data_3KB5
# 
_entry.id   3KB5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KB5         
RCSB  RCSB055772   
WWPDB D_1000055772 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KB5 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Park, E.Y.'   1 
'Kwon, O.-B.'  2 
'Jeong, B.-C.' 3 
'Song, H.K.'   4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of PRY-SPRY domain of human TRIM72' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           1097-0134 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19967786 
_citation.pdbx_database_id_DOI      10.1002/prot.22647 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Park, E.Y.'   1 
primary 'Kwon, O.-B.'  2 
primary 'Jeong, B.-C.' 3 
primary 'Yi, J.-S.'    4 
primary 'Lee, C.S.'    5 
primary 'Ko, Y.-G.'    6 
primary 'Song, H.K.'   7 
# 
_cell.entry_id           3KB5 
_cell.length_a           153.747 
_cell.length_b           35.937 
_cell.length_c           33.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.87 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KB5 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tripartite motif-containing protein 72' 21601.641 1   ? ? 'PRY-SPRY domain, UNP residues 278-470' ? 
2 water   nat water                                    18.015    160 ? ? ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Mitsugumin-53, Mg53' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRW
ALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVP
LFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRW
ALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVP
LFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   LYS n 
1 3   MET n 
1 4   PHE n 
1 5   ARG n 
1 6   ALA n 
1 7   LEU n 
1 8   MET n 
1 9   PRO n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  GLU n 
1 14  LEU n 
1 15  THR n 
1 16  PHE n 
1 17  ASP n 
1 18  PRO n 
1 19  SER n 
1 20  SER n 
1 21  ALA n 
1 22  HIS n 
1 23  PRO n 
1 24  SER n 
1 25  LEU n 
1 26  VAL n 
1 27  VAL n 
1 28  SER n 
1 29  SER n 
1 30  SER n 
1 31  GLY n 
1 32  ARG n 
1 33  ARG n 
1 34  VAL n 
1 35  GLU n 
1 36  CYS n 
1 37  SER n 
1 38  GLU n 
1 39  GLN n 
1 40  LYS n 
1 41  ALA n 
1 42  PRO n 
1 43  PRO n 
1 44  ALA n 
1 45  GLY n 
1 46  GLU n 
1 47  ASP n 
1 48  PRO n 
1 49  ARG n 
1 50  GLN n 
1 51  PHE n 
1 52  ASP n 
1 53  LYS n 
1 54  ALA n 
1 55  VAL n 
1 56  ALA n 
1 57  VAL n 
1 58  VAL n 
1 59  ALA n 
1 60  HIS n 
1 61  GLN n 
1 62  GLN n 
1 63  LEU n 
1 64  SER n 
1 65  GLU n 
1 66  GLY n 
1 67  GLU n 
1 68  HIS n 
1 69  TYR n 
1 70  TRP n 
1 71  GLU n 
1 72  VAL n 
1 73  ASP n 
1 74  VAL n 
1 75  GLY n 
1 76  ASP n 
1 77  LYS n 
1 78  PRO n 
1 79  ARG n 
1 80  TRP n 
1 81  ALA n 
1 82  LEU n 
1 83  GLY n 
1 84  VAL n 
1 85  ILE n 
1 86  ALA n 
1 87  ALA n 
1 88  GLU n 
1 89  ALA n 
1 90  PRO n 
1 91  ARG n 
1 92  ARG n 
1 93  GLY n 
1 94  ARG n 
1 95  LEU n 
1 96  HIS n 
1 97  ALA n 
1 98  VAL n 
1 99  PRO n 
1 100 SER n 
1 101 GLN n 
1 102 GLY n 
1 103 LEU n 
1 104 TRP n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 LEU n 
1 109 ARG n 
1 110 GLU n 
1 111 GLY n 
1 112 LYS n 
1 113 ILE n 
1 114 LEU n 
1 115 GLU n 
1 116 ALA n 
1 117 HIS n 
1 118 VAL n 
1 119 GLU n 
1 120 ALA n 
1 121 LYS n 
1 122 GLU n 
1 123 PRO n 
1 124 ARG n 
1 125 ALA n 
1 126 LEU n 
1 127 ARG n 
1 128 SER n 
1 129 PRO n 
1 130 GLU n 
1 131 ARG n 
1 132 ARG n 
1 133 PRO n 
1 134 THR n 
1 135 ARG n 
1 136 ILE n 
1 137 GLY n 
1 138 LEU n 
1 139 TYR n 
1 140 LEU n 
1 141 SER n 
1 142 PHE n 
1 143 GLY n 
1 144 ASP n 
1 145 GLY n 
1 146 VAL n 
1 147 LEU n 
1 148 SER n 
1 149 PHE n 
1 150 TYR n 
1 151 ASP n 
1 152 ALA n 
1 153 SER n 
1 154 ASP n 
1 155 ALA n 
1 156 ASP n 
1 157 ALA n 
1 158 LEU n 
1 159 VAL n 
1 160 PRO n 
1 161 LEU n 
1 162 PHE n 
1 163 ALA n 
1 164 PHE n 
1 165 HIS n 
1 166 GLU n 
1 167 ARG n 
1 168 LEU n 
1 169 PRO n 
1 170 ARG n 
1 171 PRO n 
1 172 VAL n 
1 173 TYR n 
1 174 PRO n 
1 175 PHE n 
1 176 PHE n 
1 177 ASP n 
1 178 VAL n 
1 179 CYS n 
1 180 TRP n 
1 181 HIS n 
1 182 ASP n 
1 183 LYS n 
1 184 GLY n 
1 185 LYS n 
1 186 ASN n 
1 187 ALA n 
1 188 GLN n 
1 189 PRO n 
1 190 LEU n 
1 191 LEU n 
1 192 LEU n 
1 193 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PRY-SPRY 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TRI72_HUMAN 
_struct_ref.pdbx_db_accession          Q6ZMU5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRW
ALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVP
LFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
;
_struct_ref.pdbx_align_begin           278 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3KB5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 193 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q6ZMU5 
_struct_ref_seq.db_align_beg                  278 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  470 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       278 
_struct_ref_seq.pdbx_auth_seq_align_end       470 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3KB5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.09 
_exptl_crystal.density_percent_sol   41.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl, 20% (w/v) polyethylene glycol 3350, 0.2M potassium nitrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 210'  ? ? 
2 CCD 'ADSC QUANTUM 210r' ? ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ?                MAD                 x-ray 
2 2 M 'Si 111 CHANNEL' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97951 1.0 
2 0.97967 1.0 
3 0.9600  1.0 
4 1.0     1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'PAL/PLS BEAMLINE 4A'              PAL/PLS          4A       ? '0.97951, 0.97967, 0.9600' 
2 SYNCHROTRON 'PHOTON FACTORY BEAMLINE AR-NW12A' 'Photon Factory' AR-NW12A ? 1.0                        
# 
_reflns.entry_id                     3KB5 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.5 
_reflns.number_obs                   26011 
_reflns.number_all                   26011 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.53 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3KB5 
_refine.ls_number_reflns_obs                     26011 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.28 
_refine.ls_d_res_high                            1.5 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.400 
_refine.ls_number_reflns_R_free                  1269 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               30.819 
_refine.aniso_B[1][1]                            3.701 
_refine.aniso_B[2][2]                            2.291 
_refine.aniso_B[3][3]                            -5.992 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.414 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 58.366 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1526 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             160 
_refine_hist.number_atoms_total               1686 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        29.28 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' c_bond_d     ? 0.005 ?     ? ? 
'X-RAY DIFFRACTION' c_angle_d    ? 1.313 ?     ? ? 
'X-RAY DIFFRACTION' c_mcbond_it  ? 1.765 1.500 ? ? 
'X-RAY DIFFRACTION' c_scbond_it  ? 2.364 2.000 ? ? 
'X-RAY DIFFRACTION' c_mcangle_it ? 3.080 2.000 ? ? 
'X-RAY DIFFRACTION' c_scangle_it ? 3.593 2.500 ? ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KB5 
_struct.title                     'PRY-SPRY domain of human TRIM72' 
_struct.pdbx_descriptor           'Tripartite motif-containing protein 72' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KB5 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
'B30.2, GUSTAVUS, SPRY, TRIM21, tripartite motif, TRIM72, PRY, high resolution, MG53, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 1  ? MET A 8   ? ARG A 278 MET A 285 1 ? 8 
HELX_P HELX_P2 2 VAL A 98 ? GLN A 101 ? VAL A 375 GLN A 378 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 128 A . ? SER 405 A PRO 129 A ? PRO 406 A 1 -0.26 
2 ARG 170 A . ? ARG 447 A PRO 171 A ? PRO 448 A 1 -0.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 25  ? SER A 28  ? LEU A 302 SER A 305 
A 2 ARG A 33  ? CYS A 36  ? ARG A 310 CYS A 313 
A 3 LEU A 190 ? LEU A 192 ? LEU A 467 LEU A 469 
A 4 GLU A 67  ? ASP A 73  ? GLU A 344 ASP A 350 
A 5 ARG A 135 ? SER A 141 ? ARG A 412 SER A 418 
A 6 VAL A 146 ? ASP A 151 ? VAL A 423 ASP A 428 
A 7 VAL A 159 ? PHE A 164 ? VAL A 436 PHE A 441 
B 1 ALA A 56  ? VAL A 58  ? ALA A 333 VAL A 335 
B 2 VAL A 172 ? ASP A 177 ? VAL A 449 ASP A 454 
B 3 TRP A 80  ? ALA A 86  ? TRP A 357 ALA A 363 
B 4 LEU A 103 ? ARG A 109 ? LEU A 380 ARG A 386 
B 5 ILE A 113 ? ALA A 116 ? ILE A 390 ALA A 393 
B 6 ARG A 124 ? ALA A 125 ? ARG A 401 ALA A 402 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 28  ? N SER A 305 O ARG A 33  ? O ARG A 310 
A 2 3 N VAL A 34  ? N VAL A 311 O LEU A 190 ? O LEU A 467 
A 3 4 O LEU A 191 ? O LEU A 468 N ASP A 73  ? N ASP A 350 
A 4 5 N HIS A 68  ? N HIS A 345 O LEU A 140 ? O LEU A 417 
A 5 6 N TYR A 139 ? N TYR A 416 O SER A 148 ? O SER A 425 
A 6 7 N PHE A 149 ? N PHE A 426 O PHE A 162 ? O PHE A 439 
B 1 2 N VAL A 57  ? N VAL A 334 O PHE A 176 ? O PHE A 453 
B 2 3 O ASP A 177 ? O ASP A 454 N ALA A 81  ? N ALA A 358 
B 3 4 N LEU A 82  ? N LEU A 359 O LEU A 106 ? O LEU A 383 
B 4 5 N ARG A 109 ? N ARG A 386 O ILE A 113 ? O ILE A 390 
B 5 6 N ALA A 116 ? N ALA A 393 O ARG A 124 ? O ARG A 401 
# 
_database_PDB_matrix.entry_id          3KB5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KB5 
_atom_sites.fract_transf_matrix[1][1]   0.006504 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001132 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.027826 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.030573 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 1   ? -0.625 8.852   5.463   1.00 54.53 ? 278 ARG A N   1 
ATOM   2    C CA  . ARG A 1 1   ? 0.599  8.270   6.084   1.00 54.40 ? 278 ARG A CA  1 
ATOM   3    C C   . ARG A 1 1   ? 0.271  6.979   6.826   1.00 54.46 ? 278 ARG A C   1 
ATOM   4    O O   . ARG A 1 1   ? 1.103  6.076   6.922   1.00 54.15 ? 278 ARG A O   1 
ATOM   5    C CB  . ARG A 1 1   ? 1.222  9.276   7.053   1.00 58.93 ? 278 ARG A CB  1 
ATOM   6    C CG  . ARG A 1 1   ? 1.679  10.558  6.386   1.00 59.46 ? 278 ARG A CG  1 
ATOM   7    C CD  . ARG A 1 1   ? 2.306  11.512  7.385   1.00 60.58 ? 278 ARG A CD  1 
ATOM   8    N NE  . ARG A 1 1   ? 2.877  12.684  6.727   1.00 61.14 ? 278 ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 1   ? 3.509  13.665  7.363   1.00 61.96 ? 278 ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 1   ? 3.653  13.618  8.681   1.00 62.18 ? 278 ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 1   ? 4.001  14.691  6.681   1.00 61.89 ? 278 ARG A NH2 1 
ATOM   12   N N   . LYS A 1 2   ? -0.949 6.900   7.345   1.00 52.52 ? 279 LYS A N   1 
ATOM   13   C CA  . LYS A 1 2   ? -1.398 5.727   8.081   1.00 53.03 ? 279 LYS A CA  1 
ATOM   14   C C   . LYS A 1 2   ? -1.608 4.537   7.146   1.00 52.36 ? 279 LYS A C   1 
ATOM   15   O O   . LYS A 1 2   ? -1.339 3.394   7.515   1.00 52.32 ? 279 LYS A O   1 
ATOM   16   C CB  . LYS A 1 2   ? -2.700 6.047   8.821   1.00 63.81 ? 279 LYS A CB  1 
ATOM   17   C CG  . LYS A 1 2   ? -2.611 7.279   9.712   1.00 65.18 ? 279 LYS A CG  1 
ATOM   18   C CD  . LYS A 1 2   ? -3.940 7.576   10.389  1.00 66.23 ? 279 LYS A CD  1 
ATOM   19   C CE  . LYS A 1 2   ? -3.869 8.853   11.211  1.00 67.11 ? 279 LYS A CE  1 
ATOM   20   N NZ  . LYS A 1 2   ? -3.546 10.038  10.367  1.00 68.49 ? 279 LYS A NZ  1 
ATOM   21   N N   . MET A 1 3   ? -2.090 4.811   5.936   1.00 53.90 ? 280 MET A N   1 
ATOM   22   C CA  . MET A 1 3   ? -2.329 3.759   4.949   1.00 52.95 ? 280 MET A CA  1 
ATOM   23   C C   . MET A 1 3   ? -1.028 3.097   4.507   1.00 51.45 ? 280 MET A C   1 
ATOM   24   O O   . MET A 1 3   ? -0.921 1.870   4.495   1.00 50.63 ? 280 MET A O   1 
ATOM   25   C CB  . MET A 1 3   ? -3.051 4.328   3.724   1.00 62.19 ? 280 MET A CB  1 
ATOM   26   C CG  . MET A 1 3   ? -4.533 4.587   3.931   1.00 62.60 ? 280 MET A CG  1 
ATOM   27   S SD  . MET A 1 3   ? -5.428 3.085   4.378   1.00 64.36 ? 280 MET A SD  1 
ATOM   28   C CE  . MET A 1 3   ? -5.362 2.171   2.839   1.00 62.55 ? 280 MET A CE  1 
ATOM   29   N N   . PHE A 1 4   ? -0.048 3.916   4.136   1.00 50.05 ? 281 PHE A N   1 
ATOM   30   C CA  . PHE A 1 4   ? 1.250  3.410   3.702   1.00 48.17 ? 281 PHE A CA  1 
ATOM   31   C C   . PHE A 1 4   ? 1.766  2.374   4.690   1.00 47.05 ? 281 PHE A C   1 
ATOM   32   O O   . PHE A 1 4   ? 2.157  1.271   4.306   1.00 47.31 ? 281 PHE A O   1 
ATOM   33   C CB  . PHE A 1 4   ? 2.258  4.559   3.599   1.00 50.59 ? 281 PHE A CB  1 
ATOM   34   C CG  . PHE A 1 4   ? 2.105  5.397   2.361   1.00 50.69 ? 281 PHE A CG  1 
ATOM   35   C CD1 . PHE A 1 4   ? 2.210  6.784   2.429   1.00 50.62 ? 281 PHE A CD1 1 
ATOM   36   C CD2 . PHE A 1 4   ? 1.881  4.802   1.123   1.00 50.54 ? 281 PHE A CD2 1 
ATOM   37   C CE1 . PHE A 1 4   ? 2.096  7.566   1.282   1.00 50.83 ? 281 PHE A CE1 1 
ATOM   38   C CE2 . PHE A 1 4   ? 1.766  5.575   -0.031  1.00 50.73 ? 281 PHE A CE2 1 
ATOM   39   C CZ  . PHE A 1 4   ? 1.873  6.960   0.050   1.00 50.83 ? 281 PHE A CZ  1 
ATOM   40   N N   . ARG A 1 5   ? 1.759  2.742   5.967   1.00 42.16 ? 282 ARG A N   1 
ATOM   41   C CA  . ARG A 1 5   ? 2.225  1.863   7.032   1.00 41.21 ? 282 ARG A CA  1 
ATOM   42   C C   . ARG A 1 5   ? 1.569  0.484   6.988   1.00 41.06 ? 282 ARG A C   1 
ATOM   43   O O   . ARG A 1 5   ? 2.249  -0.537  7.096   1.00 40.20 ? 282 ARG A O   1 
ATOM   44   C CB  . ARG A 1 5   ? 1.968  2.520   8.393   1.00 46.21 ? 282 ARG A CB  1 
ATOM   45   C CG  . ARG A 1 5   ? 2.236  1.618   9.585   1.00 45.70 ? 282 ARG A CG  1 
ATOM   46   C CD  . ARG A 1 5   ? 3.691  1.183   9.653   1.00 44.62 ? 282 ARG A CD  1 
ATOM   47   N NE  . ARG A 1 5   ? 4.578  2.248   10.114  1.00 43.57 ? 282 ARG A NE  1 
ATOM   48   C CZ  . ARG A 1 5   ? 5.891  2.105   10.265  1.00 42.60 ? 282 ARG A CZ  1 
ATOM   49   N NH1 . ARG A 1 5   ? 6.464  0.941   9.988   1.00 41.04 ? 282 ARG A NH1 1 
ATOM   50   N NH2 . ARG A 1 5   ? 6.630  3.117   10.702  1.00 42.23 ? 282 ARG A NH2 1 
ATOM   51   N N   . ALA A 1 6   ? 0.250  0.458   6.819   1.00 50.27 ? 283 ALA A N   1 
ATOM   52   C CA  . ALA A 1 6   ? -0.496 -0.798  6.779   1.00 50.29 ? 283 ALA A CA  1 
ATOM   53   C C   . ALA A 1 6   ? -0.340 -1.570  5.472   1.00 50.23 ? 283 ALA A C   1 
ATOM   54   O O   . ALA A 1 6   ? -0.413 -2.800  5.460   1.00 51.16 ? 283 ALA A O   1 
ATOM   55   C CB  . ALA A 1 6   ? -1.974 -0.529  7.044   1.00 48.20 ? 283 ALA A CB  1 
ATOM   56   N N   . LEU A 1 7   ? -0.128 -0.851  4.375   1.00 44.36 ? 284 LEU A N   1 
ATOM   57   C CA  . LEU A 1 7   ? 0.020  -1.482  3.069   1.00 43.06 ? 284 LEU A CA  1 
ATOM   58   C C   . LEU A 1 7   ? 1.369  -2.172  2.878   1.00 41.87 ? 284 LEU A C   1 
ATOM   59   O O   . LEU A 1 7   ? 1.553  -2.930  1.926   1.00 41.84 ? 284 LEU A O   1 
ATOM   60   C CB  . LEU A 1 7   ? -0.199 -0.445  1.963   1.00 47.30 ? 284 LEU A CB  1 
ATOM   61   C CG  . LEU A 1 7   ? -1.607 0.159   1.886   1.00 48.73 ? 284 LEU A CG  1 
ATOM   62   C CD1 . LEU A 1 7   ? -1.643 1.270   0.850   1.00 49.11 ? 284 LEU A CD1 1 
ATOM   63   C CD2 . LEU A 1 7   ? -2.611 -0.930  1.538   1.00 49.50 ? 284 LEU A CD2 1 
ATOM   64   N N   . MET A 1 8   ? 2.308  -1.913  3.784   1.00 43.05 ? 285 MET A N   1 
ATOM   65   C CA  . MET A 1 8   ? 3.635  -2.518  3.701   1.00 41.37 ? 285 MET A CA  1 
ATOM   66   C C   . MET A 1 8   ? 3.625  -3.984  4.125   1.00 41.53 ? 285 MET A C   1 
ATOM   67   O O   . MET A 1 8   ? 2.947  -4.361  5.082   1.00 43.20 ? 285 MET A O   1 
ATOM   68   C CB  . MET A 1 8   ? 4.628  -1.754  4.584   1.00 36.09 ? 285 MET A CB  1 
ATOM   69   C CG  . MET A 1 8   ? 4.958  -0.343  4.110   1.00 33.17 ? 285 MET A CG  1 
ATOM   70   S SD  . MET A 1 8   ? 5.792  -0.311  2.514   1.00 22.80 ? 285 MET A SD  1 
ATOM   71   C CE  . MET A 1 8   ? 4.525  0.382   1.478   1.00 29.64 ? 285 MET A CE  1 
ATOM   72   N N   . PRO A 1 9   ? 4.381  -4.833  3.415   1.00 36.96 ? 286 PRO A N   1 
ATOM   73   C CA  . PRO A 1 9   ? 4.442  -6.258  3.748   1.00 36.74 ? 286 PRO A CA  1 
ATOM   74   C C   . PRO A 1 9   ? 5.223  -6.486  5.040   1.00 36.54 ? 286 PRO A C   1 
ATOM   75   O O   . PRO A 1 9   ? 5.841  -5.561  5.570   1.00 35.65 ? 286 PRO A O   1 
ATOM   76   C CB  . PRO A 1 9   ? 5.137  -6.860  2.534   1.00 38.17 ? 286 PRO A CB  1 
ATOM   77   C CG  . PRO A 1 9   ? 6.069  -5.766  2.119   1.00 38.20 ? 286 PRO A CG  1 
ATOM   78   C CD  . PRO A 1 9   ? 5.187  -4.542  2.216   1.00 38.42 ? 286 PRO A CD  1 
ATOM   79   N N   . ALA A 1 10  ? 5.191  -7.717  5.542   1.00 34.52 ? 287 ALA A N   1 
ATOM   80   C CA  . ALA A 1 10  ? 5.898  -8.060  6.770   1.00 34.27 ? 287 ALA A CA  1 
ATOM   81   C C   . ALA A 1 10  ? 7.365  -7.648  6.666   1.00 33.21 ? 287 ALA A C   1 
ATOM   82   O O   . ALA A 1 10  ? 7.968  -7.735  5.596   1.00 31.79 ? 287 ALA A O   1 
ATOM   83   C CB  . ALA A 1 10  ? 5.790  -9.559  7.034   1.00 38.53 ? 287 ALA A CB  1 
ATOM   84   N N   . LEU A 1 11  ? 7.930  -7.205  7.784   1.00 31.76 ? 288 LEU A N   1 
ATOM   85   C CA  . LEU A 1 11  ? 9.322  -6.767  7.834   1.00 30.37 ? 288 LEU A CA  1 
ATOM   86   C C   . LEU A 1 11  ? 10.264 -7.873  7.360   1.00 29.10 ? 288 LEU A C   1 
ATOM   87   O O   . LEU A 1 11  ? 10.203 -9.006  7.842   1.00 27.86 ? 288 LEU A O   1 
ATOM   88   C CB  . LEU A 1 11  ? 9.677  -6.355  9.266   1.00 38.21 ? 288 LEU A CB  1 
ATOM   89   C CG  . LEU A 1 11  ? 10.752 -5.284  9.463   1.00 38.90 ? 288 LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 11  ? 10.295 -3.976  8.833   1.00 37.09 ? 288 LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 11  ? 11.008 -5.086  10.950  1.00 40.02 ? 288 LEU A CD2 1 
ATOM   92   N N   . GLU A 1 12  ? 11.138 -7.541  6.415   1.00 28.16 ? 289 GLU A N   1 
ATOM   93   C CA  . GLU A 1 12  ? 12.082 -8.512  5.879   1.00 27.98 ? 289 GLU A CA  1 
ATOM   94   C C   . GLU A 1 12  ? 13.097 -8.916  6.944   1.00 28.36 ? 289 GLU A C   1 
ATOM   95   O O   . GLU A 1 12  ? 13.583 -8.071  7.693   1.00 28.49 ? 289 GLU A O   1 
ATOM   96   C CB  . GLU A 1 12  ? 12.828 -7.920  4.680   1.00 30.28 ? 289 GLU A CB  1 
ATOM   97   C CG  . GLU A 1 12  ? 13.699 -8.925  3.945   1.00 29.96 ? 289 GLU A CG  1 
ATOM   98   C CD  . GLU A 1 12  ? 12.902 -9.807  2.999   1.00 30.78 ? 289 GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 12  ? 13.443 -10.834 2.540   1.00 30.72 ? 289 GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 12  ? 11.738 -9.463  2.703   1.00 28.51 ? 289 GLU A OE2 1 
ATOM   101  N N   . GLU A 1 13  ? 13.408 -10.206 7.014   1.00 31.22 ? 290 GLU A N   1 
ATOM   102  C CA  . GLU A 1 13  ? 14.386 -10.699 7.976   1.00 32.05 ? 290 GLU A CA  1 
ATOM   103  C C   . GLU A 1 13  ? 15.763 -10.596 7.330   1.00 29.88 ? 290 GLU A C   1 
ATOM   104  O O   . GLU A 1 13  ? 16.114 -11.403 6.467   1.00 30.14 ? 290 GLU A O   1 
ATOM   105  C CB  . GLU A 1 13  ? 14.099 -12.158 8.338   1.00 52.32 ? 290 GLU A CB  1 
ATOM   106  C CG  . GLU A 1 13  ? 15.139 -12.781 9.260   1.00 58.78 ? 290 GLU A CG  1 
ATOM   107  C CD  . GLU A 1 13  ? 14.909 -14.264 9.484   1.00 63.63 ? 290 GLU A CD  1 
ATOM   108  O OE1 . GLU A 1 13  ? 13.845 -14.628 10.029  1.00 66.26 ? 290 GLU A OE1 1 
ATOM   109  O OE2 . GLU A 1 13  ? 15.793 -15.066 9.113   1.00 66.17 ? 290 GLU A OE2 1 
ATOM   110  N N   . LEU A 1 14  ? 16.536 -9.595  7.738   1.00 21.78 ? 291 LEU A N   1 
ATOM   111  C CA  . LEU A 1 14  ? 17.866 -9.394  7.179   1.00 19.48 ? 291 LEU A CA  1 
ATOM   112  C C   . LEU A 1 14  ? 18.963 -9.412  8.235   1.00 17.05 ? 291 LEU A C   1 
ATOM   113  O O   . LEU A 1 14  ? 18.722 -9.132  9.410   1.00 18.19 ? 291 LEU A O   1 
ATOM   114  C CB  . LEU A 1 14  ? 17.925 -8.052  6.444   1.00 17.56 ? 291 LEU A CB  1 
ATOM   115  C CG  . LEU A 1 14  ? 16.961 -7.828  5.279   1.00 17.97 ? 291 LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 14  ? 17.113 -6.403  4.762   1.00 17.92 ? 291 LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 14  ? 17.255 -8.823  4.168   1.00 17.27 ? 291 LEU A CD2 1 
ATOM   118  N N   . THR A 1 15  ? 20.172 -9.742  7.795   1.00 16.56 ? 292 THR A N   1 
ATOM   119  C CA  . THR A 1 15  ? 21.340 -9.754  8.661   1.00 16.38 ? 292 THR A CA  1 
ATOM   120  C C   . THR A 1 15  ? 22.523 -9.248  7.846   1.00 16.31 ? 292 THR A C   1 
ATOM   121  O O   . THR A 1 15  ? 22.644 -9.540  6.656   1.00 16.97 ? 292 THR A O   1 
ATOM   122  C CB  . THR A 1 15  ? 21.668 -11.172 9.201   1.00 19.92 ? 292 THR A CB  1 
ATOM   123  O OG1 . THR A 1 15  ? 21.676 -12.119 8.127   1.00 20.66 ? 292 THR A OG1 1 
ATOM   124  C CG2 . THR A 1 15  ? 20.649 -11.587 10.244  1.00 20.70 ? 292 THR A CG2 1 
ATOM   125  N N   . PHE A 1 16  ? 23.386 -8.465  8.481   1.00 16.62 ? 293 PHE A N   1 
ATOM   126  C CA  . PHE A 1 16  ? 24.558 -7.947  7.790   1.00 16.86 ? 293 PHE A CA  1 
ATOM   127  C C   . PHE A 1 16  ? 25.540 -9.093  7.549   1.00 17.57 ? 293 PHE A C   1 
ATOM   128  O O   . PHE A 1 16  ? 25.807 -9.881  8.451   1.00 18.95 ? 293 PHE A O   1 
ATOM   129  C CB  . PHE A 1 16  ? 25.236 -6.860  8.631   1.00 15.51 ? 293 PHE A CB  1 
ATOM   130  C CG  . PHE A 1 16  ? 24.380 -5.639  8.870   1.00 16.17 ? 293 PHE A CG  1 
ATOM   131  C CD1 . PHE A 1 16  ? 23.833 -4.937  7.799   1.00 15.67 ? 293 PHE A CD1 1 
ATOM   132  C CD2 . PHE A 1 16  ? 24.156 -5.174  10.163  1.00 15.05 ? 293 PHE A CD2 1 
