data_3K9W
# 
_entry.id   3K9W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K9W         
RCSB  RCSB055729   
WWPDB D_1000055729 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      3ikz          'structure at neutral pH with dephospho-CoA' unspecified 
TargetDB BupsA.00142.a .                                            unspecified 
# 
_pdbx_database_status.entry_id                        3K9W 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-16 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.'         'Acta Crystallogr.,Sect.F' 
67 1032   1037   2011 ? DK 1744-3091 ? ? 21904046 10.1107/S1744309111004349    
1       'Combining functional and structural genomics to sample the essential Burkholderia structome.' 'Plos One'                 
8  e53851 e53851 2013 ? US 1932-6203 ? ? 23382856 10.1371/journal.pone.0053851 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Edwards, T.E.'       1  
primary 'Leibly, D.J.'        2  
primary 'Bhandari, J.'        3  
primary 'Statnekov, J.B.'     4  
primary 'Phan, I.'            5  
primary 'Dieterich, S.H.'     6  
primary 'Abendroth, J.'       7  
primary 'Staker, B.L.'        8  
primary 'Van Voorhis, W.C.'   9  
primary 'Myler, P.J.'         10 
primary 'Stewart, L.J.'       11 
1       'Baugh, L.'           12 
1       'Gallagher, L.A.'     13 
1       'Patrapuvich, R.'     14 
1       'Clifton, M.C.'       15 
1       'Gardberg, A.S.'      16 
1       'Edwards, T.E.'       17 
1       'Armour, B.'          18 
1       'Begley, D.W.'        19 
1       'Dieterich, S.H.'     20 
1       'Dranow, D.M.'        21 
1       'Abendroth, J.'       22 
1       'Fairman, J.W.'       23 
1       'Fox, D.'             24 
1       'Staker, B.L.'        25 
1       'Phan, I.'            26 
1       'Gillespie, A.'       27 
1       'Choi, R.'            28 
1       'Nakazawa-Hewitt, S.' 29 
1       'Nguyen, M.T.'        30 
1       'Napuli, A.'          31 
1       'Barrett, L.'         32 
1       'Buchko, G.W.'        33 
1       'Stacy, R.'           34 
1       'Myler, P.J.'         35 
1       'Stewart, L.J.'       36 
1       'Manoil, C.'          37 
1       'Van Voorhis, W.C.'   38 
# 
_cell.entry_id           3K9W 
_cell.length_a           134.431 
_cell.length_b           134.431 
_cell.length_c           134.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K9W 
_symmetry.space_group_name_H-M             'I 4 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                211 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phosphopantetheine adenylyltransferase' 20840.877 1   2.7.7.3 ? ? ? 
2 non-polymer syn 
;4'-diphospho pantetheine
;
438.328   1   ?       ? ? ? 
3 non-polymer syn ADENINE                                  135.127   1   ?       ? ? ? 
4 non-polymer syn 'TETRAETHYLENE GLYCOL'                   194.226   1   ?       ? ? ? 
5 non-polymer syn 'ACETATE ION'                            59.044    1   ?       ? ? ? 
6 non-polymer syn 'SULFATE ION'                            96.063    1   ?       ? ? ? 
7 water       nat water                                    18.015    137 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pantetheine-phosphate adenylyltransferase, PPAT, Dephospho-CoA pyrophosphorylase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAHHHHHHMGTLEAQTQGPGSMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLG
HYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGG
DVSKFVFPSVEKWLTEKVAAMAQGPSA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHHHHHHMGTLEAQTQGPGSMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLG
HYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGG
DVSKFVFPSVEKWLTEKVAAMAQGPSA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         BupsA.00142.a 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   MET n 
1 10  GLY n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  ALA n 
1 15  GLN n 
1 16  THR n 
1 17  GLN n 
1 18  GLY n 
1 19  PRO n 
1 20  GLY n 
1 21  SER n 
1 22  MET n 
1 23  VAL n 
1 24  VAL n 
1 25  ALA n 
1 26  VAL n 
1 27  TYR n 
1 28  PRO n 
1 29  GLY n 
1 30  THR n 
1 31  PHE n 
1 32  ASP n 
1 33  PRO n 
1 34  LEU n 
1 35  THR n 
1 36  ARG n 
1 37  GLY n 
1 38  HIS n 
1 39  GLU n 
1 40  ASP n 
1 41  LEU n 
1 42  VAL n 
1 43  ARG n 
1 44  ARG n 
1 45  ALA n 
1 46  SER n 
1 47  SER n 
1 48  ILE n 
1 49  PHE n 
1 50  ASP n 
1 51  THR n 
1 52  LEU n 
1 53  VAL n 
1 54  VAL n 
1 55  GLY n 
1 56  VAL n 
1 57  ALA n 
1 58  ASP n 
1 59  SER n 
1 60  ARG n 
1 61  ALA n 
1 62  LYS n 
1 63  LYS n 
1 64  PRO n 
1 65  PHE n 
1 66  PHE n 
1 67  SER n 
1 68  LEU n 
1 69  GLU n 
1 70  GLU n 
1 71  ARG n 
1 72  LEU n 
1 73  LYS n 
1 74  ILE n 
1 75  ALA n 
1 76  ASN n 
1 77  GLU n 
1 78  VAL n 
1 79  LEU n 
1 80  GLY n 
1 81  HIS n 
1 82  TYR n 
1 83  PRO n 
1 84  ASN n 
1 85  VAL n 
1 86  LYS n 
1 87  VAL n 
1 88  MET n 
1 89  GLY n 
1 90  PHE n 
1 91  THR n 
1 92  GLY n 
1 93  LEU n 
1 94  LEU n 
1 95  LYS n 
1 96  ASP n 
1 97  PHE n 
1 98  VAL n 
1 99  ARG n 
1 100 ALA n 
1 101 ASN n 
1 102 ASP n 
1 103 ALA n 
1 104 ARG n 
1 105 VAL n 
1 106 ILE n 
1 107 VAL n 
1 108 ARG n 
1 109 GLY n 
1 110 LEU n 
1 111 ARG n 
1 112 ALA n 
1 113 VAL n 
1 114 SER n 
1 115 ASP n 
1 116 PHE n 
1 117 GLU n 
1 118 TYR n 
1 119 GLU n 
1 120 PHE n 
1 121 GLN n 
1 122 MET n 
1 123 ALA n 
1 124 GLY n 
1 125 MET n 
1 126 ASN n 
1 127 ARG n 
1 128 TYR n 
1 129 LEU n 
1 130 LEU n 
1 131 PRO n 
1 132 ASP n 
1 133 VAL n 
1 134 GLU n 
1 135 THR n 
1 136 MET n 
1 137 PHE n 
1 138 MET n 
1 139 THR n 
1 140 PRO n 
1 141 SER n 
1 142 ASP n 
1 143 GLN n 
1 144 TYR n 
1 145 GLN n 
1 146 PHE n 
1 147 ILE n 
1 148 SER n 
1 149 GLY n 
1 150 THR n 
1 151 ILE n 
1 152 VAL n 
1 153 ARG n 
1 154 GLU n 
1 155 ILE n 
1 156 ALA n 
1 157 GLN n 
1 158 LEU n 
1 159 GLY n 
1 160 GLY n 
1 161 ASP n 
1 162 VAL n 
1 163 SER n 
1 164 LYS n 
1 165 PHE n 
1 166 VAL n 
1 167 PHE n 
1 168 PRO n 
1 169 SER n 
1 170 VAL n 
1 171 GLU n 
1 172 LYS n 
1 173 TRP n 
1 174 LEU n 
1 175 THR n 
1 176 GLU n 
1 177 LYS n 
1 178 VAL n 
1 179 ALA n 
1 180 ALA n 
1 181 MET n 
1 182 ALA n 
1 183 GLN n 
1 184 GLY n 
1 185 PRO n 
1 186 SER n 
1 187 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'coaD, BURPS1710b_0748' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    1710b 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Burkholderia pseudomallei' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     320372 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          AVA0421 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COAD_BURP1 
_struct_ref.pdbx_db_accession          Q3JW91 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRAN
DARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM
AQGPSA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3K9W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 22 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 187 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q3JW91 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  166 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       166 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K9W MET A 1  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -20 1  
1 3K9W ALA A 2  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -19 2  
1 3K9W HIS A 3  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -18 3  
1 3K9W HIS A 4  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -17 4  
1 3K9W HIS A 5  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -16 5  
1 3K9W HIS A 6  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -15 6  
1 3K9W HIS A 7  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -14 7  
1 3K9W HIS A 8  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -13 8  
1 3K9W MET A 9  ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -12 9  
1 3K9W GLY A 10 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -11 10 
1 3K9W THR A 11 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -10 11 
1 3K9W LEU A 12 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -9  12 
1 3K9W GLU A 13 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -8  13 
1 3K9W ALA A 14 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -7  14 
1 3K9W GLN A 15 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -6  15 
1 3K9W THR A 16 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -5  16 
1 3K9W GLN A 17 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -4  17 
1 3K9W GLY A 18 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -3  18 
1 3K9W PRO A 19 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -2  19 
1 3K9W GLY A 20 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' -1  20 
1 3K9W SER A 21 ? UNP Q3JW91 ? ? 'EXPRESSION TAG' 0   21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4PS non-polymer         . 
;4'-diphospho pantetheine
;
'N~3~-[(2R)-2-hydroxy-4-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}-3,3-dimethylbutanoyl]-N-(2-sulfanylethyl)-beta-alaninamide' 
'C11 H24 N2 O10 P2 S' 438.328 
ACT non-polymer         . 'ACETATE ION'              ? 'C2 H3 O2 -1'         59.044  
ADE non-polymer         . ADENINE                    ? 'C5 H5 N5'            135.127 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'          133.103 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                      ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'       149.211 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'     ? 'C8 H18 O5'           194.226 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'          105.093 
SO4 non-polymer         . 'SULFATE ION'              ? 'O4 S -2'             96.063  
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          3K9W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.35 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CSHT condition F1: 0.2 M ammonium sulfate, 0.1 M NaOAc pH 4.6, 30% PEG MME 2000, 20% EG as cryo-protectant, 19.2 mg/mL protein in 25 mM Hepes pH 7.0, 0.3 M NaCl, 10% glycerol, 5 mM DTT, crystal tracking ID 204963f1, VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2009-09-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97953 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97953 
# 
_reflns.entry_id                     3K9W 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.600 
_reflns.number_obs                   27383 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.000 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        32.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.Rmerge_I_obs           0.555 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.98 
_reflns_shell.pdbx_redundancy        9.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3K9W 
_refine.ls_number_reflns_obs                     25986 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.36 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    98.890 
_refine.ls_R_factor_obs                          0.19200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19119 
_refine.ls_R_factor_R_free                       0.20690 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1363 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.50 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.956 
_refine.B_iso_mean                               15.125 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      3IKZ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.087 
_refine.pdbx_overall_ESU_R_Free                  0.083 
_refine.overall_SU_ML                            0.052 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.200 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1279 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             137 
_refine_hist.number_atoms_total               1471 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        26.36 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 1453 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.193  1.997  ? 1978 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.559  5.000  ? 186  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.090 23.030 ? 66   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.904 15.000 ? 246  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.527 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.076  0.200  ? 212  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 1107 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.646  1.500  ? 857  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.248  2.000  ? 1395 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.912  3.000  ? 596  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.115  4.500  ? 574  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.599 
_refine_ls_shell.d_res_low                        1.640 
_refine_ls_shell.number_reflns_R_work             1905 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               99.80 
_refine_ls_shell.R_factor_R_free                  0.229 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             113 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3K9W 
_struct.title                     
;Crystal structure of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei with hydrolyzed 3'-dephospho Coenzyme A
;
_struct.pdbx_descriptor           'Phosphopantetheine adenylyltransferase (E.C.2.7.7.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K9W 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;NIAID, SSGCID, Seattle Structural Genomics Center for Infectious Disease, Coenzyme A, CoA, biosynthesis, hydrolysis, ATP-binding, Coenzyme A biosynthesis, Nucleotide-binding, Nucleotidyltransferase, Transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 35  ? PHE A 49  ? THR A 14  PHE A 28  1 ? 15 
HELX_P HELX_P2 2 SER A 59  ? LYS A 63  ? SER A 38  LYS A 42  5 ? 5  
HELX_P HELX_P3 3 SER A 67  ? GLY A 80  ? SER A 46  GLY A 59  1 ? 14 
HELX_P HELX_P4 4 LEU A 93  ? ASN A 101 ? LEU A 72  ASN A 80  1 ? 9  
HELX_P HELX_P5 5 ASP A 115 ? LEU A 130 ? ASP A 94  LEU A 109 1 ? 16 
HELX_P HELX_P6 6 SER A 141 ? GLN A 145 ? SER A 120 GLN A 124 5 ? 5  
HELX_P HELX_P7 7 SER A 148 ? LEU A 158 ? SER A 127 LEU A 137 1 ? 11 
HELX_P HELX_P8 8 PHE A 167 ? ALA A 182 ? PHE A 146 ALA A 161 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           32 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            11 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    33 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     12 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.56 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 85  ? PHE A 90  ? VAL A 64  PHE A 69  
A 2 THR A 51  ? ALA A 57  ? THR A 30  ALA A 36  
A 3 VAL A 24  ? GLY A 29  ? VAL A 3   GLY A 8   
A 4 VAL A 105 ? GLY A 109 ? VAL A 84  GLY A 88  
A 5 GLU A 134 ? MET A 138 ? GLU A 113 MET A 117 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 86  ? O LYS A 65 N VAL A 54  ? N VAL A 33  
A 2 3 O VAL A 53  ? O VAL A 32 N ALA A 25  ? N ALA A 4   
A 3 4 N VAL A 26  ? N VAL A 5  O VAL A 107 ? O VAL A 86  
A 4 5 N ILE A 106 ? N ILE A 85 O MET A 136 ? O MET A 115 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 4PS A 167' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE ADE A 168' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PG4 A 169' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 170' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 171' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 GLY A 29  ? GLY A 8   . ? 1_555  ? 
2  AC1 22 THR A 30  ? THR A 9   . ? 1_555  ? 
3  AC1 22 PHE A 31  ? PHE A 10  . ? 1_555  ? 
4  AC1 22 HIS A 38  ? HIS A 17  . ? 1_555  ? 
5  AC1 22 ALA A 57  ? ALA A 36  . ? 1_555  ? 
6  AC1 22 LYS A 62  ? LYS A 41  . ? 1_555  ? 
7  AC1 22 GLY A 92  ? GLY A 71  . ? 1_555  ? 
8  AC1 22 LEU A 93  ? LEU A 72  . ? 1_555  ? 
9  AC1 22 LEU A 94  ? LEU A 73  . ? 1_555  ? 
10 AC1 22 ARG A 108 ? ARG A 87  . ? 1_555  ? 
11 AC1 22 TYR A 118 ? TYR A 97  . ? 1_555  ? 
12 AC1 22 ASN A 126 ? ASN A 105 . ? 1_555  ? 
13 AC1 22 ILE A 151 ? ILE A 130 . ? 12_555 ? 
14 AC1 22 GLU A 154 ? GLU A 133 . ? 12_555 ? 
15 AC1 22 LEU A 158 ? LEU A 137 . ? 12_555 ? 
16 AC1 22 HOH G .   ? HOH A 184 . ? 1_555  ? 
17 AC1 22 HOH G .   ? HOH A 214 . ? 1_555  ? 
18 AC1 22 HOH G .   ? HOH A 232 . ? 1_555  ? 
19 AC1 22 HOH G .   ? HOH A 262 . ? 1_555  ? 
20 AC1 22 HOH G .   ? HOH A 266 . ? 12_555 ? 
21 AC1 22 HOH G .   ? HOH A 301 . ? 1_555  ? 
22 AC1 22 HOH G .   ? HOH A 306 . ? 1_555  ? 
23 AC2 9  GLY A 37  ? GLY A 16  . ? 1_555  ? 
24 AC2 9  ARG A 111 ? ARG A 90  . ? 1_555  ? 
25 AC2 9  PRO A 140 ? PRO A 119 . ? 1_555  ? 
26 AC2 9  TYR A 144 ? TYR A 123 . ? 1_555  ? 
27 AC2 9  ILE A 147 ? ILE A 126 . ? 1_555  ? 
28 AC2 9  ACT E .   ? ACT A 170 . ? 1_555  ? 
29 AC2 9  SO4 F .   ? SO4 A 171 . ? 1_555  ? 
30 AC2 9  HOH G .   ? HOH A 197 . ? 1_555  ? 
31 AC2 9  HOH G .   ? HOH A 306 . ? 1_555  ? 
32 AC3 10 ASP A 58  ? ASP A 37  . ? 1_555  ? 
33 AC3 10 PHE A 66  ? PHE A 45  . ? 1_555  ? 
34 AC3 10 SER A 67  ? SER A 46  . ? 1_555  ? 
35 AC3 10 LEU A 68  ? LEU A 47  . ? 1_555  ? 
36 AC3 10 GLU A 69  ? GLU A 48  . ? 1_555  ? 
37 AC3 10 ARG A 71  ? ARG A 50  . ? 1_555  ? 
38 AC3 10 GLU A 176 ? GLU A 155 . ? 21_555 ? 
39 AC3 10 ALA A 179 ? ALA A 158 . ? 21_555 ? 
40 AC3 10 ALA A 180 ? ALA A 159 . ? 21_555 ? 
41 AC3 10 HOH G .   ? HOH A 225 . ? 1_555  ? 
42 AC4 5  SER A 148 ? SER A 127 . ? 1_555  ? 
43 AC4 5  GLY A 149 ? GLY A 128 . ? 1_555  ? 
44 AC4 5  THR A 150 ? THR A 129 . ? 1_555  ? 
45 AC4 5  ADE C .   ? ADE A 168 . ? 1_555  ? 
46 AC4 5  HOH G .   ? HOH A 193 . ? 1_555  ? 
47 AC5 7  ARG A 111 ? ARG A 90  . ? 1_555  ? 
48 AC5 7  SER A 114 ? SER A 93  . ? 1_555  ? 
49 AC5 7  ASP A 115 ? ASP A 94  . ? 1_555  ? 
50 AC5 7  TYR A 118 ? TYR A 97  . ? 1_555  ? 
51 AC5 7  GLU A 119 ? GLU A 98  . ? 1_555  ? 
52 AC5 7  ADE C .   ? ADE A 168 . ? 1_555  ? 
53 AC5 7  HOH G .   ? HOH A 307 . ? 1_555  ? 
# 
_atom_sites.entry_id                    3K9W 
_atom_sites.fract_transf_matrix[1][1]   0.007439 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007439 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007439 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 20  ? -35.433 63.043 -6.411  1.00 29.02 ? -1  GLY A N   1 
ATOM   2    C CA  . GLY A 1 20  ? -36.185 61.990 -7.159  1.00 28.61 ? -1  GLY A CA  1 
ATOM   3    C C   . GLY A 1 20  ? -36.417 60.735 -6.337  1.00 28.43 ? -1  GLY A C   1 
ATOM   4    O O   . GLY A 1 20  ? -37.279 60.708 -5.454  1.00 28.92 ? -1  GLY A O   1 
ATOM   5    N N   . SER A 1 21  ? -35.658 59.688 -6.646  1.00 27.65 ? 0   SER A N   1 
ATOM   6    C CA  . SER A 1 21  ? -35.695 58.445 -5.875  1.00 27.04 ? 0   SER A CA  1 
ATOM   7    C C   . SER A 1 21  ? -34.313 57.803 -5.858  1.00 26.23 ? 0   SER A C   1 
ATOM   8    O O   . SER A 1 21  ? -33.453 58.156 -6.674  1.00 26.61 ? 0   SER A O   1 
ATOM   9    C CB  . SER A 1 21  ? -36.721 57.470 -6.455  1.00 27.23 ? 0   SER A CB  1 
ATOM   10   O OG  . SER A 1 21  ? -36.385 57.113 -7.790  1.00 27.60 ? 0   SER A OG  1 
ATOM   11   N N   . MET A 1 22  ? -34.096 56.885 -4.918  1.00 24.87 ? 1   MET A N   1 
ATOM   12   C CA  . MET A 1 22  ? -32.859 56.108 -4.861  1.00 23.49 ? 1   MET A CA  1 
ATOM   13   C C   . MET A 1 22  ? -33.135 54.703 -5.391  1.00 21.56 ? 1   MET A C   1 
ATOM   14   O O   . MET A 1 22  ? -33.879 53.932 -4.777  1.00 21.77 ? 1   MET A O   1 
ATOM   15   C CB  . MET A 1 22  ? -32.324 56.049 -3.424  1.00 24.41 ? 1   MET A CB  1 
ATOM   16   C CG  . MET A 1 22  ? -30.884 55.554 -3.303  1.00 26.89 ? 1   MET A CG  1 
ATOM   17   S SD  . MET A 1 22  ? -29.661 56.844 -3.626  1.00 32.98 ? 1   MET A SD  1 
ATOM   18   C CE  . MET A 1 22  ? -29.834 57.874 -2.163  1.00 31.40 ? 1   MET A CE  1 
ATOM   19   N N   . VAL A 1 23  ? -32.552 54.375 -6.544  1.00 18.64 ? 2   VAL A N   1 
ATOM   20   C CA  . VAL A 1 23  ? -32.751 53.059 -7.141  1.00 16.33 ? 2   VAL A CA  1 
ATOM   21   C C   . VAL A 1 23  ? -31.413 52.339 -7.232  1.00 14.52 ? 2   VAL A C   1 
ATOM   22   O O   . VAL A 1 23  ? -30.469 52.847 -7.828  1.00 14.33 ? 2   VAL A O   1 
ATOM   23   C CB  . VAL A 1 23  ? -33.398 53.136 -8.552  1.00 16.17 ? 2   VAL A CB  1 
ATOM   24   C CG1 . VAL A 1 23  ? -33.583 51.729 -9.125  1.00 17.10 ? 2   VAL A CG1 1 
ATOM   25   C CG2 . VAL A 1 23  ? -34.738 53.862 -8.492  1.00 16.72 ? 2   VAL A CG2 1 
ATOM   26   N N   . VAL A 1 24  ? -31.354 51.168 -6.612  1.00 12.51 ? 3   VAL A N   1 
ATOM   27   C CA  . VAL A 1 24  ? -30.189 50.290 -6.688  1.00 10.77 ? 3   VAL A CA  1 
ATOM   28   C C   . VAL A 1 24  ? -30.484 49.196 -7.705  1.00 10.05 ? 3   VAL A C   1 
ATOM   29   O O   . VAL A 1 24  ? -31.566 48.611 -7.700  1.00 10.29 ? 3   VAL A O   1 
ATOM   30   C CB  . VAL A 1 24  ? -29.902 49.623 -5.325  1.00 10.17 ? 3   VAL A CB  1 
ATOM   31   C CG1 . VAL A 1 24  ? -28.676 48.711 -5.423  1.00 10.30 ? 3   VAL A CG1 1 
ATOM   32   C CG2 . VAL A 1 24  ? -29.697 50.677 -4.236  1.00 11.05 ? 3   VAL A CG2 1 
ATOM   33   N N   . ALA A 1 25  ? -29.517 48.941 -8.585  1.00 9.23  ? 4   ALA A N   1 
ATOM   34   C CA  . ALA A 1 25  ? -29.593 47.840 -9.534  1.00 9.00  ? 4   ALA A CA  1 
ATOM   35   C C   . ALA A 1 25  ? -28.456 46.875 -9.263  1.00 9.42  ? 4   ALA A C   1 
ATOM   36   O O   . ALA A 1 25  ? -27.370 47.299 -8.859  1.00 9.77  ? 4   ALA A O   1 
ATOM   37   C CB  . ALA A 1 25  ? -29.476 48.356 -10.958 1.00 9.44  ? 4   ALA A CB  1 
ATOM   38   N N   . VAL A 1 26  ? -28.711 45.592 -9.522  1.00 8.77  ? 5   VAL A N   1 
ATOM   39   C CA  . VAL A 1 26  ? -27.696 44.547 -9.465  1.00 8.86  ? 5   VAL A CA  1 
