 0.1307 0.1489 0.0011  -0.0035 0.0008  201 PHE B CD2 
3228 C  CE1 . PHE B 201 ? 0.1586 0.1428 0.1676 0.0041  0.0012  0.0124  201 PHE B CE1 
3229 C  CE2 . PHE B 201 ? 0.1477 0.1403 0.1558 0.0083  -0.0005 0.0089  201 PHE B CE2 
3230 C  CZ  . PHE B 201 ? 0.1488 0.1495 0.1737 0.0013  0.0008  0.0042  201 PHE B CZ  
3231 N  N   . ALA B 202 ? 0.1717 0.1494 0.1576 0.0067  0.0067  -0.0035 202 ALA B N   
3232 C  CA  . ALA B 202 ? 0.1680 0.1411 0.1616 0.0066  0.0044  -0.0033 202 ALA B CA  
3233 C  C   . ALA B 202 ? 0.1763 0.1427 0.1655 0.0092  0.0001  -0.0032 202 ALA B C   
3234 O  O   . ALA B 202 ? 0.1925 0.1438 0.1728 0.0131  0.0013  -0.0010 202 ALA B O   
3235 C  CB  . ALA B 202 ? 0.1839 0.1469 0.1667 0.0061  0.0038  -0.0035 202 ALA B CB  
3236 N  N   . ALA B 203 ? 0.1688 0.1477 0.1684 0.0083  -0.0044 0.0024  203 ALA B N   
3237 C  CA  . ALA B 203 ? 0.1661 0.1478 0.1692 0.0037  -0.0008 -0.0004 203 ALA B CA  
3238 C  C   . ALA B 203 ? 0.1662 0.1514 0.1673 0.0014  -0.0030 0.0004  203 ALA B C   
3239 O  O   . ALA B 203 ? 0.1669 0.1621 0.1858 -0.0028 0.0022  -0.0018 203 ALA B O   
3240 C  CB  . ALA B 203 ? 0.1644 0.1467 0.1664 0.0025  -0.0005 0.0036  203 ALA B CB  
3241 N  N   . LYS B 204 ? 0.1678 0.1486 0.1624 0.0026  0.0042  0.0029  204 LYS B N   
3242 C  CA  . LYS B 204 ? 0.1595 0.1529 0.1645 -0.0008 0.0010  0.0016  204 LYS B CA  
3243 C  C   . LYS B 204 ? 0.1588 0.1587 0.1673 0.0013  0.0029  0.0022  204 LYS B C   
3244 O  O   . LYS B 204 ? 0.1730 0.1732 0.1870 -0.0026 0.0002  0.0029  204 LYS B O   
3245 C  CB  . LYS B 204 ? 0.1559 0.1528 0.1611 0.0019  0.0052  0.0015  204 LYS B CB  
3246 C  CG  . LYS B 204 ? 0.1530 0.1584 0.1559 -0.0036 -0.0007 -0.0013 204 LYS B CG  
3247 C  CD  . LYS B 204 ? 0.1723 0.1747 0.1897 0.0027  -0.0019 0.0035  204 LYS B CD  
3248 C  CE  . LYS B 204 ? 0.1941 0.1822 0.1745 -0.0013 -0.0115 0.0001  204 LYS B CE  
3249 N  NZ  . LYS B 204 ? 0.1971 0.1845 0.1905 0.0000  -0.0049 -0.0065 204 LYS B NZ  
3250 N  N   . LYS B 205 ? 0.1665 0.1685 0.1791 -0.0015 0.0014  -0.0001 205 LYS B N   
3251 C  CA  . LYS B 205 ? 0.1753 0.1742 0.1801 -0.0008 -0.0002 0.0002  205 LYS B CA  
3252 C  C   . LYS B 205 ? 0.1774 0.1766 0.1822 -0.0036 0.0029  0.0022  205 LYS B C   
3253 O  O   . LYS B 205 ? 0.1899 0.1916 0.1792 -0.0061 0.0072  -0.0060 205 LYS B O   
3254 C  CB  . LYS B 205 ? 0.1854 0.1745 0.1808 0.0038  0.0028  0.0001  205 LYS B CB  
3255 C  CG  . LYS B 205 ? 0.1800 0.1840 0.1926 -0.0057 0.0009  -0.0006 205 LYS B CG  
3256 C  CD  . LYS B 205 ? 0.1923 0.1948 0.1942 0.0018  -0.0009 -0.0101 205 LYS B CD  
3257 C  CE  . LYS B 205 ? 0.1616 0.2004 0.1909 0.0020  0.0013  -0.0088 205 LYS B CE  
3258 N  NZ  . LYS B 205 ? 0.1674 0.1899 0.1953 0.0099  0.0113  -0.0158 205 LYS B NZ  
3259 O  OXT . LYS B 205 ? 0.1913 0.1857 0.1932 -0.0040 0.0032  0.0015  205 LYS B OXT 
3260 N  N   . SER C 1   ? 0.1402 0.1294 0.1266 -0.0093 -0.0041 -0.0118 1   SER C N   
3261 C  CA  . SER C 1   ? 0.1158 0.1340 0.1105 -0.0002 -0.0017 -0.0029 1   SER C CA  
3262 C  C   . SER C 1   ? 0.1050 0.1114 0.0960 -0.0006 -0.0027 0.0029  1   SER C C   
3263 O  O   . SER C 1   ? 0.1053 0.1221 0.0970 0.0000  0.0040  0.0058  1   SER C O   
3264 C  CB  . SER C 1   ? 0.1393 0.1409 0.1254 -0.0007 -0.0073 -0.0031 1   SER C CB  
3265 O  OG  . SER C 1   ? 0.1545 0.2025 0.1642 0.0016  0.0034  0.0007  1   SER C OG  
3266 N  N   . TYR C 2   ? 0.0747 0.0972 0.0796 -0.0008 0.0048  0.0058  2   TYR C N   
3267 C  CA  . TYR C 2   ? 0.0729 0.0796 0.0654 -0.0006 0.0020  0.0014  2   TYR C CA  
3268 C  C   . TYR C 2   ? 0.0567 0.0728 0.0567 0.0011  0.0004  0.0031  2   TYR C C   
3269 O  O   . TYR C 2   ? 0.0474 0.0652 0.0458 -0.0070 -0.0091 0.0087  2   TYR C O   
3270 C  CB  . TYR C 2   ? 0.0713 0.0831 0.0600 0.0036  0.0028  0.0042  2   TYR C CB  
3271 C  CG  . TYR C 2   ? 0.0686 0.0702 0.0475 0.0008  0.0182  0.0007  2   TYR C CG  
3272 C  CD1 . TYR C 2   ? 0.0468 0.0478 0.0393 0.0029  0.0251  -0.0058 2   TYR C CD1 
3273 C  CD2 . TYR C 2   ? 0.0824 0.0797 0.0637 0.0117  0.0076  -0.0091 2   TYR C CD2 
3274 C  CE1 . TYR C 2   ? 0.0811 0.0678 0.0524 -0.0007 0.0055  -0.0068 2   TYR C CE1 
3275 C  CE2 . TYR C 2   ? 0.1026 0.0840 0.0847 0.0018  0.0058  -0.0017 2   TYR C CE2 
3276 C  CZ  . TYR C 2   ? 0.0814 0.0645 0.0666 -0.0021 0.0010  -0.0111 2   TYR C CZ  
3277 O  OH  . TYR C 2   ? 0.0590 0.0727 0.0773 -0.0044 0.0019  -0.0086 2   TYR C OH  
3278 N  N   . THR C 3   ? 0.0601 0.0819 0.0648 -0.0059 -0.0007 -0.0013 3   THR C N   
3279 C  CA  . THR C 3   ? 0.0769 0.0874 0.0754 -0.0020 0.0029  0.0014  3   THR C CA  
3280 C  C   . THR C 3   ? 0.0651 0.0760 0.0673 -0.0009 0.0003  -0.0002 3   THR C C   
3281 O  O   . THR C 3   ? 0.0816 0.0874 0.0778 0.0000  -0.0040 0.0034  3   THR C O   
3282 C  CB  . THR C 3   ? 0.0719 0.0775 0.0785 -0.0034 -0.0005 0.0027  3   THR C CB  
3283 O  OG1 . THR C 3   ? 0.1052 0.1193 0.0956 0.0131  0.0148  0.0020  3   THR C OG1 
3284 C  CG2 . THR C 3   ? 0.0957 0.1001 0.0953 0.0021  -0.0041 0.0022  3   THR C CG2 
3285 N  N   . LEU C 4   ? 0.0499 0.0687 0.0572 0.0013  -0.0022 0.0063  4   LEU C N   
3286 C  CA  . LEU C 4   ? 0.0492 0.0679 0.0480 -0.0022 -0.0012 0.0034  4   LEU C CA  
3287 C  C   . LEU C 4   ? 0.0562 0.0699 0.0544 -0.0058 -0.0018 0.0063  4   LEU C C   
3288 O  O   . LEU C 4   ? 0.0539 0.0768 0.0352 -0.0155 -0.0073 0.0147  4   LEU C O   
3289 C  CB  . LEU C 4   ? 0.0365 0.0553 0.0377 0.0029  0.0019  -0.0048 4   LEU C CB  
3290 C  CG  . LEU C 4   ? 0.0575 0.0519 0.0408 -0.0025 -0.0004 0.0028  4   LEU C CG  
3291 C  CD1 . LEU C 4   ? 0.0627 0.0646 0.0769 -0.0021 -0.0067 -0.0115 4   LEU C CD1 
3292 C  CD2 . LEU C 4   ? 0.0232 0.0366 0.0528 0.0056  0.0249  -0.0040 4   LEU C CD2 
3293 N  N   . PRO C 5   ? 0.0690 0.0814 0.0682 -0.0056 -0.0040 0.0064  5   PRO C N   
3294 C  CA  . PRO C 5   ? 0.0741 0.0868 0.0795 -0.0011 -0.0013 0.0050  5   PRO C CA  
3295 C  C   . PRO C 5   ? 0.0787 0.0864 0.0874 -0.0018 -0.0014 0.0047  5   PRO C C   
3296 O  O   . PRO C 5   ? 0.0759 0.0992 0.1032 0.0084  0.0009  0.0113  5   PRO C O   
3297 C  CB  . PRO C 5   ? 0.0687 0.0851 0.0782 -0.0021 -0.0041 0.0036  5   PRO C CB  
3298 C  CG  . PRO C 5   ? 0.0900 0.0930 0.0890 0.0014  -0.0020 0.0039  5   PRO C CG  
3299 C  CD  . PRO C 5   ? 0.0755 0.0898 0.0704 -0.0025 -0.0030 0.0040  5   PRO C CD  
3300 N  N   . SER C 6   ? 0.0863 0.0905 0.0927 0.0015  -0.0036 0.0023  6   SER C N   
3301 C  CA  . SER C 6   ? 0.0981 0.1073 0.1093 0.0011  -0.0095 0.0008  6   SER C CA  
3302 C  C   . SER C 6   ? 0.1016 0.1109 0.1101 0.0010  -0.0057 0.0029  6   SER C C   
3303 O  O   . SER C 6   ? 0.1001 0.1160 0.1107 0.0052  -0.0069 0.0023  6   SER C O   
3304 C  CB  . SER C 6   ? 0.1057 0.1081 0.1142 0.0007  -0.0114 0.0019  6   SER C CB  
3305 O  OG  . SER C 6   ? 0.1324 0.1418 0.1519 0.0109  -0.0146 -0.0068 6   SER C OG  
3306 N  N   . LEU C 7   ? 0.1032 0.1273 0.1112 0.0002  -0.0044 0.0032  7   LEU C N   
3307 C  CA  . LEU C 7   ? 0.1111 0.1286 0.1179 -0.0030 -0.0018 0.0064  7   LEU C CA  
3308 C  C   . LEU C 7   ? 0.1033 0.1304 0.1082 -0.0028 -0.0036 0.0081  7   LEU C C   
3309 O  O   . LEU C 7   ? 0.1078 0.1467 0.1166 -0.0053 -0.0099 0.0166  7   LEU C O   
3310 C  CB  . LEU C 7   ? 0.1105 0.1391 0.1181 -0.0041 0.0048  0.0089  7   LEU C CB  
3311 C  CG  . LEU C 7   ? 0.1314 0.1441 0.1316 -0.0034 -0.0005 0.0082  7   LEU C CG  
3312 C  CD1 . LEU C 7   ? 0.1229 0.1690 0.1568 -0.0119 -0.0011 0.0046  7   LEU C CD1 
3313 C  CD2 . LEU C 7   ? 0.1367 0.1617 0.1359 -0.0046 -0.0110 0.0057  7   LEU C CD2 
3314 N  N   . PRO C 8   ? 0.1064 0.1283 0.1129 -0.0018 -0.0040 0.0140  8   PRO C N   
3315 C  CA  . PRO C 8   ? 0.1020 0.1259 0.1103 0.0006  0.0006  0.0111  8   PRO C CA  
3316 C  C   . PRO C 8   ? 0.0968 0.1263 0.1083 0.0006  0.0006  0.0129  8   PRO C C   
3317 O  O   . PRO C 8   ? 0.1174 0.1640 0.1340 -0.0039 0.0053  0.0138  8   PRO C O   
3318 C  CB  . PRO C 8   ? 0.1047 0.1267 0.1126 -0.0004 0.0006  0.0133  8   PRO C CB  
3319 C  CG  . PRO C 8   ? 0.0962 0.1227 0.1080 -0.0033 0.0049  0.0077  8   PRO C CG  
3320 C  CD  . PRO C 8   ? 0.0983 0.1226 0.1037 -0.0034 -0.0028 0.0085  8   PRO C CD  
3321 N  N   . TYR C 9   ? 0.0895 0.1323 0.1029 -0.0059 -0.0007 0.0094  9   TYR C N   
3322 C  CA  . TYR C 9   ? 0.0829 0.1135 0.0882 -0.0066 -0.0018 0.0100  9   TYR C CA  
3323 C  C   . TYR C 9   ? 0.0802 0.1206 0.0898 -0.0068 -0.0031 0.0037  9   TYR C C   
3324 O  O   . TYR C 9   ? 0.0903 0.1374 0.0737 -0.0064 0.0085  -0.0019 9   TYR C O   
3325 C  CB  . TYR C 9   ? 0.0753 0.1133 0.0898 -0.0086 -0.0061 0.0085  9   TYR C CB  
3326 C  CG  . TYR C 9   ? 0.0516 0.0964 0.0893 -0.0105 0.0068  0.0100  9   TYR C CG  
3327 C  CD1 . TYR C 9   ? 0.0455 0.0944 0.0806 -0.0123 -0.0047 0.0085  9   TYR C CD1 
3328 C  CD2 . TYR C 9   ? 0.0627 0.1210 0.0763 0.0000  -0.0059 0.0032  9   TYR C CD2 
3329 C  CE1 . TYR C 9   ? 0.0269 0.0818 0.0556 -0.0114 0.0027  0.0193  9   TYR C CE1 
3330 C  CE2 . TYR C 9   ? 0.0517 0.1108 0.0788 -0.0065 -0.0029 0.0108  9   TYR C CE2 
3331 C  CZ  . TYR C 9   ? 0.0411 0.0894 0.0439 -0.0039 0.0012  0.0047  9   TYR C CZ  
3332 O  OH  . TYR C 9   ? 0.0209 0.0781 0.0287 -0.0031 -0.0031 0.0349  9   TYR C OH  
3333 N  N   . ALA C 10  ? 0.0668 0.1045 0.0827 -0.0121 -0.0017 0.0049  10  ALA C N   
3334 C  CA  . ALA C 10  ? 0.0523 0.1046 0.0812 -0.0106 -0.0007 0.0016  10  ALA C CA  
3335 C  C   . ALA C 10  ? 0.0522 0.0983 0.0726 -0.0158 0.0021  -0.0002 10  ALA C C   
3336 O  O   . ALA C 10  ? 0.0558 0.1022 0.0811 -0.0155 0.0139  -0.0017 10  ALA C O   
3337 C  CB  . ALA C 10  ? 0.0545 0.1057 0.0852 -0.0167 0.0000  -0.0001 10  ALA C CB  
3338 N  N   . TYR C 11  ? 0.0473 0.1084 0.0659 -0.0051 -0.0026 0.0045  11  TYR C N   
3339 C  CA  . TYR C 11  ? 0.0729 0.1173 0.0689 -0.0069 -0.0045 0.0020  11  TYR C CA  
3340 C  C   . TYR C 11  ? 0.0698 0.1167 0.0729 -0.0062 -0.0025 0.0020  11  TYR C C   
3341 O  O   . TYR C 11  ? 0.0657 0.1238 0.0465 -0.0125 0.0000  -0.0085 11  TYR C O   
3342 C  CB  . TYR C 11  ? 0.0721 0.1181 0.0854 -0.0066 -0.0054 0.0115  11  TYR C CB  
3343 C  CG  . TYR C 11  ? 0.1051 0.1539 0.1070 -0.0045 0.0067  0.0011  11  TYR C CG  
3344 C  CD1 . TYR C 11  ? 0.0985 0.1506 0.1198 -0.0113 0.0053  0.0044  11  TYR C CD1 
3345 C  CD2 . TYR C 11  ? 0.1313 0.1715 0.1348 0.0029  0.0012  0.0026  11  TYR C CD2 
3346 C  CE1 . TYR C 11  ? 0.1260 0.1811 0.1389 -0.0050 0.0111  0.0044  11  TYR C CE1 
3347 C  CE2 . TYR C 11  ? 0.1374 0.1720 0.1617 -0.0056 0.0126  -0.0039 11  TYR C CE2 
3348 C  CZ  . TYR C 11  ? 0.1398 0.1712 0.1428 0.0006  0.0073  -0.0030 11  TYR C CZ  
3349 O  OH  . TYR C 11  ? 0.1259 0.1796 0.1788 0.0014  -0.0002 0.0042  11  TYR C OH  
3350 N  N   . ASP C 12  ? 0.0705 0.1090 0.0684 -0.0077 -0.0010 -0.0019 12  ASP C N   
3351 C  CA  . ASP C 12  ? 0.0732 0.1117 0.0726 -0.0083 -0.0019 0.0009  12  ASP C CA  
3352 C  C   . ASP C 12  ? 0.0764 0.1106 0.0749 -0.0096 -0.0001 0.0032  12  ASP C C   
3353 O  O   . ASP C 12  ? 0.0675 0.1235 0.0671 -0.0087 0.0045  -0.0002 12  ASP C O   
3354 C  CB  . ASP C 12  ? 0.0763 0.1065 0.0745 -0.0117 0.0014  0.0038  12  ASP C CB  
3355 C  CG  . ASP C 12  ? 0.0669 0.1087 0.0818 -0.0067 -0.0021 -0.0032 12  ASP C CG  
3356 O  OD1 . ASP C 12  ? 0.1106 0.1420 0.1259 -0.0220 -0.0053 0.0126  12  ASP C OD1 
3357 O  OD2 . ASP C 12  ? 0.0584 0.1325 0.0596 -0.0120 -0.0174 -0.0122 12  ASP C OD2 
3358 N  N   . ALA C 13  ? 0.0715 0.1070 0.0685 -0.0128 -0.0018 0.0106  13  ALA C N   
3359 C  CA  . ALA C 13  ? 0.0629 0.1021 0.0596 -0.0112 -0.0026 0.0045  13  ALA C CA  
3360 C  C   . ALA C 13  ? 0.0698 0.0985 0.0639 -0.0088 -0.0013 0.0057  13  ALA C C   
3361 O  O   . ALA C 13  ? 0.0850 0.1063 0.0776 -0.0190 -0.0020 0.0058  13  ALA C O   
3362 C  CB  . ALA C 13  ? 0.0762 0.1117 0.0533 -0.0123 -0.0056 0.0078  13  ALA C CB  
3363 N  N   . LEU C 14  ? 0.0679 0.0981 0.0632 -0.0099 0.0007  0.0096  14  LEU C N   
3364 C  CA  . LEU C 14  ? 0.0507 0.0866 0.0634 -0.0155 -0.0038 0.0050  14  LEU C CA  
3365 C  C   . LEU C 14  ? 0.0462 0.0753 0.0548 -0.0175 -0.0022 0.0073  14  LEU C C   
3366 O  O   . LEU C 14  ? 0.0208 0.0730 0.0460 -0.0296 0.0027  0.0101  14  LEU C O   
3367 C  CB  . LEU C 14  ? 0.0487 0.0936 0.0659 -0.0106 -0.0063 0.0065  14  LEU C CB  
3368 C  CG  . LEU C 14  ? 0.0738 0.0907 0.0863 -0.0053 0.0067  0.0040  14  LEU C CG  
3369 C  CD1 . LEU C 14  ? 0.0816 0.1154 0.0931 -0.0059 -0.0083 -0.0114 14  LEU C CD1 
3370 C  CD2 . LEU C 14  ? 0.0477 0.0651 0.0710 -0.0077 0.0075  0.0258  14  LEU C CD2 
3371 N  N   . GLU C 15  ? 0.0396 0.0795 0.0529 -0.0186 -0.0001 0.0115  15  GLU C N   
3372 C  CA  . GLU C 15  ? 0.0513 0.0728 0.0591 -0.0209 -0.0033 0.0084  15  GLU C CA  
3373 C  C   . GLU C 15  ? 0.0411 0.0747 0.0578 -0.0165 -0.0034 0.0111  15  GLU C C   
3374 O  O   . GLU C 15  ? 0.0287 0.0824 0.0635 -0.0217 -0.0098 0.0142  15  GLU C O   
3375 C  CB  . GLU C 15  ? 0.0379 0.0671 0.0522 -0.0226 -0.0071 0.0082  15  GLU C CB  
3376 C  CG  . GLU C 15  ? 0.0490 0.0634 0.0546 -0.0304 0.0040  0.0071  15  GLU C CG  
3377 C  CD  . GLU C 15  ? 0.0442 0.0879 0.0680 -0.0045 -0.0124 -0.0033 15  GLU C CD  
3378 O  OE1 . GLU C 15  ? 0.0464 0.0947 0.0579 -0.0068 -0.0244 0.0113  15  GLU C OE1 
3379 O  OE2 . GLU C 15  ? 0.0367 0.0849 0.0545 -0.0204 -0.0097 -0.0184 15  GLU C OE2 