ATOM   133  C CE1 . PHE A 1 16  ? 23.076 -3.781  8.008   1.00 13.67 ? 293 PHE A CE1 1 
ATOM   134  C CE2 . PHE A 1 16  ? 23.396 -4.015  10.391  1.00 13.02 ? 293 PHE A CE2 1 
ATOM   135  C CZ  . PHE A 1 16  ? 22.857 -3.319  9.303   1.00 14.98 ? 293 PHE A CZ  1 
ATOM   136  N N   . ASP A 1 17  ? 26.067 -9.180  6.333   1.00 17.00 ? 294 ASP A N   1 
ATOM   137  C CA  . ASP A 1 17  ? 27.030 -10.221 5.966   1.00 17.66 ? 294 ASP A CA  1 
ATOM   138  C C   . ASP A 1 17  ? 28.442 -9.745  6.328   1.00 17.14 ? 294 ASP A C   1 
ATOM   139  O O   . ASP A 1 17  ? 29.022 -8.895  5.644   1.00 16.12 ? 294 ASP A O   1 
ATOM   140  C CB  . ASP A 1 17  ? 26.926 -10.495 4.465   1.00 18.81 ? 294 ASP A CB  1 
ATOM   141  C CG  . ASP A 1 17  ? 27.878 -11.571 3.996   1.00 20.66 ? 294 ASP A CG  1 
ATOM   142  O OD1 . ASP A 1 17  ? 28.706 -12.033 4.808   1.00 21.67 ? 294 ASP A OD1 1 
ATOM   143  O OD2 . ASP A 1 17  ? 27.792 -11.944 2.808   1.00 23.25 ? 294 ASP A OD2 1 
ATOM   144  N N   . PRO A 1 18  ? 29.019 -10.294 7.408   1.00 19.42 ? 295 PRO A N   1 
ATOM   145  C CA  . PRO A 1 18  ? 30.361 -9.904  7.848   1.00 20.36 ? 295 PRO A CA  1 
ATOM   146  C C   . PRO A 1 18  ? 31.464 -10.073 6.806   1.00 20.98 ? 295 PRO A C   1 
ATOM   147  O O   . PRO A 1 18  ? 32.416 -9.296  6.780   1.00 20.34 ? 295 PRO A O   1 
ATOM   148  C CB  . PRO A 1 18  ? 30.595 -10.785 9.079   1.00 24.14 ? 295 PRO A CB  1 
ATOM   149  C CG  . PRO A 1 18  ? 29.200 -11.059 9.578   1.00 25.83 ? 295 PRO A CG  1 
ATOM   150  C CD  . PRO A 1 18  ? 28.459 -11.326 8.299   1.00 22.11 ? 295 PRO A CD  1 
ATOM   151  N N   . SER A 1 19  ? 31.338 -11.082 5.950   1.00 22.16 ? 296 SER A N   1 
ATOM   152  C CA  . SER A 1 19  ? 32.360 -11.329 4.933   1.00 22.91 ? 296 SER A CA  1 
ATOM   153  C C   . SER A 1 19  ? 32.369 -10.292 3.819   1.00 22.51 ? 296 SER A C   1 
ATOM   154  O O   . SER A 1 19  ? 33.310 -10.233 3.031   1.00 24.41 ? 296 SER A O   1 
ATOM   155  C CB  . SER A 1 19  ? 32.182 -12.721 4.323   1.00 29.31 ? 296 SER A CB  1 
ATOM   156  O OG  . SER A 1 19  ? 30.975 -12.809 3.589   1.00 34.74 ? 296 SER A OG  1 
ATOM   157  N N   . SER A 1 20  ? 31.324 -9.474  3.744   1.00 20.02 ? 297 SER A N   1 
ATOM   158  C CA  . SER A 1 20  ? 31.249 -8.458  2.703   1.00 19.80 ? 297 SER A CA  1 
ATOM   159  C C   . SER A 1 20  ? 31.642 -7.084  3.227   1.00 17.94 ? 297 SER A C   1 
ATOM   160  O O   . SER A 1 20  ? 31.954 -6.180  2.448   1.00 16.71 ? 297 SER A O   1 
ATOM   161  C CB  . SER A 1 20  ? 29.824 -8.395  2.145   1.00 28.17 ? 297 SER A CB  1 
ATOM   162  O OG  . SER A 1 20  ? 29.669 -7.308  1.250   1.00 40.18 ? 297 SER A OG  1 
ATOM   163  N N   . ALA A 1 21  ? 31.654 -6.942  4.548   1.00 17.05 ? 298 ALA A N   1 
ATOM   164  C CA  . ALA A 1 21  ? 31.958 -5.661  5.181   1.00 16.94 ? 298 ALA A CA  1 
ATOM   165  C C   . ALA A 1 21  ? 33.361 -5.101  4.990   1.00 17.85 ? 298 ALA A C   1 
ATOM   166  O O   . ALA A 1 21  ? 34.353 -5.830  5.018   1.00 18.58 ? 298 ALA A O   1 
ATOM   167  C CB  . ALA A 1 21  ? 31.652 -5.744  6.672   1.00 17.33 ? 298 ALA A CB  1 
ATOM   168  N N   . HIS A 1 22  ? 33.422 -3.786  4.800   1.00 17.76 ? 299 HIS A N   1 
ATOM   169  C CA  . HIS A 1 22  ? 34.679 -3.062  4.665   1.00 18.18 ? 299 HIS A CA  1 
ATOM   170  C C   . HIS A 1 22  ? 35.485 -3.438  5.913   1.00 19.00 ? 299 HIS A C   1 
ATOM   171  O O   . HIS A 1 22  ? 34.916 -3.619  6.989   1.00 17.58 ? 299 HIS A O   1 
ATOM   172  C CB  . HIS A 1 22  ? 34.376 -1.561  4.636   1.00 20.14 ? 299 HIS A CB  1 
ATOM   173  C CG  . HIS A 1 22  ? 35.588 -0.695  4.501   1.00 20.08 ? 299 HIS A CG  1 
ATOM   174  N ND1 . HIS A 1 22  ? 36.438 -0.437  5.554   1.00 21.45 ? 299 HIS A ND1 1 
ATOM   175  C CD2 . HIS A 1 22  ? 36.093 -0.031  3.435   1.00 21.88 ? 299 HIS A CD2 1 
ATOM   176  C CE1 . HIS A 1 22  ? 37.416 0.350   5.143   1.00 22.03 ? 299 HIS A CE1 1 
ATOM   177  N NE2 . HIS A 1 22  ? 37.231 0.611   3.861   1.00 21.61 ? 299 HIS A NE2 1 
ATOM   178  N N   . PRO A 1 23  ? 36.819 -3.555  5.791   1.00 19.52 ? 300 PRO A N   1 
ATOM   179  C CA  . PRO A 1 23  ? 37.660 -3.924  6.938   1.00 21.89 ? 300 PRO A CA  1 
ATOM   180  C C   . PRO A 1 23  ? 37.558 -3.085  8.214   1.00 20.85 ? 300 PRO A C   1 
ATOM   181  O O   . PRO A 1 23  ? 37.860 -3.576  9.303   1.00 21.35 ? 300 PRO A O   1 
ATOM   182  C CB  . PRO A 1 23  ? 39.075 -3.923  6.347   1.00 25.38 ? 300 PRO A CB  1 
ATOM   183  C CG  . PRO A 1 23  ? 38.981 -2.955  5.217   1.00 26.31 ? 300 PRO A CG  1 
ATOM   184  C CD  . PRO A 1 23  ? 37.643 -3.283  4.601   1.00 23.27 ? 300 PRO A CD  1 
ATOM   185  N N   . SER A 1 24  ? 37.139 -1.830  8.095   1.00 19.62 ? 301 SER A N   1 
ATOM   186  C CA  . SER A 1 24  ? 37.020 -0.985  9.277   1.00 20.40 ? 301 SER A CA  1 
ATOM   187  C C   . SER A 1 24  ? 35.736 -1.263  10.058  1.00 20.52 ? 301 SER A C   1 
ATOM   188  O O   . SER A 1 24  ? 35.571 -0.789  11.178  1.00 21.56 ? 301 SER A O   1 
ATOM   189  C CB  . SER A 1 24  ? 37.056 0.494   8.878   1.00 26.45 ? 301 SER A CB  1 
ATOM   190  O OG  . SER A 1 24  ? 35.919 0.844   8.106   1.00 30.53 ? 301 SER A OG  1 
ATOM   191  N N   . LEU A 1 25  ? 34.838 -2.053  9.479   1.00 21.54 ? 302 LEU A N   1 
ATOM   192  C CA  . LEU A 1 25  ? 33.562 -2.339  10.127  1.00 20.86 ? 302 LEU A CA  1 
ATOM   193  C C   . LEU A 1 25  ? 33.512 -3.583  10.997  1.00 21.24 ? 302 LEU A C   1 
ATOM   194  O O   . LEU A 1 25  ? 34.263 -4.536  10.794  1.00 21.98 ? 302 LEU A O   1 
ATOM   195  C CB  . LEU A 1 25  ? 32.462 -2.442  9.069   1.00 18.02 ? 302 LEU A CB  1 
ATOM   196  C CG  . LEU A 1 25  ? 32.248 -1.191  8.220   1.00 18.82 ? 302 LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 25  ? 31.218 -1.472  7.134   1.00 19.37 ? 302 LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 25  ? 31.799 -0.046  9.118   1.00 18.43 ? 302 LEU A CD2 1 
ATOM   199  N N   . VAL A 1 26  ? 32.607 -3.559  11.970  1.00 18.95 ? 303 VAL A N   1 
ATOM   200  C CA  . VAL A 1 26  ? 32.393 -4.689  12.862  1.00 19.70 ? 303 VAL A CA  1 
ATOM   201  C C   . VAL A 1 26  ? 30.892 -4.919  12.962  1.00 19.72 ? 303 VAL A C   1 
ATOM   202  O O   . VAL A 1 26  ? 30.125 -3.983  13.200  1.00 20.42 ? 303 VAL A O   1 
ATOM   203  C CB  . VAL A 1 26  ? 32.966 -4.434  14.280  1.00 23.55 ? 303 VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 26  ? 32.395 -3.149  14.865  1.00 26.29 ? 303 VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 26  ? 32.653 -5.621  15.178  1.00 25.95 ? 303 VAL A CG2 1 
ATOM   206  N N   . VAL A 1 27  ? 30.478 -6.163  12.751  1.00 19.69 ? 304 VAL A N   1 
ATOM   207  C CA  . VAL A 1 27  ? 29.068 -6.534  12.812  1.00 20.57 ? 304 VAL A CA  1 
ATOM   208  C C   . VAL A 1 27  ? 28.785 -7.196  14.154  1.00 20.49 ? 304 VAL A C   1 
ATOM   209  O O   . VAL A 1 27  ? 29.561 -8.037  14.607  1.00 23.62 ? 304 VAL A O   1 
ATOM   210  C CB  . VAL A 1 27  ? 28.705 -7.515  11.669  1.00 17.37 ? 304 VAL A CB  1 
ATOM   211  C CG1 . VAL A 1 27  ? 27.268 -8.002  11.824  1.00 17.96 ? 304 VAL A CG1 1 
ATOM   212  C CG2 . VAL A 1 27  ? 28.886 -6.824  10.317  1.00 20.92 ? 304 VAL A CG2 1 
ATOM   213  N N   . SER A 1 28  ? 27.677 -6.817  14.788  1.00 18.50 ? 305 SER A N   1 
ATOM   214  C CA  . SER A 1 28  ? 27.309 -7.381  16.087  1.00 18.87 ? 305 SER A CA  1 
ATOM   215  C C   . SER A 1 28  ? 25.796 -7.484  16.262  1.00 19.35 ? 305 SER A C   1 
ATOM   216  O O   . SER A 1 28  ? 25.031 -7.235  15.325  1.00 18.73 ? 305 SER A O   1 
ATOM   217  C CB  . SER A 1 28  ? 27.898 -6.538  17.222  1.00 22.25 ? 305 SER A CB  1 
ATOM   218  O OG  . SER A 1 28  ? 27.400 -5.209  17.194  1.00 23.45 ? 305 SER A OG  1 
ATOM   219  N N   . SER A 1 29  ? 25.373 -7.859  17.467  1.00 22.14 ? 306 SER A N   1 
ATOM   220  C CA  . SER A 1 29  ? 23.953 -8.010  17.786  1.00 23.12 ? 306 SER A CA  1 
ATOM   221  C C   . SER A 1 29  ? 23.248 -8.954  16.818  1.00 23.74 ? 306 SER A C   1 
ATOM   222  O O   . SER A 1 29  ? 22.235 -8.601  16.216  1.00 21.60 ? 306 SER A O   1 
ATOM   223  C CB  . SER A 1 29  ? 23.261 -6.644  17.777  1.00 25.84 ? 306 SER A CB  1 
ATOM   224  O OG  . SER A 1 29  ? 23.817 -5.798  18.766  1.00 30.87 ? 306 SER A OG  1 
ATOM   225  N N   . SER A 1 30  ? 23.794 -10.159 16.676  1.00 22.80 ? 307 SER A N   1 
ATOM   226  C CA  . SER A 1 30  ? 23.223 -11.162 15.789  1.00 24.30 ? 307 SER A CA  1 
ATOM   227  C C   . SER A 1 30  ? 23.018 -10.647 14.368  1.00 23.07 ? 307 SER A C   1 
ATOM   228  O O   . SER A 1 30  ? 21.993 -10.920 13.743  1.00 25.30 ? 307 SER A O   1 
ATOM   229  C CB  . SER A 1 30  ? 21.887 -11.670 16.346  1.00 35.86 ? 307 SER A CB  1 
ATOM   230  O OG  . SER A 1 30  ? 22.070 -12.360 17.571  1.00 39.87 ? 307 SER A OG  1 
ATOM   231  N N   . GLY A 1 31  ? 23.996 -9.896  13.870  1.00 20.83 ? 308 GLY A N   1 
ATOM   232  C CA  . GLY A 1 31  ? 23.922 -9.380  12.516  1.00 18.92 ? 308 GLY A CA  1 
ATOM   233  C C   . GLY A 1 31  ? 23.003 -8.199  12.276  1.00 18.40 ? 308 GLY A C   1 
ATOM   234  O O   . GLY A 1 31  ? 22.715 -7.872  11.128  1.00 16.87 ? 308 GLY A O   1 
ATOM   235  N N   . ARG A 1 32  ? 22.539 -7.555  13.342  1.00 18.13 ? 309 ARG A N   1 
ATOM   236  C CA  . ARG A 1 32  ? 21.643 -6.415  13.185  1.00 17.11 ? 309 ARG A CA  1 
ATOM   237  C C   . ARG A 1 32  ? 22.285 -5.063  13.473  1.00 17.86 ? 309 ARG A C   1 
ATOM   238  O O   . ARG A 1 32  ? 21.621 -4.032  13.396  1.00 18.33 ? 309 ARG A O   1 
ATOM   239  C CB  . ARG A 1 32  ? 20.396 -6.611  14.052  1.00 24.07 ? 309 ARG A CB  1 
ATOM   240  C CG  . ARG A 1 32  ? 19.452 -7.678  13.500  1.00 28.58 ? 309 ARG A CG  1 
ATOM   241  C CD  . ARG A 1 32  ? 18.261 -7.918  14.410  1.00 34.48 ? 309 ARG A CD  1 
ATOM   242  N NE  . ARG A 1 32  ? 18.635 -8.667  15.606  1.00 40.96 ? 309 ARG A NE  1 
ATOM   243  C CZ  . ARG A 1 32  ? 17.772 -9.103  16.519  1.00 42.52 ? 309 ARG A CZ  1 
ATOM   244  N NH1 . ARG A 1 32  ? 16.474 -8.865  16.379  1.00 44.60 ? 309 ARG A NH1 1 
ATOM   245  N NH2 . ARG A 1 32  ? 18.208 -9.783  17.572  1.00 44.88 ? 309 ARG A NH2 1 
ATOM   246  N N   . ARG A 1 33  ? 23.571 -5.062  13.803  1.00 17.15 ? 310 ARG A N   1 
ATOM   247  C CA  . ARG A 1 33  ? 24.277 -3.813  14.080  1.00 17.44 ? 310 ARG A CA  1 
ATOM   248  C C   . ARG A 1 33  ? 25.625 -3.791  13.378  1.00 17.63 ? 310 ARG A C   1 
ATOM   249  O O   . ARG A 1 33  ? 26.327 -4.795  13.354  1.00 17.18 ? 310 ARG A O   1 
ATOM   250  C CB  . ARG A 1 33  ? 24.473 -3.632  15.594  1.00 16.80 ? 310 ARG A CB  1 
ATOM   251  C CG  . ARG A 1 33  ? 25.322 -2.429  15.972  1.00 17.25 ? 310 ARG A CG  1 
ATOM   252  C CD  . ARG A 1 33  ? 25.243 -2.128  17.464  1.00 18.96 ? 310 ARG A CD  1 
ATOM   253  N NE  . ARG A 1 33  ? 26.208 -1.104  17.851  1.00 20.26 ? 310 ARG A NE  1 
ATOM   254  C CZ  . ARG A 1 33  ? 25.995 -0.192  18.794  1.00 22.47 ? 310 ARG A CZ  1 
ATOM   255  N NH1 . ARG A 1 33  ? 24.845 -0.175  19.456  1.00 21.81 ? 310 ARG A NH1 1 
ATOM   256  N NH2 . ARG A 1 33  ? 26.924 0.717   19.058  1.00 23.02 ? 310 ARG A NH2 1 
ATOM   257  N N   . VAL A 1 34  ? 25.976 -2.651  12.791  1.00 16.20 ? 311 VAL A N   1 
ATOM   258  C CA  . VAL A 1 34  ? 27.262 -2.510  12.112  1.00 15.57 ? 311 VAL A CA  1 
ATOM   259  C C   . VAL A 1 34  ? 27.799 -1.104  12.355  1.00 17.35 ? 311 VAL A C   1 
ATOM   260  O O   . VAL A 1 34  ? 27.034 -0.136  12.359  1.00 17.24 ? 311 VAL A O   1 
ATOM   261  C CB  . VAL A 1 34  ? 27.143 -2.787  10.586  1.00 15.98 ? 311 VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 34  ? 26.271 -1.747  9.913   1.00 13.42 ? 311 VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 34  ? 28.533 -2.812  9.947   1.00 15.49 ? 311 VAL A CG2 1 
ATOM   264  N N   . GLU A 1 35  ? 29.108 -0.986  12.569  1.00 16.47 ? 312 GLU A N   1 
ATOM   265  C CA  . GLU A 1 35  ? 29.716 0.319   12.828  1.00 17.33 ? 312 GLU A CA  1 
ATOM   266  C C   . GLU A 1 35  ? 31.217 0.264   12.610  1.00 18.84 ? 312 GLU A C   1 
ATOM   267  O O   . GLU A 1 35  ? 31.801 -0.816  12.534  1.00 18.84 ? 312 GLU A O   1 
ATOM   268  C CB  . GLU A 1 35  ? 29.442 0.751   14.268  1.00 19.07 ? 312 GLU A CB  1 
ATOM   269  C CG  . GLU A 1 35  ? 30.094 -0.149  15.300  1.00 22.30 ? 312 GLU A CG  1 
ATOM   270  C CD  . GLU A 1 35  ? 29.334 -0.169  16.609  1.00 24.65 ? 312 GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 35  ? 29.211 0.897   17.248  1.00 25.07 ? 312 GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 35  ? 28.855 -1.254  16.992  1.00 26.14 ? 312 GLU A OE2 1 
ATOM   273  N N   . CYS A 1 36  ? 31.838 1.433   12.523  1.00 22.07 ? 313 CYS A N   1 
ATOM   274  C CA  . CYS A 1 36  ? 33.276 1.495   12.328  1.00 27.87 ? 313 CYS A CA  1 
ATOM   275  C C   . CYS A 1 36  ? 33.990 1.219   13.639  1.00 31.39 ? 313 CYS A C   1 
ATOM   276  O O   . CYS A 1 36  ? 33.679 1.825   14.665  1.00 31.39 ? 313 CYS A O   1 
ATOM   277  C CB  . CYS A 1 36  ? 33.694 2.872   11.805  1.00 54.43 ? 313 CYS A CB  1 
ATOM   278  S SG  . CYS A 1 36  ? 33.376 3.151   10.053  1.00 66.58 ? 313 CYS A SG  1 
ATOM   279  N N   . SER A 1 37  ? 34.935 0.287   13.602  1.00 27.79 ? 314 SER A N   1 
ATOM   280  C CA  . SER A 1 37  ? 35.721 -0.055  14.777  1.00 33.99 ? 314 SER A CA  1 
ATOM   281  C C   . SER A 1 37  ? 37.022 0.727   14.660  1.00 36.67 ? 314 SER A C   1 
ATOM   282  O O   . SER A 1 37  ? 37.877 0.395   13.838  1.00 37.95 ? 314 SER A O   1 
ATOM   283  C CB  . SER A 1 37  ? 36.019 -1.556  14.805  1.00 45.62 ? 314 SER A CB  1 
ATOM   284  O OG  . SER A 1 37  ? 36.857 -1.888  15.899  1.00 46.57 ? 314 SER A OG  1 
ATOM   285  N N   . GLU A 1 38  ? 37.162 1.774   15.465  1.00 59.68 ? 315 GLU A N   1 
ATOM   286  C CA  . GLU A 1 38  ? 38.367 2.593   15.431  1.00 61.53 ? 315 GLU A CA  1 
ATOM   287  C C   . GLU A 1 38  ? 39.481 2.025   16.293  1.00 64.28 ? 315 GLU A C   1 
ATOM   288  O O   . GLU A 1 38  ? 39.626 2.366   17.467  1.00 64.28 ? 315 GLU A O   1 
ATOM   289  C CB  . GLU A 1 38  ? 38.042 4.031   15.841  1.00 44.82 ? 315 GLU A CB  1 
ATOM   290  C CG  . GLU A 1 38  ? 37.598 4.906   14.672  1.00 37.70 ? 315 GLU A CG  1 
ATOM   291  C CD  . GLU A 1 38  ? 37.078 4.094   13.499  1.00 34.78 ? 315 GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 38  ? 37.888 3.413   12.827  1.00 37.29 ? 315 GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 38  ? 35.861 4.130   13.252  1.00 13.47 ? 315 GLU A OE2 1 
ATOM   294  N N   . GLN A 1 39  ? 40.263 1.147   15.676  1.00 63.66 ? 316 GLN A N   1 
ATOM   295  C CA  . GLN A 1 39  ? 41.388 0.487   16.319  1.00 67.20 ? 316 GLN A CA  1 
ATOM   296  C C   . GLN A 1 39  ? 42.592 0.576   15.388  1.00 68.06 ? 316 GLN A C   1 
ATOM   297  O O   . GLN A 1 39  ? 43.408 1.494   15.485  1.00 69.58 ? 316 GLN A O   1 
ATOM   298  C CB  . GLN A 1 39  ? 41.045 -0.983  16.578  1.00 65.10 ? 316 GLN A CB  1 
ATOM   299  C CG  . GLN A 1 39  ? 40.354 -1.663  15.397  1.00 69.27 ? 316 GLN A CG  1 
ATOM   300  C CD  . GLN A 1 39  ? 40.361 -3.174  15.497  1.00 71.19 ? 316 GLN A CD  1 
ATOM   301  O OE1 . GLN A 1 39  ? 41.419 -3.805  15.464  1.00 72.41 ? 316 GLN A OE1 1 
ATOM   302  N NE2 . GLN A 1 39  ? 39.178 -3.766  15.620  1.00 72.35 ? 316 GLN A NE2 1 
ATOM   303  N N   . LYS A 1 40  ? 42.683 -0.390  14.481  1.00 64.54 ? 317 LYS A N   1 
ATOM   304  C CA  . LYS A 1 40  ? 43.759 -0.465  13.505  1.00 64.43 ? 317 LYS A CA  1 
ATOM   305  C C   . LYS A 1 40  ? 43.168 -1.078  12.240  1.00 62.43 ? 317 LYS A C   1 
ATOM   306  O O   . LYS A 1 40  ? 43.143 -2.299  12.087  1.00 63.12 ? 317 LYS A O   1 
ATOM   307  C CB  . LYS A 1 40  ? 44.890 -1.350  14.036  1.00 66.10 ? 317 LYS A CB  1 
ATOM   308  C CG  . LYS A 1 40  ? 45.427 -0.933  15.398  1.00 68.64 ? 317 LYS A CG  1 
ATOM   309  C CD  . LYS A 1 40  ? 46.503 -1.891  15.886  1.00 70.57 ? 317 LYS A CD  1 
ATOM   310  C CE  . LYS A 1 40  ? 47.014 -1.498  17.264  1.00 71.58 ? 317 LYS A CE  1 
ATOM   311  N NZ  . LYS A 1 40  ? 45.933 -1.526  18.289  1.00 72.83 ? 317 LYS A NZ  1 
ATOM   312  N N   . ALA A 1 41  ? 42.682 -0.224  11.344  1.00 56.17 ? 318 ALA A N   1 
ATOM   313  C CA  . ALA A 1 41  ? 42.074 -0.670  10.094  1.00 53.28 ? 318 ALA A CA  1 
ATOM   314  C C   . ALA A 1 41  ? 42.960 -1.652  9.332   1.00 50.88 ? 318 ALA A C   1 
ATOM   315  O O   . ALA A 1 41  ? 43.975 -1.267  8.750   1.00 50.82 ? 318 ALA A O   1 
ATOM   316  C CB  . ALA A 1 41  ? 41.758 0.533   9.215   1.00 53.74 ? 318 ALA A CB  1 
ATOM   317  N N   . PRO A 1 42  ? 42.581 -2.940  9.325   1.00 40.73 ? 319 PRO A N   1 
ATOM   318  C CA  . PRO A 1 42  ? 43.351 -3.973  8.626   1.00 38.54 ? 319 PRO A CA  1 
ATOM   319  C C   . PRO A 1 42  ? 43.139 -3.916  7.114   1.00 36.37 ? 319 PRO A C   1 
ATOM   320  O O   . PRO A 1 42  ? 42.185 -3.303  6.633   1.00 34.58 ? 319 PRO A O   1 
ATOM   321  C CB  . PRO A 1 42  ? 42.813 -5.261  9.237   1.00 44.71 ? 319 PRO A CB  1 
ATOM   322  C CG  . PRO A 1 42  ? 41.366 -4.929  9.438   1.00 45.65 ? 319 PRO A CG  1 
ATOM   323  C CD  . PRO A 1 42  ? 41.429 -3.534  10.028  1.00 46.08 ? 319 PRO A CD  1 
ATOM   324  N N   . PRO A 1 43  ? 44.033 -4.552  6.343   1.00 35.26 ? 320 PRO A N   1 
ATOM   325  C CA  . PRO A 1 43  ? 43.893 -4.543  4.885   1.00 33.12 ? 320 PRO A CA  1 
ATOM   326  C C   . PRO A 1 43  ? 42.692 -5.379  4.448   1.00 30.42 ? 320 PRO A C   1 
ATOM   327  O O   . PRO A 1 43  ? 42.285 -6.302  5.150   1.00 29.46 ? 320 PRO A O   1 
ATOM   328  C CB  . PRO A 1 43  ? 45.218 -5.135  4.414   1.00 41.05 ? 320 PRO A CB  1 
ATOM   329  C CG  . PRO A 1 43  ? 45.546 -6.109  5.507   1.00 41.86 ? 320 PRO A CG  1 
ATOM   330  C CD  . PRO A 1 43  ? 45.228 -5.313  6.755   1.00 42.40 ? 320 PRO A CD  1 
ATOM   331  N N   . ALA A 1 44  ? 42.120 -5.048  3.295   1.00 32.18 ? 321 ALA A N   1 
ATOM   332  C CA  . ALA A 1 44  ? 40.976 -5.793  2.785   1.00 30.31 ? 321 ALA A CA  1 
ATOM   333  C C   . ALA A 1 44  ? 41.454 -7.136  2.249   1.00 29.53 ? 321 ALA A C   1 
ATOM   334  O O   . ALA A 1 44  ? 42.606 -7.268  1.828   1.00 30.21 ? 321 ALA A O   1 
ATOM   335  C CB  . ALA A 1 44  ? 40.284 -5.008  1.675   1.00 32.66 ? 321 ALA A CB  1 
ATOM   336  N N   . GLY A 1 45  ? 40.570 -8.128  2.273   1.00 29.31 ? 322 GLY A N   1 
ATOM   337  C CA  . GLY A 1 45  ? 40.917 -9.440  1.762   1.00 29.58 ? 322 GLY A CA  1 
ATOM   338  C C   . GLY A 1 45  ? 40.925 -9.431  0.245   1.00 30.25 ? 322 GLY A C   1 
ATOM   339  O O   . GLY A 1 45  ? 40.713 -8.386  -0.376  1.00 30.40 ? 322 GLY A O   1 
ATOM   340  N N   . GLU A 1 46  ? 41.154 -10.595 -0.355  1.00 28.94 ? 323 GLU A N   1 
ATOM   341  C CA  . GLU A 1 46  ? 41.206 -10.720 -1.807  1.00 29.55 ? 323 GLU A CA  1 
ATOM   342  C C   . GLU A 1 46  ? 39.879 -11.134 -2.437  1.00 29.07 ? 323 GLU A C   1 
ATOM   343  O O   . GLU A 1 46  ? 39.798 -11.331 -3.649  1.00 29.51 ? 323 GLU A O   1 
ATOM   344  C CB  . GLU A 1 46  ? 42.292 -11.725 -2.199  1.00 33.21 ? 323 GLU A CB  1 
ATOM   345  C CG  . GLU A 1 46  ? 43.694 -11.291 -1.815  1.00 38.58 ? 323 GLU A CG  1 
ATOM   346  C CD  . GLU A 1 46  ? 44.113 -10.016 -2.519  1.00 40.42 ? 323 GLU A CD  1 
ATOM   347  O OE1 . GLU A 1 46  ? 44.125 -10.004 -3.768  1.00 44.76 ? 323 GLU A OE1 1 
ATOM   348  O OE2 . GLU A 1 46  ? 44.428 -9.025  -1.827  1.00 42.36 ? 323 GLU A OE2 1 
ATOM   349  N N   . ASP A 1 47  ? 38.848 -11.272 -1.611  1.00 28.01 ? 324 ASP A N   1 
ATOM   350  C CA  . ASP A 1 47  ? 37.524 -11.650 -2.093  1.00 28.31 ? 324 ASP A CA  1 
ATOM   351  C C   . ASP A 1 47  ? 36.828 -10.396 -2.616  1.00 27.93 ? 324 ASP A C   1 
ATOM   352  O O   . ASP A 1 47  ? 36.681 -9.412  -1.888  1.00 25.98 ? 324 ASP A O   1 
ATOM   353  C CB  . ASP A 1 47  ? 36.707 -12.264 -0.951  1.00 32.26 ? 324 ASP A CB  1 
ATOM   354  C CG  . ASP A 1 47  ? 35.327 -12.734 -1.393  1.00 34.59 ? 324 ASP A CG  1 
ATOM   355  O OD1 . ASP A 1 47  ? 34.574 -13.241 -0.531  1.00 35.08 ? 324 ASP A OD1 1 
ATOM   356  O OD2 . ASP A 1 47  ? 34.990 -12.602 -2.588  1.00 33.63 ? 324 ASP A OD2 1 
ATOM   357  N N   . PRO A 1 48  ? 36.405 -10.411 -3.891  1.00 26.59 ? 325 PRO A N   1 
ATOM   358  C CA  . PRO A 1 48  ? 35.722 -9.262  -4.494  1.00 26.48 ? 325 PRO A CA  1 
ATOM   359  C C   . PRO A 1 48  ? 34.354 -9.004  -3.868  1.00 25.59 ? 325 PRO A C   1 
ATOM   360  O O   . PRO A 1 48  ? 33.713 -7.989  -4.147  1.00 24.46 ? 325 PRO A O   1 
ATOM   361  C CB  . PRO A 1 48  ? 35.637 -9.649  -5.970  1.00 35.58 ? 325 PRO A CB  1 
ATOM   362  C CG  . PRO A 1 48  ? 35.535 -11.143 -5.914  1.00 36.47 ? 325 PRO A CG  1 
ATOM   363  C CD  . PRO A 1 48  ? 36.575 -11.492 -4.877  1.00 35.36 ? 325 PRO A CD  1 
ATOM   364  N N   . ARG A 1 49  ? 33.909 -9.931  -3.024  1.00 22.09 ? 326 ARG A N   1 
ATOM   365  C CA  . ARG A 1 49  ? 32.630 -9.793  -2.340  1.00 22.53 ? 326 ARG A CA  1 
ATOM   366  C C   . ARG A 1 49  ? 32.742 -8.743  -1.237  1.00 20.49 ? 326 ARG A C   1 
ATOM   367  O O   . ARG A 1 49  ? 31.734 -8.204  -0.782  1.00 19.78 ? 326 ARG A O   1 
ATOM   368  C CB  . ARG A 1 49  ? 32.212 -11.121 -1.709  1.00 38.39 ? 326 ARG A CB  1 
ATOM   369  C CG  . ARG A 1 49  ? 31.893 -12.229 -2.692  1.00 45.07 ? 326 ARG A CG  1 
ATOM   370  C CD  . ARG A 1 49  ? 31.641 -13.531 -1.947  1.00 50.35 ? 326 ARG A CD  1 
ATOM   371  N NE  . ARG A 1 49  ? 30.621 -13.370 -0.914  1.00 55.30 ? 326 ARG A NE  1 
ATOM   372  C CZ  . ARG A 1 49  ? 30.298 -14.303 -0.025  1.00 58.36 ? 326 ARG A CZ  1 
ATOM   373  N NH1 . ARG A 1 49  ? 30.914 -15.478 -0.035  1.00 60.00 ? 326 ARG A NH1 1 
ATOM   374  N NH2 . ARG A 1 49  ? 29.360 -14.061 0.881   1.00 59.86 ? 326 ARG A NH2 1 
ATOM   375  N N   . GLN A 1 50  ? 33.968 -8.463  -0.807  1.00 21.11 ? 327 GLN A N   1 
ATOM   376  C CA  . GLN A 1 50  ? 34.204 -7.495  0.258   1.00 19.77 ? 327 GLN A CA  1 