ATOM   40   C C   . VAL A 1 26  ? -27.383 44.080 -10.884 1.00 8.55  ? 5   VAL A C   1 
ATOM   41   O O   . VAL A 1 26  ? -28.297 43.810 -11.655 1.00 9.15  ? 5   VAL A O   1 
ATOM   42   C CB  . VAL A 1 26  ? -28.177 43.343 -8.628  1.00 8.90  ? 5   VAL A CB  1 
ATOM   43   C CG1 . VAL A 1 26  ? -27.205 42.159 -8.783  1.00 10.60 ? 5   VAL A CG1 1 
ATOM   44   C CG2 . VAL A 1 26  ? -28.284 43.748 -7.160  1.00 9.47  ? 5   VAL A CG2 1 
ATOM   45   N N   . TYR A 1 27  ? -26.094 43.973 -11.201 1.00 8.49  ? 6   TYR A N   1 
ATOM   46   C CA  . TYR A 1 27  ? -25.604 43.402 -12.458 1.00 8.93  ? 6   TYR A CA  1 
ATOM   47   C C   . TYR A 1 27  ? -24.883 42.121 -12.080 1.00 8.59  ? 6   TYR A C   1 
ATOM   48   O O   . TYR A 1 27  ? -23.727 42.166 -11.651 1.00 9.25  ? 6   TYR A O   1 
ATOM   49   C CB  . TYR A 1 27  ? -24.640 44.382 -13.130 1.00 9.41  ? 6   TYR A CB  1 
ATOM   50   C CG  . TYR A 1 27  ? -24.009 43.940 -14.430 1.00 9.90  ? 6   TYR A CG  1 
ATOM   51   C CD1 . TYR A 1 27  ? -24.751 43.299 -15.417 1.00 11.85 ? 6   TYR A CD1 1 
ATOM   52   C CD2 . TYR A 1 27  ? -22.667 44.195 -14.677 1.00 12.37 ? 6   TYR A CD2 1 
ATOM   53   C CE1 . TYR A 1 27  ? -24.155 42.911 -16.625 1.00 12.92 ? 6   TYR A CE1 1 
ATOM   54   C CE2 . TYR A 1 27  ? -22.073 43.836 -15.879 1.00 12.00 ? 6   TYR A CE2 1 
ATOM   55   C CZ  . TYR A 1 27  ? -22.814 43.193 -16.834 1.00 10.76 ? 6   TYR A CZ  1 
ATOM   56   O OH  . TYR A 1 27  ? -22.219 42.817 -18.017 1.00 12.42 ? 6   TYR A OH  1 
ATOM   57   N N   . PRO A 1 28  ? -25.565 40.980 -12.217 1.00 8.88  ? 7   PRO A N   1 
ATOM   58   C CA  . PRO A 1 28  ? -24.992 39.720 -11.754 1.00 8.98  ? 7   PRO A CA  1 
ATOM   59   C C   . PRO A 1 28  ? -24.308 38.969 -12.883 1.00 9.16  ? 7   PRO A C   1 
ATOM   60   O O   . PRO A 1 28  ? -24.705 39.089 -14.036 1.00 11.01 ? 7   PRO A O   1 
ATOM   61   C CB  . PRO A 1 28  ? -26.214 38.945 -11.278 1.00 9.22  ? 7   PRO A CB  1 
ATOM   62   C CG  . PRO A 1 28  ? -27.307 39.398 -12.238 1.00 9.07  ? 7   PRO A CG  1 
ATOM   63   C CD  . PRO A 1 28  ? -26.983 40.830 -12.616 1.00 9.09  ? 7   PRO A CD  1 
ATOM   64   N N   . GLY A 1 29  ? -23.318 38.159 -12.544 1.00 8.72  ? 8   GLY A N   1 
ATOM   65   C CA  . GLY A 1 29  ? -22.660 37.336 -13.561 1.00 8.73  ? 8   GLY A CA  1 
ATOM   66   C C   . GLY A 1 29  ? -21.601 36.465 -12.941 1.00 9.01  ? 8   GLY A C   1 
ATOM   67   O O   . GLY A 1 29  ? -21.312 36.568 -11.742 1.00 9.26  ? 8   GLY A O   1 
ATOM   68   N N   . THR A 1 30  ? -21.046 35.571 -13.745 1.00 8.86  ? 9   THR A N   1 
ATOM   69   C CA  . THR A 1 30  ? -19.912 34.765 -13.287 1.00 9.74  ? 9   THR A CA  1 
ATOM   70   C C   . THR A 1 30  ? -18.606 35.562 -13.436 1.00 10.09 ? 9   THR A C   1 
ATOM   71   O O   . THR A 1 30  ? -17.712 35.473 -12.591 1.00 9.67  ? 9   THR A O   1 
ATOM   72   C CB  . THR A 1 30  ? -19.890 33.410 -14.012 1.00 10.01 ? 9   THR A CB  1 
ATOM   73   O OG1 . THR A 1 30  ? -21.105 32.712 -13.722 1.00 10.67 ? 9   THR A OG1 1 
ATOM   74   C CG2 . THR A 1 30  ? -18.723 32.551 -13.532 1.00 10.39 ? 9   THR A CG2 1 
ATOM   75   N N   . PHE A 1 31  ? -18.514 36.369 -14.492 1.00 10.08 ? 10  PHE A N   1 
ATOM   76   C CA  . PHE A 1 31  ? -17.374 37.280 -14.714 1.00 10.01 ? 10  PHE A CA  1 
ATOM   77   C C   . PHE A 1 31  ? -16.034 36.553 -14.650 1.00 10.61 ? 10  PHE A C   1 
ATOM   78   O O   . PHE A 1 31  ? -15.155 36.885 -13.845 1.00 11.40 ? 10  PHE A O   1 
ATOM   79   C CB  . PHE A 1 31  ? -17.415 38.499 -13.777 1.00 10.32 ? 10  PHE A CB  1 
ATOM   80   C CG  . PHE A 1 31  ? -18.699 39.276 -13.851 1.00 10.90 ? 10  PHE A CG  1 
ATOM   81   C CD1 . PHE A 1 31  ? -19.535 39.370 -12.740 1.00 11.67 ? 10  PHE A CD1 1 
ATOM   82   C CD2 . PHE A 1 31  ? -19.079 39.915 -15.041 1.00 12.72 ? 10  PHE A CD2 1 
ATOM   83   C CE1 . PHE A 1 31  ? -20.731 40.095 -12.805 1.00 11.40 ? 10  PHE A CE1 1 
ATOM   84   C CE2 . PHE A 1 31  ? -20.280 40.630 -15.118 1.00 14.31 ? 10  PHE A CE2 1 
ATOM   85   C CZ  . PHE A 1 31  ? -21.102 40.722 -13.996 1.00 13.73 ? 10  PHE A CZ  1 
ATOM   86   N N   . ASP A 1 32  ? -15.901 35.571 -15.537 1.00 10.98 ? 11  ASP A N   1 
ATOM   87   C CA  . ASP A 1 32  ? -14.752 34.659 -15.578 1.00 11.59 ? 11  ASP A CA  1 
ATOM   88   C C   . ASP A 1 32  ? -13.932 34.785 -16.877 1.00 12.18 ? 11  ASP A C   1 
ATOM   89   O O   . ASP A 1 32  ? -13.934 33.870 -17.693 1.00 13.37 ? 11  ASP A O   1 
ATOM   90   C CB  . ASP A 1 32  ? -15.268 33.215 -15.409 1.00 11.78 ? 11  ASP A CB  1 
ATOM   91   C CG  . ASP A 1 32  ? -14.150 32.194 -15.254 1.00 12.62 ? 11  ASP A CG  1 
ATOM   92   O OD1 . ASP A 1 32  ? -13.126 32.520 -14.618 1.00 12.53 ? 11  ASP A OD1 1 
ATOM   93   O OD2 . ASP A 1 32  ? -14.306 31.053 -15.756 1.00 13.54 ? 11  ASP A OD2 1 
ATOM   94   N N   . PRO A 1 33  ? -13.215 35.907 -17.070 1.00 12.15 ? 12  PRO A N   1 
ATOM   95   C CA  . PRO A 1 33  ? -13.096 37.090 -16.240 1.00 11.76 ? 12  PRO A CA  1 
ATOM   96   C C   . PRO A 1 33  ? -14.019 38.203 -16.741 1.00 11.07 ? 12  PRO A C   1 
ATOM   97   O O   . PRO A 1 33  ? -14.708 38.027 -17.750 1.00 12.06 ? 12  PRO A O   1 
ATOM   98   C CB  . PRO A 1 33  ? -11.639 37.494 -16.466 1.00 12.22 ? 12  PRO A CB  1 
ATOM   99   C CG  . PRO A 1 33  ? -11.427 37.182 -17.911 1.00 12.53 ? 12  PRO A CG  1 
ATOM   100  C CD  . PRO A 1 33  ? -12.294 35.984 -18.229 1.00 12.57 ? 12  PRO A CD  1 
ATOM   101  N N   . LEU A 1 34  ? -13.999 39.334 -16.047 1.00 10.99 ? 13  LEU A N   1 
ATOM   102  C CA  . LEU A 1 34  ? -14.628 40.568 -16.521 1.00 10.39 ? 13  LEU A CA  1 
ATOM   103  C C   . LEU A 1 34  ? -14.013 40.973 -17.872 1.00 10.32 ? 13  LEU A C   1 
ATOM   104  O O   . LEU A 1 34  ? -12.787 41.105 -17.983 1.00 9.75  ? 13  LEU A O   1 
ATOM   105  C CB  . LEU A 1 34  ? -14.426 41.681 -15.490 1.00 11.05 ? 13  LEU A CB  1 
ATOM   106  C CG  . LEU A 1 34  ? -15.249 42.940 -15.732 1.00 11.35 ? 13  LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 34  ? -16.604 42.807 -15.056 1.00 14.35 ? 13  LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 34  ? -14.521 44.170 -15.203 1.00 13.91 ? 13  LEU A CD2 1 
ATOM   109  N N   . THR A 1 35  ? -14.856 41.147 -18.886 1.00 9.58  ? 14  THR A N   1 
ATOM   110  C CA  . THR A 1 35  ? -14.397 41.564 -20.230 1.00 9.75  ? 14  THR A CA  1 
ATOM   111  C C   . THR A 1 35  ? -14.683 43.045 -20.474 1.00 9.74  ? 14  THR A C   1 
ATOM   112  O O   . THR A 1 35  ? -15.310 43.727 -19.649 1.00 9.22  ? 14  THR A O   1 
ATOM   113  C CB  . THR A 1 35  ? -15.067 40.768 -21.380 1.00 10.17 ? 14  THR A CB  1 
ATOM   114  O OG1 . THR A 1 35  ? -16.439 41.185 -21.514 1.00 10.99 ? 14  THR A OG1 1 
ATOM   115  C CG2 . THR A 1 35  ? -15.002 39.266 -21.131 1.00 11.56 ? 14  THR A CG2 1 
ATOM   116  N N   . ARG A 1 36  ? -14.238 43.537 -21.628 1.00 9.37  ? 15  ARG A N   1 
ATOM   117  C CA  . ARG A 1 36  ? -14.542 44.906 -22.022 1.00 8.88  ? 15  ARG A CA  1 
ATOM   118  C C   . ARG A 1 36  ? -16.038 45.100 -22.252 1.00 8.78  ? 15  ARG A C   1 
ATOM   119  O O   . ARG A 1 36  ? -16.543 46.208 -22.079 1.00 9.40  ? 15  ARG A O   1 
ATOM   120  C CB  . ARG A 1 36  ? -13.760 45.286 -23.279 1.00 8.22  ? 15  ARG A CB  1 
ATOM   121  C CG  . ARG A 1 36  ? -12.275 45.477 -22.997 1.00 7.89  ? 15  ARG A CG  1 
ATOM   122  C CD  . ARG A 1 36  ? -11.534 45.811 -24.289 1.00 8.62  ? 15  ARG A CD  1 
ATOM   123  N NE  . ARG A 1 36  ? -10.077 45.823 -24.103 1.00 9.07  ? 15  ARG A NE  1 
ATOM   124  C CZ  . ARG A 1 36  ? -9.376  46.890 -23.720 1.00 11.22 ? 15  ARG A CZ  1 
ATOM   125  N NH1 . ARG A 1 36  ? -9.996  48.042 -23.449 1.00 11.81 ? 15  ARG A NH1 1 
ATOM   126  N NH2 . ARG A 1 36  ? -8.053  46.807 -23.593 1.00 10.87 ? 15  ARG A NH2 1 
ATOM   127  N N   . GLY A 1 37  ? -16.732 44.033 -22.639 1.00 8.72  ? 16  GLY A N   1 
ATOM   128  C CA  . GLY A 1 37  ? -18.193 44.086 -22.795 1.00 8.97  ? 16  GLY A CA  1 
ATOM   129  C C   . GLY A 1 37  ? -18.859 44.347 -21.452 1.00 9.59  ? 16  GLY A C   1 
ATOM   130  O O   . GLY A 1 37  ? -19.722 45.234 -21.337 1.00 9.35  ? 16  GLY A O   1 
ATOM   131  N N   . HIS A 1 38  ? -18.453 43.589 -20.431 1.00 9.74  ? 17  HIS A N   1 
ATOM   132  C CA  . HIS A 1 38  ? -18.998 43.789 -19.075 1.00 9.46  ? 17  HIS A CA  1 
ATOM   133  C C   . HIS A 1 38  ? -18.707 45.185 -18.543 1.00 9.91  ? 17  HIS A C   1 
ATOM   134  O O   . HIS A 1 38  ? -19.571 45.829 -17.943 1.00 9.79  ? 17  HIS A O   1 
ATOM   135  C CB  . HIS A 1 38  ? -18.395 42.795 -18.077 1.00 9.77  ? 17  HIS A CB  1 
ATOM   136  C CG  . HIS A 1 38  ? -18.659 41.360 -18.393 1.00 9.81  ? 17  HIS A CG  1 
ATOM   137  N ND1 . HIS A 1 38  ? -17.655 40.416 -18.418 1.00 10.17 ? 17  HIS A ND1 1 
ATOM   138  C CD2 . HIS A 1 38  ? -19.813 40.688 -18.610 1.00 13.57 ? 17  HIS A CD2 1 
ATOM   139  C CE1 . HIS A 1 38  ? -18.170 39.234 -18.700 1.00 12.54 ? 17  HIS A CE1 1 
ATOM   140  N NE2 . HIS A 1 38  ? -19.481 39.369 -18.812 1.00 14.66 ? 17  HIS A NE2 1 
ATOM   141  N N   . GLU A 1 39  ? -17.473 45.646 -18.723 1.00 9.08  ? 18  GLU A N   1 
ATOM   142  C CA  . GLU A 1 39  ? -17.101 46.963 -18.244 1.00 9.83  ? 18  GLU A CA  1 
ATOM   143  C C   . GLU A 1 39  ? -17.941 48.055 -18.883 1.00 9.56  ? 18  GLU A C   1 
ATOM   144  O O   . GLU A 1 39  ? -18.334 49.006 -18.223 1.00 9.75  ? 18  GLU A O   1 
ATOM   145  C CB  . GLU A 1 39  ? -15.610 47.220 -18.468 1.00 9.73  ? 18  GLU A CB  1 
ATOM   146  C CG  . GLU A 1 39  ? -15.100 48.460 -17.723 1.00 12.20 ? 18  GLU A CG  1 
ATOM   147  C CD  . GLU A 1 39  ? -15.264 49.766 -18.493 1.00 13.49 ? 18  GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 39  ? -15.605 49.756 -19.699 1.00 13.11 ? 18  GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 39  ? -15.036 50.827 -17.880 1.00 15.68 ? 18  GLU A OE2 1 
ATOM   150  N N   . ASP A 1 40  ? -18.220 47.915 -20.177 1.00 9.84  ? 19  ASP A N   1 
ATOM   151  C CA  . ASP A 1 40  ? -19.022 48.917 -20.857 1.00 9.86  ? 19  ASP A CA  1 
ATOM   152  C C   . ASP A 1 40  ? -20.439 48.927 -20.291 1.00 10.02 ? 19  ASP A C   1 
ATOM   153  O O   . ASP A 1 40  ? -21.035 49.988 -20.123 1.00 9.97  ? 19  ASP A O   1 
ATOM   154  C CB  . ASP A 1 40  ? -19.035 48.671 -22.365 1.00 9.97  ? 19  ASP A CB  1 
ATOM   155  C CG  . ASP A 1 40  ? -19.711 49.792 -23.121 1.00 11.85 ? 19  ASP A CG  1 
ATOM   156  O OD1 . ASP A 1 40  ? -19.173 50.921 -23.124 1.00 16.95 ? 19  ASP A OD1 1 
ATOM   157  O OD2 . ASP A 1 40  ? -20.784 49.545 -23.688 1.00 12.57 ? 19  ASP A OD2 1 
ATOM   158  N N   . LEU A 1 41  ? -20.957 47.746 -19.972 1.00 9.18  ? 20  LEU A N   1 
ATOM   159  C CA  . LEU A 1 41  ? -22.297 47.634 -19.397 1.00 10.10 ? 20  LEU A CA  1 
ATOM   160  C C   . LEU A 1 41  ? -22.310 48.299 -18.015 1.00 10.03 ? 20  LEU A C   1 
ATOM   161  O O   . LEU A 1 41  ? -23.261 48.998 -17.656 1.00 10.39 ? 20  LEU A O   1 
ATOM   162  C CB  . LEU A 1 41  ? -22.716 46.158 -19.330 1.00 10.61 ? 20  LEU A CB  1 
ATOM   163  C CG  . LEU A 1 41  ? -24.141 45.807 -19.756 1.00 14.26 ? 20  LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 41  ? -25.151 46.426 -18.807 1.00 17.81 ? 20  LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 41  ? -24.403 46.267 -21.205 1.00 15.50 ? 20  LEU A CD2 1 
ATOM   166  N N   . VAL A 1 42  ? -21.242 48.104 -17.241 1.00 9.60  ? 21  VAL A N   1 
ATOM   167  C CA  . VAL A 1 42  ? -21.145 48.762 -15.922 1.00 9.85  ? 21  VAL A CA  1 
ATOM   168  C C   . VAL A 1 42  ? -21.110 50.284 -16.057 1.00 9.77  ? 21  VAL A C   1 
ATOM   169  O O   . VAL A 1 42  ? -21.825 50.991 -15.351 1.00 9.70  ? 21  VAL A O   1 
ATOM   170  C CB  . VAL A 1 42  ? -19.934 48.253 -15.106 1.00 9.78  ? 21  VAL A CB  1 
ATOM   171  C CG1 . VAL A 1 42  ? -19.728 49.106 -13.832 1.00 10.02 ? 21  VAL A CG1 1 
ATOM   172  C CG2 . VAL A 1 42  ? -20.120 46.789 -14.761 1.00 10.41 ? 21  VAL A CG2 1 
ATOM   173  N N   . ARG A 1 43  ? -20.305 50.787 -16.995 1.00 10.24 ? 22  ARG A N   1 
ATOM   174  C CA  . ARG A 1 43  ? -20.254 52.222 -17.255 1.00 10.96 ? 22  ARG A CA  1 
ATOM   175  C C   . ARG A 1 43  ? -21.657 52.772 -17.574 1.00 11.17 ? 22  ARG A C   1 
ATOM   176  O O   . ARG A 1 43  ? -22.104 53.763 -16.986 1.00 11.36 ? 22  ARG A O   1 
ATOM   177  C CB  . ARG A 1 43  ? -19.297 52.496 -18.418 1.00 11.16 ? 22  ARG A CB  1 
ATOM   178  C CG  . ARG A 1 43  ? -19.061 53.974 -18.697 1.00 13.49 ? 22  ARG A CG  1 
ATOM   179  C CD  . ARG A 1 43  ? -18.138 54.188 -19.900 1.00 17.40 ? 22  ARG A CD  1 
ATOM   180  N NE  . ARG A 1 43  ? -18.687 53.640 -21.142 1.00 20.48 ? 22  ARG A NE  1 
ATOM   181  C CZ  . ARG A 1 43  ? -19.662 54.194 -21.868 1.00 22.08 ? 22  ARG A CZ  1 
ATOM   182  N NH1 . ARG A 1 43  ? -20.233 55.338 -21.499 1.00 24.67 ? 22  ARG A NH1 1 
ATOM   183  N NH2 . ARG A 1 43  ? -20.074 53.597 -22.978 1.00 24.29 ? 22  ARG A NH2 1 
ATOM   184  N N   . ARG A 1 44  ? -22.351 52.114 -18.498 1.00 10.61 ? 23  ARG A N   1 
ATOM   185  C CA  . ARG A 1 44  ? -23.682 52.551 -18.919 1.00 10.77 ? 23  ARG A CA  1 
ATOM   186  C C   . ARG A 1 44  ? -24.730 52.465 -17.802 1.00 10.67 ? 23  ARG A C   1 
ATOM   187  O O   . ARG A 1 44  ? -25.463 53.431 -17.554 1.00 11.19 ? 23  ARG A O   1 
ATOM   188  C CB  . ARG A 1 44  ? -24.129 51.775 -20.166 1.00 10.92 ? 23  ARG A CB  1 
ATOM   189  C CG  . ARG A 1 44  ? -23.239 52.000 -21.383 1.00 12.28 ? 23  ARG A CG  1 
ATOM   190  C CD  . ARG A 1 44  ? -23.777 51.225 -22.575 1.00 13.72 ? 23  ARG A CD  1 
ATOM   191  N NE  . ARG A 1 44  ? -22.925 51.412 -23.743 1.00 16.46 ? 23  ARG A NE  1 
ATOM   192  C CZ  . ARG A 1 44  ? -22.946 52.489 -24.524 1.00 18.93 ? 23  ARG A CZ  1 
ATOM   193  N NH1 . ARG A 1 44  ? -22.124 52.572 -25.558 1.00 20.12 ? 23  ARG A NH1 1 
ATOM   194  N NH2 . ARG A 1 44  ? -23.793 53.488 -24.281 1.00 20.80 ? 23  ARG A NH2 1 
ATOM   195  N N   . ALA A 1 45  ? -24.780 51.327 -17.112 1.00 10.26 ? 24  ALA A N   1 
ATOM   196  C CA  . ALA A 1 45  ? -25.753 51.114 -16.040 1.00 9.93  ? 24  ALA A CA  1 
ATOM   197  C C   . ALA A 1 45  ? -25.514 52.037 -14.852 1.00 10.22 ? 24  ALA A C   1 
ATOM   198  O O   . ALA A 1 45  ? -26.460 52.502 -14.230 1.00 10.04 ? 24  ALA A O   1 
ATOM   199  C CB  . ALA A 1 45  ? -25.741 49.646 -15.585 1.00 9.81  ? 24  ALA A CB  1 
ATOM   200  N N   . SER A 1 46  ? -24.252 52.292 -14.530 1.00 10.58 ? 25  SER A N   1 
ATOM   201  C CA  . SER A 1 46  ? -23.953 53.140 -13.372 1.00 11.24 ? 25  SER A CA  1 
ATOM   202  C C   . SER A 1 46  ? -24.263 54.610 -13.639 1.00 11.62 ? 25  SER A C   1 
ATOM   203  O O   . SER A 1 46  ? -24.325 55.408 -12.707 1.00 11.25 ? 25  SER A O   1 
ATOM   204  C CB  . SER A 1 46  ? -22.511 52.956 -12.908 1.00 11.50 ? 25  SER A CB  1 
ATOM   205  O OG  . SER A 1 46  ? -21.600 53.463 -13.854 1.00 13.31 ? 25  SER A OG  1 
ATOM   206  N N   . SER A 1 47  ? -24.462 54.961 -14.912 1.00 11.77 ? 26  SER A N   1 
ATOM   207  C CA  A SER A 1 47  ? -24.849 56.322 -15.282 0.50 12.20 ? 26  SER A CA  1 
ATOM   208  C CA  B SER A 1 47  ? -24.850 56.321 -15.284 0.50 12.56 ? 26  SER A CA  1 
ATOM   209  C C   . SER A 1 47  ? -26.349 56.541 -15.093 1.00 12.48 ? 26  SER A C   1 
ATOM   210  O O   . SER A 1 47  ? -26.811 57.680 -15.025 1.00 13.66 ? 26  SER A O   1 
ATOM   211  C CB  A SER A 1 47  ? -24.469 56.620 -16.733 0.50 12.21 ? 26  SER A CB  1 
ATOM   212  C CB  B SER A 1 47  ? -24.476 56.612 -16.738 0.50 12.63 ? 26  SER A CB  1 
ATOM   213  O OG  A SER A 1 47  ? -25.457 56.140 -17.634 0.50 12.08 ? 26  SER A OG  1 
ATOM   214  O OG  B SER A 1 47  ? -23.079 56.508 -16.948 0.50 14.63 ? 26  SER A OG  1 
ATOM   215  N N   . ILE A 1 48  ? -27.099 55.446 -15.017 1.00 12.31 ? 27  ILE A N   1 
ATOM   216  C CA  . ILE A 1 48  ? -28.563 55.496 -14.899 1.00 12.40 ? 27  ILE A CA  1 
ATOM   217  C C   . ILE A 1 48  ? -29.006 55.315 -13.451 1.00 12.10 ? 27  ILE A C   1 
ATOM   218  O O   . ILE A 1 48  ? -29.876 56.046 -12.949 1.00 12.17 ? 27  ILE A O   1 
ATOM   219  C CB  . ILE A 1 48  ? -29.254 54.428 -15.816 1.00 12.83 ? 27  ILE A CB  1 
ATOM   220  C CG1 . ILE A 1 48  ? -28.901 54.660 -17.296 1.00 13.78 ? 27  ILE A CG1 1 
ATOM   221  C CG2 . ILE A 1 48  ? -30.777 54.400 -15.603 1.00 13.49 ? 27  ILE A CG2 1 
ATOM   222  C CD1 . ILE A 1 48  ? -29.190 56.057 -17.833 1.00 16.86 ? 27  ILE A CD1 1 
ATOM   223  N N   . PHE A 1 49  ? -28.410 54.344 -12.768 1.00 11.55 ? 28  PHE A N   1 
ATOM   224  C CA  . PHE A 1 49  ? -28.838 53.998 -11.418 1.00 11.40 ? 28  PHE A CA  1 
ATOM   225  C C   . PHE A 1 49  ? -28.007 54.688 -10.350 1.00 11.34 ? 28  PHE A C   1 
ATOM   226  O O   . PHE A 1 49  ? -26.843 55.009 -10.568 1.00 11.95 ? 28  PHE A O   1 
ATOM   227  C CB  . PHE A 1 49  ? -28.844 52.472 -11.252 1.00 11.23 ? 28  PHE A CB  1 
ATOM   228  C CG  . PHE A 1 49  ? -29.811 51.793 -12.177 1.00 12.08 ? 28  PHE A CG  1 
ATOM   229  C CD1 . PHE A 1 49  ? -29.362 51.106 -13.307 1.00 12.63 ? 28  PHE A CD1 1 
ATOM   230  C CD2 . PHE A 1 49  ? -31.174 51.911 -11.960 1.00 13.38 ? 28  PHE A CD2 1 
ATOM   231  C CE1 . PHE A 1 49  ? -30.269 50.509 -14.184 1.00 13.78 ? 28  PHE A CE1 1 
ATOM   232  C CE2 . PHE A 1 49  ? -32.090 51.315 -12.830 1.00 14.09 ? 28  PHE A CE2 1 
ATOM   233  C CZ  . PHE A 1 49  ? -31.636 50.617 -13.942 1.00 14.24 ? 28  PHE A CZ  1 
ATOM   234  N N   . ASP A 1 50  ? -28.618 54.925 -9.197  1.00 11.41 ? 29  ASP A N   1 
ATOM   235  C CA  . ASP A 1 50  ? -27.921 55.608 -8.116  1.00 12.08 ? 29  ASP A CA  1 
ATOM   236  C C   . ASP A 1 50  ? -26.755 54.787 -7.596  1.00 11.77 ? 29  ASP A C   1 
ATOM   237  O O   . ASP A 1 50  ? -25.677 55.330 -7.349  1.00 12.35 ? 29  ASP A O   1 
ATOM   238  C CB  . ASP A 1 50  ? -28.902 55.988 -7.022  1.00 12.43 ? 29  ASP A CB  1 
ATOM   239  C CG  . ASP A 1 50  ? -29.979 56.916 -7.536  1.00 14.63 ? 29  ASP A CG  1 
ATOM   240  O OD1 . ASP A 1 50  ? -29.639 58.050 -7.930  1.00 18.10 ? 29  ASP A OD1 1 
ATOM   241  O OD2 . ASP A 1 50  ? -31.153 56.495 -7.592  1.00 18.20 ? 29  ASP A OD2 1 
ATOM   242  N N   . THR A 1 51  ? -26.972 53.482 -7.459  1.00 11.68 ? 30  THR A N   1 
ATOM   243  C CA  . THR A 1 51  ? -25.917 52.549 -7.107  1.00 11.35 ? 30  THR A CA  1 
ATOM   244  C C   . THR A 1 51  ? -26.035 51.349 -8.026  1.00 10.76 ? 30  THR A C   1 
ATOM   245  O O   . THR A 1 51  ? -27.144 50.893 -8.304  1.00 10.26 ? 30  THR A O   1 
ATOM   246  C CB  . THR A 1 51  ? -26.051 52.099 -5.633  1.00 11.73 ? 30  THR A CB  1 
ATOM   247  O OG1 . THR A 1 51  ? -25.941 53.245 -4.780  1.00 14.63 ? 30  THR A OG1 1 
ATOM   248  C CG2 . THR A 1 51  ? -24.960 51.092 -5.266  1.00 13.47 ? 30  THR A CG2 1 
ATOM   249  N N   . LEU A 1 52  ? -24.900 50.888 -8.537  1.00 9.83  ? 31  LEU A N   1 
ATOM   250  C CA  . LEU A 1 52  ? -24.859 49.643 -9.283  1.00 10.03 ? 31  LEU A CA  1 
ATOM   251  C C   . LEU A 1 52  ? -24.024 48.622 -8.520  1.00 10.70 ? 31  LEU A C   1 
ATOM   252  O O   . LEU A 1 52  ? -22.832 48.842 -8.277  1.00 10.72 ? 31  LEU A O   1 
ATOM   253  C CB  . LEU A 1 52  ? -24.281 49.867 -10.672 1.00 10.66 ? 31  LEU A CB  1 
ATOM   254  C CG  . LEU A 1 52  ? -24.292 48.599 -11.519 1.00 10.87 ? 31  LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 52  ? -25.718 48.282 -11.992 1.00 10.78 ? 31  LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 52  ? -23.360 48.715 -12.682 1.00 15.38 ? 31  LEU A CD2 1 
ATOM   257  N N   . VAL A 1 53  ? -24.656 47.516 -8.140  1.00 9.94  ? 32  VAL A N   1 
ATOM   258  C CA  . VAL A 1 53  ? -23.947 46.449 -7.448  1.00 10.13 ? 32  VAL A CA  1 
ATOM   259  C C   . VAL A 1 53  ? -23.593 45.368 -8.459  1.00 9.82  ? 32  VAL A C   1 
ATOM   260  O O   . VAL A 1 53  ? -24.474 44.773 -9.069  1.00 11.00 ? 32  VAL A O   1 
ATOM   261  C CB  . VAL A 1 53  ? -24.797 45.877 -6.296  1.00 9.56  ? 32  VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 53  ? -24.060 44.725 -5.614  1.00 11.72 ? 32  VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 53  ? -25.146 46.986 -5.313  1.00 10.16 ? 32  VAL A CG2 1 
ATOM   264  N N   . VAL A 1 54  ? -22.295 45.129 -8.642  1.00 9.54  ? 33  VAL A N   1 
ATOM   265  C CA  . VAL A 1 54  ? -21.835 44.061 -9.516  1.00 9.51  ? 33  VAL A CA  1 
ATOM   266  C C   . VAL A 1 54  ? -21.735 42.824 -8.648  1.00 9.47  ? 33  VAL A C   1 
ATOM   267  O O   . VAL A 1 54  ? -20.917 42.773 -7.711  1.00 9.18  ? 33  VAL A O   1 
ATOM   268  C CB  . VAL A 1 54  ? -20.477 44.383 -10.177 1.00 10.39 ? 33  VAL A CB  1 
ATOM   269  C CG1 . VAL A 1 54  ? -19.968 43.186 -10.960 1.00 10.01 ? 33  VAL A CG1 1 
ATOM   270  C CG2 . VAL A 1 54  ? -20.608 45.606 -11.085 1.00 10.85 ? 33  VAL A CG2 1 
ATOM   271  N N   . GLY A 1 55  ? -22.610 41.861 -8.920  1.00 8.62  ? 34  GLY A N   1 
ATOM   272  C CA  . GLY A 1 55  ? -22.701 40.648 -8.118  1.00 8.69  ? 34  GLY A CA  1 
ATOM   273  C C   . GLY A 1 55  ? -21.977 39.525 -8.823  1.00 8.91  ? 34  GLY A C   1 
ATOM   274  O O   . GLY A 1 55  ? -22.403 39.075 -9.894  1.00 9.03  ? 34  GLY A O   1 
ATOM   275  N N   . VAL A 1 56  ? -20.871 39.081 -8.231  1.00 8.50  ? 35  VAL A N   1 
ATOM   276  C CA  . VAL A 1 56  ? -20.092 37.985 -8.798  1.00 8.39  ? 35  VAL A CA  1 
ATOM   277  C C   . VAL A 1 56  ? -20.507 36.675 -8.132  1.00 8.04  ? 35  VAL A C   1 
ATOM   278  O O   . VAL A 1 56  ? -20.238 36.436 -6.947  1.00 8.24  ? 35  VAL A O   1 
ATOM   279  C CB  . VAL A 1 56  ? -18.577 38.197 -8.629  1.00 8.42  ? 35  VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 56  ? -17.806 37.093 -9.366  1.00 8.95  ? 35  VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 56  ? -18.168 39.573 -9.123  1.00 9.93  ? 35  VAL A CG2 1 
ATOM   282  N N   . ALA A 1 57  ? -21.200 35.843 -8.899  1.00 8.15  ? 36  ALA A N   1 
ATOM   283  C CA  . ALA A 1 57  ? -21.700 34.565 -8.406  1.00 8.26  ? 36  ALA A CA  1 
ATOM   284  C C   . ALA A 1 57  ? -20.588 33.532 -8.333  1.00 8.37  ? 36  ALA A C   1 
