data_3KCZ
# 
_entry.id   3KCZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KCZ         
RCSB  RCSB055836   
WWPDB D_1000055836 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KCZ 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karlberg, T.'                         1  
'Schutz, P.'                           2  
'Arrowsmith, C.H.'                     3  
'Berglund, H.'                         4  
'Bountra, C.'                          5  
'Collins, R.'                          6  
'Edwards, A.M.'                        7  
'Flodin, S.'                           8  
'Flores, A.'                           9  
'Graslund, S.'                         10 
'Hammarstrom, M.'                      11 
'Johansson, A.'                        12 
'Johansson, I.'                        13 
'Kallas, A.'                           14 
'Kotenyova, T.'                        15 
'Kotzsch, A.'                          16 
'Kraulis, P.'                          17 
'Nielsen, T.K.'                        18 
'Moche, M.'                            19 
'Nordlund, P.'                         20 
'Nyman, T.'                            21 
'Persson, C.'                          22 
'Roos, A.K.'                           23 
'Siponen, M.I.'                        24 
'Thorsell, A.G.'                       25 
'Tresaugues, L.'                       26 
'Van Den Berg, S.'                     27 
'Weigelt, J.'                          28 
'Welin, M.'                            29 
'Wisniewska, M.'                       30 
'Schuler, H.'                          31 
'Structural Genomics Consortium (SGC)' 32 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the catalytic domain of human PARP2 in complex with PARP inhibitor ABT-888.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            49 
_citation.page_first                1056 
_citation.page_last                 1058 
_citation.year                      2010 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20092359 
_citation.pdbx_database_id_DOI      10.1021/bi902079y 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karlberg, T.'    1 
primary 'Hammarstrom, M.' 2 
primary 'Schutz, P.'      3 
primary 'Svensson, L.'    4 
primary 'Schuler, H.'     5 
# 
_cell.entry_id           3KCZ 
_cell.length_a           58.280 
_cell.length_b           134.720 
_cell.length_c           58.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.67 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KCZ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly [ADP-ribose] polymerase 2' 41827.922 2   2.4.2.30 ? 'Catalytic domain' ? 
2 non-polymer syn 3-aminobenzamide                 136.151   2   ?        ? ?                  ? 
3 non-polymer syn GLYCEROL                         92.094    2   ?        ? ?                  ? 
4 water       nat water                            18.015    387 ?        ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PARP-2, NAD(+) ADP-ribosyltransferase 2, Poly[ADP-ribose] synthetase 2, pADPRT-2, hPARP-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRA
GQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRP
LDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEAP
ITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTL
NGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRA
GQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRP
LDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEAP
ITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTL
NGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  ASP n 
1 25  LEU n 
1 26  ARG n 
1 27  VAL n 
1 28  GLN n 
1 29  GLU n 
1 30  LEU n 
1 31  ILE n 
1 32  LYS n 
1 33  LEU n 
1 34  ILE n 
1 35  CYS n 
1 36  ASN n 
1 37  VAL n 
1 38  GLN n 
1 39  ALA n 
1 40  MET n 
1 41  GLU n 
1 42  GLU n 
1 43  MET n 
1 44  MET n 
1 45  MET n 
1 46  GLU n 
1 47  MET n 
1 48  LYS n 
1 49  TYR n 
1 50  ASN n 
1 51  THR n 
1 52  LYS n 
1 53  LYS n 
1 54  ALA n 
1 55  PRO n 
1 56  LEU n 
1 57  GLY n 
1 58  LYS n 
1 59  LEU n 
1 60  THR n 
1 61  VAL n 
1 62  ALA n 
1 63  GLN n 
1 64  ILE n 
1 65  LYS n 
1 66  ALA n 
1 67  GLY n 
1 68  TYR n 
1 69  GLN n 
1 70  SER n 
1 71  LEU n 
1 72  LYS n 
1 73  LYS n 
1 74  ILE n 
1 75  GLU n 
1 76  ASP n 
1 77  CYS n 
1 78  ILE n 
1 79  ARG n 
1 80  ALA n 
1 81  GLY n 
1 82  GLN n 
1 83  HIS n 
1 84  GLY n 
1 85  ARG n 
1 86  ALA n 
1 87  LEU n 
1 88  MET n 
1 89  GLU n 
1 90  ALA n 
1 91  CYS n 
1 92  ASN n 
1 93  GLU n 
1 94  PHE n 
1 95  TYR n 
1 96  THR n 
1 97  ARG n 
1 98  ILE n 
1 99  PRO n 
1 100 HIS n 
1 101 ASP n 
1 102 PHE n 
1 103 GLY n 
1 104 LEU n 
1 105 ARG n 
1 106 THR n 
1 107 PRO n 
1 108 PRO n 
1 109 LEU n 
1 110 ILE n 
1 111 ARG n 
1 112 THR n 
1 113 GLN n 
1 114 LYS n 
1 115 GLU n 
1 116 LEU n 
1 117 SER n 
1 118 GLU n 
1 119 LYS n 
1 120 ILE n 
1 121 GLN n 
1 122 LEU n 
1 123 LEU n 
1 124 GLU n 
1 125 ALA n 
1 126 LEU n 
1 127 GLY n 
1 128 ASP n 
1 129 ILE n 
1 130 GLU n 
1 131 ILE n 
1 132 ALA n 
1 133 ILE n 
1 134 LYS n 
1 135 LEU n 
1 136 VAL n 
1 137 LYS n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 GLN n 
1 142 SER n 
1 143 PRO n 
1 144 GLU n 
1 145 HIS n 
1 146 PRO n 
1 147 LEU n 
1 148 ASP n 
1 149 GLN n 
1 150 HIS n 
1 151 TYR n 
1 152 ARG n 
1 153 ASN n 
1 154 LEU n 
1 155 HIS n 
1 156 CYS n 
1 157 ALA n 
1 158 LEU n 
1 159 ARG n 
1 160 PRO n 
1 161 LEU n 
1 162 ASP n 
1 163 HIS n 
1 164 GLU n 
1 165 SER n 
1 166 TYR n 
1 167 GLU n 
1 168 PHE n 
1 169 LYS n 
1 170 VAL n 
1 171 ILE n 
1 172 SER n 
1 173 GLN n 
1 174 TYR n 
1 175 LEU n 
1 176 GLN n 
1 177 SER n 
1 178 THR n 
1 179 HIS n 
1 180 ALA n 
1 181 PRO n 
1 182 THR n 
1 183 HIS n 
1 184 SER n 
1 185 ASP n 
1 186 TYR n 
1 187 THR n 
1 188 MET n 
1 189 THR n 
1 190 LEU n 
1 191 LEU n 
1 192 ASP n 
1 193 LEU n 
1 194 PHE n 
1 195 GLU n 
1 196 VAL n 
1 197 GLU n 
1 198 LYS n 
1 199 ASP n 
1 200 GLY n 
1 201 GLU n 
1 202 LYS n 
1 203 GLU n 
1 204 ALA n 
1 205 PHE n 
1 206 ARG n 
1 207 GLU n 
1 208 ASP n 
1 209 LEU n 
1 210 HIS n 
1 211 ASN n 
1 212 ARG n 
1 213 MET n 
1 214 LEU n 
1 215 LEU n 
1 216 TRP n 
1 217 HIS n 
1 218 GLY n 
1 219 SER n 
1 220 ARG n 
1 221 MET n 
1 222 SER n 
1 223 ASN n 
1 224 TRP n 
1 225 VAL n 
1 226 GLY n 
1 227 ILE n 
1 228 LEU n 
1 229 SER n 
1 230 HIS n 
1 231 GLY n 
1 232 LEU n 
1 233 ARG n 
1 234 ILE n 
1 235 ALA n 
1 236 HIS n 
1 237 PRO n 
1 238 GLU n 
1 239 ALA n 
1 240 PRO n 
1 241 ILE n 
1 242 THR n 
1 243 GLY n 
1 244 TYR n 
1 245 MET n 
1 246 PHE n 
1 247 GLY n 
1 248 LYS n 
1 249 GLY n 
1 250 ILE n 
1 251 TYR n 
1 252 PHE n 
1 253 ALA n 
1 254 ASP n 
1 255 MET n 
1 256 SER n 
1 257 SER n 
1 258 LYS n 
1 259 SER n 
1 260 ALA n 
1 261 ASN n 
1 262 TYR n 
1 263 CYS n 
1 264 PHE n 
1 265 ALA n 
1 266 SER n 
1 267 ARG n 
1 268 LEU n 
1 269 LYS n 
1 270 ASN n 
1 271 THR n 
1 272 GLY n 
1 273 LEU n 
1 274 LEU n 
1 275 LEU n 
1 276 LEU n 
1 277 SER n 
1 278 GLU n 
1 279 VAL n 
1 280 ALA n 
1 281 LEU n 
1 282 GLY n 
1 283 GLN n 
1 284 CYS n 
1 285 ASN n 
1 286 GLU n 
1 287 LEU n 
1 288 LEU n 
1 289 GLU n 
1 290 ALA n 
1 291 ASN n 
1 292 PRO n 
1 293 LYS n 
1 294 ALA n 
1 295 GLU n 
1 296 GLY n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLY n 
1 301 LYS n 
1 302 HIS n 
1 303 SER n 
1 304 THR n 
1 305 LYS n 
1 306 GLY n 
1 307 LEU n 
1 308 GLY n 
1 309 LYS n 
1 310 MET n 
1 311 ALA n 
1 312 PRO n 
1 313 SER n 
1 314 SER n 
1 315 ALA n 
1 316 HIS n 
1 317 PHE n 
1 318 VAL n 
1 319 THR n 
1 320 LEU n 
1 321 ASN n 
1 322 GLY n 
1 323 SER n 
1 324 THR n 
1 325 VAL n 
1 326 PRO n 
1 327 LEU n 
1 328 GLY n 
1 329 PRO n 
1 330 ALA n 
1 331 SER n 
1 332 ASP n 
1 333 THR n 
1 334 GLY n 
1 335 ILE n 
1 336 LEU n 
1 337 ASN n 
1 338 PRO n 
1 339 ASP n 
1 340 GLY n 
1 341 TYR n 
1 342 THR n 
1 343 LEU n 
1 344 ASN n 
1 345 TYR n 
1 346 ASN n 
1 347 GLU n 
1 348 TYR n 
1 349 ILE n 
1 350 VAL n 
1 351 TYR n 
1 352 ASN n 
1 353 PRO n 
1 354 ASN n 
1 355 GLN n 
1 356 VAL n 
1 357 ARG n 
1 358 MET n 
1 359 ARG n 
1 360 TYR n 
1 361 LEU n 
1 362 LEU n 
1 363 LYS n 
1 364 VAL n 
1 365 GLN n 
1 366 PHE n 
1 367 ASN n 
1 368 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ADPRT2, ADPRTL2, PARP2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) R3 pRARE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARP2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UGN5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFG
LRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTH
SDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYC
FASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTL
NYNEYIVYNPNQVRMRYLLKVQFNF
;
_struct_ref.pdbx_align_begin           235 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KCZ A 24 ? 368 ? Q9UGN5 235 ? 579 ? 235 579 
2 1 3KCZ B 24 ? 368 ? Q9UGN5 235 ? 579 ? 235 579 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KCZ MET A 1   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 212 1  
1 3KCZ HIS A 2   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 213 2  
1 3KCZ HIS A 3   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 214 3  
1 3KCZ HIS A 4   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 215 4  
1 3KCZ HIS A 5   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 216 5  
1 3KCZ HIS A 6   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 217 6  
1 3KCZ HIS A 7   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 218 7  
1 3KCZ SER A 8   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 219 8  
1 3KCZ SER A 9   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 220 9  
1 3KCZ GLY A 10  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 221 10 
1 3KCZ VAL A 11  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 222 11 
1 3KCZ ASP A 12  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 223 12 
1 3KCZ LEU A 13  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 224 13 
1 3KCZ GLY A 14  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 225 14 
1 3KCZ THR A 15  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 226 15 
1 3KCZ GLU A 16  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 227 16 
1 3KCZ ASN A 17  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 228 17 
1 3KCZ LEU A 18  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 229 18 
1 3KCZ TYR A 19  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 230 19 
1 3KCZ PHE A 20  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 231 20 
1 3KCZ GLN A 21  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 232 21 
1 3KCZ SER A 22  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 233 22 
1 3KCZ MET A 23  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 234 23 
1 3KCZ HIS A 236 ? UNP Q9UGN5 PRO 447 'SEE REMARK 999' 447 24 
2 3KCZ MET B 1   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 212 25 
2 3KCZ HIS B 2   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 213 26 
2 3KCZ HIS B 3   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 214 27 
2 3KCZ HIS B 4   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 215 28 
2 3KCZ HIS B 5   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 216 29 
2 3KCZ HIS B 6   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 217 30 
2 3KCZ HIS B 7   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 218 31 
2 3KCZ SER B 8   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 219 32 
2 3KCZ SER B 9   ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 220 33 
2 3KCZ GLY B 10  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 221 34 
2 3KCZ VAL B 11  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 222 35 
2 3KCZ ASP B 12  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 223 36 
2 3KCZ LEU B 13  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 224 37 
2 3KCZ GLY B 14  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 225 38 
2 3KCZ THR B 15  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 226 39 
2 3KCZ GLU B 16  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 227 40 
2 3KCZ ASN B 17  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 228 41 
2 3KCZ LEU B 18  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 229 42 
2 3KCZ TYR B 19  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 230 43 
2 3KCZ PHE B 20  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 231 44 
2 3KCZ GLN B 21  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 232 45 
2 3KCZ SER B 22  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 233 46 
2 3KCZ MET B 23  ? UNP Q9UGN5 ?   ?   'EXPRESSION TAG' 234 47 
2 3KCZ HIS B 236 ? UNP Q9UGN5 PRO 447 'SEE REMARK 999' 447 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3AB non-polymer         . 3-aminobenzamide ?                               'C7 H8 N2 O'     136.151 
ALA 'L-peptide linking' y ALANINE          ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE        ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3KCZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
'22% PEG 3350, 0.1M Tris-HCl, 0.01M 3-aminobenzamide, pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-09-24 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97890 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97890 
# 
_reflns.entry_id                     3KCZ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             45 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   53327 
_reflns.number_all                   53327 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_Rsym_value              0.160 
_reflns.pdbx_netI_over_sigmaI        10.1 
_reflns.B_iso_Wilson_estimate        18.1 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.548 
_reflns_shell.pdbx_Rsym_value        0.638 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3893 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3KCZ 
_refine.ls_number_reflns_obs                     50659 
_refine.ls_number_reflns_all                     50659 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.97 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18991 
_refine.ls_R_factor_all                          0.18991 
_refine.ls_R_factor_R_work                       0.18743 
_refine.ls_R_factor_R_free                       0.23665 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2667 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.910 
_refine.B_iso_mean                               15.693 
_refine.aniso_B[1][1]                            0.54 
_refine.aniso_B[2][2]                            0.05 
_refine.aniso_B[3][3]                            -0.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.40 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1GS0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.181 
_refine.pdbx_overall_ESU_R_Free                  0.166 
_refine.overall_SU_ML                            0.111 
_refine.overall_SU_B                             3.921 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5563 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             387 
_refine_hist.number_atoms_total               5982 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        40.97 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 5733 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 3935 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.362  1.976  ? 7738 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.877  3.001  ? 9616 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.780  5.000  ? 705  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.738 24.385 ? 260  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.104 15.000 ? 1043 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.153 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.081  0.200  ? 848  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 6311 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1111 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.769  1.500  ? 3499 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.179  1.500  ? 1420 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.428  2.000  ? 5624 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.267  3.000  ? 2234 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.731  4.500  ? 2110 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             3690 
_refine_ls_shell.R_factor_R_work                  0.223 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.262 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             194 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KCZ 
_struct.title                     
'Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor 3-aminobenzamide' 
_struct.pdbx_descriptor           'Poly [ADP-ribose] polymerase 2 (E.C.2.4.2.30)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KCZ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;transferase, enzyme-inhibitor complex, catalytic fragment, Structural Genomics, Structural Genomics Consortium, SGC, Glycosyltransferase, NAD, Nucleus, DNA-binding
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 13  ? GLN A 21  ? LEU A 224 GLN A 232 1 ? 9  
HELX_P HELX_P2  2  ASP A 24  ? CYS A 35  ? ASP A 235 CYS A 246 1 ? 12 
HELX_P HELX_P3  3  ASN A 36  ? MET A 47  ? ASN A 247 MET A 258 1 ? 12 
HELX_P HELX_P4  4  PRO A 55  ? LEU A 59  ? PRO A 266 LEU A 270 5 ? 5  
HELX_P HELX_P5  5  THR A 60  ? GLY A 81  ? THR A 271 GLY A 292 1 ? 22 
HELX_P HELX_P6  6  GLY A 84  ? ILE A 98  ? GLY A 295 ILE A 309 1 ? 15 
HELX_P HELX_P7  7  THR A 112 ? VAL A 136 ? THR A 323 VAL A 347 1 ? 25 
HELX_P HELX_P8  8  HIS A 145 ? HIS A 155 ? HIS A 356 HIS A 366 1 ? 11 
HELX_P HELX_P9  9  SER A 165 ? THR A 178 ? SER A 376 THR A 389 1 ? 14 
HELX_P HELX_P10 10 GLY A 200 ? PHE A 205 ? GLY A 411 PHE A 416 1 ? 6  
HELX_P HELX_P11 11 ARG A 220 ? SER A 222 ? ARG A 431 SER A 433 5 ? 3  
HELX_P HELX_P12 12 ASN A 223 ? GLY A 231 ? ASN A 434 GLY A 442 1 ? 9  
HELX_P HELX_P13 13 PRO A 240 ? TYR A 244 ? PRO A 451 TYR A 455 5 ? 5  
HELX_P HELX_P14 14 MET A 255 ? ASN A 261 ? MET A 466 ASN A 472 1 ? 7  
HELX_P HELX_P15 15 TYR A 262 ? PHE A 264 ? TYR A 473 PHE A 475 5 ? 3  
HELX_P HELX_P16 16 LYS A 293 ? LEU A 298 ? LYS A 504 LEU A 509 5 ? 6  
HELX_P HELX_P17 17 SER A 314 ? PHE A 317 ? SER A 525 PHE A 528 5 ? 4  
HELX_P HELX_P18 18 ASN A 352 ? ASN A 354 ? ASN A 563 ASN A 565 5 ? 3  
HELX_P HELX_P19 19 ASP B 24  ? CYS B 35  ? ASP B 235 CYS B 246 1 ? 12 
HELX_P HELX_P20 20 ASN B 36  ? MET B 47  ? ASN B 247 MET B 258 1 ? 12 
HELX_P HELX_P21 21 PRO B 55  ? LEU B 59  ? PRO B 266 LEU B 270 5 ? 5  
HELX_P HELX_P22 22 THR B 60  ? GLY B 81  ? THR B 271 GLY B 292 1 ? 22 
HELX_P HELX_P23 23 GLY B 84  ? ILE B 98  ? GLY B 295 ILE B 309 1 ? 15 
HELX_P HELX_P24 24 THR B 112 ? VAL B 136 ? THR B 323 VAL B 347 1 ? 25 
HELX_P HELX_P25 25 HIS B 145 ? HIS B 155 ? HIS B 356 HIS B 366 1 ? 11 
HELX_P HELX_P26 26 SER B 165 ? THR B 178 ? SER B 376 THR B 389 1 ? 14 
HELX_P HELX_P27 27 GLY B 200 ? PHE B 205 ? GLY B 411 PHE B 416 1 ? 6  
HELX_P HELX_P28 28 ARG B 220 ? SER B 222 ? ARG B 431 SER B 433 5 ? 3  
HELX_P HELX_P29 29 ASN B 223 ? GLY B 231 ? ASN B 434 GLY B 442 1 ? 9  
HELX_P HELX_P30 30 PRO B 240 ? TYR B 244 ? PRO B 451 TYR B 455 5 ? 5  
HELX_P HELX_P31 31 MET B 255 ? ASN B 261 ? MET B 466 ASN B 472 1 ? 7  
HELX_P HELX_P32 32 TYR B 262 ? PHE B 264 ? TYR B 473 PHE B 475 5 ? 3  
HELX_P HELX_P33 33 LYS B 293 ? LEU B 298 ? LYS B 504 LEU B 509 5 ? 6  
HELX_P HELX_P34 34 SER B 314 ? PHE B 317 ? SER B 525 PHE B 528 5 ? 4  
HELX_P HELX_P35 35 ASN B 352 ? ASN B 354 ? ASN B 563 ASN B 565 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 328 A . ? GLY 539 A PRO 329 A ? PRO 540 A 1 2.93  