ATOM   377  C C   . GLN A 1 50  ? 34.560 -6.101  -0.241  1.00 19.94 ? 327 GLN A C   1 
ATOM   378  O O   . GLN A 1 50  ? 35.492 -5.923  -1.028  1.00 17.79 ? 327 GLN A O   1 
ATOM   379  C CB  . GLN A 1 50  ? 35.319 -7.988  1.187   1.00 19.86 ? 327 GLN A CB  1 
ATOM   380  C CG  . GLN A 1 50  ? 35.728 -6.963  2.240   1.00 20.79 ? 327 GLN A CG  1 
ATOM   381  C CD  . GLN A 1 50  ? 36.965 -7.371  3.019   1.00 21.42 ? 327 GLN A CD  1 
ATOM   382  O OE1 . GLN A 1 50  ? 37.816 -8.107  2.514   1.00 24.20 ? 327 GLN A OE1 1 
ATOM   383  N NE2 . GLN A 1 50  ? 37.080 -6.876  4.245   1.00 21.81 ? 327 GLN A NE2 1 
ATOM   384  N N   . PHE A 1 51  ? 33.805 -5.109  0.219   1.00 17.32 ? 328 PHE A N   1 
ATOM   385  C CA  . PHE A 1 51  ? 34.072 -3.721  -0.151  1.00 16.70 ? 328 PHE A CA  1 
ATOM   386  C C   . PHE A 1 51  ? 35.435 -3.347  0.438   1.00 17.48 ? 328 PHE A C   1 
ATOM   387  O O   . PHE A 1 51  ? 35.714 -3.659  1.597   1.00 17.67 ? 328 PHE A O   1 
ATOM   388  C CB  . PHE A 1 51  ? 32.999 -2.806  0.448   1.00 17.43 ? 328 PHE A CB  1 
ATOM   389  C CG  . PHE A 1 51  ? 31.627 -3.028  -0.112  1.00 16.40 ? 328 PHE A CG  1 
ATOM   390  C CD1 . PHE A 1 51  ? 31.264 -2.491  -1.345  1.00 15.65 ? 328 PHE A CD1 1 
ATOM   391  C CD2 . PHE A 1 51  ? 30.695 -3.790  0.590   1.00 16.18 ? 328 PHE A CD2 1 
ATOM   392  C CE1 . PHE A 1 51  ? 29.987 -2.712  -1.873  1.00 15.60 ? 328 PHE A CE1 1 
ATOM   393  C CE2 . PHE A 1 51  ? 29.419 -4.017  0.070   1.00 15.16 ? 328 PHE A CE2 1 
ATOM   394  C CZ  . PHE A 1 51  ? 29.065 -3.478  -1.160  1.00 16.01 ? 328 PHE A CZ  1 
ATOM   395  N N   . ASP A 1 52  ? 36.281 -2.678  -0.345  1.00 19.76 ? 329 ASP A N   1 
ATOM   396  C CA  . ASP A 1 52  ? 37.597 -2.286  0.154   1.00 20.78 ? 329 ASP A CA  1 
ATOM   397  C C   . ASP A 1 52  ? 37.780 -0.770  0.261   1.00 20.78 ? 329 ASP A C   1 
ATOM   398  O O   . ASP A 1 52  ? 38.622 -0.294  1.021   1.00 22.01 ? 329 ASP A O   1 
ATOM   399  C CB  . ASP A 1 52  ? 38.703 -2.911  -0.712  1.00 22.25 ? 329 ASP A CB  1 
ATOM   400  C CG  . ASP A 1 52  ? 38.756 -2.337  -2.111  1.00 25.49 ? 329 ASP A CG  1 
ATOM   401  O OD1 . ASP A 1 52  ? 37.694 -2.017  -2.678  1.00 25.31 ? 329 ASP A OD1 1 
ATOM   402  O OD2 . ASP A 1 52  ? 39.872 -2.222  -2.658  1.00 25.82 ? 329 ASP A OD2 1 
ATOM   403  N N   . LYS A 1 53  ? 36.981 -0.011  -0.485  1.00 20.10 ? 330 LYS A N   1 
ATOM   404  C CA  . LYS A 1 53  ? 37.064 1.449   -0.434  1.00 21.74 ? 330 LYS A CA  1 
ATOM   405  C C   . LYS A 1 53  ? 35.793 2.048   0.172   1.00 21.17 ? 330 LYS A C   1 
ATOM   406  O O   . LYS A 1 53  ? 35.857 2.921   1.040   1.00 22.94 ? 330 LYS A O   1 
ATOM   407  C CB  . LYS A 1 53  ? 37.300 2.014   -1.835  1.00 29.40 ? 330 LYS A CB  1 
ATOM   408  C CG  . LYS A 1 53  ? 38.644 1.620   -2.434  1.00 33.89 ? 330 LYS A CG  1 
ATOM   409  C CD  . LYS A 1 53  ? 39.801 2.109   -1.569  1.00 37.61 ? 330 LYS A CD  1 
ATOM   410  C CE  . LYS A 1 53  ? 41.144 1.714   -2.166  1.00 40.15 ? 330 LYS A CE  1 
ATOM   411  N NZ  . LYS A 1 53  ? 42.287 2.184   -1.332  1.00 42.62 ? 330 LYS A NZ  1 
ATOM   412  N N   . ALA A 1 54  ? 34.639 1.593   -0.298  1.00 20.94 ? 331 ALA A N   1 
ATOM   413  C CA  . ALA A 1 54  ? 33.375 2.079   0.241   1.00 20.12 ? 331 ALA A CA  1 
ATOM   414  C C   . ALA A 1 54  ? 33.230 1.425   1.612   1.00 20.40 ? 331 ALA A C   1 
ATOM   415  O O   . ALA A 1 54  ? 33.407 0.214   1.740   1.00 18.76 ? 331 ALA A O   1 
ATOM   416  C CB  . ALA A 1 54  ? 32.219 1.666   -0.668  1.00 17.05 ? 331 ALA A CB  1 
ATOM   417  N N   . VAL A 1 55  ? 32.927 2.217   2.635   1.00 18.66 ? 332 VAL A N   1 
ATOM   418  C CA  . VAL A 1 55  ? 32.772 1.680   3.985   1.00 18.30 ? 332 VAL A CA  1 
ATOM   419  C C   . VAL A 1 55  ? 31.346 1.158   4.074   1.00 17.26 ? 332 VAL A C   1 
ATOM   420  O O   . VAL A 1 55  ? 30.487 1.735   4.751   1.00 18.06 ? 332 VAL A O   1 
ATOM   421  C CB  . VAL A 1 55  ? 33.008 2.765   5.055   1.00 20.46 ? 332 VAL A CB  1 
ATOM   422  C CG1 . VAL A 1 55  ? 33.002 2.139   6.442   1.00 20.23 ? 332 VAL A CG1 1 
ATOM   423  C CG2 . VAL A 1 55  ? 34.341 3.456   4.804   1.00 24.58 ? 332 VAL A CG2 1 
ATOM   424  N N   . ALA A 1 56  ? 31.118 0.045   3.388   1.00 17.15 ? 333 ALA A N   1 
ATOM   425  C CA  . ALA A 1 56  ? 29.795 -0.547  3.308   1.00 16.07 ? 333 ALA A CA  1 
ATOM   426  C C   . ALA A 1 56  ? 29.735 -2.028  3.618   1.00 16.64 ? 333 ALA A C   1 
ATOM   427  O O   . ALA A 1 56  ? 30.753 -2.684  3.852   1.00 15.88 ? 333 ALA A O   1 
ATOM   428  C CB  . ALA A 1 56  ? 29.227 -0.296  1.922   1.00 17.78 ? 333 ALA A CB  1 
ATOM   429  N N   . VAL A 1 57  ? 28.511 -2.542  3.600   1.00 16.28 ? 334 VAL A N   1 
ATOM   430  C CA  . VAL A 1 57  ? 28.247 -3.942  3.868   1.00 15.36 ? 334 VAL A CA  1 
ATOM   431  C C   . VAL A 1 57  ? 26.905 -4.274  3.214   1.00 14.75 ? 334 VAL A C   1 
ATOM   432  O O   . VAL A 1 57  ? 26.084 -3.386  3.012   1.00 14.86 ? 334 VAL A O   1 
ATOM   433  C CB  . VAL A 1 57  ? 28.163 -4.187  5.399   1.00 15.65 ? 334 VAL A CB  1 
ATOM   434  C CG1 . VAL A 1 57  ? 27.007 -3.384  5.998   1.00 14.78 ? 334 VAL A CG1 1 
ATOM   435  C CG2 . VAL A 1 57  ? 28.005 -5.678  5.699   1.00 17.66 ? 334 VAL A CG2 1 
ATOM   436  N N   . VAL A 1 58  ? 26.697 -5.530  2.831   1.00 14.55 ? 335 VAL A N   1 
ATOM   437  C CA  . VAL A 1 58  ? 25.407 -5.920  2.274   1.00 14.02 ? 335 VAL A CA  1 
ATOM   438  C C   . VAL A 1 58  ? 24.819 -6.959  3.217   1.00 14.21 ? 335 VAL A C   1 
ATOM   439  O O   . VAL A 1 58  ? 25.503 -7.446  4.116   1.00 15.62 ? 335 VAL A O   1 
ATOM   440  C CB  . VAL A 1 58  ? 25.507 -6.558  0.862   1.00 16.39 ? 335 VAL A CB  1 
ATOM   441  C CG1 . VAL A 1 58  ? 25.926 -5.521  -0.157  1.00 15.08 ? 335 VAL A CG1 1 
ATOM   442  C CG2 . VAL A 1 58  ? 26.487 -7.731  0.875   1.00 15.78 ? 335 VAL A CG2 1 
ATOM   443  N N   . ALA A 1 59  ? 23.544 -7.271  3.034   1.00 14.40 ? 336 ALA A N   1 
ATOM   444  C CA  . ALA A 1 59  ? 22.895 -8.288  3.861   1.00 14.53 ? 336 ALA A CA  1 
ATOM   445  C C   . ALA A 1 59  ? 23.251 -9.653  3.283   1.00 15.91 ? 336 ALA A C   1 
ATOM   446  O O   . ALA A 1 59  ? 23.721 -9.746  2.151   1.00 17.09 ? 336 ALA A O   1 
ATOM   447  C CB  . ALA A 1 59  ? 21.387 -8.105  3.833   1.00 15.34 ? 336 ALA A CB  1 
ATOM   448  N N   . HIS A 1 60  ? 23.037 -10.701 4.074   1.00 17.81 ? 337 HIS A N   1 
ATOM   449  C CA  . HIS A 1 60  ? 23.286 -12.073 3.629   1.00 19.25 ? 337 HIS A CA  1 
ATOM   450  C C   . HIS A 1 60  ? 22.235 -12.426 2.581   1.00 19.96 ? 337 HIS A C   1 
ATOM   451  O O   . HIS A 1 60  ? 22.492 -13.208 1.658   1.00 20.68 ? 337 HIS A O   1 
ATOM   452  C CB  . HIS A 1 60  ? 23.091 -13.080 4.772   1.00 19.50 ? 337 HIS A CB  1 
ATOM   453  C CG  . HIS A 1 60  ? 24.258 -13.219 5.700   1.00 19.82 ? 337 HIS A CG  1 
ATOM   454  N ND1 . HIS A 1 60  ? 24.232 -12.753 6.996   1.00 21.08 ? 337 HIS A ND1 1 
ATOM   455  C CD2 . HIS A 1 60  ? 25.458 -13.825 5.541   1.00 21.67 ? 337 HIS A CD2 1 
ATOM   456  C CE1 . HIS A 1 60  ? 25.366 -13.068 7.598   1.00 22.59 ? 337 HIS A CE1 1 
ATOM   457  N NE2 . HIS A 1 60  ? 26.127 -13.718 6.737   1.00 22.06 ? 337 HIS A NE2 1 
ATOM   458  N N   . GLN A 1 61  ? 21.043 -11.860 2.760   1.00 17.27 ? 338 GLN A N   1 
ATOM   459  C CA  . GLN A 1 61  ? 19.889 -12.131 1.909   1.00 17.61 ? 338 GLN A CA  1 
ATOM   460  C C   . GLN A 1 61  ? 19.808 -11.424 0.561   1.00 21.05 ? 338 GLN A C   1 
ATOM   461  O O   . GLN A 1 61  ? 19.742 -10.195 0.478   1.00 20.57 ? 338 GLN A O   1 
ATOM   462  C CB  . GLN A 1 61  ? 18.600 -11.847 2.686   1.00 18.24 ? 338 GLN A CB  1 
ATOM   463  C CG  . GLN A 1 61  ? 18.444 -12.594 4.011   1.00 19.31 ? 338 GLN A CG  1 
ATOM   464  C CD  . GLN A 1 61  ? 19.401 -12.114 5.096   1.00 21.15 ? 338 GLN A CD  1 
ATOM   465  O OE1 . GLN A 1 61  ? 19.856 -10.964 5.085   1.00 18.77 ? 338 GLN A OE1 1 
ATOM   466  N NE2 . GLN A 1 61  ? 19.692 -12.989 6.052   1.00 20.91 ? 338 GLN A NE2 1 
ATOM   467  N N   . GLN A 1 62  ? 19.777 -12.224 -0.497  1.00 24.65 ? 339 GLN A N   1 
ATOM   468  C CA  . GLN A 1 62  ? 19.677 -11.714 -1.854  1.00 27.98 ? 339 GLN A CA  1 
ATOM   469  C C   . GLN A 1 62  ? 18.191 -11.643 -2.202  1.00 28.85 ? 339 GLN A C   1 
ATOM   470  O O   . GLN A 1 62  ? 17.409 -12.504 -1.793  1.00 30.15 ? 339 GLN A O   1 
ATOM   471  C CB  . GLN A 1 62  ? 20.408 -12.658 -2.810  1.00 43.64 ? 339 GLN A CB  1 
ATOM   472  C CG  . GLN A 1 62  ? 20.551 -12.146 -4.226  1.00 49.31 ? 339 GLN A CG  1 
ATOM   473  C CD  . GLN A 1 62  ? 21.248 -13.147 -5.127  1.00 51.84 ? 339 GLN A CD  1 
ATOM   474  O OE1 . GLN A 1 62  ? 20.745 -14.247 -5.354  1.00 55.12 ? 339 GLN A OE1 1 
ATOM   475  N NE2 . GLN A 1 62  ? 22.414 -12.771 -5.643  1.00 53.79 ? 339 GLN A NE2 1 
ATOM   476  N N   . LEU A 1 63  ? 17.795 -10.612 -2.939  1.00 21.86 ? 340 LEU A N   1 
ATOM   477  C CA  . LEU A 1 63  ? 16.399 -10.451 -3.328  1.00 22.35 ? 340 LEU A CA  1 
ATOM   478  C C   . LEU A 1 63  ? 16.313 -10.522 -4.850  1.00 23.66 ? 340 LEU A C   1 
ATOM   479  O O   . LEU A 1 63  ? 17.084 -9.862  -5.549  1.00 21.03 ? 340 LEU A O   1 
ATOM   480  C CB  . LEU A 1 63  ? 15.865 -9.109  -2.812  1.00 23.86 ? 340 LEU A CB  1 
ATOM   481  C CG  . LEU A 1 63  ? 16.042 -8.902  -1.301  1.00 25.81 ? 340 LEU A CG  1 
ATOM   482  C CD1 . LEU A 1 63  ? 15.523 -7.536  -0.893  1.00 25.37 ? 340 LEU A CD1 1 
ATOM   483  C CD2 . LEU A 1 63  ? 15.301 -10.004 -0.547  1.00 26.10 ? 340 LEU A CD2 1 
ATOM   484  N N   . SER A 1 64  ? 15.384 -11.331 -5.359  1.00 29.22 ? 341 SER A N   1 
ATOM   485  C CA  . SER A 1 64  ? 15.233 -11.507 -6.803  1.00 31.03 ? 341 SER A CA  1 
ATOM   486  C C   . SER A 1 64  ? 13.833 -11.244 -7.352  1.00 33.45 ? 341 SER A C   1 
ATOM   487  O O   . SER A 1 64  ? 13.685 -10.846 -8.507  1.00 34.10 ? 341 SER A O   1 
ATOM   488  C CB  . SER A 1 64  ? 15.667 -12.922 -7.202  1.00 37.10 ? 341 SER A CB  1 
ATOM   489  O OG  . SER A 1 64  ? 17.046 -13.129 -6.943  1.00 39.94 ? 341 SER A OG  1 
ATOM   490  N N   . GLU A 1 65  ? 12.806 -11.475 -6.543  1.00 26.98 ? 342 GLU A N   1 
ATOM   491  C CA  . GLU A 1 65  ? 11.436 -11.240 -6.993  1.00 29.56 ? 342 GLU A CA  1 
ATOM   492  C C   . GLU A 1 65  ? 10.513 -10.903 -5.831  1.00 29.04 ? 342 GLU A C   1 
ATOM   493  O O   . GLU A 1 65  ? 10.912 -10.984 -4.669  1.00 28.70 ? 342 GLU A O   1 
ATOM   494  C CB  . GLU A 1 65  ? 10.899 -12.467 -7.738  1.00 51.56 ? 342 GLU A CB  1 
ATOM   495  C CG  . GLU A 1 65  ? 10.749 -13.721 -6.887  1.00 55.09 ? 342 GLU A CG  1 
ATOM   496  C CD  . GLU A 1 65  ? 12.078 -14.327 -6.480  1.00 57.61 ? 342 GLU A CD  1 
ATOM   497  O OE1 . GLU A 1 65  ? 12.868 -14.694 -7.377  1.00 59.34 ? 342 GLU A OE1 1 
ATOM   498  O OE2 . GLU A 1 65  ? 12.332 -14.442 -5.263  1.00 59.83 ? 342 GLU A OE2 1 
ATOM   499  N N   . GLY A 1 66  ? 9.283  -10.511 -6.154  1.00 32.54 ? 343 GLY A N   1 
ATOM   500  C CA  . GLY A 1 66  ? 8.307  -10.175 -5.130  1.00 31.73 ? 343 GLY A CA  1 
ATOM   501  C C   . GLY A 1 66  ? 8.466  -8.802  -4.504  1.00 31.09 ? 343 GLY A C   1 
ATOM   502  O O   . GLY A 1 66  ? 9.239  -7.972  -4.984  1.00 30.29 ? 343 GLY A O   1 
ATOM   503  N N   . GLU A 1 67  ? 7.717  -8.565  -3.429  1.00 33.71 ? 344 GLU A N   1 
ATOM   504  C CA  . GLU A 1 67  ? 7.763  -7.298  -2.708  1.00 33.32 ? 344 GLU A CA  1 
ATOM   505  C C   . GLU A 1 67  ? 8.502  -7.507  -1.390  1.00 31.98 ? 344 GLU A C   1 
ATOM   506  O O   . GLU A 1 67  ? 8.388  -8.562  -0.766  1.00 31.02 ? 344 GLU A O   1 
ATOM   507  C CB  . GLU A 1 67  ? 6.350  -6.780  -2.420  1.00 42.50 ? 344 GLU A CB  1 
ATOM   508  C CG  . GLU A 1 67  ? 5.490  -6.544  -3.654  1.00 47.05 ? 344 GLU A CG  1 
ATOM   509  C CD  . GLU A 1 67  ? 4.908  -7.825  -4.220  1.00 50.18 ? 344 GLU A CD  1 
ATOM   510  O OE1 . GLU A 1 67  ? 4.105  -8.475  -3.516  1.00 52.34 ? 344 GLU A OE1 1 
ATOM   511  O OE2 . GLU A 1 67  ? 5.252  -8.181  -5.366  1.00 52.77 ? 344 GLU A OE2 1 
ATOM   512  N N   . HIS A 1 68  ? 9.259  -6.499  -0.971  1.00 26.95 ? 345 HIS A N   1 
ATOM   513  C CA  . HIS A 1 68  ? 10.022 -6.585  0.269   1.00 24.63 ? 345 HIS A CA  1 
ATOM   514  C C   . HIS A 1 68  ? 10.051 -5.234  0.967   1.00 22.08 ? 345 HIS A C   1 
ATOM   515  O O   . HIS A 1 68  ? 10.023 -4.191  0.317   1.00 24.65 ? 345 HIS A O   1 
ATOM   516  C CB  . HIS A 1 68  ? 11.452 -7.031  -0.036  1.00 25.57 ? 345 HIS A CB  1 
ATOM   517  C CG  . HIS A 1 68  ? 11.531 -8.334  -0.767  1.00 27.37 ? 345 HIS A CG  1 
ATOM   518  N ND1 . HIS A 1 68  ? 11.464 -9.553  -0.126  1.00 28.40 ? 345 HIS A ND1 1 
ATOM   519  C CD2 . HIS A 1 68  ? 11.624 -8.608  -2.090  1.00 28.43 ? 345 HIS A CD2 1 
ATOM   520  C CE1 . HIS A 1 68  ? 11.514 -10.522 -1.023  1.00 28.60 ? 345 HIS A CE1 1 
ATOM   521  N NE2 . HIS A 1 68  ? 11.610 -9.976  -2.222  1.00 27.90 ? 345 HIS A NE2 1 
ATOM   522  N N   . TYR A 1 69  ? 10.099 -5.260  2.292   1.00 20.69 ? 346 TYR A N   1 
ATOM   523  C CA  . TYR A 1 69  ? 10.148 -4.037  3.083   1.00 20.01 ? 346 TYR A CA  1 
ATOM   524  C C   . TYR A 1 69  ? 11.031 -4.237  4.309   1.00 20.38 ? 346 TYR A C   1 
ATOM   525  O O   . TYR A 1 69  ? 10.883 -5.212  5.039   1.00 21.03 ? 346 TYR A O   1 
ATOM   526  C CB  . TYR A 1 69  ? 8.738  -3.634  3.541   1.00 20.90 ? 346 TYR A CB  1 
ATOM   527  C CG  . TYR A 1 69  ? 8.716  -2.393  4.405   1.00 21.22 ? 346 TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 69  ? 8.931  -1.132  3.851   1.00 21.38 ? 346 TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 69  ? 8.533  -2.485  5.786   1.00 21.96 ? 346 TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 69  ? 8.971  0.011   4.651   1.00 21.54 ? 346 TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 69  ? 8.570  -1.350  6.597   1.00 21.33 ? 346 TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 69  ? 8.793  -0.109  6.024   1.00 20.31 ? 346 TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 69  ? 8.870  1.008   6.818   1.00 21.84 ? 346 TYR A OH  1 
ATOM   534  N N   . TRP A 1 70  ? 11.971 -3.326  4.527   1.00 18.30 ? 347 TRP A N   1 
ATOM   535  C CA  . TRP A 1 70  ? 12.817 -3.416  5.705   1.00 18.05 ? 347 TRP A CA  1 
ATOM   536  C C   . TRP A 1 70  ? 13.064 -2.021  6.254   1.00 17.16 ? 347 TRP A C   1 
ATOM   537  O O   . TRP A 1 70  ? 12.854 -1.025  5.554   1.00 18.99 ? 347 TRP A O   1 
ATOM   538  C CB  . TRP A 1 70  ? 14.136 -4.152  5.403   1.00 17.70 ? 347 TRP A CB  1 
ATOM   539  C CG  . TRP A 1 70  ? 15.069 -3.520  4.409   1.00 16.63 ? 347 TRP A CG  1 
ATOM   540  C CD1 . TRP A 1 70  ? 16.209 -2.812  4.691   1.00 14.25 ? 347 TRP A CD1 1 
ATOM   541  C CD2 . TRP A 1 70  ? 15.018 -3.644  2.982   1.00 17.05 ? 347 TRP A CD2 1 
ATOM   542  N NE1 . TRP A 1 70  ? 16.876 -2.507  3.527   1.00 13.57 ? 347 TRP A NE1 1 
ATOM   543  C CE2 . TRP A 1 70  ? 16.170 -3.003  2.463   1.00 16.81 ? 347 TRP A CE2 1 
ATOM   544  C CE3 . TRP A 1 70  ? 14.114 -4.241  2.087   1.00 17.94 ? 347 TRP A CE3 1 
ATOM   545  C CZ2 . TRP A 1 70  ? 16.443 -2.940  1.091   1.00 16.99 ? 347 TRP A CZ2 1 
ATOM   546  C CZ3 . TRP A 1 70  ? 14.385 -4.179  0.719   1.00 18.82 ? 347 TRP A CZ3 1 
ATOM   547  C CH2 . TRP A 1 70  ? 15.544 -3.532  0.236   1.00 18.23 ? 347 TRP A CH2 1 
ATOM   548  N N   . GLU A 1 71  ? 13.472 -1.951  7.517   1.00 16.25 ? 348 GLU A N   1 
ATOM   549  C CA  . GLU A 1 71  ? 13.722 -0.667  8.158   1.00 16.17 ? 348 GLU A CA  1 
ATOM   550  C C   . GLU A 1 71  ? 15.111 -0.603  8.768   1.00 14.69 ? 348 GLU A C   1 
ATOM   551  O O   . GLU A 1 71  ? 15.653 -1.600  9.250   1.00 15.82 ? 348 GLU A O   1 
ATOM   552  C CB  . GLU A 1 71  ? 12.670 -0.404  9.238   1.00 20.59 ? 348 GLU A CB  1 
ATOM   553  C CG  . GLU A 1 71  ? 11.245 -0.434  8.702   1.00 24.20 ? 348 GLU A CG  1 
ATOM   554  C CD  . GLU A 1 71  ? 10.215 -0.012  9.732   1.00 24.42 ? 348 GLU A CD  1 
ATOM   555  O OE1 . GLU A 1 71  ? 10.406 -0.313  10.926  1.00 24.27 ? 348 GLU A OE1 1 
ATOM   556  O OE2 . GLU A 1 71  ? 9.204  0.612   9.338   1.00 26.50 ? 348 GLU A OE2 1 
ATOM   557  N N   . VAL A 1 72  ? 15.679 0.592   8.750   1.00 14.62 ? 349 VAL A N   1 
ATOM   558  C CA  . VAL A 1 72  ? 17.008 0.800   9.288   1.00 13.94 ? 349 VAL A CA  1 
ATOM   559  C C   . VAL A 1 72  ? 16.998 1.990   10.229  1.00 14.74 ? 349 VAL A C   1 
ATOM   560  O O   . VAL A 1 72  ? 16.551 3.078   9.853   1.00 14.88 ? 349 VAL A O   1 
ATOM   561  C CB  . VAL A 1 72  ? 18.023 1.079   8.153   1.00 13.22 ? 349 VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 72  ? 19.418 1.299   8.735   1.00 14.78 ? 349 VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 72  ? 18.036 -0.092  7.169   1.00 14.20 ? 349 VAL A CG2 1 
ATOM   564  N N   . ASP A 1 73  ? 17.462 1.781   11.456  1.00 14.68 ? 350 ASP A N   1 
ATOM   565  C CA  . ASP A 1 73  ? 17.555 2.880   12.409  1.00 14.83 ? 350 ASP A CA  1 
ATOM   566  C C   . ASP A 1 73  ? 18.871 3.594   12.134  1.00 14.62 ? 350 ASP A C   1 
ATOM   567  O O   . ASP A 1 73  ? 19.942 2.968   12.107  1.00 15.65 ? 350 ASP A O   1 
ATOM   568  C CB  . ASP A 1 73  ? 17.545 2.387   13.863  1.00 15.33 ? 350 ASP A CB  1 
ATOM   569  C CG  . ASP A 1 73  ? 16.143 2.314   14.448  1.00 17.59 ? 350 ASP A CG  1 
ATOM   570  O OD1 . ASP A 1 73  ? 15.264 3.077   13.999  1.00 19.36 ? 350 ASP A OD1 1 
ATOM   571  O OD2 . ASP A 1 73  ? 15.932 1.511   15.374  1.00 19.47 ? 350 ASP A OD2 1 
ATOM   572  N N   . VAL A 1 74  ? 18.782 4.902   11.909  1.00 14.82 ? 351 VAL A N   1 
ATOM   573  C CA  . VAL A 1 74  ? 19.961 5.713   11.640  1.00 15.08 ? 351 VAL A CA  1 
ATOM   574  C C   . VAL A 1 74  ? 20.210 6.680   12.791  1.00 15.39 ? 351 VAL A C   1 
ATOM   575  O O   . VAL A 1 74  ? 21.319 7.178   12.955  1.00 16.04 ? 351 VAL A O   1 
ATOM   576  C CB  . VAL A 1 74  ? 19.823 6.507   10.309  1.00 13.18 ? 351 VAL A CB  1 
ATOM   577  C CG1 . VAL A 1 74  ? 19.749 5.533   9.125   1.00 12.12 ? 351 VAL A CG1 1 
ATOM   578  C CG2 . VAL A 1 74  ? 18.582 7.394   10.337  1.00 14.23 ? 351 VAL A CG2 1 
ATOM   579  N N   . GLY A 1 75  ? 19.182 6.928   13.597  1.00 15.57 ? 352 GLY A N   1 
ATOM   580  C CA  . GLY A 1 75  ? 19.335 7.839   14.718  1.00 16.83 ? 352 GLY A CA  1 
ATOM   581  C C   . GLY A 1 75  ? 19.803 9.202   14.256  1.00 14.71 ? 352 GLY A C   1 
ATOM   582  O O   . GLY A 1 75  ? 19.317 9.722   13.251  1.00 16.24 ? 352 GLY A O   1 
ATOM   583  N N   . ASP A 1 76  ? 20.763 9.770   14.983  1.00 18.17 ? 353 ASP A N   1 
ATOM   584  C CA  . ASP A 1 76  ? 21.305 11.080  14.648  1.00 18.46 ? 353 ASP A CA  1 
ATOM   585  C C   . ASP A 1 76  ? 22.605 10.978  13.849  1.00 18.08 ? 353 ASP A C   1 
ATOM   586  O O   . ASP A 1 76  ? 23.379 11.939  13.781  1.00 17.72 ? 353 ASP A O   1 
ATOM   587  C CB  . ASP A 1 76  ? 21.532 11.896  15.930  1.00 24.20 ? 353 ASP A CB  1 
ATOM   588  C CG  . ASP A 1 76  ? 22.731 11.420  16.730  1.00 27.52 ? 353 ASP A CG  1 
ATOM   589  O OD1 . ASP A 1 76  ? 23.055 10.214  16.680  1.00 28.36 ? 353 ASP A OD1 1 
ATOM   590  O OD2 . ASP A 1 76  ? 23.345 12.259  17.427  1.00 34.62 ? 353 ASP A OD2 1 
ATOM   591  N N   . LYS A 1 77  ? 22.845 9.817   13.242  1.00 14.91 ? 354 LYS A N   1 
ATOM   592  C CA  . LYS A 1 77  ? 24.048 9.607   12.436  1.00 15.72 ? 354 LYS A CA  1 
ATOM   593  C C   . LYS A 1 77  ? 24.039 10.670  11.335  1.00 15.28 ? 354 LYS A C   1 
ATOM   594  O O   . LYS A 1 77  ? 23.077 10.779  10.576  1.00 16.13 ? 354 LYS A O   1 
ATOM   595  C CB  . LYS A 1 77  ? 24.032 8.204   11.825  1.00 14.17 ? 354 LYS A CB  1 
ATOM   596  C CG  . LYS A 1 77  ? 25.268 7.874   11.003  1.00 16.75 ? 354 LYS A CG  1 
ATOM   597  C CD  . LYS A 1 77  ? 25.265 6.398   10.614  1.00 17.23 ? 354 LYS A CD  1 
ATOM   598  C CE  . LYS A 1 77  ? 26.512 6.010   9.849   1.00 18.62 ? 354 LYS A CE  1 
ATOM   599  N NZ  . LYS A 1 77  ? 27.751 6.305   10.639  1.00 16.02 ? 354 LYS A NZ  1 
ATOM   600  N N   . PRO A 1 78  ? 25.127 11.447  11.212  1.00 16.75 ? 355 PRO A N   1 
ATOM   601  C CA  . PRO A 1 78  ? 25.178 12.502  10.195  1.00 17.76 ? 355 PRO A CA  1 
ATOM   602  C C   . PRO A 1 78  ? 25.421 12.136  8.738   1.00 17.59 ? 355 PRO A C   1 
ATOM   603  O O   . PRO A 1 78  ? 25.074 12.904  7.842   1.00 17.52 ? 355 PRO A O   1 
ATOM   604  C CB  . PRO A 1 78  ? 26.261 13.430  10.732  1.00 19.25 ? 355 PRO A CB  1 
ATOM   605  C CG  . PRO A 1 78  ? 27.227 12.462  11.338  1.00 19.00 ? 355 PRO A CG  1 
ATOM   606  C CD  . PRO A 1 78  ? 26.334 11.470  12.060  1.00 18.39 ? 355 PRO A CD  1 
ATOM   607  N N   . ARG A 1 79  ? 26.013 10.975  8.490   1.00 15.89 ? 356 ARG A N   1 
ATOM   608  C CA  . ARG A 1 79  ? 26.310 10.574  7.121   1.00 16.00 ? 356 ARG A CA  1 
ATOM   609  C C   . ARG A 1 79  ? 26.117 9.090   6.917   1.00 14.81 ? 356 ARG A C   1 
ATOM   610  O O   . ARG A 1 79  ? 26.697 8.281   7.633   1.00 16.46 ? 356 ARG A O   1 
ATOM   611  C CB  . ARG A 1 79  ? 27.753 10.933  6.757   1.00 27.62 ? 356 ARG A CB  1 
ATOM   612  C CG  . ARG A 1 79  ? 27.893 12.154  5.870   1.00 36.64 ? 356 ARG A CG  1 
ATOM   613  C CD  . ARG A 1 79  ? 28.924 11.907  4.776   1.00 39.83 ? 356 ARG A CD  1 
ATOM   614  N NE  . ARG A 1 79  ? 30.200 11.447  5.317   1.00 42.63 ? 356 ARG A NE  1 
ATOM   615  C CZ  . ARG A 1 79  ? 31.198 10.978  4.576   1.00 45.61 ? 356 ARG A CZ  1 
ATOM   616  N NH1 . ARG A 1 79  ? 32.325 10.581  5.153   1.00 46.48 ? 356 ARG A NH1 1 
ATOM   617  N NH2 . ARG A 1 79  ? 31.068 10.900  3.259   1.00 47.56 ? 356 ARG A NH2 1 
ATOM   618  N N   . TRP A 1 80  ? 25.303 8.744   5.930   1.00 14.73 ? 357 TRP A N   1 
ATOM   619  C CA  . TRP A 1 80  ? 25.027 7.349   5.619   1.00 13.63 ? 357 TRP A CA  1 
ATOM   620  C C   . TRP A 1 80  ? 24.383 7.248   4.250   1.00 13.69 ? 357 TRP A C   1 