ATOM   285  O O   . ALA A 1 57  ? -19.768 33.427 -9.248  1.00 8.74  ? 36  ALA A O   1 
ATOM   286  C CB  . ALA A 1 57  ? -22.795 34.055 -9.335  1.00 8.84  ? 36  ALA A CB  1 
ATOM   287  N N   . ASP A 1 58  ? -20.590 32.737 -7.267  1.00 8.63  ? 37  ASP A N   1 
ATOM   288  C CA  . ASP A 1 58  ? -19.591 31.681 -7.126  1.00 9.67  ? 37  ASP A CA  1 
ATOM   289  C C   . ASP A 1 58  ? -19.600 30.749 -8.340  1.00 10.09 ? 37  ASP A C   1 
ATOM   290  O O   . ASP A 1 58  ? -18.543 30.416 -8.884  1.00 9.86  ? 37  ASP A O   1 
ATOM   291  C CB  . ASP A 1 58  ? -19.791 30.897 -5.830  1.00 10.80 ? 37  ASP A CB  1 
ATOM   292  C CG  . ASP A 1 58  ? -18.568 30.082 -5.450  1.00 12.90 ? 37  ASP A CG  1 
ATOM   293  O OD1 . ASP A 1 58  ? -17.453 30.443 -5.861  1.00 15.66 ? 37  ASP A OD1 1 
ATOM   294  O OD2 . ASP A 1 58  ? -18.715 29.094 -4.709  1.00 18.95 ? 37  ASP A OD2 1 
ATOM   295  N N   . SER A 1 59  ? -20.799 30.342 -8.752  1.00 11.22 ? 38  SER A N   1 
ATOM   296  C CA  . SER A 1 59  ? -20.996 29.537 -9.972  1.00 12.07 ? 38  SER A CA  1 
ATOM   297  C C   . SER A 1 59  ? -20.164 28.251 -9.994  1.00 13.50 ? 38  SER A C   1 
ATOM   298  O O   . SER A 1 59  ? -19.596 27.876 -11.019 1.00 12.86 ? 38  SER A O   1 
ATOM   299  C CB  . SER A 1 59  ? -20.761 30.387 -11.232 1.00 11.71 ? 38  SER A CB  1 
ATOM   300  O OG  . SER A 1 59  ? -21.751 31.397 -11.359 1.00 11.94 ? 38  SER A OG  1 
ATOM   301  N N   . ARG A 1 60  ? -20.114 27.576 -8.853  1.00 15.40 ? 39  ARG A N   1 
ATOM   302  C CA  . ARG A 1 60  ? -19.345 26.342 -8.679  1.00 17.88 ? 39  ARG A CA  1 
ATOM   303  C C   . ARG A 1 60  ? -19.514 25.322 -9.796  1.00 18.83 ? 39  ARG A C   1 
ATOM   304  O O   . ARG A 1 60  ? -18.524 24.753 -10.284 1.00 19.64 ? 39  ARG A O   1 
ATOM   305  C CB  . ARG A 1 60  ? -19.770 25.674 -7.377  1.00 17.93 ? 39  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 60  ? -19.142 26.267 -6.161  1.00 21.48 ? 39  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 60  ? -19.464 25.438 -4.917  1.00 24.84 ? 39  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 60  ? -19.469 23.994 -5.179  1.00 27.89 ? 39  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 60  ? -18.383 23.235 -5.334  1.00 29.83 ? 39  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 60  ? -18.518 21.936 -5.572  1.00 30.92 ? 39  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 60  ? -17.165 23.764 -5.265  1.00 30.84 ? 39  ARG A NH2 1 
ATOM   312  N N   . ALA A 1 61  ? -20.769 25.105 -10.191 1.00 20.19 ? 40  ALA A N   1 
ATOM   313  C CA  . ALA A 1 61  ? -21.133 24.072 -11.168 1.00 21.19 ? 40  ALA A CA  1 
ATOM   314  C C   . ALA A 1 61  ? -20.685 24.405 -12.581 1.00 21.23 ? 40  ALA A C   1 
ATOM   315  O O   . ALA A 1 61  ? -20.601 23.511 -13.440 1.00 22.56 ? 40  ALA A O   1 
ATOM   316  C CB  . ALA A 1 61  ? -22.633 23.827 -11.138 1.00 21.50 ? 40  ALA A CB  1 
ATOM   317  N N   . LYS A 1 62  ? -20.374 25.661 -12.812 1.00 20.71 ? 41  LYS A N   1 
ATOM   318  C CA  A LYS A 1 62  ? -19.910 26.083 -14.100 0.50 20.22 ? 41  LYS A CA  1 
ATOM   319  C CA  B LYS A 1 62  ? -19.925 26.106 -14.103 0.50 20.19 ? 41  LYS A CA  1 
ATOM   320  C C   . LYS A 1 62  ? -18.434 25.868 -14.237 1.00 19.64 ? 41  LYS A C   1 
ATOM   321  O O   . LYS A 1 62  ? -17.897 26.079 -15.251 1.00 20.07 ? 41  LYS A O   1 
ATOM   322  C CB  A LYS A 1 62  ? -20.204 27.554 -14.368 0.50 20.30 ? 41  LYS A CB  1 
ATOM   323  C CB  B LYS A 1 62  ? -20.226 27.590 -14.374 0.50 20.28 ? 41  LYS A CB  1 
ATOM   324  C CG  A LYS A 1 62  ? -21.659 27.965 -14.309 0.50 21.18 ? 41  LYS A CG  1 
ATOM   325  C CG  B LYS A 1 62  ? -21.704 28.057 -14.342 0.50 20.99 ? 41  LYS A CG  1 
ATOM   326  C CD  A LYS A 1 62  ? -21.867 29.080 -15.280 0.50 22.01 ? 41  LYS A CD  1 
ATOM   327  C CD  B LYS A 1 62  ? -21.890 29.244 -15.310 0.50 22.12 ? 41  LYS A CD  1 
ATOM   328  C CE  A LYS A 1 62  ? -22.905 30.008 -14.867 0.50 22.03 ? 41  LYS A CE  1 
ATOM   329  C CE  B LYS A 1 62  ? -22.880 30.298 -14.891 0.50 23.20 ? 41  LYS A CE  1 
ATOM   330  N NZ  A LYS A 1 62  ? -22.400 31.243 -15.335 0.50 22.84 ? 41  LYS A NZ  1 
ATOM   331  N NZ  B LYS A 1 62  ? -24.331 29.888 -14.880 0.50 23.54 ? 41  LYS A NZ  1 
ATOM   332  N N   . LYS A 1 63  ? -17.802 25.471 -13.176 1.00 18.39 ? 42  LYS A N   1 
ATOM   333  C CA  . LYS A 1 63  ? -16.358 25.211 -13.119 1.00 17.50 ? 42  LYS A CA  1 
ATOM   334  C C   . LYS A 1 63  ? -15.542 26.392 -13.649 1.00 15.78 ? 42  LYS A C   1 
ATOM   335  O O   . LYS A 1 63  ? -14.841 26.266 -14.664 1.00 15.41 ? 42  LYS A O   1 
ATOM   336  C CB  . LYS A 1 63  ? -15.996 23.902 -13.841 1.00 18.13 ? 42  LYS A CB  1 
ATOM   337  C CG  . LYS A 1 63  ? -16.499 22.654 -13.119 1.00 20.54 ? 42  LYS A CG  1 
ATOM   338  C CD  . LYS A 1 63  ? -16.083 21.375 -13.820 1.00 24.84 ? 42  LYS A CD  1 
ATOM   339  C CE  . LYS A 1 63  ? -16.654 20.164 -13.105 1.00 27.04 ? 42  LYS A CE  1 
ATOM   340  N NZ  . LYS A 1 63  ? -16.162 18.885 -13.689 1.00 29.74 ? 42  LYS A NZ  1 
ATOM   341  N N   . PRO A 1 64  ? -15.637 27.554 -12.970 1.00 13.94 ? 43  PRO A N   1 
ATOM   342  C CA  . PRO A 1 64  ? -14.952 28.740 -13.476 1.00 13.31 ? 43  PRO A CA  1 
ATOM   343  C C   . PRO A 1 64  ? -13.437 28.584 -13.458 1.00 12.54 ? 43  PRO A C   1 
ATOM   344  O O   . PRO A 1 64  ? -12.880 27.869 -12.618 1.00 12.47 ? 43  PRO A O   1 
ATOM   345  C CB  . PRO A 1 64  ? -15.384 29.846 -12.507 1.00 13.36 ? 43  PRO A CB  1 
ATOM   346  C CG  . PRO A 1 64  ? -16.632 29.325 -11.871 1.00 13.44 ? 43  PRO A CG  1 
ATOM   347  C CD  . PRO A 1 64  ? -16.400 27.857 -11.740 1.00 13.78 ? 43  PRO A CD  1 
ATOM   348  N N   . PHE A 1 65  ? -12.783 29.264 -14.392 1.00 11.52 ? 44  PHE A N   1 
ATOM   349  C CA  . PHE A 1 65  ? -11.330 29.219 -14.504 1.00 11.31 ? 44  PHE A CA  1 
ATOM   350  C C   . PHE A 1 65  ? -10.669 29.900 -13.308 1.00 10.91 ? 44  PHE A C   1 
ATOM   351  O O   . PHE A 1 65  ? -9.752  29.342 -12.687 1.00 11.71 ? 44  PHE A O   1 
ATOM   352  C CB  . PHE A 1 65  ? -10.934 29.892 -15.820 1.00 11.47 ? 44  PHE A CB  1 
ATOM   353  C CG  . PHE A 1 65  ? -9.469  29.836 -16.127 1.00 12.23 ? 44  PHE A CG  1 
ATOM   354  C CD1 . PHE A 1 65  ? -8.807  28.613 -16.231 1.00 14.09 ? 44  PHE A CD1 1 
ATOM   355  C CD2 . PHE A 1 65  ? -8.760  31.003 -16.347 1.00 14.09 ? 44  PHE A CD2 1 
ATOM   356  C CE1 . PHE A 1 65  ? -7.448  28.561 -16.538 1.00 16.06 ? 44  PHE A CE1 1 
ATOM   357  C CE2 . PHE A 1 65  ? -7.404  30.960 -16.663 1.00 16.49 ? 44  PHE A CE2 1 
ATOM   358  C CZ  . PHE A 1 65  ? -6.749  29.738 -16.755 1.00 15.47 ? 44  PHE A CZ  1 
ATOM   359  N N   . PHE A 1 66  ? -11.160 31.088 -12.971 1.00 9.91  ? 45  PHE A N   1 
ATOM   360  C CA  . PHE A 1 66  ? -10.707 31.828 -11.798 1.00 9.33  ? 45  PHE A CA  1 
ATOM   361  C C   . PHE A 1 66  ? -11.597 31.523 -10.605 1.00 9.33  ? 45  PHE A C   1 
ATOM   362  O O   . PHE A 1 66  ? -12.810 31.376 -10.749 1.00 9.68  ? 45  PHE A O   1 
ATOM   363  C CB  . PHE A 1 66  ? -10.762 33.335 -12.062 1.00 9.04  ? 45  PHE A CB  1 
ATOM   364  C CG  . PHE A 1 66  ? -9.767  33.810 -13.081 1.00 8.97  ? 45  PHE A CG  1 
ATOM   365  C CD1 . PHE A 1 66  ? -10.192 34.227 -14.335 1.00 9.29  ? 45  PHE A CD1 1 
ATOM   366  C CD2 . PHE A 1 66  ? -8.415  33.848 -12.776 1.00 9.04  ? 45  PHE A CD2 1 
ATOM   367  C CE1 . PHE A 1 66  ? -9.284  34.689 -15.278 1.00 11.64 ? 45  PHE A CE1 1 
ATOM   368  C CE2 . PHE A 1 66  ? -7.491  34.301 -13.713 1.00 9.92  ? 45  PHE A CE2 1 
ATOM   369  C CZ  . PHE A 1 66  ? -7.935  34.714 -14.976 1.00 9.96  ? 45  PHE A CZ  1 
ATOM   370  N N   . SER A 1 67  ? -10.992 31.465 -9.424  1.00 8.68  ? 46  SER A N   1 
ATOM   371  C CA  . SER A 1 67  ? -11.748 31.326 -8.170  1.00 9.33  ? 46  SER A CA  1 
ATOM   372  C C   . SER A 1 67  ? -12.609 32.568 -7.933  1.00 8.77  ? 46  SER A C   1 
ATOM   373  O O   . SER A 1 67  ? -12.373 33.620 -8.534  1.00 8.88  ? 46  SER A O   1 
ATOM   374  C CB  . SER A 1 67  ? -10.771 31.155 -7.013  1.00 9.52  ? 46  SER A CB  1 
ATOM   375  O OG  . SER A 1 67  ? -10.122 32.380 -6.709  1.00 10.32 ? 46  SER A OG  1 
ATOM   376  N N   . LEU A 1 68  ? -13.592 32.469 -7.045  1.00 8.41  ? 47  LEU A N   1 
ATOM   377  C CA  . LEU A 1 68  ? -14.379 33.660 -6.719  1.00 8.33  ? 47  LEU A CA  1 
ATOM   378  C C   . LEU A 1 68  ? -13.505 34.812 -6.206  1.00 9.04  ? 47  LEU A C   1 
ATOM   379  O O   . LEU A 1 68  ? -13.712 35.967 -6.612  1.00 8.89  ? 47  LEU A O   1 
ATOM   380  C CB  . LEU A 1 68  ? -15.499 33.336 -5.717  1.00 8.36  ? 47  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 68  ? -16.414 34.493 -5.300  1.00 8.38  ? 47  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 68  ? -17.141 35.112 -6.497  1.00 9.50  ? 47  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 68  ? -17.410 34.020 -4.251  1.00 8.97  ? 47  LEU A CD2 1 
ATOM   384  N N   . GLU A 1 69  ? -12.545 34.505 -5.327  1.00 9.93  ? 48  GLU A N   1 
ATOM   385  C CA  . GLU A 1 69  ? -11.663 35.533 -4.765  1.00 10.74 ? 48  GLU A CA  1 
ATOM   386  C C   . GLU A 1 69  ? -10.918 36.237 -5.886  1.00 10.32 ? 48  GLU A C   1 
ATOM   387  O O   . GLU A 1 69  ? -10.834 37.462 -5.901  1.00 10.14 ? 48  GLU A O   1 
ATOM   388  C CB  . GLU A 1 69  ? -10.649 34.946 -3.784  1.00 11.74 ? 48  GLU A CB  1 
ATOM   389  C CG  . GLU A 1 69  ? -9.791  36.027 -3.108  1.00 15.50 ? 48  GLU A CG  1 
ATOM   390  C CD  . GLU A 1 69  ? -8.821  35.490 -2.067  1.00 21.42 ? 48  GLU A CD  1 
ATOM   391  O OE1 . GLU A 1 69  ? -8.870  34.280 -1.726  1.00 24.38 ? 48  GLU A OE1 1 
ATOM   392  O OE2 . GLU A 1 69  ? -8.000  36.300 -1.574  1.00 23.83 ? 48  GLU A OE2 1 
ATOM   393  N N   . GLU A 1 70  ? -10.421 35.448 -6.832  1.00 9.51  ? 49  GLU A N   1 
ATOM   394  C CA  . GLU A 1 70  ? -9.706  35.994 -7.993  1.00 9.64  ? 49  GLU A CA  1 
ATOM   395  C C   . GLU A 1 70  ? -10.628 36.852 -8.866  1.00 9.13  ? 49  GLU A C   1 
ATOM   396  O O   . GLU A 1 70  ? -10.267 37.956 -9.277  1.00 8.87  ? 49  GLU A O   1 
ATOM   397  C CB  . GLU A 1 70  ? -9.067  34.873 -8.818  1.00 9.62  ? 49  GLU A CB  1 
ATOM   398  C CG  . GLU A 1 70  ? -7.920  34.175 -8.092  1.00 11.57 ? 49  GLU A CG  1 
ATOM   399  C CD  . GLU A 1 70  ? -7.413  32.941 -8.811  1.00 11.83 ? 49  GLU A CD  1 
ATOM   400  O OE1 . GLU A 1 70  ? -8.183  32.292 -9.550  1.00 10.69 ? 49  GLU A OE1 1 
ATOM   401  O OE2 . GLU A 1 70  ? -6.225  32.597 -8.608  1.00 13.13 ? 49  GLU A OE2 1 
ATOM   402  N N   . ARG A 1 71  ? -11.838 36.363 -9.136  1.00 8.56  ? 50  ARG A N   1 
ATOM   403  C CA  . ARG A 1 71  ? -12.769 37.116 -9.978  1.00 7.99  ? 50  ARG A CA  1 
ATOM   404  C C   . ARG A 1 71  ? -13.170 38.464 -9.353  1.00 8.40  ? 50  ARG A C   1 
ATOM   405  O O   . ARG A 1 71  ? -13.309 39.470 -10.057 1.00 8.43  ? 50  ARG A O   1 
ATOM   406  C CB  . ARG A 1 71  ? -13.991 36.251 -10.314 1.00 7.55  ? 50  ARG A CB  1 
ATOM   407  C CG  . ARG A 1 71  ? -13.644 35.213 -11.376 1.00 8.56  ? 50  ARG A CG  1 
ATOM   408  C CD  . ARG A 1 71  ? -14.783 34.250 -11.714 1.00 10.45 ? 50  ARG A CD  1 
ATOM   409  N NE  . ARG A 1 71  ? -14.983 33.212 -10.692 1.00 7.94  ? 50  ARG A NE  1 
ATOM   410  C CZ  . ARG A 1 71  ? -16.148 32.927 -10.109 1.00 7.85  ? 50  ARG A CZ  1 
ATOM   411  N NH1 . ARG A 1 71  ? -16.221 31.962 -9.204  1.00 8.60  ? 50  ARG A NH1 1 
ATOM   412  N NH2 . ARG A 1 71  ? -17.252 33.592 -10.433 1.00 8.73  ? 50  ARG A NH2 1 
ATOM   413  N N   . LEU A 1 72  ? -13.315 38.481 -8.026  1.00 8.17  ? 51  LEU A N   1 
ATOM   414  C CA  . LEU A 1 72  ? -13.548 39.714 -7.294  1.00 9.17  ? 51  LEU A CA  1 
ATOM   415  C C   . LEU A 1 72  ? -12.375 40.687 -7.398  1.00 8.99  ? 51  LEU A C   1 
ATOM   416  O O   . LEU A 1 72  ? -12.584 41.875 -7.645  1.00 9.71  ? 51  LEU A O   1 
ATOM   417  C CB  . LEU A 1 72  ? -13.863 39.410 -5.826  1.00 8.83  ? 51  LEU A CB  1 
ATOM   418  C CG  . LEU A 1 72  ? -15.248 38.780 -5.646  1.00 9.47  ? 51  LEU A CG  1 
ATOM   419  C CD1 . LEU A 1 72  ? -15.398 38.209 -4.235  1.00 9.88  ? 51  LEU A CD1 1 
ATOM   420  C CD2 . LEU A 1 72  ? -16.324 39.805 -5.936  1.00 10.17 ? 51  LEU A CD2 1 
ATOM   421  N N   . LYS A 1 73  ? -11.147 40.190 -7.241  1.00 9.08  ? 52  LYS A N   1 
ATOM   422  C CA  . LYS A 1 73  ? -9.962  41.045 -7.395  1.00 9.37  ? 52  LYS A CA  1 
ATOM   423  C C   . LYS A 1 73  ? -9.877  41.599 -8.812  1.00 9.36  ? 52  LYS A C   1 
ATOM   424  O O   . LYS A 1 73  ? -9.600  42.785 -9.012  1.00 9.83  ? 52  LYS A O   1 
ATOM   425  C CB  . LYS A 1 73  ? -8.676  40.285 -7.061  1.00 9.49  ? 52  LYS A CB  1 
ATOM   426  C CG  . LYS A 1 73  ? -8.469  40.000 -5.578  1.00 11.00 ? 52  LYS A CG  1 
ATOM   427  C CD  . LYS A 1 73  ? -7.257  39.111 -5.392  1.00 13.79 ? 52  LYS A CD  1 
ATOM   428  C CE  . LYS A 1 73  ? -6.978  38.864 -3.921  1.00 16.23 ? 52  LYS A CE  1 
ATOM   429  N NZ  . LYS A 1 73  ? -5.703  38.110 -3.755  1.00 18.82 ? 52  LYS A NZ  1 
ATOM   430  N N   . ILE A 1 74  ? -10.145 40.746 -9.795  1.00 8.66  ? 53  ILE A N   1 
ATOM   431  C CA  . ILE A 1 74  ? -10.046 41.147 -11.201 1.00 9.11  ? 53  ILE A CA  1 
ATOM   432  C C   . ILE A 1 74  ? -11.042 42.274 -11.467 1.00 9.72  ? 53  ILE A C   1 
ATOM   433  O O   . ILE A 1 74  ? -10.683 43.319 -12.037 1.00 9.86  ? 53  ILE A O   1 
ATOM   434  C CB  . ILE A 1 74  ? -10.302 39.938 -12.137 1.00 8.30  ? 53  ILE A CB  1 
ATOM   435  C CG1 . ILE A 1 74  ? -9.118  38.954 -12.073 1.00 8.08  ? 53  ILE A CG1 1 
ATOM   436  C CG2 . ILE A 1 74  ? -10.566 40.388 -13.599 1.00 9.23  ? 53  ILE A CG2 1 
ATOM   437  C CD1 . ILE A 1 74  ? -9.396  37.583 -12.666 1.00 10.39 ? 53  ILE A CD1 1 
ATOM   438  N N   . ALA A 1 75  ? -12.282 42.071 -11.026 1.00 9.77  ? 54  ALA A N   1 
ATOM   439  C CA  . ALA A 1 75  ? -13.341 43.056 -11.235 1.00 10.33 ? 54  ALA A CA  1 
ATOM   440  C C   . ALA A 1 75  ? -13.093 44.359 -10.470 1.00 11.05 ? 54  ALA A C   1 
ATOM   441  O O   . ALA A 1 75  ? -13.323 45.434 -11.014 1.00 11.41 ? 54  ALA A O   1 
ATOM   442  C CB  . ALA A 1 75  ? -14.721 42.451 -10.890 1.00 10.36 ? 54  ALA A CB  1 
ATOM   443  N N   . ASN A 1 76  ? -12.590 44.264 -9.238  1.00 11.01 ? 55  ASN A N   1 
ATOM   444  C CA  . ASN A 1 76  ? -12.277 45.460 -8.446  1.00 12.41 ? 55  ASN A CA  1 
ATOM   445  C C   . ASN A 1 76  ? -11.183 46.298 -9.083  1.00 12.52 ? 55  ASN A C   1 
ATOM   446  O O   . ASN A 1 76  ? -11.239 47.526 -9.048  1.00 12.91 ? 55  ASN A O   1 
ATOM   447  C CB  . ASN A 1 76  ? -11.904 45.088 -7.012  1.00 12.82 ? 55  ASN A CB  1 
ATOM   448  C CG  . ASN A 1 76  ? -13.115 45.001 -6.099  1.00 16.29 ? 55  ASN A CG  1 
ATOM   449  O OD1 . ASN A 1 76  ? -14.000 45.864 -6.136  1.00 20.91 ? 55  ASN A OD1 1 
ATOM   450  N ND2 . ASN A 1 76  ? -13.144 43.979 -5.253  1.00 19.82 ? 55  ASN A ND2 1 
ATOM   451  N N   . GLU A 1 77  ? -10.193 45.638 -9.677  1.00 12.31 ? 56  GLU A N   1 
ATOM   452  C CA  . GLU A 1 77  ? -9.116  46.363 -10.350 1.00 12.43 ? 56  GLU A CA  1 
ATOM   453  C C   . GLU A 1 77  ? -9.650  47.226 -11.493 1.00 12.37 ? 56  GLU A C   1 
ATOM   454  O O   . GLU A 1 77  ? -9.209  48.365 -11.684 1.00 13.01 ? 56  GLU A O   1 
ATOM   455  C CB  . GLU A 1 77  ? -8.053  45.392 -10.858 1.00 12.96 ? 56  GLU A CB  1 
ATOM   456  C CG  . GLU A 1 77  ? -7.196  44.825 -9.723  1.00 13.79 ? 56  GLU A CG  1 
ATOM   457  C CD  . GLU A 1 77  ? -6.299  43.674 -10.145 1.00 16.03 ? 56  GLU A CD  1 
ATOM   458  O OE1 . GLU A 1 77  ? -6.183  43.384 -11.354 1.00 15.55 ? 56  GLU A OE1 1 
ATOM   459  O OE2 . GLU A 1 77  ? -5.690  43.056 -9.241  1.00 18.63 ? 56  GLU A OE2 1 
ATOM   460  N N   . VAL A 1 78  ? -10.616 46.690 -12.236 1.00 11.51 ? 57  VAL A N   1 
ATOM   461  C CA  . VAL A 1 78  ? -11.145 47.384 -13.411 1.00 11.61 ? 57  VAL A CA  1 
ATOM   462  C C   . VAL A 1 78  ? -12.184 48.438 -13.022 1.00 11.48 ? 57  VAL A C   1 
ATOM   463  O O   . VAL A 1 78  ? -12.229 49.513 -13.611 1.00 11.51 ? 57  VAL A O   1 
ATOM   464  C CB  . VAL A 1 78  ? -11.747 46.388 -14.429 1.00 10.91 ? 57  VAL A CB  1 
ATOM   465  C CG1 . VAL A 1 78  ? -12.310 47.112 -15.653 1.00 12.85 ? 57  VAL A CG1 1 
ATOM   466  C CG2 . VAL A 1 78  ? -10.694 45.395 -14.892 1.00 12.10 ? 57  VAL A CG2 1 
ATOM   467  N N   . LEU A 1 79  ? -13.002 48.117 -12.019 1.00 11.96 ? 58  LEU A N   1 
ATOM   468  C CA  . LEU A 1 79  ? -14.213 48.889 -11.723 1.00 12.28 ? 58  LEU A CA  1 
ATOM   469  C C   . LEU A 1 79  ? -14.131 49.803 -10.510 1.00 13.27 ? 58  LEU A C   1 
ATOM   470  O O   . LEU A 1 79  ? -15.021 50.636 -10.301 1.00 13.56 ? 58  LEU A O   1 
ATOM   471  C CB  . LEU A 1 79  ? -15.418 47.954 -11.571 1.00 11.38 ? 58  LEU A CB  1 
ATOM   472  C CG  . LEU A 1 79  ? -15.697 47.013 -12.746 1.00 11.39 ? 58  LEU A CG  1 
ATOM   473  C CD1 . LEU A 1 79  ? -16.828 46.061 -12.384 1.00 13.34 ? 58  LEU A CD1 1 
ATOM   474  C CD2 . LEU A 1 79  ? -16.055 47.825 -13.993 1.00 12.17 ? 58  LEU A CD2 1 
ATOM   475  N N   . GLY A 1 80  ? -13.072 49.652 -9.720  1.00 14.02 ? 59  GLY A N   1 
ATOM   476  C CA  . GLY A 1 80  ? -12.914 50.396 -8.468  1.00 14.84 ? 59  GLY A CA  1 
ATOM   477  C C   . GLY A 1 80  ? -13.052 51.905 -8.574  1.00 15.33 ? 59  GLY A C   1 
ATOM   478  O O   . GLY A 1 80  ? -13.509 52.561 -7.627  1.00 16.39 ? 59  GLY A O   1 
ATOM   479  N N   . HIS A 1 81  ? -12.658 52.463 -9.714  1.00 15.36 ? 60  HIS A N   1 
ATOM   480  C CA  . HIS A 1 81  ? -12.672 53.906 -9.899  1.00 15.56 ? 60  HIS A CA  1 
ATOM   481  C C   . HIS A 1 81  ? -14.085 54.494 -10.022 1.00 15.58 ? 60  HIS A C   1 
ATOM   482  O O   . HIS A 1 81  ? -14.269 55.687 -9.786  1.00 16.34 ? 60  HIS A O   1 
ATOM   483  C CB  . HIS A 1 81  ? -11.811 54.312 -11.097 1.00 15.68 ? 60  HIS A CB  1 
ATOM   484  C CG  . HIS A 1 81  ? -12.371 53.883 -12.414 1.00 16.44 ? 60  HIS A CG  1 
ATOM   485  N ND1 . HIS A 1 81  ? -13.178 54.698 -13.177 1.00 18.34 ? 60  HIS A ND1 1 
ATOM   486  C CD2 . HIS A 1 81  ? -12.258 52.718 -13.095 1.00 18.02 ? 60  HIS A CD2 1 
ATOM   487  C CE1 . HIS A 1 81  ? -13.530 54.058 -14.279 1.00 18.53 ? 60  HIS A CE1 1 
ATOM   488  N NE2 . HIS A 1 81  ? -12.982 52.857 -14.255 1.00 17.76 ? 60  HIS A NE2 1 
ATOM   489  N N   . TYR A 1 82  ? -15.071 53.670 -10.383 1.00 15.00 ? 61  TYR A N   1 
ATOM   490  C CA  . TYR A 1 82  ? -16.463 54.132 -10.479 1.00 14.82 ? 61  TYR A CA  1 
ATOM   491  C C   . TYR A 1 82  ? -17.047 54.363 -9.088  1.00 15.27 ? 61  TYR A C   1 
ATOM   492  O O   . TYR A 1 82  ? -17.206 53.416 -8.326  1.00 15.77 ? 61  TYR A O   1 
ATOM   493  C CB  . TYR A 1 82  ? -17.338 53.124 -11.225 1.00 14.80 ? 61  TYR A CB  1 
ATOM   494  C CG  . TYR A 1 82  ? -17.088 53.029 -12.708 1.00 14.46 ? 61  TYR A CG  1 
ATOM   495  C CD1 . TYR A 1 82  ? -17.472 54.060 -13.568 1.00 15.36 ? 61  TYR A CD1 1 
ATOM   496  C CD2 . TYR A 1 82  ? -16.490 51.902 -13.261 1.00 13.21 ? 61  TYR A CD2 1 
ATOM   497  C CE1 . TYR A 1 82  ? -17.244 53.974 -14.939 1.00 15.78 ? 61  TYR A CE1 1 
ATOM   498  C CE2 . TYR A 1 82  ? -16.265 51.803 -14.633 1.00 13.83 ? 61  TYR A CE2 1 
ATOM   499  C CZ  . TYR A 1 82  ? -16.648 52.842 -15.466 1.00 15.47 ? 61  TYR A CZ  1 
ATOM   500  O OH  . TYR A 1 82  ? -16.420 52.770 -16.818 1.00 16.72 ? 61  TYR A OH  1 
ATOM   501  N N   . PRO A 1 83  ? -17.400 55.619 -8.765  1.00 15.08 ? 62  PRO A N   1 
ATOM   502  C CA  . PRO A 1 83  ? -17.757 55.954 -7.379  1.00 14.84 ? 62  PRO A CA  1 
ATOM   503  C C   . PRO A 1 83  ? -19.052 55.326 -6.854  1.00 14.39 ? 62  PRO A C   1 
ATOM   504  O O   . PRO A 1 83  ? -19.190 55.157 -5.639  1.00 15.36 ? 62  PRO A O   1 
ATOM   505  C CB  . PRO A 1 83  ? -17.882 57.482 -7.405  1.00 15.11 ? 62  PRO A CB  1 
ATOM   506  C CG  . PRO A 1 83  ? -18.189 57.821 -8.814  1.00 15.73 ? 62  PRO A CG  1 
ATOM   507  C CD  . PRO A 1 83  ? -17.483 56.785 -9.660  1.00 15.59 ? 62  PRO A CD  1 
ATOM   508  N N   . ASN A 1 84  ? -19.984 54.993 -7.748  1.00 13.31 ? 63  ASN A N   1 
ATOM   509  C CA  . ASN A 1 84  ? -21.266 54.431 -7.338  1.00 12.14 ? 63  ASN A CA  1 
ATOM   510  C C   . ASN A 1 84  ? -21.408 52.956 -7.701  1.00 11.63 ? 63  ASN A C   1 
ATOM   511  O O   . ASN A 1 84  ? -22.526 52.432 -7.777  1.00 11.75 ? 63  ASN A O   1 
ATOM   512  C CB  . ASN A 1 84  ? -22.436 55.238 -7.918  1.00 11.88 ? 63  ASN A CB  1 
ATOM   513  C CG  . ASN A 1 84  ? -22.552 55.110 -9.430  1.00 12.34 ? 63  ASN A CG  1 
ATOM   514  O OD1 . ASN A 1 84  ? -21.560 54.913 -10.137 1.00 13.44 ? 63  ASN A OD1 1 
ATOM   515  N ND2 . ASN A 1 84  ? -23.775 55.216 -9.933  1.00 11.40 ? 63  ASN A ND2 1 
ATOM   516  N N   . VAL A 1 85  ? -20.274 52.297 -7.920  1.00 11.06 ? 64  VAL A N   1 
ATOM   517  C CA  . VAL A 1 85  ? -20.266 50.869 -8.229  1.00 11.29 ? 64  VAL A CA  1 
ATOM   518  C C   . VAL A 1 85  ? -19.678 50.102 -7.057  1.00 11.89 ? 64  VAL A C   1 
ATOM   519  O O   . VAL A 1 85  ? -18.613 50.467 -6.549  1.00 12.14 ? 64  VAL A O   1 
ATOM   520  C CB  . VAL A 1 85  ? -19.468 50.569 -9.521  1.00 11.28 ? 64  VAL A CB  1 
ATOM   521  C CG1 . VAL A 1 85  ? -19.258 49.077 -9.696  1.00 12.12 ? 64  VAL A CG1 1 
ATOM   522  C CG2 . VAL A 1 85  ? -20.189 51.154 -10.738 1.00 12.47 ? 64  VAL A CG2 1 
ATOM   523  N N   . LYS A 1 86  ? -20.393 49.063 -6.622  1.00 12.23 ? 65  LYS A N   1 
ATOM   524  C CA  . LYS A 1 86  ? -19.918 48.146 -5.574  1.00 12.94 ? 65  LYS A CA  1 
ATOM   525  C C   . LYS A 1 86  ? -19.744 46.763 -6.182  1.00 12.80 ? 65  LYS A C   1 
ATOM   526  O O   . LYS A 1 86  ? -20.623 46.292 -6.893  1.00 14.06 ? 65  LYS A O   1 
ATOM   527  C CB  . LYS A 1 86  ? -20.915 48.082 -4.410  1.00 13.49 ? 65  LYS A CB  1 
ATOM   528  C CG  . LYS A 1 86  ? -21.227 49.422 -3.761  1.00 16.78 ? 65  LYS A CG  1 
ATOM   529  C CD  . LYS A 1 86  ? -21.646 49.268 -2.306  1.00 21.28 ? 65  LYS A CD  1 