2 GLY 328 B . ? GLY 539 B PRO 329 B ? PRO 540 B 1 11.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 3 ? 
D ? 2 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 156 ? PRO A 160 ? CYS A 367 PRO A 371 
A 2 THR A 187 ? LYS A 198 ? THR A 398 LYS A 409 
A 3 VAL A 356 ? ASN A 367 ? VAL A 567 ASN A 578 
A 4 THR A 271 ? ALA A 280 ? THR A 482 ALA A 491 
A 5 ARG A 212 ? GLY A 218 ? ARG A 423 GLY A 429 
B 1 ILE A 250 ? PHE A 252 ? ILE A 461 PHE A 463 
B 2 GLU A 347 ? VAL A 350 ? GLU A 558 VAL A 561 
B 3 SER A 303 ? GLY A 306 ? SER A 514 GLY A 517 
B 4 CYS A 284 ? LEU A 287 ? CYS A 495 LEU A 498 
C 1 ALA A 330 ? ASP A 332 ? ALA A 541 ASP A 543 
C 2 GLY A 308 ? PRO A 312 ? GLY A 519 PRO A 523 
C 3 LEU A 343 ? TYR A 345 ? LEU A 554 TYR A 556 
D 1 VAL A 318 ? LEU A 320 ? VAL A 529 LEU A 531 
D 2 SER A 323 ? VAL A 325 ? SER A 534 VAL A 536 
E 1 CYS B 156 ? PRO B 160 ? CYS B 367 PRO B 371 
E 2 THR B 187 ? LYS B 198 ? THR B 398 LYS B 409 
E 3 VAL B 356 ? ASN B 367 ? VAL B 567 ASN B 578 
E 4 THR B 271 ? ALA B 280 ? THR B 482 ALA B 491 
E 5 ARG B 212 ? GLY B 218 ? ARG B 423 GLY B 429 
F 1 ILE B 250 ? PHE B 252 ? ILE B 461 PHE B 463 
F 2 GLU B 347 ? VAL B 350 ? GLU B 558 VAL B 561 
F 3 SER B 303 ? GLY B 306 ? SER B 514 GLY B 517 
F 4 CYS B 284 ? LEU B 287 ? CYS B 495 LEU B 498 
G 1 ALA B 330 ? ASP B 332 ? ALA B 541 ASP B 543 
G 2 GLY B 308 ? PRO B 312 ? GLY B 519 PRO B 523 
G 3 LEU B 343 ? TYR B 345 ? LEU B 554 TYR B 556 
H 1 VAL B 318 ? LEU B 320 ? VAL B 529 LEU B 531 
H 2 SER B 323 ? VAL B 325 ? SER B 534 VAL B 536 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 157 ? N ALA A 368 O GLU A 197 ? O GLU A 408 
A 2 3 N THR A 187 ? N THR A 398 O ASN A 367 ? O ASN A 578 
A 3 4 O LEU A 362 ? O LEU A 573 N LEU A 274 ? N LEU A 485 
A 4 5 O VAL A 279 ? O VAL A 490 N MET A 213 ? N MET A 424 
B 1 2 N ILE A 250 ? N ILE A 461 O VAL A 350 ? O VAL A 561 
B 2 3 O GLU A 347 ? O GLU A 558 N GLY A 306 ? N GLY A 517 
B 3 4 O SER A 303 ? O SER A 514 N ASN A 285 ? N ASN A 496 
C 1 2 O SER A 331 ? O SER A 542 N ALA A 311 ? N ALA A 522 
C 2 3 N MET A 310 ? N MET A 521 O ASN A 344 ? O ASN A 555 
D 1 2 N VAL A 318 ? N VAL A 529 O VAL A 325 ? O VAL A 536 
E 1 2 N ARG B 159 ? N ARG B 370 O GLU B 195 ? O GLU B 406 
E 2 3 N THR B 187 ? N THR B 398 O ASN B 367 ? O ASN B 578 
E 3 4 O LEU B 362 ? O LEU B 573 N LEU B 274 ? N LEU B 485 
E 4 5 O VAL B 279 ? O VAL B 490 N MET B 213 ? N MET B 424 
F 1 2 N ILE B 250 ? N ILE B 461 O VAL B 350 ? O VAL B 561 
F 2 3 O ILE B 349 ? O ILE B 560 N THR B 304 ? N THR B 515 
F 3 4 O SER B 303 ? O SER B 514 N ASN B 285 ? N ASN B 496 
G 1 2 O SER B 331 ? O SER B 542 N ALA B 311 ? N ALA B 522 
G 2 3 N LYS B 309 ? N LYS B 520 O LEU B 343 ? O LEU B 554 
H 1 2 N VAL B 318 ? N VAL B 529 O VAL B 325 ? O VAL B 536 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE 3AB A 1'   
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 580' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE 3AB B 1'   
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL B 580' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 217 ? HIS A 428 . ? 1_555 ? 
2  AC1 5 GLY A 218 ? GLY A 429 . ? 1_555 ? 
3  AC1 5 PHE A 252 ? PHE A 463 . ? 1_555 ? 
4  AC1 5 SER A 259 ? SER A 470 . ? 1_555 ? 
5  AC1 5 TYR A 262 ? TYR A 473 . ? 1_555 ? 
6  AC2 7 ASP A 185 ? ASP A 396 . ? 1_555 ? 
7  AC2 7 TYR A 186 ? TYR A 397 . ? 1_555 ? 
8  AC2 7 ALA A 260 ? ALA A 471 . ? 1_555 ? 
9  AC2 7 ASN A 261 ? ASN A 472 . ? 1_555 ? 
10 AC2 7 PHE A 264 ? PHE A 475 . ? 1_555 ? 
11 AC2 7 ALA A 265 ? ALA A 476 . ? 1_555 ? 
12 AC2 7 PHE A 366 ? PHE A 577 . ? 1_555 ? 
13 AC3 5 HIS B 217 ? HIS B 428 . ? 1_555 ? 
14 AC3 5 GLY B 218 ? GLY B 429 . ? 1_555 ? 
15 AC3 5 PHE B 252 ? PHE B 463 . ? 1_555 ? 
16 AC3 5 SER B 259 ? SER B 470 . ? 1_555 ? 
17 AC3 5 TYR B 262 ? TYR B 473 . ? 1_555 ? 
18 AC4 6 ASP B 185 ? ASP B 396 . ? 1_555 ? 
19 AC4 6 TYR B 186 ? TYR B 397 . ? 1_555 ? 
20 AC4 6 ALA B 260 ? ALA B 471 . ? 1_555 ? 
21 AC4 6 ASN B 261 ? ASN B 472 . ? 1_555 ? 
22 AC4 6 PHE B 264 ? PHE B 475 . ? 1_555 ? 
23 AC4 6 ALA B 265 ? ALA B 476 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KCZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KCZ 
_atom_sites.fract_transf_matrix[1][1]   0.017159 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008997 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007423 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019384 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LEU A 1 13  ? -18.528 8.790   12.566  1.00 40.30 ? 224 LEU A N     1 
ATOM   2    C CA    . LEU A 1 13  ? -17.472 7.723   12.555  1.00 40.06 ? 224 LEU A CA    1 
ATOM   3    C C     . LEU A 1 13  ? -17.414 7.003   13.901  1.00 39.06 ? 224 LEU A C     1 
ATOM   4    O O     . LEU A 1 13  ? -17.322 5.777   13.954  1.00 38.47 ? 224 LEU A O     1 
ATOM   5    C CB    . LEU A 1 13  ? -16.097 8.307   12.214  1.00 40.35 ? 224 LEU A CB    1 
ATOM   6    C CG    . LEU A 1 13  ? -15.848 8.781   10.773  1.00 42.11 ? 224 LEU A CG    1 
ATOM   7    C CD1   . LEU A 1 13  ? -14.472 9.452   10.695  1.00 43.15 ? 224 LEU A CD1   1 
ATOM   8    C CD2   . LEU A 1 13  ? -15.949 7.638   9.739   1.00 42.93 ? 224 LEU A CD2   1 
ATOM   9    N N     . GLY A 1 14  ? -17.463 7.774   14.985  1.00 38.28 ? 225 GLY A N     1 
ATOM   10   C CA    . GLY A 1 14  ? -17.498 7.215   16.335  1.00 37.52 ? 225 GLY A CA    1 
ATOM   11   C C     . GLY A 1 14  ? -18.727 6.359   16.574  1.00 36.79 ? 225 GLY A C     1 
ATOM   12   O O     . GLY A 1 14  ? -18.628 5.271   17.138  1.00 36.10 ? 225 GLY A O     1 
ATOM   13   N N     . THR A 1 15  ? -19.891 6.852   16.143  1.00 35.99 ? 226 THR A N     1 
ATOM   14   C CA    . THR A 1 15  ? -21.134 6.089   16.289  1.00 35.24 ? 226 THR A CA    1 
ATOM   15   C C     . THR A 1 15  ? -21.080 4.896   15.343  1.00 33.60 ? 226 THR A C     1 
ATOM   16   O O     . THR A 1 15  ? -21.351 3.773   15.759  1.00 33.21 ? 226 THR A O     1 
ATOM   17   C CB    . THR A 1 15  ? -22.445 6.947   16.092  1.00 35.70 ? 226 THR A CB    1 
ATOM   18   O OG1   . THR A 1 15  ? -22.724 7.146   14.696  1.00 37.03 ? 226 THR A OG1   1 
ATOM   19   C CG2   . THR A 1 15  ? -22.338 8.313   16.813  1.00 35.62 ? 226 THR A CG2   1 
ATOM   20   N N     . GLU A 1 16  ? -20.674 5.127   14.099  1.00 31.82 ? 227 GLU A N     1 
ATOM   21   C CA    . GLU A 1 16  ? -20.540 4.033   13.138  1.00 30.99 ? 227 GLU A CA    1 
ATOM   22   C C     . GLU A 1 16  ? -19.632 2.920   13.669  1.00 29.82 ? 227 GLU A C     1 
ATOM   23   O O     . GLU A 1 16  ? -19.883 1.747   13.403  1.00 29.13 ? 227 GLU A O     1 
ATOM   24   C CB    . GLU A 1 16  ? -20.037 4.513   11.759  1.00 31.22 ? 227 GLU A CB    1 
ATOM   25   C CG    . GLU A 1 16  ? -20.856 5.658   11.111  1.00 31.49 ? 227 GLU A CG    1 
ATOM   26   C CD    . GLU A 1 16  ? -22.344 5.331   10.924  1.00 30.30 ? 227 GLU A CD    1 
ATOM   27   O OE1   . GLU A 1 16  ? -23.161 6.144   11.379  1.00 34.13 ? 227 GLU A OE1   1 
ATOM   28   O OE2   . GLU A 1 16  ? -22.693 4.285   10.321  1.00 27.22 ? 227 GLU A OE2   1 
ATOM   29   N N     . ASN A 1 17  ? -18.599 3.282   14.435  1.00 28.89 ? 228 ASN A N     1 
ATOM   30   C CA    A ASN A 1 17  ? -17.714 2.277   15.004  0.50 28.79 ? 228 ASN A CA    1 
ATOM   31   C CA    B ASN A 1 17  ? -17.681 2.315   15.059  0.50 28.62 ? 228 ASN A CA    1 
ATOM   32   C C     . ASN A 1 17  ? -18.398 1.420   16.076  1.00 28.79 ? 228 ASN A C     1 
ATOM   33   O O     . ASN A 1 17  ? -18.158 0.212   16.135  1.00 29.03 ? 228 ASN A O     1 
ATOM   34   C CB    A ASN A 1 17  ? -16.431 2.894   15.553  0.50 28.75 ? 228 ASN A CB    1 
ATOM   35   C CB    B ASN A 1 17  ? -16.493 3.055   15.719  0.50 28.46 ? 228 ASN A CB    1 
ATOM   36   C CG    A ASN A 1 17  ? -15.251 1.976   15.389  0.50 28.12 ? 228 ASN A CG    1 
ATOM   37   C CG    B ASN A 1 17  ? -15.857 2.276   16.883  0.50 27.18 ? 228 ASN A CG    1 
ATOM   38   O OD1   A ASN A 1 17  ? -14.932 1.579   14.276  0.50 26.80 ? 228 ASN A OD1   1 
ATOM   39   O OD1   B ASN A 1 17  ? -15.994 2.657   18.050  0.50 23.81 ? 228 ASN A OD1   1 
ATOM   40   N ND2   A ASN A 1 17  ? -14.604 1.619   16.496  0.50 26.95 ? 228 ASN A ND2   1 
ATOM   41   N ND2   B ASN A 1 17  ? -15.149 1.197   16.561  0.50 24.84 ? 228 ASN A ND2   1 
ATOM   42   N N     . LEU A 1 18  ? -19.262 2.031   16.888  1.00 28.60 ? 229 LEU A N     1 
ATOM   43   C CA    . LEU A 1 18  ? -19.996 1.309   17.933  1.00 29.15 ? 229 LEU A CA    1 
ATOM   44   C C     . LEU A 1 18  ? -21.004 0.319   17.378  1.00 28.72 ? 229 LEU A C     1 
ATOM   45   O O     . LEU A 1 18  ? -21.113 -0.788  17.872  1.00 28.59 ? 229 LEU A O     1 
ATOM   46   C CB    . LEU A 1 18  ? -20.736 2.279   18.860  1.00 29.71 ? 229 LEU A CB    1 
ATOM   47   C CG    . LEU A 1 18  ? -19.978 2.793   20.086  1.00 30.73 ? 229 LEU A CG    1 
ATOM   48   C CD1   . LEU A 1 18  ? -20.913 3.689   20.891  1.00 34.66 ? 229 LEU A CD1   1 
ATOM   49   C CD2   . LEU A 1 18  ? -19.447 1.656   20.934  1.00 33.05 ? 229 LEU A CD2   1 
ATOM   50   N N     . TYR A 1 19  ? -21.745 0.716   16.353  1.00 28.59 ? 230 TYR A N     1 
ATOM   51   C CA    . TYR A 1 19  ? -22.736 -0.186  15.769  1.00 28.64 ? 230 TYR A CA    1 
ATOM   52   C C     . TYR A 1 19  ? -22.079 -1.395  15.102  1.00 28.91 ? 230 TYR A C     1 
ATOM   53   O O     . TYR A 1 19  ? -22.480 -2.533  15.334  1.00 28.93 ? 230 TYR A O     1 
ATOM   54   C CB    . TYR A 1 19  ? -23.645 0.560   14.804  1.00 28.31 ? 230 TYR A CB    1 
ATOM   55   C CG    . TYR A 1 19  ? -24.747 1.313   15.499  1.00 28.36 ? 230 TYR A CG    1 
ATOM   56   C CD1   . TYR A 1 19  ? -25.982 0.723   15.698  1.00 29.13 ? 230 TYR A CD1   1 
ATOM   57   C CD2   . TYR A 1 19  ? -24.561 2.616   15.962  1.00 28.64 ? 230 TYR A CD2   1 
ATOM   58   C CE1   . TYR A 1 19  ? -27.006 1.400   16.329  1.00 29.83 ? 230 TYR A CE1   1 
ATOM   59   C CE2   . TYR A 1 19  ? -25.590 3.310   16.599  1.00 27.90 ? 230 TYR A CE2   1 
ATOM   60   C CZ    . TYR A 1 19  ? -26.813 2.687   16.763  1.00 29.03 ? 230 TYR A CZ    1 
ATOM   61   O OH    . TYR A 1 19  ? -27.853 3.320   17.368  1.00 29.22 ? 230 TYR A OH    1 
ATOM   62   N N     . PHE A 1 20  ? -21.037 -1.167  14.312  1.00 29.30 ? 231 PHE A N     1 
ATOM   63   C CA    . PHE A 1 20  ? -20.334 -2.286  13.711  1.00 29.98 ? 231 PHE A CA    1 
ATOM   64   C C     . PHE A 1 20  ? -19.396 -3.009  14.691  1.00 30.23 ? 231 PHE A C     1 
ATOM   65   O O     . PHE A 1 20  ? -18.982 -4.147  14.435  1.00 30.23 ? 231 PHE A O     1 
ATOM   66   C CB    . PHE A 1 20  ? -19.646 -1.827  12.426  1.00 30.09 ? 231 PHE A CB    1 
ATOM   67   C CG    . PHE A 1 20  ? -20.639 -1.460  11.358  1.00 31.35 ? 231 PHE A CG    1 