ATOM   621  O O   . TRP A 1 80  ? 23.998 8.252   3.659   1.00 13.86 ? 357 TRP A O   1 
ATOM   622  C CB  . TRP A 1 80  ? 24.079 6.729   6.661   1.00 14.32 ? 357 TRP A CB  1 
ATOM   623  C CG  . TRP A 1 80  ? 22.837 7.542   6.988   1.00 12.99 ? 357 TRP A CG  1 
ATOM   624  C CD1 . TRP A 1 80  ? 22.639 8.298   8.112   1.00 15.77 ? 357 TRP A CD1 1 
ATOM   625  C CD2 . TRP A 1 80  ? 21.628 7.654   6.216   1.00 14.45 ? 357 TRP A CD2 1 
ATOM   626  N NE1 . TRP A 1 80  ? 21.388 8.868   8.092   1.00 15.78 ? 357 TRP A NE1 1 
ATOM   627  C CE2 . TRP A 1 80  ? 20.747 8.495   6.941   1.00 15.25 ? 357 TRP A CE2 1 
ATOM   628  C CE3 . TRP A 1 80  ? 21.203 7.131   4.986   1.00 15.12 ? 357 TRP A CE3 1 
ATOM   629  C CZ2 . TRP A 1 80  ? 19.466 8.826   6.476   1.00 14.64 ? 357 TRP A CZ2 1 
ATOM   630  C CZ3 . TRP A 1 80  ? 19.921 7.462   4.523   1.00 15.15 ? 357 TRP A CZ3 1 
ATOM   631  C CH2 . TRP A 1 80  ? 19.073 8.302   5.270   1.00 14.86 ? 357 TRP A CH2 1 
ATOM   632  N N   . ALA A 1 81  ? 24.272 6.028   3.742   1.00 13.15 ? 358 ALA A N   1 
ATOM   633  C CA  . ALA A 1 81  ? 23.625 5.795   2.461   1.00 12.28 ? 358 ALA A CA  1 
ATOM   634  C C   . ALA A 1 81  ? 22.971 4.430   2.562   1.00 14.08 ? 358 ALA A C   1 
ATOM   635  O O   . ALA A 1 81  ? 23.551 3.506   3.137   1.00 13.79 ? 358 ALA A O   1 
ATOM   636  C CB  . ALA A 1 81  ? 24.640 5.825   1.322   1.00 16.38 ? 358 ALA A CB  1 
ATOM   637  N N   . LEU A 1 82  ? 21.758 4.319   2.031   1.00 11.97 ? 359 LEU A N   1 
ATOM   638  C CA  . LEU A 1 82  ? 21.003 3.077   2.092   1.00 12.44 ? 359 LEU A CA  1 
ATOM   639  C C   . LEU A 1 82  ? 20.324 2.792   0.768   1.00 12.98 ? 359 LEU A C   1 
ATOM   640  O O   . LEU A 1 82  ? 19.948 3.709   0.043   1.00 12.66 ? 359 LEU A O   1 
ATOM   641  C CB  . LEU A 1 82  ? 19.921 3.185   3.169   1.00 13.28 ? 359 LEU A CB  1 
ATOM   642  C CG  . LEU A 1 82  ? 20.361 3.443   4.607   1.00 12.27 ? 359 LEU A CG  1 
ATOM   643  C CD1 . LEU A 1 82  ? 19.147 3.729   5.483   1.00 14.21 ? 359 LEU A CD1 1 
ATOM   644  C CD2 . LEU A 1 82  ? 21.111 2.219   5.120   1.00 15.42 ? 359 LEU A CD2 1 
ATOM   645  N N   . GLY A 1 83  ? 20.148 1.512   0.459   1.00 12.63 ? 360 GLY A N   1 
ATOM   646  C CA  . GLY A 1 83  ? 19.464 1.161   -0.773  1.00 13.23 ? 360 GLY A CA  1 
ATOM   647  C C   . GLY A 1 83  ? 19.759 -0.276  -1.122  1.00 14.04 ? 360 GLY A C   1 
ATOM   648  O O   . GLY A 1 83  ? 19.719 -1.134  -0.249  1.00 13.05 ? 360 GLY A O   1 
ATOM   649  N N   . VAL A 1 84  ? 20.028 -0.536  -2.397  1.00 13.77 ? 361 VAL A N   1 
ATOM   650  C CA  . VAL A 1 84  ? 20.378 -1.889  -2.827  1.00 13.82 ? 361 VAL A CA  1 
ATOM   651  C C   . VAL A 1 84  ? 21.504 -1.799  -3.831  1.00 14.97 ? 361 VAL A C   1 
ATOM   652  O O   . VAL A 1 84  ? 21.732 -0.748  -4.436  1.00 14.70 ? 361 VAL A O   1 
ATOM   653  C CB  . VAL A 1 84  ? 19.197 -2.643  -3.492  1.00 15.23 ? 361 VAL A CB  1 
ATOM   654  C CG1 . VAL A 1 84  ? 18.020 -2.694  -2.543  1.00 14.84 ? 361 VAL A CG1 1 
ATOM   655  C CG2 . VAL A 1 84  ? 18.808 -1.980  -4.805  1.00 15.94 ? 361 VAL A CG2 1 
ATOM   656  N N   . ILE A 1 85  ? 22.224 -2.905  -3.983  1.00 16.70 ? 362 ILE A N   1 
ATOM   657  C CA  . ILE A 1 85  ? 23.308 -2.982  -4.947  1.00 15.50 ? 362 ILE A CA  1 
ATOM   658  C C   . ILE A 1 85  ? 23.054 -4.229  -5.783  1.00 16.42 ? 362 ILE A C   1 
ATOM   659  O O   . ILE A 1 85  ? 22.717 -5.275  -5.244  1.00 17.87 ? 362 ILE A O   1 
ATOM   660  C CB  . ILE A 1 85  ? 24.708 -3.067  -4.249  1.00 13.98 ? 362 ILE A CB  1 
ATOM   661  C CG1 . ILE A 1 85  ? 25.818 -3.030  -5.307  1.00 14.03 ? 362 ILE A CG1 1 
ATOM   662  C CG2 . ILE A 1 85  ? 24.799 -4.321  -3.371  1.00 14.98 ? 362 ILE A CG2 1 
ATOM   663  C CD1 . ILE A 1 85  ? 27.227 -2.959  -4.722  1.00 15.04 ? 362 ILE A CD1 1 
ATOM   664  N N   . ALA A 1 86  ? 23.177 -4.095  -7.100  1.00 16.15 ? 363 ALA A N   1 
ATOM   665  C CA  . ALA A 1 86  ? 22.975 -5.228  -8.004  1.00 17.51 ? 363 ALA A CA  1 
ATOM   666  C C   . ALA A 1 86  ? 24.020 -6.295  -7.698  1.00 17.57 ? 363 ALA A C   1 
ATOM   667  O O   . ALA A 1 86  ? 25.159 -5.977  -7.368  1.00 18.13 ? 363 ALA A O   1 
ATOM   668  C CB  . ALA A 1 86  ? 23.106 -4.767  -9.453  1.00 17.18 ? 363 ALA A CB  1 
ATOM   669  N N   . ALA A 1 87  ? 23.634 -7.560  -7.822  1.00 20.04 ? 364 ALA A N   1 
ATOM   670  C CA  . ALA A 1 87  ? 24.552 -8.660  -7.549  1.00 21.35 ? 364 ALA A CA  1 
ATOM   671  C C   . ALA A 1 87  ? 25.767 -8.660  -8.472  1.00 22.95 ? 364 ALA A C   1 
ATOM   672  O O   . ALA A 1 87  ? 26.851 -9.088  -8.076  1.00 23.52 ? 364 ALA A O   1 
ATOM   673  C CB  . ALA A 1 87  ? 23.815 -9.993  -7.661  1.00 22.00 ? 364 ALA A CB  1 
ATOM   674  N N   . GLU A 1 88  ? 25.586 -8.172  -9.696  1.00 25.62 ? 365 GLU A N   1 
ATOM   675  C CA  . GLU A 1 88  ? 26.663 -8.124  -10.685 1.00 27.92 ? 365 GLU A CA  1 
ATOM   676  C C   . GLU A 1 88  ? 27.480 -6.834  -10.616 1.00 27.09 ? 365 GLU A C   1 
ATOM   677  O O   . GLU A 1 88  ? 28.435 -6.654  -11.373 1.00 26.83 ? 365 GLU A O   1 
ATOM   678  C CB  . GLU A 1 88  ? 26.080 -8.261  -12.096 1.00 42.65 ? 365 GLU A CB  1 
ATOM   679  C CG  . GLU A 1 88  ? 25.361 -9.572  -12.367 1.00 47.20 ? 365 GLU A CG  1 
ATOM   680  C CD  . GLU A 1 88  ? 26.309 -10.707 -12.702 1.00 50.41 ? 365 GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 88  ? 25.825 -11.832 -12.947 1.00 53.27 ? 365 GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 88  ? 27.537 -10.478 -12.726 1.00 51.72 ? 365 GLU A OE2 1 
ATOM   683  N N   . ALA A 1 89  ? 27.103 -5.933  -9.715  1.00 21.42 ? 366 ALA A N   1 
ATOM   684  C CA  . ALA A 1 89  ? 27.809 -4.665  -9.589  1.00 20.48 ? 366 ALA A CA  1 
ATOM   685  C C   . ALA A 1 89  ? 29.151 -4.811  -8.876  1.00 20.05 ? 366 ALA A C   1 
ATOM   686  O O   . ALA A 1 89  ? 29.307 -5.646  -7.978  1.00 18.68 ? 366 ALA A O   1 
ATOM   687  C CB  . ALA A 1 89  ? 26.931 -3.655  -8.856  1.00 21.29 ? 366 ALA A CB  1 
ATOM   688  N N   . PRO A 1 90  ? 30.147 -4.006  -9.282  1.00 20.95 ? 367 PRO A N   1 
ATOM   689  C CA  . PRO A 1 90  ? 31.472 -4.061  -8.661  1.00 21.13 ? 367 PRO A CA  1 
ATOM   690  C C   . PRO A 1 90  ? 31.441 -3.497  -7.243  1.00 20.46 ? 367 PRO A C   1 
ATOM   691  O O   . PRO A 1 90  ? 30.741 -2.522  -6.972  1.00 21.20 ? 367 PRO A O   1 
ATOM   692  C CB  . PRO A 1 90  ? 32.330 -3.224  -9.607  1.00 29.98 ? 367 PRO A CB  1 
ATOM   693  C CG  . PRO A 1 90  ? 31.362 -2.211  -10.127 1.00 31.01 ? 367 PRO A CG  1 
ATOM   694  C CD  . PRO A 1 90  ? 30.132 -3.047  -10.402 1.00 28.54 ? 367 PRO A CD  1 
ATOM   695  N N   . ARG A 1 91  ? 32.185 -4.128  -6.339  1.00 19.37 ? 368 ARG A N   1 
ATOM   696  C CA  . ARG A 1 91  ? 32.253 -3.690  -4.948  1.00 19.58 ? 368 ARG A CA  1 
ATOM   697  C C   . ARG A 1 91  ? 33.660 -3.237  -4.585  1.00 19.54 ? 368 ARG A C   1 
ATOM   698  O O   . ARG A 1 91  ? 33.903 -2.758  -3.475  1.00 18.90 ? 368 ARG A O   1 
ATOM   699  C CB  . ARG A 1 91  ? 31.855 -4.830  -4.007  1.00 21.21 ? 368 ARG A CB  1 
ATOM   700  C CG  . ARG A 1 91  ? 30.464 -5.384  -4.230  1.00 21.51 ? 368 ARG A CG  1 
ATOM   701  C CD  . ARG A 1 91  ? 30.156 -6.468  -3.208  1.00 18.89 ? 368 ARG A CD  1 
ATOM   702  N NE  . ARG A 1 91  ? 28.819 -7.022  -3.394  1.00 20.19 ? 368 ARG A NE  1 
ATOM   703  C CZ  . ARG A 1 91  ? 28.311 -8.011  -2.664  1.00 18.48 ? 368 ARG A CZ  1 
ATOM   704  N NH1 . ARG A 1 91  ? 29.028 -8.552  -1.688  1.00 18.34 ? 368 ARG A NH1 1 
ATOM   705  N NH2 . ARG A 1 91  ? 27.092 -8.472  -2.919  1.00 18.93 ? 368 ARG A NH2 1 
ATOM   706  N N   . ARG A 1 92  ? 34.589 -3.392  -5.524  1.00 21.18 ? 369 ARG A N   1 
ATOM   707  C CA  . ARG A 1 92  ? 35.977 -3.021  -5.278  1.00 22.73 ? 369 ARG A CA  1 
ATOM   708  C C   . ARG A 1 92  ? 36.361 -1.682  -5.898  1.00 20.76 ? 369 ARG A C   1 
ATOM   709  O O   . ARG A 1 92  ? 35.896 -1.324  -6.984  1.00 22.65 ? 369 ARG A O   1 
ATOM   710  C CB  . ARG A 1 92  ? 36.903 -4.120  -5.803  1.00 24.06 ? 369 ARG A CB  1 
ATOM   711  C CG  . ARG A 1 92  ? 36.544 -5.513  -5.304  1.00 25.26 ? 369 ARG A CG  1 
ATOM   712  C CD  . ARG A 1 92  ? 36.929 -5.735  -3.845  1.00 26.93 ? 369 ARG A CD  1 
ATOM   713  N NE  . ARG A 1 92  ? 38.378 -5.791  -3.674  1.00 27.86 ? 369 ARG A NE  1 
ATOM   714  C CZ  . ARG A 1 92  ? 38.992 -6.303  -2.612  1.00 28.26 ? 369 ARG A CZ  1 
ATOM   715  N NH1 . ARG A 1 92  ? 38.286 -6.808  -1.610  1.00 27.06 ? 369 ARG A NH1 1 
ATOM   716  N NH2 . ARG A 1 92  ? 40.317 -6.324  -2.561  1.00 27.17 ? 369 ARG A NH2 1 
ATOM   717  N N   . GLY A 1 93  ? 37.214 -0.950  -5.192  1.00 21.09 ? 370 GLY A N   1 
ATOM   718  C CA  . GLY A 1 93  ? 37.657 0.345   -5.666  1.00 23.70 ? 370 GLY A CA  1 
ATOM   719  C C   . GLY A 1 93  ? 36.649 1.424   -5.332  1.00 24.58 ? 370 GLY A C   1 
ATOM   720  O O   . GLY A 1 93  ? 35.659 1.167   -4.648  1.00 24.99 ? 370 GLY A O   1 
ATOM   721  N N   . ARG A 1 94  ? 36.902 2.635   -5.808  1.00 27.04 ? 371 ARG A N   1 
ATOM   722  C CA  . ARG A 1 94  ? 36.001 3.749   -5.563  1.00 28.83 ? 371 ARG A CA  1 
ATOM   723  C C   . ARG A 1 94  ? 34.726 3.465   -6.350  1.00 27.43 ? 371 ARG A C   1 
ATOM   724  O O   . ARG A 1 94  ? 34.778 3.223   -7.555  1.00 28.61 ? 371 ARG A O   1 
ATOM   725  C CB  . ARG A 1 94  ? 36.653 5.045   -6.041  1.00 34.44 ? 371 ARG A CB  1 
ATOM   726  C CG  . ARG A 1 94  ? 35.959 6.319   -5.604  1.00 38.14 ? 371 ARG A CG  1 
ATOM   727  C CD  . ARG A 1 94  ? 36.875 7.500   -5.862  1.00 40.11 ? 371 ARG A CD  1 
ATOM   728  N NE  . ARG A 1 94  ? 38.124 7.356   -5.119  1.00 42.25 ? 371 ARG A NE  1 
ATOM   729  C CZ  . ARG A 1 94  ? 39.235 8.040   -5.375  1.00 42.90 ? 371 ARG A CZ  1 
ATOM   730  N NH1 . ARG A 1 94  ? 39.262 8.925   -6.362  1.00 43.82 ? 371 ARG A NH1 1 
ATOM   731  N NH2 . ARG A 1 94  ? 40.320 7.836   -4.641  1.00 43.12 ? 371 ARG A NH2 1 
ATOM   732  N N   . LEU A 1 95  ? 33.587 3.482   -5.669  1.00 24.96 ? 372 LEU A N   1 
ATOM   733  C CA  . LEU A 1 95  ? 32.318 3.197   -6.325  1.00 24.28 ? 372 LEU A CA  1 
ATOM   734  C C   . LEU A 1 95  ? 31.571 4.441   -6.783  1.00 23.48 ? 372 LEU A C   1 
ATOM   735  O O   . LEU A 1 95  ? 31.701 5.512   -6.190  1.00 23.79 ? 372 LEU A O   1 
ATOM   736  C CB  . LEU A 1 95  ? 31.421 2.379   -5.397  1.00 25.42 ? 372 LEU A CB  1 
ATOM   737  C CG  . LEU A 1 95  ? 31.979 1.020   -4.963  1.00 25.59 ? 372 LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 95  ? 30.910 0.260   -4.198  1.00 25.86 ? 372 LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 95  ? 32.426 0.226   -6.184  1.00 25.82 ? 372 LEU A CD2 1 
ATOM   740  N N   . HIS A 1 96  ? 30.793 4.286   -7.851  1.00 20.97 ? 373 HIS A N   1 
ATOM   741  C CA  . HIS A 1 96  ? 30.002 5.381   -8.399  1.00 20.56 ? 373 HIS A CA  1 
ATOM   742  C C   . HIS A 1 96  ? 28.535 5.103   -8.103  1.00 18.46 ? 373 HIS A C   1 
ATOM   743  O O   . HIS A 1 96  ? 27.940 4.187   -8.671  1.00 19.63 ? 373 HIS A O   1 
ATOM   744  C CB  . HIS A 1 96  ? 30.223 5.497   -9.909  1.00 36.95 ? 373 HIS A CB  1 
ATOM   745  C CG  . HIS A 1 96  ? 31.654 5.718   -10.290 1.00 41.58 ? 373 HIS A CG  1 
ATOM   746  N ND1 . HIS A 1 96  ? 32.615 4.737   -10.175 1.00 43.92 ? 373 HIS A ND1 1 
ATOM   747  C CD2 . HIS A 1 96  ? 32.293 6.818   -10.756 1.00 44.81 ? 373 HIS A CD2 1 
ATOM   748  C CE1 . HIS A 1 96  ? 33.784 5.222   -10.553 1.00 44.90 ? 373 HIS A CE1 1 
ATOM   749  N NE2 . HIS A 1 96  ? 33.617 6.483   -10.910 1.00 45.08 ? 373 HIS A NE2 1 
ATOM   750  N N   . ALA A 1 97  ? 27.961 5.910   -7.216  1.00 19.61 ? 374 ALA A N   1 
ATOM   751  C CA  . ALA A 1 97  ? 26.575 5.740   -6.801  1.00 18.96 ? 374 ALA A CA  1 
ATOM   752  C C   . ALA A 1 97  ? 25.534 6.248   -7.790  1.00 18.41 ? 374 ALA A C   1 
ATOM   753  O O   . ALA A 1 97  ? 24.939 7.311   -7.599  1.00 16.98 ? 374 ALA A O   1 
ATOM   754  C CB  . ALA A 1 97  ? 26.362 6.393   -5.438  1.00 23.30 ? 374 ALA A CB  1 
ATOM   755  N N   . VAL A 1 98  ? 25.327 5.480   -8.853  1.00 17.91 ? 375 VAL A N   1 
ATOM   756  C CA  . VAL A 1 98  ? 24.329 5.796   -9.865  1.00 17.15 ? 375 VAL A CA  1 
ATOM   757  C C   . VAL A 1 98  ? 23.698 4.476   -10.283 1.00 18.76 ? 375 VAL A C   1 
ATOM   758  O O   . VAL A 1 98  ? 24.372 3.441   -10.346 1.00 17.21 ? 375 VAL A O   1 
ATOM   759  C CB  . VAL A 1 98  ? 24.932 6.510   -11.103 1.00 19.78 ? 375 VAL A CB  1 
ATOM   760  C CG1 . VAL A 1 98  ? 25.499 7.866   -10.695 1.00 21.24 ? 375 VAL A CG1 1 
ATOM   761  C CG2 . VAL A 1 98  ? 26.003 5.641   -11.746 1.00 20.61 ? 375 VAL A CG2 1 
ATOM   762  N N   . PRO A 1 99  ? 22.389 4.487   -10.561 1.00 17.95 ? 376 PRO A N   1 
ATOM   763  C CA  . PRO A 1 99  ? 21.671 3.276   -10.965 1.00 18.80 ? 376 PRO A CA  1 
ATOM   764  C C   . PRO A 1 99  ? 22.326 2.476   -12.091 1.00 18.11 ? 376 PRO A C   1 
ATOM   765  O O   . PRO A 1 99  ? 22.363 1.242   -12.042 1.00 19.14 ? 376 PRO A O   1 
ATOM   766  C CB  . PRO A 1 99  ? 20.299 3.810   -11.359 1.00 21.34 ? 376 PRO A CB  1 
ATOM   767  C CG  . PRO A 1 99  ? 20.115 4.954   -10.410 1.00 18.77 ? 376 PRO A CG  1 
ATOM   768  C CD  . PRO A 1 99  ? 21.469 5.637   -10.463 1.00 18.80 ? 376 PRO A CD  1 
ATOM   769  N N   . SER A 1 100 ? 22.838 3.172   -13.100 1.00 18.35 ? 377 SER A N   1 
ATOM   770  C CA  . SER A 1 100 ? 23.463 2.489   -14.231 1.00 18.80 ? 377 SER A CA  1 
ATOM   771  C C   . SER A 1 100 ? 24.596 1.559   -13.819 1.00 20.16 ? 377 SER A C   1 
ATOM   772  O O   . SER A 1 100 ? 24.840 0.543   -14.479 1.00 20.80 ? 377 SER A O   1 
ATOM   773  C CB  . SER A 1 100 ? 23.976 3.500   -15.264 1.00 19.89 ? 377 SER A CB  1 
ATOM   774  O OG  . SER A 1 100 ? 24.946 4.370   -14.716 1.00 20.94 ? 377 SER A OG  1 
ATOM   775  N N   . GLN A 1 101 ? 25.281 1.888   -12.728 1.00 19.26 ? 378 GLN A N   1 
ATOM   776  C CA  . GLN A 1 101 ? 26.381 1.047   -12.280 1.00 20.23 ? 378 GLN A CA  1 
ATOM   777  C C   . GLN A 1 101 ? 26.011 0.095   -11.150 1.00 20.95 ? 378 GLN A C   1 
ATOM   778  O O   . GLN A 1 101 ? 26.882 -0.465  -10.483 1.00 22.20 ? 378 GLN A O   1 
ATOM   779  C CB  . GLN A 1 101 ? 27.588 1.909   -11.909 1.00 20.65 ? 378 GLN A CB  1 
ATOM   780  C CG  . GLN A 1 101 ? 28.054 2.751   -13.091 1.00 21.56 ? 378 GLN A CG  1 
ATOM   781  C CD  . GLN A 1 101 ? 29.441 3.333   -12.924 1.00 22.58 ? 378 GLN A CD  1 
ATOM   782  O OE1 . GLN A 1 101 ? 29.795 4.300   -13.601 1.00 24.19 ? 378 GLN A OE1 1 
ATOM   783  N NE2 . GLN A 1 101 ? 30.237 2.743   -12.041 1.00 20.86 ? 378 GLN A NE2 1 
ATOM   784  N N   . GLY A 1 102 ? 24.709 -0.074  -10.936 1.00 18.53 ? 379 GLY A N   1 
ATOM   785  C CA  . GLY A 1 102 ? 24.228 -1.015  -9.941  1.00 18.17 ? 379 GLY A CA  1 
ATOM   786  C C   . GLY A 1 102 ? 23.942 -0.556  -8.525  1.00 16.02 ? 379 GLY A C   1 
ATOM   787  O O   . GLY A 1 102 ? 23.746 -1.388  -7.642  1.00 16.98 ? 379 GLY A O   1 
ATOM   788  N N   . LEU A 1 103 ? 23.906 0.750   -8.295  1.00 16.27 ? 380 LEU A N   1 
ATOM   789  C CA  . LEU A 1 103 ? 23.635 1.262   -6.957  1.00 15.46 ? 380 LEU A CA  1 
ATOM   790  C C   . LEU A 1 103 ? 22.417 2.167   -6.979  1.00 16.11 ? 380 LEU A C   1 
ATOM   791  O O   . LEU A 1 103 ? 22.340 3.081   -7.794  1.00 16.48 ? 380 LEU A O   1 
ATOM   792  C CB  . LEU A 1 103 ? 24.851 2.035   -6.440  1.00 15.87 ? 380 LEU A CB  1 
ATOM   793  C CG  . LEU A 1 103 ? 26.003 1.177   -5.907  1.00 18.52 ? 380 LEU A CG  1 
ATOM   794  C CD1 . LEU A 1 103 ? 27.278 2.007   -5.756  1.00 19.50 ? 380 LEU A CD1 1 
ATOM   795  C CD2 . LEU A 1 103 ? 25.581 0.584   -4.569  1.00 20.06 ? 380 LEU A CD2 1 
ATOM   796  N N   . TRP A 1 104 ? 21.465 1.890   -6.093  1.00 14.33 ? 381 TRP A N   1 
ATOM   797  C CA  . TRP A 1 104 ? 20.231 2.676   -5.982  1.00 15.49 ? 381 TRP A CA  1 
ATOM   798  C C   . TRP A 1 104 ? 20.196 3.139   -4.538  1.00 13.57 ? 381 TRP A C   1 
ATOM   799  O O   . TRP A 1 104 ? 19.780 2.398   -3.649  1.00 14.35 ? 381 TRP A O   1 
ATOM   800  C CB  . TRP A 1 104 ? 19.025 1.788   -6.287  1.00 18.65 ? 381 TRP A CB  1 
ATOM   801  C CG  . TRP A 1 104 ? 18.921 1.374   -7.726  1.00 23.79 ? 381 TRP A CG  1 
ATOM   802  C CD1 . TRP A 1 104 ? 18.224 2.007   -8.718  1.00 25.14 ? 381 TRP A CD1 1 
ATOM   803  C CD2 . TRP A 1 104 ? 19.533 0.231   -8.331  1.00 27.50 ? 381 TRP A CD2 1 
ATOM   804  N NE1 . TRP A 1 104 ? 18.363 1.324   -9.903  1.00 28.96 ? 381 TRP A NE1 1 
ATOM   805  C CE2 . TRP A 1 104 ? 19.162 0.231   -9.695  1.00 27.09 ? 381 TRP A CE2 1 
ATOM   806  C CE3 . TRP A 1 104 ? 20.359 -0.795  -7.854  1.00 28.24 ? 381 TRP A CE3 1 
ATOM   807  C CZ2 . TRP A 1 104 ? 19.589 -0.756  -10.588 1.00 30.18 ? 381 TRP A CZ2 1 
ATOM   808  C CZ3 . TRP A 1 104 ? 20.784 -1.779  -8.743  1.00 30.77 ? 381 TRP A CZ3 1 
ATOM   809  C CH2 . TRP A 1 104 ? 20.397 -1.750  -10.095 1.00 30.90 ? 381 TRP A CH2 1 
ATOM   810  N N   . LEU A 1 105 ? 20.622 4.377   -4.303  1.00 14.30 ? 382 LEU A N   1 
ATOM   811  C CA  . LEU A 1 105 ? 20.725 4.864   -2.937  1.00 13.99 ? 382 LEU A CA  1 
ATOM   812  C C   . LEU A 1 105 ? 20.109 6.195   -2.588  1.00 15.51 ? 382 LEU A C   1 
ATOM   813  O O   . LEU A 1 105 ? 19.983 7.081   -3.428  1.00 14.88 ? 382 LEU A O   1 
ATOM   814  C CB  . LEU A 1 105 ? 22.196 4.990   -2.541  1.00 15.69 ? 382 LEU A CB  1 
ATOM   815  C CG  . LEU A 1 105 ? 23.183 3.862   -2.815  1.00 18.89 ? 382 LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 105 ? 22.670 2.582   -2.193  1.00 18.86 ? 382 LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 105 ? 23.380 3.707   -4.299  1.00 26.11 ? 382 LEU A CD2 1 
ATOM   818  N N   . LEU A 1 106 ? 19.764 6.298   -1.309  1.00 14.66 ? 383 LEU A N   1 
ATOM   819  C CA  . LEU A 1 106 ? 19.262 7.514   -0.686  1.00 14.97 ? 383 LEU A CA  1 
ATOM   820  C C   . LEU A 1 106 ? 20.335 7.726   0.375   1.00 14.61 ? 383 LEU A C   1 
ATOM   821  O O   . LEU A 1 106 ? 20.759 6.766   1.031   1.00 15.31 ? 383 LEU A O   1 
ATOM   822  C CB  . LEU A 1 106 ? 17.925 7.276   0.015   1.00 16.73 ? 383 LEU A CB  1 
ATOM   823  C CG  . LEU A 1 106 ? 17.526 8.442   0.928   1.00 19.07 ? 383 LEU A CG  1 
ATOM   824  C CD1 . LEU A 1 106 ? 17.134 9.639   0.075   1.00 21.80 ? 383 LEU A CD1 1 
ATOM   825  C CD2 . LEU A 1 106 ? 16.379 8.016   1.844   1.00 21.67 ? 383 LEU A CD2 1 
ATOM   826  N N   . GLY A 1 107 ? 20.796 8.956   0.543   1.00 14.69 ? 384 GLY A N   1 
ATOM   827  C CA  . GLY A 1 107 ? 21.812 9.193   1.549   1.00 15.63 ? 384 GLY A CA  1 
ATOM   828  C C   . GLY A 1 107 ? 21.610 10.486  2.304   1.00 15.21 ? 384 GLY A C   1 
ATOM   829  O O   . GLY A 1 107 ? 20.748 11.299  1.953   1.00 16.71 ? 384 GLY A O   1 
ATOM   830  N N   . LEU A 1 108 ? 22.402 10.662  3.351   1.00 13.55 ? 385 LEU A N   1 
ATOM   831  C CA  . LEU A 1 108 ? 22.363 11.868  4.169   1.00 15.49 ? 385 LEU A CA  1 
ATOM   832  C C   . LEU A 1 108 ? 23.783 12.394  4.323   1.00 15.99 ? 385 LEU A C   1 
ATOM   833  O O   . LEU A 1 108 ? 24.727 11.616  4.463   1.00 14.74 ? 385 LEU A O   1 
ATOM   834  C CB  . LEU A 1 108 ? 21.794 11.564  5.561   1.00 16.59 ? 385 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 108 ? 21.699 12.775  6.498   1.00 15.75 ? 385 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 108 ? 20.590 13.710  6.012   1.00 18.52 ? 385 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 108 ? 21.415 12.312  7.912   1.00 17.78 ? 385 LEU A CD2 1 
ATOM   838  N N   . ARG A 1 109 ? 23.933 13.715  4.278   1.00 19.68 ? 386 ARG A N   1 
ATOM   839  C CA  . ARG A 1 109 ? 25.235 14.350  4.455   1.00 23.66 ? 386 ARG A CA  1 
ATOM   840  C C   . ARG A 1 109 ? 25.079 15.502  5.436   1.00 25.91 ? 386 ARG A C   1 
ATOM   841  O O   . ARG A 1 109 ? 24.024 16.130  5.490   1.00 23.29 ? 386 ARG A O   1 
ATOM   842  C CB  . ARG A 1 109 ? 25.774 14.890  3.127   1.00 32.64 ? 386 ARG A CB  1 
ATOM   843  C CG  . ARG A 1 109 ? 26.170 13.820  2.129   1.00 36.00 ? 386 ARG A CG  1 
ATOM   844  C CD  . ARG A 1 109 ? 26.909 14.407  0.927   1.00 37.00 ? 386 ARG A CD  1 
ATOM   845  N NE  . ARG A 1 109 ? 26.108 15.379  0.183   1.00 39.28 ? 386 ARG A NE  1 
ATOM   846  C CZ  . ARG A 1 109 ? 26.080 16.685  0.429   1.00 37.49 ? 386 ARG A CZ  1 
ATOM   847  N NH1 . ARG A 1 109 ? 26.815 17.201  1.405   1.00 42.85 ? 386 ARG A NH1 1 
ATOM   848  N NH2 . ARG A 1 109 ? 25.309 17.479  -0.303  1.00 39.58 ? 386 ARG A NH2 1 
ATOM   849  N N   . GLU A 1 110 ? 26.122 15.763  6.219   1.00 31.34 ? 387 GLU A N   1 
ATOM   850  C CA  . GLU A 1 110 ? 26.110 16.850  7.198   1.00 33.47 ? 387 GLU A CA  1 
ATOM   851  C C   . GLU A 1 110 ? 24.970 16.746  8.206   1.00 34.40 ? 387 GLU A C   1 
ATOM   852  O O   . GLU A 1 110 ? 24.643 17.720  8.890   1.00 35.34 ? 387 GLU A O   1 
ATOM   853  C CB  . GLU A 1 110 ? 26.022 18.196  6.476   1.00 41.13 ? 387 GLU A CB  1 
ATOM   854  C CG  . GLU A 1 110 ? 27.033 18.355  5.355   1.00 44.09 ? 387 GLU A CG  1 
ATOM   855  C CD  . GLU A 1 110 ? 28.464 18.217  5.832   1.00 47.57 ? 387 GLU A CD  1 
ATOM   856  O OE1 . GLU A 1 110 ? 29.375 18.218  4.978   1.00 50.49 ? 387 GLU A OE1 1 
ATOM   857  O OE2 . GLU A 1 110 ? 28.682 18.113  7.058   1.00 48.47 ? 387 GLU A OE2 1 
ATOM   858  N N   . GLY A 1 111 ? 24.364 15.568  8.293   1.00 34.19 ? 388 GLY A N   1 
ATOM   859  C CA  . GLY A 1 111 ? 23.269 15.367  9.221   1.00 33.99 ? 388 GLY A CA  1 
ATOM   860  C C   . GLY A 1 111 ? 22.023 16.162  8.879   1.00 34.29 ? 388 GLY A C   1 
ATOM   861  O O   . GLY A 1 111 ? 21.084 16.216  9.674   1.00 35.73 ? 388 GLY A O   1 
ATOM   862  N N   . LYS A 1 112 ? 21.992 16.776  7.701   1.00 32.23 ? 389 LYS A N   1 
ATOM   863  C CA  . LYS A 1 112 ? 20.819 17.553  7.325   1.00 32.30 ? 389 LYS A CA  1 
ATOM   864  C C   . LYS A 1 112 ? 20.445 17.559  5.851   1.00 28.73 ? 389 LYS A C   1 