3380 N  N   . PRO C 16  ? 0.0374 0.0813 0.0620 -0.0176 0.0036  0.0067  16  PRO C N   
3381 C  CA  . PRO C 16  ? 0.0351 0.0752 0.0609 -0.0136 0.0033  0.0078  16  PRO C CA  
3382 C  C   . PRO C 16  ? 0.0326 0.0725 0.0617 -0.0155 0.0026  0.0096  16  PRO C C   
3383 O  O   . PRO C 16  ? 0.0209 0.0678 0.0760 -0.0244 0.0088  0.0158  16  PRO C O   
3384 C  CB  . PRO C 16  ? 0.0281 0.0774 0.0618 -0.0124 0.0042  0.0019  16  PRO C CB  
3385 C  CG  . PRO C 16  ? 0.0470 0.0836 0.0634 -0.0120 0.0040  0.0096  16  PRO C CG  
3386 C  CD  . PRO C 16  ? 0.0445 0.0754 0.0595 -0.0086 0.0022  0.0077  16  PRO C CD  
3387 N  N   . HIS C 17  ? 0.0364 0.0628 0.0505 -0.0097 0.0036  0.0088  17  HIS C N   
3388 C  CA  . HIS C 17  ? 0.0356 0.0594 0.0546 -0.0076 0.0076  -0.0003 17  HIS C CA  
3389 C  C   . HIS C 17  ? 0.0355 0.0552 0.0539 -0.0063 0.0057  0.0039  17  HIS C C   
3390 O  O   . HIS C 17  ? 0.0227 0.0584 0.0404 -0.0227 -0.0005 0.0020  17  HIS C O   
3391 C  CB  . HIS C 17  ? 0.0352 0.0568 0.0545 -0.0105 0.0046  0.0056  17  HIS C CB  
3392 C  CG  . HIS C 17  ? 0.0443 0.0555 0.0613 -0.0148 0.0039  -0.0078 17  HIS C CG  
3393 N  ND1 . HIS C 17  ? 0.0622 0.0894 0.0936 -0.0189 0.0158  0.0051  17  HIS C ND1 
3394 C  CD2 . HIS C 17  ? 0.0393 0.0482 0.0716 -0.0173 0.0114  -0.0082 17  HIS C CD2 
3395 C  CE1 . HIS C 17  ? 0.0745 0.0664 0.0899 -0.0116 0.0120  0.0037  17  HIS C CE1 
3396 N  NE2 . HIS C 17  ? 0.0342 0.0586 0.0605 -0.0146 0.0039  -0.0142 17  HIS C NE2 
3397 N  N   . PHE C 18  ? 0.0377 0.0487 0.0440 -0.0107 0.0055  0.0056  18  PHE C N   
3398 C  CA  . PHE C 18  ? 0.0453 0.0606 0.0518 -0.0150 0.0103  0.0132  18  PHE C CA  
3399 C  C   . PHE C 18  ? 0.0443 0.0665 0.0451 -0.0132 0.0086  0.0147  18  PHE C C   
3400 O  O   . PHE C 18  ? 0.0468 0.0984 0.0569 -0.0185 0.0059  0.0160  18  PHE C O   
3401 C  CB  . PHE C 18  ? 0.0373 0.0498 0.0525 -0.0199 0.0062  0.0123  18  PHE C CB  
3402 C  CG  . PHE C 18  ? 0.0638 0.0780 0.0761 -0.0113 -0.0050 0.0078  18  PHE C CG  
3403 C  CD1 . PHE C 18  ? 0.0627 0.0623 0.0772 -0.0058 -0.0047 -0.0026 18  PHE C CD1 
3404 C  CD2 . PHE C 18  ? 0.0657 0.0886 0.0805 -0.0115 0.0017  0.0079  18  PHE C CD2 
3405 C  CE1 . PHE C 18  ? 0.0870 0.0965 0.0770 -0.0151 0.0047  0.0091  18  PHE C CE1 
3406 C  CE2 . PHE C 18  ? 0.0687 0.0651 0.0669 -0.0109 -0.0070 0.0028  18  PHE C CE2 
3407 C  CZ  . PHE C 18  ? 0.0752 0.0928 0.0871 -0.0131 0.0028  0.0018  18  PHE C CZ  
3408 N  N   . ASP C 19  ? 0.0444 0.0744 0.0476 -0.0100 0.0085  0.0139  19  ASP C N   
3409 C  CA  . ASP C 19  ? 0.0492 0.0695 0.0446 -0.0070 0.0035  0.0112  19  ASP C CA  
3410 C  C   . ASP C 19  ? 0.0537 0.0871 0.0526 -0.0085 0.0032  0.0102  19  ASP C C   
3411 O  O   . ASP C 19  ? 0.0547 0.0916 0.0586 -0.0107 0.0047  0.0112  19  ASP C O   
3412 C  CB  . ASP C 19  ? 0.0492 0.0675 0.0526 -0.0056 -0.0020 0.0065  19  ASP C CB  
3413 C  CG  . ASP C 19  ? 0.0476 0.0565 0.0608 -0.0091 0.0079  0.0003  19  ASP C CG  
3414 O  OD1 . ASP C 19  ? 0.0248 0.0815 0.0492 -0.0060 -0.0006 0.0168  19  ASP C OD1 
3415 O  OD2 . ASP C 19  ? 0.0253 0.1010 0.0519 -0.0118 0.0241  -0.0082 19  ASP C OD2 
3416 N  N   . LYS C 20  ? 0.0702 0.1003 0.0560 -0.0142 0.0006  0.0082  20  LYS C N   
3417 C  CA  . LYS C 20  ? 0.0686 0.1012 0.0634 -0.0119 -0.0041 0.0071  20  LYS C CA  
3418 C  C   . LYS C 20  ? 0.0623 0.0981 0.0602 -0.0185 -0.0107 0.0027  20  LYS C C   
3419 O  O   . LYS C 20  ? 0.0470 0.1047 0.0685 -0.0285 -0.0104 0.0132  20  LYS C O   
3420 C  CB  . LYS C 20  ? 0.0700 0.1001 0.0731 -0.0075 -0.0040 0.0034  20  LYS C CB  
3421 C  CG  . LYS C 20  ? 0.1218 0.1299 0.1112 -0.0074 -0.0031 0.0059  20  LYS C CG  
3422 C  CD  . LYS C 20  ? 0.1326 0.1271 0.1385 -0.0009 -0.0118 -0.0006 20  LYS C CD  
3423 C  CE  . LYS C 20  ? 0.1194 0.1257 0.1368 -0.0101 -0.0075 -0.0146 20  LYS C CE  
3424 N  NZ  . LYS C 20  ? 0.1266 0.1430 0.1781 0.0091  -0.0091 -0.0130 20  LYS C NZ  
3425 N  N   . GLN C 21  ? 0.0509 0.0900 0.0571 -0.0213 -0.0120 -0.0006 21  GLN C N   
3426 C  CA  . GLN C 21  ? 0.0453 0.0838 0.0548 -0.0220 -0.0092 -0.0045 21  GLN C CA  
3427 C  C   . GLN C 21  ? 0.0360 0.0895 0.0539 -0.0202 -0.0085 -0.0098 21  GLN C C   
3428 O  O   . GLN C 21  ? 0.0266 0.1060 0.0534 -0.0261 -0.0162 -0.0072 21  GLN C O   
3429 C  CB  . GLN C 21  ? 0.0565 0.0931 0.0603 -0.0189 -0.0028 -0.0006 21  GLN C CB  
3430 C  CG  . GLN C 21  ? 0.0563 0.0834 0.0685 -0.0149 -0.0148 0.0102  21  GLN C CG  
3431 C  CD  . GLN C 21  ? 0.0817 0.0963 0.1014 -0.0129 -0.0076 0.0038  21  GLN C CD  
3432 O  OE1 . GLN C 21  ? 0.0830 0.0991 0.0982 -0.0151 -0.0241 0.0022  21  GLN C OE1 
3433 N  NE2 . GLN C 21  ? 0.1189 0.1016 0.1042 -0.0147 0.0006  0.0134  21  GLN C NE2 
3434 N  N   . THR C 22  ? 0.0336 0.0809 0.0561 -0.0205 -0.0059 -0.0094 22  THR C N   
3435 C  CA  . THR C 22  ? 0.0228 0.0669 0.0434 -0.0229 -0.0038 -0.0066 22  THR C CA  
3436 C  C   . THR C 22  ? 0.0272 0.0611 0.0405 -0.0186 -0.0083 -0.0108 22  THR C C   
3437 O  O   . THR C 22  ? 0.0189 0.0657 0.0409 -0.0162 -0.0078 -0.0137 22  THR C O   
3438 C  CB  . THR C 22  ? 0.0181 0.0516 0.0420 -0.0195 -0.0051 -0.0123 22  THR C CB  
3439 O  OG1 . THR C 22  ? 0.0366 0.0702 0.0276 -0.0424 -0.0043 -0.0037 22  THR C OG1 
3440 C  CG2 . THR C 22  ? 0.0199 0.0486 0.0412 -0.0234 0.0011  -0.0098 22  THR C CG2 
3441 N  N   . MET C 23  ? 0.0386 0.0645 0.0464 -0.0155 0.0004  -0.0102 23  MET C N   
3442 C  CA  . MET C 23  ? 0.0487 0.0754 0.0422 -0.0114 -0.0009 -0.0044 23  MET C CA  
3443 C  C   . MET C 23  ? 0.0553 0.0800 0.0462 -0.0121 -0.0001 -0.0038 23  MET C C   
3444 O  O   . MET C 23  ? 0.0671 0.0798 0.0331 -0.0078 -0.0028 0.0126  23  MET C O   
3445 C  CB  . MET C 23  ? 0.0553 0.0742 0.0535 -0.0171 0.0034  -0.0105 23  MET C CB  
3446 C  CG  . MET C 23  ? 0.0340 0.0834 0.0404 -0.0122 0.0038  0.0031  23  MET C CG  
3447 S  SD  . MET C 23  ? 0.0289 0.1130 0.0516 -0.0243 -0.0030 0.0165  23  MET C SD  
3448 C  CE  . MET C 23  ? 0.1211 0.1215 0.1116 -0.0037 0.0041  0.0085  23  MET C CE  
3449 N  N   . GLU C 24  ? 0.0764 0.0835 0.0490 -0.0087 0.0054  -0.0028 24  GLU C N   
3450 C  CA  . GLU C 24  ? 0.0775 0.0767 0.0503 -0.0106 0.0010  -0.0046 24  GLU C CA  
3451 C  C   . GLU C 24  ? 0.0706 0.0738 0.0492 -0.0127 -0.0025 -0.0030 24  GLU C C   
3452 O  O   . GLU C 24  ? 0.0551 0.0782 0.0539 -0.0141 -0.0003 -0.0032 24  GLU C O   
3453 C  CB  . GLU C 24  ? 0.0780 0.0869 0.0497 -0.0099 -0.0041 0.0030  24  GLU C CB  
3454 C  CG  . GLU C 24  ? 0.1034 0.0890 0.0714 -0.0116 -0.0009 -0.0147 24  GLU C CG  
3455 C  CD  . GLU C 24  ? 0.1089 0.1366 0.1044 -0.0109 -0.0058 -0.0060 24  GLU C CD  
3456 O  OE1 . GLU C 24  ? 0.1489 0.1770 0.1173 -0.0037 -0.0189 -0.0111 24  GLU C OE1 
3457 O  OE2 . GLU C 24  ? 0.1377 0.1637 0.1420 -0.0199 -0.0043 -0.0075 24  GLU C OE2 
3458 N  N   . ILE C 25  ? 0.0691 0.0708 0.0575 -0.0159 -0.0031 -0.0050 25  ILE C N   
3459 C  CA  . ILE C 25  ? 0.0571 0.0673 0.0487 -0.0163 -0.0030 -0.0039 25  ILE C CA  
3460 C  C   . ILE C 25  ? 0.0500 0.0690 0.0463 -0.0147 -0.0049 -0.0074 25  ILE C C   
3461 O  O   . ILE C 25  ? 0.0365 0.0849 0.0283 -0.0061 -0.0139 -0.0143 25  ILE C O   
3462 C  CB  . ILE C 25  ? 0.0616 0.0539 0.0552 -0.0206 -0.0012 -0.0046 25  ILE C CB  
3463 C  CG1 . ILE C 25  ? 0.0752 0.0754 0.0882 -0.0271 -0.0038 -0.0076 25  ILE C CG1 
3464 C  CG2 . ILE C 25  ? 0.0590 0.0641 0.0574 -0.0248 0.0080  -0.0102 25  ILE C CG2 
3465 C  CD1 . ILE C 25  ? 0.0804 0.1059 0.0757 -0.0010 -0.0022 -0.0024 25  ILE C CD1 
3466 N  N   . HIS C 26  ? 0.0348 0.0697 0.0200 -0.0128 -0.0063 -0.0028 26  HIS C N   
3467 C  CA  . HIS C 26  ? 0.0375 0.0562 0.0210 -0.0087 0.0009  0.0014  26  HIS C CA  
3468 C  C   . HIS C 26  ? 0.0347 0.0564 0.0277 -0.0111 -0.0023 0.0048  26  HIS C C   
3469 O  O   . HIS C 26  ? 0.0149 0.0423 0.0090 -0.0125 -0.0017 0.0091  26  HIS C O   
3470 C  CB  . HIS C 26  ? 0.0377 0.0482 0.0265 -0.0029 -0.0009 -0.0019 26  HIS C CB  
3471 C  CG  . HIS C 26  ? 0.0211 0.0556 0.0193 -0.0012 0.0029  -0.0008 26  HIS C CG  
3472 N  ND1 . HIS C 26  ? 0.0256 0.0673 0.0409 0.0016  -0.0002 -0.0029 26  HIS C ND1 
3473 C  CD2 . HIS C 26  ? 0.0224 0.0481 0.0229 -0.0137 0.0046  0.0042  26  HIS C CD2 
3474 C  CE1 . HIS C 26  ? 0.0180 0.0484 0.0436 -0.0214 -0.0057 0.0007  26  HIS C CE1 
3475 N  NE2 . HIS C 26  ? 0.0117 0.0469 0.0099 -0.0059 -0.0039 -0.0009 26  HIS C NE2 
3476 N  N   . HIS C 27  ? 0.0269 0.0575 0.0290 -0.0100 -0.0017 0.0185  27  HIS C N   
3477 C  CA  . HIS C 27  ? 0.0460 0.0729 0.0403 -0.0087 -0.0042 0.0085  27  HIS C CA  
3478 C  C   . HIS C 27  ? 0.0437 0.0745 0.0452 -0.0087 -0.0004 0.0076  27  HIS C C   
3479 O  O   . HIS C 27  ? 0.0310 0.0874 0.0320 -0.0124 -0.0019 0.0142  27  HIS C O   
3480 C  CB  . HIS C 27  ? 0.0450 0.0766 0.0363 -0.0084 -0.0054 0.0120  27  HIS C CB  
3481 C  CG  . HIS C 27  ? 0.0548 0.0569 0.0459 -0.0071 -0.0086 0.0090  27  HIS C CG  
3482 N  ND1 . HIS C 27  ? 0.0287 0.0812 0.0505 -0.0147 -0.0071 0.0105  27  HIS C ND1 
3483 C  CD2 . HIS C 27  ? 0.0691 0.0896 0.0626 -0.0165 -0.0030 0.0221  27  HIS C CD2 
3484 C  CE1 . HIS C 27  ? 0.0549 0.0684 0.0454 0.0049  -0.0214 0.0176  27  HIS C CE1 
3485 N  NE2 . HIS C 27  ? 0.0358 0.0567 0.0567 -0.0010 -0.0192 0.0314  27  HIS C NE2 
3486 N  N   . THR C 28  ? 0.0521 0.0738 0.0510 -0.0108 -0.0010 0.0006  28  THR C N   
3487 C  CA  . THR C 28  ? 0.0482 0.0749 0.0378 -0.0237 0.0013  0.0014  28  THR C CA  
3488 C  C   . THR C 28  ? 0.0544 0.0718 0.0374 -0.0221 0.0009  0.0009  28  THR C C   
3489 O  O   . THR C 28  ? 0.0425 0.0808 0.0295 -0.0143 0.0007  -0.0057 28  THR C O   
3490 C  CB  . THR C 28  ? 0.0673 0.0764 0.0601 -0.0207 0.0022  0.0017  28  THR C CB  
3491 O  OG1 . THR C 28  ? 0.0468 0.0734 0.0426 -0.0428 -0.0009 0.0059  28  THR C OG1 
3492 C  CG2 . THR C 28  ? 0.0606 0.0718 0.0508 -0.0213 -0.0038 -0.0002 28  THR C CG2 
3493 N  N   . LYS C 29  ? 0.0577 0.0775 0.0437 -0.0188 -0.0003 0.0078  29  LYS C N   
3494 C  CA  . LYS C 29  ? 0.0571 0.0719 0.0431 -0.0183 -0.0028 0.0026  29  LYS C CA  
3495 C  C   . LYS C 29  ? 0.0539 0.0657 0.0395 -0.0188 -0.0031 -0.0009 29  LYS C C   
3496 O  O   . LYS C 29  ? 0.0649 0.0664 0.0286 -0.0225 -0.0031 -0.0033 29  LYS C O   
3497 C  CB  . LYS C 29  ? 0.0683 0.0805 0.0524 -0.0195 -0.0065 0.0037  29  LYS C CB  
3498 C  CG  . LYS C 29  ? 0.0689 0.0797 0.0599 -0.0188 -0.0121 -0.0012 29  LYS C CG  
3499 C  CD  . LYS C 29  ? 0.1184 0.1062 0.0902 -0.0092 -0.0043 -0.0006 29  LYS C CD  
3500 C  CE  . LYS C 29  ? 0.1420 0.1346 0.1217 -0.0133 -0.0125 0.0006  29  LYS C CE  
3501 N  NZ  . LYS C 29  ? 0.1869 0.1635 0.1473 -0.0059 0.0017  -0.0023 29  LYS C NZ  
3502 N  N   . HIS C 30  ? 0.0471 0.0577 0.0312 -0.0204 -0.0017 0.0046  30  HIS C N   
3503 C  CA  . HIS C 30  ? 0.0462 0.0568 0.0395 -0.0156 -0.0006 0.0023  30  HIS C CA  
3504 C  C   . HIS C 30  ? 0.0442 0.0566 0.0359 -0.0119 -0.0011 0.0017  30  HIS C C   
3505 O  O   . HIS C 30  ? 0.0284 0.0560 0.0274 -0.0165 0.0054  0.0064  30  HIS C O   
3506 C  CB  . HIS C 30  ? 0.0381 0.0568 0.0394 -0.0082 -0.0019 0.0036  30  HIS C CB  
3507 C  CG  . HIS C 30  ? 0.0527 0.0667 0.0608 -0.0163 0.0003  0.0032  30  HIS C CG  
3508 N  ND1 . HIS C 30  ? 0.0610 0.0520 0.0430 -0.0170 -0.0056 0.0191  30  HIS C ND1 
3509 C  CD2 . HIS C 30  ? 0.0521 0.0729 0.0552 -0.0104 0.0069  0.0042  30  HIS C CD2 
3510 C  CE1 . HIS C 30  ? 0.0660 0.0744 0.0531 -0.0165 0.0029  0.0130  30  HIS C CE1 
3511 N  NE2 . HIS C 30  ? 0.0666 0.0700 0.0533 -0.0166 0.0179  0.0059  30  HIS C NE2 
3512 N  N   . HIS C 31  ? 0.0398 0.0481 0.0307 -0.0166 -0.0071 0.0048  31  HIS C N   
3513 C  CA  . HIS C 31  ? 0.0302 0.0373 0.0207 -0.0082 0.0020  0.0057  31  HIS C CA  
3514 C  C   . HIS C 31  ? 0.0405 0.0477 0.0312 -0.0082 0.0019  0.0015  31  HIS C C   
3515 O  O   . HIS C 31  ? 0.0308 0.0650 0.0332 -0.0060 0.0011  -0.0011 31  HIS C O   
3516 C  CB  . HIS C 31  ? 0.0364 0.0492 0.0241 -0.0136 0.0018  0.0097  31  HIS C CB  
3517 C  CG  . HIS C 31  ? 0.0178 0.0314 0.0216 -0.0106 -0.0077 -0.0054 31  HIS C CG  
3518 N  ND1 . HIS C 31  ? 0.0127 0.0141 0.0088 -0.0071 -0.0040 0.0044  31  HIS C ND1 
3519 C  CD2 . HIS C 31  ? 0.0290 0.0456 0.0239 -0.0057 0.0097  0.0065  31  HIS C CD2 
3520 C  CE1 . HIS C 31  ? 0.0263 0.0388 0.0216 -0.0159 0.0000  0.0058  31  HIS C CE1 
3521 N  NE2 . HIS C 31  ? 0.0221 0.0100 0.0087 -0.0016 0.0059  -0.0013 31  HIS C NE2 
3522 N  N   . GLN C 32  ? 0.0376 0.0437 0.0229 -0.0005 0.0079  -0.0025 32  GLN C N   
3523 C  CA  . GLN C 32  ? 0.0252 0.0391 0.0210 -0.0058 0.0023  -0.0014 32  GLN C CA  
3524 C  C   . GLN C 32  ? 0.0371 0.0481 0.0305 -0.0030 0.0018  0.0032  32  GLN C C   
3525 O  O   . GLN C 32  ? 0.0092 0.0260 0.0177 -0.0032 0.0032  0.0070  32  GLN C O   
3526 C  CB  . GLN C 32  ? 0.0332 0.0305 0.0257 -0.0085 0.0052  0.0018  32  GLN C CB  
3527 C  CG  . GLN C 32  ? 0.0225 0.0368 0.0275 -0.0085 0.0018  0.0026  32  GLN C CG  
3528 C  CD  . GLN C 32  ? 0.0172 0.0496 0.0215 -0.0117 -0.0050 0.0075  32  GLN C CD  
3529 O  OE1 . GLN C 32  ? 0.0447 0.0531 0.0461 -0.0157 -0.0083 -0.0003 32  GLN C OE1 
3530 N  NE2 . GLN C 32  ? 0.0367 0.0515 0.0174 0.0070  0.0073  0.0219  32  GLN C NE2 
3531 N  N   . THR C 33  ? 0.0251 0.0288 0.0292 0.0004  0.0012  0.0032  33  THR C N   
3532 C  CA  . THR C 33  ? 0.0362 0.0538 0.0313 -0.0032 0.0011  0.0118  33  THR C CA  