ATOM   530  C CE  . LYS A 1 86  ? -23.106 48.907 -2.137  1.00 23.49 ? 65  LYS A CE  1 
ATOM   531  N NZ  . LYS A 1 86  ? -23.516 49.029 -0.702  1.00 23.77 ? 65  LYS A NZ  1 
ATOM   532  N N   . VAL A 1 87  ? -18.608 46.121 -5.913  1.00 11.74 ? 66  VAL A N   1 
ATOM   533  C CA  . VAL A 1 87  ? -18.346 44.763 -6.402  1.00 11.48 ? 66  VAL A CA  1 
ATOM   534  C C   . VAL A 1 87  ? -18.419 43.821 -5.202  1.00 11.14 ? 66  VAL A C   1 
ATOM   535  O O   . VAL A 1 87  ? -17.695 44.011 -4.215  1.00 12.01 ? 66  VAL A O   1 
ATOM   536  C CB  . VAL A 1 87  ? -16.966 44.648 -7.101  1.00 11.49 ? 66  VAL A CB  1 
ATOM   537  C CG1 . VAL A 1 87  ? -16.700 43.204 -7.529  1.00 13.23 ? 66  VAL A CG1 1 
ATOM   538  C CG2 . VAL A 1 87  ? -16.902 45.567 -8.314  1.00 12.85 ? 66  VAL A CG2 1 
ATOM   539  N N   . MET A 1 88  ? -19.321 42.843 -5.278  1.00 10.95 ? 67  MET A N   1 
ATOM   540  C CA  A MET A 1 88  ? -19.519 41.908 -4.175  0.50 11.01 ? 67  MET A CA  1 
ATOM   541  C CA  B MET A 1 88  ? -19.598 41.914 -4.174  0.50 10.95 ? 67  MET A CA  1 
ATOM   542  C C   . MET A 1 88  ? -19.746 40.502 -4.705  1.00 10.44 ? 67  MET A C   1 
ATOM   543  O O   . MET A 1 88  ? -20.401 40.311 -5.725  1.00 10.76 ? 67  MET A O   1 
ATOM   544  C CB  A MET A 1 88  ? -20.705 42.337 -3.299  0.50 11.77 ? 67  MET A CB  1 
ATOM   545  C CB  B MET A 1 88  ? -20.941 42.242 -3.523  0.50 11.44 ? 67  MET A CB  1 
ATOM   546  C CG  A MET A 1 88  ? -20.532 43.691 -2.605  0.50 14.40 ? 67  MET A CG  1 
ATOM   547  C CG  B MET A 1 88  ? -20.995 43.441 -2.632  0.50 14.28 ? 67  MET A CG  1 
ATOM   548  S SD  A MET A 1 88  ? -22.128 44.388 -2.134  0.50 21.72 ? 67  MET A SD  1 
ATOM   549  S SD  B MET A 1 88  ? -22.721 43.556 -2.111  0.50 18.38 ? 67  MET A SD  1 
ATOM   550  C CE  A MET A 1 88  ? -22.823 42.959 -1.303  0.50 20.91 ? 67  MET A CE  1 
ATOM   551  C CE  B MET A 1 88  ? -22.660 45.021 -1.076  0.50 18.55 ? 67  MET A CE  1 
ATOM   552  N N   . GLY A 1 89  ? -19.200 39.520 -3.999  1.00 9.22  ? 68  GLY A N   1 
ATOM   553  C CA  . GLY A 1 89  ? -19.419 38.119 -4.338  1.00 8.58  ? 68  GLY A CA  1 
ATOM   554  C C   . GLY A 1 89  ? -20.659 37.577 -3.646  1.00 7.90  ? 68  GLY A C   1 
ATOM   555  O O   . GLY A 1 89  ? -21.124 38.147 -2.650  1.00 8.66  ? 68  GLY A O   1 
ATOM   556  N N   . PHE A 1 90  ? -21.204 36.478 -4.177  1.00 7.68  ? 69  PHE A N   1 
ATOM   557  C CA  . PHE A 1 90  ? -22.278 35.760 -3.486  1.00 7.81  ? 69  PHE A CA  1 
ATOM   558  C C   . PHE A 1 90  ? -22.298 34.286 -3.841  1.00 7.80  ? 69  PHE A C   1 
ATOM   559  O O   . PHE A 1 90  ? -22.012 33.916 -4.983  1.00 8.10  ? 69  PHE A O   1 
ATOM   560  C CB  . PHE A 1 90  ? -23.649 36.433 -3.685  1.00 7.25  ? 69  PHE A CB  1 
ATOM   561  C CG  . PHE A 1 90  ? -24.221 36.319 -5.078  1.00 7.21  ? 69  PHE A CG  1 
ATOM   562  C CD1 . PHE A 1 90  ? -23.801 37.163 -6.104  1.00 8.43  ? 69  PHE A CD1 1 
ATOM   563  C CD2 . PHE A 1 90  ? -25.244 35.409 -5.340  1.00 9.12  ? 69  PHE A CD2 1 
ATOM   564  C CE1 . PHE A 1 90  ? -24.349 37.063 -7.394  1.00 8.89  ? 69  PHE A CE1 1 
ATOM   565  C CE2 . PHE A 1 90  ? -25.810 35.311 -6.622  1.00 8.55  ? 69  PHE A CE2 1 
ATOM   566  C CZ  . PHE A 1 90  ? -25.359 36.138 -7.648  1.00 8.33  ? 69  PHE A CZ  1 
ATOM   567  N N   . THR A 1 91  ? -22.637 33.460 -2.847  1.00 8.36  ? 70  THR A N   1 
ATOM   568  C CA  . THR A 1 91  ? -22.555 32.011 -2.990  1.00 8.81  ? 70  THR A CA  1 
ATOM   569  C C   . THR A 1 91  ? -23.929 31.364 -3.034  1.00 9.27  ? 70  THR A C   1 
ATOM   570  O O   . THR A 1 91  ? -24.036 30.144 -3.234  1.00 9.81  ? 70  THR A O   1 
ATOM   571  C CB  . THR A 1 91  ? -21.750 31.361 -1.844  1.00 8.93  ? 70  THR A CB  1 
ATOM   572  O OG1 . THR A 1 91  ? -22.429 31.563 -0.603  1.00 9.91  ? 70  THR A OG1 1 
ATOM   573  C CG2 . THR A 1 91  ? -20.320 31.961 -1.745  1.00 9.21  ? 70  THR A CG2 1 
ATOM   574  N N   . GLY A 1 92  ? -24.969 32.168 -2.834  1.00 9.14  ? 71  GLY A N   1 
ATOM   575  C CA  . GLY A 1 92  ? -26.326 31.638 -2.806  1.00 9.73  ? 71  GLY A CA  1 
ATOM   576  C C   . GLY A 1 92  ? -27.183 32.095 -3.964  1.00 9.17  ? 71  GLY A C   1 
ATOM   577  O O   . GLY A 1 92  ? -26.716 32.319 -5.089  1.00 9.67  ? 71  GLY A O   1 
ATOM   578  N N   . LEU A 1 93  ? -28.465 32.234 -3.686  1.00 9.72  ? 72  LEU A N   1 
ATOM   579  C CA  . LEU A 1 93  ? -29.419 32.576 -4.708  1.00 10.02 ? 72  LEU A CA  1 
ATOM   580  C C   . LEU A 1 93  ? -29.351 34.061 -5.044  1.00 10.34 ? 72  LEU A C   1 
ATOM   581  O O   . LEU A 1 93  ? -29.183 34.902 -4.155  1.00 9.64  ? 72  LEU A O   1 
ATOM   582  C CB  . LEU A 1 93  ? -30.821 32.181 -4.226  1.00 11.02 ? 72  LEU A CB  1 
ATOM   583  C CG  . LEU A 1 93  ? -30.922 30.683 -3.936  1.00 12.10 ? 72  LEU A CG  1 
ATOM   584  C CD1 . LEU A 1 93  ? -32.037 30.366 -2.950  1.00 15.07 ? 72  LEU A CD1 1 
ATOM   585  C CD2 . LEU A 1 93  ? -31.081 29.906 -5.243  1.00 15.09 ? 72  LEU A CD2 1 
ATOM   586  N N   . LEU A 1 94  ? -29.494 34.378 -6.330  1.00 10.57 ? 73  LEU A N   1 
ATOM   587  C CA  . LEU A 1 94  ? -29.545 35.771 -6.785  1.00 12.04 ? 73  LEU A CA  1 
ATOM   588  C C   . LEU A 1 94  ? -30.678 36.510 -6.083  1.00 12.92 ? 73  LEU A C   1 
ATOM   589  O O   . LEU A 1 94  ? -30.494 37.660 -5.672  1.00 12.82 ? 73  LEU A O   1 
ATOM   590  C CB  . LEU A 1 94  ? -29.734 35.869 -8.311  1.00 12.17 ? 73  LEU A CB  1 
ATOM   591  C CG  . LEU A 1 94  ? -29.860 37.292 -8.891  1.00 12.92 ? 73  LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 94  ? -28.653 38.149 -8.582  1.00 12.62 ? 73  LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 94  ? -30.099 37.272 -10.396 1.00 16.22 ? 73  LEU A CD2 1 
ATOM   594  N N   . LYS A 1 95  ? -31.828 35.840 -5.947  1.00 14.48 ? 74  LYS A N   1 
ATOM   595  C CA  . LYS A 1 95  ? -32.998 36.398 -5.234  1.00 15.68 ? 74  LYS A CA  1 
ATOM   596  C C   . LYS A 1 95  ? -32.572 37.013 -3.910  1.00 15.42 ? 74  LYS A C   1 
ATOM   597  O O   . LYS A 1 95  ? -32.920 38.156 -3.587  1.00 15.97 ? 74  LYS A O   1 
ATOM   598  C CB  . LYS A 1 95  ? -34.070 35.313 -4.981  1.00 16.22 ? 74  LYS A CB  1 
ATOM   599  C CG  . LYS A 1 95  ? -35.157 35.711 -3.960  1.00 18.44 ? 74  LYS A CG  1 
ATOM   600  C CD  . LYS A 1 95  ? -36.302 34.706 -3.880  1.00 22.73 ? 74  LYS A CD  1 
ATOM   601  C CE  . LYS A 1 95  ? -35.893 33.432 -3.148  1.00 24.64 ? 74  LYS A CE  1 
ATOM   602  N NZ  . LYS A 1 95  ? -35.208 32.457 -4.046  1.00 28.47 ? 74  LYS A NZ  1 
ATOM   603  N N   . ASP A 1 96  ? -31.801 36.251 -3.150  1.00 14.63 ? 75  ASP A N   1 
ATOM   604  C CA  . ASP A 1 96  ? -31.383 36.675 -1.835  1.00 14.34 ? 75  ASP A CA  1 
ATOM   605  C C   . ASP A 1 96  ? -30.384 37.826 -1.888  1.00 12.75 ? 75  ASP A C   1 
ATOM   606  O O   . ASP A 1 96  ? -30.458 38.737 -1.077  1.00 12.56 ? 75  ASP A O   1 
ATOM   607  C CB  . ASP A 1 96  ? -30.937 35.449 -1.049  1.00 15.28 ? 75  ASP A CB  1 
ATOM   608  C CG  . ASP A 1 96  ? -32.096 34.465 -0.874  1.00 18.38 ? 75  ASP A CG  1 
ATOM   609  O OD1 . ASP A 1 96  ? -33.120 34.893 -0.297  1.00 21.85 ? 75  ASP A OD1 1 
ATOM   610  O OD2 . ASP A 1 96  ? -32.024 33.312 -1.362  1.00 21.33 ? 75  ASP A OD2 1 
ATOM   611  N N   . PHE A 1 97  ? -29.512 37.820 -2.896  1.00 11.61 ? 76  PHE A N   1 
ATOM   612  C CA  . PHE A 1 97  ? -28.537 38.882 -3.084  1.00 10.69 ? 76  PHE A CA  1 
ATOM   613  C C   . PHE A 1 97  ? -29.214 40.196 -3.477  1.00 10.52 ? 76  PHE A C   1 
ATOM   614  O O   . PHE A 1 97  ? -28.848 41.266 -2.983  1.00 10.07 ? 76  PHE A O   1 
ATOM   615  C CB  . PHE A 1 97  ? -27.526 38.449 -4.153  1.00 10.36 ? 76  PHE A CB  1 
ATOM   616  C CG  . PHE A 1 97  ? -26.421 39.440 -4.397  1.00 10.75 ? 76  PHE A CG  1 
ATOM   617  C CD1 . PHE A 1 97  ? -25.348 39.536 -3.515  1.00 11.67 ? 76  PHE A CD1 1 
ATOM   618  C CD2 . PHE A 1 97  ? -26.430 40.247 -5.528  1.00 9.75  ? 76  PHE A CD2 1 
ATOM   619  C CE1 . PHE A 1 97  ? -24.313 40.433 -3.750  1.00 11.61 ? 76  PHE A CE1 1 
ATOM   620  C CE2 . PHE A 1 97  ? -25.391 41.155 -5.773  1.00 11.59 ? 76  PHE A CE2 1 
ATOM   621  C CZ  . PHE A 1 97  ? -24.341 41.254 -4.883  1.00 11.03 ? 76  PHE A CZ  1 
ATOM   622  N N   . VAL A 1 98  ? -30.203 40.104 -4.360  1.00 10.62 ? 77  VAL A N   1 
ATOM   623  C CA  . VAL A 1 98  ? -30.980 41.273 -4.760  1.00 10.87 ? 77  VAL A CA  1 
ATOM   624  C C   . VAL A 1 98  ? -31.700 41.898 -3.566  1.00 11.30 ? 77  VAL A C   1 
ATOM   625  O O   . VAL A 1 98  ? -31.593 43.105 -3.337  1.00 10.83 ? 77  VAL A O   1 
ATOM   626  C CB  . VAL A 1 98  ? -31.994 40.917 -5.853  1.00 11.33 ? 77  VAL A CB  1 
ATOM   627  C CG1 . VAL A 1 98  ? -32.990 42.073 -6.073  1.00 12.61 ? 77  VAL A CG1 1 
ATOM   628  C CG2 . VAL A 1 98  ? -31.258 40.568 -7.139  1.00 11.27 ? 77  VAL A CG2 1 
ATOM   629  N N   . ARG A 1 99  ? -32.410 41.066 -2.806  1.00 11.30 ? 78  ARG A N   1 
ATOM   630  C CA  . ARG A 1 99  ? -33.122 41.544 -1.621  1.00 12.27 ? 78  ARG A CA  1 
ATOM   631  C C   . ARG A 1 99  ? -32.165 42.177 -0.614  1.00 12.00 ? 78  ARG A C   1 
ATOM   632  O O   . ARG A 1 99  ? -32.464 43.220 -0.034  1.00 13.18 ? 78  ARG A O   1 
ATOM   633  C CB  . ARG A 1 99  ? -33.944 40.427 -0.967  1.00 12.79 ? 78  ARG A CB  1 
ATOM   634  C CG  . ARG A 1 99  ? -35.150 39.955 -1.775  1.00 15.23 ? 78  ARG A CG  1 
ATOM   635  C CD  . ARG A 1 99  ? -36.172 41.053 -1.988  1.00 18.85 ? 78  ARG A CD  1 
ATOM   636  N NE  . ARG A 1 99  ? -37.415 40.520 -2.543  1.00 21.60 ? 78  ARG A NE  1 
ATOM   637  C CZ  . ARG A 1 99  ? -38.205 41.181 -3.383  1.00 22.75 ? 78  ARG A CZ  1 
ATOM   638  N NH1 . ARG A 1 99  ? -37.880 42.405 -3.794  1.00 22.77 ? 78  ARG A NH1 1 
ATOM   639  N NH2 . ARG A 1 99  ? -39.318 40.611 -3.827  1.00 22.93 ? 78  ARG A NH2 1 
ATOM   640  N N   . ALA A 1 100 ? -30.998 41.556 -0.440  1.00 11.99 ? 79  ALA A N   1 
ATOM   641  C CA  . ALA A 1 100 ? -29.988 42.031 0.500   1.00 12.28 ? 79  ALA A CA  1 
ATOM   642  C C   . ALA A 1 100 ? -29.481 43.423 0.182   1.00 12.72 ? 79  ALA A C   1 
ATOM   643  O O   . ALA A 1 100 ? -29.119 44.188 1.083   1.00 13.72 ? 79  ALA A O   1 
ATOM   644  C CB  . ALA A 1 100 ? -28.832 41.066 0.518   1.00 11.66 ? 79  ALA A CB  1 
ATOM   645  N N   . ASN A 1 101 ? -29.441 43.733 -1.111  1.00 12.53 ? 80  ASN A N   1 
ATOM   646  C CA  . ASN A 1 101 ? -28.959 45.021 -1.581  1.00 12.95 ? 80  ASN A CA  1 
ATOM   647  C C   . ASN A 1 101 ? -30.072 46.042 -1.813  1.00 13.16 ? 80  ASN A C   1 
ATOM   648  O O   . ASN A 1 101 ? -29.804 47.129 -2.336  1.00 13.62 ? 80  ASN A O   1 
ATOM   649  C CB  . ASN A 1 101 ? -28.127 44.818 -2.854  1.00 12.89 ? 80  ASN A CB  1 
ATOM   650  C CG  . ASN A 1 101 ? -26.740 44.302 -2.547  1.00 13.58 ? 80  ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 101 ? -25.881 45.052 -2.095  1.00 15.52 ? 80  ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 101 ? -26.518 43.010 -2.769  1.00 14.47 ? 80  ASN A ND2 1 
ATOM   653  N N   . ASP A 1 102 ? -31.304 45.700 -1.409  1.00 13.16 ? 81  ASP A N   1 
ATOM   654  C CA  . ASP A 1 102 ? -32.478 46.587 -1.566  1.00 13.67 ? 81  ASP A CA  1 
ATOM   655  C C   . ASP A 1 102 ? -32.646 47.010 -3.025  1.00 12.73 ? 81  ASP A C   1 
ATOM   656  O O   . ASP A 1 102 ? -33.039 48.143 -3.318  1.00 13.22 ? 81  ASP A O   1 
ATOM   657  C CB  . ASP A 1 102 ? -32.362 47.833 -0.675  1.00 15.02 ? 81  ASP A CB  1 
ATOM   658  C CG  . ASP A 1 102 ? -32.274 47.494 0.797   1.00 18.95 ? 81  ASP A CG  1 
ATOM   659  O OD1 . ASP A 1 102 ? -33.028 46.611 1.254   1.00 24.33 ? 81  ASP A OD1 1 
ATOM   660  O OD2 . ASP A 1 102 ? -31.447 48.115 1.499   1.00 24.33 ? 81  ASP A OD2 1 
ATOM   661  N N   . ALA A 1 103 ? -32.330 46.093 -3.929  1.00 11.42 ? 82  ALA A N   1 
ATOM   662  C CA  . ALA A 1 103 ? -32.325 46.405 -5.358  1.00 10.87 ? 82  ALA A CA  1 
ATOM   663  C C   . ALA A 1 103 ? -33.708 46.247 -5.976  1.00 10.63 ? 82  ALA A C   1 
ATOM   664  O O   . ALA A 1 103 ? -34.420 45.292 -5.683  1.00 11.62 ? 82  ALA A O   1 
ATOM   665  C CB  . ALA A 1 103 ? -31.295 45.520 -6.080  1.00 10.58 ? 82  ALA A CB  1 
ATOM   666  N N   . ARG A 1 104 ? -34.079 47.183 -6.847  1.00 10.26 ? 83  ARG A N   1 
ATOM   667  C CA  . ARG A 1 104 ? -35.343 47.094 -7.572  1.00 10.92 ? 83  ARG A CA  1 
ATOM   668  C C   . ARG A 1 104 ? -35.168 46.605 -9.010  1.00 9.90  ? 83  ARG A C   1 
ATOM   669  O O   . ARG A 1 104 ? -36.153 46.303 -9.693  1.00 10.46 ? 83  ARG A O   1 
ATOM   670  C CB  . ARG A 1 104 ? -36.074 48.453 -7.570  1.00 11.85 ? 83  ARG A CB  1 
ATOM   671  C CG  . ARG A 1 104 ? -36.317 49.035 -6.169  1.00 16.38 ? 83  ARG A CG  1 
ATOM   672  C CD  . ARG A 1 104 ? -37.710 49.637 -5.991  1.00 23.05 ? 83  ARG A CD  1 
ATOM   673  N NE  . ARG A 1 104 ? -38.022 50.707 -6.942  1.00 27.35 ? 83  ARG A NE  1 
ATOM   674  C CZ  . ARG A 1 104 ? -37.948 52.013 -6.685  1.00 29.03 ? 83  ARG A CZ  1 
ATOM   675  N NH1 . ARG A 1 104 ? -38.273 52.887 -7.629  1.00 29.91 ? 83  ARG A NH1 1 
ATOM   676  N NH2 . ARG A 1 104 ? -37.562 52.456 -5.491  1.00 30.56 ? 83  ARG A NH2 1 
ATOM   677  N N   . VAL A 1 105 ? -33.919 46.516 -9.464  1.00 9.14  ? 84  VAL A N   1 
ATOM   678  C CA  . VAL A 1 105 ? -33.628 46.174 -10.845 1.00 9.05  ? 84  VAL A CA  1 
ATOM   679  C C   . VAL A 1 105 ? -32.487 45.176 -10.901 1.00 8.35  ? 84  VAL A C   1 
ATOM   680  O O   . VAL A 1 105 ? -31.522 45.289 -10.148 1.00 8.93  ? 84  VAL A O   1 
ATOM   681  C CB  . VAL A 1 105 ? -33.221 47.431 -11.682 1.00 9.19  ? 84  VAL A CB  1 
ATOM   682  C CG1 . VAL A 1 105 ? -32.728 47.030 -13.073 1.00 10.08 ? 84  VAL A CG1 1 
ATOM   683  C CG2 . VAL A 1 105 ? -34.399 48.393 -11.808 1.00 10.86 ? 84  VAL A CG2 1 
ATOM   684  N N   . ILE A 1 106 ? -32.640 44.189 -11.778 1.00 8.25  ? 85  ILE A N   1 
ATOM   685  C CA  . ILE A 1 106 ? -31.559 43.323 -12.214 1.00 8.25  ? 85  ILE A CA  1 
ATOM   686  C C   . ILE A 1 106 ? -31.210 43.762 -13.637 1.00 8.73  ? 85  ILE A C   1 
ATOM   687  O O   . ILE A 1 106 ? -32.070 43.725 -14.522 1.00 8.69  ? 85  ILE A O   1 
ATOM   688  C CB  . ILE A 1 106 ? -32.003 41.832 -12.219 1.00 7.84  ? 85  ILE A CB  1 
ATOM   689  C CG1 . ILE A 1 106 ? -32.261 41.328 -10.799 1.00 9.05  ? 85  ILE A CG1 1 
ATOM   690  C CG2 . ILE A 1 106 ? -30.926 40.970 -12.897 1.00 8.80  ? 85  ILE A CG2 1 
ATOM   691  C CD1 . ILE A 1 106 ? -33.150 40.082 -10.759 1.00 10.12 ? 85  ILE A CD1 1 
ATOM   692  N N   . VAL A 1 107 ? -29.975 44.213 -13.851 1.00 8.41  ? 86  VAL A N   1 
ATOM   693  C CA  . VAL A 1 107 ? -29.514 44.608 -15.190 1.00 9.41  ? 86  VAL A CA  1 
ATOM   694  C C   . VAL A 1 107 ? -28.785 43.441 -15.808 1.00 9.09  ? 86  VAL A C   1 
ATOM   695  O O   . VAL A 1 107 ? -27.951 42.804 -15.144 1.00 9.42  ? 86  VAL A O   1 
ATOM   696  C CB  . VAL A 1 107 ? -28.548 45.823 -15.111 1.00 10.27 ? 86  VAL A CB  1 
ATOM   697  C CG1 . VAL A 1 107 ? -27.756 46.010 -16.436 1.00 12.56 ? 86  VAL A CG1 1 
ATOM   698  C CG2 . VAL A 1 107 ? -29.317 47.068 -14.716 1.00 12.24 ? 86  VAL A CG2 1 
ATOM   699  N N   . ARG A 1 108 ? -29.101 43.152 -17.072 1.00 9.47  ? 87  ARG A N   1 
ATOM   700  C CA  . ARG A 1 108 ? -28.345 42.173 -17.844 1.00 10.24 ? 87  ARG A CA  1 
ATOM   701  C C   . ARG A 1 108 ? -27.961 42.773 -19.181 1.00 11.33 ? 87  ARG A C   1 
ATOM   702  O O   . ARG A 1 108 ? -28.671 43.622 -19.707 1.00 10.71 ? 87  ARG A O   1 
ATOM   703  C CB  . ARG A 1 108 ? -29.166 40.896 -18.042 1.00 10.51 ? 87  ARG A CB  1 
ATOM   704  C CG  . ARG A 1 108 ? -29.425 40.128 -16.734 1.00 11.59 ? 87  ARG A CG  1 
ATOM   705  C CD  . ARG A 1 108 ? -28.200 39.327 -16.289 1.00 12.91 ? 87  ARG A CD  1 
ATOM   706  N NE  . ARG A 1 108 ? -27.938 38.176 -17.159 1.00 14.07 ? 87  ARG A NE  1 
ATOM   707  C CZ  . ARG A 1 108 ? -26.958 37.304 -16.964 1.00 16.86 ? 87  ARG A CZ  1 
ATOM   708  N NH1 . ARG A 1 108 ? -26.140 37.442 -15.921 1.00 17.11 ? 87  ARG A NH1 1 
ATOM   709  N NH2 . ARG A 1 108 ? -26.798 36.281 -17.810 1.00 17.00 ? 87  ARG A NH2 1 
ATOM   710  N N   . GLY A 1 109 ? -26.823 42.354 -19.711 1.00 12.11 ? 88  GLY A N   1 
ATOM   711  C CA  . GLY A 1 109 ? -26.433 42.774 -21.055 1.00 15.09 ? 88  GLY A CA  1 
ATOM   712  C C   . GLY A 1 109 ? -27.170 41.925 -22.061 1.00 16.26 ? 88  GLY A C   1 
ATOM   713  O O   . GLY A 1 109 ? -27.334 40.717 -21.883 1.00 18.16 ? 88  GLY A O   1 
ATOM   714  N N   . LEU A 1 110 ? -27.670 42.560 -23.109 1.00 17.56 ? 89  LEU A N   1 
ATOM   715  C CA  . LEU A 1 110 ? -28.267 41.824 -24.189 1.00 19.31 ? 89  LEU A CA  1 
ATOM   716  C C   . LEU A 1 110 ? -27.607 42.323 -25.443 1.00 20.68 ? 89  LEU A C   1 
ATOM   717  O O   . LEU A 1 110 ? -27.496 43.527 -25.676 1.00 21.48 ? 89  LEU A O   1 
ATOM   718  C CB  . LEU A 1 110 ? -29.786 42.013 -24.231 1.00 19.21 ? 89  LEU A CB  1 
ATOM   719  C CG  . LEU A 1 110 ? -30.550 40.895 -24.944 1.00 20.21 ? 89  LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 110 ? -30.418 39.550 -24.226 1.00 20.20 ? 89  LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 110 ? -31.992 41.291 -25.041 1.00 20.69 ? 89  LEU A CD2 1 
ATOM   722  N N   . ARG A 1 111 ? -27.118 41.378 -26.219 1.00 21.74 ? 90  ARG A N   1 
ATOM   723  C CA  . ARG A 1 111 ? -26.408 41.687 -27.436 1.00 23.45 ? 90  ARG A CA  1 
ATOM   724  C C   . ARG A 1 111 ? -27.134 40.957 -28.534 1.00 23.99 ? 90  ARG A C   1 
ATOM   725  O O   . ARG A 1 111 ? -27.941 40.066 -28.272 1.00 24.31 ? 90  ARG A O   1 
ATOM   726  C CB  . ARG A 1 111 ? -24.980 41.175 -27.341 1.00 23.51 ? 90  ARG A CB  1 
ATOM   727  C CG  . ARG A 1 111 ? -24.209 41.672 -26.143 1.00 26.12 ? 90  ARG A CG  1 
ATOM   728  C CD  . ARG A 1 111 ? -22.940 40.884 -26.016 1.00 28.92 ? 90  ARG A CD  1 
ATOM   729  N NE  . ARG A 1 111 ? -23.144 39.552 -25.450 1.00 30.85 ? 90  ARG A NE  1 
ATOM   730  C CZ  . ARG A 1 111 ? -22.430 38.479 -25.784 1.00 31.60 ? 90  ARG A CZ  1 
ATOM   731  N NH1 . ARG A 1 111 ? -21.480 38.564 -26.707 1.00 32.06 ? 90  ARG A NH1 1 
ATOM   732  N NH2 . ARG A 1 111 ? -22.677 37.312 -25.206 1.00 33.04 ? 90  ARG A NH2 1 
ATOM   733  N N   . ALA A 1 112 ? -26.846 41.334 -29.773 1.00 24.64 ? 91  ALA A N   1 
ATOM   734  C CA  . ALA A 1 112 ? -27.480 40.690 -30.910 1.00 24.85 ? 91  ALA A CA  1 
ATOM   735  C C   . ALA A 1 112 ? -27.131 39.198 -30.959 1.00 24.98 ? 91  ALA A C   1 
ATOM   736  O O   . ALA A 1 112 ? -27.893 38.392 -31.499 1.00 25.10 ? 91  ALA A O   1 
ATOM   737  C CB  . ALA A 1 112 ? -27.083 41.396 -32.177 1.00 25.13 ? 91  ALA A CB  1 
ATOM   738  N N   . VAL A 1 113 ? -26.002 38.837 -30.351 1.00 24.77 ? 92  VAL A N   1 
ATOM   739  C CA  . VAL A 1 113 ? -25.567 37.435 -30.273 1.00 24.86 ? 92  VAL A CA  1 
ATOM   740  C C   . VAL A 1 113 ? -25.653 36.827 -28.856 1.00 24.68 ? 92  VAL A C   1 
ATOM   741  O O   . VAL A 1 113 ? -24.891 35.921 -28.509 1.00 24.86 ? 92  VAL A O   1 
ATOM   742  C CB  . VAL A 1 113 ? -24.143 37.245 -30.882 1.00 24.99 ? 92  VAL A CB  1 
ATOM   743  C CG1 . VAL A 1 113 ? -24.160 37.607 -32.347 1.00 25.72 ? 92  VAL A CG1 1 
ATOM   744  C CG2 . VAL A 1 113 ? -23.106 38.097 -30.142 1.00 25.27 ? 92  VAL A CG2 1 
ATOM   745  N N   . SER A 1 114 ? -26.584 37.321 -28.042 1.00 23.89 ? 93  SER A N   1 
ATOM   746  C CA  . SER A 1 114 ? -26.782 36.772 -26.704 1.00 23.29 ? 93  SER A CA  1 
ATOM   747  C C   . SER A 1 114 ? -27.440 35.402 -26.751 1.00 22.77 ? 93  SER A C   1 
ATOM   748  O O   . SER A 1 114 ? -28.078 35.047 -27.740 1.00 22.40 ? 93  SER A O   1 
ATOM   749  C CB  . SER A 1 114 ? -27.645 37.709 -25.855 1.00 23.29 ? 93  SER A CB  1 
ATOM   750  O OG  . SER A 1 114 ? -26.864 38.738 -25.280 1.00 23.78 ? 93  SER A OG  1 
ATOM   751  N N   . ASP A 1 115 ? -27.296 34.642 -25.667 1.00 22.42 ? 94  ASP A N   1 
ATOM   752  C CA  . ASP A 1 115 ? -28.087 33.431 -25.494 1.00 22.32 ? 94  ASP A CA  1 
ATOM   753  C C   . ASP A 1 115 ? -29.472 33.881 -25.023 1.00 21.57 ? 94  ASP A C   1 
ATOM   754  O O   . ASP A 1 115 ? -29.739 33.979 -23.824 1.00 20.38 ? 94  ASP A O   1 
ATOM   755  C CB  . ASP A 1 115 ? -27.417 32.489 -24.483 1.00 22.98 ? 94  ASP A CB  1 
ATOM   756  C CG  . ASP A 1 115 ? -28.092 31.121 -24.409 1.00 25.06 ? 94  ASP A CG  1 
ATOM   757  O OD1 . ASP A 1 115 ? -29.257 30.982 -24.853 1.00 26.28 ? 94  ASP A OD1 1 
ATOM   758  O OD2 . ASP A 1 115 ? -27.447 30.175 -23.890 1.00 28.65 ? 94  ASP A OD2 1 
ATOM   759  N N   . PHE A 1 116 ? -30.344 34.182 -25.979 1.00 20.67 ? 95  PHE A N   1 
ATOM   760  C CA  . PHE A 1 116 ? -31.656 34.740 -25.666 1.00 20.18 ? 95  PHE A CA  1 
ATOM   761  C C   . PHE A 1 116 ? -32.540 33.777 -24.867 1.00 19.13 ? 95  PHE A C   1 
ATOM   762  O O   . PHE A 1 116 ? -33.278 34.202 -23.969 1.00 19.10 ? 95  PHE A O   1 
ATOM   763  C CB  . PHE A 1 116 ? -32.373 35.179 -26.943 1.00 20.87 ? 95  PHE A CB  1 
ATOM   764  C CG  . PHE A 1 116 ? -31.678 36.288 -27.679 1.00 22.21 ? 95  PHE A CG  1 
ATOM   765  C CD1 . PHE A 1 116 ? -31.775 37.601 -27.235 1.00 24.25 ? 95  PHE A CD1 1 
ATOM   766  C CD2 . PHE A 1 116 ? -30.948 36.021 -28.835 1.00 24.49 ? 95  PHE A CD2 1 
ATOM   767  C CE1 . PHE A 1 116 ? -31.138 38.635 -27.921 1.00 24.98 ? 95  PHE A CE1 1 
ATOM   768  C CE2 . PHE A 1 116 ? -30.312 37.050 -29.530 1.00 25.51 ? 95  PHE A CE2 1 
ATOM   769  C CZ  . PHE A 1 116 ? -30.410 38.356 -29.069 1.00 25.07 ? 95  PHE A CZ  1 
ATOM   770  N N   . GLU A 1 117 ? -32.469 32.488 -25.202 1.00 18.05 ? 96  GLU A N   1 
ATOM   771  C CA  . GLU A 1 117 ? -33.190 31.455 -24.458 1.00 17.62 ? 96  GLU A CA  1 
ATOM   772  C C   . GLU A 1 117 ? -32.848 31.577 -22.973 1.00 15.72 ? 96  GLU A C   1 
ATOM   773  O O   . GLU A 1 117 ? -33.732 31.683 -22.118 1.00 14.85 ? 96  GLU A O   1 
ATOM   774  C CB  . GLU A 1 117 ? -32.834 30.044 -24.974 1.00 18.39 ? 96  GLU A CB  1 
ATOM   775  C CG  . GLU A 1 117 ? -33.044 28.935 -23.917 1.00 22.55 ? 96  GLU A CG  1 