ATOM   865  O O   . LYS A 1 112 ? 19.345 17.981  5.499   1.00 30.39 ? 389 LYS A O   1 
ATOM   866  C CB  . LYS A 1 112 ? 20.970 18.991  7.818   1.00 45.28 ? 389 LYS A CB  1 
ATOM   867  C CG  . LYS A 1 112 ? 22.330 19.608  7.565   1.00 49.72 ? 389 LYS A CG  1 
ATOM   868  C CD  . LYS A 1 112 ? 22.423 21.003  8.174   1.00 54.47 ? 389 LYS A CD  1 
ATOM   869  C CE  . LYS A 1 112 ? 22.147 21.001  9.679   1.00 56.74 ? 389 LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 112 ? 20.726 20.696  10.022  1.00 58.49 ? 389 LYS A NZ  1 
ATOM   871  N N   . ILE A 1 113 ? 21.341 17.096  4.986   1.00 21.52 ? 390 ILE A N   1 
ATOM   872  C CA  . ILE A 1 113 ? 21.035 17.076  3.562   1.00 19.66 ? 390 ILE A CA  1 
ATOM   873  C C   . ILE A 1 113 ? 20.715 15.670  3.077   1.00 18.55 ? 390 ILE A C   1 
ATOM   874  O O   . ILE A 1 113 ? 21.601 14.822  2.986   1.00 18.11 ? 390 ILE A O   1 
ATOM   875  C CB  . ILE A 1 113 ? 22.204 17.634  2.724   1.00 24.76 ? 390 ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 113 ? 22.486 19.083  3.133   1.00 26.13 ? 390 ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 113 ? 21.862 17.564  1.240   1.00 27.39 ? 390 ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 113 ? 21.278 19.999  3.007   1.00 29.05 ? 390 ILE A CD1 1 
ATOM   879  N N   . LEU A 1 114 ? 19.440 15.439  2.782   1.00 19.33 ? 391 LEU A N   1 
ATOM   880  C CA  . LEU A 1 114 ? 18.962 14.151  2.291   1.00 19.87 ? 391 LEU A CA  1 
ATOM   881  C C   . LEU A 1 114 ? 19.059 14.227  0.775   1.00 19.53 ? 391 LEU A C   1 
ATOM   882  O O   . LEU A 1 114 ? 18.594 15.190  0.167   1.00 20.06 ? 391 LEU A O   1 
ATOM   883  C CB  . LEU A 1 114 ? 17.505 13.943  2.703   1.00 24.77 ? 391 LEU A CB  1 
ATOM   884  C CG  . LEU A 1 114 ? 16.926 12.531  2.679   1.00 29.27 ? 391 LEU A CG  1 
ATOM   885  C CD1 . LEU A 1 114 ? 17.635 11.665  3.715   1.00 27.71 ? 391 LEU A CD1 1 
ATOM   886  C CD2 . LEU A 1 114 ? 15.434 12.598  2.988   1.00 31.52 ? 391 LEU A CD2 1 
ATOM   887  N N   . GLU A 1 115 ? 19.664 13.227  0.150   1.00 18.33 ? 392 GLU A N   1 
ATOM   888  C CA  . GLU A 1 115 ? 19.797 13.278  -1.297  1.00 18.58 ? 392 GLU A CA  1 
ATOM   889  C C   . GLU A 1 115 ? 19.619 11.929  -1.967  1.00 17.67 ? 392 GLU A C   1 
ATOM   890  O O   . GLU A 1 115 ? 20.021 10.893  -1.436  1.00 18.68 ? 392 GLU A O   1 
ATOM   891  C CB  . GLU A 1 115 ? 21.154 13.887  -1.677  1.00 22.17 ? 392 GLU A CB  1 
ATOM   892  C CG  . GLU A 1 115 ? 22.361 13.136  -1.150  1.00 23.88 ? 392 GLU A CG  1 
ATOM   893  C CD  . GLU A 1 115 ? 23.648 13.953  -1.212  1.00 25.60 ? 392 GLU A CD  1 
ATOM   894  O OE1 . GLU A 1 115 ? 24.723 13.372  -0.962  1.00 29.35 ? 392 GLU A OE1 1 
ATOM   895  O OE2 . GLU A 1 115 ? 23.590 15.168  -1.500  1.00 28.01 ? 392 GLU A OE2 1 
ATOM   896  N N   . ALA A 1 116 ? 18.989 11.954  -3.132  1.00 14.85 ? 393 ALA A N   1 
ATOM   897  C CA  . ALA A 1 116 ? 18.767 10.737  -3.901  1.00 14.41 ? 393 ALA A CA  1 
ATOM   898  C C   . ALA A 1 116 ? 19.883 10.658  -4.930  1.00 15.77 ? 393 ALA A C   1 
ATOM   899  O O   . ALA A 1 116 ? 20.155 11.618  -5.660  1.00 16.46 ? 393 ALA A O   1 
ATOM   900  C CB  . ALA A 1 116 ? 17.407 10.787  -4.595  1.00 20.82 ? 393 ALA A CB  1 
ATOM   901  N N   . HIS A 1 117 ? 20.550 9.513   -4.988  1.00 15.72 ? 394 HIS A N   1 
ATOM   902  C CA  . HIS A 1 117 ? 21.639 9.360   -5.933  1.00 16.29 ? 394 HIS A CA  1 
ATOM   903  C C   . HIS A 1 117 ? 21.115 8.922   -7.293  1.00 17.95 ? 394 HIS A C   1 
ATOM   904  O O   . HIS A 1 117 ? 21.186 7.753   -7.679  1.00 16.93 ? 394 HIS A O   1 
ATOM   905  C CB  . HIS A 1 117 ? 22.682 8.401   -5.360  1.00 17.83 ? 394 HIS A CB  1 
ATOM   906  C CG  . HIS A 1 117 ? 23.458 9.001   -4.230  1.00 17.24 ? 394 HIS A CG  1 
ATOM   907  N ND1 . HIS A 1 117 ? 22.959 9.093   -2.949  1.00 19.53 ? 394 HIS A ND1 1 
ATOM   908  C CD2 . HIS A 1 117 ? 24.648 9.648   -4.217  1.00 17.18 ? 394 HIS A CD2 1 
ATOM   909  C CE1 . HIS A 1 117 ? 23.807 9.772   -2.196  1.00 18.23 ? 394 HIS A CE1 1 
ATOM   910  N NE2 . HIS A 1 117 ? 24.840 10.121  -2.941  1.00 20.23 ? 394 HIS A NE2 1 
ATOM   911  N N   . VAL A 1 118 ? 20.553 9.902   -7.993  1.00 17.36 ? 395 VAL A N   1 
ATOM   912  C CA  . VAL A 1 118 ? 19.972 9.712   -9.313  1.00 18.40 ? 395 VAL A CA  1 
ATOM   913  C C   . VAL A 1 118 ? 21.038 9.637   -10.395 1.00 18.82 ? 395 VAL A C   1 
ATOM   914  O O   . VAL A 1 118 ? 22.208 9.941   -10.162 1.00 19.86 ? 395 VAL A O   1 
ATOM   915  C CB  . VAL A 1 118 ? 19.009 10.871  -9.653  1.00 19.13 ? 395 VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 118 ? 17.870 10.901  -8.657  1.00 22.45 ? 395 VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 118 ? 19.763 12.199  -9.627  1.00 20.71 ? 395 VAL A CG2 1 
ATOM   918  N N   . GLU A 1 119 ? 20.619 9.223   -11.584 1.00 18.78 ? 396 GLU A N   1 
ATOM   919  C CA  . GLU A 1 119 ? 21.532 9.113   -12.716 1.00 21.21 ? 396 GLU A CA  1 
ATOM   920  C C   . GLU A 1 119 ? 21.860 10.535  -13.162 1.00 24.77 ? 396 GLU A C   1 
ATOM   921  O O   . GLU A 1 119 ? 21.132 11.128  -13.956 1.00 27.38 ? 396 GLU A O   1 
ATOM   922  C CB  . GLU A 1 119 ? 20.861 8.343   -13.855 1.00 21.16 ? 396 GLU A CB  1 
ATOM   923  C CG  . GLU A 1 119 ? 21.806 7.846   -14.945 1.00 20.37 ? 396 GLU A CG  1 
ATOM   924  C CD  . GLU A 1 119 ? 22.719 6.736   -14.463 1.00 18.94 ? 396 GLU A CD  1 
ATOM   925  O OE1 . GLU A 1 119 ? 22.225 5.836   -13.746 1.00 18.86 ? 396 GLU A OE1 1 
ATOM   926  O OE2 . GLU A 1 119 ? 23.925 6.759   -14.804 1.00 19.82 ? 396 GLU A OE2 1 
ATOM   927  N N   . ALA A 1 120 ? 22.946 11.076  -12.622 1.00 40.12 ? 397 ALA A N   1 
ATOM   928  C CA  . ALA A 1 120 ? 23.393 12.428  -12.942 1.00 44.24 ? 397 ALA A CA  1 
ATOM   929  C C   . ALA A 1 120 ? 24.762 12.636  -12.308 1.00 47.06 ? 397 ALA A C   1 
ATOM   930  O O   . ALA A 1 120 ? 25.273 11.748  -11.627 1.00 48.28 ? 397 ALA A O   1 
ATOM   931  C CB  . ALA A 1 120 ? 22.401 13.451  -12.403 1.00 40.09 ? 397 ALA A CB  1 
ATOM   932  N N   . LYS A 1 121 ? 25.358 13.804  -12.527 1.00 55.64 ? 398 LYS A N   1 
ATOM   933  C CA  . LYS A 1 121 ? 26.670 14.077  -11.955 1.00 57.92 ? 398 LYS A CA  1 
ATOM   934  C C   . LYS A 1 121 ? 26.543 14.595  -10.526 1.00 56.94 ? 398 LYS A C   1 
ATOM   935  O O   . LYS A 1 121 ? 27.521 14.626  -9.779  1.00 58.83 ? 398 LYS A O   1 
ATOM   936  C CB  . LYS A 1 121 ? 27.431 15.092  -12.814 1.00 54.62 ? 398 LYS A CB  1 
ATOM   937  C CG  . LYS A 1 121 ? 28.911 15.197  -12.470 1.00 59.27 ? 398 LYS A CG  1 
ATOM   938  C CD  . LYS A 1 121 ? 29.612 13.854  -12.649 1.00 63.54 ? 398 LYS A CD  1 
ATOM   939  C CE  . LYS A 1 121 ? 31.089 13.939  -12.295 1.00 65.91 ? 398 LYS A CE  1 
ATOM   940  N NZ  . LYS A 1 121 ? 31.300 14.360  -10.882 1.00 67.69 ? 398 LYS A NZ  1 
ATOM   941  N N   . GLU A 1 122 ? 25.332 14.998  -10.150 1.00 37.70 ? 399 GLU A N   1 
ATOM   942  C CA  . GLU A 1 122 ? 25.082 15.504  -8.804  1.00 34.77 ? 399 GLU A CA  1 
ATOM   943  C C   . GLU A 1 122 ? 23.806 14.929  -8.196  1.00 31.10 ? 399 GLU A C   1 
ATOM   944  O O   . GLU A 1 122 ? 22.754 14.895  -8.838  1.00 30.10 ? 399 GLU A O   1 
ATOM   945  C CB  . GLU A 1 122 ? 24.996 17.032  -8.813  1.00 51.25 ? 399 GLU A CB  1 
ATOM   946  C CG  . GLU A 1 122 ? 26.310 17.723  -9.132  1.00 55.83 ? 399 GLU A CG  1 
ATOM   947  C CD  . GLU A 1 122 ? 26.203 19.233  -9.068  1.00 58.07 ? 399 GLU A CD  1 
ATOM   948  O OE1 . GLU A 1 122 ? 25.789 19.755  -8.011  1.00 59.29 ? 399 GLU A OE1 1 
ATOM   949  O OE2 . GLU A 1 122 ? 26.536 19.898  -10.073 1.00 59.61 ? 399 GLU A OE2 1 
ATOM   950  N N   . PRO A 1 123 ? 23.887 14.460  -6.942  1.00 30.59 ? 400 PRO A N   1 
ATOM   951  C CA  . PRO A 1 123 ? 22.714 13.892  -6.273  1.00 28.08 ? 400 PRO A CA  1 
ATOM   952  C C   . PRO A 1 123 ? 21.594 14.924  -6.171  1.00 27.25 ? 400 PRO A C   1 
ATOM   953  O O   . PRO A 1 123 ? 21.851 16.129  -6.143  1.00 27.67 ? 400 PRO A O   1 
ATOM   954  C CB  . PRO A 1 123 ? 23.258 13.498  -4.904  1.00 23.32 ? 400 PRO A CB  1 
ATOM   955  C CG  . PRO A 1 123 ? 24.691 13.153  -5.199  1.00 23.91 ? 400 PRO A CG  1 
ATOM   956  C CD  . PRO A 1 123 ? 25.101 14.271  -6.128  1.00 23.73 ? 400 PRO A CD  1 
ATOM   957  N N   . ARG A 1 124 ? 20.354 14.451  -6.116  1.00 24.83 ? 401 ARG A N   1 
ATOM   958  C CA  . ARG A 1 124 ? 19.208 15.346  -6.009  1.00 25.52 ? 401 ARG A CA  1 
ATOM   959  C C   . ARG A 1 124 ? 18.847 15.589  -4.547  1.00 24.55 ? 401 ARG A C   1 
ATOM   960  O O   . ARG A 1 124 ? 18.473 14.661  -3.830  1.00 22.16 ? 401 ARG A O   1 
ATOM   961  C CB  . ARG A 1 124 ? 17.994 14.756  -6.732  1.00 31.50 ? 401 ARG A CB  1 
ATOM   962  C CG  . ARG A 1 124 ? 16.754 15.636  -6.661  1.00 34.26 ? 401 ARG A CG  1 
ATOM   963  C CD  . ARG A 1 124 ? 15.508 14.874  -7.076  1.00 37.18 ? 401 ARG A CD  1 
ATOM   964  N NE  . ARG A 1 124 ? 15.622 14.324  -8.423  1.00 40.96 ? 401 ARG A NE  1 
ATOM   965  C CZ  . ARG A 1 124 ? 14.697 13.564  -9.001  1.00 41.64 ? 401 ARG A CZ  1 
ATOM   966  N NH1 . ARG A 1 124 ? 13.582 13.260  -8.349  1.00 43.68 ? 401 ARG A NH1 1 
ATOM   967  N NH2 . ARG A 1 124 ? 14.889 13.101  -10.229 1.00 42.31 ? 401 ARG A NH2 1 
ATOM   968  N N   . ALA A 1 125 ? 18.959 16.842  -4.113  1.00 25.43 ? 402 ALA A N   1 
ATOM   969  C CA  . ALA A 1 125 ? 18.632 17.204  -2.738  1.00 25.50 ? 402 ALA A CA  1 
ATOM   970  C C   . ALA A 1 125 ? 17.128 17.089  -2.524  1.00 27.79 ? 402 ALA A C   1 
ATOM   971  O O   . ALA A 1 125 ? 16.335 17.514  -3.368  1.00 27.51 ? 402 ALA A O   1 
ATOM   972  C CB  . ALA A 1 125 ? 19.098 18.630  -2.440  1.00 24.58 ? 402 ALA A CB  1 
ATOM   973  N N   . LEU A 1 126 ? 16.741 16.514  -1.393  1.00 23.32 ? 403 LEU A N   1 
ATOM   974  C CA  . LEU A 1 126 ? 15.333 16.330  -1.066  1.00 27.38 ? 403 LEU A CA  1 
ATOM   975  C C   . LEU A 1 126 ? 14.964 17.165  0.158   1.00 32.91 ? 403 LEU A C   1 
ATOM   976  O O   . LEU A 1 126 ? 15.828 17.791  0.772   1.00 31.32 ? 403 LEU A O   1 
ATOM   977  C CB  . LEU A 1 126 ? 15.059 14.856  -0.764  1.00 28.53 ? 403 LEU A CB  1 
ATOM   978  C CG  . LEU A 1 126 ? 15.538 13.829  -1.793  1.00 25.38 ? 403 LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 126 ? 15.411 12.434  -1.205  1.00 24.66 ? 403 LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 126 ? 14.729 13.955  -3.073  1.00 23.59 ? 403 LEU A CD2 1 
ATOM   981  N N   . ARG A 1 127 ? 13.681 17.164  0.508   1.00 50.98 ? 404 ARG A N   1 
ATOM   982  C CA  . ARG A 1 127 ? 13.205 17.898  1.678   1.00 58.47 ? 404 ARG A CA  1 
ATOM   983  C C   . ARG A 1 127 ? 13.263 16.988  2.902   1.00 61.85 ? 404 ARG A C   1 
ATOM   984  O O   . ARG A 1 127 ? 12.835 15.835  2.845   1.00 62.45 ? 404 ARG A O   1 
ATOM   985  C CB  . ARG A 1 127 ? 11.766 18.379  1.469   1.00 64.61 ? 404 ARG A CB  1 
ATOM   986  C CG  . ARG A 1 127 ? 11.626 19.614  0.593   1.00 68.69 ? 404 ARG A CG  1 
ATOM   987  C CD  . ARG A 1 127 ? 11.999 19.341  -0.855  1.00 73.49 ? 404 ARG A CD  1 
ATOM   988  N NE  . ARG A 1 127 ? 11.831 20.529  -1.691  1.00 77.94 ? 404 ARG A NE  1 
ATOM   989  C CZ  . ARG A 1 127 ? 10.676 21.166  -1.866  1.00 80.24 ? 404 ARG A CZ  1 
ATOM   990  N NH1 . ARG A 1 127 ? 9.576  20.733  -1.264  1.00 81.58 ? 404 ARG A NH1 1 
ATOM   991  N NH2 . ARG A 1 127 ? 10.621 22.241  -2.641  1.00 81.28 ? 404 ARG A NH2 1 
ATOM   992  N N   . SER A 1 128 ? 13.792 17.512  4.006   1.00 65.00 ? 405 SER A N   1 
ATOM   993  C CA  . SER A 1 128 ? 13.917 16.745  5.243   1.00 68.45 ? 405 SER A CA  1 
ATOM   994  C C   . SER A 1 128 ? 12.632 16.004  5.621   1.00 70.68 ? 405 SER A C   1 
ATOM   995  O O   . SER A 1 128 ? 12.646 14.787  5.802   1.00 70.88 ? 405 SER A O   1 
ATOM   996  C CB  . SER A 1 128 ? 14.352 17.663  6.389   1.00 68.66 ? 405 SER A CB  1 
ATOM   997  O OG  . SER A 1 128 ? 15.605 18.263  6.108   1.00 70.15 ? 405 SER A OG  1 
ATOM   998  N N   . PRO A 1 129 ? 11.503 16.724  5.749   1.00 72.94 ? 406 PRO A N   1 
ATOM   999  C CA  . PRO A 1 129 ? 11.341 18.169  5.573   1.00 74.43 ? 406 PRO A CA  1 
ATOM   1000 C C   . PRO A 1 129 ? 11.100 18.883  6.905   1.00 75.28 ? 406 PRO A C   1 
ATOM   1001 O O   . PRO A 1 129 ? 11.591 19.991  7.127   1.00 75.95 ? 406 PRO A O   1 
ATOM   1002 C CB  . PRO A 1 129 ? 10.132 18.250  4.661   1.00 75.49 ? 406 PRO A CB  1 
ATOM   1003 C CG  . PRO A 1 129 ? 9.246  17.198  5.257   1.00 75.34 ? 406 PRO A CG  1 
ATOM   1004 C CD  . PRO A 1 129 ? 10.202 16.046  5.591   1.00 74.55 ? 406 PRO A CD  1 
ATOM   1005 N N   . GLU A 1 130 ? 10.343 18.233  7.786   1.00 73.45 ? 407 GLU A N   1 
ATOM   1006 C CA  . GLU A 1 130 ? 10.007 18.794  9.090   1.00 73.06 ? 407 GLU A CA  1 
ATOM   1007 C C   . GLU A 1 130 ? 10.995 18.424  10.192  1.00 71.21 ? 407 GLU A C   1 
ATOM   1008 O O   . GLU A 1 130 ? 11.596 19.302  10.813  1.00 71.14 ? 407 GLU A O   1 
ATOM   1009 C CB  . GLU A 1 130 ? 8.597  18.355  9.496   1.00 79.01 ? 407 GLU A CB  1 
ATOM   1010 C CG  . GLU A 1 130 ? 8.378  16.850  9.457   1.00 82.02 ? 407 GLU A CG  1 
ATOM   1011 C CD  . GLU A 1 130 ? 6.974  16.454  9.868   1.00 83.79 ? 407 GLU A CD  1 
ATOM   1012 O OE1 . GLU A 1 130 ? 6.588  16.735  11.023  1.00 84.75 ? 407 GLU A OE1 1 
ATOM   1013 O OE2 . GLU A 1 130 ? 6.255  15.861  9.035   1.00 85.02 ? 407 GLU A OE2 1 
ATOM   1014 N N   . ARG A 1 131 ? 11.158 17.129  10.441  1.00 67.25 ? 408 ARG A N   1 
ATOM   1015 C CA  . ARG A 1 131 ? 12.075 16.676  11.478  1.00 63.66 ? 408 ARG A CA  1 
ATOM   1016 C C   . ARG A 1 131 ? 12.987 15.537  11.034  1.00 59.24 ? 408 ARG A C   1 
ATOM   1017 O O   . ARG A 1 131 ? 12.544 14.560  10.432  1.00 59.64 ? 408 ARG A O   1 
ATOM   1018 C CB  . ARG A 1 131 ? 11.295 16.261  12.727  1.00 69.87 ? 408 ARG A CB  1 
ATOM   1019 C CG  . ARG A 1 131 ? 10.227 15.212  12.484  1.00 73.35 ? 408 ARG A CG  1 
ATOM   1020 C CD  . ARG A 1 131 ? 9.476  14.902  13.767  1.00 76.89 ? 408 ARG A CD  1 
ATOM   1021 N NE  . ARG A 1 131 ? 8.396  13.944  13.554  1.00 80.53 ? 408 ARG A NE  1 
ATOM   1022 C CZ  . ARG A 1 131 ? 7.577  13.517  14.510  1.00 82.39 ? 408 ARG A CZ  1 
ATOM   1023 N NH1 . ARG A 1 131 ? 6.621  12.644  14.225  1.00 83.54 ? 408 ARG A NH1 1 
ATOM   1024 N NH2 . ARG A 1 131 ? 7.713  13.964  15.752  1.00 83.57 ? 408 ARG A NH2 1 
ATOM   1025 N N   . ARG A 1 132 ? 14.268 15.693  11.348  1.00 44.46 ? 409 ARG A N   1 
ATOM   1026 C CA  . ARG A 1 132 ? 15.318 14.733  11.025  1.00 38.30 ? 409 ARG A CA  1 
ATOM   1027 C C   . ARG A 1 132 ? 14.855 13.291  11.267  1.00 31.44 ? 409 ARG A C   1 
ATOM   1028 O O   . ARG A 1 132 ? 14.623 12.893  12.408  1.00 30.02 ? 409 ARG A O   1 
ATOM   1029 C CB  . ARG A 1 132 ? 16.538 15.049  11.896  1.00 56.10 ? 409 ARG A CB  1 
ATOM   1030 C CG  . ARG A 1 132 ? 17.887 14.571  11.382  1.00 60.16 ? 409 ARG A CG  1 
ATOM   1031 C CD  . ARG A 1 132 ? 18.984 15.138  12.280  1.00 63.58 ? 409 ARG A CD  1 
ATOM   1032 N NE  . ARG A 1 132 ? 20.337 14.857  11.807  1.00 66.77 ? 409 ARG A NE  1 
ATOM   1033 C CZ  . ARG A 1 132 ? 20.881 13.647  11.757  1.00 69.14 ? 409 ARG A CZ  1 
ATOM   1034 N NH1 . ARG A 1 132 ? 22.121 13.495  11.313  1.00 71.40 ? 409 ARG A NH1 1 
ATOM   1035 N NH2 . ARG A 1 132 ? 20.190 12.587  12.151  1.00 71.32 ? 409 ARG A NH2 1 
ATOM   1036 N N   . PRO A 1 133 ? 14.710 12.493  10.194  1.00 30.35 ? 410 PRO A N   1 
ATOM   1037 C CA  . PRO A 1 133 ? 14.274 11.096  10.330  1.00 24.32 ? 410 PRO A CA  1 
ATOM   1038 C C   . PRO A 1 133 ? 15.273 10.271  11.142  1.00 20.86 ? 410 PRO A C   1 
ATOM   1039 O O   . PRO A 1 133 ? 16.481 10.459  11.017  1.00 18.44 ? 410 PRO A O   1 
ATOM   1040 C CB  . PRO A 1 133 ? 14.195 10.615  8.881   1.00 28.72 ? 410 PRO A CB  1 
ATOM   1041 C CG  . PRO A 1 133 ? 13.887 11.872  8.122   1.00 31.44 ? 410 PRO A CG  1 
ATOM   1042 C CD  . PRO A 1 133 ? 14.809 12.869  8.773   1.00 32.43 ? 410 PRO A CD  1 
ATOM   1043 N N   . THR A 1 134 ? 14.768 9.365   11.973  1.00 19.01 ? 411 THR A N   1 
ATOM   1044 C CA  . THR A 1 134 ? 15.640 8.514   12.776  1.00 18.11 ? 411 THR A CA  1 
ATOM   1045 C C   . THR A 1 134 ? 15.576 7.075   12.292  1.00 15.93 ? 411 THR A C   1 
ATOM   1046 O O   . THR A 1 134 ? 16.385 6.242   12.703  1.00 15.74 ? 411 THR A O   1 
ATOM   1047 C CB  . THR A 1 134 ? 15.254 8.519   14.269  1.00 18.51 ? 411 THR A CB  1 
ATOM   1048 O OG1 . THR A 1 134 ? 13.922 8.016   14.427  1.00 20.68 ? 411 THR A OG1 1 
ATOM   1049 C CG2 . THR A 1 134 ? 15.350 9.926   14.839  1.00 20.37 ? 411 THR A CG2 1 
ATOM   1050 N N   . ARG A 1 135 ? 14.601 6.781   11.437  1.00 16.23 ? 412 ARG A N   1 
ATOM   1051 C CA  . ARG A 1 135 ? 14.432 5.435   10.894  1.00 16.16 ? 412 ARG A CA  1 
ATOM   1052 C C   . ARG A 1 135 ? 13.980 5.538   9.446   1.00 16.78 ? 412 ARG A C   1 
ATOM   1053 O O   . ARG A 1 135 ? 13.089 6.319   9.124   1.00 17.20 ? 412 ARG A O   1 
ATOM   1054 C CB  . ARG A 1 135 ? 13.386 4.659   11.704  1.00 17.17 ? 412 ARG A CB  1 
ATOM   1055 C CG  . ARG A 1 135 ? 13.198 3.225   11.244  1.00 18.48 ? 412 ARG A CG  1 
ATOM   1056 C CD  . ARG A 1 135 ? 12.203 2.490   12.130  1.00 21.44 ? 412 ARG A CD  1 
ATOM   1057 N NE  . ARG A 1 135 ? 12.710 2.329   13.490  1.00 23.47 ? 412 ARG A NE  1 
ATOM   1058 C CZ  . ARG A 1 135 ? 12.070 1.678   14.455  1.00 28.07 ? 412 ARG A CZ  1 
ATOM   1059 N NH1 . ARG A 1 135 ? 10.886 1.126   14.214  1.00 29.48 ? 412 ARG A NH1 1 
ATOM   1060 N NH2 . ARG A 1 135 ? 12.619 1.568   15.658  1.00 29.30 ? 412 ARG A NH2 1 
ATOM   1061 N N   . ILE A 1 136 ? 14.607 4.750   8.577   1.00 13.42 ? 413 ILE A N   1 
ATOM   1062 C CA  . ILE A 1 136 ? 14.287 4.743   7.160   1.00 13.86 ? 413 ILE A CA  1 
ATOM   1063 C C   . ILE A 1 136 ? 13.655 3.421   6.748   1.00 14.93 ? 413 ILE A C   1 
ATOM   1064 O O   . ILE A 1 136 ? 14.143 2.348   7.109   1.00 15.10 ? 413 ILE A O   1 
ATOM   1065 C CB  . ILE A 1 136 ? 15.561 4.943   6.297   1.00 13.31 ? 413 ILE A CB  1 
ATOM   1066 C CG1 . ILE A 1 136 ? 16.265 6.248   6.682   1.00 14.78 ? 413 ILE A CG1 1 
ATOM   1067 C CG2 . ILE A 1 136 ? 15.201 4.880   4.810   1.00 14.88 ? 413 ILE A CG2 1 
ATOM   1068 C CD1 . ILE A 1 136 ? 15.423 7.512   6.497   1.00 16.16 ? 413 ILE A CD1 1 
ATOM   1069 N N   . GLY A 1 137 ? 12.565 3.504   5.996   1.00 16.20 ? 414 GLY A N   1 
ATOM   1070 C CA  . GLY A 1 137 ? 11.909 2.303   5.520   1.00 18.13 ? 414 GLY A CA  1 
ATOM   1071 C C   . GLY A 1 137 ? 12.197 2.170   4.037   1.00 18.12 ? 414 GLY A C   1 
ATOM   1072 O O   . GLY A 1 137 ? 12.172 3.161   3.311   1.00 17.84 ? 414 GLY A O   1 
ATOM   1073 N N   . LEU A 1 138 ? 12.497 0.953   3.591   1.00 16.41 ? 415 LEU A N   1 
ATOM   1074 C CA  . LEU A 1 138 ? 12.793 0.696   2.193   1.00 16.43 ? 415 LEU A CA  1 
ATOM   1075 C C   . LEU A 1 138 ? 11.833 -0.341  1.633   1.00 18.21 ? 415 LEU A C   1 
ATOM   1076 O O   . LEU A 1 138 ? 11.712 -1.435  2.175   1.00 18.36 ? 415 LEU A O   1 
ATOM   1077 C CB  . LEU A 1 138 ? 14.238 0.200   2.026   1.00 16.25 ? 415 LEU A CB  1 
ATOM   1078 C CG  . LEU A 1 138 ? 15.342 1.174   2.446   1.00 16.94 ? 415 LEU A CG  1 
ATOM   1079 C CD1 . LEU A 1 138 ? 15.646 1.030   3.928   1.00 15.28 ? 415 LEU A CD1 1 
ATOM   1080 C CD2 . LEU A 1 138 ? 16.592 0.904   1.614   1.00 15.91 ? 415 LEU A CD2 1 
ATOM   1081 N N   . TYR A 1 139 ? 11.154 0.021   0.549   1.00 18.64 ? 416 TYR A N   1 
ATOM   1082 C CA  . TYR A 1 139 ? 10.205 -0.873  -0.107  1.00 20.33 ? 416 TYR A CA  1 
ATOM   1083 C C   . TYR A 1 139 ? 10.733 -1.246  -1.486  1.00 18.83 ? 416 TYR A C   1 
ATOM   1084 O O   . TYR A 1 139 ? 11.033 -0.378  -2.304  1.00 18.59 ? 416 TYR A O   1 
ATOM   1085 C CB  . TYR A 1 139 ? 8.839  -0.190  -0.246  1.00 21.09 ? 416 TYR A CB  1 
ATOM   1086 C CG  . TYR A 1 139 ? 7.821  -1.011  -1.014  1.00 24.40 ? 416 TYR A CG  1 
ATOM   1087 C CD1 . TYR A 1 139 ? 7.226  -2.134  -0.444  1.00 25.35 ? 416 TYR A CD1 1 
ATOM   1088 C CD2 . TYR A 1 139 ? 7.478  -0.677  -2.324  1.00 24.17 ? 416 TYR A CD2 1 
ATOM   1089 C CE1 . TYR A 1 139 ? 6.309  -2.912  -1.164  1.00 28.65 ? 416 TYR A CE1 1 
ATOM   1090 C CE2 . TYR A 1 139 ? 6.564  -1.444  -3.052  1.00 28.28 ? 416 TYR A CE2 1 
ATOM   1091 C CZ  . TYR A 1 139 ? 5.986  -2.559  -2.466  1.00 28.68 ? 416 TYR A CZ  1 
ATOM   1092 O OH  . TYR A 1 139 ? 5.093  -3.321  -3.191  1.00 31.48 ? 416 TYR A OH  1 
ATOM   1093 N N   . LEU A 1 140 ? 10.843 -2.546  -1.738  1.00 21.87 ? 417 LEU A N   1 
ATOM   1094 C CA  . LEU A 1 140 ? 11.339 -3.043  -3.014  1.00 22.09 ? 417 LEU A CA  1 
ATOM   1095 C C   . LEU A 1 140 ? 10.292 -3.931  -3.673  1.00 24.11 ? 417 LEU A C   1 
ATOM   1096 O O   . LEU A 1 140 ? 9.824  -4.892  -3.069  1.00 25.22 ? 417 LEU A O   1 
ATOM   1097 C CB  . LEU A 1 140 ? 12.623 -3.851  -2.801  1.00 23.08 ? 417 LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 140 ? 13.272 -4.473  -4.040  1.00 24.03 ? 417 LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 140 ? 13.765 -3.373  -4.962  1.00 24.82 ? 417 LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 140 ? 14.427 -5.368  -3.616  1.00 23.42 ? 417 LEU A CD2 1 
ATOM   1101 N N   . SER A 1 141 ? 9.929  -3.601  -4.908  1.00 23.00 ? 418 SER A N   1 
ATOM   1102 C CA  . SER A 1 141 ? 8.949  -4.384  -5.656  1.00 24.72 ? 418 SER A CA  1 
ATOM   1103 C C   . SER A 1 141 ? 9.477  -4.654  -7.059  1.00 23.34 ? 418 SER A C   1 
ATOM   1104 O O   . SER A 1 141 ? 9.621  -3.738  -7.868  1.00 23.85 ? 418 SER A O   1 
ATOM   1105 C CB  . SER A 1 141 ? 7.618  -3.634  -5.745  1.00 34.74 ? 418 SER A CB  1 
ATOM   1106 O OG  . SER A 1 141 ? 6.656  -4.398  -6.455  1.00 38.93 ? 418 SER A OG  1 
ATOM   1107 N N   . PHE A 1 142 ? 9.776  -5.917  -7.341  1.00 24.55 ? 419 PHE A N   1 