3533 C  C   . THR C 33  ? 0.0348 0.0512 0.0331 -0.0001 -0.0021 0.0069  33  THR C C   
3534 O  O   . THR C 33  ? 0.0199 0.0608 0.0216 -0.0118 0.0019  0.0117  33  THR C O   
3535 C  CB  . THR C 33  ? 0.0417 0.0441 0.0447 -0.0004 -0.0034 0.0113  33  THR C CB  
3536 O  OG1 . THR C 33  ? 0.0314 0.0704 0.0366 -0.0107 0.0005  0.0148  33  THR C OG1 
3537 C  CG2 . THR C 33  ? 0.0337 0.0662 0.0250 -0.0077 0.0014  0.0063  33  THR C CG2 
3538 N  N   . TYR C 34  ? 0.0364 0.0511 0.0293 -0.0068 -0.0018 0.0051  34  TYR C N   
3539 C  CA  . TYR C 34  ? 0.0306 0.0523 0.0327 -0.0058 -0.0007 0.0053  34  TYR C CA  
3540 C  C   . TYR C 34  ? 0.0337 0.0520 0.0374 -0.0080 -0.0011 0.0081  34  TYR C C   
3541 O  O   . TYR C 34  ? 0.0185 0.0663 0.0381 -0.0093 -0.0010 0.0004  34  TYR C O   
3542 C  CB  . TYR C 34  ? 0.0254 0.0611 0.0387 -0.0059 -0.0056 0.0053  34  TYR C CB  
3543 C  CG  . TYR C 34  ? 0.0323 0.0515 0.0460 -0.0019 0.0017  0.0039  34  TYR C CG  
3544 C  CD1 . TYR C 34  ? 0.0296 0.0347 0.0217 -0.0085 -0.0008 0.0086  34  TYR C CD1 
3545 C  CD2 . TYR C 34  ? 0.0292 0.0422 0.0334 -0.0060 -0.0035 0.0005  34  TYR C CD2 
3546 C  CE1 . TYR C 34  ? 0.0725 0.0344 0.0418 0.0087  0.0002  -0.0030 34  TYR C CE1 
3547 C  CE2 . TYR C 34  ? 0.0775 0.0801 0.0653 -0.0092 -0.0049 0.0078  34  TYR C CE2 
3548 C  CZ  . TYR C 34  ? 0.0664 0.0541 0.0558 -0.0091 0.0081  0.0068  34  TYR C CZ  
3549 O  OH  . TYR C 34  ? 0.1127 0.0827 0.0643 -0.0048 0.0126  0.0175  34  TYR C OH  
3550 N  N   . VAL C 35  ? 0.0218 0.0487 0.0276 -0.0073 0.0021  0.0053  35  VAL C N   
3551 C  CA  . VAL C 35  ? 0.0262 0.0550 0.0277 -0.0020 -0.0015 0.0104  35  VAL C CA  
3552 C  C   . VAL C 35  ? 0.0332 0.0590 0.0327 -0.0046 -0.0010 0.0101  35  VAL C C   
3553 O  O   . VAL C 35  ? 0.0201 0.0577 0.0160 -0.0023 -0.0017 0.0223  35  VAL C O   
3554 C  CB  . VAL C 35  ? 0.0326 0.0660 0.0326 -0.0035 0.0059  0.0112  35  VAL C CB  
3555 C  CG1 . VAL C 35  ? 0.0495 0.0715 0.0191 -0.0012 -0.0025 0.0101  35  VAL C CG1 
3556 C  CG2 . VAL C 35  ? 0.0143 0.0681 0.0227 0.0069  0.0109  0.0006  35  VAL C CG2 
3557 N  N   . ASN C 36  ? 0.0298 0.0517 0.0323 -0.0013 -0.0009 0.0089  36  ASN C N   
3558 C  CA  . ASN C 36  ? 0.0340 0.0492 0.0300 0.0001  -0.0022 0.0040  36  ASN C CA  
3559 C  C   . ASN C 36  ? 0.0328 0.0551 0.0319 -0.0010 0.0027  0.0061  36  ASN C C   
3560 O  O   . ASN C 36  ? 0.0433 0.0598 0.0268 0.0029  0.0132  0.0032  36  ASN C O   
3561 C  CB  . ASN C 36  ? 0.0292 0.0489 0.0293 0.0038  -0.0048 0.0102  36  ASN C CB  
3562 C  CG  . ASN C 36  ? 0.0472 0.0515 0.0388 -0.0102 0.0018  -0.0030 36  ASN C CG  
3563 O  OD1 . ASN C 36  ? 0.0250 0.0378 0.0437 -0.0240 0.0064  -0.0038 36  ASN C OD1 
3564 N  ND2 . ASN C 36  ? 0.0761 0.0456 0.0302 -0.0076 0.0135  -0.0041 36  ASN C ND2 
3565 N  N   . ASN C 37  ? 0.0243 0.0458 0.0150 -0.0068 -0.0014 0.0025  37  ASN C N   
3566 C  CA  . ASN C 37  ? 0.0331 0.0512 0.0215 -0.0009 0.0005  0.0066  37  ASN C CA  
3567 C  C   . ASN C 37  ? 0.0457 0.0559 0.0274 -0.0015 -0.0005 0.0041  37  ASN C C   
3568 O  O   . ASN C 37  ? 0.0563 0.0604 0.0529 -0.0099 -0.0020 0.0014  37  ASN C O   
3569 C  CB  . ASN C 37  ? 0.0336 0.0558 0.0151 -0.0101 0.0066  0.0085  37  ASN C CB  
3570 C  CG  . ASN C 37  ? 0.0490 0.0389 0.0153 0.0031  -0.0021 0.0109  37  ASN C CG  
3571 O  OD1 . ASN C 37  ? 0.0663 0.0240 0.0539 -0.0152 0.0046  0.0192  37  ASN C OD1 
3572 N  ND2 . ASN C 37  ? 0.0155 0.0573 0.0234 -0.0149 0.0013  0.0192  37  ASN C ND2 
3573 N  N   . ALA C 38  ? 0.0583 0.0677 0.0300 -0.0029 -0.0007 -0.0036 38  ALA C N   
3574 C  CA  . ALA C 38  ? 0.0581 0.0630 0.0268 -0.0006 0.0026  -0.0027 38  ALA C CA  
3575 C  C   . ALA C 38  ? 0.0538 0.0717 0.0372 -0.0034 -0.0005 0.0013  38  ALA C C   
3576 O  O   . ALA C 38  ? 0.0547 0.0588 0.0355 -0.0069 -0.0077 0.0013  38  ALA C O   
3577 C  CB  . ALA C 38  ? 0.0661 0.0821 0.0369 0.0050  0.0002  0.0005  38  ALA C CB  
3578 N  N   . ASN C 39  ? 0.0445 0.0733 0.0262 -0.0062 -0.0014 0.0030  39  ASN C N   
3579 C  CA  . ASN C 39  ? 0.0417 0.0747 0.0312 -0.0057 0.0064  0.0008  39  ASN C CA  
3580 C  C   . ASN C 39  ? 0.0383 0.0708 0.0430 -0.0061 0.0054  0.0039  39  ASN C C   
3581 O  O   . ASN C 39  ? 0.0479 0.0846 0.0360 -0.0082 0.0114  0.0073  39  ASN C O   
3582 C  CB  . ASN C 39  ? 0.0495 0.0732 0.0320 -0.0142 0.0021  0.0041  39  ASN C CB  
3583 C  CG  . ASN C 39  ? 0.0454 0.0702 0.0326 -0.0173 0.0067  -0.0005 39  ASN C CG  
3584 O  OD1 . ASN C 39  ? 0.0567 0.0326 0.0246 0.0079  0.0267  0.0144  39  ASN C OD1 
3585 N  ND2 . ASN C 39  ? 0.0290 0.0724 0.0158 -0.0133 -0.0075 -0.0037 39  ASN C ND2 
3586 N  N   . ALA C 40  ? 0.0336 0.0699 0.0454 0.0000  0.0080  -0.0009 40  ALA C N   
3587 C  CA  . ALA C 40  ? 0.0437 0.0621 0.0502 -0.0010 0.0062  0.0003  40  ALA C CA  
3588 C  C   . ALA C 40  ? 0.0445 0.0587 0.0545 -0.0110 0.0119  -0.0015 40  ALA C C   
3589 O  O   . ALA C 40  ? 0.0540 0.0792 0.0508 -0.0183 0.0094  -0.0078 40  ALA C O   
3590 C  CB  . ALA C 40  ? 0.0536 0.0597 0.0599 -0.0056 0.0086  0.0005  40  ALA C CB  
3591 N  N   . ALA C 41  ? 0.0370 0.0557 0.0534 -0.0137 0.0106  0.0084  41  ALA C N   
3592 C  CA  . ALA C 41  ? 0.0451 0.0495 0.0538 -0.0076 0.0052  0.0090  41  ALA C CA  
3593 C  C   . ALA C 41  ? 0.0481 0.0505 0.0584 -0.0089 0.0075  0.0096  41  ALA C C   
3594 O  O   . ALA C 41  ? 0.0413 0.0464 0.0654 -0.0038 0.0095  0.0197  41  ALA C O   
3595 C  CB  . ALA C 41  ? 0.0481 0.0502 0.0535 0.0006  0.0168  0.0136  41  ALA C CB  
3596 N  N   . LEU C 42  ? 0.0459 0.0579 0.0618 -0.0108 0.0118  0.0079  42  LEU C N   
3597 C  CA  . LEU C 42  ? 0.0574 0.0585 0.0594 -0.0036 0.0028  0.0017  42  LEU C CA  
3598 C  C   . LEU C 42  ? 0.0533 0.0610 0.0589 -0.0026 0.0002  0.0043  42  LEU C C   
3599 O  O   . LEU C 42  ? 0.0512 0.0606 0.0615 -0.0088 0.0000  0.0023  42  LEU C O   
3600 C  CB  . LEU C 42  ? 0.0600 0.0694 0.0625 -0.0079 0.0046  0.0022  42  LEU C CB  
3601 C  CG  . LEU C 42  ? 0.0501 0.0519 0.0544 -0.0158 -0.0050 0.0016  42  LEU C CG  
3602 C  CD1 . LEU C 42  ? 0.0558 0.0819 0.0638 -0.0092 -0.0074 0.0148  42  LEU C CD1 
3603 C  CD2 . LEU C 42  ? 0.0444 0.0655 0.0549 -0.0306 -0.0074 -0.0046 42  LEU C CD2 
3604 N  N   . GLU C 43  ? 0.0551 0.0653 0.0454 0.0036  -0.0046 -0.0011 43  GLU C N   
3605 C  CA  . GLU C 43  ? 0.0587 0.0762 0.0500 -0.0046 0.0053  0.0081  43  GLU C CA  
3606 C  C   . GLU C 43  ? 0.0744 0.0915 0.0689 -0.0022 0.0051  0.0060  43  GLU C C   
3607 O  O   . GLU C 43  ? 0.0837 0.0952 0.0791 -0.0049 0.0093  0.0102  43  GLU C O   
3608 C  CB  . GLU C 43  ? 0.0639 0.0679 0.0290 -0.0035 0.0023  0.0095  43  GLU C CB  
3609 C  CG  . GLU C 43  ? 0.0748 0.0784 0.0425 -0.0052 0.0142  -0.0010 43  GLU C CG  
3610 C  CD  . GLU C 43  ? 0.1077 0.1010 0.0813 0.0038  0.0145  0.0112  43  GLU C CD  
3611 O  OE1 . GLU C 43  ? 0.1173 0.1026 0.0967 0.0048  0.0188  0.0008  43  GLU C OE1 
3612 O  OE2 . GLU C 43  ? 0.1577 0.1289 0.0504 0.0078  0.0163  -0.0028 43  GLU C OE2 
3613 N  N   . SER C 44  ? 0.0734 0.0930 0.0838 -0.0021 0.0074  0.0067  44  SER C N   
3614 C  CA  . SER C 44  ? 0.0816 0.1035 0.0966 -0.0027 0.0057  0.0055  44  SER C CA  
3615 C  C   . SER C 44  ? 0.0858 0.0999 0.1033 -0.0053 0.0087  0.0006  44  SER C C   
3616 O  O   . SER C 44  ? 0.0911 0.1105 0.1070 -0.0095 0.0165  0.0071  44  SER C O   
3617 C  CB  . SER C 44  ? 0.0872 0.1016 0.1067 0.0010  0.0076  -0.0004 44  SER C CB  
3618 O  OG  . SER C 44  ? 0.0907 0.1294 0.1029 0.0073  -0.0006 0.0167  44  SER C OG  
3619 N  N   . LEU C 45  ? 0.0909 0.1002 0.0948 -0.0084 0.0107  0.0016  45  LEU C N   
3620 C  CA  . LEU C 45  ? 0.0971 0.0996 0.1014 -0.0080 0.0076  0.0036  45  LEU C CA  
3621 C  C   . LEU C 45  ? 0.1062 0.1053 0.0994 -0.0035 0.0064  0.0064  45  LEU C C   
3622 O  O   . LEU C 45  ? 0.1049 0.1009 0.1032 -0.0124 0.0108  0.0058  45  LEU C O   
3623 C  CB  . LEU C 45  ? 0.0875 0.0867 0.0945 -0.0143 0.0072  0.0026  45  LEU C CB  
3624 C  CG  . LEU C 45  ? 0.0957 0.1067 0.1092 -0.0071 0.0047  0.0021  45  LEU C CG  
3625 C  CD1 . LEU C 45  ? 0.1030 0.1127 0.1128 -0.0142 -0.0077 0.0026  45  LEU C CD1 
3626 C  CD2 . LEU C 45  ? 0.0968 0.1118 0.1079 -0.0139 -0.0053 -0.0027 45  LEU C CD2 
3627 N  N   . PRO C 46  ? 0.1060 0.1069 0.0994 -0.0055 0.0089  0.0062  46  PRO C N   
3628 C  CA  . PRO C 46  ? 0.1103 0.1072 0.0964 -0.0009 0.0047  0.0028  46  PRO C CA  
3629 C  C   . PRO C 46  ? 0.1152 0.1124 0.1077 0.0016  0.0047  0.0027  46  PRO C C   
3630 O  O   . PRO C 46  ? 0.1292 0.1351 0.1322 0.0000  -0.0007 -0.0015 46  PRO C O   
3631 C  CB  . PRO C 46  ? 0.1040 0.1059 0.0993 -0.0041 0.0115  0.0023  46  PRO C CB  
3632 C  CG  . PRO C 46  ? 0.1029 0.0955 0.0917 0.0023  0.0023  0.0022  46  PRO C CG  
3633 C  CD  . PRO C 46  ? 0.1072 0.1105 0.1005 -0.0002 0.0035  0.0045  46  PRO C CD  
3634 N  N   . GLU C 47  ? 0.1163 0.1141 0.1158 -0.0005 0.0066  0.0005  47  GLU C N   
3635 C  CA  . GLU C 47  ? 0.1262 0.1135 0.1214 0.0005  0.0045  0.0050  47  GLU C CA  
3636 C  C   . GLU C 47  ? 0.1247 0.1017 0.1122 0.0011  0.0068  0.0056  47  GLU C C   
3637 O  O   . GLU C 47  ? 0.1444 0.1003 0.1168 0.0005  0.0057  0.0088  47  GLU C O   
3638 C  CB  . GLU C 47  ? 0.1385 0.1249 0.1335 -0.0035 0.0036  0.0053  47  GLU C CB  
3639 C  CG  . GLU C 47  ? 0.1708 0.1593 0.1712 0.0030  0.0024  0.0029  47  GLU C CG  
3640 C  CD  . GLU C 47  ? 0.1936 0.1678 0.1980 0.0009  -0.0051 0.0072  47  GLU C CD  
3641 O  OE1 . GLU C 47  ? 0.2141 0.2185 0.2373 -0.0039 -0.0055 0.0026  47  GLU C OE1 
3642 O  OE2 . GLU C 47  ? 0.1895 0.1520 0.2040 -0.0032 0.0143  0.0050  47  GLU C OE2 
3643 N  N   . PHE C 48  ? 0.1060 0.0851 0.1049 -0.0014 0.0071  0.0033  48  PHE C N   
3644 C  CA  . PHE C 48  ? 0.0854 0.0783 0.0903 -0.0066 0.0031  0.0013  48  PHE C CA  
3645 C  C   . PHE C 48  ? 0.0838 0.0764 0.0922 -0.0041 0.0017  0.0009  48  PHE C C   
3646 O  O   . PHE C 48  ? 0.0679 0.0702 0.0973 -0.0140 -0.0032 -0.0021 48  PHE C O   
3647 C  CB  . PHE C 48  ? 0.0879 0.0810 0.0928 -0.0029 0.0041  0.0060  48  PHE C CB  
3648 C  CG  . PHE C 48  ? 0.0941 0.0959 0.1097 -0.0119 0.0090  -0.0043 48  PHE C CG  
3649 C  CD1 . PHE C 48  ? 0.1118 0.1096 0.1152 -0.0067 0.0118  -0.0004 48  PHE C CD1 
3650 C  CD2 . PHE C 48  ? 0.0938 0.1134 0.1204 -0.0109 0.0091  -0.0006 48  PHE C CD2 
3651 C  CE1 . PHE C 48  ? 0.1150 0.1157 0.1305 -0.0009 0.0095  -0.0069 48  PHE C CE1 
3652 C  CE2 . PHE C 48  ? 0.1187 0.1355 0.1222 -0.0067 0.0090  -0.0048 48  PHE C CE2 
3653 C  CZ  . PHE C 48  ? 0.1168 0.1343 0.1424 -0.0089 0.0099  -0.0115 48  PHE C CZ  
3654 N  N   . ALA C 49  ? 0.0867 0.0836 0.0955 -0.0017 0.0029  0.0035  49  ALA C N   
3655 C  CA  . ALA C 49  ? 0.1002 0.0969 0.1085 -0.0033 0.0016  -0.0030 49  ALA C CA  
3656 C  C   . ALA C 49  ? 0.1058 0.1071 0.1137 -0.0011 0.0004  -0.0009 49  ALA C C   
3657 O  O   . ALA C 49  ? 0.1191 0.1316 0.1326 -0.0080 0.0000  -0.0056 49  ALA C O   
3658 C  CB  . ALA C 49  ? 0.0970 0.0873 0.1023 0.0072  0.0073  -0.0023 49  ALA C CB  
3659 N  N   . ASN C 50  ? 0.1220 0.1162 0.1203 -0.0015 -0.0031 -0.0049 50  ASN C N   
3660 C  CA  . ASN C 50  ? 0.1235 0.1247 0.1299 0.0027  -0.0007 -0.0007 50  ASN C CA  
3661 C  C   . ASN C 50  ? 0.1205 0.1192 0.1210 0.0021  -0.0021 0.0019  50  ASN C C   
3662 O  O   . ASN C 50  ? 0.1299 0.1294 0.1329 0.0074  -0.0041 0.0033  50  ASN C O   
3663 C  CB  . ASN C 50  ? 0.1452 0.1368 0.1425 0.0065  -0.0004 0.0021  50  ASN C CB  
3664 C  CG  . ASN C 50  ? 0.1593 0.1737 0.1689 -0.0020 -0.0005 0.0000  50  ASN C CG  
3665 O  OD1 . ASN C 50  ? 0.2181 0.2490 0.1937 0.0012  0.0087  -0.0144 50  ASN C OD1 
3666 N  ND2 . ASN C 50  ? 0.2257 0.2083 0.1854 0.0060  0.0046  -0.0100 50  ASN C ND2 
3667 N  N   . LEU C 51  ? 0.1178 0.1105 0.1140 -0.0034 0.0005  -0.0006 51  LEU C N   
3668 C  CA  . LEU C 51  ? 0.0957 0.0924 0.1066 -0.0015 0.0021  0.0065  51  LEU C CA  
3669 C  C   . LEU C 51  ? 0.0864 0.0842 0.1018 -0.0032 0.0023  0.0060  51  LEU C C   
3670 O  O   . LEU C 51  ? 0.0815 0.0729 0.1068 -0.0034 0.0127  0.0106  51  LEU C O   
3671 C  CB  . LEU C 51  ? 0.0952 0.0936 0.1035 -0.0046 0.0002  0.0012  51  LEU C CB  
3672 C  CG  . LEU C 51  ? 0.1004 0.0802 0.1138 -0.0073 -0.0046 0.0066  51  LEU C CG  
3673 C  CD1 . LEU C 51  ? 0.0636 0.0666 0.1161 -0.0064 -0.0076 -0.0047 51  LEU C CD1 
3674 C  CD2 . LEU C 51  ? 0.0863 0.0488 0.1278 -0.0023 -0.0014 -0.0073 51  LEU C CD2 
3675 N  N   . PRO C 52  ? 0.0693 0.0686 0.0833 -0.0023 0.0037  0.0079  52  PRO C N   
3676 C  CA  . PRO C 52  ? 0.0675 0.0693 0.0754 0.0008  0.0018  0.0133  52  PRO C CA  
3677 C  C   . PRO C 52  ? 0.0602 0.0596 0.0663 -0.0012 0.0022  0.0126  52  PRO C C   
3678 O  O   . PRO C 52  ? 0.0490 0.0489 0.0594 0.0061  0.0113  0.0198  52  PRO C O   
3679 C  CB  . PRO C 52  ? 0.0696 0.0692 0.0738 0.0014  0.0003  0.0137  52  PRO C CB  
3680 C  CG  . PRO C 52  ? 0.0700 0.0588 0.0734 0.0002  -0.0013 0.0089  52  PRO C CG  
3681 C  CD  . PRO C 52  ? 0.0772 0.0793 0.0940 -0.0036 0.0004  0.0118  52  PRO C CD  
3682 N  N   . VAL C 53  ? 0.0630 0.0602 0.0635 0.0045  0.0006  0.0119  53  VAL C N   
3683 C  CA  . VAL C 53  ? 0.0584 0.0655 0.0604 -0.0040 -0.0015 0.0150  53  VAL C CA  
3684 C  C   . VAL C 53  ? 0.0635 0.0723 0.0718 -0.0014 0.0022  0.0120  53  VAL C C   
3685 O  O   . VAL C 53  ? 0.0398 0.0576 0.0502 -0.0076 -0.0004 0.0238  53  VAL C O   