ATOM   776  C CD  . GLU A 1 117 ? -32.918 27.514 -24.446 1.00 25.74 ? 96  GLU A CD  1 
ATOM   777  O OE1 . GLU A 1 117 ? -31.922 27.208 -25.137 1.00 28.95 ? 96  GLU A OE1 1 
ATOM   778  O OE2 . GLU A 1 117 ? -33.809 26.692 -24.129 1.00 28.21 ? 96  GLU A OE2 1 
ATOM   779  N N   . TYR A 1 118 ? -31.554 31.596 -22.692 1.00 14.72 ? 97  TYR A N   1 
ATOM   780  C CA  A TYR A 1 118 ? -31.030 31.631 -21.346 0.50 14.05 ? 97  TYR A CA  1 
ATOM   781  C CA  B TYR A 1 118 ? -31.103 31.623 -21.304 0.50 14.15 ? 97  TYR A CA  1 
ATOM   782  C C   . TYR A 1 118 ? -31.487 32.914 -20.612 1.00 13.54 ? 97  TYR A C   1 
ATOM   783  O O   . TYR A 1 118 ? -31.958 32.877 -19.478 1.00 12.96 ? 97  TYR A O   1 
ATOM   784  C CB  A TYR A 1 118 ? -29.514 31.539 -21.499 0.50 14.47 ? 97  TYR A CB  1 
ATOM   785  C CB  B TYR A 1 118 ? -29.603 31.378 -21.130 0.50 14.62 ? 97  TYR A CB  1 
ATOM   786  C CG  A TYR A 1 118 ? -28.681 31.647 -20.266 0.50 15.20 ? 97  TYR A CG  1 
ATOM   787  C CG  B TYR A 1 118 ? -29.224 31.337 -19.660 0.50 15.73 ? 97  TYR A CG  1 
ATOM   788  C CD1 A TYR A 1 118 ? -27.720 32.637 -20.160 0.50 16.67 ? 97  TYR A CD1 1 
ATOM   789  C CD1 B TYR A 1 118 ? -29.469 30.204 -18.897 0.50 16.88 ? 97  TYR A CD1 1 
ATOM   790  C CD2 A TYR A 1 118 ? -28.822 30.748 -19.221 0.50 16.67 ? 97  TYR A CD2 1 
ATOM   791  C CD2 B TYR A 1 118 ? -28.665 32.442 -19.027 0.50 17.31 ? 97  TYR A CD2 1 
ATOM   792  C CE1 A TYR A 1 118 ? -26.936 32.741 -19.049 0.50 17.26 ? 97  TYR A CE1 1 
ATOM   793  C CE1 B TYR A 1 118 ? -29.144 30.158 -17.555 0.50 18.01 ? 97  TYR A CE1 1 
ATOM   794  C CE2 A TYR A 1 118 ? -28.037 30.845 -18.101 0.50 18.04 ? 97  TYR A CE2 1 
ATOM   795  C CE2 B TYR A 1 118 ? -28.336 32.405 -17.680 0.50 18.85 ? 97  TYR A CE2 1 
ATOM   796  C CZ  A TYR A 1 118 ? -27.095 31.849 -18.023 0.50 17.57 ? 97  TYR A CZ  1 
ATOM   797  C CZ  B TYR A 1 118 ? -28.579 31.258 -16.951 0.50 19.14 ? 97  TYR A CZ  1 
ATOM   798  O OH  A TYR A 1 118 ? -26.303 31.960 -16.909 0.50 19.90 ? 97  TYR A OH  1 
ATOM   799  O OH  B TYR A 1 118 ? -28.260 31.202 -15.613 0.50 20.85 ? 97  TYR A OH  1 
ATOM   800  N N   . GLU A 1 119 ? -31.330 34.049 -21.285 1.00 12.61 ? 98  GLU A N   1 
ATOM   801  C CA  . GLU A 1 119 ? -31.665 35.332 -20.665 1.00 12.11 ? 98  GLU A CA  1 
ATOM   802  C C   . GLU A 1 119 ? -33.147 35.466 -20.319 1.00 12.12 ? 98  GLU A C   1 
ATOM   803  O O   . GLU A 1 119 ? -33.508 35.960 -19.238 1.00 12.04 ? 98  GLU A O   1 
ATOM   804  C CB  . GLU A 1 119 ? -31.227 36.494 -21.561 1.00 12.15 ? 98  GLU A CB  1 
ATOM   805  C CG  . GLU A 1 119 ? -29.722 36.659 -21.715 1.00 13.17 ? 98  GLU A CG  1 
ATOM   806  C CD  . GLU A 1 119 ? -28.989 37.001 -20.415 1.00 14.71 ? 98  GLU A CD  1 
ATOM   807  O OE1 . GLU A 1 119 ? -29.612 37.486 -19.435 1.00 14.36 ? 98  GLU A OE1 1 
ATOM   808  O OE2 . GLU A 1 119 ? -27.759 36.785 -20.386 1.00 16.01 ? 98  GLU A OE2 1 
ATOM   809  N N   . PHE A 1 120 ? -34.005 35.023 -21.227 1.00 12.46 ? 99  PHE A N   1 
ATOM   810  C CA  A PHE A 1 120 ? -35.435 35.168 -21.021 0.50 12.35 ? 99  PHE A CA  1 
ATOM   811  C CA  B PHE A 1 120 ? -35.441 35.150 -21.013 0.50 12.57 ? 99  PHE A CA  1 
ATOM   812  C C   . PHE A 1 120 ? -35.961 34.120 -20.026 1.00 12.07 ? 99  PHE A C   1 
ATOM   813  O O   . PHE A 1 120 ? -36.909 34.382 -19.293 1.00 12.19 ? 99  PHE A O   1 
ATOM   814  C CB  A PHE A 1 120 ? -36.187 35.161 -22.355 0.50 13.12 ? 99  PHE A CB  1 
ATOM   815  C CB  B PHE A 1 120 ? -36.211 35.105 -22.326 0.50 13.49 ? 99  PHE A CB  1 
ATOM   816  C CG  A PHE A 1 120 ? -35.697 36.209 -23.340 0.50 13.41 ? 99  PHE A CG  1 
ATOM   817  C CG  B PHE A 1 120 ? -36.281 36.431 -23.012 0.50 14.76 ? 99  PHE A CG  1 
ATOM   818  C CD1 A PHE A 1 120 ? -35.164 37.417 -22.895 0.50 13.97 ? 99  PHE A CD1 1 
ATOM   819  C CD1 B PHE A 1 120 ? -37.258 37.346 -22.670 0.50 16.68 ? 99  PHE A CD1 1 
ATOM   820  C CD2 A PHE A 1 120 ? -35.801 35.994 -24.705 0.50 14.19 ? 99  PHE A CD2 1 
ATOM   821  C CD2 B PHE A 1 120 ? -35.355 36.771 -23.985 0.50 16.02 ? 99  PHE A CD2 1 
ATOM   822  C CE1 A PHE A 1 120 ? -34.716 38.381 -23.800 0.50 14.35 ? 99  PHE A CE1 1 
ATOM   823  C CE1 B PHE A 1 120 ? -37.326 38.579 -23.293 0.50 17.96 ? 99  PHE A CE1 1 
ATOM   824  C CE2 A PHE A 1 120 ? -35.363 36.953 -25.617 0.50 14.47 ? 99  PHE A CE2 1 
ATOM   825  C CE2 B PHE A 1 120 ? -35.418 38.008 -24.619 0.50 17.74 ? 99  PHE A CE2 1 
ATOM   826  C CZ  A PHE A 1 120 ? -34.819 38.146 -25.163 0.50 14.26 ? 99  PHE A CZ  1 
ATOM   827  C CZ  B PHE A 1 120 ? -36.400 38.911 -24.265 0.50 17.79 ? 99  PHE A CZ  1 
ATOM   828  N N   . GLN A 1 121 ? -35.326 32.949 -19.990 1.00 11.86 ? 100 GLN A N   1 
ATOM   829  C CA  . GLN A 1 121 ? -35.674 31.963 -18.962 1.00 11.81 ? 100 GLN A CA  1 
ATOM   830  C C   . GLN A 1 121 ? -35.333 32.479 -17.579 1.00 11.41 ? 100 GLN A C   1 
ATOM   831  O O   . GLN A 1 121 ? -36.158 32.391 -16.659 1.00 11.85 ? 100 GLN A O   1 
ATOM   832  C CB  . GLN A 1 121 ? -34.962 30.644 -19.193 1.00 12.63 ? 100 GLN A CB  1 
ATOM   833  C CG  . GLN A 1 121 ? -35.576 29.851 -20.305 1.00 15.15 ? 100 GLN A CG  1 
ATOM   834  C CD  . GLN A 1 121 ? -34.872 28.540 -20.518 1.00 18.82 ? 100 GLN A CD  1 
ATOM   835  O OE1 . GLN A 1 121 ? -33.642 28.452 -20.426 1.00 20.55 ? 100 GLN A OE1 1 
ATOM   836  N NE2 . GLN A 1 121 ? -35.647 27.502 -20.777 1.00 21.27 ? 100 GLN A NE2 1 
ATOM   837  N N   . MET A 1 122 ? -34.127 33.015 -17.425 1.00 11.58 ? 101 MET A N   1 
ATOM   838  C CA  A MET A 1 122 ? -33.721 33.580 -16.148 0.50 11.83 ? 101 MET A CA  1 
ATOM   839  C CA  B MET A 1 122 ? -33.728 33.573 -16.132 0.50 11.55 ? 101 MET A CA  1 
ATOM   840  C C   . MET A 1 122 ? -34.653 34.724 -15.740 1.00 11.67 ? 101 MET A C   1 
ATOM   841  O O   . MET A 1 122 ? -35.123 34.789 -14.604 1.00 11.94 ? 101 MET A O   1 
ATOM   842  C CB  A MET A 1 122 ? -32.272 34.054 -16.218 0.50 12.22 ? 101 MET A CB  1 
ATOM   843  C CB  B MET A 1 122 ? -32.250 34.003 -16.105 0.50 11.68 ? 101 MET A CB  1 
ATOM   844  C CG  A MET A 1 122 ? -31.876 35.006 -15.126 0.50 13.28 ? 101 MET A CG  1 
ATOM   845  C CG  B MET A 1 122 ? -31.263 32.851 -15.871 0.50 11.67 ? 101 MET A CG  1 
ATOM   846  S SD  A MET A 1 122 ? -30.236 35.665 -15.432 0.50 17.32 ? 101 MET A SD  1 
ATOM   847  S SD  B MET A 1 122 ? -29.537 33.332 -15.591 0.50 13.24 ? 101 MET A SD  1 
ATOM   848  C CE  A MET A 1 122 ? -30.211 37.127 -14.378 0.50 14.69 ? 101 MET A CE  1 
ATOM   849  C CE  B MET A 1 122 ? -29.228 34.329 -17.042 0.50 13.76 ? 101 MET A CE  1 
ATOM   850  N N   . ALA A 1 123 ? -34.938 35.627 -16.677 1.00 11.31 ? 102 ALA A N   1 
ATOM   851  C CA  . ALA A 1 123 ? -35.811 36.767 -16.355 1.00 11.62 ? 102 ALA A CA  1 
ATOM   852  C C   . ALA A 1 123 ? -37.199 36.288 -15.949 1.00 12.38 ? 102 ALA A C   1 
ATOM   853  O O   . ALA A 1 123 ? -37.760 36.781 -14.980 1.00 12.86 ? 102 ALA A O   1 
ATOM   854  C CB  . ALA A 1 123 ? -35.892 37.730 -17.528 1.00 12.14 ? 102 ALA A CB  1 
ATOM   855  N N   . GLY A 1 124 ? -37.730 35.305 -16.675 1.00 12.55 ? 103 GLY A N   1 
ATOM   856  C CA  . GLY A 1 124 ? -39.058 34.774 -16.381 1.00 12.71 ? 103 GLY A CA  1 
ATOM   857  C C   . GLY A 1 124 ? -39.114 34.070 -15.038 1.00 13.19 ? 103 GLY A C   1 
ATOM   858  O O   . GLY A 1 124 ? -40.088 34.208 -14.290 1.00 13.52 ? 103 GLY A O   1 
ATOM   859  N N   . MET A 1 125 ? -38.070 33.311 -14.719 1.00 12.75 ? 104 MET A N   1 
ATOM   860  C CA  . MET A 1 125 ? -38.035 32.587 -13.453 1.00 13.30 ? 104 MET A CA  1 
ATOM   861  C C   . MET A 1 125 ? -37.766 33.516 -12.274 1.00 14.43 ? 104 MET A C   1 
ATOM   862  O O   . MET A 1 125 ? -38.341 33.347 -11.191 1.00 14.79 ? 104 MET A O   1 
ATOM   863  C CB  . MET A 1 125 ? -37.022 31.450 -13.516 1.00 12.89 ? 104 MET A CB  1 
ATOM   864  C CG  . MET A 1 125 ? -37.504 30.321 -14.420 1.00 11.88 ? 104 MET A CG  1 
ATOM   865  S SD  . MET A 1 125 ? -36.299 29.005 -14.565 1.00 10.64 ? 104 MET A SD  1 
ATOM   866  C CE  . MET A 1 125 ? -36.535 28.177 -12.983 1.00 10.70 ? 104 MET A CE  1 
ATOM   867  N N   . ASN A 1 126 ? -36.901 34.504 -12.480 1.00 15.10 ? 105 ASN A N   1 
ATOM   868  C CA  . ASN A 1 126 ? -36.666 35.511 -11.441 1.00 15.98 ? 105 ASN A CA  1 
ATOM   869  C C   . ASN A 1 126 ? -37.908 36.345 -11.145 1.00 16.39 ? 105 ASN A C   1 
ATOM   870  O O   . ASN A 1 126 ? -38.062 36.828 -10.008 1.00 17.02 ? 105 ASN A O   1 
ATOM   871  C CB  . ASN A 1 126 ? -35.456 36.409 -11.762 1.00 16.20 ? 105 ASN A CB  1 
ATOM   872  C CG  . ASN A 1 126 ? -34.129 35.758 -11.416 1.00 17.24 ? 105 ASN A CG  1 
ATOM   873  O OD1 . ASN A 1 126 ? -34.017 34.992 -10.453 1.00 18.27 ? 105 ASN A OD1 1 
ATOM   874  N ND2 . ASN A 1 126 ? -33.103 36.065 -12.201 1.00 17.00 ? 105 ASN A ND2 1 
ATOM   875  N N   A ARG A 1 127 ? -38.774 36.485 -12.172 0.50 16.37 ? 106 ARG A N   1 
ATOM   876  N N   B ARG A 1 127 ? -38.774 36.532 -12.120 0.50 15.70 ? 106 ARG A N   1 
ATOM   877  C CA  A ARG A 1 127 ? -40.120 37.140 -12.149 0.50 16.56 ? 106 ARG A CA  1 
ATOM   878  C CA  B ARG A 1 127 ? -39.997 37.249 -11.847 0.50 15.47 ? 106 ARG A CA  1 
ATOM   879  C C   A ARG A 1 127 ? -41.103 36.437 -11.207 0.50 16.15 ? 106 ARG A C   1 
ATOM   880  C C   B ARG A 1 127 ? -40.847 36.446 -10.866 0.50 15.22 ? 106 ARG A C   1 
ATOM   881  O O   A ARG A 1 127 ? -42.049 37.052 -10.685 0.50 16.39 ? 106 ARG A O   1 
ATOM   882  O O   B ARG A 1 127 ? -41.413 37.003 -9.923  0.50 14.94 ? 106 ARG A O   1 
ATOM   883  C CB  A ARG A 1 127 ? -40.795 37.139 -13.543 0.50 16.99 ? 106 ARG A CB  1 
ATOM   884  C CB  B ARG A 1 127 ? -40.753 37.528 -13.131 0.50 15.04 ? 106 ARG A CB  1 
ATOM   885  C CG  A ARG A 1 127 ? -40.384 38.211 -14.573 0.50 17.44 ? 106 ARG A CG  1 
ATOM   886  C CG  B ARG A 1 127 ? -42.107 38.127 -12.904 0.50 14.05 ? 106 ARG A CG  1 
ATOM   887  C CD  A ARG A 1 127 ? -41.501 38.534 -15.620 0.50 17.60 ? 106 ARG A CD  1 
ATOM   888  C CD  B ARG A 1 127 ? -42.622 38.757 -14.163 0.50 13.18 ? 106 ARG A CD  1 
ATOM   889  N NE  A ARG A 1 127 ? -41.833 37.462 -16.577 0.50 16.79 ? 106 ARG A NE  1 
ATOM   890  N NE  B ARG A 1 127 ? -41.889 39.971 -14.506 0.50 10.83 ? 106 ARG A NE  1 
ATOM   891  C CZ  A ARG A 1 127 ? -41.234 37.274 -17.756 0.50 16.37 ? 106 ARG A CZ  1 
ATOM   892  C CZ  B ARG A 1 127 ? -41.925 40.526 -15.711 0.50 11.12 ? 106 ARG A CZ  1 
ATOM   893  N NH1 A ARG A 1 127 ? -40.244 38.064 -18.148 0.50 15.88 ? 106 ARG A NH1 1 
ATOM   894  N NH1 B ARG A 1 127 ? -42.642 39.959 -16.668 0.50 10.78 ? 106 ARG A NH1 1 
ATOM   895  N NH2 A ARG A 1 127 ? -41.613 36.277 -18.548 0.50 16.49 ? 106 ARG A NH2 1 
ATOM   896  N NH2 B ARG A 1 127 ? -41.246 41.638 -15.958 0.50 9.74  ? 106 ARG A NH2 1 
ATOM   897  N N   . TYR A 1 128 ? -40.913 35.130 -11.060 1.00 15.07 ? 107 TYR A N   1 
ATOM   898  C CA  . TYR A 1 128 ? -41.665 34.305 -10.116 1.00 15.37 ? 107 TYR A CA  1 
ATOM   899  C C   . TYR A 1 128 ? -41.051 34.442 -8.726  1.00 15.25 ? 107 TYR A C   1 
ATOM   900  O O   . TYR A 1 128 ? -41.773 34.528 -7.723  1.00 15.72 ? 107 TYR A O   1 
ATOM   901  C CB  . TYR A 1 128 ? -41.620 32.837 -10.524 1.00 15.13 ? 107 TYR A CB  1 
ATOM   902  C CG  . TYR A 1 128 ? -42.744 32.374 -11.406 1.00 16.28 ? 107 TYR A CG  1 
ATOM   903  C CD1 . TYR A 1 128 ? -44.047 32.277 -10.911 1.00 16.72 ? 107 TYR A CD1 1 
ATOM   904  C CD2 . TYR A 1 128 ? -42.499 31.978 -12.721 1.00 16.62 ? 107 TYR A CD2 1 
ATOM   905  C CE1 . TYR A 1 128 ? -45.087 31.821 -11.714 1.00 17.91 ? 107 TYR A CE1 1 
ATOM   906  C CE2 . TYR A 1 128 ? -43.530 31.518 -13.535 1.00 17.80 ? 107 TYR A CE2 1 
ATOM   907  C CZ  . TYR A 1 128 ? -44.816 31.446 -13.025 1.00 18.03 ? 107 TYR A CZ  1 
ATOM   908  O OH  . TYR A 1 128 ? -45.841 30.983 -13.822 1.00 19.82 ? 107 TYR A OH  1 
ATOM   909  N N   . LEU A 1 129 ? -39.723 34.449 -8.674  1.00 15.20 ? 108 LEU A N   1 
ATOM   910  C CA  . LEU A 1 129 ? -39.007 34.532 -7.409  1.00 15.53 ? 108 LEU A CA  1 
ATOM   911  C C   . LEU A 1 129 ? -39.035 35.935 -6.798  1.00 15.47 ? 108 LEU A C   1 
ATOM   912  O O   . LEU A 1 129 ? -39.033 36.068 -5.575  1.00 16.19 ? 108 LEU A O   1 
ATOM   913  C CB  . LEU A 1 129 ? -37.559 34.069 -7.572  1.00 16.19 ? 108 LEU A CB  1 
ATOM   914  C CG  . LEU A 1 129 ? -37.354 32.633 -8.055  1.00 16.93 ? 108 LEU A CG  1 
ATOM   915  C CD1 . LEU A 1 129 ? -35.894 32.408 -8.398  1.00 17.21 ? 108 LEU A CD1 1 
ATOM   916  C CD2 . LEU A 1 129 ? -37.820 31.626 -7.009  1.00 17.71 ? 108 LEU A CD2 1 
ATOM   917  N N   . LEU A 1 130 ? -39.066 36.959 -7.651  1.00 15.42 ? 109 LEU A N   1 
ATOM   918  C CA  . LEU A 1 130 ? -38.976 38.377 -7.246  1.00 15.55 ? 109 LEU A CA  1 
ATOM   919  C C   . LEU A 1 130 ? -39.954 39.217 -8.066  1.00 14.96 ? 109 LEU A C   1 
ATOM   920  O O   . LEU A 1 130 ? -39.536 39.974 -8.947  1.00 14.38 ? 109 LEU A O   1 
ATOM   921  C CB  . LEU A 1 130 ? -37.567 38.911 -7.513  1.00 16.56 ? 109 LEU A CB  1 
ATOM   922  C CG  . LEU A 1 130 ? -36.368 38.342 -6.767  1.00 18.07 ? 109 LEU A CG  1 
ATOM   923  C CD1 . LEU A 1 130 ? -35.103 38.497 -7.608  1.00 19.75 ? 109 LEU A CD1 1 
ATOM   924  C CD2 . LEU A 1 130 ? -36.221 39.047 -5.432  1.00 19.35 ? 109 LEU A CD2 1 
ATOM   925  N N   . PRO A 1 131 ? -41.264 39.090 -7.795  1.00 14.77 ? 110 PRO A N   1 
ATOM   926  C CA  . PRO A 1 131 ? -42.250 39.719 -8.689  1.00 15.17 ? 110 PRO A CA  1 
ATOM   927  C C   . PRO A 1 131 ? -42.124 41.240 -8.812  1.00 15.34 ? 110 PRO A C   1 
ATOM   928  O O   . PRO A 1 131 ? -42.443 41.798 -9.862  1.00 16.23 ? 110 PRO A O   1 
ATOM   929  C CB  . PRO A 1 131 ? -43.592 39.350 -8.050  1.00 15.24 ? 110 PRO A CB  1 
ATOM   930  C CG  . PRO A 1 131 ? -43.297 38.153 -7.200  1.00 15.41 ? 110 PRO A CG  1 
ATOM   931  C CD  . PRO A 1 131 ? -41.910 38.348 -6.696  1.00 14.98 ? 110 PRO A CD  1 
ATOM   932  N N   . ASP A 1 132 ? -41.645 41.892 -7.761  1.00 15.15 ? 111 ASP A N   1 
ATOM   933  C CA  . ASP A 1 132 ? -41.519 43.349 -7.745  1.00 14.91 ? 111 ASP A CA  1 
ATOM   934  C C   . ASP A 1 132 ? -40.166 43.868 -8.248  1.00 13.97 ? 111 ASP A C   1 
ATOM   935  O O   . ASP A 1 132 ? -39.926 45.079 -8.209  1.00 14.37 ? 111 ASP A O   1 
ATOM   936  C CB  . ASP A 1 132 ? -41.680 43.836 -6.314  1.00 15.75 ? 111 ASP A CB  1 
ATOM   937  C CG  . ASP A 1 132 ? -40.603 43.261 -5.417  1.00 19.07 ? 111 ASP A CG  1 
ATOM   938  O OD1 . ASP A 1 132 ? -40.593 42.026 -5.219  1.00 23.88 ? 111 ASP A OD1 1 
ATOM   939  O OD2 . ASP A 1 132 ? -39.732 44.024 -4.970  1.00 24.92 ? 111 ASP A OD2 1 
ATOM   940  N N   . VAL A 1 133 ? -39.277 42.973 -8.678  1.00 12.11 ? 112 VAL A N   1 
ATOM   941  C CA  . VAL A 1 133 ? -37.972 43.376 -9.220  1.00 10.99 ? 112 VAL A CA  1 
ATOM   942  C C   . VAL A 1 133 ? -38.024 43.256 -10.740 1.00 11.25 ? 112 VAL A C   1 
ATOM   943  O O   . VAL A 1 133 ? -38.469 42.233 -11.260 1.00 11.65 ? 112 VAL A O   1 
ATOM   944  C CB  . VAL A 1 133 ? -36.829 42.514 -8.630  1.00 10.33 ? 112 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 133 ? -35.492 42.781 -9.335  1.00 11.28 ? 112 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 133 ? -36.701 42.764 -7.122  1.00 11.70 ? 112 VAL A CG2 1 
ATOM   947  N N   . GLU A 1 134 ? -37.602 44.302 -11.444 1.00 10.36 ? 113 GLU A N   1 
ATOM   948  C CA  . GLU A 1 134 ? -37.579 44.270 -12.902 1.00 11.16 ? 113 GLU A CA  1 
ATOM   949  C C   . GLU A 1 134 ? -36.227 43.867 -13.464 1.00 10.97 ? 113 GLU A C   1 
ATOM   950  O O   . GLU A 1 134 ? -35.209 44.453 -13.105 1.00 11.83 ? 113 GLU A O   1 
ATOM   951  C CB  . GLU A 1 134 ? -37.955 45.646 -13.459 1.00 11.17 ? 113 GLU A CB  1 
ATOM   952  C CG  . GLU A 1 134 ? -39.366 46.097 -13.073 1.00 13.63 ? 113 GLU A CG  1 
ATOM   953  C CD  . GLU A 1 134 ? -40.458 45.204 -13.651 1.00 14.03 ? 113 GLU A CD  1 
ATOM   954  O OE1 . GLU A 1 134 ? -40.222 44.528 -14.673 1.00 15.98 ? 113 GLU A OE1 1 
ATOM   955  O OE2 . GLU A 1 134 ? -41.552 45.173 -13.056 1.00 16.33 ? 113 GLU A OE2 1 
ATOM   956  N N   . THR A 1 135 ? -36.218 42.885 -14.360 1.00 10.63 ? 114 THR A N   1 
ATOM   957  C CA  . THR A 1 135 ? -35.033 42.626 -15.177 1.00 10.95 ? 114 THR A CA  1 
ATOM   958  C C   . THR A 1 135 ? -35.073 43.592 -16.353 1.00 11.19 ? 114 THR A C   1 
ATOM   959  O O   . THR A 1 135 ? -36.059 43.642 -17.099 1.00 11.57 ? 114 THR A O   1 
ATOM   960  C CB  . THR A 1 135 ? -34.950 41.166 -15.670 1.00 11.17 ? 114 THR A CB  1 
ATOM   961  O OG1 . THR A 1 135 ? -34.774 40.308 -14.541 1.00 14.10 ? 114 THR A OG1 1 
ATOM   962  C CG2 . THR A 1 135 ? -33.744 40.975 -16.604 1.00 11.67 ? 114 THR A CG2 1 
ATOM   963  N N   . MET A 1 136 ? -34.016 44.386 -16.474 1.00 10.24 ? 115 MET A N   1 
ATOM   964  C CA  . MET A 1 136 ? -33.873 45.349 -17.557 1.00 10.23 ? 115 MET A CA  1 
ATOM   965  C C   . MET A 1 136 ? -32.625 45.016 -18.364 1.00 9.70  ? 115 MET A C   1 
ATOM   966  O O   . MET A 1 136 ? -31.564 44.777 -17.803 1.00 10.21 ? 115 MET A O   1 
ATOM   967  C CB  . MET A 1 136 ? -33.811 46.762 -17.001 1.00 10.47 ? 115 MET A CB  1 
ATOM   968  C CG  . MET A 1 136 ? -35.050 47.103 -16.154 1.00 13.02 ? 115 MET A CG  1 
ATOM   969  S SD  . MET A 1 136 ? -35.019 48.806 -15.569 1.00 17.63 ? 115 MET A SD  1 
ATOM   970  C CE  . MET A 1 136 ? -35.393 49.645 -17.103 1.00 18.85 ? 115 MET A CE  1 
ATOM   971  N N   . PHE A 1 137 ? -32.767 44.957 -19.677 1.00 8.85  ? 116 PHE A N   1 
ATOM   972  C CA  . PHE A 1 137 ? -31.646 44.601 -20.542 1.00 9.93  ? 116 PHE A CA  1 
ATOM   973  C C   . PHE A 1 137 ? -31.026 45.851 -21.150 1.00 10.59 ? 116 PHE A C   1 
ATOM   974  O O   . PHE A 1 137 ? -31.737 46.724 -21.631 1.00 10.79 ? 116 PHE A O   1 
ATOM   975  C CB  . PHE A 1 137 ? -32.114 43.657 -21.655 1.00 10.01 ? 116 PHE A CB  1 
ATOM   976  C CG  . PHE A 1 137 ? -32.588 42.326 -21.153 1.00 11.71 ? 116 PHE A CG  1 
ATOM   977  C CD1 . PHE A 1 137 ? -31.672 41.369 -20.724 1.00 13.46 ? 116 PHE A CD1 1 
ATOM   978  C CD2 . PHE A 1 137 ? -33.944 42.036 -21.091 1.00 13.26 ? 116 PHE A CD2 1 
ATOM   979  C CE1 . PHE A 1 137 ? -32.106 40.122 -20.251 1.00 14.14 ? 116 PHE A CE1 1 
ATOM   980  C CE2 . PHE A 1 137 ? -34.388 40.789 -20.617 1.00 14.91 ? 116 PHE A CE2 1 
ATOM   981  C CZ  . PHE A 1 137 ? -33.457 39.840 -20.198 1.00 13.52 ? 116 PHE A CZ  1 
ATOM   982  N N   . MET A 1 138 ? -29.699 45.924 -21.128 1.00 11.30 ? 117 MET A N   1 
ATOM   983  C CA  . MET A 1 138 ? -28.975 47.048 -21.729 1.00 12.74 ? 117 MET A CA  1 
ATOM   984  C C   . MET A 1 138 ? -28.039 46.502 -22.781 1.00 13.73 ? 117 MET A C   1 
ATOM   985  O O   . MET A 1 138 ? -27.736 45.313 -22.774 1.00 13.72 ? 117 MET A O   1 
ATOM   986  C CB  . MET A 1 138 ? -28.177 47.798 -20.663 1.00 13.31 ? 117 MET A CB  1 
ATOM   987  C CG  . MET A 1 138 ? -29.042 48.396 -19.570 1.00 14.07 ? 117 MET A CG  1 
ATOM   988  S SD  . MET A 1 138 ? -28.093 49.437 -18.435 1.00 16.60 ? 117 MET A SD  1 
ATOM   989  C CE  . MET A 1 138 ? -27.997 50.953 -19.380 1.00 17.43 ? 117 MET A CE  1 
ATOM   990  N N   . THR A 1 139 ? -27.579 47.368 -23.687 1.00 14.46 ? 118 THR A N   1 
ATOM   991  C CA  . THR A 1 139 ? -26.726 46.921 -24.796 1.00 16.19 ? 118 THR A CA  1 
ATOM   992  C C   . THR A 1 139 ? -25.364 47.590 -24.736 1.00 15.25 ? 118 THR A C   1 
ATOM   993  O O   . THR A 1 139 ? -25.289 48.812 -24.580 1.00 16.34 ? 118 THR A O   1 
ATOM   994  C CB  . THR A 1 139 ? -27.359 47.226 -26.169 1.00 16.63 ? 118 THR A CB  1 
ATOM   995  O OG1 . THR A 1 139 ? -27.533 48.642 -26.321 1.00 20.24 ? 118 THR A OG1 1 
ATOM   996  C CG2 . THR A 1 139 ? -28.706 46.541 -26.309 1.00 18.81 ? 118 THR A CG2 1 
ATOM   997  N N   . PRO A 1 140 ? -24.280 46.807 -24.867 1.00 15.08 ? 119 PRO A N   1 
ATOM   998  C CA  . PRO A 1 140 ? -22.961 47.431 -24.879 1.00 14.63 ? 119 PRO A CA  1 
ATOM   999  C C   . PRO A 1 140 ? -22.699 48.098 -26.234 1.00 13.96 ? 119 PRO A C   1 
ATOM   1000 O O   . PRO A 1 140 ? -23.473 47.902 -27.179 1.00 14.05 ? 119 PRO A O   1 
ATOM   1001 C CB  . PRO A 1 140 ? -22.018 46.241 -24.678 1.00 14.88 ? 119 PRO A CB  1 
ATOM   1002 C CG  . PRO A 1 140 ? -22.736 45.113 -25.357 1.00 15.59 ? 119 PRO A CG  1 
ATOM   1003 C CD  . PRO A 1 140 ? -24.197 45.344 -25.074 1.00 15.16 ? 119 PRO A CD  1 
ATOM   1004 N N   . SER A 1 141 ? -21.618 48.872 -26.317 1.00 13.91 ? 120 SER A N   1 
ATOM   1005 C CA  . SER A 1 141 ? -21.196 49.481 -27.581 1.00 13.99 ? 120 SER A CA  1 
ATOM   1006 C C   . SER A 1 141 ? -20.999 48.410 -28.663 1.00 14.01 ? 120 SER A C   1 
ATOM   1007 O O   . SER A 1 141 ? -20.680 47.262 -28.355 1.00 13.47 ? 120 SER A O   1 
ATOM   1008 C CB  . SER A 1 141 ? -19.894 50.258 -27.388 1.00 14.38 ? 120 SER A CB  1 
ATOM   1009 O OG  . SER A 1 141 ? -19.985 51.200 -26.325 1.00 17.33 ? 120 SER A OG  1 
ATOM   1010 N N   . ASP A 1 142 ? -21.180 48.805 -29.925 1.00 14.28 ? 121 ASP A N   1 
ATOM   1011 C CA  . ASP A 1 142 ? -21.051 47.906 -31.076 1.00 14.69 ? 121 ASP A CA  1 
ATOM   1012 C C   . ASP A 1 142 ? -19.777 47.073 -31.040 1.00 14.57 ? 121 ASP A C   1 
ATOM   1013 O O   . ASP A 1 142 ? -19.802 45.888 -31.377 1.00 14.51 ? 121 ASP A O   1 
ATOM   1014 C CB  . ASP A 1 142 ? -21.036 48.696 -32.395 1.00 15.28 ? 121 ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 142 ? -22.313 49.485 -32.642 1.00 18.86 ? 121 ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 142 ? -23.372 49.119 -32.097 1.00 22.62 ? 121 ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 142 ? -22.251 50.468 -33.418 1.00 22.24 ? 121 ASP A OD2 1 
ATOM   1018 N N   . GLN A 1 143 ? -18.678 47.708 -30.644 1.00 14.18 ? 122 GLN A N   1 
ATOM   1019 C CA  A GLN A 1 143 ? -17.369 47.066 -30.721 0.50 14.35 ? 122 GLN A CA  1 
ATOM   1020 C CA  B GLN A 1 143 ? -17.350 47.095 -30.687 0.50 14.55 ? 122 GLN A CA  1 
ATOM   1021 C C   . GLN A 1 143 ? -17.185 45.926 -29.712 1.00 14.49 ? 122 GLN A C   1 
ATOM   1022 O O   . GLN A 1 143 ? -16.255 45.136 -29.843 1.00 14.33 ? 122 GLN A O   1 