ATOM   1108 C CA  . PHE A 1 142 ? 10.286 -6.298  -8.647  1.00 25.23 ? 419 PHE A CA  1 
ATOM   1109 C C   . PHE A 1 142 ? 9.178  -6.248  -9.696  1.00 27.32 ? 419 PHE A C   1 
ATOM   1110 O O   . PHE A 1 142 ? 9.397  -5.801  -10.820 1.00 28.19 ? 419 PHE A O   1 
ATOM   1111 C CB  . PHE A 1 142 ? 10.900 -7.699  -8.573  1.00 27.69 ? 419 PHE A CB  1 
ATOM   1112 C CG  . PHE A 1 142 ? 12.273 -7.725  -7.950  1.00 27.41 ? 419 PHE A CG  1 
ATOM   1113 C CD1 . PHE A 1 142 ? 13.398 -7.392  -8.701  1.00 28.72 ? 419 PHE A CD1 1 
ATOM   1114 C CD2 . PHE A 1 142 ? 12.438 -8.064  -6.612  1.00 28.08 ? 419 PHE A CD2 1 
ATOM   1115 C CE1 . PHE A 1 142 ? 14.669 -7.398  -8.125  1.00 29.19 ? 419 PHE A CE1 1 
ATOM   1116 C CE2 . PHE A 1 142 ? 13.705 -8.072  -6.027  1.00 29.08 ? 419 PHE A CE2 1 
ATOM   1117 C CZ  . PHE A 1 142 ? 14.821 -7.739  -6.785  1.00 28.93 ? 419 PHE A CZ  1 
ATOM   1118 N N   . GLY A 1 143 ? 7.983  -6.687  -9.319  1.00 36.47 ? 420 GLY A N   1 
ATOM   1119 C CA  . GLY A 1 143 ? 6.871  -6.671  -10.251 1.00 37.36 ? 420 GLY A CA  1 
ATOM   1120 C C   . GLY A 1 143 ? 6.547  -5.274  -10.746 1.00 38.27 ? 420 GLY A C   1 
ATOM   1121 O O   . GLY A 1 143 ? 6.183  -5.087  -11.906 1.00 38.71 ? 420 GLY A O   1 
ATOM   1122 N N   . ASP A 1 144 ? 6.686  -4.288  -9.866  1.00 32.42 ? 421 ASP A N   1 
ATOM   1123 C CA  . ASP A 1 144 ? 6.400  -2.903  -10.216 1.00 32.32 ? 421 ASP A CA  1 
ATOM   1124 C C   . ASP A 1 144 ? 7.657  -2.131  -10.600 1.00 32.50 ? 421 ASP A C   1 
ATOM   1125 O O   . ASP A 1 144 ? 7.577  -0.992  -11.063 1.00 32.44 ? 421 ASP A O   1 
ATOM   1126 C CB  . ASP A 1 144 ? 5.700  -2.206  -9.048  1.00 39.90 ? 421 ASP A CB  1 
ATOM   1127 C CG  . ASP A 1 144 ? 4.390  -2.875  -8.676  1.00 41.86 ? 421 ASP A CG  1 
ATOM   1128 O OD1 . ASP A 1 144 ? 3.497  -2.951  -9.546  1.00 43.37 ? 421 ASP A OD1 1 
ATOM   1129 O OD2 . ASP A 1 144 ? 4.253  -3.327  -7.520  1.00 43.04 ? 421 ASP A OD2 1 
ATOM   1130 N N   . GLY A 1 145 ? 8.816  -2.756  -10.409 1.00 34.15 ? 422 GLY A N   1 
ATOM   1131 C CA  . GLY A 1 145 ? 10.070 -2.109  -10.747 1.00 33.73 ? 422 GLY A CA  1 
ATOM   1132 C C   . GLY A 1 145 ? 10.273 -0.815  -9.987  1.00 33.28 ? 422 GLY A C   1 
ATOM   1133 O O   . GLY A 1 145 ? 10.459 0.247   -10.581 1.00 34.20 ? 422 GLY A O   1 
ATOM   1134 N N   . VAL A 1 146 ? 10.239 -0.896  -8.663  1.00 27.47 ? 423 VAL A N   1 
ATOM   1135 C CA  . VAL A 1 146 ? 10.416 0.298   -7.856  1.00 24.55 ? 423 VAL A CA  1 
ATOM   1136 C C   . VAL A 1 146 ? 11.148 0.027   -6.551  1.00 21.97 ? 423 VAL A C   1 
ATOM   1137 O O   . VAL A 1 146 ? 11.081 -1.069  -5.998  1.00 21.58 ? 423 VAL A O   1 
ATOM   1138 C CB  . VAL A 1 146 ? 9.049  0.945   -7.523  1.00 43.58 ? 423 VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 146 ? 8.191  -0.031  -6.735  1.00 45.52 ? 423 VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 146 ? 9.250  2.230   -6.735  1.00 45.25 ? 423 VAL A CG2 1 
ATOM   1141 N N   . LEU A 1 147 ? 11.879 1.038   -6.097  1.00 20.55 ? 424 LEU A N   1 
ATOM   1142 C CA  . LEU A 1 147 ? 12.592 1.004   -4.827  1.00 18.56 ? 424 LEU A CA  1 
ATOM   1143 C C   . LEU A 1 147 ? 12.216 2.345   -4.221  1.00 18.47 ? 424 LEU A C   1 
ATOM   1144 O O   . LEU A 1 147 ? 12.614 3.390   -4.733  1.00 18.20 ? 424 LEU A O   1 
ATOM   1145 C CB  . LEU A 1 147 ? 14.113 0.937   -5.015  1.00 21.36 ? 424 LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 147 ? 14.884 1.073   -3.692  1.00 19.60 ? 424 LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 147 ? 14.564 -0.096  -2.777  1.00 20.06 ? 424 LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 147 ? 16.380 1.137   -3.966  1.00 21.21 ? 424 LEU A CD2 1 
ATOM   1149 N N   . SER A 1 148 ? 11.422 2.315   -3.156  1.00 18.30 ? 425 SER A N   1 
ATOM   1150 C CA  . SER A 1 148 ? 10.985 3.544   -2.506  1.00 19.03 ? 425 SER A CA  1 
ATOM   1151 C C   . SER A 1 148 ? 11.491 3.655   -1.071  1.00 18.77 ? 425 SER A C   1 
ATOM   1152 O O   . SER A 1 148 ? 11.678 2.652   -0.375  1.00 17.78 ? 425 SER A O   1 
ATOM   1153 C CB  . SER A 1 148 ? 9.457  3.634   -2.533  1.00 23.97 ? 425 SER A CB  1 
ATOM   1154 O OG  . SER A 1 148 ? 8.873  2.472   -1.983  1.00 27.22 ? 425 SER A OG  1 
ATOM   1155 N N   . PHE A 1 149 ? 11.702 4.895   -0.644  1.00 18.13 ? 426 PHE A N   1 
ATOM   1156 C CA  . PHE A 1 149 ? 12.212 5.200   0.683   1.00 17.63 ? 426 PHE A CA  1 
ATOM   1157 C C   . PHE A 1 149 ? 11.192 6.005   1.467   1.00 19.02 ? 426 PHE A C   1 
ATOM   1158 O O   . PHE A 1 149 ? 10.571 6.916   0.922   1.00 19.09 ? 426 PHE A O   1 
ATOM   1159 C CB  . PHE A 1 149 ? 13.490 6.027   0.561   1.00 16.34 ? 426 PHE A CB  1 
ATOM   1160 C CG  . PHE A 1 149 ? 14.593 5.337   -0.186  1.00 15.50 ? 426 PHE A CG  1 
ATOM   1161 C CD1 . PHE A 1 149 ? 15.566 4.619   0.501   1.00 16.37 ? 426 PHE A CD1 1 
ATOM   1162 C CD2 . PHE A 1 149 ? 14.666 5.413   -1.572  1.00 16.36 ? 426 PHE A CD2 1 
ATOM   1163 C CE1 . PHE A 1 149 ? 16.610 3.983   -0.184  1.00 14.93 ? 426 PHE A CE1 1 
ATOM   1164 C CE2 . PHE A 1 149 ? 15.707 4.779   -2.271  1.00 18.87 ? 426 PHE A CE2 1 
ATOM   1165 C CZ  . PHE A 1 149 ? 16.680 4.064   -1.568  1.00 15.45 ? 426 PHE A CZ  1 
ATOM   1166 N N   . TYR A 1 150 ? 11.062 5.690   2.751   1.00 18.49 ? 427 TYR A N   1 
ATOM   1167 C CA  . TYR A 1 150 ? 10.119 6.370   3.630   1.00 19.74 ? 427 TYR A CA  1 
ATOM   1168 C C   . TYR A 1 150 ? 10.741 6.767   4.963   1.00 21.67 ? 427 TYR A C   1 
ATOM   1169 O O   . TYR A 1 150 ? 11.707 6.152   5.428   1.00 18.91 ? 427 TYR A O   1 
ATOM   1170 C CB  . TYR A 1 150 ? 8.946  5.448   3.946   1.00 22.70 ? 427 TYR A CB  1 
ATOM   1171 C CG  . TYR A 1 150 ? 8.131  5.020   2.754   1.00 23.46 ? 427 TYR A CG  1 
ATOM   1172 C CD1 . TYR A 1 150 ? 7.027  5.763   2.342   1.00 26.11 ? 427 TYR A CD1 1 
ATOM   1173 C CD2 . TYR A 1 150 ? 8.454  3.867   2.042   1.00 25.70 ? 427 TYR A CD2 1 
ATOM   1174 C CE1 . TYR A 1 150 ? 6.261  5.370   1.251   1.00 28.57 ? 427 TYR A CE1 1 
ATOM   1175 C CE2 . TYR A 1 150 ? 7.693  3.464   0.943   1.00 27.80 ? 427 TYR A CE2 1 
ATOM   1176 C CZ  . TYR A 1 150 ? 6.599  4.222   0.557   1.00 29.77 ? 427 TYR A CZ  1 
ATOM   1177 O OH  . TYR A 1 150 ? 5.841  3.835   -0.522  1.00 35.13 ? 427 TYR A OH  1 
ATOM   1178 N N   . ASP A 1 151 ? 10.176 7.803   5.574   1.00 21.65 ? 428 ASP A N   1 
ATOM   1179 C CA  . ASP A 1 151 ? 10.602 8.231   6.895   1.00 23.57 ? 428 ASP A CA  1 
ATOM   1180 C C   . ASP A 1 151 ? 9.732  7.334   7.775   1.00 23.85 ? 428 ASP A C   1 
ATOM   1181 O O   . ASP A 1 151 ? 8.507  7.474   7.787   1.00 24.14 ? 428 ASP A O   1 
ATOM   1182 C CB  . ASP A 1 151 ? 10.238 9.696   7.133   1.00 23.72 ? 428 ASP A CB  1 
ATOM   1183 C CG  . ASP A 1 151 ? 10.618 10.169  8.521   1.00 24.27 ? 428 ASP A CG  1 
ATOM   1184 O OD1 . ASP A 1 151 ? 10.879 9.309   9.389   1.00 22.80 ? 428 ASP A OD1 1 
ATOM   1185 O OD2 . ASP A 1 151 ? 10.647 11.397  8.744   1.00 24.74 ? 428 ASP A OD2 1 
ATOM   1186 N N   . ALA A 1 152 ? 10.352 6.406   8.495   1.00 21.10 ? 429 ALA A N   1 
ATOM   1187 C CA  . ALA A 1 152 ? 9.607  5.475   9.332   1.00 20.96 ? 429 ALA A CA  1 
ATOM   1188 C C   . ALA A 1 152 ? 9.798  5.737   10.824  1.00 20.90 ? 429 ALA A C   1 
ATOM   1189 O O   . ALA A 1 152 ? 9.610  4.842   11.642  1.00 21.85 ? 429 ALA A O   1 
ATOM   1190 C CB  . ALA A 1 152 ? 10.027 4.046   8.999   1.00 22.25 ? 429 ALA A CB  1 
ATOM   1191 N N   . SER A 1 153 ? 10.170 6.964   11.167  1.00 23.03 ? 430 SER A N   1 
ATOM   1192 C CA  . SER A 1 153 ? 10.404 7.338   12.557  1.00 24.27 ? 430 SER A CA  1 
ATOM   1193 C C   . SER A 1 153 ? 9.164  7.139   13.431  1.00 27.17 ? 430 SER A C   1 
ATOM   1194 O O   . SER A 1 153 ? 9.268  6.694   14.575  1.00 25.83 ? 430 SER A O   1 
ATOM   1195 C CB  . SER A 1 153 ? 10.868 8.790   12.623  1.00 25.15 ? 430 SER A CB  1 
ATOM   1196 O OG  . SER A 1 153 ? 12.027 8.989   11.827  1.00 22.45 ? 430 SER A OG  1 
ATOM   1197 N N   . ASP A 1 154 ? 7.996  7.477   12.896  1.00 25.09 ? 431 ASP A N   1 
ATOM   1198 C CA  . ASP A 1 154 ? 6.752  7.304   13.642  1.00 29.69 ? 431 ASP A CA  1 
ATOM   1199 C C   . ASP A 1 154 ? 6.294  5.857   13.495  1.00 31.69 ? 431 ASP A C   1 
ATOM   1200 O O   . ASP A 1 154 ? 6.039  5.383   12.388  1.00 32.03 ? 431 ASP A O   1 
ATOM   1201 C CB  . ASP A 1 154 ? 5.675  8.258   13.119  1.00 41.01 ? 431 ASP A CB  1 
ATOM   1202 C CG  . ASP A 1 154 ? 4.329  8.053   13.798  1.00 43.65 ? 431 ASP A CG  1 
ATOM   1203 O OD1 . ASP A 1 154 ? 3.420  8.880   13.579  1.00 43.86 ? 431 ASP A OD1 1 
ATOM   1204 O OD2 . ASP A 1 154 ? 4.175  7.063   14.546  1.00 43.85 ? 431 ASP A OD2 1 
ATOM   1205 N N   . ALA A 1 155 ? 6.190  5.165   14.625  1.00 44.64 ? 432 ALA A N   1 
ATOM   1206 C CA  . ALA A 1 155 ? 5.791  3.761   14.659  1.00 46.79 ? 432 ALA A CA  1 
ATOM   1207 C C   . ALA A 1 155 ? 4.563  3.407   13.823  1.00 48.24 ? 432 ALA A C   1 
ATOM   1208 O O   . ALA A 1 155 ? 4.528  2.354   13.187  1.00 48.96 ? 432 ALA A O   1 
ATOM   1209 C CB  . ALA A 1 155 ? 5.571  3.328   16.105  1.00 44.12 ? 432 ALA A CB  1 
ATOM   1210 N N   . ASP A 1 156 ? 3.558  4.276   13.824  1.00 49.28 ? 433 ASP A N   1 
ATOM   1211 C CA  . ASP A 1 156 ? 2.340  4.008   13.068  1.00 50.03 ? 433 ASP A CA  1 
ATOM   1212 C C   . ASP A 1 156 ? 2.122  4.978   11.913  1.00 48.39 ? 433 ASP A C   1 
ATOM   1213 O O   . ASP A 1 156 ? 1.054  5.578   11.788  1.00 49.37 ? 433 ASP A O   1 
ATOM   1214 C CB  . ASP A 1 156 ? 1.126  4.037   14.005  1.00 56.73 ? 433 ASP A CB  1 
ATOM   1215 C CG  . ASP A 1 156 ? 0.941  5.383   14.684  1.00 59.23 ? 433 ASP A CG  1 
ATOM   1216 O OD1 . ASP A 1 156 ? 0.024  5.503   15.524  1.00 61.70 ? 433 ASP A OD1 1 
ATOM   1217 O OD2 . ASP A 1 156 ? 1.707  6.322   14.378  1.00 61.68 ? 433 ASP A OD2 1 
ATOM   1218 N N   . ALA A 1 157 ? 3.134  5.125   11.065  1.00 37.30 ? 434 ALA A N   1 
ATOM   1219 C CA  . ALA A 1 157 ? 3.037  6.023   9.921   1.00 34.92 ? 434 ALA A CA  1 
ATOM   1220 C C   . ALA A 1 157 ? 4.291  5.960   9.059   1.00 33.16 ? 434 ALA A C   1 
ATOM   1221 O O   . ALA A 1 157 ? 5.375  5.637   9.543   1.00 32.01 ? 434 ALA A O   1 
ATOM   1222 C CB  . ALA A 1 157 ? 2.808  7.451   10.397  1.00 39.80 ? 434 ALA A CB  1 
ATOM   1223 N N   . LEU A 1 158 ? 4.129  6.269   7.777   1.00 33.06 ? 435 LEU A N   1 
ATOM   1224 C CA  . LEU A 1 158 ? 5.239  6.271   6.829   1.00 30.73 ? 435 LEU A CA  1 
ATOM   1225 C C   . LEU A 1 158 ? 5.112  7.461   5.892   1.00 29.92 ? 435 LEU A C   1 
ATOM   1226 O O   . LEU A 1 158 ? 4.081  7.640   5.244   1.00 32.06 ? 435 LEU A O   1 
ATOM   1227 C CB  . LEU A 1 158 ? 5.255  4.981   6.003   1.00 27.91 ? 435 LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 158 ? 5.660  3.697   6.728   1.00 26.76 ? 435 LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 158 ? 5.715  2.545   5.735   1.00 25.86 ? 435 LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 158 ? 7.019  3.893   7.391   1.00 26.82 ? 435 LEU A CD2 1 
ATOM   1231 N N   . VAL A 1 159 ? 6.158  8.276   5.829   1.00 27.42 ? 436 VAL A N   1 
ATOM   1232 C CA  . VAL A 1 159 ? 6.163  9.444   4.961   1.00 26.63 ? 436 VAL A CA  1 
ATOM   1233 C C   . VAL A 1 159 ? 7.130  9.225   3.800   1.00 25.75 ? 436 VAL A C   1 
ATOM   1234 O O   . VAL A 1 159 ? 8.323  8.997   4.003   1.00 24.61 ? 436 VAL A O   1 
ATOM   1235 C CB  . VAL A 1 159 ? 6.589  10.711  5.723   1.00 27.89 ? 436 VAL A CB  1 
ATOM   1236 C CG1 . VAL A 1 159 ? 6.508  11.918  4.805   1.00 30.05 ? 436 VAL A CG1 1 
ATOM   1237 C CG2 . VAL A 1 159 ? 5.699  10.908  6.944   1.00 29.93 ? 436 VAL A CG2 1 
ATOM   1238 N N   . PRO A 1 160 ? 6.624  9.289   2.562   1.00 23.46 ? 437 PRO A N   1 
ATOM   1239 C CA  . PRO A 1 160 ? 7.474  9.091   1.386   1.00 23.51 ? 437 PRO A CA  1 
ATOM   1240 C C   . PRO A 1 160 ? 8.581  10.130  1.248   1.00 22.82 ? 437 PRO A C   1 
ATOM   1241 O O   . PRO A 1 160 ? 8.371  11.318  1.488   1.00 22.82 ? 437 PRO A O   1 
ATOM   1242 C CB  . PRO A 1 160 ? 6.477  9.140   0.229   1.00 37.29 ? 437 PRO A CB  1 
ATOM   1243 C CG  . PRO A 1 160 ? 5.414  10.062  0.744   1.00 39.46 ? 437 PRO A CG  1 
ATOM   1244 C CD  . PRO A 1 160 ? 5.237  9.589   2.164   1.00 37.49 ? 437 PRO A CD  1 
ATOM   1245 N N   . LEU A 1 161 ? 9.768  9.670   0.866   1.00 21.14 ? 438 LEU A N   1 
ATOM   1246 C CA  . LEU A 1 161 ? 10.908 10.558  0.686   1.00 21.29 ? 438 LEU A CA  1 
ATOM   1247 C C   . LEU A 1 161 ? 11.359 10.575  -0.767  1.00 21.59 ? 438 LEU A C   1 
ATOM   1248 O O   . LEU A 1 161 ? 11.621 11.632  -1.336  1.00 22.43 ? 438 LEU A O   1 
ATOM   1249 C CB  . LEU A 1 161 ? 12.085 10.112  1.557   1.00 22.46 ? 438 LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 161 ? 11.919 10.123  3.077   1.00 23.84 ? 438 LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 161 ? 13.157 9.515   3.719   1.00 23.07 ? 438 LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 161 ? 11.703 11.550  3.564   1.00 24.82 ? 438 LEU A CD2 1 
ATOM   1253 N N   . PHE A 1 162 ? 11.444 9.394   -1.368  1.00 21.22 ? 439 PHE A N   1 
ATOM   1254 C CA  . PHE A 1 162 ? 11.898 9.290   -2.747  1.00 21.30 ? 439 PHE A CA  1 
ATOM   1255 C C   . PHE A 1 162 ? 11.656 7.894   -3.297  1.00 20.90 ? 439 PHE A C   1 
ATOM   1256 O O   . PHE A 1 162 ? 11.523 6.935   -2.540  1.00 22.42 ? 439 PHE A O   1 
ATOM   1257 C CB  . PHE A 1 162 ? 13.399 9.596   -2.815  1.00 21.31 ? 439 PHE A CB  1 
ATOM   1258 C CG  . PHE A 1 162 ? 13.971 9.509   -4.199  1.00 22.31 ? 439 PHE A CG  1 
ATOM   1259 C CD1 . PHE A 1 162 ? 13.768 10.536  -5.113  1.00 21.29 ? 439 PHE A CD1 1 
ATOM   1260 C CD2 . PHE A 1 162 ? 14.671 8.376   -4.608  1.00 21.75 ? 439 PHE A CD2 1 
ATOM   1261 C CE1 . PHE A 1 162 ? 14.247 10.437  -6.418  1.00 23.72 ? 439 PHE A CE1 1 
ATOM   1262 C CE2 . PHE A 1 162 ? 15.152 8.266   -5.905  1.00 22.60 ? 439 PHE A CE2 1 
ATOM   1263 C CZ  . PHE A 1 162 ? 14.939 9.298   -6.815  1.00 21.06 ? 439 PHE A CZ  1 
ATOM   1264 N N   . ALA A 1 163 ? 11.605 7.782   -4.620  1.00 22.35 ? 440 ALA A N   1 
ATOM   1265 C CA  . ALA A 1 163 ? 11.417 6.483   -5.246  1.00 23.40 ? 440 ALA A CA  1 
ATOM   1266 C C   . ALA A 1 163 ? 12.072 6.384   -6.619  1.00 25.30 ? 440 ALA A C   1 
ATOM   1267 O O   . ALA A 1 163 ? 11.986 7.306   -7.432  1.00 24.17 ? 440 ALA A O   1 
ATOM   1268 C CB  . ALA A 1 163 ? 9.928  6.164   -5.359  1.00 28.24 ? 440 ALA A CB  1 
ATOM   1269 N N   . PHE A 1 164 ? 12.754 5.267   -6.853  1.00 22.05 ? 441 PHE A N   1 
ATOM   1270 C CA  . PHE A 1 164 ? 13.379 4.988   -8.144  1.00 25.82 ? 441 PHE A CA  1 
ATOM   1271 C C   . PHE A 1 164 ? 12.292 4.206   -8.880  1.00 30.50 ? 441 PHE A C   1 
ATOM   1272 O O   . PHE A 1 164 ? 11.690 3.302   -8.300  1.00 29.47 ? 441 PHE A O   1 
ATOM   1273 C CB  . PHE A 1 164 ? 14.616 4.099   -7.974  1.00 22.94 ? 441 PHE A CB  1 
ATOM   1274 C CG  . PHE A 1 164 ? 15.836 4.829   -7.483  1.00 21.77 ? 441 PHE A CG  1 
ATOM   1275 C CD1 . PHE A 1 164 ? 16.592 5.613   -8.350  1.00 20.40 ? 441 PHE A CD1 1 
ATOM   1276 C CD2 . PHE A 1 164 ? 16.242 4.717   -6.156  1.00 20.10 ? 441 PHE A CD2 1 
ATOM   1277 C CE1 . PHE A 1 164 ? 17.737 6.270   -7.904  1.00 18.49 ? 441 PHE A CE1 1 
ATOM   1278 C CE2 . PHE A 1 164 ? 17.385 5.372   -5.700  1.00 20.18 ? 441 PHE A CE2 1 
ATOM   1279 C CZ  . PHE A 1 164 ? 18.135 6.151   -6.579  1.00 18.48 ? 441 PHE A CZ  1 
ATOM   1280 N N   . HIS A 1 165 ? 12.035 4.540   -10.142 1.00 37.46 ? 442 HIS A N   1 
ATOM   1281 C CA  . HIS A 1 165 ? 10.986 3.849   -10.886 1.00 45.25 ? 442 HIS A CA  1 
ATOM   1282 C C   . HIS A 1 165 ? 11.436 3.041   -12.095 1.00 49.61 ? 442 HIS A C   1 
ATOM   1283 O O   . HIS A 1 165 ? 10.659 2.249   -12.630 1.00 50.54 ? 442 HIS A O   1 
ATOM   1284 C CB  . HIS A 1 165 ? 9.906  4.846   -11.317 1.00 55.91 ? 442 HIS A CB  1 
ATOM   1285 C CG  . HIS A 1 165 ? 9.058  5.341   -10.187 1.00 58.24 ? 442 HIS A CG  1 
ATOM   1286 N ND1 . HIS A 1 165 ? 8.331  4.495   -9.377  1.00 58.70 ? 442 HIS A ND1 1 
ATOM   1287 C CD2 . HIS A 1 165 ? 8.814  6.594   -9.736  1.00 58.93 ? 442 HIS A CD2 1 
ATOM   1288 C CE1 . HIS A 1 165 ? 7.675  5.205   -8.477  1.00 58.96 ? 442 HIS A CE1 1 
ATOM   1289 N NE2 . HIS A 1 165 ? 7.951  6.482   -8.673  1.00 59.63 ? 442 HIS A NE2 1 
ATOM   1290 N N   . GLU A 1 166 ? 12.674 3.233   -12.534 1.00 59.22 ? 443 GLU A N   1 
ATOM   1291 C CA  . GLU A 1 166 ? 13.177 2.481   -13.678 1.00 63.58 ? 443 GLU A CA  1 
ATOM   1292 C C   . GLU A 1 166 ? 13.124 1.001   -13.315 1.00 65.09 ? 443 GLU A C   1 
ATOM   1293 O O   . GLU A 1 166 ? 13.176 0.651   -12.136 1.00 65.54 ? 443 GLU A O   1 
ATOM   1294 C CB  . GLU A 1 166 ? 14.621 2.875   -13.993 1.00 70.46 ? 443 GLU A CB  1 
ATOM   1295 C CG  . GLU A 1 166 ? 15.622 2.447   -12.933 1.00 73.53 ? 443 GLU A CG  1 
ATOM   1296 C CD  . GLU A 1 166 ? 17.057 2.605   -13.391 1.00 75.61 ? 443 GLU A CD  1 
ATOM   1297 O OE1 . GLU A 1 166 ? 17.969 2.235   -12.623 1.00 77.20 ? 443 GLU A OE1 1 
ATOM   1298 O OE2 . GLU A 1 166 ? 17.273 3.098   -14.519 1.00 76.64 ? 443 GLU A OE2 1 
ATOM   1299 N N   . ARG A 1 167 ? 13.018 0.131   -14.313 1.00 63.21 ? 444 ARG A N   1 
ATOM   1300 C CA  . ARG A 1 167 ? 12.968 -1.295  -14.025 1.00 64.47 ? 444 ARG A CA  1 
ATOM   1301 C C   . ARG A 1 167 ? 14.250 -1.714  -13.323 1.00 63.23 ? 444 ARG A C   1 
ATOM   1302 O O   . ARG A 1 167 ? 15.350 -1.359  -13.748 1.00 63.43 ? 444 ARG A O   1 
ATOM   1303 C CB  . ARG A 1 167 ? 12.784 -2.115  -15.302 1.00 72.85 ? 444 ARG A CB  1 
ATOM   1304 C CG  . ARG A 1 167 ? 12.702 -3.606  -15.020 1.00 77.22 ? 444 ARG A CG  1 
ATOM   1305 C CD  . ARG A 1 167 ? 12.170 -4.394  -16.199 1.00 80.96 ? 444 ARG A CD  1 
ATOM   1306 N NE  . ARG A 1 167 ? 11.999 -5.802  -15.852 1.00 84.48 ? 444 ARG A NE  1 
ATOM   1307 C CZ  . ARG A 1 167 ? 11.450 -6.711  -16.652 1.00 86.47 ? 444 ARG A CZ  1 
ATOM   1308 N NH1 . ARG A 1 167 ? 11.012 -6.363  -17.854 1.00 87.87 ? 444 ARG A NH1 1 
ATOM   1309 N NH2 . ARG A 1 167 ? 11.337 -7.968  -16.246 1.00 87.71 ? 444 ARG A NH2 1 
ATOM   1310 N N   . LEU A 1 168 ? 14.100 -2.474  -12.244 1.00 60.83 ? 445 LEU A N   1 
ATOM   1311 C CA  . LEU A 1 168 ? 15.239 -2.929  -11.461 1.00 58.56 ? 445 LEU A CA  1 
ATOM   1312 C C   . LEU A 1 168 ? 15.720 -4.315  -11.869 1.00 56.71 ? 445 LEU A C   1 
ATOM   1313 O O   . LEU A 1 168 ? 14.920 -5.235  -12.046 1.00 56.27 ? 445 LEU A O   1 
ATOM   1314 C CB  . LEU A 1 168 ? 14.872 -2.931  -9.976  1.00 57.39 ? 445 LEU A CB  1 
ATOM   1315 C CG  . LEU A 1 168 ? 14.326 -1.611  -9.423  1.00 57.11 ? 445 LEU A CG  1 
ATOM   1316 C CD1 . LEU A 1 168 ? 13.850 -1.816  -7.996  1.00 56.99 ? 445 LEU A CD1 1 
ATOM   1317 C CD2 . LEU A 1 168 ? 15.401 -0.536  -9.487  1.00 56.68 ? 445 LEU A CD2 1 
ATOM   1318 N N   . PRO A 1 169 ? 17.042 -4.481  -12.026 1.00 50.57 ? 446 PRO A N   1 
ATOM   1319 C CA  . PRO A 1 169 ? 17.622 -5.767  -12.411 1.00 49.04 ? 446 PRO A CA  1 
ATOM   1320 C C   . PRO A 1 169 ? 17.683 -6.686  -11.199 1.00 46.91 ? 446 PRO A C   1 
ATOM   1321 O O   . PRO A 1 169 ? 17.613 -6.225  -10.061 1.00 46.02 ? 446 PRO A O   1 
ATOM   1322 C CB  . PRO A 1 169 ? 19.007 -5.376  -12.905 1.00 57.98 ? 446 PRO A CB  1 
ATOM   1323 C CG  . PRO A 1 169 ? 19.366 -4.271  -11.970 1.00 58.37 ? 446 PRO A CG  1 
ATOM   1324 C CD  . PRO A 1 169 ? 18.089 -3.447  -11.932 1.00 58.47 ? 446 PRO A CD  1 
ATOM   1325 N N   . ARG A 1 170 ? 17.810 -7.984  -11.440 1.00 46.82 ? 447 ARG A N   1 
ATOM   1326 C CA  . ARG A 1 170 ? 17.877 -8.927  -10.339 1.00 44.13 ? 447 ARG A CA  1 
ATOM   1327 C C   . ARG A 1 170 ? 19.005 -9.930  -10.532 1.00 39.41 ? 447 ARG A C   1 
ATOM   1328 O O   . ARG A 1 170 ? 19.388 -10.247 -11.656 1.00 39.82 ? 447 ARG A O   1 
ATOM   1329 C CB  . ARG A 1 170 ? 16.547 -9.671  -10.184 1.00 56.85 ? 447 ARG A CB  1 
ATOM   1330 C CG  . ARG A 1 170 ? 16.252 -10.685 -11.274 1.00 61.31 ? 447 ARG A CG  1 
ATOM   1331 C CD  . ARG A 1 170 ? 15.045 -11.528 -10.897 1.00 65.49 ? 447 ARG A CD  1 
ATOM   1332 N NE  . ARG A 1 170 ? 14.832 -12.650 -11.806 1.00 70.28 ? 447 ARG A NE  1 
ATOM   1333 C CZ  . ARG A 1 170 ? 13.917 -13.597 -11.618 1.00 72.59 ? 447 ARG A CZ  1 
ATOM   1334 N NH1 . ARG A 1 170 ? 13.126 -13.558 -10.554 1.00 74.01 ? 447 ARG A NH1 1 
ATOM   1335 N NH2 . ARG A 1 170 ? 13.793 -14.585 -12.494 1.00 74.43 ? 447 ARG A NH2 1 
ATOM   1336 N N   . PRO A 1 171 ? 19.555 -10.440 -9.424  1.00 35.19 ? 448 PRO A N   1 
ATOM   1337 C CA  . PRO A 1 171 ? 19.109 -10.065 -8.080  1.00 29.18 ? 448 PRO A CA  1 
ATOM   1338 C C   . PRO A 1 171 ? 19.855 -8.850  -7.540  1.00 23.66 ? 448 PRO A C   1 
ATOM   1339 O O   . PRO A 1 171 ? 20.740 -8.301  -8.200  1.00 21.84 ? 448 PRO A O   1 
ATOM   1340 C CB  . PRO A 1 171 ? 19.398 -11.319 -7.272  1.00 38.02 ? 448 PRO A CB  1 
ATOM   1341 C CG  . PRO A 1 171 ? 20.677 -11.793 -7.891  1.00 39.25 ? 448 PRO A CG  1 
ATOM   1342 C CD  . PRO A 1 171 ? 20.435 -11.622 -9.376  1.00 40.86 ? 448 PRO A CD  1 
ATOM   1343 N N   . VAL A 1 172 ? 19.477 -8.432  -6.338  1.00 21.09 ? 449 VAL A N   1 
ATOM   1344 C CA  . VAL A 1 172 ? 20.132 -7.310  -5.675  1.00 19.05 ? 449 VAL A CA  1 
ATOM   1345 C C   . VAL A 1 172 ? 20.309 -7.670  -4.208  1.00 18.23 ? 449 VAL A C   1 
ATOM   1346 O O   . VAL A 1 172 ? 19.699 -8.618  -3.712  1.00 18.70 ? 449 VAL A O   1 
ATOM   1347 C CB  . VAL A 1 172 ? 19.298 -6.004  -5.743  1.00 20.56 ? 449 VAL A CB  1 
ATOM   1348 C CG1 . VAL A 1 172 ? 18.985 -5.652  -7.183  1.00 21.88 ? 449 VAL A CG1 1 
ATOM   1349 C CG2 . VAL A 1 172 ? 18.029 -6.150  -4.928  1.00 18.69 ? 449 VAL A CG2 1 
ATOM   1350 N N   . TYR A 1 173 ? 21.152 -6.910  -3.521  1.00 15.44 ? 450 TYR A N   1 
ATOM   1351 C CA  . TYR A 1 173 ? 21.385 -7.111  -2.101  1.00 15.53 ? 450 TYR A CA  1 