ATOM   68   C CD1   . PHE A 1 20  ? -21.067 -2.401  10.440  1.00 32.48 ? 231 PHE A CD1   1 
ATOM   69   C CD2   . PHE A 1 20  ? -21.219 -0.208  11.330  1.00 31.96 ? 231 PHE A CD2   1 
ATOM   70   C CE1   . PHE A 1 20  ? -22.023 -2.076  9.485   1.00 31.92 ? 231 PHE A CE1   1 
ATOM   71   C CE2   . PHE A 1 20  ? -22.164 0.126   10.382  1.00 33.20 ? 231 PHE A CE2   1 
ATOM   72   C CZ    . PHE A 1 20  ? -22.579 -0.829  9.461   1.00 32.99 ? 231 PHE A CZ    1 
ATOM   73   N N     . GLN A 1 21  ? -19.143 -2.381  15.844  1.00 30.39 ? 232 GLN A N     1 
ATOM   74   C CA    . GLN A 1 21  ? -18.168 -2.865  16.834  1.00 30.61 ? 232 GLN A CA    1 
ATOM   75   C C     . GLN A 1 21  ? -16.839 -3.265  16.167  1.00 29.60 ? 232 GLN A C     1 
ATOM   76   O O     . GLN A 1 21  ? -16.250 -4.315  16.439  1.00 29.88 ? 232 GLN A O     1 
ATOM   77   C CB    . GLN A 1 21  ? -18.789 -3.966  17.697  1.00 31.04 ? 232 GLN A CB    1 
ATOM   78   C CG    . GLN A 1 21  ? -19.927 -3.395  18.530  1.00 33.34 ? 232 GLN A CG    1 
ATOM   79   C CD    . GLN A 1 21  ? -20.532 -4.379  19.472  1.00 34.96 ? 232 GLN A CD    1 
ATOM   80   O OE1   . GLN A 1 21  ? -21.009 -5.421  19.061  1.00 36.61 ? 232 GLN A OE1   1 
ATOM   81   N NE2   . GLN A 1 21  ? -20.528 -4.049  20.754  1.00 38.36 ? 232 GLN A NE2   1 
ATOM   82   N N     . SER A 1 22  ? -16.402 -2.395  15.265  1.00 28.94 ? 233 SER A N     1 
ATOM   83   C CA    . SER A 1 22  ? -15.109 -2.496  14.633  1.00 28.29 ? 233 SER A CA    1 
ATOM   84   C C     . SER A 1 22  ? -14.008 -2.267  15.678  1.00 27.03 ? 233 SER A C     1 
ATOM   85   O O     . SER A 1 22  ? -14.261 -1.800  16.801  1.00 27.02 ? 233 SER A O     1 
ATOM   86   C CB    . SER A 1 22  ? -14.960 -1.426  13.546  1.00 28.35 ? 233 SER A CB    1 
ATOM   87   O OG    . SER A 1 22  ? -15.889 -1.596  12.489  1.00 30.39 ? 233 SER A OG    1 
ATOM   88   N N     . MET A 1 23  ? -12.787 -2.605  15.284  1.00 24.96 ? 234 MET A N     1 
ATOM   89   C CA    . MET A 1 23  ? -11.569 -2.194  15.978  1.00 23.03 ? 234 MET A CA    1 
ATOM   90   C C     . MET A 1 23  ? -11.659 -0.726  16.449  1.00 21.77 ? 234 MET A C     1 
ATOM   91   O O     . MET A 1 23  ? -12.182 0.131   15.742  1.00 20.52 ? 234 MET A O     1 
ATOM   92   C CB    . MET A 1 23  ? -10.399 -2.395  14.991  1.00 22.70 ? 234 MET A CB    1 
ATOM   93   C CG    . MET A 1 23  ? -9.048  -1.801  15.333  1.00 21.66 ? 234 MET A CG    1 
ATOM   94   S SD    . MET A 1 23  ? -7.920  -2.026  13.923  1.00 21.79 ? 234 MET A SD    1 
ATOM   95   C CE    . MET A 1 23  ? -7.720  -3.791  13.987  1.00 19.89 ? 234 MET A CE    1 
ATOM   96   N N     . ASP A 1 24  ? -11.149 -0.463  17.648  1.00 20.77 ? 235 ASP A N     1 
ATOM   97   C CA    . ASP A 1 24  ? -11.103 0.889   18.217  1.00 20.52 ? 235 ASP A CA    1 
ATOM   98   C C     . ASP A 1 24  ? -10.471 1.825   17.199  1.00 19.50 ? 235 ASP A C     1 
ATOM   99   O O     . ASP A 1 24  ? -9.490  1.468   16.567  1.00 18.47 ? 235 ASP A O     1 
ATOM   100  C CB    . ASP A 1 24  ? -10.309 0.842   19.530  1.00 21.30 ? 235 ASP A CB    1 
ATOM   101  C CG    . ASP A 1 24  ? -10.150 2.210   20.206  1.00 23.77 ? 235 ASP A CG    1 
ATOM   102  O OD1   . ASP A 1 24  ? -9.446  3.102   19.667  1.00 25.12 ? 235 ASP A OD1   1 
ATOM   103  O OD2   . ASP A 1 24  ? -10.692 2.366   21.320  1.00 25.20 ? 235 ASP A OD2   1 
ATOM   104  N N     . LEU A 1 25  ? -11.072 2.994   17.006  1.00 18.23 ? 236 LEU A N     1 
ATOM   105  C CA    . LEU A 1 25  ? -10.630 3.947   15.988  1.00 18.44 ? 236 LEU A CA    1 
ATOM   106  C C     . LEU A 1 25  ? -9.149  4.378   16.094  1.00 16.96 ? 236 LEU A C     1 
ATOM   107  O O     . LEU A 1 25  ? -8.495  4.632   15.087  1.00 15.40 ? 236 LEU A O     1 
ATOM   108  C CB    . LEU A 1 25  ? -11.509 5.202   16.050  1.00 19.29 ? 236 LEU A CB    1 
ATOM   109  C CG    . LEU A 1 25  ? -12.970 5.006   15.600  1.00 20.69 ? 236 LEU A CG    1 
ATOM   110  C CD1   . LEU A 1 25  ? -13.835 6.234   16.029  1.00 22.10 ? 236 LEU A CD1   1 
ATOM   111  C CD2   . LEU A 1 25  ? -13.064 4.738   14.094  1.00 22.10 ? 236 LEU A CD2   1 
ATOM   112  N N     . ARG A 1 26  ? -8.654  4.474   17.320  1.00 16.10 ? 237 ARG A N     1 
ATOM   113  C CA    . ARG A 1 26  ? -7.291  4.878   17.576  1.00 15.89 ? 237 ARG A CA    1 
ATOM   114  C C     . ARG A 1 26  ? -6.369  3.774   17.088  1.00 14.86 ? 237 ARG A C     1 
ATOM   115  O O     . ARG A 1 26  ? -5.340  4.059   16.468  1.00 14.60 ? 237 ARG A O     1 
ATOM   116  C CB    . ARG A 1 26  ? -7.098  5.175   19.063  1.00 15.90 ? 237 ARG A CB    1 
ATOM   117  C CG    . ARG A 1 26  ? -7.848  6.447   19.510  1.00 17.78 ? 237 ARG A CG    1 
ATOM   118  C CD    . ARG A 1 26  ? -8.292  6.368   20.973  1.00 17.61 ? 237 ARG A CD    1 
ATOM   119  N NE    . ARG A 1 26  ? -7.168  6.509   21.886  1.00 20.14 ? 237 ARG A NE    1 
ATOM   120  C CZ    . ARG A 1 26  ? -7.241  6.348   23.205  1.00 19.46 ? 237 ARG A CZ    1 
ATOM   121  N NH1   . ARG A 1 26  ? -6.155  6.486   23.942  1.00 18.34 ? 237 ARG A NH1   1 
ATOM   122  N NH2   . ARG A 1 26  ? -8.401  6.027   23.800  1.00 19.80 ? 237 ARG A NH2   1 
ATOM   123  N N     . VAL A 1 27  ? -6.757  2.526   17.345  1.00 13.92 ? 238 VAL A N     1 
ATOM   124  C CA    . VAL A 1 27  ? -5.984  1.388   16.862  1.00 13.68 ? 238 VAL A CA    1 
ATOM   125  C C     . VAL A 1 27  ? -6.025  1.347   15.341  1.00 14.07 ? 238 VAL A C     1 
ATOM   126  O O     . VAL A 1 27  ? -4.998  1.073   14.704  1.00 13.21 ? 238 VAL A O     1 
ATOM   127  C CB    . VAL A 1 27  ? -6.437  0.065   17.451  1.00 13.02 ? 238 VAL A CB    1 
ATOM   128  C CG1   . VAL A 1 27  ? -5.629  -1.106  16.883  1.00 12.56 ? 238 VAL A CG1   1 
ATOM   129  C CG2   . VAL A 1 27  ? -6.297  0.096   18.943  1.00 12.09 ? 238 VAL A CG2   1 
ATOM   130  N N     . GLN A 1 28  ? -7.188  1.648   14.752  1.00 14.56 ? 239 GLN A N     1 
ATOM   131  C CA    . GLN A 1 28  ? -7.315  1.692   13.291  1.00 14.65 ? 239 GLN A CA    1 
ATOM   132  C C     . GLN A 1 28  ? -6.338  2.677   12.665  1.00 14.89 ? 239 GLN A C     1 
ATOM   133  O O     . GLN A 1 28  ? -5.694  2.370   11.639  1.00 14.52 ? 239 GLN A O     1 
ATOM   134  C CB    . GLN A 1 28  ? -8.752  2.064   12.862  1.00 14.97 ? 239 GLN A CB    1 
ATOM   135  C CG    . GLN A 1 28  ? -9.800  0.943   13.031  1.00 14.56 ? 239 GLN A CG    1 
ATOM   136  C CD    . GLN A 1 28  ? -11.197 1.365   12.587  1.00 18.72 ? 239 GLN A CD    1 
ATOM   137  O OE1   . GLN A 1 28  ? -11.366 1.983   11.535  1.00 17.80 ? 239 GLN A OE1   1 
ATOM   138  N NE2   . GLN A 1 28  ? -12.209 1.020   13.393  1.00 19.12 ? 239 GLN A NE2   1 
ATOM   139  N N     . GLU A 1 29  ? -6.231  3.857   13.274  1.00 15.15 ? 240 GLU A N     1 
ATOM   140  C CA    . GLU A 1 29  ? -5.320  4.885   12.789  1.00 15.69 ? 240 GLU A CA    1 
ATOM   141  C C     . GLU A 1 29  ? -3.856  4.459   12.936  1.00 14.45 ? 240 GLU A C     1 
ATOM   142  O O     . GLU A 1 29  ? -3.043  4.765   12.059  1.00 14.34 ? 240 GLU A O     1 
ATOM   143  C CB    . GLU A 1 29  ? -5.558  6.230   13.490  1.00 17.27 ? 240 GLU A CB    1 
ATOM   144  C CG    . GLU A 1 29  ? -6.889  6.920   13.095  1.00 21.32 ? 240 GLU A CG    1 
ATOM   145  C CD    . GLU A 1 29  ? -6.997  7.158   11.600  1.00 26.41 ? 240 GLU A CD    1 
ATOM   146  O OE1   . GLU A 1 29  ? -6.079  7.777   11.029  1.00 31.82 ? 240 GLU A OE1   1 
ATOM   147  O OE2   . GLU A 1 29  ? -7.985  6.713   10.979  1.00 29.82 ? 240 GLU A OE2   1 
ATOM   148  N N     . LEU A 1 30  ? -3.541  3.758   14.024  1.00 12.99 ? 241 LEU A N     1 
ATOM   149  C CA    . LEU A 1 30  ? -2.195  3.232   14.262  1.00 12.97 ? 241 LEU A CA    1 
ATOM   150  C C     . LEU A 1 30  ? -1.822  2.192   13.200  1.00 12.49 ? 241 LEU A C     1 
ATOM   151  O O     . LEU A 1 30  ? -0.780  2.301   12.585  1.00 12.53 ? 241 LEU A O     1 
ATOM   152  C CB    . LEU A 1 30  ? -2.075  2.634   15.669  1.00 12.24 ? 241 LEU A CB    1 
ATOM   153  C CG    . LEU A 1 30  ? -0.731  1.964   16.026  1.00 13.55 ? 241 LEU A CG    1 
ATOM   154  C CD1   . LEU A 1 30  ? 0.388   2.999   16.000  1.00 10.91 ? 241 LEU A CD1   1 
ATOM   155  C CD2   . LEU A 1 30  ? -0.805  1.259   17.394  1.00 13.73 ? 241 LEU A CD2   1 
ATOM   156  N N     . ILE A 1 31  ? -2.697  1.208   12.965  1.00 12.23 ? 242 ILE A N     1 
ATOM   157  C CA    . ILE A 1 31  ? -2.479  0.198   11.924  1.00 12.89 ? 242 ILE A CA    1 
ATOM   158  C C     . ILE A 1 31  ? -2.361  0.784   10.518  1.00 13.90 ? 242 ILE A C     1 
ATOM   159  O O     . ILE A 1 31  ? -1.500  0.348   9.722   1.00 13.34 ? 242 ILE A O     1 
ATOM   160  C CB    . ILE A 1 31  ? -3.610  -0.858  11.903  1.00 12.63 ? 242 ILE A CB    1 
ATOM   161  C CG1   . ILE A 1 31  ? -3.685  -1.599  13.241  1.00 12.84 ? 242 ILE A CG1   1 
ATOM   162  C CG2   . ILE A 1 31  ? -3.365  -1.872  10.805  1.00 13.81 ? 242 ILE A CG2   1 
ATOM   163  C CD1   . ILE A 1 31  ? -2.397  -2.335  13.655  1.00 15.94 ? 242 ILE A CD1   1 
ATOM   164  N N     . LYS A 1 32  ? -3.238  1.728   10.184  1.00 14.02 ? 243 LYS A N     1 
ATOM   165  C CA    . LYS A 1 32  ? -3.196  2.352   8.850   1.00 15.88 ? 243 LYS A CA    1 
ATOM   166  C C     . LYS A 1 32  ? -1.843  3.010   8.653   1.00 15.02 ? 243 LYS A C     1 
ATOM   167  O O     . LYS A 1 32  ? -1.240  2.919   7.589   1.00 14.80 ? 243 LYS A O     1 
ATOM   168  C CB    . LYS A 1 32  ? -4.267  3.435   8.666   1.00 15.55 ? 243 LYS A CB    1 
ATOM   169  C CG    . LYS A 1 32  ? -5.606  2.975   8.198   1.00 20.91 ? 243 LYS A CG    1 
ATOM   170  C CD    . LYS A 1 32  ? -6.481  4.220   7.929   1.00 25.89 ? 243 LYS A CD    1 
ATOM   171  C CE    . LYS A 1 32  ? -7.895  3.881   7.512   1.00 29.33 ? 243 LYS A CE    1 
ATOM   172  N NZ    . LYS A 1 32  ? -8.730  5.132   7.452   1.00 32.83 ? 243 LYS A NZ    1 
ATOM   173  N N     . LEU A 1 33  ? -1.399  3.700   9.693   1.00 15.13 ? 244 LEU A N     1 
ATOM   174  C CA    . LEU A 1 33  ? -0.148  4.413   9.656   1.00 15.05 ? 244 LEU A CA    1 
ATOM   175  C C     . LEU A 1 33  ? 1.076   3.486   9.477   1.00 14.34 ? 244 LEU A C     1 
ATOM   176  O O     . LEU A 1 33  ? 1.905   3.717   8.573   1.00 14.78 ? 244 LEU A O     1 
ATOM   177  C CB    . LEU A 1 33  ? -0.026  5.270   10.918  1.00 14.99 ? 244 LEU A CB    1 
ATOM   178  C CG    . LEU A 1 33  ? 1.235   6.113   11.106  1.00 17.34 ? 244 LEU A CG    1 
ATOM   179  C CD1   . LEU A 1 33  ? 1.390   7.161   10.009  1.00 19.12 ? 244 LEU A CD1   1 
ATOM   180  C CD2   . LEU A 1 33  ? 1.210   6.773   12.487  1.00 17.75 ? 244 LEU A CD2   1 
ATOM   181  N N     . ILE A 1 34  ? 1.198   2.445   10.291  1.00 12.98 ? 245 ILE A N     1 
ATOM   182  C CA    . ILE A 1 34  ? 2.387   1.598   10.204  1.00 12.83 ? 245 ILE A CA    1 
ATOM   183  C C     . ILE A 1 34  ? 2.381   0.681   8.984   1.00 14.00 ? 245 ILE A C     1 