3686 C  CB  . VAL C 53  ? 0.0607 0.0581 0.0522 -0.0008 -0.0069 0.0109  53  VAL C CB  
3687 C  CG1 . VAL C 53  ? 0.0429 0.0428 0.0437 -0.0201 -0.0102 0.0090  53  VAL C CG1 
3688 C  CG2 . VAL C 53  ? 0.0511 0.0351 0.0590 -0.0088 0.0046  0.0140  53  VAL C CG2 
3689 N  N   . GLU C 54  ? 0.0847 0.0759 0.0768 -0.0054 0.0069  0.0106  54  GLU C N   
3690 C  CA  . GLU C 54  ? 0.0949 0.0881 0.0881 -0.0025 0.0041  0.0093  54  GLU C CA  
3691 C  C   . GLU C 54  ? 0.0889 0.0777 0.0844 -0.0031 0.0061  0.0053  54  GLU C C   
3692 O  O   . GLU C 54  ? 0.0823 0.0856 0.0962 -0.0067 0.0135  0.0121  54  GLU C O   
3693 C  CB  . GLU C 54  ? 0.1080 0.0982 0.0955 0.0011  0.0063  0.0076  54  GLU C CB  
3694 C  CG  . GLU C 54  ? 0.1261 0.1476 0.1265 -0.0083 -0.0026 0.0006  54  GLU C CG  
3695 C  CD  . GLU C 54  ? 0.1517 0.1690 0.1219 -0.0066 0.0018  0.0058  54  GLU C CD  
3696 O  OE1 . GLU C 54  ? 0.1086 0.1863 0.1148 -0.0058 0.0104  0.0007  54  GLU C OE1 
3697 O  OE2 . GLU C 54  ? 0.1484 0.2115 0.1640 -0.0026 0.0023  0.0089  54  GLU C OE2 
3698 N  N   . GLU C 55  ? 0.0889 0.0858 0.0954 -0.0048 0.0049  0.0035  55  GLU C N   
3699 C  CA  . GLU C 55  ? 0.0847 0.0832 0.1003 -0.0036 0.0036  0.0047  55  GLU C CA  
3700 C  C   . GLU C 55  ? 0.0751 0.0768 0.0895 -0.0035 0.0039  0.0077  55  GLU C C   
3701 O  O   . GLU C 55  ? 0.0804 0.0768 0.1060 -0.0048 -0.0032 0.0076  55  GLU C O   
3702 C  CB  . GLU C 55  ? 0.0976 0.0954 0.1002 -0.0013 0.0023  0.0014  55  GLU C CB  
3703 C  CG  . GLU C 55  ? 0.1163 0.1240 0.1284 -0.0047 0.0031  0.0025  55  GLU C CG  
3704 C  CD  . GLU C 55  ? 0.1514 0.1592 0.1485 -0.0030 -0.0041 0.0111  55  GLU C CD  
3705 O  OE1 . GLU C 55  ? 0.1374 0.1464 0.1644 -0.0093 -0.0119 -0.0006 55  GLU C OE1 
3706 O  OE2 . GLU C 55  ? 0.1798 0.2061 0.1994 -0.0231 -0.0062 0.0013  55  GLU C OE2 
3707 N  N   . LEU C 56  ? 0.0653 0.0786 0.0906 -0.0026 0.0066  0.0091  56  LEU C N   
3708 C  CA  . LEU C 56  ? 0.0680 0.0754 0.0843 0.0018  0.0042  0.0044  56  LEU C CA  
3709 C  C   . LEU C 56  ? 0.0683 0.0865 0.0838 -0.0018 0.0051  0.0088  56  LEU C C   
3710 O  O   . LEU C 56  ? 0.0683 0.0864 0.0762 0.0028  0.0062  0.0170  56  LEU C O   
3711 C  CB  . LEU C 56  ? 0.0755 0.0897 0.0858 0.0025  0.0009  0.0034  56  LEU C CB  
3712 C  CG  . LEU C 56  ? 0.0820 0.0920 0.1131 0.0009  0.0131  -0.0045 56  LEU C CG  
3713 C  CD1 . LEU C 56  ? 0.0927 0.0841 0.1155 -0.0069 0.0119  0.0200  56  LEU C CD1 
3714 C  CD2 . LEU C 56  ? 0.1121 0.1110 0.1221 -0.0056 0.0038  -0.0096 56  LEU C CD2 
3715 N  N   . ILE C 57  ? 0.0644 0.0827 0.0783 -0.0045 0.0054  0.0099  57  ILE C N   
3716 C  CA  . ILE C 57  ? 0.0749 0.0817 0.0773 -0.0088 0.0048  0.0082  57  ILE C CA  
3717 C  C   . ILE C 57  ? 0.0751 0.0843 0.0814 -0.0135 0.0010  0.0099  57  ILE C C   
3718 O  O   . ILE C 57  ? 0.0793 0.0907 0.0910 -0.0223 0.0045  0.0130  57  ILE C O   
3719 C  CB  . ILE C 57  ? 0.0663 0.0709 0.0717 -0.0024 0.0035  0.0100  57  ILE C CB  
3720 C  CG1 . ILE C 57  ? 0.0710 0.0867 0.0661 0.0012  0.0149  0.0103  57  ILE C CG1 
3721 C  CG2 . ILE C 57  ? 0.0670 0.0807 0.0467 0.0052  0.0075  -0.0002 57  ILE C CG2 
3722 C  CD1 . ILE C 57  ? 0.0933 0.0752 0.0508 -0.0180 0.0087  0.0075  57  ILE C CD1 
3723 N  N   . THR C 58  ? 0.0813 0.0929 0.0894 -0.0093 0.0010  0.0093  58  THR C N   
3724 C  CA  . THR C 58  ? 0.0878 0.0921 0.0871 -0.0088 0.0041  0.0048  58  THR C CA  
3725 C  C   . THR C 58  ? 0.0901 0.0946 0.0949 -0.0075 0.0031  0.0054  58  THR C C   
3726 O  O   . THR C 58  ? 0.0864 0.1052 0.1063 -0.0138 0.0076  0.0099  58  THR C O   
3727 C  CB  . THR C 58  ? 0.0869 0.0950 0.0881 -0.0048 0.0059  0.0084  58  THR C CB  
3728 O  OG1 . THR C 58  ? 0.0952 0.1225 0.0810 -0.0007 0.0094  0.0026  58  THR C OG1 
3729 C  CG2 . THR C 58  ? 0.0821 0.1089 0.0812 0.0000  -0.0015 0.0036  58  THR C CG2 
3730 N  N   . LYS C 59  ? 0.0927 0.0941 0.0933 -0.0119 0.0054  0.0070  59  LYS C N   
3731 C  CA  . LYS C 59  ? 0.0911 0.0941 0.0952 -0.0029 0.0037  0.0069  59  LYS C CA  
3732 C  C   . LYS C 59  ? 0.0873 0.0940 0.0897 -0.0081 0.0023  0.0032  59  LYS C C   
3733 O  O   . LYS C 59  ? 0.0831 0.0991 0.0853 -0.0164 0.0018  0.0107  59  LYS C O   
3734 C  CB  . LYS C 59  ? 0.0954 0.1097 0.1070 -0.0004 0.0014  0.0021  59  LYS C CB  
3735 C  CG  . LYS C 59  ? 0.1240 0.1026 0.1309 -0.0040 0.0008  0.0030  59  LYS C CG  
3736 C  CD  . LYS C 59  ? 0.1555 0.1464 0.1430 -0.0039 0.0062  0.0006  59  LYS C CD  
3737 C  CE  . LYS C 59  ? 0.1776 0.1516 0.1751 0.0021  0.0081  0.0014  59  LYS C CE  
3738 N  NZ  . LYS C 59  ? 0.1928 0.1779 0.1975 0.0016  0.0056  0.0129  59  LYS C NZ  
3739 N  N   . LEU C 60  ? 0.0764 0.0781 0.0804 -0.0059 0.0040  0.0113  60  LEU C N   
3740 C  CA  . LEU C 60  ? 0.0783 0.0844 0.0817 -0.0043 0.0051  0.0007  60  LEU C CA  
3741 C  C   . LEU C 60  ? 0.0736 0.0813 0.0834 -0.0052 0.0016  0.0013  60  LEU C C   
3742 O  O   . LEU C 60  ? 0.0626 0.0848 0.0871 -0.0111 0.0005  -0.0013 60  LEU C O   
3743 C  CB  . LEU C 60  ? 0.0735 0.0751 0.0812 -0.0119 0.0081  0.0044  60  LEU C CB  
3744 C  CG  . LEU C 60  ? 0.0508 0.0752 0.0507 -0.0044 -0.0053 0.0011  60  LEU C CG  
3745 C  CD1 . LEU C 60  ? 0.0838 0.1107 0.0921 -0.0032 0.0137  0.0045  60  LEU C CD1 
3746 C  CD2 . LEU C 60  ? 0.0517 0.0510 0.0573 0.0132  0.0119  0.0098  60  LEU C CD2 
3747 N  N   . ASP C 61  ? 0.0818 0.0950 0.1030 -0.0048 0.0013  -0.0002 61  ASP C N   
3748 C  CA  . ASP C 61  ? 0.0966 0.1064 0.1165 -0.0033 0.0024  0.0018  61  ASP C CA  
3749 C  C   . ASP C 61  ? 0.0937 0.1042 0.1175 -0.0038 0.0068  0.0032  61  ASP C C   
3750 O  O   . ASP C 61  ? 0.0867 0.0925 0.1455 -0.0046 0.0075  0.0048  61  ASP C O   
3751 C  CB  . ASP C 61  ? 0.1036 0.1108 0.1331 -0.0034 0.0006  -0.0012 61  ASP C CB  
3752 C  CG  . ASP C 61  ? 0.1519 0.1457 0.1626 -0.0037 -0.0033 0.0032  61  ASP C CG  
3753 O  OD1 . ASP C 61  ? 0.1966 0.1766 0.2010 -0.0008 -0.0037 -0.0107 61  ASP C OD1 
3754 O  OD2 . ASP C 61  ? 0.1964 0.1426 0.2297 0.0082  -0.0131 -0.0011 61  ASP C OD2 
3755 N  N   . GLN C 62  ? 0.0954 0.1001 0.1017 -0.0069 0.0110  0.0039  62  GLN C N   
3756 C  CA  . GLN C 62  ? 0.0916 0.1031 0.0942 -0.0090 0.0101  0.0013  62  GLN C CA  
3757 C  C   . GLN C 62  ? 0.0871 0.0967 0.0923 -0.0072 0.0090  0.0031  62  GLN C C   
3758 O  O   . GLN C 62  ? 0.0884 0.1016 0.0928 -0.0150 0.0156  0.0079  62  GLN C O   
3759 C  CB  . GLN C 62  ? 0.0929 0.0920 0.0922 -0.0107 0.0142  0.0033  62  GLN C CB  
3760 C  CG  . GLN C 62  ? 0.1081 0.1160 0.1022 -0.0084 0.0179  -0.0087 62  GLN C CG  
3761 C  CD  . GLN C 62  ? 0.1191 0.1271 0.1307 -0.0024 0.0049  -0.0078 62  GLN C CD  
3762 O  OE1 . GLN C 62  ? 0.1779 0.1800 0.1693 0.0055  0.0044  -0.0073 62  GLN C OE1 
3763 N  NE2 . GLN C 62  ? 0.1227 0.1315 0.1437 0.0055  0.0116  -0.0145 62  GLN C NE2 
3764 N  N   . LEU C 63  ? 0.0828 0.0955 0.0913 -0.0068 0.0036  0.0068  63  LEU C N   
3765 C  CA  . LEU C 63  ? 0.0711 0.0895 0.0916 -0.0050 0.0046  0.0074  63  LEU C CA  
3766 C  C   . LEU C 63  ? 0.0760 0.0961 0.0958 -0.0035 0.0001  0.0059  63  LEU C C   
3767 O  O   . LEU C 63  ? 0.0633 0.1034 0.0969 -0.0035 -0.0014 0.0146  63  LEU C O   
3768 C  CB  . LEU C 63  ? 0.0642 0.0810 0.0810 -0.0037 0.0019  0.0038  63  LEU C CB  
3769 C  CG  . LEU C 63  ? 0.0663 0.0894 0.0875 -0.0145 0.0047  0.0121  63  LEU C CG  
3770 C  CD1 . LEU C 63  ? 0.0446 0.0731 0.0960 -0.0121 0.0124  0.0060  63  LEU C CD1 
3771 C  CD2 . LEU C 63  ? 0.0341 0.0681 0.0666 -0.0182 0.0098  0.0017  63  LEU C CD2 
3772 N  N   . PRO C 64  ? 0.0761 0.1033 0.1011 0.0022  0.0010  0.0057  64  PRO C N   
3773 C  CA  . PRO C 64  ? 0.0780 0.0984 0.1002 0.0030  -0.0007 0.0041  64  PRO C CA  
3774 C  C   . PRO C 64  ? 0.0798 0.1105 0.1050 0.0000  -0.0010 0.0058  64  PRO C C   
3775 O  O   . PRO C 64  ? 0.0773 0.1101 0.1170 -0.0106 -0.0099 0.0036  64  PRO C O   
3776 C  CB  . PRO C 64  ? 0.0800 0.0995 0.0976 -0.0003 0.0014  0.0068  64  PRO C CB  
3777 C  CG  . PRO C 64  ? 0.0827 0.1001 0.1031 0.0084  0.0045  0.0043  64  PRO C CG  
3778 C  CD  . PRO C 64  ? 0.0797 0.0983 0.0969 0.0037  0.0045  0.0002  64  PRO C CD  
3779 N  N   . ALA C 65  ? 0.0771 0.1156 0.1023 -0.0018 -0.0057 0.0058  65  ALA C N   
3780 C  CA  . ALA C 65  ? 0.0728 0.1012 0.1004 -0.0021 -0.0028 0.0060  65  ALA C CA  
3781 C  C   . ALA C 65  ? 0.0723 0.1084 0.1002 -0.0035 -0.0039 0.0019  65  ALA C C   
3782 O  O   . ALA C 65  ? 0.0736 0.1179 0.1091 -0.0026 -0.0057 0.0063  65  ALA C O   
3783 C  CB  . ALA C 65  ? 0.0815 0.1087 0.1016 -0.0039 -0.0080 0.0051  65  ALA C CB  
3784 N  N   . ASP C 66  ? 0.0688 0.0910 0.1040 -0.0006 -0.0027 -0.0016 66  ASP C N   
3785 C  CA  . ASP C 66  ? 0.0777 0.1003 0.1042 0.0031  -0.0013 -0.0039 66  ASP C CA  
3786 C  C   . ASP C 66  ? 0.0713 0.0899 0.0955 0.0033  -0.0011 -0.0009 66  ASP C C   
3787 O  O   . ASP C 66  ? 0.0777 0.1068 0.1000 0.0076  -0.0091 -0.0060 66  ASP C O   
3788 C  CB  . ASP C 66  ? 0.0790 0.0865 0.1135 0.0074  -0.0018 -0.0029 66  ASP C CB  
3789 C  CG  . ASP C 66  ? 0.1242 0.1328 0.1390 0.0017  0.0032  -0.0074 66  ASP C CG  
3790 O  OD1 . ASP C 66  ? 0.1734 0.1723 0.1952 0.0082  0.0159  -0.0185 66  ASP C OD1 
3791 O  OD2 . ASP C 66  ? 0.1574 0.1335 0.1798 -0.0045 -0.0091 0.0012  66  ASP C OD2 
3792 N  N   . LYS C 67  ? 0.0655 0.0863 0.0833 0.0049  0.0001  -0.0007 67  LYS C N   
3793 C  CA  . LYS C 67  ? 0.0632 0.0808 0.0746 0.0022  -0.0038 0.0078  67  LYS C CA  
3794 C  C   . LYS C 67  ? 0.0645 0.0752 0.0729 -0.0003 -0.0037 0.0065  67  LYS C C   
3795 O  O   . LYS C 67  ? 0.0540 0.0814 0.0624 -0.0002 -0.0028 0.0087  67  LYS C O   
3796 C  CB  . LYS C 67  ? 0.0698 0.0754 0.0759 -0.0007 -0.0016 0.0120  67  LYS C CB  
3797 C  CG  . LYS C 67  ? 0.0700 0.0862 0.0907 0.0044  -0.0029 0.0009  67  LYS C CG  
3798 C  CD  . LYS C 67  ? 0.0807 0.0844 0.0859 0.0055  -0.0010 0.0050  67  LYS C CD  
3799 C  CE  . LYS C 67  ? 0.0957 0.0916 0.0786 0.0031  -0.0133 -0.0048 67  LYS C CE  
3800 N  NZ  . LYS C 67  ? 0.0970 0.0518 0.0949 -0.0112 -0.0056 0.0065  67  LYS C NZ  
3801 N  N   . LYS C 68  ? 0.0583 0.0743 0.0684 -0.0029 -0.0016 0.0036  68  LYS C N   
3802 C  CA  . LYS C 68  ? 0.0664 0.0811 0.0712 -0.0060 0.0011  0.0057  68  LYS C CA  
3803 C  C   . LYS C 68  ? 0.0569 0.0725 0.0641 -0.0040 0.0022  0.0076  68  LYS C C   
3804 O  O   . LYS C 68  ? 0.0599 0.0784 0.0653 -0.0023 0.0062  0.0123  68  LYS C O   
3805 C  CB  . LYS C 68  ? 0.0668 0.0796 0.0725 -0.0019 -0.0035 0.0052  68  LYS C CB  
3806 C  CG  . LYS C 68  ? 0.1079 0.1072 0.0930 0.0016  0.0038  0.0013  68  LYS C CG  
3807 C  CD  . LYS C 68  ? 0.1216 0.1271 0.1264 -0.0056 0.0041  -0.0043 68  LYS C CD  
3808 C  CE  . LYS C 68  ? 0.1371 0.1537 0.1341 0.0004  0.0112  -0.0114 68  LYS C CE  
3809 N  NZ  . LYS C 68  ? 0.1353 0.1753 0.1343 -0.0004 -0.0129 0.0000  68  LYS C NZ  
3810 N  N   . THR C 69  ? 0.0518 0.0734 0.0586 -0.0026 0.0066  0.0109  69  THR C N   
3811 C  CA  . THR C 69  ? 0.0422 0.0662 0.0495 -0.0077 0.0029  0.0134  69  THR C CA  
3812 C  C   . THR C 69  ? 0.0422 0.0589 0.0428 -0.0009 0.0000  0.0078  69  THR C C   
3813 O  O   . THR C 69  ? 0.0407 0.0618 0.0221 -0.0080 0.0003  0.0171  69  THR C O   
3814 C  CB  . THR C 69  ? 0.0311 0.0550 0.0565 0.0000  0.0044  0.0042  69  THR C CB  
3815 O  OG1 . THR C 69  ? 0.0357 0.0628 0.0542 -0.0117 0.0149  0.0065  69  THR C OG1 
3816 C  CG2 . THR C 69  ? 0.0323 0.0619 0.0487 0.0008  0.0001  0.0220  69  THR C CG2 
3817 N  N   . VAL C 70  ? 0.0411 0.0515 0.0354 -0.0048 -0.0044 0.0102  70  VAL C N   
3818 C  CA  . VAL C 70  ? 0.0391 0.0569 0.0510 -0.0056 0.0007  0.0041  70  VAL C CA  
3819 C  C   . VAL C 70  ? 0.0355 0.0514 0.0410 -0.0039 -0.0020 0.0080  70  VAL C C   
3820 O  O   . VAL C 70  ? 0.0213 0.0320 0.0393 -0.0147 0.0077  0.0105  70  VAL C O   
3821 C  CB  . VAL C 70  ? 0.0395 0.0578 0.0399 -0.0015 0.0027  0.0068  70  VAL C CB  
3822 C  CG1 . VAL C 70  ? 0.0440 0.0643 0.0711 -0.0028 0.0083  0.0116  70  VAL C CG1 
3823 C  CG2 . VAL C 70  ? 0.0462 0.0624 0.0377 -0.0092 0.0105  0.0079  70  VAL C CG2 
3824 N  N   . LEU C 71  ? 0.0231 0.0469 0.0365 -0.0071 0.0019  0.0046  71  LEU C N   
3825 C  CA  . LEU C 71  ? 0.0262 0.0559 0.0449 -0.0023 0.0000  0.0096  71  LEU C CA  
3826 C  C   . LEU C 71  ? 0.0310 0.0587 0.0399 -0.0044 -0.0008 0.0106  71  LEU C C   
3827 O  O   . LEU C 71  ? 0.0303 0.0612 0.0532 -0.0029 -0.0040 0.0222  71  LEU C O   
3828 C  CB  . LEU C 71  ? 0.0300 0.0558 0.0490 -0.0081 -0.0010 0.0023  71  LEU C CB  
3829 C  CG  . LEU C 71  ? 0.0179 0.0676 0.0493 -0.0122 0.0005  0.0097  71  LEU C CG  
3830 C  CD1 . LEU C 71  ? 0.0629 0.0758 0.0719 -0.0211 0.0231  0.0102  71  LEU C CD1 
3831 C  CD2 . LEU C 71  ? 0.0088 0.0460 0.0426 -0.0099 -0.0043 0.0136  71  LEU C CD2 
3832 N  N   . ARG C 72  ? 0.0208 0.0527 0.0350 -0.0126 0.0002  0.0046  72  ARG C N   
3833 C  CA  . ARG C 72  ? 0.0291 0.0646 0.0404 -0.0115 0.0011  0.0047  72  ARG C CA  
3834 C  C   . ARG C 72  ? 0.0331 0.0542 0.0365 -0.0101 -0.0010 0.0063  72  ARG C C   
3835 O  O   . ARG C 72  ? 0.0216 0.0482 0.0300 -0.0131 0.0018  0.0086  72  ARG C O   
3836 C  CB  . ARG C 72  ? 0.0182 0.0645 0.0309 -0.0118 0.0011  0.0093  72  ARG C CB  
3837 C  CG  . ARG C 72  ? 0.0279 0.0512 0.0284 -0.0076 -0.0081 -0.0074 72  ARG C CG  
3838 C  CD  . ARG C 72  ? 0.0084 0.0643 0.0175 -0.0040 0.0033  -0.0008 72  ARG C CD  