ATOM   1352 C C   . TYR A 1 173 ? 21.143 -5.812  -1.366  1.00 14.96 ? 450 TYR A C   1 
ATOM   1353 O O   . TYR A 1 173 ? 21.553 -4.754  -1.841  1.00 15.99 ? 450 TYR A O   1 
ATOM   1354 C CB  . TYR A 1 173 ? 22.837 -7.492  -1.797  1.00 17.49 ? 450 TYR A CB  1 
ATOM   1355 C CG  . TYR A 1 173 ? 23.262 -8.878  -2.207  1.00 19.45 ? 450 TYR A CG  1 
ATOM   1356 C CD1 . TYR A 1 173 ? 23.775 -9.122  -3.478  1.00 21.02 ? 450 TYR A CD1 1 
ATOM   1357 C CD2 . TYR A 1 173 ? 23.167 -9.938  -1.312  1.00 21.08 ? 450 TYR A CD2 1 
ATOM   1358 C CE1 . TYR A 1 173 ? 24.190 -10.399 -3.852  1.00 24.42 ? 450 TYR A CE1 1 
ATOM   1359 C CE2 . TYR A 1 173 ? 23.578 -11.223 -1.674  1.00 24.69 ? 450 TYR A CE2 1 
ATOM   1360 C CZ  . TYR A 1 173 ? 24.088 -11.439 -2.946  1.00 25.48 ? 450 TYR A CZ  1 
ATOM   1361 O OH  . TYR A 1 173 ? 24.506 -12.699 -3.311  1.00 26.71 ? 450 TYR A OH  1 
ATOM   1362 N N   . PRO A 1 174 ? 20.451 -5.867  -0.215  1.00 15.21 ? 451 PRO A N   1 
ATOM   1363 C CA  . PRO A 1 174 ? 20.220 -4.638  0.550   1.00 14.87 ? 451 PRO A CA  1 
ATOM   1364 C C   . PRO A 1 174 ? 21.637 -4.142  0.846   1.00 14.74 ? 451 PRO A C   1 
ATOM   1365 O O   . PRO A 1 174 ? 22.508 -4.933  1.232   1.00 14.59 ? 451 PRO A O   1 
ATOM   1366 C CB  . PRO A 1 174 ? 19.507 -5.142  1.796   1.00 15.54 ? 451 PRO A CB  1 
ATOM   1367 C CG  . PRO A 1 174 ? 18.667 -6.277  1.237   1.00 16.33 ? 451 PRO A CG  1 
ATOM   1368 C CD  . PRO A 1 174 ? 19.648 -6.983  0.319   1.00 16.36 ? 451 PRO A CD  1 
ATOM   1369 N N   . PHE A 1 175 ? 21.859 -2.846  0.657   1.00 14.39 ? 452 PHE A N   1 
ATOM   1370 C CA  . PHE A 1 175 ? 23.173 -2.217  0.811   1.00 12.88 ? 452 PHE A CA  1 
ATOM   1371 C C   . PHE A 1 175 ? 23.143 -1.171  1.913   1.00 12.37 ? 452 PHE A C   1 
ATOM   1372 O O   . PHE A 1 175 ? 22.167 -0.438  2.042   1.00 14.24 ? 452 PHE A O   1 
ATOM   1373 C CB  . PHE A 1 175 ? 23.537 -1.570  -0.537  1.00 13.89 ? 452 PHE A CB  1 
ATOM   1374 C CG  . PHE A 1 175 ? 24.798 -0.737  -0.524  1.00 13.92 ? 452 PHE A CG  1 
ATOM   1375 C CD1 . PHE A 1 175 ? 26.030 -1.299  -0.834  1.00 16.55 ? 452 PHE A CD1 1 
ATOM   1376 C CD2 . PHE A 1 175 ? 24.734 0.629   -0.264  1.00 15.31 ? 452 PHE A CD2 1 
ATOM   1377 C CE1 . PHE A 1 175 ? 27.176 -0.511  -0.891  1.00 15.00 ? 452 PHE A CE1 1 
ATOM   1378 C CE2 . PHE A 1 175 ? 25.870 1.427   -0.317  1.00 15.46 ? 452 PHE A CE2 1 
ATOM   1379 C CZ  . PHE A 1 175 ? 27.097 0.862   -0.633  1.00 14.30 ? 452 PHE A CZ  1 
ATOM   1380 N N   . PHE A 1 176 ? 24.227 -1.094  2.683   1.00 13.24 ? 453 PHE A N   1 
ATOM   1381 C CA  . PHE A 1 176 ? 24.322 -0.143  3.785   1.00 12.90 ? 453 PHE A CA  1 
ATOM   1382 C C   . PHE A 1 176 ? 25.696 0.500   3.825   1.00 15.16 ? 453 PHE A C   1 
ATOM   1383 O O   . PHE A 1 176 ? 26.702 -0.193  3.959   1.00 15.17 ? 453 PHE A O   1 
ATOM   1384 C CB  . PHE A 1 176 ? 24.066 -0.852  5.119   1.00 13.14 ? 453 PHE A CB  1 
ATOM   1385 C CG  . PHE A 1 176 ? 22.895 -1.800  5.088   1.00 11.46 ? 453 PHE A CG  1 
ATOM   1386 C CD1 . PHE A 1 176 ? 23.043 -3.085  4.574   1.00 14.63 ? 453 PHE A CD1 1 
ATOM   1387 C CD2 . PHE A 1 176 ? 21.641 -1.401  5.546   1.00 13.91 ? 453 PHE A CD2 1 
ATOM   1388 C CE1 . PHE A 1 176 ? 21.960 -3.960  4.512   1.00 14.19 ? 453 PHE A CE1 1 
ATOM   1389 C CE2 . PHE A 1 176 ? 20.550 -2.270  5.489   1.00 14.45 ? 453 PHE A CE2 1 
ATOM   1390 C CZ  . PHE A 1 176 ? 20.710 -3.550  4.971   1.00 13.88 ? 453 PHE A CZ  1 
ATOM   1391 N N   . ASP A 1 177 ? 25.748 1.825   3.709   1.00 15.99 ? 454 ASP A N   1 
ATOM   1392 C CA  . ASP A 1 177 ? 27.035 2.498   3.769   1.00 17.68 ? 454 ASP A CA  1 
ATOM   1393 C C   . ASP A 1 177 ? 27.078 3.291   5.058   1.00 17.11 ? 454 ASP A C   1 
ATOM   1394 O O   . ASP A 1 177 ? 26.252 4.184   5.288   1.00 15.07 ? 454 ASP A O   1 
ATOM   1395 C CB  . ASP A 1 177 ? 27.240 3.416   2.565   1.00 20.70 ? 454 ASP A CB  1 
ATOM   1396 C CG  . ASP A 1 177 ? 28.705 3.774   2.354   1.00 25.54 ? 454 ASP A CG  1 
ATOM   1397 O OD1 . ASP A 1 177 ? 29.171 3.709   1.200   1.00 28.59 ? 454 ASP A OD1 1 
ATOM   1398 O OD2 . ASP A 1 177 ? 29.390 4.120   3.340   1.00 26.87 ? 454 ASP A OD2 1 
ATOM   1399 N N   . VAL A 1 178 ? 28.040 2.934   5.901   1.00 17.29 ? 455 VAL A N   1 
ATOM   1400 C CA  . VAL A 1 178 ? 28.230 3.557   7.195   1.00 18.12 ? 455 VAL A CA  1 
ATOM   1401 C C   . VAL A 1 178 ? 29.101 4.801   7.053   1.00 19.42 ? 455 VAL A C   1 
ATOM   1402 O O   . VAL A 1 178 ? 29.070 5.690   7.905   1.00 20.05 ? 455 VAL A O   1 
ATOM   1403 C CB  . VAL A 1 178 ? 28.898 2.562   8.173   1.00 33.02 ? 455 VAL A CB  1 
ATOM   1404 C CG1 . VAL A 1 178 ? 29.032 3.181   9.551   1.00 36.61 ? 455 VAL A CG1 1 
ATOM   1405 C CG2 . VAL A 1 178 ? 28.078 1.281   8.238   1.00 35.37 ? 455 VAL A CG2 1 
ATOM   1406 N N   . CYS A 1 179 ? 29.874 4.844   5.970   1.00 20.34 ? 456 CYS A N   1 
ATOM   1407 C CA  . CYS A 1 179 ? 30.760 5.967   5.662   1.00 23.12 ? 456 CYS A CA  1 
ATOM   1408 C C   . CYS A 1 179 ? 31.923 6.083   6.641   1.00 24.56 ? 456 CYS A C   1 
ATOM   1409 O O   . CYS A 1 179 ? 31.944 5.426   7.681   1.00 25.86 ? 456 CYS A O   1 
ATOM   1410 C CB  . CYS A 1 179 ? 29.968 7.279   5.655   1.00 26.01 ? 456 CYS A CB  1 
ATOM   1411 S SG  . CYS A 1 179 ? 28.488 7.265   4.605   1.00 29.35 ? 456 CYS A SG  1 
ATOM   1412 N N   . TRP A 1 180 ? 32.898 6.921   6.298   1.00 28.13 ? 457 TRP A N   1 
ATOM   1413 C CA  . TRP A 1 180 ? 34.054 7.123   7.165   1.00 29.26 ? 457 TRP A CA  1 
ATOM   1414 C C   . TRP A 1 180 ? 33.565 7.806   8.441   1.00 30.59 ? 457 TRP A C   1 
ATOM   1415 O O   . TRP A 1 180 ? 32.586 8.553   8.408   1.00 29.88 ? 457 TRP A O   1 
ATOM   1416 C CB  . TRP A 1 180 ? 35.103 7.983   6.453   1.00 30.23 ? 457 TRP A CB  1 
ATOM   1417 C CG  . TRP A 1 180 ? 36.386 8.100   7.212   1.00 31.44 ? 457 TRP A CG  1 
ATOM   1418 C CD1 . TRP A 1 180 ? 37.169 7.077   7.661   1.00 31.05 ? 457 TRP A CD1 1 
ATOM   1419 C CD2 . TRP A 1 180 ? 37.029 9.310   7.628   1.00 31.81 ? 457 TRP A CD2 1 
ATOM   1420 N NE1 . TRP A 1 180 ? 38.259 7.572   8.334   1.00 30.90 ? 457 TRP A NE1 1 
ATOM   1421 C CE2 . TRP A 1 180 ? 38.198 8.941   8.330   1.00 31.69 ? 457 TRP A CE2 1 
ATOM   1422 C CE3 . TRP A 1 180 ? 36.731 10.671  7.477   1.00 31.60 ? 457 TRP A CE3 1 
ATOM   1423 C CZ2 . TRP A 1 180 ? 39.071 9.886   8.882   1.00 31.83 ? 457 TRP A CZ2 1 
ATOM   1424 C CZ3 . TRP A 1 180 ? 37.600 11.611  8.027   1.00 32.61 ? 457 TRP A CZ3 1 
ATOM   1425 C CH2 . TRP A 1 180 ? 38.755 11.211  8.720   1.00 32.24 ? 457 TRP A CH2 1 
ATOM   1426 N N   . HIS A 1 181 ? 34.244 7.559   9.559   1.00 28.55 ? 458 HIS A N   1 
ATOM   1427 C CA  . HIS A 1 181 ? 33.825 8.136   10.835  1.00 30.20 ? 458 HIS A CA  1 
ATOM   1428 C C   . HIS A 1 181 ? 33.985 9.650   10.968  1.00 30.81 ? 458 HIS A C   1 
ATOM   1429 O O   . HIS A 1 181 ? 33.602 10.226  11.986  1.00 29.90 ? 458 HIS A O   1 
ATOM   1430 C CB  . HIS A 1 181 ? 34.531 7.435   12.004  1.00 37.61 ? 458 HIS A CB  1 
ATOM   1431 C CG  . HIS A 1 181 ? 36.021 7.575   11.996  1.00 39.91 ? 458 HIS A CG  1 
ATOM   1432 N ND1 . HIS A 1 181 ? 36.831 6.878   11.125  1.00 42.67 ? 458 HIS A ND1 1 
ATOM   1433 C CD2 . HIS A 1 181 ? 36.849 8.325   12.762  1.00 40.40 ? 458 HIS A CD2 1 
ATOM   1434 C CE1 . HIS A 1 181 ? 38.094 7.191   11.356  1.00 41.11 ? 458 HIS A CE1 1 
ATOM   1435 N NE2 . HIS A 1 181 ? 38.132 8.067   12.344  1.00 42.29 ? 458 HIS A NE2 1 
ATOM   1436 N N   . ASP A 1 182 ? 34.542 10.289  9.944   1.00 29.18 ? 459 ASP A N   1 
ATOM   1437 C CA  . ASP A 1 182 ? 34.727 11.738  9.940   1.00 30.08 ? 459 ASP A CA  1 
ATOM   1438 C C   . ASP A 1 182 ? 35.310 12.299  11.236  1.00 30.96 ? 459 ASP A C   1 
ATOM   1439 O O   . ASP A 1 182 ? 34.705 13.158  11.886  1.00 29.90 ? 459 ASP A O   1 
ATOM   1440 C CB  . ASP A 1 182 ? 33.398 12.435  9.633   1.00 43.00 ? 459 ASP A CB  1 
ATOM   1441 C CG  . ASP A 1 182 ? 32.777 11.956  8.334   1.00 44.05 ? 459 ASP A CG  1 
ATOM   1442 O OD1 . ASP A 1 182 ? 33.510 11.844  7.329   1.00 41.85 ? 459 ASP A OD1 1 
ATOM   1443 O OD2 . ASP A 1 182 ? 31.554 11.700  8.315   1.00 45.35 ? 459 ASP A OD2 1 
ATOM   1444 N N   . LYS A 1 183 ? 36.495 11.821  11.599  1.00 37.87 ? 460 LYS A N   1 
ATOM   1445 C CA  . LYS A 1 183 ? 37.171 12.278  12.807  1.00 38.32 ? 460 LYS A CA  1 
ATOM   1446 C C   . LYS A 1 183 ? 36.305 12.088  14.052  1.00 38.04 ? 460 LYS A C   1 
ATOM   1447 O O   . LYS A 1 183 ? 36.232 12.970  14.908  1.00 37.83 ? 460 LYS A O   1 
ATOM   1448 C CB  . LYS A 1 183 ? 37.557 13.755  12.662  1.00 38.69 ? 460 LYS A CB  1 
ATOM   1449 C CG  . LYS A 1 183 ? 38.367 14.061  11.406  1.00 38.87 ? 460 LYS A CG  1 
ATOM   1450 C CD  . LYS A 1 183 ? 38.677 15.546  11.282  1.00 40.73 ? 460 LYS A CD  1 
ATOM   1451 C CE  . LYS A 1 183 ? 39.333 15.870  9.944   1.00 41.85 ? 460 LYS A CE  1 
ATOM   1452 N NZ  . LYS A 1 183 ? 40.634 15.168  9.757   1.00 42.33 ? 460 LYS A NZ  1 
ATOM   1453 N N   . GLY A 1 184 ? 35.650 10.934  14.143  1.00 38.82 ? 461 GLY A N   1 
ATOM   1454 C CA  . GLY A 1 184 ? 34.808 10.638  15.290  1.00 37.77 ? 461 GLY A CA  1 
ATOM   1455 C C   . GLY A 1 184 ? 33.436 11.289  15.282  1.00 37.17 ? 461 GLY A C   1 
ATOM   1456 O O   . GLY A 1 184 ? 32.631 11.056  16.185  1.00 38.41 ? 461 GLY A O   1 
ATOM   1457 N N   . LYS A 1 185 ? 33.161 12.102  14.268  1.00 31.48 ? 462 LYS A N   1 
ATOM   1458 C CA  . LYS A 1 185 ? 31.873 12.785  14.162  1.00 29.79 ? 462 LYS A CA  1 
ATOM   1459 C C   . LYS A 1 185 ? 30.769 11.897  13.597  1.00 27.46 ? 462 LYS A C   1 
ATOM   1460 O O   . LYS A 1 185 ? 29.584 12.166  13.791  1.00 26.13 ? 462 LYS A O   1 
ATOM   1461 C CB  . LYS A 1 185 ? 32.007 14.026  13.275  1.00 40.60 ? 462 LYS A CB  1 
ATOM   1462 C CG  . LYS A 1 185 ? 32.677 15.219  13.936  1.00 43.91 ? 462 LYS A CG  1 
ATOM   1463 C CD  . LYS A 1 185 ? 32.885 16.340  12.928  1.00 46.85 ? 462 LYS A CD  1 
ATOM   1464 C CE  . LYS A 1 185 ? 32.930 17.706  13.599  1.00 49.11 ? 462 LYS A CE  1 
ATOM   1465 N NZ  . LYS A 1 185 ? 33.966 17.800  14.664  1.00 50.78 ? 462 LYS A NZ  1 
ATOM   1466 N N   . ASN A 1 186 ? 31.158 10.834  12.905  1.00 24.73 ? 463 ASN A N   1 
ATOM   1467 C CA  . ASN A 1 186 ? 30.189 9.938   12.287  1.00 21.76 ? 463 ASN A CA  1 
ATOM   1468 C C   . ASN A 1 186 ? 30.464 8.489   12.678  1.00 20.82 ? 463 ASN A C   1 
ATOM   1469 O O   . ASN A 1 186 ? 30.547 7.606   11.827  1.00 22.22 ? 463 ASN A O   1 
ATOM   1470 C CB  . ASN A 1 186 ? 30.256 10.122  10.766  1.00 20.98 ? 463 ASN A CB  1 
ATOM   1471 C CG  . ASN A 1 186 ? 29.241 9.283   10.020  1.00 20.13 ? 463 ASN A CG  1 
ATOM   1472 O OD1 . ASN A 1 186 ? 28.079 9.188   10.418  1.00 19.96 ? 463 ASN A OD1 1 
ATOM   1473 N ND2 . ASN A 1 186 ? 29.673 8.683   8.916   1.00 19.31 ? 463 ASN A ND2 1 
ATOM   1474 N N   . ALA A 1 187 ? 30.590 8.252   13.980  1.00 22.87 ? 464 ALA A N   1 
ATOM   1475 C CA  . ALA A 1 187 ? 30.874 6.917   14.486  1.00 21.99 ? 464 ALA A CA  1 
ATOM   1476 C C   . ALA A 1 187 ? 29.622 6.098   14.785  1.00 22.91 ? 464 ALA A C   1 
ATOM   1477 O O   . ALA A 1 187 ? 29.724 4.923   15.142  1.00 23.38 ? 464 ALA A O   1 
ATOM   1478 C CB  . ALA A 1 187 ? 31.737 7.016   15.741  1.00 33.25 ? 464 ALA A CB  1 
ATOM   1479 N N   . GLN A 1 188 ? 28.446 6.706   14.639  1.00 20.21 ? 465 GLN A N   1 
ATOM   1480 C CA  . GLN A 1 188 ? 27.195 5.997   14.923  1.00 19.55 ? 465 GLN A CA  1 
ATOM   1481 C C   . GLN A 1 188 ? 27.003 4.765   14.051  1.00 18.38 ? 465 GLN A C   1 
ATOM   1482 O O   . GLN A 1 188 ? 27.468 4.713   12.916  1.00 18.94 ? 465 GLN A O   1 
ATOM   1483 C CB  . GLN A 1 188 ? 25.983 6.916   14.745  1.00 22.11 ? 465 GLN A CB  1 
ATOM   1484 C CG  . GLN A 1 188 ? 25.924 8.066   15.729  1.00 25.14 ? 465 GLN A CG  1 
ATOM   1485 C CD  . GLN A 1 188 ? 26.616 9.299   15.203  1.00 25.25 ? 465 GLN A CD  1 
ATOM   1486 O OE1 . GLN A 1 188 ? 27.557 9.205   14.414  1.00 25.54 ? 465 GLN A OE1 1 
ATOM   1487 N NE2 . GLN A 1 188 ? 26.163 10.466  15.646  1.00 28.51 ? 465 GLN A NE2 1 
ATOM   1488 N N   . PRO A 1 189 ? 26.302 3.754   14.579  1.00 17.61 ? 466 PRO A N   1 
ATOM   1489 C CA  . PRO A 1 189 ? 26.050 2.517   13.836  1.00 18.22 ? 466 PRO A CA  1 
ATOM   1490 C C   . PRO A 1 189 ? 24.788 2.593   12.987  1.00 16.83 ? 466 PRO A C   1 
ATOM   1491 O O   . PRO A 1 189 ? 24.012 3.537   13.086  1.00 16.64 ? 466 PRO A O   1 
ATOM   1492 C CB  . PRO A 1 189 ? 25.873 1.496   14.943  1.00 15.01 ? 466 PRO A CB  1 
ATOM   1493 C CG  . PRO A 1 189 ? 25.102 2.299   15.976  1.00 17.03 ? 466 PRO A CG  1 
ATOM   1494 C CD  . PRO A 1 189 ? 25.862 3.623   15.982  1.00 16.43 ? 466 PRO A CD  1 
ATOM   1495 N N   . LEU A 1 190 ? 24.615 1.594   12.131  1.00 16.24 ? 467 LEU A N   1 
ATOM   1496 C CA  . LEU A 1 190 ? 23.407 1.469   11.337  1.00 14.60 ? 467 LEU A CA  1 
ATOM   1497 C C   . LEU A 1 190 ? 22.833 0.216   11.977  1.00 15.49 ? 467 LEU A C   1 
ATOM   1498 O O   . LEU A 1 190 ? 23.576 -0.721  12.295  1.00 15.19 ? 467 LEU A O   1 
ATOM   1499 C CB  . LEU A 1 190 ? 23.708 1.245   9.853   1.00 15.26 ? 467 LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 190 ? 24.110 2.506   9.075   1.00 14.97 ? 467 LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 190 ? 24.344 2.160   7.607   1.00 14.29 ? 467 LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 190 ? 23.017 3.559   9.209   1.00 17.48 ? 467 LEU A CD2 1 
ATOM   1503 N N   . LEU A 1 191 ? 21.525 0.204   12.190  1.00 15.74 ? 468 LEU A N   1 
ATOM   1504 C CA  . LEU A 1 191 ? 20.883 -0.917  12.857  1.00 16.87 ? 468 LEU A CA  1 
ATOM   1505 C C   . LEU A 1 191 ? 19.668 -1.431  12.098  1.00 16.25 ? 468 LEU A C   1 
ATOM   1506 O O   . LEU A 1 191 ? 18.834 -0.647  11.661  1.00 16.35 ? 468 LEU A O   1 
ATOM   1507 C CB  . LEU A 1 191 ? 20.460 -0.463  14.257  1.00 20.31 ? 468 LEU A CB  1 
ATOM   1508 C CG  . LEU A 1 191 ? 21.572 0.294   14.991  1.00 23.32 ? 468 LEU A CG  1 
ATOM   1509 C CD1 . LEU A 1 191 ? 21.022 1.534   15.671  1.00 25.10 ? 468 LEU A CD1 1 
ATOM   1510 C CD2 . LEU A 1 191 ? 22.248 -0.635  15.975  1.00 23.53 ? 468 LEU A CD2 1 
ATOM   1511 N N   . LEU A 1 192 ? 19.572 -2.749  11.935  1.00 14.45 ? 469 LEU A N   1 
ATOM   1512 C CA  . LEU A 1 192 ? 18.424 -3.329  11.253  1.00 16.06 ? 469 LEU A CA  1 
ATOM   1513 C C   . LEU A 1 192 ? 17.321 -3.510  12.289  1.00 17.44 ? 469 LEU A C   1 
ATOM   1514 O O   . LEU A 1 192 ? 17.558 -4.064  13.360  1.00 17.77 ? 469 LEU A O   1 
ATOM   1515 C CB  . LEU A 1 192 ? 18.789 -4.677  10.631  1.00 17.72 ? 469 LEU A CB  1 
ATOM   1516 C CG  . LEU A 1 192 ? 19.506 -4.583  9.281   1.00 17.70 ? 469 LEU A CG  1 
ATOM   1517 C CD1 . LEU A 1 192 ? 20.175 -5.909  8.946   1.00 18.45 ? 469 LEU A CD1 1 
ATOM   1518 C CD2 . LEU A 1 192 ? 18.495 -4.189  8.210   1.00 17.91 ? 469 LEU A CD2 1 
ATOM   1519 N N   . VAL A 1 193 ? 16.125 -3.022  11.970  1.00 19.09 ? 470 VAL A N   1 
ATOM   1520 C CA  . VAL A 1 193 ? 14.988 -3.117  12.882  1.00 23.77 ? 470 VAL A CA  1 
ATOM   1521 C C   . VAL A 1 193 ? 14.343 -4.499  12.852  1.00 24.56 ? 470 VAL A C   1 
ATOM   1522 O O   . VAL A 1 193 ? 14.253 -5.125  13.929  1.00 28.49 ? 470 VAL A O   1 
ATOM   1523 C CB  . VAL A 1 193 ? 13.925 -2.058  12.537  1.00 26.72 ? 470 VAL A CB  1 
ATOM   1524 C CG1 . VAL A 1 193 ? 12.734 -2.181  13.482  1.00 26.72 ? 470 VAL A CG1 1 
ATOM   1525 C CG2 . VAL A 1 193 ? 14.535 -0.673  12.639  1.00 27.18 ? 470 VAL A CG2 1 
ATOM   1526 O OXT . VAL A 1 193 ? 13.936 -4.937  11.758  1.00 27.12 ? 470 VAL A OXT 1 
HETATM 1527 O O   . HOH B 2 .   ? 19.360 -1.138  2.685   1.00 14.74 ? 2   HOH A O   1 
HETATM 1528 O O   . HOH B 2 .   ? 34.852 -0.308  -2.526  1.00 20.04 ? 3   HOH A O   1 
HETATM 1529 O O   . HOH B 2 .   ? 25.847 -11.318 1.031   1.00 19.62 ? 4   HOH A O   1 
HETATM 1530 O O   . HOH B 2 .   ? 21.036 -14.923 -0.030  1.00 22.16 ? 5   HOH A O   1 
HETATM 1531 O O   . HOH B 2 .   ? 22.836 5.445   14.669  1.00 17.20 ? 6   HOH A O   1 
HETATM 1532 O O   . HOH B 2 .   ? 34.966 -5.960  8.518   1.00 22.87 ? 7   HOH A O   1 
HETATM 1533 O O   . HOH B 2 .   ? 28.841 -3.571  15.685  1.00 21.39 ? 8   HOH A O   1 
HETATM 1534 O O   . HOH B 2 .   ? 20.494 10.292  10.665  1.00 22.05 ? 9   HOH A O   1 
HETATM 1535 O O   . HOH B 2 .   ? 30.085 3.672   12.295  1.00 23.94 ? 10  HOH A O   1 
HETATM 1536 O O   . HOH B 2 .   ? 23.025 -0.576  -16.232 1.00 21.44 ? 11  HOH A O   1 
HETATM 1537 O O   . HOH B 2 .   ? 25.387 9.978   -6.967  1.00 25.25 ? 12  HOH A O   1 
HETATM 1538 O O   . HOH B 2 .   ? 27.530 5.209   -15.577 1.00 21.89 ? 13  HOH A O   1 
HETATM 1539 O O   . HOH B 2 .   ? 14.394 -4.079  9.204   1.00 22.90 ? 14  HOH A O   1 
HETATM 1540 O O   . HOH B 2 .   ? 19.908 4.902   -14.766 1.00 23.57 ? 15  HOH A O   1 
HETATM 1541 O O   . HOH B 2 .   ? 22.629 -1.709  19.877  1.00 24.51 ? 16  HOH A O   1 
HETATM 1542 O O   . HOH B 2 .   ? 27.373 -6.591  -5.648  1.00 26.22 ? 17  HOH A O   1 
HETATM 1543 O O   . HOH B 2 .   ? 25.531 8.935   -14.632 1.00 27.30 ? 18  HOH A O   1 
HETATM 1544 O O   . HOH B 2 .   ? 29.413 8.435   -6.556  1.00 29.36 ? 19  HOH A O   1 
HETATM 1545 O O   . HOH B 2 .   ? 14.307 5.365   15.199  1.00 26.44 ? 20  HOH A O   1 
HETATM 1546 O O   . HOH B 2 .   ? 27.371 -10.866 -1.200  1.00 25.47 ? 21  HOH A O   1 
HETATM 1547 O O   . HOH B 2 .   ? 29.093 -0.369  -8.175  1.00 25.73 ? 22  HOH A O   1 
HETATM 1548 O O   . HOH B 2 .   ? 13.741 -12.809 -3.836  1.00 34.37 ? 23  HOH A O   1 
HETATM 1549 O O   . HOH B 2 .   ? 23.513 11.363  -8.241  1.00 25.27 ? 24  HOH A O   1 
HETATM 1550 O O   . HOH B 2 .   ? 33.169 -6.906  -6.663  1.00 26.63 ? 25  HOH A O   1 
HETATM 1551 O O   . HOH B 2 .   ? 25.711 -11.591 10.665  1.00 25.45 ? 26  HOH A O   1 
HETATM 1552 O O   . HOH B 2 .   ? 18.241 11.271  9.145   1.00 24.36 ? 27  HOH A O   1 
HETATM 1553 O O   . HOH B 2 .   ? 37.970 3.218   2.715   1.00 32.64 ? 28  HOH A O   1 
HETATM 1554 O O   . HOH B 2 .   ? 25.107 -13.859 0.591   1.00 29.68 ? 29  HOH A O   1 
HETATM 1555 O O   . HOH B 2 .   ? 39.183 2.670   -7.607  1.00 36.58 ? 30  HOH A O   1 
HETATM 1556 O O   . HOH B 2 .   ? 24.338 10.955  0.224   1.00 22.37 ? 31  HOH A O   1 
HETATM 1557 O O   . HOH B 2 .   ? 40.334 -4.110  -5.023  1.00 33.21 ? 32  HOH A O   1 
HETATM 1558 O O   . HOH B 2 .   ? 17.930 11.934  13.100  1.00 30.48 ? 33  HOH A O   1 
HETATM 1559 O O   . HOH B 2 .   ? 26.061 10.343  2.309   1.00 23.74 ? 34  HOH A O   1 
HETATM 1560 O O   . HOH B 2 .   ? 32.282 -8.249  11.851  1.00 26.91 ? 35  HOH A O   1 
HETATM 1561 O O   . HOH B 2 .   ? 26.636 -10.299 14.774  1.00 26.85 ? 36  HOH A O   1 
HETATM 1562 O O   . HOH B 2 .   ? 26.731 -4.559  19.632  1.00 30.49 ? 37  HOH A O   1 
HETATM 1563 O O   . HOH B 2 .   ? 33.256 -7.919  9.246   1.00 31.80 ? 38  HOH A O   1 
HETATM 1564 O O   . HOH B 2 .   ? 17.004 -14.333 -0.024  1.00 35.12 ? 39  HOH A O   1 
HETATM 1565 O O   . HOH B 2 .   ? 9.488  -7.948  3.353   1.00 26.31 ? 40  HOH A O   1 
HETATM 1566 O O   . HOH B 2 .   ? 17.397 17.436  2.971   1.00 29.24 ? 41  HOH A O   1 
HETATM 1567 O O   . HOH B 2 .   ? 17.939 -15.484 6.213   1.00 34.27 ? 42  HOH A O   1 
HETATM 1568 O O   . HOH B 2 .   ? 16.712 -7.711  10.236  1.00 31.59 ? 43  HOH A O   1 
HETATM 1569 O O   . HOH B 2 .   ? 31.836 6.064   -13.844 1.00 38.44 ? 44  HOH A O   1 
HETATM 1570 O O   . HOH B 2 .   ? 29.133 7.281   2.047   1.00 30.72 ? 45  HOH A O   1 
HETATM 1571 O O   . HOH B 2 .   ? 11.808 16.491  -2.115  1.00 39.11 ? 46  HOH A O   1 
HETATM 1572 O O   . HOH B 2 .   ? 32.366 9.413   18.266  1.00 51.47 ? 47  HOH A O   1 
HETATM 1573 O O   . HOH B 2 .   ? 17.954 8.103   -11.799 1.00 31.43 ? 48  HOH A O   1 
HETATM 1574 O O   . HOH B 2 .   ? 38.021 -10.152 0.960   1.00 34.84 ? 49  HOH A O   1 
HETATM 1575 O O   . HOH B 2 .   ? 10.565 10.511  -5.856  1.00 32.69 ? 50  HOH A O   1 
HETATM 1576 O O   . HOH B 2 .   ? 22.708 7.726   18.061  1.00 38.28 ? 51  HOH A O   1 
HETATM 1577 O O   . HOH B 2 .   ? 14.369 2.196   17.925  1.00 32.53 ? 52  HOH A O   1 
HETATM 1578 O O   . HOH B 2 .   ? 15.099 13.710  14.942  1.00 40.20 ? 53  HOH A O   1 
HETATM 1579 O O   . HOH B 2 .   ? 30.690 1.766   -9.127  1.00 29.04 ? 54  HOH A O   1 
HETATM 1580 O O   . HOH B 2 .   ? 22.612 -8.102  -10.748 1.00 28.73 ? 55  HOH A O   1 
HETATM 1581 O O   . HOH B 2 .   ? 34.782 -8.397  5.868   1.00 30.84 ? 56  HOH A O   1 
HETATM 1582 O O   . HOH B 2 .   ? 30.109 3.445   17.424  1.00 33.95 ? 57  HOH A O   1 
HETATM 1583 O O   . HOH B 2 .   ? 17.566 -11.015 11.387  1.00 34.94 ? 58  HOH A O   1 
HETATM 1584 O O   . HOH B 2 .   ? 5.347  -1.107  7.638   1.00 37.49 ? 59  HOH A O   1 
HETATM 1585 O O   . HOH B 2 .   ? 15.473 -6.468  8.251   1.00 26.97 ? 60  HOH A O   1 
HETATM 1586 O O   . HOH B 2 .   ? 26.068 -11.488 17.909  1.00 42.56 ? 61  HOH A O   1 
HETATM 1587 O O   . HOH B 2 .   ? 17.742 6.140   -13.636 1.00 39.01 ? 62  HOH A O   1 
HETATM 1588 O O   . HOH B 2 .   ? 27.706 13.283  15.213  1.00 41.87 ? 63  HOH A O   1 
HETATM 1589 O O   . HOH B 2 .   ? 15.470 -14.686 2.469   1.00 40.92 ? 64  HOH A O   1 
HETATM 1590 O O   . HOH B 2 .   ? 8.366  -10.517 -8.974  1.00 39.22 ? 65  HOH A O   1 
HETATM 1591 O O   . HOH B 2 .   ? 11.221 14.173  -0.281  1.00 31.49 ? 66  HOH A O   1 
HETATM 1592 O O   . HOH B 2 .   ? -3.652 8.444   6.032   1.00 49.00 ? 67  HOH A O   1 
HETATM 1593 O O   . HOH B 2 .   ? 21.400 -0.817  -13.908 1.00 39.13 ? 68  HOH A O   1 
HETATM 1594 O O   . HOH B 2 .   ? 35.133 -12.011 2.223   1.00 36.57 ? 69  HOH A O   1 
HETATM 1595 O O   . HOH B 2 .   ? 31.079 0.600   19.585  1.00 42.17 ? 70  HOH A O   1 
HETATM 1596 O O   . HOH B 2 .   ? 14.124 6.293   -11.457 1.00 33.33 ? 71  HOH A O   1 