ATOM   184  O O     . ILE A 1 34  ? 3.468   0.292   8.512   1.00 13.48 ? 245 ILE A O     1 
ATOM   185  C CB    . ILE A 1 34  ? 2.683   0.790   11.516  1.00 12.82 ? 245 ILE A CB    1 
ATOM   186  C CG1   . ILE A 1 34  ? 1.627   -0.322  11.759  1.00 10.55 ? 245 ILE A CG1   1 
ATOM   187  C CG2   . ILE A 1 34  ? 2.760   1.758   12.705  1.00 11.76 ? 245 ILE A CG2   1 
ATOM   188  C CD1   . ILE A 1 34  ? 1.866   -1.091  13.009  1.00 11.94 ? 245 ILE A CD1   1 
ATOM   189  N N     . CYS A 1 35  ? 1.186   0.325   8.490   1.00 13.64 ? 246 CYS A N     1 
ATOM   190  C CA    . CYS A 1 35  ? 1.070   -0.561  7.334   1.00 14.08 ? 246 CYS A CA    1 
ATOM   191  C C     . CYS A 1 35  ? 1.060   0.177   5.998   1.00 14.69 ? 246 CYS A C     1 
ATOM   192  O O     . CYS A 1 35  ? 0.844   -0.456  4.988   1.00 13.93 ? 246 CYS A O     1 
ATOM   193  C CB    . CYS A 1 35  ? -0.213  -1.414  7.409   1.00 13.86 ? 246 CYS A CB    1 
ATOM   194  S SG    . CYS A 1 35  ? -0.250  -2.534  8.786   1.00 13.13 ? 246 CYS A SG    1 
ATOM   195  N N     . ASN A 1 36  ? 1.242   1.496   6.003   1.00 15.23 ? 247 ASN A N     1 
ATOM   196  C CA    . ASN A 1 36  ? 1.233   2.307   4.779   1.00 16.26 ? 247 ASN A CA    1 
ATOM   197  C C     . ASN A 1 36  ? 2.464   2.015   3.921   1.00 16.53 ? 247 ASN A C     1 
ATOM   198  O O     . ASN A 1 36  ? 3.599   2.395   4.251   1.00 15.08 ? 247 ASN A O     1 
ATOM   199  C CB    . ASN A 1 36  ? 1.196   3.806   5.126   1.00 16.70 ? 247 ASN A CB    1 
ATOM   200  C CG    . ASN A 1 36  ? 0.907   4.686   3.918   1.00 19.52 ? 247 ASN A CG    1 
ATOM   201  O OD1   . ASN A 1 36  ? 1.363   4.422   2.801   1.00 21.74 ? 247 ASN A OD1   1 
ATOM   202  N ND2   . ASN A 1 36  ? 0.161   5.763   4.147   1.00 24.22 ? 247 ASN A ND2   1 
ATOM   203  N N     . VAL A 1 37  ? 2.235   1.323   2.820   1.00 16.78 ? 248 VAL A N     1 
ATOM   204  C CA    . VAL A 1 37  ? 3.329   0.866   1.978   1.00 17.76 ? 248 VAL A CA    1 
ATOM   205  C C     . VAL A 1 37  ? 3.882   2.009   1.127   1.00 17.23 ? 248 VAL A C     1 
ATOM   206  O O     . VAL A 1 37  ? 5.065   2.056   0.841   1.00 16.58 ? 248 VAL A O     1 
ATOM   207  C CB    . VAL A 1 37  ? 2.895   -0.285  1.037   1.00 17.60 ? 248 VAL A CB    1 
ATOM   208  C CG1   . VAL A 1 37  ? 4.078   -0.682  0.151   1.00 19.80 ? 248 VAL A CG1   1 
ATOM   209  C CG2   . VAL A 1 37  ? 2.408   -1.488  1.849   1.00 18.71 ? 248 VAL A CG2   1 
ATOM   210  N N     . GLN A 1 38  ? 3.012   2.908   0.711   1.00 17.54 ? 249 GLN A N     1 
ATOM   211  C CA    . GLN A 1 38  ? 3.449   4.110   0.004   1.00 19.18 ? 249 GLN A CA    1 
ATOM   212  C C     . GLN A 1 38  ? 4.442   4.924   0.841   1.00 18.11 ? 249 GLN A C     1 
ATOM   213  O O     . GLN A 1 38  ? 5.362   5.529   0.292   1.00 17.49 ? 249 GLN A O     1 
ATOM   214  C CB    . GLN A 1 38  ? 2.243   4.968   -0.394  1.00 20.28 ? 249 GLN A CB    1 
ATOM   215  C CG    . GLN A 1 38  ? 2.589   6.396   -0.854  1.00 24.71 ? 249 GLN A CG    1 
ATOM   216  C CD    . GLN A 1 38  ? 3.422   6.431   -2.124  1.00 29.44 ? 249 GLN A CD    1 
ATOM   217  O OE1   . GLN A 1 38  ? 3.572   5.421   -2.813  1.00 33.33 ? 249 GLN A OE1   1 
ATOM   218  N NE2   . GLN A 1 38  ? 3.972   7.606   -2.439  1.00 31.47 ? 249 GLN A NE2   1 
ATOM   219  N N     . ALA A 1 39  ? 4.264   4.937   2.161   1.00 16.96 ? 250 ALA A N     1 
ATOM   220  C CA    . ALA A 1 39  ? 5.170   5.660   3.032   1.00 16.68 ? 250 ALA A CA    1 
ATOM   221  C C     . ALA A 1 39  ? 6.510   4.921   3.118   1.00 16.41 ? 250 ALA A C     1 
ATOM   222  O O     . ALA A 1 39  ? 7.556   5.562   3.241   1.00 16.63 ? 250 ALA A O     1 
ATOM   223  C CB    . ALA A 1 39  ? 4.549   5.855   4.430   1.00 16.07 ? 250 ALA A CB    1 
ATOM   224  N N     . MET A 1 40  ? 6.478   3.590   3.044   1.00 15.08 ? 251 MET A N     1 
ATOM   225  C CA    . MET A 1 40  ? 7.701   2.796   3.027   1.00 15.58 ? 251 MET A CA    1 
ATOM   226  C C     . MET A 1 40  ? 8.500   3.086   1.753   1.00 16.04 ? 251 MET A C     1 
ATOM   227  O O     . MET A 1 40  ? 9.718   3.199   1.807   1.00 15.48 ? 251 MET A O     1 
ATOM   228  C CB    . MET A 1 40  ? 7.404   1.307   3.107   1.00 14.82 ? 251 MET A CB    1 
ATOM   229  C CG    . MET A 1 40  ? 6.838   0.876   4.446   1.00 15.52 ? 251 MET A CG    1 
ATOM   230  S SD    . MET A 1 40  ? 6.181   -0.790  4.436   1.00 15.92 ? 251 MET A SD    1 
ATOM   231  C CE    . MET A 1 40  ? 5.659   -0.865  6.157   1.00 17.24 ? 251 MET A CE    1 
ATOM   232  N N     . GLU A 1 41  ? 7.797   3.181   0.630   1.00 16.45 ? 252 GLU A N     1 
ATOM   233  C CA    . GLU A 1 41  ? 8.366   3.561   -0.676  1.00 17.88 ? 252 GLU A CA    1 
ATOM   234  C C     . GLU A 1 41  ? 9.080   4.917   -0.595  1.00 16.82 ? 252 GLU A C     1 
ATOM   235  O O     . GLU A 1 41  ? 10.234  5.045   -0.980  1.00 16.96 ? 252 GLU A O     1 
ATOM   236  C CB    . GLU A 1 41  ? 7.234   3.616   -1.716  1.00 19.14 ? 252 GLU A CB    1 
ATOM   237  C CG    . GLU A 1 41  ? 7.566   4.175   -3.103  1.00 23.78 ? 252 GLU A CG    1 
ATOM   238  C CD    . GLU A 1 41  ? 7.915   3.108   -4.119  1.00 30.23 ? 252 GLU A CD    1 
ATOM   239  O OE1   . GLU A 1 41  ? 8.418   3.478   -5.216  1.00 34.63 ? 252 GLU A OE1   1 
ATOM   240  O OE2   . GLU A 1 41  ? 7.668   1.912   -3.843  1.00 33.05 ? 252 GLU A OE2   1 
ATOM   241  N N     . GLU A 1 42  ? 8.397   5.919   -0.082  1.00 16.79 ? 253 GLU A N     1 
ATOM   242  C CA    . GLU A 1 42  ? 8.985   7.234   0.053   1.00 16.92 ? 253 GLU A CA    1 
ATOM   243  C C     . GLU A 1 42  ? 10.175  7.201   0.990   1.00 16.14 ? 253 GLU A C     1 
ATOM   244  O O     . GLU A 1 42  ? 11.162  7.846   0.731   1.00 15.67 ? 253 GLU A O     1 
ATOM   245  C CB    . GLU A 1 42  ? 7.967   8.231   0.590   1.00 17.71 ? 253 GLU A CB    1 
ATOM   246  C CG    . GLU A 1 42  ? 6.926   8.633   -0.433  1.00 21.60 ? 253 GLU A CG    1 
ATOM   247  C CD    . GLU A 1 42  ? 5.730   9.298   0.198   1.00 26.70 ? 253 GLU A CD    1 
ATOM   248  O OE1   . GLU A 1 42  ? 5.777   9.659   1.403   1.00 33.21 ? 253 GLU A OE1   1 
ATOM   249  O OE2   . GLU A 1 42  ? 4.716   9.409   -0.497  1.00 30.56 ? 253 GLU A OE2   1 
ATOM   250  N N     . MET A 1 43  ? 10.067  6.460   2.084   1.00 15.31 ? 254 MET A N     1 
ATOM   251  C CA    . MET A 1 43  ? 11.154  6.374   3.064   1.00 15.66 ? 254 MET A CA    1 
ATOM   252  C C     . MET A 1 43  ? 12.392  5.754   2.428   1.00 15.64 ? 254 MET A C     1 
ATOM   253  O O     . MET A 1 43  ? 13.527  6.209   2.675   1.00 15.47 ? 254 MET A O     1 
ATOM   254  C CB    . MET A 1 43  ? 10.739  5.546   4.304   1.00 15.94 ? 254 MET A CB    1 
ATOM   255  C CG    . MET A 1 43  ? 10.011  6.327   5.410   1.00 16.75 ? 254 MET A CG    1 
ATOM   256  S SD    . MET A 1 43  ? 9.474   5.332   6.862   1.00 20.60 ? 254 MET A SD    1 
ATOM   257  C CE    . MET A 1 43  ? 7.843   4.766   6.325   1.00 13.00 ? 254 MET A CE    1 
ATOM   258  N N     . MET A 1 44  ? 12.205  4.702   1.645   1.00 15.10 ? 255 MET A N     1 
ATOM   259  C CA    . MET A 1 44  ? 13.354  4.062   1.013   1.00 16.24 ? 255 MET A CA    1 
ATOM   260  C C     . MET A 1 44  ? 13.973  4.943   -0.082  1.00 16.75 ? 255 MET A C     1 
ATOM   261  O O     . MET A 1 44  ? 15.192  5.009   -0.184  1.00 16.10 ? 255 MET A O     1 
ATOM   262  C CB    . MET A 1 44  ? 13.016  2.690   0.462   1.00 15.87 ? 255 MET A CB    1 
ATOM   263  C CG    . MET A 1 44  ? 12.672  1.645   1.541   1.00 16.47 ? 255 MET A CG    1 
ATOM   264  S SD    . MET A 1 44  ? 13.954  1.442   2.810   1.00 18.00 ? 255 MET A SD    1 
ATOM   265  C CE    . MET A 1 44  ? 13.503  2.637   4.017   1.00 20.65 ? 255 MET A CE    1 
ATOM   266  N N     . MET A 1 45  ? 13.148  5.636   -0.857  1.00 17.52 ? 256 MET A N     1 
ATOM   267  C CA    . MET A 1 45  ? 13.689  6.567   -1.862  1.00 19.25 ? 256 MET A CA    1 
ATOM   268  C C     . MET A 1 45  ? 14.563  7.612   -1.152  1.00 19.37 ? 256 MET A C     1 
ATOM   269  O O     . MET A 1 45  ? 15.657  7.871   -1.582  1.00 19.08 ? 256 MET A O     1 
ATOM   270  C CB    . MET A 1 45  ? 12.579  7.221   -2.683  1.00 19.82 ? 256 MET A CB    1 
ATOM   271  C CG    . MET A 1 45  ? 11.885  6.266   -3.665  1.00 21.44 ? 256 MET A CG    1 
ATOM   272  S SD    . MET A 1 45  ? 10.574  7.144   -4.585  1.00 32.47 ? 256 MET A SD    1 
ATOM   273  C CE    . MET A 1 45  ? 11.574  8.314   -5.537  1.00 27.47 ? 256 MET A CE    1 
ATOM   274  N N     . GLU A 1 46  ? 14.103  8.112   -0.008  1.00 20.30 ? 257 GLU A N     1 
ATOM   275  C CA    . GLU A 1 46  ? 14.871  9.050   0.825   1.00 20.66 ? 257 GLU A CA    1 
ATOM   276  C C     . GLU A 1 46  ? 16.227  8.515   1.278   1.00 19.57 ? 257 GLU A C     1 
ATOM   277  O O     . GLU A 1 46  ? 17.168  9.288   1.469   1.00 18.13 ? 257 GLU A O     1 
ATOM   278  C CB    . GLU A 1 46  ? 14.087  9.425   2.091   1.00 22.08 ? 257 GLU A CB    1 
ATOM   279  C CG    . GLU A 1 46  ? 13.225  10.630  1.951   1.00 27.02 ? 257 GLU A CG    1 
ATOM   280  C CD    . GLU A 1 46  ? 14.051  11.892  1.800   1.00 32.85 ? 257 GLU A CD    1 
ATOM   281  O OE1   . GLU A 1 46  ? 15.090  12.015  2.504   1.00 36.39 ? 257 GLU A OE1   1 
ATOM   282  O OE2   . GLU A 1 46  ? 13.650  12.743  0.965   1.00 35.74 ? 257 GLU A OE2   1 
ATOM   283  N N     . MET A 1 47  ? 16.309  7.208   1.497   1.00 18.08 ? 258 MET A N     1 
ATOM   284  C CA    . MET A 1 47  ? 17.568  6.568   1.875   1.00 17.59 ? 258 MET A CA    1 
ATOM   285  C C     . MET A 1 47  ? 18.431  6.218   0.645   1.00 17.19 ? 258 MET A C     1 
ATOM   286  O O     . MET A 1 47  ? 19.458  5.563   0.791   1.00 16.62 ? 258 MET A O     1 
ATOM   287  C CB    . MET A 1 47  ? 17.271  5.294   2.691   1.00 17.23 ? 258 MET A CB    1 
ATOM   288  C CG    . MET A 1 47  ? 16.472  5.560   3.981   1.00 18.05 ? 258 MET A CG    1 
ATOM   289  S SD    . MET A 1 47  ? 16.320  4.137   5.099   1.00 19.32 ? 258 MET A SD    1 
ATOM   290  C CE    . MET A 1 47  ? 17.967  4.074   5.771   1.00 18.03 ? 258 MET A CE    1 
ATOM   291  N N     . LYS A 1 48  ? 17.975  6.618   -0.551  1.00 17.46 ? 259 LYS A N     1 
ATOM   292  C CA    . LYS A 1 48  ? 18.699  6.456   -1.842  1.00 17.48 ? 259 LYS A CA    1 
ATOM   293  C C     . LYS A 1 48  ? 18.545  5.075   -2.463  1.00 16.90 ? 259 LYS A C     1 
ATOM   294  O O     . LYS A 1 48  ? 19.244  4.710   -3.429  1.00 15.95 ? 259 LYS A O     1 
ATOM   295  C CB    . LYS A 1 48  ? 20.197  6.797   -1.714  1.00 18.42 ? 259 LYS A CB    1 
ATOM   296  C CG    . LYS A 1 48  ? 20.497  8.159   -1.111  1.00 21.45 ? 259 LYS A CG    1 
ATOM   297  C CD    . LYS A 1 48  ? 19.829  9.288   -1.855  1.00 26.11 ? 259 LYS A CD    1 
ATOM   298  C CE    . LYS A 1 48  ? 20.303  10.646  -1.323  1.00 28.51 ? 259 LYS A CE    1 