3839 N  NE  . ARG C 72  ? 0.0154 0.0434 0.0130 -0.0104 -0.0051 0.0005  72  ARG C NE  
3840 C  CZ  . ARG C 72  ? 0.0214 0.0657 0.0297 -0.0042 -0.0039 0.0049  72  ARG C CZ  
3841 N  NH1 . ARG C 72  ? 0.0327 0.0947 0.0465 -0.0311 0.0084  0.0305  72  ARG C NH1 
3842 N  NH2 . ARG C 72  ? 0.0338 0.0905 0.0299 -0.0232 -0.0116 0.0159  72  ARG C NH2 
3843 N  N   . ASN C 73  ? 0.0274 0.0522 0.0306 -0.0080 -0.0057 0.0102  73  ASN C N   
3844 C  CA  . ASN C 73  ? 0.0344 0.0555 0.0247 -0.0085 -0.0001 0.0100  73  ASN C CA  
3845 C  C   . ASN C 73  ? 0.0341 0.0522 0.0252 0.0004  0.0005  0.0110  73  ASN C C   
3846 O  O   . ASN C 73  ? 0.0463 0.0662 0.0284 -0.0033 -0.0051 0.0183  73  ASN C O   
3847 C  CB  . ASN C 73  ? 0.0102 0.0438 0.0148 -0.0047 0.0016  0.0092  73  ASN C CB  
3848 C  CG  . ASN C 73  ? 0.0156 0.0408 0.0228 -0.0100 0.0080  0.0021  73  ASN C CG  
3849 O  OD1 . ASN C 73  ? 0.0118 0.0473 0.0159 -0.0100 0.0049  0.0018  73  ASN C OD1 
3850 N  ND2 . ASN C 73  ? 0.0082 0.0173 0.0133 -0.0046 -0.0037 0.0087  73  ASN C ND2 
3851 N  N   . ASN C 74  ? 0.0496 0.0639 0.0351 -0.0055 0.0002  0.0068  74  ASN C N   
3852 C  CA  . ASN C 74  ? 0.0367 0.0476 0.0288 -0.0001 0.0024  0.0013  74  ASN C CA  
3853 C  C   . ASN C 74  ? 0.0465 0.0545 0.0366 -0.0081 0.0045  0.0039  74  ASN C C   
3854 O  O   . ASN C 74  ? 0.0184 0.0321 0.0253 -0.0070 0.0140  -0.0005 74  ASN C O   
3855 C  CB  . ASN C 74  ? 0.0469 0.0484 0.0249 0.0061  0.0024  0.0004  74  ASN C CB  
3856 C  CG  . ASN C 74  ? 0.0420 0.0473 0.0446 -0.0060 -0.0018 0.0075  74  ASN C CG  
3857 O  OD1 . ASN C 74  ? 0.0391 0.0430 0.0358 0.0142  0.0072  -0.0029 74  ASN C OD1 
3858 N  ND2 . ASN C 74  ? 0.0573 0.0503 0.0351 0.0017  0.0057  0.0024  74  ASN C ND2 
3859 N  N   . ALA C 75  ? 0.0338 0.0354 0.0184 -0.0130 0.0088  0.0103  75  ALA C N   
3860 C  CA  . ALA C 75  ? 0.0352 0.0419 0.0265 -0.0128 0.0050  0.0040  75  ALA C CA  
3861 C  C   . ALA C 75  ? 0.0300 0.0293 0.0197 -0.0146 0.0032  0.0113  75  ALA C C   
3862 O  O   . ALA C 75  ? 0.0292 0.0411 0.0146 -0.0233 0.0021  0.0071  75  ALA C O   
3863 C  CB  . ALA C 75  ? 0.0332 0.0149 0.0223 -0.0063 0.0031  0.0098  75  ALA C CB  
3864 N  N   . GLY C 76  ? 0.0352 0.0407 0.0240 -0.0109 0.0021  0.0106  76  GLY C N   
3865 C  CA  . GLY C 76  ? 0.0219 0.0285 0.0205 -0.0058 0.0037  0.0148  76  GLY C CA  
3866 C  C   . GLY C 76  ? 0.0194 0.0410 0.0276 -0.0055 0.0018  0.0110  76  GLY C C   
3867 O  O   . GLY C 76  ? 0.0063 0.0303 0.0229 -0.0002 -0.0002 0.0199  76  GLY C O   
3868 N  N   . GLY C 77  ? 0.0085 0.0471 0.0172 -0.0095 -0.0009 0.0062  77  GLY C N   
3869 C  CA  . GLY C 77  ? 0.0114 0.0486 0.0203 -0.0114 -0.0003 0.0093  77  GLY C CA  
3870 C  C   . GLY C 77  ? 0.0145 0.0499 0.0218 -0.0059 -0.0011 0.0114  77  GLY C C   
3871 O  O   . GLY C 77  ? 0.0075 0.0506 0.0223 -0.0073 -0.0016 0.0121  77  GLY C O   
3872 N  N   . HIS C 78  ? 0.0116 0.0466 0.0231 -0.0119 0.0021  0.0099  78  HIS C N   
3873 C  CA  . HIS C 78  ? 0.0169 0.0476 0.0201 -0.0064 0.0052  0.0096  78  HIS C CA  
3874 C  C   . HIS C 78  ? 0.0188 0.0428 0.0166 -0.0061 0.0029  0.0075  78  HIS C C   
3875 O  O   . HIS C 78  ? 0.0109 0.0516 0.0132 -0.0115 -0.0003 0.0114  78  HIS C O   
3876 C  CB  . HIS C 78  ? 0.0191 0.0436 0.0187 -0.0087 0.0062  0.0115  78  HIS C CB  
3877 C  CG  . HIS C 78  ? 0.0068 0.0346 0.0073 -0.0038 -0.0002 0.0026  78  HIS C CG  
3878 N  ND1 . HIS C 78  ? 0.0213 0.0419 0.0364 -0.0076 0.0063  0.0097  78  HIS C ND1 
3879 C  CD2 . HIS C 78  ? 0.0181 0.0433 0.0154 0.0123  -0.0016 0.0129  78  HIS C CD2 
3880 C  CE1 . HIS C 78  ? 0.0349 0.0699 0.0097 -0.0189 0.0044  0.0087  78  HIS C CE1 
3881 N  NE2 . HIS C 78  ? 0.0108 0.0549 0.0090 -0.0147 -0.0032 0.0099  78  HIS C NE2 
3882 N  N   . ALA C 79  ? 0.0164 0.0474 0.0189 -0.0077 0.0037  0.0057  79  ALA C N   
3883 C  CA  . ALA C 79  ? 0.0253 0.0444 0.0216 -0.0103 0.0069  0.0032  79  ALA C CA  
3884 C  C   . ALA C 79  ? 0.0302 0.0508 0.0210 -0.0084 0.0037  -0.0026 79  ALA C C   
3885 O  O   . ALA C 79  ? 0.0405 0.0428 0.0090 0.0016  0.0026  -0.0022 79  ALA C O   
3886 C  CB  . ALA C 79  ? 0.0242 0.0434 0.0141 -0.0075 -0.0085 -0.0018 79  ALA C CB  
3887 N  N   . ASN C 80  ? 0.0381 0.0615 0.0276 -0.0083 0.0029  -0.0011 80  ASN C N   
3888 C  CA  . ASN C 80  ? 0.0255 0.0446 0.0242 -0.0088 0.0057  0.0039  80  ASN C CA  
3889 C  C   . ASN C 80  ? 0.0310 0.0492 0.0184 -0.0070 -0.0023 0.0048  80  ASN C C   
3890 O  O   . ASN C 80  ? 0.0084 0.0426 0.0141 -0.0056 -0.0008 0.0149  80  ASN C O   
3891 C  CB  . ASN C 80  ? 0.0244 0.0554 0.0127 -0.0067 -0.0042 -0.0073 80  ASN C CB  
3892 C  CG  . ASN C 80  ? 0.0387 0.0545 0.0344 -0.0156 -0.0023 0.0025  80  ASN C CG  
3893 O  OD1 . ASN C 80  ? 0.0436 0.0223 0.0076 -0.0050 -0.0065 0.0023  80  ASN C OD1 
3894 N  ND2 . ASN C 80  ? 0.0192 0.0431 0.0396 -0.0123 -0.0015 -0.0027 80  ASN C ND2 
3895 N  N   . HIS C 81  ? 0.0176 0.0354 0.0248 -0.0123 0.0053  0.0099  81  HIS C N   
3896 C  CA  . HIS C 81  ? 0.0221 0.0395 0.0221 -0.0086 0.0044  0.0141  81  HIS C CA  
3897 C  C   . HIS C 81  ? 0.0260 0.0403 0.0247 -0.0108 0.0049  0.0155  81  HIS C C   
3898 O  O   . HIS C 81  ? 0.0292 0.0292 0.0185 -0.0072 0.0109  0.0084  81  HIS C O   
3899 C  CB  . HIS C 81  ? 0.0143 0.0448 0.0200 -0.0080 0.0054  0.0119  81  HIS C CB  
3900 C  CG  . HIS C 81  ? 0.0231 0.0333 0.0296 -0.0042 0.0077  0.0207  81  HIS C CG  
3901 N  ND1 . HIS C 81  ? 0.0284 0.0418 0.0257 -0.0225 0.0019  0.0136  81  HIS C ND1 
3902 C  CD2 . HIS C 81  ? 0.0351 0.0546 0.0345 -0.0226 0.0152  0.0127  81  HIS C CD2 
3903 C  CE1 . HIS C 81  ? 0.0507 0.0601 0.0273 -0.0076 -0.0125 0.0050  81  HIS C CE1 
3904 N  NE2 . HIS C 81  ? 0.0387 0.0409 0.0223 -0.0172 0.0036  0.0180  81  HIS C NE2 
3905 N  N   . SER C 82  ? 0.0285 0.0278 0.0211 -0.0157 0.0030  0.0100  82  SER C N   
3906 C  CA  . SER C 82  ? 0.0306 0.0385 0.0261 -0.0128 0.0098  0.0087  82  SER C CA  
3907 C  C   . SER C 82  ? 0.0315 0.0411 0.0277 -0.0083 0.0058  0.0071  82  SER C C   
3908 O  O   . SER C 82  ? 0.0291 0.0597 0.0229 -0.0065 0.0097  0.0031  82  SER C O   
3909 C  CB  . SER C 82  ? 0.0286 0.0336 0.0301 -0.0199 0.0087  0.0060  82  SER C CB  
3910 O  OG  . SER C 82  ? 0.0397 0.0296 0.0282 -0.0274 0.0023  0.0020  82  SER C OG  
3911 N  N   . LEU C 83  ? 0.0288 0.0420 0.0302 -0.0011 0.0038  0.0102  83  LEU C N   
3912 C  CA  . LEU C 83  ? 0.0391 0.0429 0.0417 -0.0025 -0.0036 0.0053  83  LEU C CA  
3913 C  C   . LEU C 83  ? 0.0421 0.0550 0.0442 0.0071  0.0013  0.0066  83  LEU C C   
3914 O  O   . LEU C 83  ? 0.0456 0.0707 0.0478 0.0140  -0.0069 0.0030  83  LEU C O   
3915 C  CB  . LEU C 83  ? 0.0361 0.0436 0.0341 0.0012  0.0017  0.0080  83  LEU C CB  
3916 C  CG  . LEU C 83  ? 0.0619 0.0594 0.0651 -0.0008 -0.0020 0.0074  83  LEU C CG  
3917 C  CD1 . LEU C 83  ? 0.0485 0.0542 0.0897 0.0002  0.0027  -0.0042 83  LEU C CD1 
3918 C  CD2 . LEU C 83  ? 0.0427 0.0856 0.0662 0.0064  0.0014  0.0197  83  LEU C CD2 
3919 N  N   . PHE C 84  ? 0.0482 0.0607 0.0577 -0.0019 0.0008  0.0048  84  PHE C N   
3920 C  CA  . PHE C 84  ? 0.0359 0.0460 0.0423 0.0017  0.0044  0.0086  84  PHE C CA  
3921 C  C   . PHE C 84  ? 0.0421 0.0558 0.0419 -0.0015 0.0011  0.0055  84  PHE C C   
3922 O  O   . PHE C 84  ? 0.0293 0.0632 0.0409 0.0073  0.0019  0.0156  84  PHE C O   
3923 C  CB  . PHE C 84  ? 0.0313 0.0353 0.0362 -0.0037 -0.0008 0.0149  84  PHE C CB  
3924 C  CG  . PHE C 84  ? 0.0093 0.0116 0.0348 -0.0006 0.0075  -0.0087 84  PHE C CG  
3925 C  CD1 . PHE C 84  ? 0.0091 0.0165 0.0150 -0.0053 -0.0049 0.0093  84  PHE C CD1 
3926 C  CD2 . PHE C 84  ? 0.0127 0.0197 0.0233 -0.0087 0.0034  -0.0001 84  PHE C CD2 
3927 C  CE1 . PHE C 84  ? 0.0066 0.0134 0.0144 0.0011  -0.0014 -0.0073 84  PHE C CE1 
3928 C  CE2 . PHE C 84  ? 0.0066 0.0165 0.0306 -0.0018 -0.0027 0.0157  84  PHE C CE2 
3929 C  CZ  . PHE C 84  ? 0.0346 0.0142 0.0239 -0.0128 -0.0148 0.0113  84  PHE C CZ  
3930 N  N   . TRP C 85  ? 0.0398 0.0631 0.0453 -0.0054 0.0067  0.0082  85  TRP C N   
3931 C  CA  . TRP C 85  ? 0.0384 0.0637 0.0415 -0.0046 0.0019  0.0055  85  TRP C CA  
3932 C  C   . TRP C 85  ? 0.0477 0.0584 0.0497 -0.0029 0.0032  0.0059  85  TRP C C   
3933 O  O   . TRP C 85  ? 0.0367 0.0532 0.0463 -0.0140 0.0011  0.0062  85  TRP C O   
3934 C  CB  . TRP C 85  ? 0.0453 0.0637 0.0418 -0.0020 0.0070  0.0072  85  TRP C CB  
3935 C  CG  . TRP C 85  ? 0.0229 0.0550 0.0304 -0.0025 0.0003  -0.0043 85  TRP C CG  
3936 C  CD1 . TRP C 85  ? 0.0138 0.0331 0.0283 -0.0142 0.0002  -0.0002 85  TRP C CD1 
3937 C  CD2 . TRP C 85  ? 0.0163 0.0607 0.0349 0.0014  0.0145  0.0098  85  TRP C CD2 
3938 N  NE1 . TRP C 85  ? 0.0070 0.0562 0.0237 -0.0013 -0.0034 0.0045  85  TRP C NE1 
3939 C  CE2 . TRP C 85  ? 0.0067 0.0441 0.0214 0.0037  0.0002  -0.0015 85  TRP C CE2 
3940 C  CE3 . TRP C 85  ? 0.0240 0.0683 0.0160 -0.0143 0.0088  0.0092  85  TRP C CE3 
3941 C  CZ2 . TRP C 85  ? 0.0160 0.0505 0.0155 -0.0203 0.0053  -0.0080 85  TRP C CZ2 
3942 C  CZ3 . TRP C 85  ? 0.0275 0.0654 0.0408 0.0012  -0.0005 -0.0003 85  TRP C CZ3 
3943 C  CH2 . TRP C 85  ? 0.0321 0.0593 0.0088 -0.0039 -0.0046 0.0030  85  TRP C CH2 
3944 N  N   . LYS C 86  ? 0.0513 0.0618 0.0559 -0.0045 -0.0005 0.0054  86  LYS C N   
3945 C  CA  . LYS C 86  ? 0.0631 0.0714 0.0713 0.0010  0.0033  0.0089  86  LYS C CA  
3946 C  C   . LYS C 86  ? 0.0746 0.0723 0.0796 0.0010  0.0023  0.0081  86  LYS C C   
3947 O  O   . LYS C 86  ? 0.0684 0.0899 0.0817 -0.0019 0.0101  0.0069  86  LYS C O   
3948 C  CB  . LYS C 86  ? 0.0616 0.0658 0.0800 0.0056  -0.0046 0.0106  86  LYS C CB  
3949 C  CG  . LYS C 86  ? 0.0808 0.0566 0.0780 -0.0029 0.0028  0.0128  86  LYS C CG  
3950 C  CD  . LYS C 86  ? 0.0598 0.1004 0.0831 -0.0163 0.0080  0.0128  86  LYS C CD  
3951 C  CE  . LYS C 86  ? 0.1036 0.1178 0.0976 -0.0134 0.0143  0.0106  86  LYS C CE  
3952 N  NZ  . LYS C 86  ? 0.1457 0.1258 0.1552 -0.0209 0.0286  0.0213  86  LYS C NZ  
3953 N  N   . GLY C 87  ? 0.0753 0.0741 0.0666 0.0002  0.0024  0.0071  87  GLY C N   
3954 C  CA  . GLY C 87  ? 0.0674 0.0626 0.0663 -0.0068 0.0078  0.0113  87  GLY C CA  
3955 C  C   . GLY C 87  ? 0.0618 0.0610 0.0584 -0.0046 0.0056  0.0103  87  GLY C C   
3956 O  O   . GLY C 87  ? 0.0621 0.0576 0.0620 -0.0014 0.0089  0.0132  87  GLY C O   
3957 N  N   . LEU C 88  ? 0.0482 0.0729 0.0629 0.0024  0.0050  0.0138  88  LEU C N   
3958 C  CA  . LEU C 88  ? 0.0527 0.0705 0.0572 -0.0015 -0.0030 0.0121  88  LEU C CA  
3959 C  C   . LEU C 88  ? 0.0590 0.0860 0.0694 0.0024  -0.0019 0.0076  88  LEU C C   
3960 O  O   . LEU C 88  ? 0.0662 0.1127 0.0893 0.0019  -0.0024 0.0122  88  LEU C O   
3961 C  CB  . LEU C 88  ? 0.0398 0.0728 0.0537 0.0053  -0.0042 0.0138  88  LEU C CB  
3962 C  CG  . LEU C 88  ? 0.0430 0.0504 0.0186 0.0055  -0.0057 0.0213  88  LEU C CG  
3963 C  CD1 . LEU C 88  ? 0.0399 0.0460 0.0190 -0.0104 0.0022  -0.0016 88  LEU C CD1 
3964 C  CD2 . LEU C 88  ? 0.0569 0.0549 0.0309 -0.0013 0.0110  0.0019  88  LEU C CD2 
3965 N  N   . LYS C 89  ? 0.0583 0.0987 0.0805 -0.0037 -0.0043 0.0105  89  LYS C N   
3966 C  CA  . LYS C 89  ? 0.0757 0.1011 0.0931 0.0002  0.0000  0.0127  89  LYS C CA  
3967 C  C   . LYS C 89  ? 0.0781 0.0994 0.0902 -0.0011 -0.0004 0.0070  89  LYS C C   
3968 O  O   . LYS C 89  ? 0.0817 0.1034 0.0935 -0.0061 0.0061  0.0121  89  LYS C O   
3969 C  CB  . LYS C 89  ? 0.0776 0.1033 0.0977 0.0022  -0.0038 0.0098  89  LYS C CB  
3970 C  CG  . LYS C 89  ? 0.0900 0.1245 0.1143 0.0014  -0.0111 0.0046  89  LYS C CG  
3971 C  CD  . LYS C 89  ? 0.1244 0.1433 0.1455 0.0077  -0.0067 0.0049  89  LYS C CD  
3972 C  CE  . LYS C 89  ? 0.1465 0.1750 0.1685 -0.0014 -0.0156 0.0042  89  LYS C CE  
3973 N  NZ  . LYS C 89  ? 0.1597 0.1886 0.1795 0.0014  -0.0091 -0.0004 89  LYS C NZ  
3974 N  N   . LYS C 90  ? 0.0857 0.0997 0.0928 -0.0031 -0.0012 0.0048  90  LYS C N   
3975 C  CA  . LYS C 90  ? 0.0946 0.0983 0.0977 -0.0016 0.0014  0.0072  90  LYS C CA  
3976 C  C   . LYS C 90  ? 0.0887 0.0959 0.0934 -0.0012 -0.0006 0.0079  90  LYS C C   
3977 O  O   . LYS C 90  ? 0.0894 0.0957 0.1084 0.0015  -0.0009 0.0172  90  LYS C O   
3978 C  CB  . LYS C 90  ? 0.0932 0.0955 0.1037 -0.0040 -0.0018 0.0048  90  LYS C CB  
3979 C  CG  . LYS C 90  ? 0.1076 0.1036 0.1125 0.0011  -0.0061 0.0122  90  LYS C CG  
3980 C  CD  . LYS C 90  ? 0.1191 0.1048 0.1202 -0.0008 0.0031  0.0118  90  LYS C CD  
3981 C  CE  . LYS C 90  ? 0.1272 0.1220 0.1301 -0.0137 0.0000  0.0101  90  LYS C CE  
3982 N  NZ  . LYS C 90  ? 0.1453 0.1115 0.1475 -0.0188 -0.0058 0.0084  90  LYS C NZ  
3983 N  N   . GLY C 91  ? 0.0825 0.0981 0.1024 0.0018  0.0028  0.0067  91  GLY C N   
3984 C  CA  . GLY C 91  ? 0.0934 0.1044 0.1054 0.0038  0.0075  0.0060  91  GLY C CA  
3985 C  C   . GLY C 91  ? 0.0904 0.1027 0.1109 0.0043  0.0058  0.0086  91  GLY C C   
3986 O  O   . GLY C 91  ? 0.1118 0.1140 0.1286 0.0081  0.0114  0.0087  91  GLY C O   
3987 N  N   . THR C 92  ? 0.0840 0.1070 0.1102 0.0024  0.0074  0.0091  92  THR C N   
3988 C  CA  . THR C 92  ? 0.0764 0.0988 0.0952 0.0022  0.0047  0.0012  92  THR C CA  
3989 C  C   . THR C 92  ? 0.0784 0.0960 0.0914 0.0045  0.0063  0.0020  92  THR C C   
3990 O  O   . THR C 92  ? 0.0664 0.0907 0.0756 0.0044  0.0164  -0.0051 92  THR C O   
3991 C  CB  . THR C 92  ? 0.0808 0.1091 0.1013 0.0055  0.0053  0.0029  92  THR C CB  