ATOM   1023 C CB  A GLN A 1 143 ? -16.225 48.091 -30.641 0.50 14.47 ? 122 GLN A CB  1 
ATOM   1024 C CB  B GLN A 1 143 ? -16.250 48.149 -30.472 0.50 14.80 ? 122 GLN A CB  1 
ATOM   1025 C CG  A GLN A 1 143 ? -16.075 48.801 -29.309 0.50 15.19 ? 122 GLN A CG  1 
ATOM   1026 C CG  B GLN A 1 143 ? -16.384 48.974 -29.197 0.50 16.56 ? 122 GLN A CG  1 
ATOM   1027 C CD  A GLN A 1 143 ? -16.878 50.087 -29.235 0.50 15.52 ? 122 GLN A CD  1 
ATOM   1028 C CD  B GLN A 1 143 ? -15.318 50.054 -29.086 0.50 18.33 ? 122 GLN A CD  1 
ATOM   1029 O OE1 A GLN A 1 143 ? -17.793 50.313 -30.028 0.50 15.24 ? 122 GLN A OE1 1 
ATOM   1030 O OE1 B GLN A 1 143 ? -14.180 49.870 -29.522 0.50 19.70 ? 122 GLN A OE1 1 
ATOM   1031 N NE2 A GLN A 1 143 ? -16.537 50.939 -28.271 0.50 17.16 ? 122 GLN A NE2 1 
ATOM   1032 N NE2 B GLN A 1 143 ? -15.682 51.185 -28.495 0.50 19.11 ? 122 GLN A NE2 1 
ATOM   1033 N N   . TYR A 1 144 ? -18.088 45.824 -28.736 1.00 14.26 ? 123 TYR A N   1 
ATOM   1034 C CA  . TYR A 1 144 ? -18.005 44.750 -27.740 1.00 15.52 ? 123 TYR A CA  1 
ATOM   1035 C C   . TYR A 1 144 ? -19.113 43.701 -27.876 1.00 16.13 ? 123 TYR A C   1 
ATOM   1036 O O   . TYR A 1 144 ? -19.134 42.729 -27.111 1.00 17.38 ? 123 TYR A O   1 
ATOM   1037 C CB  . TYR A 1 144 ? -18.002 45.324 -26.304 1.00 15.38 ? 123 TYR A CB  1 
ATOM   1038 C CG  . TYR A 1 144 ? -17.063 46.492 -26.089 1.00 16.55 ? 123 TYR A CG  1 
ATOM   1039 C CD1 . TYR A 1 144 ? -15.701 46.384 -26.364 1.00 17.19 ? 123 TYR A CD1 1 
ATOM   1040 C CD2 . TYR A 1 144 ? -17.542 47.709 -25.596 1.00 17.64 ? 123 TYR A CD2 1 
ATOM   1041 C CE1 . TYR A 1 144 ? -14.832 47.466 -26.172 1.00 18.24 ? 123 TYR A CE1 1 
ATOM   1042 C CE2 . TYR A 1 144 ? -16.682 48.792 -25.403 1.00 18.19 ? 123 TYR A CE2 1 
ATOM   1043 C CZ  . TYR A 1 144 ? -15.333 48.659 -25.684 1.00 18.65 ? 123 TYR A CZ  1 
ATOM   1044 O OH  . TYR A 1 144 ? -14.476 49.727 -25.503 1.00 20.93 ? 123 TYR A OH  1 
ATOM   1045 N N   . GLN A 1 145 ? -19.998 43.885 -28.861 1.00 16.86 ? 124 GLN A N   1 
ATOM   1046 C CA  . GLN A 1 145 ? -21.189 43.045 -29.050 1.00 17.69 ? 124 GLN A CA  1 
ATOM   1047 C C   . GLN A 1 145 ? -20.857 41.569 -29.314 1.00 18.22 ? 124 GLN A C   1 
ATOM   1048 O O   . GLN A 1 145 ? -21.687 40.699 -29.060 1.00 19.91 ? 124 GLN A O   1 
ATOM   1049 C CB  . GLN A 1 145 ? -22.076 43.589 -30.187 1.00 18.07 ? 124 GLN A CB  1 
ATOM   1050 C CG  . GLN A 1 145 ? -22.842 44.902 -29.887 1.00 18.89 ? 124 GLN A CG  1 
ATOM   1051 C CD  . GLN A 1 145 ? -24.302 44.702 -29.456 1.00 20.10 ? 124 GLN A CD  1 
ATOM   1052 O OE1 . GLN A 1 145 ? -24.945 43.710 -29.803 1.00 20.55 ? 124 GLN A OE1 1 
ATOM   1053 N NE2 . GLN A 1 145 ? -24.830 45.663 -28.700 1.00 19.14 ? 124 GLN A NE2 1 
ATOM   1054 N N   . PHE A 1 146 ? -19.657 41.284 -29.813 1.00 17.63 ? 125 PHE A N   1 
ATOM   1055 C CA  . PHE A 1 146 ? -19.334 39.928 -30.246 1.00 17.47 ? 125 PHE A CA  1 
ATOM   1056 C C   . PHE A 1 146 ? -18.284 39.225 -29.381 1.00 17.08 ? 125 PHE A C   1 
ATOM   1057 O O   . PHE A 1 146 ? -17.801 38.150 -29.739 1.00 17.20 ? 125 PHE A O   1 
ATOM   1058 C CB  . PHE A 1 146 ? -18.974 39.940 -31.748 1.00 17.81 ? 125 PHE A CB  1 
ATOM   1059 C CG  . PHE A 1 146 ? -20.063 40.530 -32.610 1.00 18.86 ? 125 PHE A CG  1 
ATOM   1060 C CD1 . PHE A 1 146 ? -20.076 41.894 -32.907 1.00 20.21 ? 125 PHE A CD1 1 
ATOM   1061 C CD2 . PHE A 1 146 ? -21.105 39.736 -33.082 1.00 19.67 ? 125 PHE A CD2 1 
ATOM   1062 C CE1 . PHE A 1 146 ? -21.096 42.453 -33.685 1.00 21.31 ? 125 PHE A CE1 1 
ATOM   1063 C CE2 . PHE A 1 146 ? -22.130 40.282 -33.862 1.00 20.54 ? 125 PHE A CE2 1 
ATOM   1064 C CZ  . PHE A 1 146 ? -22.125 41.646 -34.161 1.00 21.09 ? 125 PHE A CZ  1 
ATOM   1065 N N   . ILE A 1 147 ? -17.955 39.809 -28.229 1.00 16.13 ? 126 ILE A N   1 
ATOM   1066 C CA  . ILE A 1 147 ? -16.964 39.204 -27.328 1.00 16.09 ? 126 ILE A CA  1 
ATOM   1067 C C   . ILE A 1 147 ? -17.587 38.079 -26.489 1.00 16.10 ? 126 ILE A C   1 
ATOM   1068 O O   . ILE A 1 147 ? -18.576 38.293 -25.771 1.00 16.54 ? 126 ILE A O   1 
ATOM   1069 C CB  . ILE A 1 147 ? -16.303 40.250 -26.398 1.00 16.22 ? 126 ILE A CB  1 
ATOM   1070 C CG1 . ILE A 1 147 ? -15.592 41.340 -27.210 1.00 17.31 ? 126 ILE A CG1 1 
ATOM   1071 C CG2 . ILE A 1 147 ? -15.317 39.570 -25.426 1.00 16.51 ? 126 ILE A CG2 1 
ATOM   1072 C CD1 . ILE A 1 147 ? -15.140 42.549 -26.370 1.00 19.39 ? 126 ILE A CD1 1 
ATOM   1073 N N   . SER A 1 148 ? -17.012 36.885 -26.605 1.00 14.95 ? 127 SER A N   1 
ATOM   1074 C CA  . SER A 1 148 ? -17.398 35.729 -25.795 1.00 15.25 ? 127 SER A CA  1 
ATOM   1075 C C   . SER A 1 148 ? -16.335 35.424 -24.749 1.00 15.16 ? 127 SER A C   1 
ATOM   1076 O O   . SER A 1 148 ? -15.167 35.256 -25.080 1.00 14.34 ? 127 SER A O   1 
ATOM   1077 C CB  . SER A 1 148 ? -17.595 34.504 -26.683 1.00 15.38 ? 127 SER A CB  1 
ATOM   1078 O OG  . SER A 1 148 ? -17.540 33.311 -25.918 1.00 15.96 ? 127 SER A OG  1 
ATOM   1079 N N   . GLY A 1 149 ? -16.745 35.339 -23.487 1.00 14.99 ? 128 GLY A N   1 
ATOM   1080 C CA  . GLY A 1 149 ? -15.816 35.007 -22.408 1.00 15.60 ? 128 GLY A CA  1 
ATOM   1081 C C   . GLY A 1 149 ? -15.202 33.626 -22.568 1.00 15.41 ? 128 GLY A C   1 
ATOM   1082 O O   . GLY A 1 149 ? -14.022 33.422 -22.270 1.00 15.53 ? 128 GLY A O   1 
ATOM   1083 N N   . THR A 1 150 ? -16.007 32.680 -23.041 1.00 16.20 ? 129 THR A N   1 
ATOM   1084 C CA  . THR A 1 150 ? -15.542 31.315 -23.279 1.00 16.69 ? 129 THR A CA  1 
ATOM   1085 C C   . THR A 1 150 ? -14.409 31.314 -24.302 1.00 15.78 ? 129 THR A C   1 
ATOM   1086 O O   . THR A 1 150 ? -13.395 30.633 -24.115 1.00 15.77 ? 129 THR A O   1 
ATOM   1087 C CB  . THR A 1 150 ? -16.689 30.403 -23.767 1.00 17.58 ? 129 THR A CB  1 
ATOM   1088 O OG1 . THR A 1 150 ? -17.790 30.510 -22.859 1.00 21.30 ? 129 THR A OG1 1 
ATOM   1089 C CG2 . THR A 1 150 ? -16.237 28.950 -23.813 1.00 19.08 ? 129 THR A CG2 1 
ATOM   1090 N N   . ILE A 1 151 ? -14.583 32.090 -25.365 1.00 14.50 ? 130 ILE A N   1 
ATOM   1091 C CA  . ILE A 1 151 ? -13.576 32.182 -26.421 1.00 13.92 ? 130 ILE A CA  1 
ATOM   1092 C C   . ILE A 1 151 ? -12.344 32.941 -25.905 1.00 13.36 ? 130 ILE A C   1 
ATOM   1093 O O   . ILE A 1 151 ? -11.203 32.577 -26.220 1.00 11.94 ? 130 ILE A O   1 
ATOM   1094 C CB  . ILE A 1 151 ? -14.149 32.801 -27.718 1.00 13.95 ? 130 ILE A CB  1 
ATOM   1095 C CG1 . ILE A 1 151 ? -15.270 31.905 -28.276 1.00 15.56 ? 130 ILE A CG1 1 
ATOM   1096 C CG2 . ILE A 1 151 ? -13.051 32.982 -28.786 1.00 14.76 ? 130 ILE A CG2 1 
ATOM   1097 C CD1 . ILE A 1 151 ? -15.962 32.460 -29.490 1.00 16.27 ? 130 ILE A CD1 1 
ATOM   1098 N N   . VAL A 1 152 ? -12.568 33.978 -25.098 1.00 12.59 ? 131 VAL A N   1 
ATOM   1099 C CA  . VAL A 1 152 ? -11.449 34.666 -24.438 1.00 12.45 ? 131 VAL A CA  1 
ATOM   1100 C C   . VAL A 1 152 ? -10.574 33.683 -23.630 1.00 12.32 ? 131 VAL A C   1 
ATOM   1101 O O   . VAL A 1 152 ? -9.341  33.703 -23.734 1.00 12.06 ? 131 VAL A O   1 
ATOM   1102 C CB  . VAL A 1 152 ? -11.936 35.833 -23.533 1.00 12.37 ? 131 VAL A CB  1 
ATOM   1103 C CG1 . VAL A 1 152 ? -10.824 36.327 -22.630 1.00 12.96 ? 131 VAL A CG1 1 
ATOM   1104 C CG2 . VAL A 1 152 ? -12.494 36.970 -24.380 1.00 12.90 ? 131 VAL A CG2 1 
ATOM   1105 N N   . ARG A 1 153 ? -11.210 32.820 -22.837 1.00 12.67 ? 132 ARG A N   1 
ATOM   1106 C CA  . ARG A 1 153 ? -10.447 31.862 -22.021 1.00 12.67 ? 132 ARG A CA  1 
ATOM   1107 C C   . ARG A 1 153 ? -9.695  30.863 -22.890 1.00 12.75 ? 132 ARG A C   1 
ATOM   1108 O O   . ARG A 1 153 ? -8.534  30.564 -22.620 1.00 12.89 ? 132 ARG A O   1 
ATOM   1109 C CB  . ARG A 1 153 ? -11.345 31.127 -21.027 1.00 13.41 ? 132 ARG A CB  1 
ATOM   1110 C CG  . ARG A 1 153 ? -11.928 32.025 -19.942 1.00 14.63 ? 132 ARG A CG  1 
ATOM   1111 C CD  . ARG A 1 153 ? -12.581 31.199 -18.839 1.00 16.73 ? 132 ARG A CD  1 
ATOM   1112 N NE  . ARG A 1 153 ? -13.675 30.372 -19.350 1.00 19.84 ? 132 ARG A NE  1 
ATOM   1113 C CZ  . ARG A 1 153 ? -14.925 30.785 -19.539 1.00 20.12 ? 132 ARG A CZ  1 
ATOM   1114 N NH1 . ARG A 1 153 ? -15.282 32.034 -19.274 1.00 20.81 ? 132 ARG A NH1 1 
ATOM   1115 N NH2 . ARG A 1 153 ? -15.827 29.935 -20.013 1.00 23.40 ? 132 ARG A NH2 1 
ATOM   1116 N N   . GLU A 1 154 ? -10.356 30.396 -23.947 1.00 12.51 ? 133 GLU A N   1 
ATOM   1117 C CA  . GLU A 1 154 ? -9.775  29.471 -24.920 1.00 12.78 ? 133 GLU A CA  1 
ATOM   1118 C C   . GLU A 1 154 ? -8.526  30.072 -25.559 1.00 11.64 ? 133 GLU A C   1 
ATOM   1119 O O   . GLU A 1 154 ? -7.479  29.423 -25.634 1.00 11.91 ? 133 GLU A O   1 
ATOM   1120 C CB  . GLU A 1 154 ? -10.813 29.134 -25.990 1.00 13.56 ? 133 GLU A CB  1 
ATOM   1121 C CG  . GLU A 1 154 ? -10.384 28.068 -26.978 1.00 16.78 ? 133 GLU A CG  1 
ATOM   1122 C CD  . GLU A 1 154 ? -11.486 27.735 -27.967 1.00 21.21 ? 133 GLU A CD  1 
ATOM   1123 O OE1 . GLU A 1 154 ? -12.529 27.180 -27.544 1.00 23.85 ? 133 GLU A OE1 1 
ATOM   1124 O OE2 . GLU A 1 154 ? -11.322 28.032 -29.166 1.00 22.09 ? 133 GLU A OE2 1 
ATOM   1125 N N   . ILE A 1 155 ? -8.632  31.316 -26.017 1.00 10.69 ? 134 ILE A N   1 
ATOM   1126 C CA  . ILE A 1 155 ? -7.480  31.983 -26.615 1.00 9.93  ? 134 ILE A CA  1 
ATOM   1127 C C   . ILE A 1 155 ? -6.335  32.121 -25.612 1.00 10.11 ? 134 ILE A C   1 
ATOM   1128 O O   . ILE A 1 155 ? -5.185  31.844 -25.954 1.00 10.51 ? 134 ILE A O   1 
ATOM   1129 C CB  . ILE A 1 155 ? -7.868  33.351 -27.211 1.00 9.58  ? 134 ILE A CB  1 
ATOM   1130 C CG1 . ILE A 1 155 ? -8.782  33.142 -28.412 1.00 10.24 ? 134 ILE A CG1 1 
ATOM   1131 C CG2 . ILE A 1 155 ? -6.650  34.131 -27.665 1.00 8.48  ? 134 ILE A CG2 1 
ATOM   1132 C CD1 . ILE A 1 155 ? -9.534  34.388 -28.835 1.00 9.87  ? 134 ILE A CD1 1 
ATOM   1133 N N   . ALA A 1 156 ? -6.658  32.533 -24.383 1.00 10.78 ? 135 ALA A N   1 
ATOM   1134 C CA  . ALA A 1 156 ? -5.629  32.775 -23.369 1.00 11.28 ? 135 ALA A CA  1 
ATOM   1135 C C   . ALA A 1 156 ? -4.899  31.474 -23.031 1.00 12.03 ? 135 ALA A C   1 
ATOM   1136 O O   . ALA A 1 156 ? -3.668  31.459 -22.890 1.00 11.77 ? 135 ALA A O   1 
ATOM   1137 C CB  . ALA A 1 156 ? -6.250  33.413 -22.108 1.00 11.85 ? 135 ALA A CB  1 
ATOM   1138 N N   . GLN A 1 157 ? -5.660  30.382 -22.943 1.00 12.71 ? 136 GLN A N   1 
ATOM   1139 C CA  . GLN A 1 157 ? -5.100  29.058 -22.607 1.00 14.25 ? 136 GLN A CA  1 
ATOM   1140 C C   . GLN A 1 157 ? -4.191  28.514 -23.709 1.00 14.37 ? 136 GLN A C   1 
ATOM   1141 O O   . GLN A 1 157 ? -3.247  27.759 -23.450 1.00 14.89 ? 136 GLN A O   1 
ATOM   1142 C CB  . GLN A 1 157 ? -6.226  28.075 -22.269 1.00 14.80 ? 136 GLN A CB  1 
ATOM   1143 C CG  . GLN A 1 157 ? -6.837  28.311 -20.881 1.00 18.28 ? 136 GLN A CG  1 
ATOM   1144 C CD  . GLN A 1 157 ? -8.308  27.919 -20.776 1.00 21.85 ? 136 GLN A CD  1 
ATOM   1145 O OE1 . GLN A 1 157 ? -8.882  27.323 -21.695 1.00 25.19 ? 136 GLN A OE1 1 
ATOM   1146 N NE2 . GLN A 1 157 ? -8.931  28.277 -19.660 1.00 23.82 ? 136 GLN A NE2 1 
ATOM   1147 N N   . LEU A 1 158 ? -4.451  28.927 -24.942 1.00 13.67 ? 137 LEU A N   1 
ATOM   1148 C CA  . LEU A 1 158 ? -3.610  28.534 -26.062 1.00 13.93 ? 137 LEU A CA  1 
ATOM   1149 C C   . LEU A 1 158 ? -2.462  29.530 -26.294 1.00 13.67 ? 137 LEU A C   1 
ATOM   1150 O O   . LEU A 1 158 ? -1.710  29.425 -27.273 1.00 14.29 ? 137 LEU A O   1 
ATOM   1151 C CB  . LEU A 1 158 ? -4.472  28.330 -27.320 1.00 13.65 ? 137 LEU A CB  1 
ATOM   1152 C CG  . LEU A 1 158 ? -5.453  27.148 -27.233 1.00 15.13 ? 137 LEU A CG  1 
ATOM   1153 C CD1 . LEU A 1 158 ? -6.448  27.163 -28.402 1.00 15.93 ? 137 LEU A CD1 1 
ATOM   1154 C CD2 . LEU A 1 158 ? -4.725  25.804 -27.171 1.00 15.69 ? 137 LEU A CD2 1 
ATOM   1155 N N   . GLY A 1 159 ? -2.325  30.484 -25.371 1.00 14.41 ? 138 GLY A N   1 
ATOM   1156 C CA  . GLY A 1 159 ? -1.240  31.463 -25.396 1.00 14.52 ? 138 GLY A CA  1 
ATOM   1157 C C   . GLY A 1 159 ? -1.438  32.634 -26.335 1.00 14.94 ? 138 GLY A C   1 
ATOM   1158 O O   . GLY A 1 159 ? -0.475  33.241 -26.810 1.00 15.59 ? 138 GLY A O   1 
ATOM   1159 N N   . GLY A 1 160 ? -2.696  32.950 -26.611 1.00 14.40 ? 139 GLY A N   1 
ATOM   1160 C CA  . GLY A 1 160 ? -3.007  34.038 -27.507 1.00 14.42 ? 139 GLY A CA  1 
ATOM   1161 C C   . GLY A 1 160 ? -3.366  35.312 -26.775 1.00 14.47 ? 139 GLY A C   1 
ATOM   1162 O O   . GLY A 1 160 ? -3.859  35.282 -25.638 1.00 14.95 ? 139 GLY A O   1 
ATOM   1163 N N   A ASP A 1 161 ? -3.094  36.449 -27.391 0.50 14.65 ? 140 ASP A N   1 
ATOM   1164 N N   B ASP A 1 161 ? -3.173  36.413 -27.504 0.50 14.65 ? 140 ASP A N   1 
ATOM   1165 C CA  A ASP A 1 161 ? -3.390  37.703 -26.718 0.50 14.26 ? 140 ASP A CA  1 
ATOM   1166 C CA  B ASP A 1 161 ? -3.537  37.786 -27.131 0.50 14.38 ? 140 ASP A CA  1 
ATOM   1167 C C   A ASP A 1 161 ? -4.863  38.063 -26.856 0.50 13.63 ? 140 ASP A C   1 
ATOM   1168 C C   B ASP A 1 161 ? -5.027  37.942 -26.887 0.50 13.67 ? 140 ASP A C   1 
ATOM   1169 O O   A ASP A 1 161 ? -5.457  37.970 -27.933 0.50 13.49 ? 140 ASP A O   1 
ATOM   1170 O O   B ASP A 1 161 ? -5.821  37.597 -27.764 0.50 13.77 ? 140 ASP A O   1 
ATOM   1171 C CB  A ASP A 1 161 ? -2.511  38.831 -27.229 0.50 14.33 ? 140 ASP A CB  1 
ATOM   1172 C CB  B ASP A 1 161 ? -3.164  38.706 -28.299 0.50 14.44 ? 140 ASP A CB  1 
ATOM   1173 C CG  A ASP A 1 161 ? -2.799  40.141 -26.535 0.50 15.01 ? 140 ASP A CG  1 
ATOM   1174 C CG  B ASP A 1 161 ? -3.613  40.140 -28.092 0.50 14.31 ? 140 ASP A CG  1 
ATOM   1175 O OD1 A ASP A 1 161 ? -2.338  40.320 -25.386 0.50 15.16 ? 140 ASP A OD1 1 
ATOM   1176 O OD1 B ASP A 1 161 ? -3.907  40.825 -29.102 0.50 12.97 ? 140 ASP A OD1 1 
ATOM   1177 O OD2 A ASP A 1 161 ? -3.479  40.989 -27.149 0.50 14.80 ? 140 ASP A OD2 1 
ATOM   1178 O OD2 B ASP A 1 161 ? -3.655  40.584 -26.924 0.50 14.29 ? 140 ASP A OD2 1 
ATOM   1179 N N   . VAL A 1 162 ? -5.419  38.477 -25.727 1.00 12.81 ? 141 VAL A N   1 
ATOM   1180 C CA  . VAL A 1 162 ? -6.831  38.834 -25.568 1.00 12.05 ? 141 VAL A CA  1 
ATOM   1181 C C   . VAL A 1 162 ? -7.020  40.313 -25.193 1.00 11.00 ? 141 VAL A C   1 
ATOM   1182 O O   . VAL A 1 162 ? -8.089  40.697 -24.717 1.00 10.17 ? 141 VAL A O   1 
ATOM   1183 C CB  . VAL A 1 162 ? -7.575  37.894 -24.574 1.00 12.48 ? 141 VAL A CB  1 
ATOM   1184 C CG1 . VAL A 1 162 ? -7.650  36.462 -25.126 1.00 12.79 ? 141 VAL A CG1 1 
ATOM   1185 C CG2 . VAL A 1 162 ? -6.935  37.904 -23.188 1.00 13.32 ? 141 VAL A CG2 1 
ATOM   1186 N N   . SER A 1 163 ? -5.990  41.129 -25.428 1.00 10.55 ? 142 SER A N   1 
ATOM   1187 C CA  . SER A 1 163 ? -6.032  42.579 -25.126 1.00 11.47 ? 142 SER A CA  1 
ATOM   1188 C C   . SER A 1 163 ? -7.152  43.364 -25.807 1.00 10.81 ? 142 SER A C   1 
ATOM   1189 O O   . SER A 1 163 ? -7.587  44.406 -25.299 1.00 10.73 ? 142 SER A O   1 
ATOM   1190 C CB  . SER A 1 163 ? -4.690  43.250 -25.485 1.00 11.23 ? 142 SER A CB  1 
ATOM   1191 O OG  . SER A 1 163 ? -4.489  43.257 -26.889 1.00 15.84 ? 142 SER A OG  1 
ATOM   1192 N N   . LYS A 1 164 ? -7.610  42.895 -26.965 1.00 10.08 ? 143 LYS A N   1 
ATOM   1193 C CA  . LYS A 1 164 ? -8.731  43.547 -27.637 1.00 9.33  ? 143 LYS A CA  1 
ATOM   1194 C C   . LYS A 1 164 ? -10.051 43.266 -26.918 1.00 9.28  ? 143 LYS A C   1 
ATOM   1195 O O   . LYS A 1 164 ? -11.052 43.947 -27.167 1.00 9.94  ? 143 LYS A O   1 
ATOM   1196 C CB  . LYS A 1 164 ? -8.836  43.093 -29.099 1.00 10.23 ? 143 LYS A CB  1 
ATOM   1197 N N   . PHE A 1 165 ? -10.048 42.277 -26.018 1.00 8.39  ? 144 PHE A N   1 
ATOM   1198 C CA  . PHE A 1 165 ? -11.290 41.773 -25.417 1.00 8.64  ? 144 PHE A CA  1 
ATOM   1199 C C   . PHE A 1 165 ? -11.406 42.025 -23.916 1.00 8.55  ? 144 PHE A C   1 
ATOM   1200 O O   . PHE A 1 165 ? -12.513 42.028 -23.367 1.00 8.80  ? 144 PHE A O   1 
ATOM   1201 C CB  . PHE A 1 165 ? -11.418 40.267 -25.653 1.00 8.53  ? 144 PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 165 ? -11.171 39.856 -27.072 1.00 9.09  ? 144 PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 165 ? -10.237 38.870 -27.360 1.00 9.52  ? 144 PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 165 ? -11.855 40.477 -28.123 1.00 9.60  ? 144 PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 165 ? -9.978  38.496 -28.674 1.00 10.87 ? 144 PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 165 ? -11.604 40.100 -29.449 1.00 9.78  ? 144 PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 165 ? -10.676 39.112 -29.719 1.00 9.41  ? 144 PHE A CZ  1 
ATOM   1208 N N   . VAL A 1 166 ? -10.256 42.196 -23.266 1.00 8.33  ? 145 VAL A N   1 
ATOM   1209 C CA  . VAL A 1 166 ? -10.200 42.437 -21.814 1.00 7.99  ? 145 VAL A CA  1 
ATOM   1210 C C   . VAL A 1 166 ? -9.188  43.541 -21.520 1.00 8.38  ? 145 VAL A C   1 
ATOM   1211 O O   . VAL A 1 166 ? -8.302  43.800 -22.330 1.00 9.04  ? 145 VAL A O   1 
ATOM   1212 C CB  . VAL A 1 166 ? -9.824  41.165 -21.004 1.00 7.62  ? 145 VAL A CB  1 
ATOM   1213 C CG1 . VAL A 1 166 ? -10.774 39.990 -21.298 1.00 8.24  ? 145 VAL A CG1 1 
ATOM   1214 C CG2 . VAL A 1 166 ? -8.351  40.759 -21.218 1.00 7.72  ? 145 VAL A CG2 1 
ATOM   1215 N N   . PHE A 1 167 ? -9.337  44.206 -20.372 1.00 8.60  ? 146 PHE A N   1 
ATOM   1216 C CA  . PHE A 1 167 ? -8.386  45.258 -19.979 1.00 9.22  ? 146 PHE A CA  1 
ATOM   1217 C C   . PHE A 1 167 ? -7.009  44.685 -19.632 1.00 9.14  ? 146 PHE A C   1 
ATOM   1218 O O   . PHE A 1 167 ? -6.909  43.491 -19.334 1.00 8.94  ? 146 PHE A O   1 
ATOM   1219 C CB  . PHE A 1 167 ? -8.951  46.080 -18.817 1.00 9.44  ? 146 PHE A CB  1 
ATOM   1220 C CG  . PHE A 1 167 ? -9.940  47.108 -19.253 1.00 10.66 ? 146 PHE A CG  1 
ATOM   1221 C CD1 . PHE A 1 167 ? -9.523  48.366 -19.674 1.00 14.73 ? 146 PHE A CD1 1 
ATOM   1222 C CD2 . PHE A 1 167 ? -11.287 46.800 -19.303 1.00 13.78 ? 146 PHE A CD2 1 
ATOM   1223 C CE1 . PHE A 1 167 ? -10.451 49.314 -20.099 1.00 16.11 ? 146 PHE A CE1 1 
ATOM   1224 C CE2 . PHE A 1 167 ? -12.217 47.741 -19.729 1.00 12.68 ? 146 PHE A CE2 1 
ATOM   1225 C CZ  . PHE A 1 167 ? -11.809 48.992 -20.119 1.00 14.77 ? 146 PHE A CZ  1 
ATOM   1226 N N   . PRO A 1 168 ? -5.939  45.516 -19.706 1.00 9.24  ? 147 PRO A N   1 
ATOM   1227 C CA  . PRO A 1 168 ? -4.586  45.023 -19.430 1.00 9.25  ? 147 PRO A CA  1 
ATOM   1228 C C   . PRO A 1 168 ? -4.450  44.318 -18.087 1.00 8.88  ? 147 PRO A C   1 
ATOM   1229 O O   . PRO A 1 168 ? -3.740  43.313 -17.996 1.00 9.14  ? 147 PRO A O   1 
ATOM   1230 C CB  . PRO A 1 168 ? -3.743  46.299 -19.452 1.00 9.41  ? 147 PRO A CB  1 
ATOM   1231 C CG  . PRO A 1 168 ? -4.419  47.146 -20.482 1.00 10.08 ? 147 PRO A CG  1 
ATOM   1232 C CD  . PRO A 1 168 ? -5.903  46.891 -20.251 1.00 9.57  ? 147 PRO A CD  1 
ATOM   1233 N N   . SER A 1 169 ? -5.130  44.815 -17.054 1.00 8.73  ? 148 SER A N   1 
ATOM   1234 C CA  . SER A 1 169 ? -5.031  44.172 -15.751 1.00 8.90  ? 148 SER A CA  1 
ATOM   1235 C C   . SER A 1 169 ? -5.570  42.744 -15.803 1.00 8.79  ? 148 SER A C   1 
ATOM   1236 O O   . SER A 1 169 ? -5.056  41.853 -15.136 1.00 9.32  ? 148 SER A O   1 
ATOM   1237 C CB  . SER A 1 169 ? -5.741  44.991 -14.667 1.00 8.88  ? 148 SER A CB  1 
ATOM   1238 O OG  . SER A 1 169 ? -7.118  45.140 -14.958 1.00 10.38 ? 148 SER A OG  1 
ATOM   1239 N N   . VAL A 1 170 ? -6.604  42.529 -16.618 1.00 8.73  ? 149 VAL A N   1 
ATOM   1240 C CA  . VAL A 1 170 ? -7.221  41.220 -16.739 1.00 8.47  ? 149 VAL A CA  1 
ATOM   1241 C C   . VAL A 1 170 ? -6.328  40.278 -17.549 1.00 8.51  ? 149 VAL A C   1 
ATOM   1242 O O   . VAL A 1 170 ? -6.234  39.080 -17.246 1.00 8.58  ? 149 VAL A O   1 
ATOM   1243 C CB  . VAL A 1 170 ? -8.621  41.329 -17.391 1.00 8.53  ? 149 VAL A CB  1 
ATOM   1244 C CG1 . VAL A 1 170 ? -9.285  39.981 -17.446 1.00 8.68  ? 149 VAL A CG1 1 
ATOM   1245 C CG2 . VAL A 1 170 ? -9.505  42.348 -16.631 1.00 9.58  ? 149 VAL A CG2 1 
ATOM   1246 N N   A GLU A 1 171 ? -5.684  40.822 -18.578 0.50 8.22  ? 150 GLU A N   1 
ATOM   1247 N N   B GLU A 1 171 ? -5.661  40.809 -18.569 0.50 8.34  ? 150 GLU A N   1 
ATOM   1248 C CA  A GLU A 1 171 ? -4.700  40.072 -19.348 0.50 8.05  ? 150 GLU A CA  1 
ATOM   1249 C CA  B GLU A 1 171 ? -4.723  39.993 -19.334 0.50 8.27  ? 150 GLU A CA  1 
ATOM   1250 C C   A GLU A 1 171 ? -3.632  39.497 -18.417 0.50 7.82  ? 150 GLU A C   1 
ATOM   1251 C C   B GLU A 1 171 ? -3.555  39.512 -18.465 0.50 8.01  ? 150 GLU A C   1 
ATOM   1252 O O   A GLU A 1 171 ? -3.274  38.326 -18.529 0.50 7.23  ? 150 GLU A O   1 
ATOM   1253 O O   B GLU A 1 171 ? -3.040  38.420 -18.676 0.50 7.61  ? 150 GLU A O   1 
ATOM   1254 C CB  A GLU A 1 171 ? -4.060  40.967 -20.409 0.50 8.53  ? 150 GLU A CB  1 
ATOM   1255 C CB  B GLU A 1 171 ? -4.226  40.722 -20.582 0.50 8.81  ? 150 GLU A CB  1 
ATOM   1256 C CG  A GLU A 1 171 ? -2.949  40.288 -21.180 0.50 10.27 ? 150 GLU A CG  1 
ATOM   1257 C CG  B GLU A 1 171 ? -3.375  39.832 -21.471 0.50 11.03 ? 150 GLU A CG  1 
ATOM   1258 C CD  A GLU A 1 171 ? -3.456  39.134 -22.021 0.50 13.00 ? 150 GLU A CD  1 
ATOM   1259 C CD  B GLU A 1 171 ? -3.320  40.311 -22.904 0.50 14.16 ? 150 GLU A CD  1 
ATOM   1260 O OE1 A GLU A 1 171 ? -4.342  39.371 -22.861 0.50 14.64 ? 150 GLU A OE1 1 
ATOM   1261 O OE1 B GLU A 1 171 ? -3.236  39.452 -23.817 0.50 15.88 ? 150 GLU A OE1 1 
ATOM   1262 O OE2 A GLU A 1 171 ? -2.960  37.998 -21.851 0.50 15.11 ? 150 GLU A OE2 1 
ATOM   1263 O OE2 B GLU A 1 171 ? -3.371  41.540 -23.118 0.50 15.75 ? 150 GLU A OE2 1 
ATOM   1264 N N   . LYS A 1 172 ? -3.151  40.323 -17.486 1.00 7.79  ? 151 LYS A N   1 
ATOM   1265 C CA  . LYS A 1 172 ? -2.128  39.904 -16.517 1.00 8.07  ? 151 LYS A CA  1 
ATOM   1266 C C   . LYS A 1 172 ? -2.583  38.693 -15.690 1.00 7.52  ? 151 LYS A C   1 
ATOM   1267 O O   . LYS A 1 172 ? -1.822  37.740 -15.496 1.00 7.43  ? 151 LYS A O   1 
ATOM   1268 C CB  . LYS A 1 172 ? -1.749  41.067 -15.588 1.00 8.94  ? 151 LYS A CB  1 