ATOM   299  N NZ    . LYS A 1 48  ? 19.287  11.722  -1.610  1.00 31.86 ? 259 LYS A NZ    1 
ATOM   300  N N     . TYR A 1 49  ? 17.630  4.287   -1.913  1.00 15.79 ? 260 TYR A N     1 
ATOM   301  C CA    . TYR A 1 49  ? 17.335  2.994   -2.478  1.00 15.53 ? 260 TYR A CA    1 
ATOM   302  C C     . TYR A 1 49  ? 16.520  3.155   -3.756  1.00 15.62 ? 260 TYR A C     1 
ATOM   303  O O     . TYR A 1 49  ? 15.579  3.934   -3.805  1.00 15.98 ? 260 TYR A O     1 
ATOM   304  C CB    . TYR A 1 49  ? 16.557  2.159   -1.488  1.00 15.80 ? 260 TYR A CB    1 
ATOM   305  C CG    . TYR A 1 49  ? 16.253  0.781   -1.994  1.00 14.87 ? 260 TYR A CG    1 
ATOM   306  C CD1   . TYR A 1 49  ? 17.174  -0.241  -1.879  1.00 15.62 ? 260 TYR A CD1   1 
ATOM   307  C CD2   . TYR A 1 49  ? 15.040  0.510   -2.586  1.00 15.05 ? 260 TYR A CD2   1 
ATOM   308  C CE1   . TYR A 1 49  ? 16.872  -1.516  -2.332  1.00 17.53 ? 260 TYR A CE1   1 
ATOM   309  C CE2   . TYR A 1 49  ? 14.732  -0.741  -3.038  1.00 16.93 ? 260 TYR A CE2   1 
ATOM   310  C CZ    . TYR A 1 49  ? 15.632  -1.747  -2.903  1.00 17.30 ? 260 TYR A CZ    1 
ATOM   311  O OH    . TYR A 1 49  ? 15.293  -2.982  -3.356  1.00 21.40 ? 260 TYR A OH    1 
ATOM   312  N N     . ASN A 1 50  ? 16.874  2.407   -4.781  1.00 16.43 ? 261 ASN A N     1 
ATOM   313  C CA    . ASN A 1 50  ? 16.271  2.607   -6.091  1.00 17.36 ? 261 ASN A CA    1 
ATOM   314  C C     . ASN A 1 50  ? 15.013  1.770   -6.226  1.00 17.76 ? 261 ASN A C     1 
ATOM   315  O O     . ASN A 1 50  ? 15.064  0.656   -6.725  1.00 16.71 ? 261 ASN A O     1 
ATOM   316  C CB    . ASN A 1 50  ? 17.274  2.267   -7.184  1.00 17.59 ? 261 ASN A CB    1 
ATOM   317  C CG    . ASN A 1 50  ? 16.807  2.716   -8.558  1.00 18.89 ? 261 ASN A CG    1 
ATOM   318  O OD1   . ASN A 1 50  ? 15.621  2.937   -8.762  1.00 18.34 ? 261 ASN A OD1   1 
ATOM   319  N ND2   . ASN A 1 50  ? 17.745  2.878   -9.490  1.00 18.92 ? 261 ASN A ND2   1 
ATOM   320  N N     . THR A 1 51  ? 13.890  2.305   -5.754  1.00 19.45 ? 262 THR A N     1 
ATOM   321  C CA    . THR A 1 51  ? 12.621  1.546   -5.759  1.00 21.00 ? 262 THR A CA    1 
ATOM   322  C C     . THR A 1 51  ? 12.085  1.304   -7.178  1.00 22.92 ? 262 THR A C     1 
ATOM   323  O O     . THR A 1 51  ? 11.229  0.459   -7.377  1.00 23.11 ? 262 THR A O     1 
ATOM   324  C CB    . THR A 1 51  ? 11.533  2.251   -4.960  1.00 20.48 ? 262 THR A CB    1 
ATOM   325  O OG1   . THR A 1 51  ? 11.462  3.617   -5.366  1.00 20.78 ? 262 THR A OG1   1 
ATOM   326  C CG2   . THR A 1 51  ? 11.820  2.195   -3.464  1.00 19.00 ? 262 THR A CG2   1 
ATOM   327  N N     . LYS A 1 52  ? 12.578  2.051   -8.159  1.00 25.11 ? 263 LYS A N     1 
ATOM   328  C CA    . LYS A 1 52  ? 12.145  1.858   -9.545  1.00 27.00 ? 263 LYS A CA    1 
ATOM   329  C C     . LYS A 1 52  ? 12.820  0.650   -10.141 1.00 27.32 ? 263 LYS A C     1 
ATOM   330  O O     . LYS A 1 52  ? 12.160  -0.183  -10.732 1.00 28.39 ? 263 LYS A O     1 
ATOM   331  C CB    . LYS A 1 52  ? 12.409  3.105   -10.403 1.00 27.85 ? 263 LYS A CB    1 
ATOM   332  C CG    . LYS A 1 52  ? 11.623  4.331   -9.945  1.00 30.85 ? 263 LYS A CG    1 
ATOM   333  C CD    . LYS A 1 52  ? 10.130  4.013   -9.611  1.00 33.90 ? 263 LYS A CD    1 
ATOM   334  C CE    . LYS A 1 52  ? 9.320   5.280   -9.308  1.00 35.35 ? 263 LYS A CE    1 
ATOM   335  N NZ    . LYS A 1 52  ? 9.973   6.187   -8.277  1.00 38.36 ? 263 LYS A NZ    1 
ATOM   336  N N     . LYS A 1 53  ? 14.125  0.531   -9.936  1.00 27.69 ? 264 LYS A N     1 
ATOM   337  C CA    . LYS A 1 53  ? 14.877  -0.597  -10.439 1.00 27.88 ? 264 LYS A CA    1 
ATOM   338  C C     . LYS A 1 53  ? 14.558  -1.901  -9.705  1.00 27.41 ? 264 LYS A C     1 
ATOM   339  O O     . LYS A 1 53  ? 14.641  -2.970  -10.293 1.00 26.83 ? 264 LYS A O     1 
ATOM   340  C CB    . LYS A 1 53  ? 16.374  -0.308  -10.308 1.00 28.64 ? 264 LYS A CB    1 
ATOM   341  C CG    . LYS A 1 53  ? 17.272  -1.318  -10.983 1.00 31.46 ? 264 LYS A CG    1 
ATOM   342  C CD    . LYS A 1 53  ? 18.634  -0.685  -11.316 1.00 33.81 ? 264 LYS A CD    1 
ATOM   343  C CE    . LYS A 1 53  ? 19.714  -1.746  -11.522 1.00 35.11 ? 264 LYS A CE    1 
ATOM   344  N NZ    . LYS A 1 53  ? 21.039  -1.120  -11.804 1.00 35.70 ? 264 LYS A NZ    1 
ATOM   345  N N     . ALA A 1 54  ? 14.254  -1.816  -8.409  1.00 26.16 ? 265 ALA A N     1 
ATOM   346  C CA    . ALA A 1 54  ? 13.996  -3.006  -7.590  1.00 25.69 ? 265 ALA A CA    1 
ATOM   347  C C     . ALA A 1 54  ? 12.825  -2.708  -6.657  1.00 25.15 ? 265 ALA A C     1 
ATOM   348  O O     . ALA A 1 54  ? 13.031  -2.343  -5.503  1.00 24.50 ? 265 ALA A O     1 
ATOM   349  C CB    . ALA A 1 54  ? 15.220  -3.382  -6.793  1.00 25.08 ? 265 ALA A CB    1 
ATOM   350  N N     . PRO A 1 55  ? 11.591  -2.862  -7.163  1.00 24.86 ? 266 PRO A N     1 
ATOM   351  C CA    . PRO A 1 55  ? 10.410  -2.585  -6.363  1.00 24.16 ? 266 PRO A CA    1 
ATOM   352  C C     . PRO A 1 55  ? 10.395  -3.387  -5.087  1.00 23.34 ? 266 PRO A C     1 
ATOM   353  O O     . PRO A 1 55  ? 10.826  -4.548  -5.050  1.00 23.26 ? 266 PRO A O     1 
ATOM   354  C CB    . PRO A 1 55  ? 9.242   -2.974  -7.299  1.00 24.40 ? 266 PRO A CB    1 
ATOM   355  C CG    . PRO A 1 55  ? 9.814   -2.907  -8.663  1.00 25.02 ? 266 PRO A CG    1 
ATOM   356  C CD    . PRO A 1 55  ? 11.232  -3.340  -8.515  1.00 25.04 ? 266 PRO A CD    1 
ATOM   357  N N     . LEU A 1 56  ? 9.902   -2.754  -4.030  1.00 22.68 ? 267 LEU A N     1 
ATOM   358  C CA    . LEU A 1 56  ? 9.832   -3.374  -2.726  1.00 22.35 ? 267 LEU A CA    1 
ATOM   359  C C     . LEU A 1 56  ? 8.971   -4.663  -2.728  1.00 22.20 ? 267 LEU A C     1 
ATOM   360  O O     . LEU A 1 56  ? 9.270   -5.593  -2.030  1.00 21.37 ? 267 LEU A O     1 
ATOM   361  C CB    . LEU A 1 56  ? 9.305   -2.354  -1.719  1.00 22.22 ? 267 LEU A CB    1 
ATOM   362  C CG    . LEU A 1 56  ? 10.107  -1.052  -1.573  1.00 20.56 ? 267 LEU A CG    1 
ATOM   363  C CD1   . LEU A 1 56  ? 9.328   -0.098  -0.695  1.00 19.53 ? 267 LEU A CD1   1 
ATOM   364  C CD2   . LEU A 1 56  ? 11.501  -1.334  -1.000  1.00 19.88 ? 267 LEU A CD2   1 
ATOM   365  N N     . GLY A 1 57  ? 7.932   -4.720  -3.552  1.00 22.95 ? 268 GLY A N     1 
ATOM   366  C CA    . GLY A 1 57  ? 7.089   -5.911  -3.676  1.00 23.12 ? 268 GLY A CA    1 
ATOM   367  C C     . GLY A 1 57  ? 7.806   -7.160  -4.170  1.00 24.16 ? 268 GLY A C     1 
ATOM   368  O O     . GLY A 1 57  ? 7.294   -8.266  -4.017  1.00 23.55 ? 268 GLY A O     1 
ATOM   369  N N     . LYS A 1 58  ? 8.999   -6.985  -4.746  1.00 24.89 ? 269 LYS A N     1 
ATOM   370  C CA    . LYS A 1 58  ? 9.817   -8.089  -5.262  1.00 25.69 ? 269 LYS A CA    1 
ATOM   371  C C     . LYS A 1 58  ? 11.071  -8.378  -4.406  1.00 24.90 ? 269 LYS A C     1 
ATOM   372  O O     . LYS A 1 58  ? 11.767  -9.362  -4.603  1.00 24.70 ? 269 LYS A O     1 
ATOM   373  C CB    . LYS A 1 58  ? 10.180  -7.778  -6.732  1.00 26.34 ? 269 LYS A CB    1 
ATOM   374  C CG    . LYS A 1 58  ? 8.911   -7.681  -7.647  1.00 29.51 ? 269 LYS A CG    1 
ATOM   375  C CD    . LYS A 1 58  ? 9.222   -7.193  -9.085  1.00 34.42 ? 269 LYS A CD    1 
ATOM   376  C CE    . LYS A 1 58  ? 7.934   -7.026  -9.953  1.00 35.93 ? 269 LYS A CE    1 
ATOM   377  N NZ    . LYS A 1 58  ? 7.198   -5.725  -9.668  1.00 37.29 ? 269 LYS A NZ    1 
ATOM   378  N N     . LEU A 1 59  ? 11.317  -7.529  -3.418  1.00 24.50 ? 270 LEU A N     1 
ATOM   379  C CA    . LEU A 1 59  ? 12.366  -7.733  -2.410  1.00 24.15 ? 270 LEU A CA    1 
ATOM   380  C C     . LEU A 1 59  ? 12.225  -9.090  -1.697  1.00 22.94 ? 270 LEU A C     1 
ATOM   381  O O     . LEU A 1 59  ? 11.146  -9.441  -1.241  1.00 23.40 ? 270 LEU A O     1 
ATOM   382  C CB    . LEU A 1 59  ? 12.265  -6.575  -1.394  1.00 25.11 ? 270 LEU A CB    1 
ATOM   383  C CG    . LEU A 1 59  ? 13.224  -6.394  -0.238  1.00 26.32 ? 270 LEU A CG    1 
ATOM   384  C CD1   . LEU A 1 59  ? 14.568  -5.914  -0.720  1.00 25.81 ? 270 LEU A CD1   1 
ATOM   385  C CD2   . LEU A 1 59  ? 12.591  -5.393  0.765   1.00 26.85 ? 270 LEU A CD2   1 
ATOM   386  N N     . THR A 1 60  ? 13.300  -9.865  -1.643  1.00 21.43 ? 271 THR A N     1 
ATOM   387  C CA    . THR A 1 60  ? 13.299  -11.157 -0.963  1.00 20.50 ? 271 THR A CA    1 
ATOM   388  C C     . THR A 1 60  ? 14.314  -11.173 0.159   1.00 19.62 ? 271 THR A C     1 
ATOM   389  O O     . THR A 1 60  ? 15.300  -10.424 0.121   1.00 18.75 ? 271 THR A O     1 
ATOM   390  C CB    . THR A 1 60  ? 13.704  -12.297 -1.905  1.00 20.70 ? 271 THR A CB    1 
ATOM   391  O OG1   . THR A 1 60  ? 15.085  -12.155 -2.243  1.00 19.54 ? 271 THR A OG1   1 
ATOM   392  C CG2   . THR A 1 60  ? 12.863  -12.310 -3.202  1.00 20.65 ? 271 THR A CG2   1 
ATOM   393  N N     . VAL A 1 61  ? 14.126  -12.067 1.128   1.00 19.25 ? 272 VAL A N     1 
ATOM   394  C CA    . VAL A 1 61  ? 15.104  -12.221 2.205   1.00 19.68 ? 272 VAL A CA    1 
ATOM   395  C C     . VAL A 1 61  ? 16.495  -12.656 1.687   1.00 19.77 ? 272 VAL A C     1 
ATOM   396  O O     . VAL A 1 61  ? 17.530  -12.269 2.238   1.00 19.64 ? 272 VAL A O     1 
ATOM   397  C CB    . VAL A 1 61  ? 14.602  -13.147 3.359   1.00 20.56 ? 272 VAL A CB    1 
ATOM   398  C CG1   . VAL A 1 61  ? 13.237  -12.643 3.914   1.00 19.58 ? 272 VAL A CG1   1 
ATOM   399  C CG2   . VAL A 1 61  ? 14.522  -14.586 2.937   1.00 20.95 ? 272 VAL A CG2   1 
ATOM   400  N N     . ALA A 1 62  ? 16.530  -13.450 0.621   1.00 19.25 ? 273 ALA A N     1 
ATOM   401  C CA    . ALA A 1 62  ? 17.808  -13.844 0.028   1.00 18.48 ? 273 ALA A CA    1 
ATOM   402  C C     . ALA A 1 62  ? 18.516  -12.608 -0.550  1.00 17.58 ? 273 ALA A C     1 
ATOM   403  O O     . ALA A 1 62  ? 19.705  -12.454 -0.355  1.00 17.77 ? 273 ALA A O     1 
ATOM   404  C CB    . ALA A 1 62  ? 17.608  -14.946 -1.064  1.00 19.08 ? 273 ALA A CB    1 
ATOM   405  N N     . GLN A 1 63  ? 17.798  -11.706 -1.212  1.00 17.35 ? 274 GLN A N     1 
ATOM   406  C CA    . GLN A 1 63  ? 18.427  -10.478 -1.713  1.00 17.36 ? 274 GLN A CA    1 
ATOM   407  C C     . GLN A 1 63  ? 19.069  -9.669  -0.573  1.00 16.00 ? 274 GLN A C     1 
ATOM   408  O O     . GLN A 1 63  ? 20.199  -9.149  -0.692  1.00 15.17 ? 274 GLN A O     1 
ATOM   409  C CB    . GLN A 1 63  ? 17.416  -9.580  -2.412  1.00 18.89 ? 274 GLN A CB    1 
ATOM   410  C CG    . GLN A 1 63  ? 17.004  -9.969  -3.815  1.00 22.46 ? 274 GLN A CG    1 
ATOM   411  C CD    . GLN A 1 63  ? 15.736  -9.220  -4.236  1.00 26.46 ? 274 GLN A CD    1 
ATOM   412  O OE1   . GLN A 1 63  ? 15.244  -8.342  -3.505  1.00 32.14 ? 274 GLN A OE1   1 
ATOM   413  N NE2   . GLN A 1 63  ? 15.231  -9.526  -5.403  1.00 25.82 ? 274 GLN A NE2   1 
ATOM   414  N N     . ILE A 1 64  ? 18.344  -9.575  0.534   1.00 15.12 ? 275 ILE A N     1 