3992 O  OG1 . THR C 92  ? 0.0847 0.1238 0.0967 -0.0037 -0.0017 0.0122  92  THR C OG1 
3993 C  CG2 . THR C 92  ? 0.0823 0.1039 0.0950 0.0025  -0.0079 0.0041  92  THR C CG2 
3994 N  N   . THR C 93  ? 0.0835 0.1081 0.1009 -0.0026 0.0054  0.0030  93  THR C N   
3995 C  CA  . THR C 93  ? 0.0935 0.1148 0.1113 0.0022  0.0040  0.0014  93  THR C CA  
3996 C  C   . THR C 93  ? 0.0921 0.1117 0.1068 0.0045  0.0071  0.0047  93  THR C C   
3997 O  O   . THR C 93  ? 0.0781 0.1092 0.1183 0.0095  0.0137  0.0082  93  THR C O   
3998 C  CB  . THR C 93  ? 0.1045 0.1241 0.1171 0.0013  0.0079  0.0012  93  THR C CB  
3999 O  OG1 . THR C 93  ? 0.1324 0.1462 0.1528 -0.0039 0.0016  0.0042  93  THR C OG1 
4000 C  CG2 . THR C 93  ? 0.1279 0.1271 0.1241 -0.0048 -0.0003 -0.0035 93  THR C CG2 
4001 N  N   . LEU C 94  ? 0.0791 0.1111 0.1091 0.0082  0.0051  0.0026  94  LEU C N   
4002 C  CA  . LEU C 94  ? 0.0885 0.0954 0.1012 0.0047  0.0083  0.0018  94  LEU C CA  
4003 C  C   . LEU C 94  ? 0.0925 0.0936 0.1038 0.0076  0.0092  0.0013  94  LEU C C   
4004 O  O   . LEU C 94  ? 0.1034 0.0971 0.1257 0.0103  0.0140  -0.0034 94  LEU C O   
4005 C  CB  . LEU C 94  ? 0.0796 0.0983 0.1038 0.0018  0.0079  0.0068  94  LEU C CB  
4006 C  CG  . LEU C 94  ? 0.0971 0.0937 0.0947 0.0049  0.0112  -0.0055 94  LEU C CG  
4007 C  CD1 . LEU C 94  ? 0.1170 0.0910 0.0752 0.0049  0.0173  -0.0004 94  LEU C CD1 
4008 C  CD2 . LEU C 94  ? 0.1119 0.0961 0.0876 -0.0013 0.0080  0.0024  94  LEU C CD2 
4009 N  N   . GLN C 95  ? 0.1067 0.1023 0.1192 0.0103  0.0072  0.0000  95  GLN C N   
4010 C  CA  . GLN C 95  ? 0.1220 0.1034 0.1202 0.0076  0.0047  0.0014  95  GLN C CA  
4011 C  C   . GLN C 95  ? 0.1221 0.1090 0.1255 0.0065  0.0098  0.0010  95  GLN C C   
4012 O  O   . GLN C 95  ? 0.1356 0.1175 0.1467 0.0091  0.0124  0.0040  95  GLN C O   
4013 C  CB  . GLN C 95  ? 0.1221 0.1107 0.1235 0.0069  0.0082  0.0032  95  GLN C CB  
4014 C  CG  . GLN C 95  ? 0.1382 0.1058 0.1343 0.0146  0.0032  -0.0029 95  GLN C CG  
4015 C  CD  . GLN C 95  ? 0.1536 0.1487 0.1549 0.0129  -0.0047 -0.0082 95  GLN C CD  
4016 O  OE1 . GLN C 95  ? 0.1887 0.1708 0.2156 0.0189  -0.0022 0.0043  95  GLN C OE1 
4017 N  NE2 . GLN C 95  ? 0.1377 0.1452 0.1805 0.0069  0.0097  -0.0002 95  GLN C NE2 
4018 N  N   . GLY C 96  ? 0.1303 0.1141 0.1255 0.0043  0.0043  0.0052  96  GLY C N   
4019 C  CA  . GLY C 96  ? 0.1186 0.1067 0.1209 0.0038  0.0004  0.0035  96  GLY C CA  
4020 C  C   . GLY C 96  ? 0.1183 0.1117 0.1164 0.0061  0.0032  0.0058  96  GLY C C   
4021 O  O   . GLY C 96  ? 0.1227 0.1081 0.1161 0.0085  0.0048  0.0038  96  GLY C O   
4022 N  N   . ASP C 97  ? 0.1169 0.1105 0.1134 0.0089  0.0033  0.0058  97  ASP C N   
4023 C  CA  . ASP C 97  ? 0.1166 0.1028 0.1121 0.0044  0.0001  0.0019  97  ASP C CA  
4024 C  C   . ASP C 97  ? 0.1101 0.1029 0.1092 0.0068  -0.0017 0.0047  97  ASP C C   
4025 O  O   . ASP C 97  ? 0.1094 0.1066 0.1140 0.0079  -0.0001 0.0085  97  ASP C O   
4026 C  CB  . ASP C 97  ? 0.1219 0.1103 0.1161 0.0010  0.0028  0.0002  97  ASP C CB  
4027 C  CG  . ASP C 97  ? 0.1301 0.1089 0.1181 -0.0017 0.0037  -0.0006 97  ASP C CG  
4028 O  OD1 . ASP C 97  ? 0.1622 0.1234 0.1462 0.0093  0.0115  -0.0128 97  ASP C OD1 
4029 O  OD2 . ASP C 97  ? 0.1618 0.1219 0.1408 -0.0117 0.0106  -0.0109 97  ASP C OD2 
4030 N  N   . LEU C 98  ? 0.1097 0.1018 0.1083 0.0095  0.0003  0.0059  98  LEU C N   
4031 C  CA  . LEU C 98  ? 0.1009 0.1029 0.1117 0.0101  0.0024  0.0046  98  LEU C CA  
4032 C  C   . LEU C 98  ? 0.0966 0.1055 0.1075 0.0071  0.0026  0.0030  98  LEU C C   
4033 O  O   . LEU C 98  ? 0.1078 0.1249 0.1194 0.0082  0.0112  0.0038  98  LEU C O   
4034 C  CB  . LEU C 98  ? 0.1070 0.1031 0.1217 0.0074  0.0047  0.0033  98  LEU C CB  
4035 C  CG  . LEU C 98  ? 0.1046 0.0957 0.1161 0.0082  -0.0048 0.0090  98  LEU C CG  
4036 C  CD1 . LEU C 98  ? 0.1075 0.1113 0.1349 0.0076  0.0076  -0.0011 98  LEU C CD1 
4037 C  CD2 . LEU C 98  ? 0.1150 0.1077 0.1214 -0.0002 0.0032  0.0073  98  LEU C CD2 
4038 N  N   . LYS C 99  ? 0.1074 0.1081 0.1075 0.0092  0.0049  0.0007  99  LYS C N   
4039 C  CA  . LYS C 99  ? 0.1027 0.1026 0.1112 0.0046  0.0022  0.0030  99  LYS C CA  
4040 C  C   . LYS C 99  ? 0.1038 0.1031 0.1114 0.0051  0.0025  0.0025  99  LYS C C   
4041 O  O   . LYS C 99  ? 0.1023 0.1072 0.1221 0.0052  -0.0021 0.0020  99  LYS C O   
4042 C  CB  . LYS C 99  ? 0.1014 0.1011 0.1082 0.0037  0.0088  -0.0058 99  LYS C CB  
4043 C  CG  . LYS C 99  ? 0.1199 0.1196 0.1157 -0.0001 -0.0060 0.0012  99  LYS C CG  
4044 C  CD  . LYS C 99  ? 0.1026 0.1391 0.1262 -0.0057 -0.0042 -0.0082 99  LYS C CD  
4045 C  CE  . LYS C 99  ? 0.1145 0.1245 0.1275 0.0002  -0.0148 0.0008  99  LYS C CE  
4046 N  NZ  . LYS C 99  ? 0.1181 0.1537 0.1370 -0.0004 -0.0158 0.0022  99  LYS C NZ  
4047 N  N   . ALA C 100 ? 0.1076 0.1008 0.1177 0.0028  0.0018  0.0047  100 ALA C N   
4048 C  CA  . ALA C 100 ? 0.1130 0.1034 0.1225 0.0020  -0.0024 0.0040  100 ALA C CA  
4049 C  C   . ALA C 100 ? 0.1127 0.1035 0.1235 0.0008  -0.0020 0.0041  100 ALA C C   
4050 O  O   . ALA C 100 ? 0.1322 0.1176 0.1374 -0.0043 0.0022  0.0031  100 ALA C O   
4051 C  CB  . ALA C 100 ? 0.1011 0.0999 0.1218 0.0040  -0.0027 0.0051  100 ALA C CB  
4052 N  N   . ALA C 101 ? 0.1076 0.1045 0.1244 0.0014  -0.0022 0.0071  101 ALA C N   
4053 C  CA  . ALA C 101 ? 0.1103 0.1040 0.1234 0.0048  0.0017  0.0035  101 ALA C CA  
4054 C  C   . ALA C 101 ? 0.1048 0.0956 0.1171 0.0057  0.0013  -0.0012 101 ALA C C   
4055 O  O   . ALA C 101 ? 0.1100 0.0910 0.1132 0.0121  -0.0009 -0.0040 101 ALA C O   
4056 C  CB  . ALA C 101 ? 0.1158 0.1042 0.1174 0.0029  0.0009  0.0048  101 ALA C CB  
4057 N  N   . ILE C 102 ? 0.1077 0.1066 0.1170 0.0029  0.0056  0.0000  102 ILE C N   
4058 C  CA  . ILE C 102 ? 0.1095 0.1027 0.1185 -0.0055 0.0049  -0.0017 102 ILE C CA  
4059 C  C   . ILE C 102 ? 0.1058 0.1032 0.1185 -0.0092 -0.0019 0.0017  102 ILE C C   
4060 O  O   . ILE C 102 ? 0.0948 0.1033 0.1277 -0.0077 -0.0067 0.0108  102 ILE C O   
4061 C  CB  . ILE C 102 ? 0.1104 0.1049 0.1135 -0.0075 0.0081  -0.0060 102 ILE C CB  
4062 C  CG1 . ILE C 102 ? 0.0989 0.0828 0.1036 -0.0084 -0.0017 -0.0090 102 ILE C CG1 
4063 C  CG2 . ILE C 102 ? 0.1317 0.1203 0.1155 0.0046  0.0062  -0.0026 102 ILE C CG2 
4064 C  CD1 . ILE C 102 ? 0.0846 0.0761 0.0988 0.0006  -0.0131 -0.0039 102 ILE C CD1 
4065 N  N   . GLU C 103 ? 0.1119 0.0992 0.1204 -0.0072 -0.0002 0.0013  103 GLU C N   
4066 C  CA  . GLU C 103 ? 0.1199 0.1152 0.1292 -0.0049 0.0006  0.0001  103 GLU C CA  
4067 C  C   . GLU C 103 ? 0.1162 0.1108 0.1231 -0.0049 0.0014  0.0002  103 GLU C C   
4068 O  O   . GLU C 103 ? 0.1176 0.1125 0.1298 -0.0098 0.0000  0.0000  103 GLU C O   
4069 C  CB  . GLU C 103 ? 0.1249 0.1232 0.1331 -0.0025 -0.0016 0.0010  103 GLU C CB  
4070 C  CG  . GLU C 103 ? 0.1400 0.1351 0.1536 -0.0077 0.0002  0.0033  103 GLU C CG  
4071 C  CD  . GLU C 103 ? 0.1545 0.1544 0.1744 -0.0010 0.0057  -0.0002 103 GLU C CD  
4072 O  OE1 . GLU C 103 ? 0.1779 0.1685 0.1764 -0.0062 -0.0044 0.0092  103 GLU C OE1 
4073 O  OE2 . GLU C 103 ? 0.1383 0.1589 0.1693 -0.0027 0.0100  -0.0169 103 GLU C OE2 
4074 N  N   . ARG C 104 ? 0.1222 0.1179 0.1209 -0.0003 0.0031  0.0033  104 ARG C N   
4075 C  CA  . ARG C 104 ? 0.1250 0.1166 0.1178 0.0023  0.0033  -0.0004 104 ARG C CA  
4076 C  C   . ARG C 104 ? 0.1254 0.1154 0.1191 0.0014  0.0013  -0.0028 104 ARG C C   
4077 O  O   . ARG C 104 ? 0.1277 0.1212 0.1090 0.0011  0.0012  -0.0028 104 ARG C O   
4078 C  CB  . ARG C 104 ? 0.1319 0.1178 0.1239 0.0063  -0.0004 0.0049  104 ARG C CB  
4079 C  CG  . ARG C 104 ? 0.1456 0.1267 0.1318 0.0023  0.0053  0.0021  104 ARG C CG  
4080 C  CD  . ARG C 104 ? 0.1835 0.1534 0.1579 -0.0071 0.0041  0.0040  104 ARG C CD  
4081 N  NE  . ARG C 104 ? 0.1948 0.1792 0.1689 -0.0037 0.0031  0.0004  104 ARG C NE  
4082 C  CZ  . ARG C 104 ? 0.1970 0.1804 0.1784 -0.0035 0.0050  -0.0007 104 ARG C CZ  
4083 N  NH1 . ARG C 104 ? 0.2090 0.1855 0.2075 -0.0073 0.0043  0.0026  104 ARG C NH1 
4084 N  NH2 . ARG C 104 ? 0.2001 0.1794 0.1785 0.0062  0.0137  -0.0071 104 ARG C NH2 
4085 N  N   . ASP C 105 ? 0.1242 0.1128 0.1169 -0.0032 0.0040  -0.0062 105 ASP C N   
4086 C  CA  . ASP C 105 ? 0.1224 0.1092 0.1178 -0.0039 0.0027  -0.0015 105 ASP C CA  
4087 C  C   . ASP C 105 ? 0.1181 0.1111 0.1178 -0.0022 0.0016  0.0008  105 ASP C C   
4088 O  O   . ASP C 105 ? 0.1097 0.1053 0.1168 -0.0015 0.0026  0.0037  105 ASP C O   
4089 C  CB  . ASP C 105 ? 0.1367 0.1127 0.1194 -0.0053 0.0061  -0.0068 105 ASP C CB  
4090 C  CG  . ASP C 105 ? 0.1678 0.1303 0.1370 -0.0031 0.0042  0.0006  105 ASP C CG  
4091 O  OD1 . ASP C 105 ? 0.2091 0.1504 0.1941 -0.0002 0.0006  -0.0096 105 ASP C OD1 
4092 O  OD2 . ASP C 105 ? 0.2001 0.1551 0.1439 -0.0041 0.0055  -0.0163 105 ASP C OD2 
4093 N  N   . PHE C 106 ? 0.1156 0.1092 0.1202 -0.0032 0.0045  0.0015  106 PHE C N   
4094 C  CA  . PHE C 106 ? 0.1189 0.1060 0.1126 0.0000  0.0044  -0.0007 106 PHE C CA  
4095 C  C   . PHE C 106 ? 0.1259 0.1093 0.1190 0.0008  0.0056  0.0002  106 PHE C C   
4096 O  O   . PHE C 106 ? 0.1397 0.1105 0.1234 0.0043  0.0071  -0.0022 106 PHE C O   
4097 C  CB  . PHE C 106 ? 0.1195 0.1145 0.1215 -0.0034 0.0051  -0.0033 106 PHE C CB  
4098 C  CG  . PHE C 106 ? 0.1069 0.1050 0.1172 -0.0016 0.0013  -0.0055 106 PHE C CG  
4099 C  CD1 . PHE C 106 ? 0.1223 0.1043 0.1288 0.0023  0.0002  -0.0075 106 PHE C CD1 
4100 C  CD2 . PHE C 106 ? 0.1279 0.1150 0.1220 -0.0032 0.0069  -0.0075 106 PHE C CD2 
4101 C  CE1 . PHE C 106 ? 0.1081 0.1125 0.1206 -0.0176 -0.0003 -0.0050 106 PHE C CE1 
4102 C  CE2 . PHE C 106 ? 0.0942 0.0966 0.1113 -0.0081 -0.0033 -0.0026 106 PHE C CE2 
4103 C  CZ  . PHE C 106 ? 0.0997 0.0964 0.1202 -0.0099 -0.0071 -0.0050 106 PHE C CZ  
4104 N  N   . GLY C 107 ? 0.1223 0.1106 0.1210 0.0008  0.0054  -0.0050 107 GLY C N   
4105 C  CA  . GLY C 107 ? 0.1290 0.1177 0.1241 -0.0004 0.0038  -0.0060 107 GLY C CA  
4106 C  C   . GLY C 107 ? 0.1247 0.1203 0.1257 0.0011  0.0050  -0.0074 107 GLY C C   
4107 O  O   . GLY C 107 ? 0.1455 0.1322 0.1354 0.0012  0.0020  -0.0122 107 GLY C O   
4108 N  N   . SER C 108 ? 0.1255 0.1236 0.1237 0.0001  0.0013  -0.0051 108 SER C N   
4109 C  CA  . SER C 108 ? 0.1110 0.1145 0.1197 0.0081  0.0034  -0.0048 108 SER C CA  
4110 C  C   . SER C 108 ? 0.1133 0.1215 0.1181 0.0083  -0.0014 -0.0028 108 SER C C   
4111 O  O   . SER C 108 ? 0.1031 0.1269 0.1210 0.0131  0.0050  -0.0053 108 SER C O   
4112 C  CB  . SER C 108 ? 0.1194 0.1175 0.1184 0.0103  -0.0003 -0.0019 108 SER C CB  
4113 O  OG  . SER C 108 ? 0.1295 0.1357 0.1330 0.0184  0.0101  -0.0022 108 SER C OG  
4114 N  N   . VAL C 109 ? 0.1085 0.1116 0.1180 -0.0012 0.0014  -0.0016 109 VAL C N   
4115 C  CA  . VAL C 109 ? 0.1102 0.0985 0.1123 0.0033  0.0008  0.0000  109 VAL C CA  
4116 C  C   . VAL C 109 ? 0.1100 0.0954 0.1047 0.0018  0.0042  0.0014  109 VAL C C   
4117 O  O   . VAL C 109 ? 0.1200 0.0826 0.1045 0.0069  0.0016  0.0035  109 VAL C O   
4118 C  CB  . VAL C 109 ? 0.1063 0.1029 0.1147 0.0051  0.0006  0.0000  109 VAL C CB  
4119 C  CG1 . VAL C 109 ? 0.0979 0.0897 0.1220 0.0052  0.0021  0.0016  109 VAL C CG1 
4120 C  CG2 . VAL C 109 ? 0.1096 0.1131 0.1155 -0.0007 0.0103  0.0071  109 VAL C CG2 
4121 N  N   . ASP C 110 ? 0.1222 0.0993 0.1053 0.0036  0.0061  -0.0035 110 ASP C N   
4122 C  CA  . ASP C 110 ? 0.1176 0.1006 0.1035 0.0033  0.0099  -0.0007 110 ASP C CA  
4123 C  C   . ASP C 110 ? 0.1173 0.1002 0.1060 0.0023  0.0083  -0.0016 110 ASP C C   
4124 O  O   . ASP C 110 ? 0.1213 0.0952 0.1167 0.0006  0.0093  -0.0034 110 ASP C O   
4125 C  CB  . ASP C 110 ? 0.1248 0.1163 0.1131 0.0095  0.0113  -0.0012 110 ASP C CB  
4126 C  CG  . ASP C 110 ? 0.1385 0.1458 0.1272 -0.0035 0.0090  0.0005  110 ASP C CG  
4127 O  OD1 . ASP C 110 ? 0.1709 0.1845 0.1561 -0.0077 0.0000  -0.0113 110 ASP C OD1 
4128 O  OD2 . ASP C 110 ? 0.1830 0.1934 0.1802 -0.0165 0.0246  0.0093  110 ASP C OD2 
4129 N  N   . ASN C 111 ? 0.1114 0.0993 0.1025 0.0003  0.0072  -0.0051 111 ASN C N   
4130 C  CA  . ASN C 111 ? 0.1117 0.1066 0.1081 -0.0003 0.0062  -0.0028 111 ASN C CA  
4131 C  C   . ASN C 111 ? 0.1056 0.1005 0.1025 0.0011  0.0024  -0.0031 111 ASN C C   
4132 O  O   . ASN C 111 ? 0.1104 0.1135 0.1248 0.0006  0.0142  -0.0059 111 ASN C O   
4133 C  CB  . ASN C 111 ? 0.1318 0.1098 0.1120 -0.0033 0.0030  -0.0064 111 ASN C CB  
4134 C  CG  . ASN C 111 ? 0.1440 0.1293 0.1264 -0.0049 0.0109  -0.0095 111 ASN C CG  
4135 O  OD1 . ASN C 111 ? 0.1538 0.1280 0.1387 -0.0075 0.0003  -0.0008 111 ASN C OD1 
4136 N  ND2 . ASN C 111 ? 0.1588 0.1428 0.0974 -0.0066 0.0175  -0.0021 111 ASN C ND2 
4137 N  N   . PHE C 112 ? 0.0953 0.1079 0.0989 -0.0015 0.0006  -0.0064 112 PHE C N   
4138 C  CA  . PHE C 112 ? 0.0870 0.0947 0.0928 -0.0025 0.0002  -0.0065 112 PHE C CA  
4139 C  C   . PHE C 112 ? 0.0811 0.0923 0.0902 -0.0057 0.0005  -0.0049 112 PHE C C   
4140 O  O   . PHE C 112 ? 0.0803 0.0755 0.0794 -0.0065 0.0046  -0.0109 112 PHE C O   
4141 C  CB  . PHE C 112 ? 0.0773 0.0985 0.0953 -0.0004 -0.0024 -0.0069 112 PHE C CB  
4142 C  CG  . PHE C 112 ? 0.0895 0.1067 0.0921 -0.0002 -0.0011 -0.0017 112 PHE C CG  
4143 C  CD1 . PHE C 112 ? 0.0966 0.1087 0.0943 -0.0010 0.0038  -0.0010 112 PHE C CD1 
4144 C  CD2 . PHE C 112 ? 0.0985 0.0988 0.1128 0.0037  -0.0060 -0.0078 112 PHE C CD2 