HETATM 1597 O O   . HOH B 2 .   ? 25.486 -12.903 -6.014  1.00 42.06 ? 72  HOH A O   1 
HETATM 1598 O O   . HOH B 2 .   ? 19.637 19.067  -6.089  1.00 43.95 ? 73  HOH A O   1 
HETATM 1599 O O   . HOH B 2 .   ? 5.143  -3.845  7.963   1.00 57.80 ? 74  HOH A O   1 
HETATM 1600 O O   . HOH B 2 .   ? 39.207 -13.589 -4.962  1.00 37.15 ? 75  HOH A O   1 
HETATM 1601 O O   . HOH B 2 .   ? 40.687 -1.197  2.524   1.00 41.29 ? 76  HOH A O   1 
HETATM 1602 O O   . HOH B 2 .   ? 20.266 16.165  -9.830  1.00 38.75 ? 77  HOH A O   1 
HETATM 1603 O O   . HOH B 2 .   ? 42.207 16.685  11.651  1.00 42.24 ? 78  HOH A O   1 
HETATM 1604 O O   . HOH B 2 .   ? 40.615 -0.537  -4.778  1.00 40.11 ? 79  HOH A O   1 
HETATM 1605 O O   . HOH B 2 .   ? 19.148 -11.849 13.670  1.00 38.60 ? 80  HOH A O   1 
HETATM 1606 O O   . HOH B 2 .   ? 42.187 -2.656  -1.672  1.00 36.84 ? 81  HOH A O   1 
HETATM 1607 O O   . HOH B 2 .   ? 39.595 -7.253  5.738   1.00 31.66 ? 82  HOH A O   1 
HETATM 1608 O O   . HOH B 2 .   ? 14.941 -12.660 4.181   1.00 38.24 ? 83  HOH A O   1 
HETATM 1609 O O   . HOH B 2 .   ? 17.051 16.038  7.181   1.00 41.28 ? 84  HOH A O   1 
HETATM 1610 O O   . HOH B 2 .   ? 25.923 16.005  -3.357  1.00 36.13 ? 85  HOH A O   1 
HETATM 1611 O O   . HOH B 2 .   ? 38.092 -6.085  9.782   1.00 41.89 ? 86  HOH A O   1 
HETATM 1612 O O   . HOH B 2 .   ? 29.804 10.138  16.196  1.00 36.01 ? 87  HOH A O   1 
HETATM 1613 O O   . HOH B 2 .   ? 14.969 19.103  -7.300  1.00 46.40 ? 88  HOH A O   1 
HETATM 1614 O O   . HOH B 2 .   ? 6.769  -7.025  10.430  1.00 40.46 ? 89  HOH A O   1 
HETATM 1615 O O   . HOH B 2 .   ? 9.368  -3.598  14.040  1.00 54.39 ? 90  HOH A O   1 
HETATM 1616 O O   . HOH B 2 .   ? 27.044 13.043  -2.117  1.00 42.88 ? 91  HOH A O   1 
HETATM 1617 O O   . HOH B 2 .   ? 28.670 14.712  6.933   1.00 36.19 ? 92  HOH A O   1 
HETATM 1618 O O   . HOH B 2 .   ? 8.136  6.570   17.323  1.00 66.17 ? 93  HOH A O   1 
HETATM 1619 O O   . HOH B 2 .   ? 21.607 -3.893  18.869  1.00 38.50 ? 94  HOH A O   1 
HETATM 1620 O O   . HOH B 2 .   ? 1.378  -5.602  1.823   1.00 70.33 ? 95  HOH A O   1 
HETATM 1621 O O   . HOH B 2 .   ? 34.754 -5.932  -8.778  1.00 40.56 ? 96  HOH A O   1 
HETATM 1622 O O   . HOH B 2 .   ? 43.556 18.885  10.279  1.00 35.17 ? 97  HOH A O   1 
HETATM 1623 O O   . HOH B 2 .   ? 19.046 -2.935  19.913  1.00 44.88 ? 98  HOH A O   1 
HETATM 1624 O O   . HOH B 2 .   ? 20.186 -3.670  16.729  1.00 47.99 ? 99  HOH A O   1 
HETATM 1625 O O   . HOH B 2 .   ? 18.777 -15.729 1.214   1.00 35.65 ? 100 HOH A O   1 
HETATM 1626 O O   . HOH B 2 .   ? 30.806 -8.766  16.816  1.00 42.88 ? 101 HOH A O   1 
HETATM 1627 O O   . HOH B 2 .   ? 24.353 -13.730 11.221  1.00 44.12 ? 102 HOH A O   1 
HETATM 1628 O O   . HOH B 2 .   ? 36.054 15.573  14.783  1.00 40.32 ? 103 HOH A O   1 
HETATM 1629 O O   . HOH B 2 .   ? 40.005 -1.964  -7.372  1.00 37.23 ? 104 HOH A O   1 
HETATM 1630 O O   . HOH B 2 .   ? 39.565 -7.939  8.237   1.00 42.89 ? 105 HOH A O   1 
HETATM 1631 O O   . HOH B 2 .   ? 28.049 -11.478 12.576  1.00 34.51 ? 106 HOH A O   1 
HETATM 1632 O O   . HOH B 2 .   ? 22.888 -6.312  -13.155 1.00 37.30 ? 107 HOH A O   1 
HETATM 1633 O O   . HOH B 2 .   ? 11.740 -5.790  14.852  1.00 47.21 ? 108 HOH A O   1 
HETATM 1634 O O   . HOH B 2 .   ? 15.438 -7.249  12.286  1.00 43.69 ? 109 HOH A O   1 
HETATM 1635 O O   . HOH B 2 .   ? 23.067 -3.187  -16.681 1.00 43.84 ? 110 HOH A O   1 
HETATM 1636 O O   . HOH B 2 .   ? 27.868 4.141   18.804  1.00 54.12 ? 111 HOH A O   1 
HETATM 1637 O O   . HOH B 2 .   ? 15.448 8.408   -10.684 1.00 43.75 ? 112 HOH A O   1 
HETATM 1638 O O   . HOH B 2 .   ? 28.622 21.018  7.867   1.00 37.52 ? 113 HOH A O   1 
HETATM 1639 O O   . HOH B 2 .   ? 23.859 11.108  -15.950 1.00 35.21 ? 114 HOH A O   1 
HETATM 1640 O O   . HOH B 2 .   ? 42.010 -1.141  4.853   1.00 39.84 ? 115 HOH A O   1 
HETATM 1641 O O   . HOH B 2 .   ? 22.418 -15.975 -2.197  1.00 41.17 ? 116 HOH A O   1 
HETATM 1642 O O   . HOH B 2 .   ? 27.492 -12.991 -2.814  1.00 43.03 ? 117 HOH A O   1 
HETATM 1643 O O   . HOH B 2 .   ? 16.286 19.476  -5.103  1.00 44.89 ? 118 HOH A O   1 
HETATM 1644 O O   . HOH B 2 .   ? 39.247 0.578   -9.514  1.00 42.71 ? 119 HOH A O   1 
HETATM 1645 O O   . HOH B 2 .   ? 7.988  -9.928  2.155   1.00 51.41 ? 120 HOH A O   1 
HETATM 1646 O O   . HOH B 2 .   ? 6.981  -7.829  -7.233  1.00 39.86 ? 121 HOH A O   1 
HETATM 1647 O O   . HOH B 2 .   ? 26.824 -8.652  19.826  1.00 39.46 ? 122 HOH A O   1 
HETATM 1648 O O   . HOH B 2 .   ? 24.982 -15.330 -1.821  1.00 62.81 ? 123 HOH A O   1 
HETATM 1649 O O   . HOH B 2 .   ? 29.985 -10.275 -11.822 1.00 57.56 ? 124 HOH A O   1 
HETATM 1650 O O   . HOH B 2 .   ? 33.676 4.324   -2.816  1.00 32.54 ? 125 HOH A O   1 
HETATM 1651 O O   . HOH B 2 .   ? 17.548 -14.191 -4.594  1.00 38.80 ? 126 HOH A O   1 
HETATM 1652 O O   . HOH B 2 .   ? 44.371 1.998   -3.269  1.00 35.84 ? 127 HOH A O   1 
HETATM 1653 O O   . HOH B 2 .   ? 23.678 -12.444 -10.291 1.00 47.70 ? 128 HOH A O   1 
HETATM 1654 O O   . HOH B 2 .   ? 27.894 10.831  -6.398  1.00 44.88 ? 129 HOH A O   1 
HETATM 1655 O O   . HOH B 2 .   ? 25.901 -6.453  21.256  1.00 34.96 ? 130 HOH A O   1 
HETATM 1656 O O   . HOH B 2 .   ? 11.961 9.104   15.999  1.00 42.71 ? 131 HOH A O   1 
HETATM 1657 O O   . HOH B 2 .   ? 8.222  -5.798  14.563  1.00 53.90 ? 132 HOH A O   1 
HETATM 1658 O O   . HOH B 2 .   ? 14.959 20.063  -2.857  1.00 55.34 ? 133 HOH A O   1 
HETATM 1659 O O   . HOH B 2 .   ? 30.961 5.577   10.292  1.00 27.47 ? 134 HOH A O   1 
HETATM 1660 O O   . HOH B 2 .   ? 7.113  7.758   10.162  1.00 29.25 ? 135 HOH A O   1 
HETATM 1661 O O   . HOH B 2 .   ? 8.766  -1.701  12.465  1.00 34.48 ? 136 HOH A O   1 
HETATM 1662 O O   . HOH B 2 .   ? -1.096 6.647   4.201   1.00 37.21 ? 137 HOH A O   1 
HETATM 1663 O O   . HOH B 2 .   ? 10.934 12.386  11.287  1.00 34.13 ? 138 HOH A O   1 
HETATM 1664 O O   . HOH B 2 .   ? 29.837 13.684  9.240   1.00 37.82 ? 139 HOH A O   1 
HETATM 1665 O O   . HOH B 2 .   ? 8.669  1.668   12.543  1.00 35.52 ? 140 HOH A O   1 
HETATM 1666 O O   . HOH B 2 .   ? 21.262 18.539  -8.535  1.00 40.59 ? 141 HOH A O   1 
HETATM 1667 O O   . HOH B 2 .   ? 13.926 17.306  -5.168  1.00 46.30 ? 142 HOH A O   1 
HETATM 1668 O O   . HOH B 2 .   ? 7.535  -10.685 4.670   1.00 50.26 ? 143 HOH A O   1 
HETATM 1669 O O   . HOH B 2 .   ? 27.322 10.554  -12.827 1.00 38.71 ? 144 HOH A O   1 
HETATM 1670 O O   . HOH B 2 .   ? 23.448 13.388  -17.298 1.00 49.37 ? 145 HOH A O   1 
HETATM 1671 O O   . HOH B 2 .   ? 36.790 3.325   7.465   1.00 39.05 ? 146 HOH A O   1 
HETATM 1672 O O   . HOH B 2 .   ? 33.322 -9.243  16.129  1.00 45.61 ? 147 HOH A O   1 
HETATM 1673 O O   . HOH B 2 .   ? 40.590 0.773   13.113  1.00 43.65 ? 148 HOH A O   1 
HETATM 1674 O O   . HOH B 2 .   ? 30.470 -3.874  18.169  1.00 34.42 ? 149 HOH A O   1 
HETATM 1675 O O   . HOH B 2 .   ? 29.465 -11.396 0.414   1.00 48.89 ? 150 HOH A O   1 
HETATM 1676 O O   . HOH B 2 .   ? 30.751 -10.400 12.848  1.00 41.01 ? 151 HOH A O   1 
HETATM 1677 O O   . HOH B 2 .   ? 11.440 11.674  15.545  1.00 43.35 ? 152 HOH A O   1 
HETATM 1678 O O   . HOH B 2 .   ? 27.250 -15.694 1.070   1.00 42.97 ? 153 HOH A O   1 
HETATM 1679 O O   . HOH B 2 .   ? 25.982 19.711  10.259  1.00 40.74 ? 154 HOH A O   1 
HETATM 1680 O O   . HOH B 2 .   ? 28.813 -14.914 3.491   1.00 46.85 ? 155 HOH A O   1 
HETATM 1681 O O   . HOH B 2 .   ? 11.052 -6.909  17.413  1.00 44.07 ? 156 HOH A O   1 
HETATM 1682 O O   . HOH B 2 .   ? 11.989 -12.909 1.516   1.00 46.20 ? 157 HOH A O   1 
HETATM 1683 O O   . HOH B 2 .   ? 30.684 11.706  -10.237 1.00 49.19 ? 158 HOH A O   1 
HETATM 1684 O O   . HOH B 2 .   ? 38.745 -2.675  12.026  1.00 38.24 ? 159 HOH A O   1 
HETATM 1685 O O   . HOH B 2 .   ? 24.286 17.689  -5.252  1.00 48.82 ? 160 HOH A O   1 
HETATM 1686 O O   . HOH B 2 .   ? 3.797  -6.286  -13.173 1.00 40.77 ? 161 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   278 278 ARG ARG A . n 
A 1 2   LYS 2   279 279 LYS LYS A . n 
A 1 3   MET 3   280 280 MET MET A . n 
A 1 4   PHE 4   281 281 PHE PHE A . n 
A 1 5   ARG 5   282 282 ARG ARG A . n 
A 1 6   ALA 6   283 283 ALA ALA A . n 
A 1 7   LEU 7   284 284 LEU LEU A . n 
A 1 8   MET 8   285 285 MET MET A . n 
A 1 9   PRO 9   286 286 PRO PRO A . n 
A 1 10  ALA 10  287 287 ALA ALA A . n 
A 1 11  LEU 11  288 288 LEU LEU A . n 
A 1 12  GLU 12  289 289 GLU GLU A . n 
A 1 13  GLU 13  290 290 GLU GLU A . n 
A 1 14  LEU 14  291 291 LEU LEU A . n 
A 1 15  THR 15  292 292 THR THR A . n 
A 1 16  PHE 16  293 293 PHE PHE A . n 
A 1 17  ASP 17  294 294 ASP ASP A . n 
A 1 18  PRO 18  295 295 PRO PRO A . n 
A 1 19  SER 19  296 296 SER SER A . n 
A 1 20  SER 20  297 297 SER SER A . n 
A 1 21  ALA 21  298 298 ALA ALA A . n 
A 1 22  HIS 22  299 299 HIS HIS A . n 
A 1 23  PRO 23  300 300 PRO PRO A . n 
A 1 24  SER 24  301 301 SER SER A . n 
A 1 25  LEU 25  302 302 LEU LEU A . n 
A 1 26  VAL 26  303 303 VAL VAL A . n 
A 1 27  VAL 27  304 304 VAL VAL A . n 
A 1 28  SER 28  305 305 SER SER A . n 
A 1 29  SER 29  306 306 SER SER A . n 
A 1 30  SER 30  307 307 SER SER A . n 
A 1 31  GLY 31  308 308 GLY GLY A . n 
A 1 32  ARG 32  309 309 ARG ARG A . n 
A 1 33  ARG 33  310 310 ARG ARG A . n 
A 1 34  VAL 34  311 311 VAL VAL A . n 
A 1 35  GLU 35  312 312 GLU GLU A . n 
A 1 36  CYS 36  313 313 CYS CYS A . n 
A 1 37  SER 37  314 314 SER SER A . n 
A 1 38  GLU 38  315 315 GLU GLU A . n 
A 1 39  GLN 39  316 316 GLN GLN A . n 
A 1 40  LYS 40  317 317 LYS LYS A . n 
A 1 41  ALA 41  318 318 ALA ALA A . n 
A 1 42  PRO 42  319 319 PRO PRO A . n 
A 1 43  PRO 43  320 320 PRO PRO A . n 
A 1 44  ALA 44  321 321 ALA ALA A . n 
A 1 45  GLY 45  322 322 GLY GLY A . n 
A 1 46  GLU 46  323 323 GLU GLU A . n 
A 1 47  ASP 47  324 324 ASP ASP A . n 
A 1 48  PRO 48  325 325 PRO PRO A . n 
A 1 49  ARG 49  326 326 ARG ARG A . n 
A 1 50  GLN 50  327 327 GLN GLN A . n 
A 1 51  PHE 51  328 328 PHE PHE A . n 
A 1 52  ASP 52  329 329 ASP ASP A . n 
A 1 53  LYS 53  330 330 LYS LYS A . n 
A 1 54  ALA 54  331 331 ALA ALA A . n 
A 1 55  VAL 55  332 332 VAL VAL A . n 
A 1 56  ALA 56  333 333 ALA ALA A . n 
A 1 57  VAL 57  334 334 VAL VAL A . n 
A 1 58  VAL 58  335 335 VAL VAL A . n 
A 1 59  ALA 59  336 336 ALA ALA A . n 
A 1 60  HIS 60  337 337 HIS HIS A . n 
A 1 61  GLN 61  338 338 GLN GLN A . n 
A 1 62  GLN 62  339 339 GLN GLN A . n 
A 1 63  LEU 63  340 340 LEU LEU A . n 
A 1 64  SER 64  341 341 SER SER A . n 
A 1 65  GLU 65  342 342 GLU GLU A . n 
A 1 66  GLY 66  343 343 GLY GLY A . n 
A 1 67  GLU 67  344 344 GLU GLU A . n 
A 1 68  HIS 68  345 345 HIS HIS A . n 
A 1 69  TYR 69  346 346 TYR TYR A . n 
A 1 70  TRP 70  347 347 TRP TRP A . n 
A 1 71  GLU 71  348 348 GLU GLU A . n 
A 1 72  VAL 72  349 349 VAL VAL A . n 
A 1 73  ASP 73  350 350 ASP ASP A . n 
A 1 74  VAL 74  351 351 VAL VAL A . n 
A 1 75  GLY 75  352 352 GLY GLY A . n 
A 1 76  ASP 76  353 353 ASP ASP A . n 
A 1 77  LYS 77  354 354 LYS LYS A . n 
A 1 78  PRO 78  355 355 PRO PRO A . n 
A 1 79  ARG 79  356 356 ARG ARG A . n 
A 1 80  TRP 80  357 357 TRP TRP A . n 
A 1 81  ALA 81  358 358 ALA ALA A . n 
A 1 82  LEU 82  359 359 LEU LEU A . n 
A 1 83  GLY 83  360 360 GLY GLY A . n 
A 1 84  VAL 84  361 361 VAL VAL A . n 
A 1 85  ILE 85  362 362 ILE ILE A . n 
A 1 86  ALA 86  363 363 ALA ALA A . n 
A 1 87  ALA 87  364 364 ALA ALA A . n 
A 1 88  GLU 88  365 365 GLU GLU A . n 
A 1 89  ALA 89  366 366 ALA ALA A . n 
A 1 90  PRO 90  367 367 PRO PRO A . n 
A 1 91  ARG 91  368 368 ARG ARG A . n 
A 1 92  ARG 92  369 369 ARG ARG A . n 
A 1 93  GLY 93  370 370 GLY GLY A . n 
A 1 94  ARG 94  371 371 ARG ARG A . n 
A 1 95  LEU 95  372 372 LEU LEU A . n 
A 1 96  HIS 96  373 373 HIS HIS A . n 
A 1 97  ALA 97  374 374 ALA ALA A . n 
A 1 98  VAL 98  375 375 VAL VAL A . n 
A 1 99  PRO 99  376 376 PRO PRO A . n 
A 1 100 SER 100 377 377 SER SER A . n 
A 1 101 GLN 101 378 378 GLN GLN A . n 
A 1 102 GLY 102 379 379 GLY GLY A . n 
A 1 103 LEU 103 380 380 LEU LEU A . n 
A 1 104 TRP 104 381 381 TRP TRP A . n 
A 1 105 LEU 105 382 382 LEU LEU A . n 
A 1 106 LEU 106 383 383 LEU LEU A . n 
A 1 107 GLY 107 384 384 GLY GLY A . n 
A 1 108 LEU 108 385 385 LEU LEU A . n 
A 1 109 ARG 109 386 386 ARG ARG A . n 
A 1 110 GLU 110 387 387 GLU GLU A . n 
A 1 111 GLY 111 388 388 GLY GLY A . n 
A 1 112 LYS 112 389 389 LYS LYS A . n 
A 1 113 ILE 113 390 390 ILE ILE A . n 
A 1 114 LEU 114 391 391 LEU LEU A . n 
A 1 115 GLU 115 392 392 GLU GLU A . n 
A 1 116 ALA 116 393 393 ALA ALA A . n 
A 1 117 HIS 117 394 394 HIS HIS A . n 
A 1 118 VAL 118 395 395 VAL VAL A . n 
A 1 119 GLU 119 396 396 GLU GLU A . n 
A 1 120 ALA 120 397 397 ALA ALA A . n 
A 1 121 LYS 121 398 398 LYS LYS A . n 
A 1 122 GLU 122 399 399 GLU GLU A . n 
A 1 123 PRO 123 400 400 PRO PRO A . n 
A 1 124 ARG 124 401 401 ARG ARG A . n 
A 1 125 ALA 125 402 402 ALA ALA A . n 
A 1 126 LEU 126 403 403 LEU LEU A . n 
A 1 127 ARG 127 404 404 ARG ARG A . n 
A 1 128 SER 128 405 405 SER SER A . n 
A 1 129 PRO 129 406 406 PRO PRO A . n 
A 1 130 GLU 130 407 407 GLU GLU A . n 
A 1 131 ARG 131 408 408 ARG ARG A . n 
A 1 132 ARG 132 409 409 ARG ARG A . n 
A 1 133 PRO 133 410 410 PRO PRO A . n 
A 1 134 THR 134 411 411 THR THR A . n 
A 1 135 ARG 135 412 412 ARG ARG A . n 
A 1 136 ILE 136 413 413 ILE ILE A . n 
A 1 137 GLY 137 414 414 GLY GLY A . n 
A 1 138 LEU 138 415 415 LEU LEU A . n 
A 1 139 TYR 139 416 416 TYR TYR A . n 
A 1 140 LEU 140 417 417 LEU LEU A . n 
A 1 141 SER 141 418 418 SER SER A . n 
A 1 142 PHE 142 419 419 PHE PHE A . n 
A 1 143 GLY 143 420 420 GLY GLY A . n 
A 1 144 ASP 144 421 421 ASP ASP A . n 
A 1 145 GLY 145 422 422 GLY GLY A . n 
A 1 146 VAL 146 423 423 VAL VAL A . n 
A 1 147 LEU 147 424 424 LEU LEU A . n 
A 1 148 SER 148 425 425 SER SER A . n 
A 1 149 PHE 149 426 426 PHE PHE A . n 
A 1 150 TYR 150 427 427 TYR TYR A . n 
A 1 151 ASP 151 428 428 ASP ASP A . n 
A 1 152 ALA 152 429 429 ALA ALA A . n 
A 1 153 SER 153 430 430 SER SER A . n 
A 1 154 ASP 154 431 431 ASP ASP A . n 
A 1 155 ALA 155 432 432 ALA ALA A . n 
A 1 156 ASP 156 433 433 ASP ASP A . n 
A 1 157 ALA 157 434 434 ALA ALA A . n 
A 1 158 LEU 158 435 435 LEU LEU A . n 
A 1 159 VAL 159 436 436 VAL VAL A . n 
A 1 160 PRO 160 437 437 PRO PRO A . n 
A 1 161 LEU 161 438 438 LEU LEU A . n 
A 1 162 PHE 162 439 439 PHE PHE A . n 
A 1 163 ALA 163 440 440 ALA ALA A . n 
A 1 164 PHE 164 441 441 PHE PHE A . n 
A 1 165 HIS 165 442 442 HIS HIS A . n 
A 1 166 GLU 166 443 443 GLU GLU A . n 
A 1 167 ARG 167 444 444 ARG ARG A . n 
A 1 168 LEU 168 445 445 LEU LEU A . n 
A 1 169 PRO 169 446 446 PRO PRO A . n 
A 1 170 ARG 170 447 447 ARG ARG A . n 
A 1 171 PRO 171 448 448 PRO PRO A . n 
A 1 172 VAL 172 449 449 VAL VAL A . n 
A 1 173 TYR 173 450 450 TYR TYR A . n 
A 1 174 PRO 174 451 451 PRO PRO A . n 
A 1 175 PHE 175 452 452 PHE PHE A . n 
A 1 176 PHE 176 453 453 PHE PHE A . n 
A 1 177 ASP 177 454 454 ASP ASP A . n 
A 1 178 VAL 178 455 455 VAL VAL A . n 
A 1 179 CYS 179 456 456 CYS CYS A . n 
A 1 180 TRP 180 457 457 TRP TRP A . n 
A 1 181 HIS 181 458 458 HIS HIS A . n 
A 1 182 ASP 182 459 459 ASP ASP A . n 
A 1 183 LYS 183 460 460 LYS LYS A . n 
A 1 184 GLY 184 461 461 GLY GLY A . n 
A 1 185 LYS 185 462 462 LYS LYS A . n 
A 1 186 ASN 186 463 463 ASN ASN A . n 
A 1 187 ALA 187 464 464 ALA ALA A . n 
A 1 188 GLN 188 465 465 GLN GLN A . n 
A 1 189 PRO 189 466 466 PRO PRO A . n 
A 1 190 LEU 190 467 467 LEU LEU A . n 
A 1 191 LEU 191 468 468 LEU LEU A . n 
A 1 192 LEU 192 469 469 LEU LEU A . n 
A 1 193 VAL 193 470 470 VAL VAL A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B 
2 1,2 A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 960   ? 
2 MORE         -12   ? 
2 'SSA (A^2)'  18930 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-22 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
SOLVE    phasing           .   ? 2 
CNS      refinement        1.1 ? 3 
HKL-2000 'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 316 ? ? -132.67 -86.41 
2 1 ALA A 318 ? ? -50.94  107.03 
3 1 GLU A 387 ? ? 57.01   16.29  
4 1 LYS A 389 ? ? -146.10 -13.26 
5 1 ASP A 433 ? ? -114.06 52.41  
6 1 CYS A 456 ? ? 68.11   168.44 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   2   2   HOH HOH A . 
B 2 HOH 2   3   3   HOH HOH A . 
B 2 HOH 3   4   4   HOH HOH A . 
B 2 HOH 4   5   5   HOH HOH A . 
B 2 HOH 5   6   6   HOH HOH A . 
B 2 HOH 6   7   7   HOH HOH A . 
B 2 HOH 7   8   8   HOH HOH A . 
B 2 HOH 8   9   9   HOH HOH A . 
B 2 HOH 9   10  10  HOH HOH A . 
B 2 HOH 10  11  11  HOH HOH A . 
B 2 HOH 11  12  12  HOH HOH A . 
B 2 HOH 12  13  13  HOH HOH A . 
B 2 HOH 13  14  14  HOH HOH A . 
B 2 HOH 14  15  15  HOH HOH A . 
B 2 HOH 15  16  16  HOH HOH A . 
B 2 HOH 16  17  17  HOH HOH A . 
B 2 HOH 17  18  18  HOH HOH A . 
B 2 HOH 18  19  19  HOH HOH A . 
B 2 HOH 19  20  20  HOH HOH A . 
B 2 HOH 20  21  21  HOH HOH A . 
B 2 HOH 21  22  22  HOH HOH A . 
B 2 HOH 22  23  23  HOH HOH A . 
B 2 HOH 23  24  24  HOH HOH A . 
B 2 HOH 24  25  25  HOH HOH A . 
B 2 HOH 25  26  26  HOH HOH A . 
B 2 HOH 26  27  27  HOH HOH A . 
B 2 HOH 27  28  28  HOH HOH A . 
B 2 HOH 28  29  29  HOH HOH A . 
B 2 HOH 29  30  30  HOH HOH A . 
B 2 HOH 30  31  31  HOH HOH A . 
B 2 HOH 31  32  32  HOH HOH A . 
B 2 HOH 32  33  33  HOH HOH A . 
B 2 HOH 33  34  34  HOH HOH A . 
B 2 HOH 34  35  35  HOH HOH A . 
B 2 HOH 35  36  36  HOH HOH A . 
B 2 HOH 36  37  37  HOH HOH A . 
B 2 HOH 37  38  38  HOH HOH A . 
B 2 HOH 38  39  39  HOH HOH A . 
B 2 HOH 39  40  40  HOH HOH A . 
B 2 HOH 40  41  41  HOH HOH A . 
B 2 HOH 41  42  42  HOH HOH A . 
B 2 HOH 42  43  43  HOH HOH A . 
B 2 HOH 43  44  44  HOH HOH A . 
B 2 HOH 44  45  45  HOH HOH A . 
B 2 HOH 45  46  46  HOH HOH A . 
B 2 HOH 46  47  47  HOH HOH A . 
B 2 HOH 47  48  48  HOH HOH A . 
B 2 HOH 48  49  49  HOH HOH A . 
B 2 HOH 49  50  50  HOH HOH A . 
B 2 HOH 50  51  51  HOH HOH A . 
B 2 HOH 51  52  52  HOH HOH A . 
B 2 HOH 52  53  53  HOH HOH A . 
B 2 HOH 53  54  54  HOH HOH A . 
B 2 HOH 54  55  55  HOH HOH A . 
B 2 HOH 55  56  56  HOH HOH A . 
B 2 HOH 56  57  57  HOH HOH A . 
B 2 HOH 57  58  58  HOH HOH A . 
B 2 HOH 58  59  59  HOH HOH A . 
B 2 HOH 59  60  60  HOH HOH A . 
B 2 HOH 60  61  61  HOH HOH A . 
B 2 HOH 61  62  62  HOH HOH A . 
B 2 HOH 62  63  63  HOH HOH A . 
B 2 HOH 63  64  64  HOH HOH A . 
B 2 HOH 64  65  65  HOH HOH A . 
B 2 HOH 65  66  66  HOH HOH A . 
B 2 HOH 66  67  67  HOH HOH A . 
B 2 HOH 67  68  68  HOH HOH A . 
B 2 HOH 68  69  69  HOH HOH A . 
B 2 HOH 69  70  70  HOH HOH A . 
B 2 HOH 70  71  71  HOH HOH A . 
B 2 HOH 71  72  72  HOH HOH A . 
B 2 HOH 72  73  73  HOH HOH A . 
B 2 HOH 73  74  74  HOH HOH A . 
B 2 HOH 74  75  75  HOH HOH A . 
B 2 HOH 75  76  76  HOH HOH A . 
B 2 HOH 76  77  77  HOH HOH A . 
B 2 HOH 77  78  78  HOH HOH A . 
B 2 HOH 78  79  79  HOH HOH A . 
B 2 HOH 79  80  80  HOH HOH A . 
B 2 HOH 80  81  81  HOH HOH A . 
B 2 HOH 81  82  82  HOH HOH A . 
B 2 HOH 82  83  83  HOH HOH A . 
B 2 HOH 83  84  84  HOH HOH A . 
B 2 HOH 84  85  85  HOH HOH A . 
B 2 HOH 85  86  86  HOH HOH A . 
B 2 HOH 86  87  87  HOH HOH A . 
B 2 HOH 87  88  88  HOH HOH A . 
B 2 HOH 88  89  89  HOH HOH A . 
B 2 HOH 89  90  90  HOH HOH A . 
B 2 HOH 90  91  91  HOH HOH A . 
B 2 HOH 91  92  92  HOH HOH A . 
B 2 HOH 92  93  93  HOH HOH A . 
B 2 HOH 93  94  94  HOH HOH A . 
B 2 HOH 94  95  95  HOH HOH A . 
B 2 HOH 95  96  96  HOH HOH A . 
B 2 HOH 96  97  97  HOH HOH A . 
B 2 HOH 97  98  98  HOH HOH A . 
B 2 HOH 98  99  99  HOH HOH A . 
B 2 HOH 99  100 100 HOH HOH A . 
B 2 HOH 100 101 101 HOH HOH A . 
B 2 HOH 101 102 102 HOH HOH A . 
B 2 HOH 102 103 103 HOH HOH A . 
B 2 HOH 103 104 104 HOH HOH A . 
B 2 HOH 104 105 105 HOH HOH A . 
B 2 HOH 105 106 106 HOH HOH A . 
B 2 HOH 106 107 107 HOH HOH A . 
B 2 HOH 107 108 108 HOH HOH A . 
B 2 HOH 108 109 109 HOH HOH A . 
B 2 HOH 109 110 110 HOH HOH A . 
B 2 HOH 110 111 111 HOH HOH A . 
B 2 HOH 111 112 112 HOH HOH A . 
B 2 HOH 112 113 113 HOH HOH A . 
B 2 HOH 113 114 114 HOH HOH A . 
B 2 HOH 114 115 115 HOH HOH A . 
B 2 HOH 115 116 116 HOH HOH A . 
B 2 HOH 116 117 117 HOH HOH A . 
B 2 HOH 117 118 118 HOH HOH A . 
B 2 HOH 118 119 119 HOH HOH A . 
B 2 HOH 119 120 120 HOH HOH A . 
B 2 HOH 120 121 121 HOH HOH A . 
B 2 HOH 121 122 122 HOH HOH A . 
B 2 HOH 122 123 123 HOH HOH A . 
B 2 HOH 123 124 124 HOH HOH A . 
B 2 HOH 124 125 125 HOH HOH A . 
B 2 HOH 125 126 126 HOH HOH A . 
B 2 HOH 126 127 127 HOH HOH A . 
B 2 HOH 127 128 128 HOH HOH A . 
B 2 HOH 128 129 129 HOH HOH A . 
B 2 HOH 129 130 130 HOH HOH A . 
B 2 HOH 130 131 131 HOH HOH A . 
B 2 HOH 131 132 132 HOH HOH A . 
B 2 HOH 132 133 133 HOH HOH A . 
B 2 HOH 133 134 134 HOH HOH A . 
B 2 HOH 134 135 135 HOH HOH A . 
B 2 HOH 135 136 136 HOH HOH A . 
B 2 HOH 136 137 137 HOH HOH A . 
B 2 HOH 137 138 138 HOH HOH A . 
B 2 HOH 138 139 139 HOH HOH A . 
B 2 HOH 139 140 140 HOH HOH A . 
B 2 HOH 140 141 141 HOH HOH A . 
B 2 HOH 141 142 142 HOH HOH A . 
B 2 HOH 142 143 143 HOH HOH A . 
B 2 HOH 143 144 144 HOH HOH A . 
B 2 HOH 144 145 145 HOH HOH A . 
B 2 HOH 145 146 146 HOH HOH A . 
B 2 HOH 146 147 147 HOH HOH A . 
B 2 HOH 147 148 148 HOH HOH A . 
B 2 HOH 148 149 149 HOH HOH A . 
B 2 HOH 149 150 150 HOH HOH A . 
B 2 HOH 150 151 151 HOH HOH A . 
B 2 HOH 151 152 152 HOH HOH A . 
B 2 HOH 152 153 153 HOH HOH A . 
B 2 HOH 153 154 154 HOH HOH A . 
B 2 HOH 154 155 155 HOH HOH A . 
B 2 HOH 155 156 156 HOH HOH A . 
B 2 HOH 156 157 157 HOH HOH A . 
B 2 HOH 157 158 158 HOH HOH A . 
B 2 HOH 158 159 159 HOH HOH A . 
B 2 HOH 159 160 160 HOH HOH A . 
B 2 HOH 160 161 161 HOH HOH A . 
#