ATOM   415  C CA    . ILE A 1 64  ? 18.776  -8.775  1.670   1.00 14.13 ? 275 ILE A CA    1 
ATOM   416  C C     . ILE A 1 64  ? 19.995  -9.443  2.297   1.00 14.61 ? 275 ILE A C     1 
ATOM   417  O O     . ILE A 1 64  ? 20.956  -8.763  2.637   1.00 14.56 ? 275 ILE A O     1 
ATOM   418  C CB    . ILE A 1 64  ? 17.642  -8.539  2.692   1.00 14.05 ? 275 ILE A CB    1 
ATOM   419  C CG1   . ILE A 1 64  ? 16.490  -7.762  2.029   1.00 13.90 ? 275 ILE A CG1   1 
ATOM   420  C CG2   . ILE A 1 64  ? 18.155  -7.739  3.888   1.00 13.68 ? 275 ILE A CG2   1 
ATOM   421  C CD1   . ILE A 1 64  ? 15.201  -7.733  2.856   1.00 15.36 ? 275 ILE A CD1   1 
ATOM   422  N N     . LYS A 1 65  ? 19.982  -10.764 2.414   1.00 14.47 ? 276 LYS A N     1 
ATOM   423  C CA    . LYS A 1 65  ? 21.132  -11.478 2.961   1.00 14.63 ? 276 LYS A CA    1 
ATOM   424  C C     . LYS A 1 65  ? 22.367  -11.298 2.082   1.00 14.40 ? 276 LYS A C     1 
ATOM   425  O O     . LYS A 1 65  ? 23.468  -11.152 2.601   1.00 13.49 ? 276 LYS A O     1 
ATOM   426  C CB    . LYS A 1 65  ? 20.856  -12.970 3.124   1.00 15.11 ? 276 LYS A CB    1 
ATOM   427  C CG    . LYS A 1 65  ? 22.089  -13.825 3.452   1.00 16.47 ? 276 LYS A CG    1 
ATOM   428  C CD    . LYS A 1 65  ? 21.729  -15.306 3.468   1.00 20.66 ? 276 LYS A CD    1 
ATOM   429  C CE    . LYS A 1 65  ? 22.955  -16.186 3.697   1.00 23.31 ? 276 LYS A CE    1 
ATOM   430  N NZ    . LYS A 1 65  ? 22.632  -17.385 4.548   1.00 24.23 ? 276 LYS A NZ    1 
ATOM   431  N N     . ALA A 1 66  ? 22.175  -11.325 0.768   1.00 13.24 ? 277 ALA A N     1 
ATOM   432  C CA    . ALA A 1 66  ? 23.264  -11.085 -0.175  1.00 13.77 ? 277 ALA A CA    1 
ATOM   433  C C     . ALA A 1 66  ? 23.857  -9.705  0.056   1.00 13.80 ? 277 ALA A C     1 
ATOM   434  O O     . ALA A 1 66  ? 25.076  -9.510  -0.025  1.00 14.44 ? 277 ALA A O     1 
ATOM   435  C CB    . ALA A 1 66  ? 22.787  -11.238 -1.624  1.00 13.68 ? 277 ALA A CB    1 
ATOM   436  N N     . GLY A 1 67  ? 22.992  -8.751  0.348   1.00 12.54 ? 278 GLY A N     1 
ATOM   437  C CA    . GLY A 1 67  ? 23.423  -7.407  0.666   1.00 12.65 ? 278 GLY A CA    1 
ATOM   438  C C     . GLY A 1 67  ? 24.335  -7.358  1.851   1.00 12.38 ? 278 GLY A C     1 
ATOM   439  O O     . GLY A 1 67  ? 25.393  -6.712  1.801   1.00 11.87 ? 278 GLY A O     1 
ATOM   440  N N     . TYR A 1 68  ? 23.935  -8.016  2.937   1.00 12.74 ? 279 TYR A N     1 
ATOM   441  C CA    . TYR A 1 68  ? 24.780  -8.062  4.121   1.00 12.88 ? 279 TYR A CA    1 
ATOM   442  C C     . TYR A 1 68  ? 26.127  -8.704  3.813   1.00 13.74 ? 279 TYR A C     1 
ATOM   443  O O     . TYR A 1 68  ? 27.174  -8.252  4.296   1.00 12.33 ? 279 TYR A O     1 
ATOM   444  C CB    . TYR A 1 68  ? 24.128  -8.800  5.259   1.00 12.85 ? 279 TYR A CB    1 
ATOM   445  C CG    . TYR A 1 68  ? 23.044  -8.060  6.005   1.00 12.55 ? 279 TYR A CG    1 
ATOM   446  C CD1   . TYR A 1 68  ? 23.346  -6.941  6.795   1.00 13.26 ? 279 TYR A CD1   1 
ATOM   447  C CD2   . TYR A 1 68  ? 21.720  -8.535  5.998   1.00 11.11 ? 279 TYR A CD2   1 
ATOM   448  C CE1   . TYR A 1 68  ? 22.354  -6.313  7.548   1.00 12.02 ? 279 TYR A CE1   1 
ATOM   449  C CE2   . TYR A 1 68  ? 20.708  -7.899  6.731   1.00 11.91 ? 279 TYR A CE2   1 
ATOM   450  C CZ    . TYR A 1 68  ? 21.030  -6.789  7.492   1.00 12.98 ? 279 TYR A CZ    1 
ATOM   451  O OH    . TYR A 1 68  ? 20.052  -6.136  8.223   1.00 12.96 ? 279 TYR A OH    1 
ATOM   452  N N     . GLN A 1 69  ? 26.096  -9.759  3.019   1.00 14.12 ? 280 GLN A N     1 
ATOM   453  C CA    . GLN A 1 69  ? 27.346  -10.415 2.641   1.00 15.55 ? 280 GLN A CA    1 
ATOM   454  C C     . GLN A 1 69  ? 28.295  -9.475  1.926   1.00 15.60 ? 280 GLN A C     1 
ATOM   455  O O     . GLN A 1 69  ? 29.493  -9.479  2.208   1.00 15.20 ? 280 GLN A O     1 
ATOM   456  C CB    . GLN A 1 69  ? 27.090  -11.678 1.818   1.00 15.75 ? 280 GLN A CB    1 
ATOM   457  C CG    . GLN A 1 69  ? 26.468  -12.780 2.645   1.00 17.65 ? 280 GLN A CG    1 
ATOM   458  C CD    . GLN A 1 69  ? 25.935  -13.890 1.790   1.00 19.43 ? 280 GLN A CD    1 
ATOM   459  O OE1   . GLN A 1 69  ? 25.359  -13.644 0.736   1.00 23.09 ? 280 GLN A OE1   1 
ATOM   460  N NE2   . GLN A 1 69  ? 26.095  -15.115 2.246   1.00 21.50 ? 280 GLN A NE2   1 
ATOM   461  N N     . SER A 1 70  ? 27.769  -8.625  1.042   1.00 15.77 ? 281 SER A N     1 
ATOM   462  C CA    . SER A 1 70  ? 28.634  -7.666  0.363   1.00 16.10 ? 281 SER A CA    1 
ATOM   463  C C     . SER A 1 70  ? 29.161  -6.570  1.302   1.00 15.63 ? 281 SER A C     1 
ATOM   464  O O     . SER A 1 70  ? 30.301  -6.104  1.163   1.00 15.02 ? 281 SER A O     1 
ATOM   465  C CB    . SER A 1 70  ? 27.930  -7.046  -0.846  1.00 16.01 ? 281 SER A CB    1 
ATOM   466  O OG    . SER A 1 70  ? 27.476  -8.060  -1.718  1.00 18.18 ? 281 SER A OG    1 
ATOM   467  N N     . LEU A 1 71  ? 28.338  -6.149  2.253   1.00 15.35 ? 282 LEU A N     1 
ATOM   468  C CA    . LEU A 1 71  ? 28.804  -5.240  3.281   1.00 15.25 ? 282 LEU A CA    1 
ATOM   469  C C     . LEU A 1 71  ? 29.933  -5.833  4.115   1.00 15.62 ? 282 LEU A C     1 
ATOM   470  O O     . LEU A 1 71  ? 30.850  -5.106  4.516   1.00 15.53 ? 282 LEU A O     1 
ATOM   471  C CB    . LEU A 1 71  ? 27.663  -4.798  4.181   1.00 14.91 ? 282 LEU A CB    1 
ATOM   472  C CG    . LEU A 1 71  ? 26.668  -3.828  3.561   1.00 13.99 ? 282 LEU A CG    1 
ATOM   473  C CD1   . LEU A 1 71  ? 25.606  -3.490  4.660   1.00 10.69 ? 282 LEU A CD1   1 
ATOM   474  C CD2   . LEU A 1 71  ? 27.403  -2.537  3.054   1.00 10.90 ? 282 LEU A CD2   1 
ATOM   475  N N     . LYS A 1 72  ? 29.857  -7.135  4.389   1.00 15.87 ? 283 LYS A N     1 
ATOM   476  C CA    . LYS A 1 72  ? 30.913  -7.847  5.124   1.00 16.85 ? 283 LYS A CA    1 
ATOM   477  C C     . LYS A 1 72  ? 32.206  -7.834  4.304   1.00 16.83 ? 283 LYS A C     1 
ATOM   478  O O     . LYS A 1 72  ? 33.290  -7.651  4.855   1.00 15.54 ? 283 LYS A O     1 
ATOM   479  C CB    . LYS A 1 72  ? 30.473  -9.275  5.450   1.00 17.34 ? 283 LYS A CB    1 
ATOM   480  C CG    . LYS A 1 72  ? 31.572  -10.252 5.937   1.00 19.62 ? 283 LYS A CG    1 
ATOM   481  C CD    . LYS A 1 72  ? 32.176  -9.822  7.249   1.00 20.79 ? 283 LYS A CD    1 
ATOM   482  C CE    . LYS A 1 72  ? 32.833  -11.000 7.962   1.00 21.96 ? 283 LYS A CE    1 
ATOM   483  N NZ    . LYS A 1 72  ? 34.229  -11.258 7.579   1.00 22.75 ? 283 LYS A NZ    1 
ATOM   484  N N     . LYS A 1 73  ? 32.085  -7.987  2.988   1.00 17.27 ? 284 LYS A N     1 
ATOM   485  C CA    . LYS A 1 73  ? 33.264  -7.910  2.094   1.00 18.28 ? 284 LYS A CA    1 
ATOM   486  C C     . LYS A 1 73  ? 33.887  -6.535  2.122   1.00 18.03 ? 284 LYS A C     1 
ATOM   487  O O     . LYS A 1 73  ? 35.126  -6.388  2.139   1.00 17.75 ? 284 LYS A O     1 
ATOM   488  C CB    . LYS A 1 73  ? 32.905  -8.261  0.653   1.00 19.28 ? 284 LYS A CB    1 
ATOM   489  C CG    . LYS A 1 73  ? 32.678  -9.728  0.417   1.00 21.48 ? 284 LYS A CG    1 
ATOM   490  C CD    . LYS A 1 73  ? 32.273  -9.952  -1.027  1.00 26.61 ? 284 LYS A CD    1 
ATOM   491  C CE    . LYS A 1 73  ? 31.845  -11.373 -1.284  1.00 29.41 ? 284 LYS A CE    1 
ATOM   492  N NZ    . LYS A 1 73  ? 31.452  -11.527 -2.711  1.00 31.15 ? 284 LYS A NZ    1 
ATOM   493  N N     . ILE A 1 74  ? 33.035  -5.518  2.149   1.00 17.64 ? 285 ILE A N     1 
ATOM   494  C CA    . ILE A 1 74  ? 33.508  -4.157  2.302   1.00 17.66 ? 285 ILE A CA    1 
ATOM   495  C C     . ILE A 1 74  ? 34.264  -4.000  3.623   1.00 17.62 ? 285 ILE A C     1 
ATOM   496  O O     . ILE A 1 74  ? 35.369  -3.469  3.643   1.00 17.50 ? 285 ILE A O     1 
ATOM   497  C CB    . ILE A 1 74  ? 32.364  -3.141  2.195   1.00 17.34 ? 285 ILE A CB    1 
ATOM   498  C CG1   . ILE A 1 74  ? 31.814  -3.103  0.755   1.00 18.74 ? 285 ILE A CG1   1 
ATOM   499  C CG2   . ILE A 1 74  ? 32.828  -1.783  2.648   1.00 17.61 ? 285 ILE A CG2   1 
ATOM   500  C CD1   . ILE A 1 74  ? 30.433  -2.470  0.617   1.00 12.68 ? 285 ILE A CD1   1 
ATOM   501  N N     . GLU A 1 75  ? 33.680  -4.492  4.713   1.00 17.34 ? 286 GLU A N     1 
ATOM   502  C CA    . GLU A 1 75  ? 34.330  -4.463  6.012   1.00 17.35 ? 286 GLU A CA    1 
ATOM   503  C C     . GLU A 1 75  ? 35.703  -5.154  5.956   1.00 17.82 ? 286 GLU A C     1 
ATOM   504  O O     . GLU A 1 75  ? 36.674  -4.636  6.478   1.00 17.19 ? 286 GLU A O     1 
ATOM   505  C CB    . GLU A 1 75  ? 33.445  -5.098  7.087   1.00 17.51 ? 286 GLU A CB    1 
ATOM   506  C CG    . GLU A 1 75  ? 34.089  -5.125  8.479   1.00 17.46 ? 286 GLU A CG    1 
ATOM   507  C CD    . GLU A 1 75  ? 33.295  -5.915  9.497   1.00 17.46 ? 286 GLU A CD    1 
ATOM   508  O OE1   . GLU A 1 75  ? 33.376  -7.150  9.490   1.00 19.33 ? 286 GLU A OE1   1 
ATOM   509  O OE2   . GLU A 1 75  ? 32.600  -5.295  10.322  1.00 21.32 ? 286 GLU A OE2   1 
ATOM   510  N N     . ASP A 1 76  ? 35.782  -6.308  5.312   1.00 19.17 ? 287 ASP A N     1 
ATOM   511  C CA    . ASP A 1 76  ? 37.076  -6.998  5.144   1.00 20.41 ? 287 ASP A CA    1 
ATOM   512  C C     . ASP A 1 76  ? 38.118  -6.096  4.450   1.00 20.53 ? 287 ASP A C     1 
ATOM   513  O O     . ASP A 1 76  ? 39.247  -6.016  4.899   1.00 20.42 ? 287 ASP A O     1 
ATOM   514  C CB    . ASP A 1 76  ? 36.925  -8.290  4.366   1.00 20.72 ? 287 ASP A CB    1 
ATOM   515  C CG    . ASP A 1 76  ? 36.049  -9.318  5.065   1.00 21.88 ? 287 ASP A CG    1 
ATOM   516  O OD1   . ASP A 1 76  ? 35.929  -9.345  6.311   1.00 23.71 ? 287 ASP A OD1   1 
ATOM   517  O OD2   . ASP A 1 76  ? 35.484  -10.143 4.341   1.00 24.79 ? 287 ASP A OD2   1 
ATOM   518  N N     . CYS A 1 77  ? 37.732  -5.417  3.373   1.00 21.53 ? 288 CYS A N     1 
ATOM   519  C CA    . CYS A 1 77  ? 38.634  -4.504  2.653   1.00 21.84 ? 288 CYS A CA    1 
ATOM   520  C C     . CYS A 1 77  ? 39.146  -3.375  3.528   1.00 22.23 ? 288 CYS A C     1 
ATOM   521  O O     . CYS A 1 77  ? 40.344  -3.021  3.478   1.00 22.04 ? 288 CYS A O     1 
ATOM   522  C CB    . CYS A 1 77  ? 37.948  -3.840  1.454   1.00 22.20 ? 288 CYS A CB    1 
ATOM   523  S SG    . CYS A 1 77  ? 37.593  -4.905  0.064   1.00 23.75 ? 288 CYS A SG    1 
ATOM   524  N N     . ILE A 1 78  ? 38.230  -2.782  4.291   1.00 21.85 ? 289 ILE A N     1 
ATOM   525  C CA    . ILE A 1 78  ? 38.574  -1.697  5.179   1.00 22.02 ? 289 ILE A CA    1 
ATOM   526  C C     . ILE A 1 78  ? 39.565  -2.228  6.219   1.00 22.64 ? 289 ILE A C     1 
ATOM   527  O O     . ILE A 1 78  ? 40.605  -1.611  6.420   1.00 22.61 ? 289 ILE A O     1 
ATOM   528  C CB    . ILE A 1 78  ? 37.350  -1.045  5.844   1.00 22.25 ? 289 ILE A CB    1 
ATOM   529  C CG1   . ILE A 1 78  ? 36.388  -0.484  4.786   1.00 21.28 ? 289 ILE A CG1   1 