4145 C  CE1 . PHE C 112 ? 0.0940 0.0738 0.0888 -0.0005 0.0014  0.0090  112 PHE C CE1 
4146 C  CE2 . PHE C 112 ? 0.1098 0.1021 0.1086 0.0004  0.0009  0.0051  112 PHE C CE2 
4147 C  CZ  . PHE C 112 ? 0.1227 0.0905 0.1089 0.0041  -0.0012 -0.0003 112 PHE C CZ  
4148 N  N   . LYS C 113 ? 0.0841 0.0909 0.0894 -0.0101 0.0006  -0.0039 113 LYS C N   
4149 C  CA  . LYS C 113 ? 0.0859 0.0927 0.0867 -0.0074 0.0013  -0.0029 113 LYS C CA  
4150 C  C   . LYS C 113 ? 0.0847 0.0897 0.0856 -0.0078 0.0013  -0.0046 113 LYS C C   
4151 O  O   . LYS C 113 ? 0.0863 0.0923 0.0777 -0.0067 0.0048  -0.0084 113 LYS C O   
4152 C  CB  . LYS C 113 ? 0.0846 0.0926 0.0942 -0.0079 -0.0028 0.0001  113 LYS C CB  
4153 C  CG  . LYS C 113 ? 0.0961 0.1105 0.0946 -0.0026 -0.0011 -0.0007 113 LYS C CG  
4154 C  CD  . LYS C 113 ? 0.0890 0.0953 0.0980 -0.0059 0.0020  -0.0129 113 LYS C CD  
4155 C  CE  . LYS C 113 ? 0.0671 0.0948 0.1072 -0.0041 -0.0018 0.0027  113 LYS C CE  
4156 N  NZ  . LYS C 113 ? 0.0813 0.0830 0.1204 -0.0104 0.0193  0.0029  113 LYS C NZ  
4157 N  N   . ALA C 114 ? 0.0788 0.0777 0.0687 -0.0103 0.0045  -0.0031 114 ALA C N   
4158 C  CA  . ALA C 114 ? 0.0810 0.0850 0.0681 -0.0036 0.0031  -0.0058 114 ALA C CA  
4159 C  C   . ALA C 114 ? 0.0816 0.0831 0.0676 -0.0047 0.0033  -0.0031 114 ALA C C   
4160 O  O   . ALA C 114 ? 0.0837 0.0774 0.0561 -0.0122 -0.0009 -0.0103 114 ALA C O   
4161 C  CB  . ALA C 114 ? 0.0925 0.0970 0.0743 0.0005  0.0075  -0.0004 114 ALA C CB  
4162 N  N   . GLU C 115 ? 0.0809 0.0842 0.0738 -0.0053 0.0080  -0.0047 115 GLU C N   
4163 C  CA  . GLU C 115 ? 0.0746 0.0750 0.0793 -0.0042 0.0080  -0.0023 115 GLU C CA  
4164 C  C   . GLU C 115 ? 0.0641 0.0682 0.0677 -0.0094 0.0084  0.0026  115 GLU C C   
4165 O  O   . GLU C 115 ? 0.0643 0.0451 0.0759 -0.0077 0.0116  0.0031  115 GLU C O   
4166 C  CB  . GLU C 115 ? 0.0747 0.0744 0.0767 -0.0061 0.0107  0.0019  115 GLU C CB  
4167 C  CG  . GLU C 115 ? 0.0828 0.1175 0.0914 0.0068  0.0052  -0.0044 115 GLU C CG  
4168 C  CD  . GLU C 115 ? 0.1103 0.1325 0.1293 0.0005  0.0009  -0.0067 115 GLU C CD  
4169 O  OE1 . GLU C 115 ? 0.1413 0.1621 0.1485 0.0061  0.0067  -0.0202 115 GLU C OE1 
4170 O  OE2 . GLU C 115 ? 0.1215 0.1505 0.1290 0.0036  0.0037  -0.0058 115 GLU C OE2 
4171 N  N   . PHE C 116 ? 0.0484 0.0633 0.0658 -0.0071 0.0120  0.0040  116 PHE C N   
4172 C  CA  . PHE C 116 ? 0.0512 0.0583 0.0583 -0.0090 0.0007  -0.0016 116 PHE C CA  
4173 C  C   . PHE C 116 ? 0.0494 0.0612 0.0522 -0.0091 0.0029  0.0015  116 PHE C C   
4174 O  O   . PHE C 116 ? 0.0499 0.0378 0.0566 -0.0230 -0.0065 -0.0090 116 PHE C O   
4175 C  CB  . PHE C 116 ? 0.0475 0.0660 0.0603 -0.0061 0.0064  0.0031  116 PHE C CB  
4176 C  CG  . PHE C 116 ? 0.0495 0.0686 0.0582 -0.0051 0.0000  -0.0004 116 PHE C CG  
4177 C  CD1 . PHE C 116 ? 0.0648 0.0733 0.0533 -0.0090 0.0067  -0.0076 116 PHE C CD1 
4178 C  CD2 . PHE C 116 ? 0.0413 0.0572 0.0300 0.0048  -0.0046 0.0098  116 PHE C CD2 
4179 C  CE1 . PHE C 116 ? 0.0385 0.0606 0.0580 -0.0155 0.0017  -0.0207 116 PHE C CE1 
4180 C  CE2 . PHE C 116 ? 0.0369 0.0774 0.0359 -0.0034 -0.0047 0.0020  116 PHE C CE2 
4181 C  CZ  . PHE C 116 ? 0.0468 0.0521 0.0565 -0.0211 -0.0015 -0.0057 116 PHE C CZ  
4182 N  N   . GLU C 117 ? 0.0522 0.0687 0.0531 -0.0067 -0.0011 0.0011  117 GLU C N   
4183 C  CA  . GLU C 117 ? 0.0582 0.0698 0.0553 -0.0042 0.0070  -0.0003 117 GLU C CA  
4184 C  C   . GLU C 117 ? 0.0553 0.0638 0.0563 -0.0040 0.0082  -0.0018 117 GLU C C   
4185 O  O   . GLU C 117 ? 0.0638 0.0724 0.0717 -0.0007 0.0094  -0.0051 117 GLU C O   
4186 C  CB  . GLU C 117 ? 0.0546 0.0696 0.0388 0.0008  0.0082  0.0035  117 GLU C CB  
4187 C  CG  . GLU C 117 ? 0.0679 0.0951 0.0678 0.0129  0.0064  -0.0038 117 GLU C CG  
4188 C  CD  . GLU C 117 ? 0.0795 0.1071 0.0674 0.0070  0.0083  0.0109  117 GLU C CD  
4189 O  OE1 . GLU C 117 ? 0.1064 0.0639 0.0668 0.0182  -0.0031 -0.0088 117 GLU C OE1 
4190 O  OE2 . GLU C 117 ? 0.0619 0.1145 0.0528 -0.0014 0.0181  0.0125  117 GLU C OE2 
4191 N  N   . LYS C 118 ? 0.0613 0.0626 0.0648 -0.0061 0.0073  -0.0056 118 LYS C N   
4192 C  CA  . LYS C 118 ? 0.0674 0.0594 0.0632 -0.0065 -0.0012 -0.0018 118 LYS C CA  
4193 C  C   . LYS C 118 ? 0.0695 0.0617 0.0620 -0.0075 -0.0030 -0.0001 118 LYS C C   
4194 O  O   . LYS C 118 ? 0.0679 0.0708 0.0646 -0.0041 -0.0079 -0.0011 118 LYS C O   
4195 C  CB  . LYS C 118 ? 0.0751 0.0602 0.0677 -0.0094 -0.0006 -0.0028 118 LYS C CB  
4196 C  CG  . LYS C 118 ? 0.0980 0.0919 0.0799 0.0010  0.0012  -0.0096 118 LYS C CG  
4197 C  CD  . LYS C 118 ? 0.1084 0.0913 0.1048 -0.0129 -0.0060 -0.0058 118 LYS C CD  
4198 C  CE  . LYS C 118 ? 0.1421 0.1423 0.1149 -0.0006 0.0207  -0.0019 118 LYS C CE  
4199 N  NZ  . LYS C 118 ? 0.1996 0.1951 0.1768 -0.0107 -0.0064 -0.0106 118 LYS C NZ  
4200 N  N   . ALA C 119 ? 0.0713 0.0648 0.0578 -0.0093 -0.0052 0.0017  119 ALA C N   
4201 C  CA  . ALA C 119 ? 0.0686 0.0533 0.0505 -0.0079 -0.0018 0.0075  119 ALA C CA  
4202 C  C   . ALA C 119 ? 0.0667 0.0517 0.0468 -0.0073 0.0006  0.0108  119 ALA C C   
4203 O  O   . ALA C 119 ? 0.0704 0.0470 0.0377 -0.0100 0.0005  0.0154  119 ALA C O   
4204 C  CB  . ALA C 119 ? 0.0743 0.0523 0.0662 -0.0050 -0.0038 0.0073  119 ALA C CB  
4205 N  N   . ALA C 120 ? 0.0561 0.0437 0.0301 -0.0102 0.0002  0.0109  120 ALA C N   
4206 C  CA  . ALA C 120 ? 0.0569 0.0478 0.0412 -0.0081 -0.0015 0.0073  120 ALA C CA  
4207 C  C   . ALA C 120 ? 0.0484 0.0466 0.0368 -0.0061 0.0008  0.0086  120 ALA C C   
4208 O  O   . ALA C 120 ? 0.0542 0.0460 0.0320 -0.0148 0.0076  0.0130  120 ALA C O   
4209 C  CB  . ALA C 120 ? 0.0437 0.0400 0.0274 -0.0056 0.0052  0.0102  120 ALA C CB  
4210 N  N   . ALA C 121 ? 0.0472 0.0549 0.0437 -0.0029 0.0046  0.0026  121 ALA C N   
4211 C  CA  . ALA C 121 ? 0.0464 0.0560 0.0439 -0.0017 0.0003  0.0034  121 ALA C CA  
4212 C  C   . ALA C 121 ? 0.0573 0.0631 0.0444 0.0026  -0.0019 0.0049  121 ALA C C   
4213 O  O   . ALA C 121 ? 0.0778 0.0664 0.0478 0.0058  -0.0088 0.0027  121 ALA C O   
4214 C  CB  . ALA C 121 ? 0.0319 0.0578 0.0374 -0.0096 -0.0029 0.0019  121 ALA C CB  
4215 N  N   . SER C 122 ? 0.0680 0.0716 0.0527 0.0017  -0.0022 0.0067  122 SER C N   
4216 C  CA  . SER C 122 ? 0.0747 0.0788 0.0675 -0.0017 -0.0003 0.0026  122 SER C CA  
4217 C  C   . SER C 122 ? 0.0650 0.0729 0.0675 0.0005  -0.0023 0.0011  122 SER C C   
4218 O  O   . SER C 122 ? 0.0766 0.0810 0.0788 0.0027  0.0014  0.0001  122 SER C O   
4219 C  CB  . SER C 122 ? 0.0722 0.0875 0.0633 0.0020  -0.0021 -0.0019 122 SER C CB  
4220 O  OG  . SER C 122 ? 0.1346 0.1331 0.1076 0.0014  0.0046  -0.0027 122 SER C OG  
4221 N  N   . ARG C 123 ? 0.0576 0.0616 0.0511 0.0036  0.0014  0.0031  123 ARG C N   
4222 C  CA  . ARG C 123 ? 0.0489 0.0583 0.0531 0.0031  -0.0017 0.0025  123 ARG C CA  
4223 C  C   . ARG C 123 ? 0.0448 0.0576 0.0501 0.0027  -0.0038 -0.0010 123 ARG C C   
4224 O  O   . ARG C 123 ? 0.0439 0.0592 0.0604 0.0067  -0.0115 0.0086  123 ARG C O   
4225 C  CB  . ARG C 123 ? 0.0469 0.0556 0.0459 -0.0001 0.0021  -0.0013 123 ARG C CB  
4226 C  CG  . ARG C 123 ? 0.0281 0.0334 0.0288 0.0041  0.0080  0.0043  123 ARG C CG  
4227 C  CD  . ARG C 123 ? 0.0405 0.0178 0.0226 -0.0095 -0.0034 0.0129  123 ARG C CD  
4228 N  NE  . ARG C 123 ? 0.0607 0.0395 0.0251 -0.0115 -0.0031 -0.0040 123 ARG C NE  
4229 C  CZ  . ARG C 123 ? 0.0614 0.0313 0.0223 -0.0132 0.0121  0.0122  123 ARG C CZ  
4230 N  NH1 . ARG C 123 ? 0.0725 0.0448 0.0312 -0.0132 0.0118  0.0262  123 ARG C NH1 
4231 N  NH2 . ARG C 123 ? 0.0619 0.0261 0.0504 -0.0139 -0.0061 -0.0005 123 ARG C NH2 
4232 N  N   . PHE C 124 ? 0.0418 0.0553 0.0291 -0.0022 -0.0066 0.0063  124 PHE C N   
4233 C  CA  . PHE C 124 ? 0.0299 0.0461 0.0205 -0.0070 -0.0083 -0.0033 124 PHE C CA  
4234 C  C   . PHE C 124 ? 0.0288 0.0508 0.0218 -0.0058 -0.0006 0.0071  124 PHE C C   
4235 O  O   . PHE C 124 ? 0.0250 0.0637 0.0094 -0.0154 -0.0024 0.0132  124 PHE C O   
4236 C  CB  . PHE C 124 ? 0.0396 0.0399 0.0259 -0.0025 -0.0071 0.0080  124 PHE C CB  
4237 C  CG  . PHE C 124 ? 0.0461 0.0431 0.0232 -0.0077 -0.0059 0.0069  124 PHE C CG  
4238 C  CD1 . PHE C 124 ? 0.0768 0.0795 0.0565 -0.0161 -0.0091 0.0056  124 PHE C CD1 
4239 C  CD2 . PHE C 124 ? 0.0323 0.0379 0.0249 -0.0206 -0.0083 0.0016  124 PHE C CD2 
4240 C  CE1 . PHE C 124 ? 0.0427 0.0455 0.0266 -0.0128 -0.0091 0.0062  124 PHE C CE1 
4241 C  CE2 . PHE C 124 ? 0.0234 0.0305 0.0193 -0.0063 -0.0149 0.0059  124 PHE C CE2 
4242 C  CZ  . PHE C 124 ? 0.0458 0.0668 0.0087 -0.0019 -0.0013 0.0121  124 PHE C CZ  
4243 N  N   . GLY C 125 ? 0.0156 0.0370 0.0068 -0.0079 0.0003  0.0031  125 GLY C N   
4244 C  CA  . GLY C 125 ? 0.0236 0.0358 0.0148 -0.0111 0.0029  0.0034  125 GLY C CA  
4245 C  C   . GLY C 125 ? 0.0138 0.0313 0.0131 -0.0117 -0.0014 -0.0024 125 GLY C C   
4246 O  O   . GLY C 125 ? 0.0281 0.0443 0.0127 -0.0096 0.0019  0.0060  125 GLY C O   
4247 N  N   . SER C 126 ? 0.0158 0.0228 0.0092 -0.0125 -0.0052 0.0069  126 SER C N   
4248 C  CA  . SER C 126 ? 0.0257 0.0433 0.0164 -0.0112 -0.0043 0.0030  126 SER C CA  
4249 C  C   . SER C 126 ? 0.0222 0.0320 0.0076 -0.0040 0.0033  0.0032  126 SER C C   
4250 O  O   . SER C 126 ? 0.0290 0.0220 0.0079 -0.0112 0.0030  -0.0050 126 SER C O   
4251 C  CB  . SER C 126 ? 0.0225 0.0455 0.0093 -0.0056 0.0024  0.0002  126 SER C CB  
4252 O  OG  . SER C 126 ? 0.0245 0.0624 0.0078 -0.0119 -0.0042 0.0080  126 SER C OG  
4253 N  N   . GLY C 127 ? 0.0311 0.0397 0.0211 -0.0125 0.0045  0.0053  127 GLY C N   
4254 C  CA  . GLY C 127 ? 0.0238 0.0358 0.0134 -0.0001 0.0075  0.0106  127 GLY C CA  
4255 C  C   . GLY C 127 ? 0.0379 0.0454 0.0282 -0.0061 0.0051  0.0111  127 GLY C C   
4256 O  O   . GLY C 127 ? 0.0137 0.0469 0.0179 -0.0083 0.0012  0.0174  127 GLY C O   
4257 N  N   . TRP C 128 ? 0.0369 0.0393 0.0248 -0.0084 0.0087  0.0090  128 TRP C N   
4258 C  CA  . TRP C 128 ? 0.0424 0.0298 0.0256 -0.0050 0.0084  0.0090  128 TRP C CA  
4259 C  C   . TRP C 128 ? 0.0474 0.0342 0.0300 -0.0040 0.0050  0.0065  128 TRP C C   
4260 O  O   . TRP C 128 ? 0.0590 0.0136 0.0266 -0.0046 0.0047  0.0067  128 TRP C O   
4261 C  CB  . TRP C 128 ? 0.0361 0.0223 0.0199 -0.0067 0.0125  0.0082  128 TRP C CB  
4262 C  CG  . TRP C 128 ? 0.0415 0.0463 0.0263 -0.0117 0.0085  0.0147  128 TRP C CG  
4263 C  CD1 . TRP C 128 ? 0.0540 0.0556 0.0218 -0.0111 0.0116  0.0215  128 TRP C CD1 
4264 C  CD2 . TRP C 128 ? 0.0437 0.0440 0.0190 -0.0120 0.0109  0.0143  128 TRP C CD2 
4265 N  NE1 . TRP C 128 ? 0.0184 0.0246 0.0309 -0.0097 0.0006  0.0156  128 TRP C NE1 
4266 C  CE2 . TRP C 128 ? 0.0336 0.0259 0.0209 -0.0063 0.0155  0.0066  128 TRP C CE2 
4267 C  CE3 . TRP C 128 ? 0.0347 0.0401 0.0120 -0.0085 0.0049  0.0107  128 TRP C CE3 
4268 C  CZ2 . TRP C 128 ? 0.0187 0.0332 0.0321 -0.0058 0.0076  0.0190  128 TRP C CZ2 
4269 C  CZ3 . TRP C 128 ? 0.0503 0.0425 0.0285 -0.0008 0.0091  0.0018  128 TRP C CZ3 
4270 C  CH2 . TRP C 128 ? 0.0442 0.0209 0.0121 -0.0011 0.0075  0.0077  128 TRP C CH2 
4271 N  N   . ALA C 129 ? 0.0459 0.0376 0.0364 -0.0064 0.0059  0.0100  129 ALA C N   
4272 C  CA  . ALA C 129 ? 0.0477 0.0447 0.0320 -0.0104 0.0025  0.0061  129 ALA C CA  
4273 C  C   . ALA C 129 ? 0.0443 0.0417 0.0387 -0.0020 -0.0003 0.0021  129 ALA C C   
4274 O  O   . ALA C 129 ? 0.0522 0.0321 0.0366 0.0071  -0.0067 0.0028  129 ALA C O   
4275 C  CB  . ALA C 129 ? 0.0579 0.0558 0.0268 -0.0157 0.0082  0.0010  129 ALA C CB  
4276 N  N   . TRP C 130 ? 0.0524 0.0479 0.0355 -0.0055 0.0029  0.0059  130 TRP C N   
4277 C  CA  . TRP C 130 ? 0.0483 0.0382 0.0459 -0.0109 0.0045  0.0040  130 TRP C CA  
4278 C  C   . TRP C 130 ? 0.0539 0.0417 0.0461 -0.0083 0.0078  0.0056  130 TRP C C   
4279 O  O   . TRP C 130 ? 0.0481 0.0233 0.0446 -0.0144 0.0079  0.0066  130 TRP C O   
4280 C  CB  . TRP C 130 ? 0.0396 0.0417 0.0429 -0.0097 0.0041  0.0054  130 TRP C CB  
4281 C  CG  . TRP C 130 ? 0.0274 0.0346 0.0503 -0.0177 0.0097  0.0113  130 TRP C CG  
4282 C  CD1 . TRP C 130 ? 0.0237 0.0171 0.0513 -0.0097 0.0052  0.0121  130 TRP C CD1 
4283 C  CD2 . TRP C 130 ? 0.0209 0.0308 0.0449 -0.0127 0.0079  0.0046  130 TRP C CD2 
4284 N  NE1 . TRP C 130 ? 0.0328 0.0362 0.0281 -0.0234 0.0044  0.0098  130 TRP C NE1 
4285 C  CE2 . TRP C 130 ? 0.0175 0.0289 0.0360 -0.0159 -0.0031 0.0036  130 TRP C CE2 
4286 C  CE3 . TRP C 130 ? 0.0401 0.0479 0.0578 -0.0043 0.0058  -0.0098 130 TRP C CE3 
4287 C  CZ2 . TRP C 130 ? 0.0367 0.0382 0.0457 0.0046  0.0068  0.0037  130 TRP C CZ2 
4288 C  CZ3 . TRP C 130 ? 0.0215 0.0402 0.0313 -0.0053 0.0145  0.0137  130 TRP C CZ3 
4289 C  CH2 . TRP C 130 ? 0.0135 0.0123 0.0164 0.0025  0.0020  -0.0062 130 TRP C CH2 
4290 N  N   . LEU C 131 ? 0.0646 0.0513 0.0567 -0.0068 0.0086  -0.0007 131 LEU C N   
4291 C  CA  . LEU C 131 ? 0.0679 0.0491 0.0665 -0.0085 0.0068  0.0023  131 LEU C CA  
4292 C  C   . LEU C 131 ? 0.0645 0.0539 0.0724 -0.0086 0.0033  0.0032  131 LEU C C   
4293 O  O   . LEU C 131 ? 0.0524 0.0511 0.0843 -0.0131 0.0098  0.0050  131 LEU C O   
4294 C  CB  . LEU C 131 ? 0.0593 0.0409 0.0641 -0.0055 0.0016  0.0037  131 LEU C CB  
4295 C  CG  . LEU C 131 ? 0.0665 0.0645 0.0707 -0.0023 -0.0008 -0.0052 131 LEU C CG  
4296 C  CD1 . LEU C 131 ? 0.0716 0.0483 0.0529 0.0135  -0.0016 -0.0009 131 LEU C CD1 
4297 C  CD2 . LEU C 131 ? 0.0708 0.0602 0.0909 0.0097  -0.0127 0.0115  131 LEU C CD2 