ATOM   1269 C CG  . LYS A 1 172 ? -1.030  42.218 -16.255 1.00 12.39 ? 151 LYS A CG  1 
ATOM   1270 C CD  . LYS A 1 172 ? -0.639  43.276 -15.222 1.00 17.04 ? 151 LYS A CD  1 
ATOM   1271 C CE  . LYS A 1 172 ? -0.013  44.507 -15.866 1.00 20.01 ? 151 LYS A CE  1 
ATOM   1272 N NZ  . LYS A 1 172 ? 0.137   45.624 -14.877 1.00 22.31 ? 151 LYS A NZ  1 
ATOM   1273 N N   . TRP A 1 173 ? -3.829  38.727 -15.228 1.00 7.32  ? 152 TRP A N   1 
ATOM   1274 C CA  . TRP A 1 173 ? -4.387  37.602 -14.487 1.00 7.42  ? 152 TRP A CA  1 
ATOM   1275 C C   . TRP A 1 173 ? -4.473  36.333 -15.340 1.00 7.48  ? 152 TRP A C   1 
ATOM   1276 O O   . TRP A 1 173 ? -4.125  35.247 -14.876 1.00 8.24  ? 152 TRP A O   1 
ATOM   1277 C CB  . TRP A 1 173 ? -5.767  37.978 -13.962 1.00 7.77  ? 152 TRP A CB  1 
ATOM   1278 C CG  . TRP A 1 173 ? -5.745  38.728 -12.658 1.00 8.31  ? 152 TRP A CG  1 
ATOM   1279 C CD1 . TRP A 1 173 ? -5.846  40.079 -12.471 1.00 8.27  ? 152 TRP A CD1 1 
ATOM   1280 C CD2 . TRP A 1 173 ? -5.642  38.144 -11.356 1.00 9.75  ? 152 TRP A CD2 1 
ATOM   1281 N NE1 . TRP A 1 173 ? -5.823  40.372 -11.116 1.00 9.93  ? 152 TRP A NE1 1 
ATOM   1282 C CE2 . TRP A 1 173 ? -5.693  39.202 -10.415 1.00 9.90  ? 152 TRP A CE2 1 
ATOM   1283 C CE3 . TRP A 1 173 ? -5.509  36.827 -10.892 1.00 10.94 ? 152 TRP A CE3 1 
ATOM   1284 C CZ2 . TRP A 1 173 ? -5.617  38.978 -9.026  1.00 11.55 ? 152 TRP A CZ2 1 
ATOM   1285 C CZ3 . TRP A 1 173 ? -5.426  36.607 -9.513  1.00 12.58 ? 152 TRP A CZ3 1 
ATOM   1286 C CH2 . TRP A 1 173 ? -5.481  37.683 -8.603  1.00 12.36 ? 152 TRP A CH2 1 
ATOM   1287 N N   . LEU A 1 174 ? -4.939  36.475 -16.587 1.00 7.02  ? 153 LEU A N   1 
ATOM   1288 C CA  . LEU A 1 174 ? -5.049  35.330 -17.477 1.00 6.82  ? 153 LEU A CA  1 
ATOM   1289 C C   . LEU A 1 174 ? -3.679  34.695 -17.724 1.00 6.61  ? 153 LEU A C   1 
ATOM   1290 O O   . LEU A 1 174 ? -3.513  33.480 -17.626 1.00 6.85  ? 153 LEU A O   1 
ATOM   1291 C CB  . LEU A 1 174 ? -5.707  35.744 -18.801 1.00 6.28  ? 153 LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 174 ? -7.227  35.923 -18.721 1.00 7.75  ? 153 LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 174 ? -7.683  36.752 -19.909 1.00 8.59  ? 153 LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 174 ? -7.929  34.574 -18.695 1.00 7.81  ? 153 LEU A CD2 1 
ATOM   1295 N N   . THR A 1 175 ? -2.686  35.530 -18.005 1.00 6.67  ? 154 THR A N   1 
ATOM   1296 C CA  . THR A 1 175 ? -1.337  35.052 -18.276 1.00 6.83  ? 154 THR A CA  1 
ATOM   1297 C C   . THR A 1 175 ? -0.770  34.316 -17.077 1.00 7.66  ? 154 THR A C   1 
ATOM   1298 O O   . THR A 1 175 ? -0.199  33.238 -17.228 1.00 8.01  ? 154 THR A O   1 
ATOM   1299 C CB  . THR A 1 175 ? -0.436  36.227 -18.696 1.00 6.99  ? 154 THR A CB  1 
ATOM   1300 O OG1 . THR A 1 175 ? -0.934  36.743 -19.939 1.00 7.51  ? 154 THR A OG1 1 
ATOM   1301 C CG2 . THR A 1 175 ? 1.032   35.790 -18.871 1.00 6.97  ? 154 THR A CG2 1 
ATOM   1302 N N   . GLU A 1 176 ? -0.970  34.893 -15.898 1.00 8.49  ? 155 GLU A N   1 
ATOM   1303 C CA  A GLU A 1 176 ? -0.418  34.280 -14.706 0.50 9.33  ? 155 GLU A CA  1 
ATOM   1304 C CA  B GLU A 1 176 ? -0.489  34.334 -14.631 0.50 9.44  ? 155 GLU A CA  1 
ATOM   1305 C C   . GLU A 1 176 ? -1.107  32.964 -14.379 1.00 9.35  ? 155 GLU A C   1 
ATOM   1306 O O   . GLU A 1 176 ? -0.414  31.997 -14.039 1.00 9.55  ? 155 GLU A O   1 
ATOM   1307 C CB  A GLU A 1 176 ? -0.377  35.262 -13.528 0.50 9.45  ? 155 GLU A CB  1 
ATOM   1308 C CB  B GLU A 1 176 ? -0.832  35.293 -13.474 0.50 9.52  ? 155 GLU A CB  1 
ATOM   1309 C CG  A GLU A 1 176 ? 0.949   36.016 -13.481 0.50 11.63 ? 155 GLU A CG  1 
ATOM   1310 C CG  B GLU A 1 176 ? -0.597  34.744 -12.062 0.50 12.14 ? 155 GLU A CG  1 
ATOM   1311 C CD  A GLU A 1 176 ? 0.950   37.198 -12.535 0.50 12.66 ? 155 GLU A CD  1 
ATOM   1312 C CD  B GLU A 1 176 ? -1.004  35.727 -10.974 0.50 15.49 ? 155 GLU A CD  1 
ATOM   1313 O OE1 A GLU A 1 176 ? 0.317   37.112 -11.459 0.50 14.60 ? 155 GLU A OE1 1 
ATOM   1314 O OE1 B GLU A 1 176 ? -0.307  36.748 -10.804 0.50 16.55 ? 155 GLU A OE1 1 
ATOM   1315 O OE2 A GLU A 1 176 ? 1.590   38.213 -12.871 0.50 10.81 ? 155 GLU A OE2 1 
ATOM   1316 O OE2 B GLU A 1 176 ? -2.021  35.478 -10.286 0.50 16.05 ? 155 GLU A OE2 1 
ATOM   1317 N N   . LYS A 1 177 ? -2.430  32.903 -14.548 1.00 9.27  ? 156 LYS A N   1 
ATOM   1318 C CA  . LYS A 1 177 ? -3.169  31.680 -14.242 1.00 9.91  ? 156 LYS A CA  1 
ATOM   1319 C C   . LYS A 1 177 ? -2.839  30.573 -15.235 1.00 9.10  ? 156 LYS A C   1 
ATOM   1320 O O   . LYS A 1 177 ? -2.643  29.427 -14.841 1.00 9.09  ? 156 LYS A O   1 
ATOM   1321 C CB  . LYS A 1 177 ? -4.675  31.944 -14.190 1.00 10.91 ? 156 LYS A CB  1 
ATOM   1322 C CG  . LYS A 1 177 ? -5.492  30.747 -13.699 1.00 14.66 ? 156 LYS A CG  1 
ATOM   1323 C CD  . LYS A 1 177 ? -5.959  30.915 -12.254 1.00 15.64 ? 156 LYS A CD  1 
ATOM   1324 C CE  . LYS A 1 177 ? -6.542  29.612 -11.733 1.00 17.59 ? 156 LYS A CE  1 
ATOM   1325 N NZ  . LYS A 1 177 ? -7.402  29.797 -10.531 1.00 20.46 ? 156 LYS A NZ  1 
ATOM   1326 N N   . VAL A 1 178 ? -2.745  30.926 -16.518 1.00 7.84  ? 157 VAL A N   1 
ATOM   1327 C CA  . VAL A 1 178 ? -2.364  29.961 -17.542 1.00 7.71  ? 157 VAL A CA  1 
ATOM   1328 C C   . VAL A 1 178 ? -0.973  29.381 -17.265 1.00 8.04  ? 157 VAL A C   1 
ATOM   1329 O O   . VAL A 1 178 ? -0.757  28.169 -17.369 1.00 8.28  ? 157 VAL A O   1 
ATOM   1330 C CB  . VAL A 1 178 ? -2.479  30.586 -18.977 1.00 6.90  ? 157 VAL A CB  1 
ATOM   1331 C CG1 . VAL A 1 178 ? -1.841  29.698 -20.047 1.00 7.21  ? 157 VAL A CG1 1 
ATOM   1332 C CG2 . VAL A 1 178 ? -3.946  30.838 -19.327 1.00 7.11  ? 157 VAL A CG2 1 
ATOM   1333 N N   . ALA A 1 179 ? -0.029  30.244 -16.880 1.00 8.26  ? 158 ALA A N   1 
ATOM   1334 C CA  . ALA A 1 179 ? 1.328   29.795 -16.606 1.00 9.50  ? 158 ALA A CA  1 
ATOM   1335 C C   . ALA A 1 179 ? 1.373   28.895 -15.376 1.00 10.60 ? 158 ALA A C   1 
ATOM   1336 O O   . ALA A 1 179 ? 2.117   27.920 -15.357 1.00 10.90 ? 158 ALA A O   1 
ATOM   1337 C CB  . ALA A 1 179 ? 2.268   30.993 -16.437 1.00 8.63  ? 158 ALA A CB  1 
ATOM   1338 N N   . ALA A 1 180 ? 0.555   29.213 -14.377 1.00 12.32 ? 159 ALA A N   1 
ATOM   1339 C CA  . ALA A 1 180 ? 0.551   28.455 -13.119 1.00 15.01 ? 159 ALA A CA  1 
ATOM   1340 C C   . ALA A 1 180 ? -0.049  27.069 -13.287 1.00 17.15 ? 159 ALA A C   1 
ATOM   1341 O O   . ALA A 1 180 ? 0.439   26.110 -12.671 1.00 17.88 ? 159 ALA A O   1 
ATOM   1342 C CB  . ALA A 1 180 ? -0.177  29.218 -12.029 1.00 14.62 ? 159 ALA A CB  1 
ATOM   1343 N N   . MET A 1 181 ? -1.084  26.959 -14.125 1.00 18.84 ? 160 MET A N   1 
ATOM   1344 C CA  A MET A 1 181 ? -1.756  25.679 -14.336 0.50 20.23 ? 160 MET A CA  1 
ATOM   1345 C CA  B MET A 1 181 ? -1.769  25.676 -14.365 0.50 20.13 ? 160 MET A CA  1 
ATOM   1346 C C   . MET A 1 181 ? -0.921  24.709 -15.183 1.00 20.84 ? 160 MET A C   1 
ATOM   1347 O O   . MET A 1 181 ? -1.116  23.498 -15.117 1.00 21.61 ? 160 MET A O   1 
ATOM   1348 C CB  A MET A 1 181 ? -3.151  25.890 -14.933 0.50 20.40 ? 160 MET A CB  1 
ATOM   1349 C CB  B MET A 1 181 ? -3.180  25.835 -14.992 0.50 20.25 ? 160 MET A CB  1 
ATOM   1350 C CG  A MET A 1 181 ? -4.146  26.577 -13.992 0.50 21.84 ? 160 MET A CG  1 
ATOM   1351 C CG  B MET A 1 181 ? -3.369  26.947 -16.031 0.50 21.16 ? 160 MET A CG  1 
ATOM   1352 S SD  A MET A 1 181 ? -4.324  25.780 -12.376 0.50 24.82 ? 160 MET A SD  1 
ATOM   1353 S SD  B MET A 1 181 ? -4.334  26.573 -17.529 0.50 23.43 ? 160 MET A SD  1 
ATOM   1354 C CE  A MET A 1 181 ? -3.079  26.626 -11.406 0.50 24.03 ? 160 MET A CE  1 
ATOM   1355 C CE  B MET A 1 181 ? -3.030  25.928 -18.580 0.50 22.92 ? 160 MET A CE  1 
ATOM   1356 N N   . ALA A 1 182 ? 0.016   25.246 -15.962 1.00 21.74 ? 161 ALA A N   1 
ATOM   1357 C CA  . ALA A 1 182 ? 0.942   24.418 -16.733 1.00 22.62 ? 161 ALA A CA  1 
ATOM   1358 C C   . ALA A 1 182 ? 2.088   23.968 -15.832 1.00 23.23 ? 161 ALA A C   1 
ATOM   1359 O O   . ALA A 1 182 ? 2.329   22.772 -15.662 1.00 24.10 ? 161 ALA A O   1 
ATOM   1360 C CB  . ALA A 1 182 ? 1.476   25.181 -17.935 1.00 22.86 ? 161 ALA A CB  1 
HETATM 1361 O O19 . 4PS B 2 .   ? -22.119 37.600 -18.028 1.00 20.57 ? 167 4PS A O19 1 
HETATM 1362 P P20 . 4PS B 2 .   ? -21.729 36.150 -17.468 1.00 16.91 ? 167 4PS A P20 1 
HETATM 1363 O O21 . 4PS B 2 .   ? -21.669 35.142 -18.599 1.00 18.96 ? 167 4PS A O21 1 
HETATM 1364 O O22 . 4PS B 2 .   ? -20.495 36.299 -16.612 1.00 17.70 ? 167 4PS A O22 1 
HETATM 1365 O O23 . 4PS B 2 .   ? -22.967 35.791 -16.491 1.00 15.62 ? 167 4PS A O23 1 
HETATM 1366 P P24 . 4PS B 2 .   ? -23.738 34.396 -16.336 1.00 14.16 ? 167 4PS A P24 1 
HETATM 1367 O O25 . 4PS B 2 .   ? -24.621 34.239 -17.526 1.00 16.58 ? 167 4PS A O25 1 
HETATM 1368 O O26 . 4PS B 2 .   ? -22.733 33.338 -15.920 1.00 17.30 ? 167 4PS A O26 1 
HETATM 1369 O O27 . 4PS B 2 .   ? -24.657 34.804 -15.084 1.00 13.16 ? 167 4PS A O27 1 
HETATM 1370 C C28 . 4PS B 2 .   ? -25.646 33.900 -14.615 1.00 12.28 ? 167 4PS A C28 1 
HETATM 1371 C C29 . 4PS B 2 .   ? -25.887 34.146 -13.137 1.00 11.39 ? 167 4PS A C29 1 
HETATM 1372 C C30 . 4PS B 2 .   ? -24.562 33.930 -12.403 1.00 14.89 ? 167 4PS A C30 1 
HETATM 1373 C C31 . 4PS B 2 .   ? -26.402 35.573 -12.947 1.00 13.14 ? 167 4PS A C31 1 
HETATM 1374 C C32 . 4PS B 2 .   ? -26.925 33.123 -12.678 1.00 10.95 ? 167 4PS A C32 1 
HETATM 1375 O O33 . 4PS B 2 .   ? -26.429 31.782 -12.925 1.00 12.21 ? 167 4PS A O33 1 
HETATM 1376 C C34 . 4PS B 2 .   ? -27.284 33.268 -11.219 1.00 11.93 ? 167 4PS A C34 1 
HETATM 1377 O O35 . 4PS B 2 .   ? -28.111 34.108 -10.886 1.00 12.92 ? 167 4PS A O35 1 
HETATM 1378 N N36 . 4PS B 2 .   ? -26.664 32.443 -10.373 1.00 11.54 ? 167 4PS A N36 1 
HETATM 1379 C C37 . 4PS B 2 .   ? -26.897 32.465 -8.932  1.00 12.01 ? 167 4PS A C37 1 
HETATM 1380 C C38 . 4PS B 2 .   ? -27.825 31.351 -8.450  1.00 11.68 ? 167 4PS A C38 1 
HETATM 1381 C C39 . 4PS B 2 .   ? -29.264 31.603 -8.837  1.00 12.63 ? 167 4PS A C39 1 
HETATM 1382 O O40 . 4PS B 2 .   ? -29.947 32.399 -8.211  1.00 13.82 ? 167 4PS A O40 1 
HETATM 1383 N N41 . 4PS B 2 .   ? -29.753 30.910 -9.870  1.00 12.17 ? 167 4PS A N41 1 
HETATM 1384 C C42 . 4PS B 2 .   ? -31.108 31.141 -10.354 1.00 15.08 ? 167 4PS A C42 1 
HETATM 1385 C C43 . 4PS B 2 .   ? -31.095 32.068 -11.559 1.00 16.39 ? 167 4PS A C43 1 
HETATM 1386 S S44 . 4PS B 2 .   ? -32.788 32.283 -12.187 1.00 19.93 ? 167 4PS A S44 1 
HETATM 1387 N N9  . ADE C 3 .   ? -22.235 39.366 -21.509 1.00 31.13 ? 168 ADE A N9  1 
HETATM 1388 C C8  . ADE C 3 .   ? -21.412 38.449 -22.101 1.00 30.75 ? 168 ADE A C8  1 
HETATM 1389 N N7  . ADE C 3 .   ? -20.640 38.965 -23.030 1.00 30.53 ? 168 ADE A N7  1 
HETATM 1390 C C5  . ADE C 3 .   ? -20.978 40.309 -23.043 1.00 29.82 ? 168 ADE A C5  1 
HETATM 1391 C C6  . ADE C 3 .   ? -20.516 41.404 -23.808 1.00 29.46 ? 168 ADE A C6  1 
HETATM 1392 N N6  . ADE C 3 .   ? -19.574 41.286 -24.749 1.00 28.92 ? 168 ADE A N6  1 
HETATM 1393 N N1  . ADE C 3 .   ? -21.066 42.621 -23.573 1.00 29.65 ? 168 ADE A N1  1 
HETATM 1394 C C2  . ADE C 3 .   ? -22.019 42.731 -22.631 1.00 30.02 ? 168 ADE A C2  1 
HETATM 1395 N N3  . ADE C 3 .   ? -22.530 41.771 -21.856 1.00 29.95 ? 168 ADE A N3  1 
HETATM 1396 C C4  . ADE C 3 .   ? -21.963 40.577 -22.110 1.00 29.84 ? 168 ADE A C4  1 
HETATM 1397 O O2  . PG4 D 4 .   ? -11.475 31.774 -1.690  1.00 33.05 ? 169 PG4 A O2  1 
HETATM 1398 C C3  . PG4 D 4 .   ? -12.572 32.618 -2.023  1.00 30.36 ? 169 PG4 A C3  1 
HETATM 1399 C C4  . PG4 D 4 .   ? -13.232 32.231 -3.336  1.00 29.84 ? 169 PG4 A C4  1 
HETATM 1400 O O3  . PG4 D 4 .   ? -12.455 31.281 -4.054  1.00 27.17 ? 169 PG4 A O3  1 
HETATM 1401 C C5  . PG4 D 4 .   ? -13.078 29.994 -4.012  1.00 25.65 ? 169 PG4 A C5  1 
HETATM 1402 C C6  . PG4 D 4 .   ? -13.249 29.485 -5.435  1.00 26.02 ? 169 PG4 A C6  1 
HETATM 1403 O O4  . PG4 D 4 .   ? -14.555 29.735 -5.954  1.00 22.56 ? 169 PG4 A O4  1 
HETATM 1404 C C7  . PG4 D 4 .   ? -14.943 28.533 -6.631  1.00 22.80 ? 169 PG4 A C7  1 
HETATM 1405 C C8  . PG4 D 4 .   ? -15.512 28.804 -8.017  1.00 21.64 ? 169 PG4 A C8  1 
HETATM 1406 O O5  . PG4 D 4 .   ? -14.569 29.550 -8.785  1.00 18.95 ? 169 PG4 A O5  1 
HETATM 1407 C C   . ACT E 5 .   ? -19.841 33.986 -23.150 1.00 36.15 ? 170 ACT A C   1 
HETATM 1408 O O   . ACT E 5 .   ? -19.173 33.219 -22.417 1.00 36.10 ? 170 ACT A O   1 
HETATM 1409 O OXT . ACT E 5 .   ? -19.825 35.201 -22.842 1.00 36.25 ? 170 ACT A OXT 1 
HETATM 1410 C CH3 . ACT E 5 .   ? -20.609 33.485 -24.335 1.00 36.37 ? 170 ACT A CH3 1 
HETATM 1411 S S   . SO4 F 6 .   ? -25.052 36.046 -22.543 1.00 46.50 ? 171 SO4 A S   1 
HETATM 1412 O O1  . SO4 F 6 .   ? -23.802 35.325 -22.317 1.00 46.04 ? 171 SO4 A O1  1 
HETATM 1413 O O2  . SO4 F 6 .   ? -25.279 36.180 -23.978 1.00 46.36 ? 171 SO4 A O2  1 
HETATM 1414 O O3  . SO4 F 6 .   ? -26.167 35.300 -21.959 1.00 46.48 ? 171 SO4 A O3  1 
HETATM 1415 O O4  . SO4 F 6 .   ? -24.959 37.376 -21.940 1.00 45.66 ? 171 SO4 A O4  1 
HETATM 1416 O O   . HOH G 7 .   ? -22.570 28.072 -6.955  1.00 15.70 ? 172 HOH A O   1 
HETATM 1417 O O   . HOH G 7 .   ? -6.181  47.679 -16.923 1.00 17.99 ? 173 HOH A O   1 
HETATM 1418 O O   . HOH G 7 .   ? -33.109 38.076 -14.620 1.00 14.89 ? 174 HOH A O   1 
HETATM 1419 O O   . HOH G 7 .   ? -11.874 43.500 -18.969 1.00 9.86  ? 175 HOH A O   1 
HETATM 1420 O O   . HOH G 7 .   ? -37.093 39.249 -13.792 1.00 15.60 ? 176 HOH A O   1 
HETATM 1421 O O   . HOH G 7 .   ? -14.922 48.473 -21.962 1.00 12.46 ? 177 HOH A O   1 
HETATM 1422 O O   . HOH G 7 .   ? -8.062  43.103 -13.413 1.00 11.93 ? 178 HOH A O   1 
HETATM 1423 O O   . HOH G 7 .   ? -16.445 36.160 -19.199 1.00 18.73 ? 179 HOH A O   1 
HETATM 1424 O O   . HOH G 7 .   ? -13.798 39.099 -12.937 1.00 9.24  ? 180 HOH A O   1 
HETATM 1425 O O   . HOH G 7 .   ? -22.095 51.513 -30.139 1.00 24.71 ? 181 HOH A O   1 
HETATM 1426 O O   . HOH G 7 .   ? -6.798  40.585 -28.669 1.00 18.93 ? 182 HOH A O   1 
HETATM 1427 O O   . HOH G 7 .   ? -12.710 49.114 -23.451 1.00 13.49 ? 183 HOH A O   1 
HETATM 1428 O O   . HOH G 7 .   ? -18.038 34.924 -17.369 1.00 14.73 ? 184 HOH A O   1 
HETATM 1429 O O   . HOH G 7 .   ? -28.414 50.173 -23.017 1.00 16.47 ? 185 HOH A O   1 
HETATM 1430 O O   . HOH G 7 .   ? -29.431 32.020 -0.893  1.00 15.23 ? 186 HOH A O   1 
HETATM 1431 O O   . HOH G 7 .   ? -14.136 27.862 -20.617 1.00 42.23 ? 187 HOH A O   1 
HETATM 1432 O O   . HOH G 7 .   ? -16.623 51.595 -21.694 1.00 24.91 ? 188 HOH A O   1 
HETATM 1433 O O   . HOH G 7 .   ? 0.970   38.085 -15.662 1.00 13.10 ? 189 HOH A O   1 
HETATM 1434 O O   . HOH G 7 .   ? -16.870 27.893 -17.193 1.00 42.03 ? 190 HOH A O   1 
HETATM 1435 O O   . HOH G 7 .   ? -37.422 39.550 -11.048 1.00 20.66 ? 191 HOH A O   1 
HETATM 1436 O O   . HOH G 7 .   ? -31.969 37.478 -17.458 1.00 15.47 ? 192 HOH A O   1 
HETATM 1437 O O   . HOH G 7 .   ? -18.241 36.915 -21.317 1.00 24.11 ? 193 HOH A O   1 
HETATM 1438 O O   . HOH G 7 .   ? -10.259 51.078 -11.025 1.00 20.22 ? 194 HOH A O   1 
HETATM 1439 O O   . HOH G 7 .   ? -3.728  42.801 -12.803 1.00 17.15 ? 195 HOH A O   1 
HETATM 1440 O O   . HOH G 7 .   ? -38.577 41.369 -15.012 1.00 18.33 ? 196 HOH A O   1 
HETATM 1441 O O   . HOH G 7 .   ? -17.941 39.214 -22.666 1.00 22.14 ? 197 HOH A O   1 
HETATM 1442 O O   . HOH G 7 .   ? -26.841 34.807 -2.358  1.00 24.07 ? 198 HOH A O   1 
HETATM 1443 O O   . HOH G 7 .   ? 1.700   39.989 -17.514 1.00 9.54  ? 199 HOH A O   1 
HETATM 1444 O O   . HOH G 7 .   ? -16.822 30.271 -16.455 1.00 21.80 ? 200 HOH A O   1 
HETATM 1445 O O   . HOH G 7 .   ? -22.418 28.201 -4.261  1.00 19.58 ? 201 HOH A O   1 
HETATM 1446 O O   . HOH G 7 .   ? -32.280 55.580 -11.319 1.00 20.03 ? 202 HOH A O   1 
HETATM 1447 O O   . HOH G 7 .   ? -0.144  40.702 -19.343 1.00 17.62 ? 203 HOH A O   1 
HETATM 1448 O O   . HOH G 7 .   ? -17.233 42.600 -30.527 1.00 19.78 ? 204 HOH A O   1 
HETATM 1449 O O   . HOH G 7 .   ? -16.611 47.539 -4.368  1.00 27.57 ? 205 HOH A O   1 
HETATM 1450 O O   . HOH G 7 .   ? -3.453  35.783 -23.093 1.00 32.57 ? 206 HOH A O   1 
HETATM 1451 O O   . HOH G 7 .   ? -24.194 32.289 -6.090  1.00 9.70  ? 207 HOH A O   1 
HETATM 1452 O O   . HOH G 7 .   ? -22.658 34.901 -0.240  1.00 21.11 ? 208 HOH A O   1 
HETATM 1453 O O   . HOH G 7 .   ? -7.678  47.866 -14.760 1.00 23.15 ? 209 HOH A O   1 
HETATM 1454 O O   . HOH G 7 .   ? -33.535 50.186 -4.968  1.00 21.01 ? 210 HOH A O   1 
HETATM 1455 O O   . HOH G 7 .   ? -15.593 52.099 -25.057 1.00 35.94 ? 211 HOH A O   1 
HETATM 1456 O O   . HOH G 7 .   ? -23.537 30.411 -7.904  1.00 12.12 ? 212 HOH A O   1 
HETATM 1457 O O   . HOH G 7 .   ? -23.271 26.495 -9.294  1.00 26.56 ? 213 HOH A O   1 
HETATM 1458 O O   . HOH G 7 .   ? -24.405 30.583 -10.544 1.00 16.80 ? 214 HOH A O   1 
HETATM 1459 O O   . HOH G 7 .   ? -16.818 27.367 -4.226  1.00 23.28 ? 215 HOH A O   1 
HETATM 1460 O O   . HOH G 7 .   ? -8.213  31.765 -4.898  1.00 19.50 ? 216 HOH A O   1 
HETATM 1461 O O   . HOH G 7 .   ? -24.155 38.702 0.159   1.00 32.92 ? 217 HOH A O   1 
HETATM 1462 O O   . HOH G 7 .   ? -21.419 39.032 -0.200  1.00 33.47 ? 218 HOH A O   1 
HETATM 1463 O O   . HOH G 7 .   ? -35.458 44.006 -3.443  1.00 20.82 ? 219 HOH A O   1 
HETATM 1464 O O   . HOH G 7 .   ? -1.418  43.264 -19.583 1.00 18.50 ? 220 HOH A O   1 
HETATM 1465 O O   . HOH G 7 .   ? -2.606  43.833 -22.038 1.00 25.20 ? 221 HOH A O   1 
HETATM 1466 O O   . HOH G 7 .   ? -4.726  46.909 -24.328 1.00 21.66 ? 222 HOH A O   1 
HETATM 1467 O O   . HOH G 7 .   ? -20.707 56.060 -15.611 1.00 38.43 ? 223 HOH A O   1 
HETATM 1468 O O   . HOH G 7 .   ? -26.115 57.748 -11.606 1.00 25.03 ? 224 HOH A O   1 
HETATM 1469 O O   . HOH G 7 .   ? -12.627 28.032 -9.901  1.00 24.54 ? 225 HOH A O   1 
HETATM 1470 O O   . HOH G 7 .   ? -15.194 44.898 -3.413  1.00 34.17 ? 226 HOH A O   1 
HETATM 1471 O O   . HOH G 7 .   ? -23.257 28.923 0.136   1.00 19.34 ? 227 HOH A O   1 
HETATM 1472 O O   . HOH G 7 .   ? -26.441 37.229 -0.924  1.00 24.73 ? 228 HOH A O   1 
HETATM 1473 O O   . HOH G 7 .   ? -38.921 36.445 -20.024 1.00 28.72 ? 229 HOH A O   1 
HETATM 1474 O O   . HOH G 7 .   ? -40.795 41.403 -12.443 1.00 17.33 ? 230 HOH A O   1 
HETATM 1475 O O   . HOH G 7 .   ? -44.168 40.588 -11.716 1.00 24.55 ? 231 HOH A O   1 
HETATM 1476 O O   . HOH G 7 .   ? -32.474 33.841 -8.143  1.00 25.46 ? 232 HOH A O   1 
HETATM 1477 O O   . HOH G 7 .   ? -28.713 58.584 -11.764 1.00 39.35 ? 233 HOH A O   1 
HETATM 1478 O O   . HOH G 7 .   ? -23.502 54.418 -4.533  1.00 28.01 ? 234 HOH A O   1 
HETATM 1479 O O   . HOH G 7 .   ? -11.492 41.848 -4.119  1.00 22.08 ? 235 HOH A O   1 
HETATM 1480 O O   . HOH G 7 .   ? -21.579 32.971 1.704   1.00 19.35 ? 236 HOH A O   1 
HETATM 1481 O O   . HOH G 7 .   ? -12.026 27.731 -18.953 1.00 35.15 ? 237 HOH A O   1 
HETATM 1482 O O   . HOH G 7 .   ? -18.521 32.199 -17.399 1.00 26.82 ? 238 HOH A O   1 
HETATM 1483 O O   . HOH G 7 .   ? -4.697  34.103 -6.743  1.00 23.69 ? 239 HOH A O   1 
HETATM 1484 O O   . HOH G 7 .   ? -3.163  47.992 -16.016 1.00 37.21 ? 240 HOH A O   1 
HETATM 1485 O O   . HOH G 7 .   ? -9.339  28.382 -8.894  1.00 35.23 ? 241 HOH A O   1 
HETATM 1486 O O   . HOH G 7 .   ? -14.595 55.262 -6.194  1.00 40.20 ? 242 HOH A O   1 
HETATM 1487 O O   . HOH G 7 .   ? -13.127 28.152 -23.063 1.00 24.23 ? 243 HOH A O   1 
HETATM 1488 O O   . HOH G 7 .   ? -8.662  48.071 -27.262 1.00 37.66 ? 244 HOH A O   1 
HETATM 1489 O O   . HOH G 7 .   ? -11.206 46.511 -27.779 1.00 28.97 ? 245 HOH A O   1 
HETATM 1490 O O   . HOH G 7 .   ? -11.853 51.633 -22.880 1.00 29.94 ? 246 HOH A O   1 
HETATM 1491 O O   . HOH G 7 .   ? -20.175 57.298 -19.393 1.00 38.62 ? 247 HOH A O   1 
HETATM 1492 O O   . HOH G 7 .   ? -20.462 55.739 -12.408 1.00 32.19 ? 248 HOH A O   1 
HETATM 1493 O O   . HOH G 7 .   ? -27.481 59.302 -7.340  1.00 36.28 ? 249 HOH A O   1 
HETATM 1494 O O   . HOH G 7 .   ? -8.490  44.108 -6.558  1.00 25.34 ? 250 HOH A O   1 
HETATM 1495 O O   . HOH G 7 .   ? -9.505  43.555 -4.348  1.00 29.88 ? 251 HOH A O   1 
HETATM 1496 O O   . HOH G 7 .   ? -8.282  47.112 -6.773  1.00 37.78 ? 252 HOH A O   1 
HETATM 1497 O O   . HOH G 7 .   ? -6.062  43.512 -6.657  1.00 32.08 ? 253 HOH A O   1 
HETATM 1498 O O   . HOH G 7 .   ? -3.210  42.241 -9.057  1.00 27.94 ? 254 HOH A O   1 
HETATM 1499 O O   . HOH G 7 .   ? -2.487  45.099 -12.887 1.00 27.07 ? 255 HOH A O   1 
HETATM 1500 O O   . HOH G 7 .   ? -16.166 50.088 -7.660  1.00 30.09 ? 256 HOH A O   1 
HETATM 1501 O O   . HOH G 7 .   ? -16.167 42.422 -2.626  1.00 32.62 ? 257 HOH A O   1 
HETATM 1502 O O   . HOH G 7 .   ? -31.766 38.160 1.195   1.00 19.82 ? 258 HOH A O   1 
HETATM 1503 O O   . HOH G 7 .   ? -32.058 40.435 2.835   1.00 24.15 ? 259 HOH A O   1 
HETATM 1504 O O   . HOH G 7 .   ? -32.543 44.389 2.745   1.00 31.12 ? 260 HOH A O   1 
HETATM 1505 O O   . HOH G 7 .   ? -29.763 43.701 3.711   1.00 24.46 ? 261 HOH A O   1 
HETATM 1506 O O   . HOH G 7 .   ? -30.100 35.023 -12.690 1.00 20.77 ? 262 HOH A O   1 
HETATM 1507 O O   . HOH G 7 .   ? -21.007 53.594 -28.282 1.00 39.78 ? 263 HOH A O   1 
HETATM 1508 O O   . HOH G 7 .   ? -20.599 52.290 -33.443 1.00 44.37 ? 264 HOH A O   1 
HETATM 1509 O O   . HOH G 7 .   ? -15.010 27.559 -28.779 1.00 35.74 ? 265 HOH A O   1 
HETATM 1510 O O   . HOH G 7 .   ? -13.341 28.744 -30.413 1.00 32.66 ? 266 HOH A O   1 
HETATM 1511 O O   . HOH G 7 .   ? -5.660  44.749 -22.572 1.00 20.93 ? 267 HOH A O   1 
HETATM 1512 O O   . HOH G 7 .   ? -26.973 59.296 -17.473 1.00 28.72 ? 268 HOH A O   1 
HETATM 1513 O O   . HOH G 7 .   ? -26.383 52.500 -1.993  1.00 33.45 ? 269 HOH A O   1 
HETATM 1514 O O   . HOH G 7 .   ? -25.163 58.016 -7.584  1.00 33.10 ? 270 HOH A O   1 