ATOM   530  C CG2   . ILE A 1 78  ? 37.780  0.070   6.817   1.00 21.29 ? 289 ILE A CG2   1 
ATOM   531  C CD1   . ILE A 1 78  ? 35.045  -0.101  5.345   1.00 21.38 ? 289 ILE A CD1   1 
ATOM   532  N N     . ARG A 1 79  ? 39.262  -3.384  6.814   1.00 22.77 ? 290 ARG A N     1 
ATOM   533  C CA    . ARG A 1 79  ? 40.131  -4.019  7.819   1.00 24.00 ? 290 ARG A CA    1 
ATOM   534  C C     . ARG A 1 79  ? 41.570  -4.322  7.296   1.00 24.48 ? 290 ARG A C     1 
ATOM   535  O O     . ARG A 1 79  ? 42.541  -4.215  8.019   1.00 24.03 ? 290 ARG A O     1 
ATOM   536  C CB    . ARG A 1 79  ? 39.479  -5.311  8.299   1.00 24.21 ? 290 ARG A CB    1 
ATOM   537  C CG    . ARG A 1 79  ? 39.933  -5.809  9.675   1.00 27.22 ? 290 ARG A CG    1 
ATOM   538  C CD    . ARG A 1 79  ? 39.250  -7.146  10.068  1.00 28.29 ? 290 ARG A CD    1 
ATOM   539  N NE    . ARG A 1 79  ? 37.825  -6.989  10.375  1.00 29.33 ? 290 ARG A NE    1 
ATOM   540  C CZ    . ARG A 1 79  ? 37.338  -6.562  11.541  1.00 31.11 ? 290 ARG A CZ    1 
ATOM   541  N NH1   . ARG A 1 79  ? 38.149  -6.237  12.543  1.00 29.51 ? 290 ARG A NH1   1 
ATOM   542  N NH2   . ARG A 1 79  ? 36.022  -6.472  11.716  1.00 32.95 ? 290 ARG A NH2   1 
ATOM   543  N N     . ALA A 1 80  ? 41.674  -4.731  6.037   1.00 25.51 ? 291 ALA A N     1 
ATOM   544  C CA    . ALA A 1 80  ? 42.965  -5.054  5.417   1.00 26.04 ? 291 ALA A CA    1 
ATOM   545  C C     . ALA A 1 80  ? 43.634  -3.843  4.790   1.00 26.61 ? 291 ALA A C     1 
ATOM   546  O O     . ALA A 1 80  ? 44.726  -3.964  4.281   1.00 27.10 ? 291 ALA A O     1 
ATOM   547  C CB    . ALA A 1 80  ? 42.785  -6.168  4.365   1.00 25.56 ? 291 ALA A CB    1 
ATOM   548  N N     . GLY A 1 81  ? 42.995  -2.678  4.824   1.00 28.19 ? 292 GLY A N     1 
ATOM   549  C CA    . GLY A 1 81  ? 43.610  -1.438  4.323   1.00 29.17 ? 292 GLY A CA    1 
ATOM   550  C C     . GLY A 1 81  ? 43.636  -1.356  2.800   1.00 30.48 ? 292 GLY A C     1 
ATOM   551  O O     . GLY A 1 81  ? 44.627  -0.945  2.193   1.00 30.10 ? 292 GLY A O     1 
ATOM   552  N N     . GLN A 1 82  ? 42.538  -1.756  2.179   1.00 31.64 ? 293 GLN A N     1 
ATOM   553  C CA    . GLN A 1 82  ? 42.406  -1.694  0.736   1.00 32.47 ? 293 GLN A CA    1 
ATOM   554  C C     . GLN A 1 82  ? 41.359  -0.631  0.487   1.00 33.73 ? 293 GLN A C     1 
ATOM   555  O O     . GLN A 1 82  ? 40.166  -0.876  0.700   1.00 33.81 ? 293 GLN A O     1 
ATOM   556  C CB    . GLN A 1 82  ? 41.954  -3.048  0.215   1.00 32.37 ? 293 GLN A CB    1 
ATOM   557  C CG    . GLN A 1 82  ? 42.911  -4.189  0.544   1.00 32.83 ? 293 GLN A CG    1 
ATOM   558  C CD    . GLN A 1 82  ? 42.260  -5.557  0.461   1.00 32.77 ? 293 GLN A CD    1 
ATOM   559  O OE1   . GLN A 1 82  ? 41.047  -5.664  0.378   1.00 36.00 ? 293 GLN A OE1   1 
ATOM   560  N NE2   . GLN A 1 82  ? 43.064  -6.612  0.508   1.00 33.59 ? 293 GLN A NE2   1 
ATOM   561  N N     . HIS A 1 83  ? 41.812  0.556   0.084   1.00 34.43 ? 294 HIS A N     1 
ATOM   562  C CA    . HIS A 1 83  ? 40.979  1.752   0.017   1.00 35.40 ? 294 HIS A CA    1 
ATOM   563  C C     . HIS A 1 83  ? 40.852  2.311   -1.400  1.00 35.37 ? 294 HIS A C     1 
ATOM   564  O O     . HIS A 1 83  ? 40.222  3.357   -1.602  1.00 35.41 ? 294 HIS A O     1 
ATOM   565  C CB    . HIS A 1 83  ? 41.538  2.844   0.949   1.00 35.96 ? 294 HIS A CB    1 
ATOM   566  C CG    . HIS A 1 83  ? 41.627  2.426   2.389   1.00 38.63 ? 294 HIS A CG    1 
ATOM   567  N ND1   . HIS A 1 83  ? 40.869  1.402   2.916   1.00 41.06 ? 294 HIS A ND1   1 
ATOM   568  C CD2   . HIS A 1 83  ? 42.366  2.911   3.416   1.00 41.41 ? 294 HIS A CD2   1 
ATOM   569  C CE1   . HIS A 1 83  ? 41.144  1.269   4.204   1.00 42.43 ? 294 HIS A CE1   1 
ATOM   570  N NE2   . HIS A 1 83  ? 42.050  2.171   4.533   1.00 42.07 ? 294 HIS A NE2   1 
ATOM   571  N N     . GLY A 1 84  ? 41.437  1.613   -2.373  1.00 35.17 ? 295 GLY A N     1 
ATOM   572  C CA    . GLY A 1 84  ? 41.380  2.031   -3.773  1.00 35.02 ? 295 GLY A CA    1 
ATOM   573  C C     . GLY A 1 84  ? 40.489  1.113   -4.580  1.00 34.94 ? 295 GLY A C     1 
ATOM   574  O O     . GLY A 1 84  ? 39.281  1.022   -4.316  1.00 34.77 ? 295 GLY A O     1 
ATOM   575  N N     . ARG A 1 85  ? 41.080  0.414   -5.552  1.00 34.43 ? 296 ARG A N     1 
ATOM   576  C CA    . ARG A 1 85  ? 40.308  -0.394  -6.500  1.00 33.97 ? 296 ARG A CA    1 
ATOM   577  C C     . ARG A 1 85  ? 39.434  -1.500  -5.867  1.00 32.95 ? 296 ARG A C     1 
ATOM   578  O O     . ARG A 1 85  ? 38.291  -1.717  -6.329  1.00 31.96 ? 296 ARG A O     1 
ATOM   579  C CB    . ARG A 1 85  ? 41.220  -1.028  -7.562  1.00 34.51 ? 296 ARG A CB    1 
ATOM   580  C CG    . ARG A 1 85  ? 40.441  -1.802  -8.646  1.00 36.75 ? 296 ARG A CG    1 
ATOM   581  C CD    . ARG A 1 85  ? 41.244  -2.958  -9.267  1.00 41.52 ? 296 ARG A CD    1 
ATOM   582  N NE    . ARG A 1 85  ? 41.939  -2.554  -10.498 1.00 44.91 ? 296 ARG A NE    1 
ATOM   583  C CZ    . ARG A 1 85  ? 41.490  -2.742  -11.749 1.00 46.36 ? 296 ARG A CZ    1 
ATOM   584  N NH1   . ARG A 1 85  ? 42.226  -2.313  -12.775 1.00 44.83 ? 296 ARG A NH1   1 
ATOM   585  N NH2   . ARG A 1 85  ? 40.315  -3.340  -11.993 1.00 47.28 ? 296 ARG A NH2   1 
ATOM   586  N N     . ALA A 1 86  ? 39.979  -2.228  -4.887  1.00 31.71 ? 297 ALA A N     1 
ATOM   587  C CA    . ALA A 1 86  ? 39.252  -3.345  -4.271  1.00 31.50 ? 297 ALA A CA    1 
ATOM   588  C C     . ALA A 1 86  ? 37.996  -2.856  -3.523  1.00 31.52 ? 297 ALA A C     1 
ATOM   589  O O     . ALA A 1 86  ? 36.906  -3.412  -3.688  1.00 30.60 ? 297 ALA A O     1 
ATOM   590  C CB    . ALA A 1 86  ? 40.162  -4.138  -3.352  1.00 31.67 ? 297 ALA A CB    1 
ATOM   591  N N     . LEU A 1 87  ? 38.154  -1.782  -2.748  1.00 31.34 ? 298 LEU A N     1 
ATOM   592  C CA    . LEU A 1 87  ? 37.024  -1.113  -2.074  1.00 31.78 ? 298 LEU A CA    1 
ATOM   593  C C     . LEU A 1 87  ? 35.975  -0.558  -3.058  1.00 32.08 ? 298 LEU A C     1 
ATOM   594  O O     . LEU A 1 87  ? 34.766  -0.773  -2.854  1.00 32.17 ? 298 LEU A O     1 
ATOM   595  C CB    . LEU A 1 87  ? 37.533  0.010   -1.147  1.00 31.63 ? 298 LEU A CB    1 
ATOM   596  C CG    . LEU A 1 87  ? 36.521  0.799   -0.297  1.00 31.67 ? 298 LEU A CG    1 
ATOM   597  C CD1   . LEU A 1 87  ? 35.770  -0.122  0.635   1.00 31.55 ? 298 LEU A CD1   1 
ATOM   598  C CD2   . LEU A 1 87  ? 37.198  1.928   0.490   1.00 29.89 ? 298 LEU A CD2   1 
ATOM   599  N N     . MET A 1 88  ? 36.402  0.158   -4.109  1.00 32.25 ? 299 MET A N     1 
ATOM   600  C CA    . MET A 1 88  ? 35.418  0.590   -5.128  1.00 32.49 ? 299 MET A CA    1 
ATOM   601  C C     . MET A 1 88  ? 34.771  -0.630  -5.829  1.00 31.57 ? 299 MET A C     1 
ATOM   602  O O     . MET A 1 88  ? 33.563  -0.575  -6.102  1.00 30.64 ? 299 MET A O     1 
ATOM   603  C CB    . MET A 1 88  ? 35.898  1.712   -6.109  1.00 33.34 ? 299 MET A CB    1 
ATOM   604  C CG    . MET A 1 88  ? 37.125  1.479   -7.011  1.00 35.37 ? 299 MET A CG    1 
ATOM   605  S SD    . MET A 1 88  ? 37.673  2.952   -8.021  1.00 42.17 ? 299 MET A SD    1 
ATOM   606  C CE    . MET A 1 88  ? 36.941  4.375   -7.182  1.00 38.67 ? 299 MET A CE    1 
ATOM   607  N N     . GLU A 1 89  ? 35.517  -1.726  -6.047  1.00 30.40 ? 300 GLU A N     1 
ATOM   608  C CA    . GLU A 1 89  ? 34.887  -2.967  -6.578  1.00 30.44 ? 300 GLU A CA    1 
ATOM   609  C C     . GLU A 1 89  ? 33.829  -3.490  -5.640  1.00 28.56 ? 300 GLU A C     1 
ATOM   610  O O     . GLU A 1 89  ? 32.766  -3.883  -6.065  1.00 28.63 ? 300 GLU A O     1 
ATOM   611  C CB    . GLU A 1 89  ? 35.879  -4.125  -6.818  1.00 31.06 ? 300 GLU A CB    1 
ATOM   612  C CG    . GLU A 1 89  ? 35.216  -5.532  -6.656  1.00 33.86 ? 300 GLU A CG    1 
ATOM   613  C CD    . GLU A 1 89  ? 36.123  -6.715  -6.982  1.00 38.37 ? 300 GLU A CD    1 
ATOM   614  O OE1   . GLU A 1 89  ? 37.351  -6.616  -6.777  1.00 40.14 ? 300 GLU A OE1   1 
ATOM   615  O OE2   . GLU A 1 89  ? 35.590  -7.753  -7.448  1.00 42.25 ? 300 GLU A OE2   1 
ATOM   616  N N     . ALA A 1 90  ? 34.158  -3.552  -4.359  1.00 27.67 ? 301 ALA A N     1 
ATOM   617  C CA    . ALA A 1 90  ? 33.281  -4.167  -3.377  1.00 26.99 ? 301 ALA A CA    1 
ATOM   618  C C     . ALA A 1 90  ? 32.047  -3.302  -3.151  1.00 25.94 ? 301 ALA A C     1 
ATOM   619  O O     . ALA A 1 90  ? 30.975  -3.832  -2.917  1.00 25.45 ? 301 ALA A O     1 
ATOM   620  C CB    . ALA A 1 90  ? 34.040  -4.373  -2.068  1.00 27.55 ? 301 ALA A CB    1 
ATOM   621  N N     . CYS A 1 91  ? 32.216  -1.974  -3.191  1.00 25.24 ? 302 CYS A N     1 
ATOM   622  C CA    . CYS A 1 91  ? 31.095  -1.062  -3.086  1.00 25.05 ? 302 CYS A CA    1 
ATOM   623  C C     . CYS A 1 91  ? 30.169  -1.219  -4.307  1.00 25.83 ? 302 CYS A C     1 
ATOM   624  O O     . CYS A 1 91  ? 28.966  -1.322  -4.143  1.00 24.92 ? 302 CYS A O     1 
ATOM   625  C CB    . CYS A 1 91  ? 31.568  0.389   -2.911  1.00 25.02 ? 302 CYS A CB    1 
ATOM   626  S SG    . CYS A 1 91  ? 32.452  0.704   -1.323  1.00 23.04 ? 302 CYS A SG    1 
ATOM   627  N N     . ASN A 1 92  ? 30.735  -1.274  -5.515  1.00 26.17 ? 303 ASN A N     1 
ATOM   628  C CA    . ASN A 1 92  ? 29.931  -1.505  -6.733  1.00 26.71 ? 303 ASN A CA    1 
ATOM   629  C C     . ASN A 1 92  ? 29.096  -2.798  -6.649  1.00 26.08 ? 303 ASN A C     1 
ATOM   630  O O     . ASN A 1 92  ? 27.924  -2.800  -7.043  1.00 26.45 ? 303 ASN A O     1 
ATOM   631  C CB    . ASN A 1 92  ? 30.805  -1.483  -8.017  1.00 27.13 ? 303 ASN A CB    1 
ATOM   632  C CG    . ASN A 1 92  ? 31.034  -2.878  -8.627  1.00 30.15 ? 303 ASN A CG    1 
ATOM   633  O OD1   . ASN A 1 92  ? 30.102  -3.688  -8.761  1.00 34.96 ? 303 ASN A OD1   1 
ATOM   634  N ND2   . ASN A 1 92  ? 32.272  -3.148  -9.038  1.00 33.53 ? 303 ASN A ND2   1 
ATOM   635  N N     . GLU A 1 93  ? 29.680  -3.896  -6.166  1.00 24.95 ? 304 GLU A N     1 
ATOM   636  C CA    . GLU A 1 93  ? 28.897  -5.150  -6.037  1.00 24.20 ? 304 GLU A CA    1 
ATOM   637  C C     . GLU A 1 93  ? 27.762  -5.039  -4.999  1.00 22.52 ? 304 GLU A C     1 
ATOM   638  O O     . GLU A 1 93  ? 26.684  -5.591  -5.203  1.00 21.87 ? 304 GLU A O     1 
ATOM   639  C CB    . GLU A 1 93  ? 29.761  -6.353  -5.661  1.00 24.77 ? 304 GLU A CB    1 
ATOM   640  C CG    . GLU A 1 93  ? 28.924  -7.570  -5.135  1.00 26.79 ? 304 GLU A CG    1 
ATOM   641  C CD    . GLU A 1 93  ? 29.756  -8.597  -4.399  1.00 32.11 ? 304 GLU A CD    1 
ATOM   642  O OE1   . GLU A 1 93  ? 30.757  -9.058  -4.987  1.00 34.22 ? 304 GLU A OE1   1 
ATOM   643  O OE2   . GLU A 1 93  ? 29.412  -8.977  -3.235  1.00 34.44 ? 304 GLU A OE2   1 
ATOM   644  N N     . PHE A 1 94  ? 28.010  -4.366  -3.870  1.00 21.05 ? 305 PHE A N     1 