4298 N  N   . VAL C 132 ? 0.0735 0.0658 0.0870 -0.0086 0.0039  0.0006  132 VAL C N   
4299 C  CA  . VAL C 132 ? 0.0864 0.0719 0.0871 -0.0025 0.0017  0.0005  132 VAL C CA  
4300 C  C   . VAL C 132 ? 0.0871 0.0805 0.0890 0.0000  0.0018  -0.0058 132 VAL C C   
4301 O  O   . VAL C 132 ? 0.0873 0.0865 0.0913 0.0045  -0.0024 -0.0133 132 VAL C O   
4302 C  CB  . VAL C 132 ? 0.0893 0.0748 0.0925 -0.0015 0.0072  0.0000  132 VAL C CB  
4303 C  CG1 . VAL C 132 ? 0.1002 0.0733 0.0962 0.0034  0.0004  -0.0008 132 VAL C CG1 
4304 C  CG2 . VAL C 132 ? 0.1170 0.0925 0.1053 0.0043  0.0052  -0.0082 132 VAL C CG2 
4305 N  N   . LEU C 133 ? 0.0944 0.0789 0.0941 0.0002  0.0034  -0.0071 133 LEU C N   
4306 C  CA  . LEU C 133 ? 0.0978 0.0839 0.1010 -0.0025 0.0032  0.0000  133 LEU C CA  
4307 C  C   . LEU C 133 ? 0.1056 0.0917 0.1032 -0.0022 0.0016  0.0026  133 LEU C C   
4308 O  O   . LEU C 133 ? 0.0993 0.0925 0.1108 0.0037  0.0077  -0.0026 133 LEU C O   
4309 C  CB  . LEU C 133 ? 0.0965 0.0876 0.1055 0.0004  0.0015  0.0035  133 LEU C CB  
4310 C  CG  . LEU C 133 ? 0.1024 0.0944 0.1123 -0.0009 0.0055  -0.0102 133 LEU C CG  
4311 C  CD1 . LEU C 133 ? 0.1019 0.0633 0.0959 -0.0216 -0.0057 -0.0072 133 LEU C CD1 
4312 C  CD2 . LEU C 133 ? 0.1066 0.1169 0.1220 -0.0102 0.0080  0.0013  133 LEU C CD2 
4313 N  N   . LYS C 134 ? 0.1102 0.0895 0.1055 -0.0068 0.0016  -0.0041 134 LYS C N   
4314 C  CA  . LYS C 134 ? 0.1207 0.1038 0.1230 -0.0052 0.0040  -0.0003 134 LYS C CA  
4315 C  C   . LYS C 134 ? 0.1342 0.1032 0.1225 -0.0061 0.0050  -0.0007 134 LYS C C   
4316 O  O   . LYS C 134 ? 0.1533 0.1081 0.1412 -0.0097 0.0044  -0.0036 134 LYS C O   
4317 C  CB  . LYS C 134 ? 0.1227 0.1132 0.1182 -0.0067 0.0036  -0.0036 134 LYS C CB  
4318 C  CG  . LYS C 134 ? 0.1164 0.1104 0.1360 -0.0090 0.0038  0.0096  134 LYS C CG  
4319 C  CD  . LYS C 134 ? 0.1477 0.1422 0.1390 -0.0063 -0.0074 0.0056  134 LYS C CD  
4320 C  CE  . LYS C 134 ? 0.1326 0.1377 0.1444 -0.0108 -0.0003 -0.0040 134 LYS C CE  
4321 N  NZ  . LYS C 134 ? 0.1443 0.0940 0.1384 0.0019  -0.0075 0.0071  134 LYS C NZ  
4322 N  N   . GLY C 135 ? 0.1463 0.1059 0.1362 -0.0058 0.0040  -0.0016 135 GLY C N   
4323 C  CA  . GLY C 135 ? 0.1354 0.1026 0.1327 -0.0012 0.0060  -0.0003 135 GLY C CA  
4324 C  C   . GLY C 135 ? 0.1245 0.0968 0.1282 -0.0065 0.0023  0.0020  135 GLY C C   
4325 O  O   . GLY C 135 ? 0.1312 0.1059 0.1389 -0.0052 0.0037  0.0060  135 GLY C O   
4326 N  N   . ASP C 136 ? 0.1140 0.0863 0.1218 -0.0056 0.0032  0.0027  136 ASP C N   
4327 C  CA  . ASP C 136 ? 0.1085 0.0854 0.1234 -0.0074 0.0028  -0.0025 136 ASP C CA  
4328 C  C   . ASP C 136 ? 0.0997 0.0789 0.1120 -0.0095 -0.0023 -0.0051 136 ASP C C   
4329 O  O   . ASP C 136 ? 0.1009 0.0756 0.1219 -0.0163 -0.0014 -0.0024 136 ASP C O   
4330 C  CB  . ASP C 136 ? 0.1053 0.0822 0.1212 -0.0033 0.0021  -0.0023 136 ASP C CB  
4331 C  CG  . ASP C 136 ? 0.1249 0.1120 0.1388 -0.0024 0.0019  -0.0034 136 ASP C CG  
4332 O  OD1 . ASP C 136 ? 0.1248 0.1381 0.1271 -0.0198 0.0130  -0.0132 136 ASP C OD1 
4333 O  OD2 . ASP C 136 ? 0.1528 0.1474 0.1540 0.0020  -0.0087 0.0030  136 ASP C OD2 
4334 N  N   . LYS C 137 ? 0.1011 0.0781 0.1157 -0.0118 0.0005  -0.0080 137 LYS C N   
4335 C  CA  . LYS C 137 ? 0.1034 0.0868 0.1155 -0.0065 -0.0004 -0.0062 137 LYS C CA  
4336 C  C   . LYS C 137 ? 0.0952 0.0882 0.1139 -0.0068 0.0029  -0.0072 137 LYS C C   
4337 O  O   . LYS C 137 ? 0.1131 0.1042 0.1340 -0.0109 0.0058  -0.0113 137 LYS C O   
4338 C  CB  . LYS C 137 ? 0.1082 0.0961 0.1175 -0.0023 -0.0024 -0.0075 137 LYS C CB  
4339 C  CG  . LYS C 137 ? 0.1408 0.1151 0.1432 -0.0052 -0.0052 0.0009  137 LYS C CG  
4340 C  CD  . LYS C 137 ? 0.1491 0.1562 0.1638 -0.0053 -0.0083 -0.0002 137 LYS C CD  
4341 C  CE  . LYS C 137 ? 0.1763 0.1842 0.1777 -0.0081 -0.0033 0.0064  137 LYS C CE  
4342 N  NZ  . LYS C 137 ? 0.1845 0.1964 0.2162 -0.0062 -0.0104 0.0056  137 LYS C NZ  
4343 N  N   . LEU C 138 ? 0.0912 0.0785 0.1133 -0.0146 0.0035  -0.0030 138 LEU C N   
4344 C  CA  . LEU C 138 ? 0.0868 0.0749 0.1047 -0.0078 0.0032  -0.0011 138 LEU C CA  
4345 C  C   . LEU C 138 ? 0.0860 0.0708 0.0987 -0.0118 0.0006  -0.0015 138 LEU C C   
4346 O  O   . LEU C 138 ? 0.0964 0.0745 0.1027 -0.0189 0.0098  0.0038  138 LEU C O   
4347 C  CB  . LEU C 138 ? 0.0860 0.0776 0.1069 -0.0067 0.0005  0.0017  138 LEU C CB  
4348 C  CG  . LEU C 138 ? 0.0892 0.0726 0.1008 0.0003  -0.0004 0.0023  138 LEU C CG  
4349 C  CD1 . LEU C 138 ? 0.0808 0.0541 0.1250 0.0068  0.0029  -0.0135 138 LEU C CD1 
4350 C  CD2 . LEU C 138 ? 0.1301 0.0811 0.1083 0.0088  -0.0014 0.0067  138 LEU C CD2 
4351 N  N   . ALA C 139 ? 0.0660 0.0715 0.0855 -0.0031 0.0006  -0.0066 139 ALA C N   
4352 C  CA  . ALA C 139 ? 0.0654 0.0613 0.0736 -0.0066 0.0006  -0.0073 139 ALA C CA  
4353 C  C   . ALA C 139 ? 0.0612 0.0643 0.0769 -0.0100 -0.0027 -0.0017 139 ALA C C   
4354 O  O   . ALA C 139 ? 0.0637 0.0566 0.0662 -0.0088 -0.0078 0.0007  139 ALA C O   
4355 C  CB  . ALA C 139 ? 0.0581 0.0549 0.0692 -0.0020 -0.0045 -0.0113 139 ALA C CB  
4356 N  N   . VAL C 140 ? 0.0587 0.0657 0.0833 -0.0040 -0.0086 0.0003  140 VAL C N   
4357 C  CA  . VAL C 140 ? 0.0626 0.0659 0.0798 -0.0055 -0.0005 0.0028  140 VAL C CA  
4358 C  C   . VAL C 140 ? 0.0672 0.0590 0.0788 -0.0047 -0.0006 0.0027  140 VAL C C   
4359 O  O   . VAL C 140 ? 0.0782 0.0821 0.0938 -0.0003 -0.0026 0.0023  140 VAL C O   
4360 C  CB  . VAL C 140 ? 0.0554 0.0577 0.0749 -0.0005 0.0006  0.0008  140 VAL C CB  
4361 C  CG1 . VAL C 140 ? 0.0670 0.0609 0.0839 -0.0053 0.0028  -0.0017 140 VAL C CG1 
4362 C  CG2 . VAL C 140 ? 0.0644 0.0739 0.0932 -0.0056 0.0093  0.0014  140 VAL C CG2 
4363 N  N   . VAL C 141 ? 0.0693 0.0671 0.0714 -0.0076 0.0051  0.0054  141 VAL C N   
4364 C  CA  . VAL C 141 ? 0.0668 0.0510 0.0683 -0.0066 0.0015  0.0026  141 VAL C CA  
4365 C  C   . VAL C 141 ? 0.0660 0.0557 0.0618 -0.0077 0.0020  0.0038  141 VAL C C   
4366 O  O   . VAL C 141 ? 0.0648 0.0351 0.0630 -0.0052 -0.0010 -0.0008 141 VAL C O   
4367 C  CB  . VAL C 141 ? 0.0742 0.0607 0.0667 -0.0079 -0.0057 0.0006  141 VAL C CB  
4368 C  CG1 . VAL C 141 ? 0.0836 0.0580 0.0796 -0.0078 -0.0081 -0.0002 141 VAL C CG1 
4369 C  CG2 . VAL C 141 ? 0.0531 0.0540 0.0678 -0.0015 0.0018  0.0047  141 VAL C CG2 
4370 N  N   . SER C 142 ? 0.0665 0.0564 0.0612 -0.0104 0.0077  0.0070  142 SER C N   
4371 C  CA  . SER C 142 ? 0.0610 0.0596 0.0539 -0.0122 0.0014  0.0020  142 SER C CA  
4372 C  C   . SER C 142 ? 0.0594 0.0668 0.0499 -0.0135 0.0000  0.0005  142 SER C C   
4373 O  O   . SER C 142 ? 0.0528 0.0608 0.0322 -0.0213 -0.0067 -0.0033 142 SER C O   
4374 C  CB  . SER C 142 ? 0.0622 0.0743 0.0554 -0.0134 0.0052  0.0089  142 SER C CB  
4375 O  OG  . SER C 142 ? 0.0700 0.0478 0.0778 -0.0198 0.0079  0.0061  142 SER C OG  
4376 N  N   . THR C 143 ? 0.0498 0.0499 0.0291 -0.0165 -0.0009 0.0008  143 THR C N   
4377 C  CA  . THR C 143 ? 0.0404 0.0411 0.0230 -0.0115 0.0007  0.0032  143 THR C CA  
4378 C  C   . THR C 143 ? 0.0354 0.0446 0.0182 -0.0152 -0.0042 0.0078  143 THR C C   
4379 O  O   . THR C 143 ? 0.0356 0.0302 0.0244 -0.0221 -0.0012 0.0123  143 THR C O   
4380 C  CB  . THR C 143 ? 0.0321 0.0286 0.0091 -0.0127 0.0041  0.0039  143 THR C CB  
4381 O  OG1 . THR C 143 ? 0.0358 0.0276 0.0142 -0.0141 0.0062  0.0067  143 THR C OG1 
4382 C  CG2 . THR C 143 ? 0.0356 0.0298 0.0255 -0.0131 0.0110  -0.0047 143 THR C CG2 
4383 N  N   . ALA C 144 ? 0.0344 0.0502 0.0193 -0.0123 -0.0005 0.0033  144 ALA C N   
4384 C  CA  . ALA C 144 ? 0.0285 0.0574 0.0164 -0.0065 -0.0024 0.0037  144 ALA C CA  
4385 C  C   . ALA C 144 ? 0.0179 0.0510 0.0135 -0.0071 -0.0047 0.0014  144 ALA C C   
4386 O  O   . ALA C 144 ? 0.0227 0.0410 0.0212 -0.0165 -0.0139 0.0064  144 ALA C O   
4387 C  CB  . ALA C 144 ? 0.0176 0.0520 0.0155 -0.0110 -0.0058 0.0032  144 ALA C CB  
4388 N  N   . ASN C 145 ? 0.0092 0.0392 0.0088 -0.0092 -0.0010 0.0062  145 ASN C N   
4389 C  CA  . ASN C 145 ? 0.0076 0.0321 0.0110 -0.0033 0.0014  0.0035  145 ASN C CA  
4390 C  C   . ASN C 145 ? 0.0102 0.0284 0.0081 -0.0005 0.0003  0.0014  145 ASN C C   
4391 O  O   . ASN C 145 ? 0.0078 0.0365 0.0063 -0.0066 0.0002  -0.0010 145 ASN C O   
4392 C  CB  . ASN C 145 ? 0.0107 0.0203 0.0066 -0.0078 -0.0011 0.0020  145 ASN C CB  
4393 C  CG  . ASN C 145 ? 0.0132 0.0355 0.0178 0.0017  0.0025  0.0072  145 ASN C CG  
4394 O  OD1 . ASN C 145 ? 0.0147 0.0148 0.0145 -0.0084 -0.0083 0.0083  145 ASN C OD1 
4395 N  ND2 . ASN C 145 ? 0.0210 0.0151 0.0164 -0.0113 -0.0121 0.0094  145 ASN C ND2 
4396 N  N   . GLN C 146 ? 0.0116 0.0247 0.0250 -0.0018 0.0057  0.0059  146 GLN C N   
4397 C  CA  . GLN C 146 ? 0.0189 0.0195 0.0275 -0.0128 -0.0013 0.0033  146 GLN C CA  
4398 C  C   . GLN C 146 ? 0.0197 0.0285 0.0341 -0.0165 0.0027  0.0037  146 GLN C C   
4399 O  O   . GLN C 146 ? 0.0093 0.0264 0.0491 -0.0068 -0.0069 0.0050  146 GLN C O   
4400 C  CB  . GLN C 146 ? 0.0279 0.0184 0.0237 -0.0131 0.0049  0.0051  146 GLN C CB  
4401 C  CG  . GLN C 146 ? 0.0220 0.0388 0.0069 -0.0226 -0.0030 0.0043  146 GLN C CG  
4402 C  CD  . GLN C 146 ? 0.0480 0.0425 0.0139 0.0013  -0.0042 -0.0022 146 GLN C CD  
4403 O  OE1 . GLN C 146 ? 0.0275 0.0236 0.0149 -0.0133 -0.0064 0.0117  146 GLN C OE1 
4404 N  NE2 . GLN C 146 ? 0.0230 0.0671 0.0343 -0.0281 -0.0178 0.0193  146 GLN C NE2 
4405 N  N   . ASP C 147 ? 0.0149 0.0357 0.0321 -0.0145 0.0023  0.0071  147 ASP C N   
4406 C  CA  . ASP C 147 ? 0.0248 0.0391 0.0326 -0.0149 0.0012  0.0026  147 ASP C CA  
4407 C  C   . ASP C 147 ? 0.0306 0.0486 0.0413 -0.0116 0.0033  0.0065  147 ASP C C   
4408 O  O   . ASP C 147 ? 0.0213 0.0334 0.0323 -0.0196 0.0038  0.0006  147 ASP C O   
4409 C  CB  . ASP C 147 ? 0.0192 0.0383 0.0295 -0.0148 -0.0022 0.0114  147 ASP C CB  
4410 C  CG  . ASP C 147 ? 0.0223 0.0362 0.0254 -0.0196 -0.0030 0.0021  147 ASP C CG  
4411 O  OD1 . ASP C 147 ? 0.0192 0.0237 0.0212 -0.0149 -0.0131 0.0150  147 ASP C OD1 
4412 O  OD2 . ASP C 147 ? 0.0803 0.0531 0.0282 -0.0144 -0.0228 0.0273  147 ASP C OD2 
4413 N  N   . SER C 148 ? 0.0285 0.0452 0.0554 -0.0092 0.0067  -0.0011 148 SER C N   
4414 C  CA  . SER C 148 ? 0.0376 0.0573 0.0586 -0.0084 0.0070  0.0013  148 SER C CA  
4415 C  C   . SER C 148 ? 0.0418 0.0597 0.0662 -0.0077 0.0062  -0.0037 148 SER C C   
4416 O  O   . SER C 148 ? 0.0236 0.0481 0.0616 0.0019  0.0014  -0.0057 148 SER C O   
4417 C  CB  . SER C 148 ? 0.0331 0.0693 0.0635 0.0000  0.0104  0.0002  148 SER C CB  
4418 O  OG  . SER C 148 ? 0.0428 0.0512 0.0433 -0.0166 0.0047  -0.0036 148 SER C OG  
4419 N  N   . PRO C 149 ? 0.0433 0.0620 0.0695 -0.0095 0.0074  -0.0035 149 PRO C N   
4420 C  CA  . PRO C 149 ? 0.0548 0.0642 0.0669 -0.0113 0.0078  -0.0025 149 PRO C CA  
4421 C  C   . PRO C 149 ? 0.0626 0.0635 0.0703 -0.0166 0.0045  0.0016  149 PRO C C   
4422 O  O   . PRO C 149 ? 0.0814 0.0741 0.0762 -0.0170 0.0045  -0.0037 149 PRO C O   
4423 C  CB  . PRO C 149 ? 0.0503 0.0565 0.0687 -0.0063 0.0055  0.0014  149 PRO C CB  
4424 C  CG  . PRO C 149 ? 0.0603 0.0623 0.0838 -0.0122 0.0063  0.0044  149 PRO C CG  
4425 C  CD  . PRO C 149 ? 0.0366 0.0601 0.0665 -0.0061 0.0155  -0.0068 149 PRO C CD  
4426 N  N   . LEU C 150 ? 0.0615 0.0605 0.0649 -0.0149 0.0079  0.0071  150 LEU C N   
4427 C  CA  . LEU C 150 ? 0.0672 0.0623 0.0665 -0.0123 0.0026  0.0060  150 LEU C CA  
4428 C  C   . LEU C 150 ? 0.0588 0.0615 0.0632 -0.0116 0.0033  0.0047  150 LEU C C   
4429 O  O   . LEU C 150 ? 0.0507 0.0755 0.0629 -0.0217 0.0058  0.0071  150 LEU C O   
4430 C  CB  . LEU C 150 ? 0.0586 0.0507 0.0741 -0.0143 0.0007  0.0064  150 LEU C CB  
4431 C  CG  . LEU C 150 ? 0.0743 0.0661 0.0758 -0.0079 0.0000  0.0057  150 LEU C CG  
4432 C  CD1 . LEU C 150 ? 0.0420 0.0587 0.0592 -0.0258 0.0002  0.0114  150 LEU C CD1 
4433 C  CD2 . LEU C 150 ? 0.0636 0.0702 0.0896 -0.0111 -0.0003 0.0080  150 LEU C CD2 
4434 N  N   . MET C 151 ? 0.0608 0.0685 0.0573 -0.0135 -0.0006 0.0018  151 MET C N   
4435 C  CA  . MET C 151 ? 0.0516 0.0666 0.0573 -0.0127 0.0022  0.0037  151 MET C CA  
4436 C  C   . MET C 151 ? 0.0565 0.0756 0.0731 -0.0095 0.0015  0.0023  151 MET C C   
4437 O  O   . MET C 151 ? 0.0350 0.0801 0.0779 -0.0205 0.0118  0.0112  151 MET C O   
4438 C  CB  . MET C 151 ? 0.0439 0.0640 0.0483 -0.0087 -0.0021 -0.0077 151 MET C CB  
4439 C  CG  . MET C 151 ? 0.0541 0.0737 0.0455 -0.0179 0.0021  -0.0155 151 MET C CG  
4440 S  SD  . MET C 151 ? 0.0347 0.0814 0.0185 -0.0452 0.0021  0.0025  151 MET C SD  
4441 C  CE  . MET C 151 ? 0.0065 0.0557 0.0063 -0.0033 0.0000  -0.0005 151 MET C CE  
4442 N  N   . GLY C 152 ? 0.0601 0.0825 0.0633 -0.0180 0.0034  0.0000  152 GLY C N   
4443 C  CA  . GLY C 152 ? 0.0660 0.0852 0.0726 -0.0131 -0.0007 -0.0021 152 GLY C CA  
4444 C  C   . GLY C 152 ? 0.0652 0.0814 0.0771 -0.0101 0.0008  0.0006  152 GLY C C   
4445 O  O   . GLY C 152 ? 0.0721 0.0770 0.0800 -0.0193 -0.0024 0.0104  152 GLY C O   
4446 N  N   . GLU C 153 ? 0.0637 0.0716 0.0800 -0.0149 0.0002  -0.0014 153 GLU C N   
4447 C  CA  . GLU C 153 ? 0.0656 0.0782 0.0869 -0.0096 -0.0022 0.0004  153 GLU C CA  
4448 C  C   . GLU C 153 ? 0.0691 0.0681 0.0863 -0.0114 -0.0018 -0.0015 153 GLU C C   
4449 O  O   . GLU C 153 ? 0.0561 0.0875 0.1002 -0.0106 -0.0109 0.0004  153 GLU C O   
4450 C  CB  . GLU C 153 ? 0.0774 0.0818 0.0952