HETATM 1515 O O   . HOH G 7 .   ? -21.695 47.813 1.104   1.00 38.24 ? 271 HOH A O   1 
HETATM 1516 O O   . HOH G 7 .   ? -35.198 44.475 -0.791  1.00 31.08 ? 272 HOH A O   1 
HETATM 1517 O O   . HOH G 7 .   ? -19.999 28.066 -2.766  1.00 39.36 ? 273 HOH A O   1 
HETATM 1518 O O   . HOH G 7 .   ? -21.181 27.040 -0.781  1.00 40.22 ? 274 HOH A O   1 
HETATM 1519 O O   . HOH G 7 .   ? -22.979 25.484 -3.455  1.00 34.88 ? 275 HOH A O   1 
HETATM 1520 O O   . HOH G 7 .   ? -8.691  26.784 -12.924 1.00 28.76 ? 276 HOH A O   1 
HETATM 1521 O O   . HOH G 7 .   ? -11.164 39.196 -3.469  1.00 19.27 ? 277 HOH A O   1 
HETATM 1522 O O   . HOH G 7 .   ? -12.953 51.058 -16.288 1.00 21.24 ? 278 HOH A O   1 
HETATM 1523 O O   . HOH G 7 .   ? -10.397 50.507 -15.567 1.00 26.44 ? 279 HOH A O   1 
HETATM 1524 O O   . HOH G 7 .   ? -5.436  48.248 -12.673 1.00 40.11 ? 280 HOH A O   1 
HETATM 1525 O O   . HOH G 7 .   ? -9.374  49.991 -8.290  1.00 37.38 ? 281 HOH A O   1 
HETATM 1526 O O   . HOH G 7 .   ? -8.317  53.046 -11.988 1.00 37.57 ? 282 HOH A O   1 
HETATM 1527 O O   . HOH G 7 .   ? -6.088  47.296 -26.850 1.00 37.58 ? 283 HOH A O   1 
HETATM 1528 O O   . HOH G 7 .   ? -1.428  42.635 -24.437 1.00 32.46 ? 284 HOH A O   1 
HETATM 1529 O O   . HOH G 7 .   ? -1.143  44.633 -25.651 1.00 25.99 ? 285 HOH A O   1 
HETATM 1530 O O   . HOH G 7 .   ? -25.452 28.396 -1.062  1.00 35.87 ? 286 HOH A O   1 
HETATM 1531 O O   . HOH G 7 .   ? -42.080 33.059 -16.420 1.00 24.10 ? 287 HOH A O   1 
HETATM 1532 O O   . HOH G 7 .   ? -22.930 53.415 -32.087 1.00 33.17 ? 288 HOH A O   1 
HETATM 1533 O O   . HOH G 7 .   ? -21.936 55.945 -29.088 1.00 37.95 ? 289 HOH A O   1 
HETATM 1534 O O   . HOH G 7 .   ? -8.488  25.863 -24.675 1.00 38.23 ? 290 HOH A O   1 
HETATM 1535 O O   . HOH G 7 .   ? -6.926  23.767 -24.172 1.00 36.81 ? 291 HOH A O   1 
HETATM 1536 O O   . HOH G 7 .   ? -14.098 52.993 -19.435 1.00 35.54 ? 292 HOH A O   1 
HETATM 1537 O O   . HOH G 7 .   ? -15.772 24.564 -9.320  1.00 38.00 ? 293 HOH A O   1 
HETATM 1538 O O   . HOH G 7 .   ? -7.363  42.733 -2.795  1.00 36.83 ? 294 HOH A O   1 
HETATM 1539 O O   . HOH G 7 .   ? -16.100 52.365 -6.006  1.00 45.26 ? 295 HOH A O   1 
HETATM 1540 O O   . HOH G 7 .   ? -18.299 46.219 -2.220  1.00 32.80 ? 296 HOH A O   1 
HETATM 1541 O O   . HOH G 7 .   ? -34.265 37.236 0.136   1.00 38.57 ? 297 HOH A O   1 
HETATM 1542 O O   . HOH G 7 .   ? -41.681 46.744 -10.300 1.00 35.58 ? 298 HOH A O   1 
HETATM 1543 O O   . HOH G 7 .   ? -12.440 47.805 -29.562 1.00 41.39 ? 299 HOH A O   1 
HETATM 1544 O O   . HOH G 7 .   ? -20.207 58.161 -28.466 1.00 39.14 ? 300 HOH A O   1 
HETATM 1545 O O   . HOH G 7 .   ? -23.119 39.781 -16.623 1.00 25.19 ? 301 HOH A O   1 
HETATM 1546 O O   . HOH G 7 .   ? -35.848 56.855 -2.682  1.00 36.77 ? 302 HOH A O   1 
HETATM 1547 O O   . HOH G 7 .   ? -4.582  45.561 -28.039 1.00 43.34 ? 303 HOH A O   1 
HETATM 1548 O O   . HOH G 7 .   ? -2.991  36.626 -3.066  1.00 38.49 ? 304 HOH A O   1 
HETATM 1549 O O   . HOH G 7 .   ? -44.642 34.726 -7.831  1.00 29.99 ? 305 HOH A O   1 
HETATM 1550 O O   . HOH G 7 .   ? -23.264 39.545 -19.300 1.00 43.07 ? 306 HOH A O   1 
HETATM 1551 O O   . HOH G 7 .   ? -25.781 38.666 -19.908 1.00 38.40 ? 307 HOH A O   1 
HETATM 1552 O O   . HOH G 7 .   ? -25.451 40.475 -18.382 1.00 21.54 ? 308 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -20 ?   ?   ?   A . n 
A 1 2   ALA 2   -19 ?   ?   ?   A . n 
A 1 3   HIS 3   -18 ?   ?   ?   A . n 
A 1 4   HIS 4   -17 ?   ?   ?   A . n 
A 1 5   HIS 5   -16 ?   ?   ?   A . n 
A 1 6   HIS 6   -15 ?   ?   ?   A . n 
A 1 7   HIS 7   -14 ?   ?   ?   A . n 
A 1 8   HIS 8   -13 ?   ?   ?   A . n 
A 1 9   MET 9   -12 ?   ?   ?   A . n 
A 1 10  GLY 10  -11 ?   ?   ?   A . n 
A 1 11  THR 11  -10 ?   ?   ?   A . n 
A 1 12  LEU 12  -9  ?   ?   ?   A . n 
A 1 13  GLU 13  -8  ?   ?   ?   A . n 
A 1 14  ALA 14  -7  ?   ?   ?   A . n 
A 1 15  GLN 15  -6  ?   ?   ?   A . n 
A 1 16  THR 16  -5  ?   ?   ?   A . n 
A 1 17  GLN 17  -4  ?   ?   ?   A . n 
A 1 18  GLY 18  -3  ?   ?   ?   A . n 
A 1 19  PRO 19  -2  ?   ?   ?   A . n 
A 1 20  GLY 20  -1  -1  GLY GLY A . n 
A 1 21  SER 21  0   0   SER SER A . n 
A 1 22  MET 22  1   1   MET MET A . n 
A 1 23  VAL 23  2   2   VAL VAL A . n 
A 1 24  VAL 24  3   3   VAL VAL A . n 
A 1 25  ALA 25  4   4   ALA ALA A . n 
A 1 26  VAL 26  5   5   VAL VAL A . n 
A 1 27  TYR 27  6   6   TYR TYR A . n 
A 1 28  PRO 28  7   7   PRO PRO A . n 
A 1 29  GLY 29  8   8   GLY GLY A . n 
A 1 30  THR 30  9   9   THR THR A . n 
A 1 31  PHE 31  10  10  PHE PHE A . n 
A 1 32  ASP 32  11  11  ASP ASP A . n 
A 1 33  PRO 33  12  12  PRO PRO A . n 
A 1 34  LEU 34  13  13  LEU LEU A . n 
A 1 35  THR 35  14  14  THR THR A . n 
A 1 36  ARG 36  15  15  ARG ARG A . n 
A 1 37  GLY 37  16  16  GLY GLY A . n 
A 1 38  HIS 38  17  17  HIS HIS A . n 
A 1 39  GLU 39  18  18  GLU GLU A . n 
A 1 40  ASP 40  19  19  ASP ASP A . n 
A 1 41  LEU 41  20  20  LEU LEU A . n 
A 1 42  VAL 42  21  21  VAL VAL A . n 
A 1 43  ARG 43  22  22  ARG ARG A . n 
A 1 44  ARG 44  23  23  ARG ARG A . n 
A 1 45  ALA 45  24  24  ALA ALA A . n 
A 1 46  SER 46  25  25  SER SER A . n 
A 1 47  SER 47  26  26  SER SER A . n 
A 1 48  ILE 48  27  27  ILE ILE A . n 
A 1 49  PHE 49  28  28  PHE PHE A . n 
A 1 50  ASP 50  29  29  ASP ASP A . n 
A 1 51  THR 51  30  30  THR THR A . n 
A 1 52  LEU 52  31  31  LEU LEU A . n 
A 1 53  VAL 53  32  32  VAL VAL A . n 
A 1 54  VAL 54  33  33  VAL VAL A . n 
A 1 55  GLY 55  34  34  GLY GLY A . n 
A 1 56  VAL 56  35  35  VAL VAL A . n 
A 1 57  ALA 57  36  36  ALA ALA A . n 
A 1 58  ASP 58  37  37  ASP ASP A . n 
A 1 59  SER 59  38  38  SER SER A . n 
A 1 60  ARG 60  39  39  ARG ARG A . n 
A 1 61  ALA 61  40  40  ALA ALA A . n 
A 1 62  LYS 62  41  41  LYS LYS A . n 
A 1 63  LYS 63  42  42  LYS LYS A . n 
A 1 64  PRO 64  43  43  PRO PRO A . n 
A 1 65  PHE 65  44  44  PHE PHE A . n 
A 1 66  PHE 66  45  45  PHE PHE A . n 
A 1 67  SER 67  46  46  SER SER A . n 
A 1 68  LEU 68  47  47  LEU LEU A . n 
A 1 69  GLU 69  48  48  GLU GLU A . n 
A 1 70  GLU 70  49  49  GLU GLU A . n 
A 1 71  ARG 71  50  50  ARG ARG A . n 
A 1 72  LEU 72  51  51  LEU LEU A . n 
A 1 73  LYS 73  52  52  LYS LYS A . n 
A 1 74  ILE 74  53  53  ILE ILE A . n 
A 1 75  ALA 75  54  54  ALA ALA A . n 
A 1 76  ASN 76  55  55  ASN ASN A . n 
A 1 77  GLU 77  56  56  GLU GLU A . n 
A 1 78  VAL 78  57  57  VAL VAL A . n 
A 1 79  LEU 79  58  58  LEU LEU A . n 
A 1 80  GLY 80  59  59  GLY GLY A . n 
A 1 81  HIS 81  60  60  HIS HIS A . n 
A 1 82  TYR 82  61  61  TYR TYR A . n 
A 1 83  PRO 83  62  62  PRO PRO A . n 
A 1 84  ASN 84  63  63  ASN ASN A . n 
A 1 85  VAL 85  64  64  VAL VAL A . n 
A 1 86  LYS 86  65  65  LYS LYS A . n 
A 1 87  VAL 87  66  66  VAL VAL A . n 
A 1 88  MET 88  67  67  MET MET A . n 
A 1 89  GLY 89  68  68  GLY GLY A . n 
A 1 90  PHE 90  69  69  PHE PHE A . n 
A 1 91  THR 91  70  70  THR THR A . n 
A 1 92  GLY 92  71  71  GLY GLY A . n 
A 1 93  LEU 93  72  72  LEU LEU A . n 
A 1 94  LEU 94  73  73  LEU LEU A . n 
A 1 95  LYS 95  74  74  LYS LYS A . n 
A 1 96  ASP 96  75  75  ASP ASP A . n 
A 1 97  PHE 97  76  76  PHE PHE A . n 
A 1 98  VAL 98  77  77  VAL VAL A . n 
A 1 99  ARG 99  78  78  ARG ARG A . n 
A 1 100 ALA 100 79  79  ALA ALA A . n 
A 1 101 ASN 101 80  80  ASN ASN A . n 
A 1 102 ASP 102 81  81  ASP ASP A . n 
A 1 103 ALA 103 82  82  ALA ALA A . n 
A 1 104 ARG 104 83  83  ARG ARG A . n 
A 1 105 VAL 105 84  84  VAL VAL A . n 
A 1 106 ILE 106 85  85  ILE ILE A . n 
A 1 107 VAL 107 86  86  VAL VAL A . n 
A 1 108 ARG 108 87  87  ARG ARG A . n 
A 1 109 GLY 109 88  88  GLY GLY A . n 
A 1 110 LEU 110 89  89  LEU LEU A . n 
A 1 111 ARG 111 90  90  ARG ARG A . n 
A 1 112 ALA 112 91  91  ALA ALA A . n 
A 1 113 VAL 113 92  92  VAL VAL A . n 
A 1 114 SER 114 93  93  SER SER A . n 
A 1 115 ASP 115 94  94  ASP ASP A . n 
A 1 116 PHE 116 95  95  PHE PHE A . n 
A 1 117 GLU 117 96  96  GLU GLU A . n 
A 1 118 TYR 118 97  97  TYR TYR A . n 
A 1 119 GLU 119 98  98  GLU GLU A . n 
A 1 120 PHE 120 99  99  PHE PHE A . n 
A 1 121 GLN 121 100 100 GLN GLN A . n 
A 1 122 MET 122 101 101 MET MET A . n 
A 1 123 ALA 123 102 102 ALA ALA A . n 
A 1 124 GLY 124 103 103 GLY GLY A . n 
A 1 125 MET 125 104 104 MET MET A . n 
A 1 126 ASN 126 105 105 ASN ASN A . n 
A 1 127 ARG 127 106 106 ARG ARG A . n 
A 1 128 TYR 128 107 107 TYR TYR A . n 
A 1 129 LEU 129 108 108 LEU LEU A . n 
A 1 130 LEU 130 109 109 LEU LEU A . n 
A 1 131 PRO 131 110 110 PRO PRO A . n 
A 1 132 ASP 132 111 111 ASP ASP A . n 
A 1 133 VAL 133 112 112 VAL VAL A . n 
A 1 134 GLU 134 113 113 GLU GLU A . n 
A 1 135 THR 135 114 114 THR THR A . n 
A 1 136 MET 136 115 115 MET MET A . n 
A 1 137 PHE 137 116 116 PHE PHE A . n 
A 1 138 MET 138 117 117 MET MET A . n 
A 1 139 THR 139 118 118 THR THR A . n 
A 1 140 PRO 140 119 119 PRO PRO A . n 
A 1 141 SER 141 120 120 SER SER A . n 
A 1 142 ASP 142 121 121 ASP ASP A . n 
A 1 143 GLN 143 122 122 GLN GLN A . n 
A 1 144 TYR 144 123 123 TYR TYR A . n 
A 1 145 GLN 145 124 124 GLN GLN A . n 
A 1 146 PHE 146 125 125 PHE PHE A . n 
A 1 147 ILE 147 126 126 ILE ILE A . n 
A 1 148 SER 148 127 127 SER SER A . n 
A 1 149 GLY 149 128 128 GLY GLY A . n 
A 1 150 THR 150 129 129 THR THR A . n 
A 1 151 ILE 151 130 130 ILE ILE A . n 
A 1 152 VAL 152 131 131 VAL VAL A . n 
A 1 153 ARG 153 132 132 ARG ARG A . n 
A 1 154 GLU 154 133 133 GLU GLU A . n 
A 1 155 ILE 155 134 134 ILE ILE A . n 
A 1 156 ALA 156 135 135 ALA ALA A . n 
A 1 157 GLN 157 136 136 GLN GLN A . n 
A 1 158 LEU 158 137 137 LEU LEU A . n 
A 1 159 GLY 159 138 138 GLY GLY A . n 
A 1 160 GLY 160 139 139 GLY GLY A . n 
A 1 161 ASP 161 140 140 ASP ASP A . n 
A 1 162 VAL 162 141 141 VAL VAL A . n 
A 1 163 SER 163 142 142 SER SER A . n 
A 1 164 LYS 164 143 143 LYS LYS A . n 
A 1 165 PHE 165 144 144 PHE PHE A . n 
A 1 166 VAL 166 145 145 VAL VAL A . n 
A 1 167 PHE 167 146 146 PHE PHE A . n 
A 1 168 PRO 168 147 147 PRO PRO A . n 
A 1 169 SER 169 148 148 SER SER A . n 
A 1 170 VAL 170 149 149 VAL VAL A . n 
A 1 171 GLU 171 150 150 GLU GLU A . n 
A 1 172 LYS 172 151 151 LYS LYS A . n 
A 1 173 TRP 173 152 152 TRP TRP A . n 
A 1 174 LEU 174 153 153 LEU LEU A . n 
A 1 175 THR 175 154 154 THR THR A . n 
A 1 176 GLU 176 155 155 GLU GLU A . n 
A 1 177 LYS 177 156 156 LYS LYS A . n 
A 1 178 VAL 178 157 157 VAL VAL A . n 
A 1 179 ALA 179 158 158 ALA ALA A . n 
A 1 180 ALA 180 159 159 ALA ALA A . n 
A 1 181 MET 181 160 160 MET MET A . n 
A 1 182 ALA 182 161 161 ALA ALA A . n 
A 1 183 GLN 183 162 ?   ?   ?   A . n 
A 1 184 GLY 184 163 ?   ?   ?   A . n 
A 1 185 PRO 185 164 ?   ?   ?   A . n 
A 1 186 SER 186 165 ?   ?   ?   A . n 
A 1 187 ALA 187 166 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Seattle Structural Genomics Center for Infectious Disease' 
_pdbx_SG_project.initial_of_center     SSGCID 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 4PS 1   167 167 4PS 4PS A . 
C 3 ADE 1   168 168 ADE ADE A . 
D 4 PG4 1   169 169 PG4 PG4 A . 
E 5 ACT 1   170 170 ACT ACT A . 
F 6 SO4 1   171 171 SO4 SO4 A . 
G 7 HOH 1   172 172 HOH HOH A . 
G 7 HOH 2   173 173 HOH HOH A . 
G 7 HOH 3   174 174 HOH HOH A . 
G 7 HOH 4   175 175 HOH HOH A . 
G 7 HOH 5   176 176 HOH HOH A . 
G 7 HOH 6   177 177 HOH HOH A . 
G 7 HOH 7   178 178 HOH HOH A . 
G 7 HOH 8   179 179 HOH HOH A . 
G 7 HOH 9   180 180 HOH HOH A . 
G 7 HOH 10  181 181 HOH HOH A . 
G 7 HOH 11  182 182 HOH HOH A . 
G 7 HOH 12  183 183 HOH HOH A . 
G 7 HOH 13  184 184 HOH HOH A . 
G 7 HOH 14  185 185 HOH HOH A . 
G 7 HOH 15  186 186 HOH HOH A . 
G 7 HOH 16  187 187 HOH HOH A . 
G 7 HOH 17  188 188 HOH HOH A . 
G 7 HOH 18  189 189 HOH HOH A . 
G 7 HOH 19  190 190 HOH HOH A . 
G 7 HOH 20  191 191 HOH HOH A . 
G 7 HOH 21  192 192 HOH HOH A . 
G 7 HOH 22  193 193 HOH HOH A . 
G 7 HOH 23  194 194 HOH HOH A . 
G 7 HOH 24  195 195 HOH HOH A . 
G 7 HOH 25  196 196 HOH HOH A . 
G 7 HOH 26  197 197 HOH HOH A . 
G 7 HOH 27  198 198 HOH HOH A . 
G 7 HOH 28  199 199 HOH HOH A . 
G 7 HOH 29  200 200 HOH HOH A . 
G 7 HOH 30  201 201 HOH HOH A . 
G 7 HOH 31  202 202 HOH HOH A . 
G 7 HOH 32  203 203 HOH HOH A . 
G 7 HOH 33  204 204 HOH HOH A . 
G 7 HOH 34  205 205 HOH HOH A . 
G 7 HOH 35  206 206 HOH HOH A . 
G 7 HOH 36  207 207 HOH HOH A . 
G 7 HOH 37  208 208 HOH HOH A . 
G 7 HOH 38  209 209 HOH HOH A . 
G 7 HOH 39  210 210 HOH HOH A . 
G 7 HOH 40  211 211 HOH HOH A . 
G 7 HOH 41  212 212 HOH HOH A . 
G 7 HOH 42  213 213 HOH HOH A . 
G 7 HOH 43  214 214 HOH HOH A . 
G 7 HOH 44  215 215 HOH HOH A . 
G 7 HOH 45  216 216 HOH HOH A . 
G 7 HOH 46  217 217 HOH HOH A . 
G 7 HOH 47  218 218 HOH HOH A . 
G 7 HOH 48  219 219 HOH HOH A . 
G 7 HOH 49  220 220 HOH HOH A . 
G 7 HOH 50  221 221 HOH HOH A . 
G 7 HOH 51  222 222 HOH HOH A . 
G 7 HOH 52  223 223 HOH HOH A . 
G 7 HOH 53  224 224 HOH HOH A . 
G 7 HOH 54  225 225 HOH HOH A . 
G 7 HOH 55  226 226 HOH HOH A . 
G 7 HOH 56  227 227 HOH HOH A . 
G 7 HOH 57  228 228 HOH HOH A . 
G 7 HOH 58  229 229 HOH HOH A . 
G 7 HOH 59  230 230 HOH HOH A . 
G 7 HOH 60  231 231 HOH HOH A . 
G 7 HOH 61  232 232 HOH HOH A . 
G 7 HOH 62  233 233 HOH HOH A . 
G 7 HOH 63  234 234 HOH HOH A . 
G 7 HOH 64  235 235 HOH HOH A . 
G 7 HOH 65  236 236 HOH HOH A . 
G 7 HOH 66  237 237 HOH HOH A . 
G 7 HOH 67  238 238 HOH HOH A . 
G 7 HOH 68  239 239 HOH HOH A . 
G 7 HOH 69  240 240 HOH HOH A . 
G 7 HOH 70  241 241 HOH HOH A . 
G 7 HOH 71  242 242 HOH HOH A . 
G 7 HOH 72  243 243 HOH HOH A . 
G 7 HOH 73  244 244 HOH HOH A . 
G 7 HOH 74  245 245 HOH HOH A . 
G 7 HOH 75  246 246 HOH HOH A . 
G 7 HOH 76  247 247 HOH HOH A . 
G 7 HOH 77  248 248 HOH HOH A . 
G 7 HOH 78  249 249 HOH HOH A . 
G 7 HOH 79  250 250 HOH HOH A . 
G 7 HOH 80  251 251 HOH HOH A . 
G 7 HOH 81  252 252 HOH HOH A . 
G 7 HOH 82  253 253 HOH HOH A . 
G 7 HOH 83  254 254 HOH HOH A . 
G 7 HOH 84  255 255 HOH HOH A . 
G 7 HOH 85  256 256 HOH HOH A . 
G 7 HOH 86  257 257 HOH HOH A . 
G 7 HOH 87  258 258 HOH HOH A . 
G 7 HOH 88  259 259 HOH HOH A . 
G 7 HOH 89  260 260 HOH HOH A . 
G 7 HOH 90  261 261 HOH HOH A . 
G 7 HOH 91  262 262 HOH HOH A . 
G 7 HOH 92  263 263 HOH HOH A . 
G 7 HOH 93  264 264 HOH HOH A . 
G 7 HOH 94  265 265 HOH HOH A . 
G 7 HOH 95  266 266 HOH HOH A . 
G 7 HOH 96  267 267 HOH HOH A . 
G 7 HOH 97  268 268 HOH HOH A . 
G 7 HOH 98  269 269 HOH HOH A . 
G 7 HOH 99  270 270 HOH HOH A . 
G 7 HOH 100 271 271 HOH HOH A . 
G 7 HOH 101 272 272 HOH HOH A . 
G 7 HOH 102 273 273 HOH HOH A . 
G 7 HOH 103 274 274 HOH HOH A . 
G 7 HOH 104 275 275 HOH HOH A . 
G 7 HOH 105 276 276 HOH HOH A . 
G 7 HOH 106 277 277 HOH HOH A . 
G 7 HOH 107 278 278 HOH HOH A . 
G 7 HOH 108 279 279 HOH HOH A . 
G 7 HOH 109 280 280 HOH HOH A . 
G 7 HOH 110 281 281 HOH HOH A . 
G 7 HOH 111 282 282 HOH HOH A . 
G 7 HOH 112 283 283 HOH HOH A . 
G 7 HOH 113 284 284 HOH HOH A . 
G 7 HOH 114 285 285 HOH HOH A . 
G 7 HOH 115 286 286 HOH HOH A . 
G 7 HOH 116 287 287 HOH HOH A . 
G 7 HOH 117 288 288 HOH HOH A . 
G 7 HOH 118 289 289 HOH HOH A . 
G 7 HOH 119 290 290 HOH HOH A . 
G 7 HOH 120 291 291 HOH HOH A . 
G 7 HOH 121 292 292 HOH HOH A . 
G 7 HOH 122 293 293 HOH HOH A . 
G 7 HOH 123 294 294 HOH HOH A . 
G 7 HOH 124 295 295 HOH HOH A . 
G 7 HOH 125 296 296 HOH HOH A . 
G 7 HOH 126 297 297 HOH HOH A . 
G 7 HOH 127 298 298 HOH HOH A . 
G 7 HOH 128 299 299 HOH HOH A . 
G 7 HOH 129 300 300 HOH HOH A . 
G 7 HOH 130 301 301 HOH HOH A . 
G 7 HOH 131 302 302 HOH HOH A . 
G 7 HOH 132 303 303 HOH HOH A . 
G 7 HOH 133 304 304 HOH HOH A . 
G 7 HOH 134 305 305 HOH HOH A . 
G 7 HOH 135 306 306 HOH HOH A . 
G 7 HOH 136 307 307 HOH HOH A . 
G 7 HOH 137 308 308 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 24420 ? 
1 MORE         -163  ? 
1 'SSA (A^2)'  34090 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z                1.0000000000  0.0000000000  0.0000000000  0.0000000000   0.0000000000  
1.0000000000  0.0000000000  0.0000000000  0.0000000000  0.0000000000  1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_555  z,-x,-y              0.0000000000  0.0000000000  1.0000000000  0.0000000000   -1.0000000000 
0.0000000000  0.0000000000  0.0000000000  0.0000000000  -1.0000000000 0.0000000000  0.0000000000   
3 'crystal symmetry operation' 12_555 -y,-z,x              0.0000000000  -1.0000000000 0.0000000000  0.0000000000   0.0000000000  
0.0000000000  -1.0000000000 0.0000000000  1.0000000000  0.0000000000  0.0000000000  0.0000000000   
4 'crystal symmetry operation' 37_454 y-1/2,x+1/2,-z-1/2   0.0000000000  1.0000000000  0.0000000000  -67.2155000000 1.0000000000  
0.0000000000  0.0000000000  67.2155000000 0.0000000000  0.0000000000  -1.0000000000 -67.2155000000 
5 'crystal symmetry operation' 42_454 -x-1/2,z+1/2,y-1/2   -1.0000000000 0.0000000000  0.0000000000  -67.2155000000 0.0000000000  
0.0000000000  1.0000000000  67.2155000000 0.0000000000  1.0000000000  0.0000000000  -67.2155000000 
6 'crystal symmetry operation' 48_454 -z-1/2,-y+1/2,-x-1/2 0.0000000000  0.0000000000  -1.0000000000 -67.2155000000 0.0000000000  
-1.0000000000 0.0000000000  67.2155000000 -1.0000000000 0.0000000000  0.0000000000  -67.2155000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-03 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-09-21 
4 'Structure model' 1 3 2013-10-30 
5 'Structure model' 1 4 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Source and taxonomy'       
4 2 'Structure model' 'Version format compliance' 
5 3 'Structure model' 'Database references'       
6 4 'Structure model' 'Database references'       
7 5 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -20.6496 
_pdbx_refine_tls.origin_y         40.3354 
_pdbx_refine_tls.origin_z         -14.9325 
_pdbx_refine_tls.T[1][1]          0.0218 
_pdbx_refine_tls.T[2][2]          0.0363 
_pdbx_refine_tls.T[3][3]          0.0062 
_pdbx_refine_tls.T[1][2]          0.0035 
_pdbx_refine_tls.T[1][3]          0.0006 
_pdbx_refine_tls.T[2][3]          0.0032 
_pdbx_refine_tls.L[1][1]          0.8150 
_pdbx_refine_tls.L[2][2]          0.4859 
_pdbx_refine_tls.L[3][3]          0.5799 
_pdbx_refine_tls.L[1][2]          -0.1022 
_pdbx_refine_tls.L[1][3]          -0.2033 
_pdbx_refine_tls.L[2][3]          0.0567 
_pdbx_refine_tls.S[1][1]          -0.0412 
_pdbx_refine_tls.S[2][2]          -0.0082 
_pdbx_refine_tls.S[3][3]          0.0494 
_pdbx_refine_tls.S[1][2]          -0.0208 
_pdbx_refine_tls.S[1][3]          0.0040 
_pdbx_refine_tls.S[2][3]          -0.0143 
_pdbx_refine_tls.S[2][1]          0.0163 
_pdbx_refine_tls.S[3][1]          -0.0144 
_pdbx_refine_tls.S[3][2]          0.0430 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A -1  A 161 ? . . . . ? 
'X-RAY DIFFRACTION' 2 1 A 167 A 171 ? . . . . ? 
'X-RAY DIFFRACTION' 3 1 A 172 A 308 ? . . . . ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com       'data reduction'  http://www.hkl-xray.com/ 
?          ? 
2 SCALEPACK   .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com       'data scaling'    http://www.hkl-xray.com/ 
?          ? 
3 MOLREP      .     ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 
4 REFMAC      .     ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk  refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.005 'June 11, 2008' package PDB                  help@deposit.rcsb.org  'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 HKL-2000    .     ?               ?       ?                    ?                      'data reduction'  ? ?          ? 
7 HKL-2000    .     ?               ?       ?                    ?                      'data scaling'    ? ?          ? 
# 
_pdbx_entry_details.entry_id             3K9W 
_pdbx_entry_details.nonpolymer_details   
;THE COD/COA IN THE STRUCTURE APPEARS TO BE HYDROLYZED ACCORDING TO THE ELECTRON DENSITY WITH DIFFRACTION LIMITS OF 1.6 ANGSTROM. ONE COMPONENT IS 4'-DIPHOSPHO PANTETHEINE DENOTED AS 4PS IN THE COORDINATES. THE OTHER COMPONENTS ARE DEFINED AS ADENINE (ADE), SULFATE (SO4) AND THREE WATERS, WHICH FITS WELL INTO THE ELECTRON DENSITY MAP. THIS MODEL BEST REPRESENTS WHAT IS OBSERVED IN THE CRYSTAL.
;
_pdbx_entry_details.sequence_details     ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     11 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -116.24 
_pdbx_validate_torsion.psi             69.75 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 143 ? CG ? A LYS 164 CG 
2 1 Y 1 A LYS 143 ? CD ? A LYS 164 CD 
3 1 Y 1 A LYS 143 ? CE ? A LYS 164 CE 
4 1 Y 1 A LYS 143 ? NZ ? A LYS 164 NZ 
5 1 N 1 A PG4 169 ? O1 ? D PG4 1   O1 
6 1 N 1 A PG4 169 ? C1 ? D PG4 1   C1 
7 1 N 1 A PG4 169 ? C2 ? D PG4 1   C2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -20 ? A MET 1   
2  1 Y 1 A ALA -19 ? A ALA 2   
3  1 Y 1 A HIS -18 ? A HIS 3   
4  1 Y 1 A HIS -17 ? A HIS 4   
5  1 Y 1 A HIS -16 ? A HIS 5   
6  1 Y 1 A HIS -15 ? A HIS 6   
7  1 Y 1 A HIS -14 ? A HIS 7   
8  1 Y 1 A HIS -13 ? A HIS 8   
9  1 Y 1 A MET -12 ? A MET 9   
10 1 Y 1 A GLY -11 ? A GLY 10  
11 1 Y 1 A THR -10 ? A THR 11  
12 1 Y 1 A LEU -9  ? A LEU 12  
13 1 Y 1 A GLU -8  ? A GLU 13  
14 1 Y 1 A ALA -7  ? A ALA 14  
15 1 Y 1 A GLN -6  ? A GLN 15  
16 1 Y 1 A THR -5  ? A THR 16  
17 1 Y 1 A GLN -4  ? A GLN 17  
18 1 Y 1 A GLY -3  ? A GLY 18  
19 1 Y 1 A PRO -2  ? A PRO 19  
20 1 Y 1 A GLN 162 ? A GLN 183 
21 1 Y 1 A GLY 163 ? A GLY 184 
22 1 Y 1 A PRO 164 ? A PRO 185 
23 1 Y 1 A SER 165 ? A SER 186 
24 1 Y 1 A ALA 166 ? A ALA 187 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;4'-diphospho pantetheine
;
4PS 
3 ADENINE                    ADE 
4 'TETRAETHYLENE GLYCOL'     PG4 
5 'ACETATE ION'              ACT 
6 'SULFATE ION'              SO4 
7 water                      HOH 
#