ATOM   645  C CA    . PHE A 1 94  ? 26.916  -4.110  -2.920  1.00 19.22 ? 305 PHE A CA    1 
ATOM   646  C C     . PHE A 1 94  ? 25.814  -3.385  -3.677  1.00 18.64 ? 305 PHE A C     1 
ATOM   647  O O     . PHE A 1 94  ? 24.645  -3.765  -3.592  1.00 17.71 ? 305 PHE A O     1 
ATOM   648  C CB    . PHE A 1 94  ? 27.374  -3.245  -1.741  1.00 19.01 ? 305 PHE A CB    1 
ATOM   649  C CG    . PHE A 1 94  ? 26.244  -2.745  -0.885  1.00 16.99 ? 305 PHE A CG    1 
ATOM   650  C CD1   . PHE A 1 94  ? 25.553  -3.603  -0.043  1.00 15.20 ? 305 PHE A CD1   1 
ATOM   651  C CD2   . PHE A 1 94  ? 25.887  -1.400  -0.895  1.00 14.86 ? 305 PHE A CD2   1 
ATOM   652  C CE1   . PHE A 1 94  ? 24.516  -3.115  0.766   1.00 14.15 ? 305 PHE A CE1   1 
ATOM   653  C CE2   . PHE A 1 94  ? 24.881  -0.926  -0.102  1.00 13.36 ? 305 PHE A CE2   1 
ATOM   654  C CZ    . PHE A 1 94  ? 24.191  -1.781  0.738   1.00 12.68 ? 305 PHE A CZ    1 
ATOM   655  N N     . TYR A 1 95  ? 26.204  -2.343  -4.417  1.00 18.15 ? 306 TYR A N     1 
ATOM   656  C CA    . TYR A 1 95  ? 25.250  -1.490  -5.135  1.00 18.57 ? 306 TYR A CA    1 
ATOM   657  C C     . TYR A 1 95  ? 24.486  -2.235  -6.248  1.00 18.93 ? 306 TYR A C     1 
ATOM   658  O O     . TYR A 1 95  ? 23.367  -1.842  -6.592  1.00 18.22 ? 306 TYR A O     1 
ATOM   659  C CB    . TYR A 1 95  ? 25.929  -0.238  -5.720  1.00 18.32 ? 306 TYR A CB    1 
ATOM   660  C CG    . TYR A 1 95  ? 26.423  0.750   -4.695  1.00 16.71 ? 306 TYR A CG    1 
ATOM   661  C CD1   . TYR A 1 95  ? 25.605  1.192   -3.654  1.00 14.61 ? 306 TYR A CD1   1 
ATOM   662  C CD2   . TYR A 1 95  ? 27.708  1.269   -4.767  1.00 17.37 ? 306 TYR A CD2   1 
ATOM   663  C CE1   . TYR A 1 95  ? 26.062  2.102   -2.715  1.00 13.81 ? 306 TYR A CE1   1 
ATOM   664  C CE2   . TYR A 1 95  ? 28.153  2.209   -3.830  1.00 14.02 ? 306 TYR A CE2   1 
ATOM   665  C CZ    . TYR A 1 95  ? 27.344  2.594   -2.808  1.00 14.37 ? 306 TYR A CZ    1 
ATOM   666  O OH    . TYR A 1 95  ? 27.794  3.517   -1.880  1.00 16.52 ? 306 TYR A OH    1 
ATOM   667  N N     . THR A 1 96  ? 25.082  -3.305  -6.775  1.00 19.37 ? 307 THR A N     1 
ATOM   668  C CA    . THR A 1 96  ? 24.402  -4.201  -7.722  1.00 20.05 ? 307 THR A CA    1 
ATOM   669  C C     . THR A 1 96  ? 23.343  -5.040  -7.002  1.00 20.05 ? 307 THR A C     1 
ATOM   670  O O     . THR A 1 96  ? 22.240  -5.243  -7.525  1.00 20.53 ? 307 THR A O     1 
ATOM   671  C CB    . THR A 1 96  ? 25.436  -5.088  -8.460  1.00 20.74 ? 307 THR A CB    1 
ATOM   672  O OG1   . THR A 1 96  ? 26.294  -4.234  -9.235  1.00 22.25 ? 307 THR A OG1   1 
ATOM   673  C CG2   . THR A 1 96  ? 24.781  -6.110  -9.368  1.00 20.46 ? 307 THR A CG2   1 
ATOM   674  N N     . ARG A 1 97  ? 23.651  -5.510  -5.790  1.00 19.30 ? 308 ARG A N     1 
ATOM   675  C CA    . ARG A 1 97  ? 22.697  -6.313  -5.026  1.00 19.01 ? 308 ARG A CA    1 
ATOM   676  C C     . ARG A 1 97  ? 21.579  -5.486  -4.401  1.00 17.48 ? 308 ARG A C     1 
ATOM   677  O O     . ARG A 1 97  ? 20.423  -5.927  -4.347  1.00 17.27 ? 308 ARG A O     1 
ATOM   678  C CB    . ARG A 1 97  ? 23.420  -7.109  -3.966  1.00 19.77 ? 308 ARG A CB    1 
ATOM   679  C CG    . ARG A 1 97  ? 24.108  -8.342  -4.573  1.00 23.10 ? 308 ARG A CG    1 
ATOM   680  C CD    . ARG A 1 97  ? 25.189  -8.835  -3.680  1.00 24.79 ? 308 ARG A CD    1 
ATOM   681  N NE    . ARG A 1 97  ? 25.865  -9.962  -4.301  1.00 27.47 ? 308 ARG A NE    1 
ATOM   682  C CZ    . ARG A 1 97  ? 26.516  -10.921 -3.653  1.00 30.94 ? 308 ARG A CZ    1 
ATOM   683  N NH1   . ARG A 1 97  ? 26.604  -10.933 -2.321  1.00 32.00 ? 308 ARG A NH1   1 
ATOM   684  N NH2   . ARG A 1 97  ? 27.092  -11.892 -4.354  1.00 32.42 ? 308 ARG A NH2   1 
ATOM   685  N N     . ILE A 1 98  ? 21.924  -4.291  -3.949  1.00 15.37 ? 309 ILE A N     1 
ATOM   686  C CA    . ILE A 1 98  ? 20.992  -3.395  -3.300  1.00 15.00 ? 309 ILE A CA    1 
ATOM   687  C C     . ILE A 1 98  ? 21.045  -2.091  -4.103  1.00 15.27 ? 309 ILE A C     1 
ATOM   688  O O     . ILE A 1 98  ? 21.777  -1.171  -3.742  1.00 15.44 ? 309 ILE A O     1 
ATOM   689  C CB    . ILE A 1 98  ? 21.370  -3.189  -1.790  1.00 14.75 ? 309 ILE A CB    1 
ATOM   690  C CG1   . ILE A 1 98  ? 21.460  -4.523  -1.063  1.00 14.25 ? 309 ILE A CG1   1 
ATOM   691  C CG2   . ILE A 1 98  ? 20.353  -2.298  -1.046  1.00 13.23 ? 309 ILE A CG2   1 
ATOM   692  C CD1   . ILE A 1 98  ? 20.150  -5.327  -1.022  1.00 14.05 ? 309 ILE A CD1   1 
ATOM   693  N N     . PRO A 1 99  ? 20.289  -2.025  -5.225  1.00 15.35 ? 310 PRO A N     1 
ATOM   694  C CA    . PRO A 1 99  ? 20.380  -0.895  -6.130  1.00 15.21 ? 310 PRO A CA    1 
ATOM   695  C C     . PRO A 1 99  ? 20.071  0.432   -5.475  1.00 14.99 ? 310 PRO A C     1 
ATOM   696  O O     . PRO A 1 99  ? 19.077  0.566   -4.745  1.00 14.69 ? 310 PRO A O     1 
ATOM   697  C CB    . PRO A 1 99  ? 19.331  -1.204  -7.188  1.00 15.84 ? 310 PRO A CB    1 
ATOM   698  C CG    . PRO A 1 99  ? 19.115  -2.625  -7.128  1.00 16.02 ? 310 PRO A CG    1 
ATOM   699  C CD    . PRO A 1 99  ? 19.274  -2.979  -5.690  1.00 15.26 ? 310 PRO A CD    1 
ATOM   700  N N     . HIS A 1 100 ? 20.927  1.409   -5.747  1.00 14.45 ? 311 HIS A N     1 
ATOM   701  C CA    . HIS A 1 100 ? 20.779  2.744   -5.212  1.00 14.15 ? 311 HIS A CA    1 
ATOM   702  C C     . HIS A 1 100 ? 20.491  3.720   -6.360  1.00 14.11 ? 311 HIS A C     1 
ATOM   703  O O     . HIS A 1 100 ? 20.773  3.430   -7.502  1.00 14.52 ? 311 HIS A O     1 
ATOM   704  C CB    . HIS A 1 100 ? 22.048  3.194   -4.482  1.00 14.21 ? 311 HIS A CB    1 
ATOM   705  C CG    . HIS A 1 100 ? 22.174  2.684   -3.079  1.00 13.66 ? 311 HIS A CG    1 
ATOM   706  N ND1   . HIS A 1 100 ? 22.156  1.341   -2.765  1.00 12.22 ? 311 HIS A ND1   1 
ATOM   707  C CD2   . HIS A 1 100 ? 22.343  3.341   -1.908  1.00 14.19 ? 311 HIS A CD2   1 
ATOM   708  C CE1   . HIS A 1 100 ? 22.338  1.196   -1.465  1.00 12.59 ? 311 HIS A CE1   1 
ATOM   709  N NE2   . HIS A 1 100 ? 22.451  2.392   -0.921  1.00 12.60 ? 311 HIS A NE2   1 
ATOM   710  N N     . ASP A 1 101 ? 19.954  4.880   -6.038  1.00 14.89 ? 312 ASP A N     1 
ATOM   711  C CA    . ASP A 1 101 ? 19.768  5.940   -7.015  1.00 15.85 ? 312 ASP A CA    1 
ATOM   712  C C     . ASP A 1 101 ? 20.685  7.114   -6.663  1.00 15.80 ? 312 ASP A C     1 
ATOM   713  O O     . ASP A 1 101 ? 20.363  7.921   -5.815  1.00 15.47 ? 312 ASP A O     1 
ATOM   714  C CB    . ASP A 1 101 ? 18.309  6.391   -7.036  1.00 16.89 ? 312 ASP A CB    1 
ATOM   715  C CG    . ASP A 1 101 ? 18.012  7.344   -8.208  1.00 19.37 ? 312 ASP A CG    1 
ATOM   716  O OD1   . ASP A 1 101 ? 18.931  7.681   -8.980  1.00 23.89 ? 312 ASP A OD1   1 
ATOM   717  O OD2   . ASP A 1 101 ? 16.866  7.777   -8.338  1.00 25.57 ? 312 ASP A OD2   1 
ATOM   718  N N     . PHE A 1 102 ? 21.849  7.184   -7.310  1.00 15.07 ? 313 PHE A N     1 
ATOM   719  C CA    . PHE A 1 102 ? 22.768  8.307   -7.115  1.00 15.19 ? 313 PHE A CA    1 
ATOM   720  C C     . PHE A 1 102 ? 22.703  9.279   -8.298  1.00 15.29 ? 313 PHE A C     1 
ATOM   721  O O     . PHE A 1 102 ? 23.545  10.136  -8.431  1.00 16.40 ? 313 PHE A O     1 
ATOM   722  C CB    . PHE A 1 102 ? 24.198  7.800   -6.920  1.00 14.84 ? 313 PHE A CB    1 
ATOM   723  C CG    . PHE A 1 102 ? 24.403  6.984   -5.660  1.00 15.23 ? 313 PHE A CG    1 
ATOM   724  C CD1   . PHE A 1 102 ? 24.275  7.568   -4.396  1.00 15.53 ? 313 PHE A CD1   1 
ATOM   725  C CD2   . PHE A 1 102 ? 24.765  5.636   -5.747  1.00 16.60 ? 313 PHE A CD2   1 
ATOM   726  C CE1   . PHE A 1 102 ? 24.495  6.810   -3.223  1.00 16.00 ? 313 PHE A CE1   1 
ATOM   727  C CE2   . PHE A 1 102 ? 24.971  4.870   -4.596  1.00 16.60 ? 313 PHE A CE2   1 
ATOM   728  C CZ    . PHE A 1 102 ? 24.842  5.463   -3.324  1.00 15.21 ? 313 PHE A CZ    1 
ATOM   729  N N     . GLY A 1 103 ? 21.683  9.154   -9.133  1.00 16.07 ? 314 GLY A N     1 
ATOM   730  C CA    . GLY A 1 103 ? 21.534  9.985   -10.321 1.00 16.32 ? 314 GLY A CA    1 
ATOM   731  C C     . GLY A 1 103 ? 22.766  9.875   -11.207 1.00 16.44 ? 314 GLY A C     1 
ATOM   732  O O     . GLY A 1 103 ? 23.191  8.781   -11.573 1.00 15.67 ? 314 GLY A O     1 
ATOM   733  N N     . LEU A 1 104 ? 23.380  11.017  -11.496 1.00 16.06 ? 315 LEU A N     1 
ATOM   734  C CA    . LEU A 1 104 ? 24.521  11.077  -12.417 1.00 15.96 ? 315 LEU A CA    1 
ATOM   735  C C     . LEU A 1 104 ? 25.875  11.061  -11.713 1.00 15.54 ? 315 LEU A C     1 
ATOM   736  O O     . LEU A 1 104 ? 26.902  11.097  -12.362 1.00 15.01 ? 315 LEU A O     1 
ATOM   737  C CB    . LEU A 1 104 ? 24.419  12.356  -13.249 1.00 16.01 ? 315 LEU A CB    1 
ATOM   738  C CG    . LEU A 1 104 ? 23.308  12.261  -14.292 1.00 17.09 ? 315 LEU A CG    1 
ATOM   739  C CD1   . LEU A 1 104 ? 23.068  13.615  -14.971 1.00 20.12 ? 315 LEU A CD1   1 
ATOM   740  C CD2   . LEU A 1 104 ? 23.617  11.154  -15.299 1.00 19.88 ? 315 LEU A CD2   1 
ATOM   741  N N     . ARG A 1 105 ? 25.903  11.007  -10.388 1.00 15.65 ? 316 ARG A N     1 
ATOM   742  C CA    . ARG A 1 105 ? 27.192  11.126  -9.714  1.00 15.41 ? 316 ARG A CA    1 
ATOM   743  C C     . ARG A 1 105 ? 27.836  9.780   -9.448  1.00 14.33 ? 316 ARG A C     1 
ATOM   744  O O     . ARG A 1 105 ? 27.168  8.751   -9.430  1.00 14.13 ? 316 ARG A O     1 
ATOM   745  C CB    . ARG A 1 105 ? 27.095  11.975  -8.456  1.00 16.21 ? 316 ARG A CB    1 
ATOM   746  C CG    . ARG A 1 105 ? 26.493  11.342  -7.308  1.00 16.65 ? 316 ARG A CG    1 
ATOM   747  C CD    . ARG A 1 105 ? 27.012  11.985  -6.011  1.00 17.78 ? 316 ARG A CD    1 
ATOM   748  N NE    . ARG A 1 105 ? 26.208  11.468  -4.904  1.00 18.46 ? 316 ARG A NE    1 
ATOM   749  C CZ    . ARG A 1 105 ? 26.662  11.067  -3.727  1.00 20.85 ? 316 ARG A CZ    1 
ATOM   750  N NH1   . ARG A 1 105 ? 25.782  10.643  -2.838  1.00 23.17 ? 316 ARG A NH1   1 
ATOM   751  N NH2   . ARG A 1 105 ? 27.957  11.083  -3.421  1.00 21.28 ? 316 ARG A NH2   1 
ATOM   752  N N     . THR A 1 106 ? 29.144  9.809   -9.268  1.00 13.44 ? 317 THR A N     1 
ATOM   753  C CA    . THR A 1 106 ? 29.923  8.603   -9.001  1.00 13.48 ? 317 THR A CA    1 
ATOM   754  C C     . THR A 1 106 ? 29.348  7.907   -7.758  1.00 14.03 ? 317 THR A C     1 
ATOM   755  O O     . THR A 1 106 ? 29.243  8.525   -6.706  1.00 12.28 ? 317 THR A O     1 
ATOM   756  C CB    . THR A 1 106 ? 31.399  8.949   -8.755  1.00 13.93 ? 317 THR A CB    1 
ATOM   757  O OG1   . THR A 1 106 ? 31.881  9.765   -9.836  1.00 14.43 ? 317 THR A OG1   1 
ATOM   758  C CG2   . THR A 1 106 ? 32.288  7.635   -8.610  1.00 12.71 ? 317 THR A CG2   1 
ATOM   759  N N     . PRO A 1 107 ? 28.956  6.626   -7.877  1.00 15.12 ? 318 PRO A N     1 
ATOM   760  C CA    . PRO A 1 107 ? 28.506  5.987   -6.645  1.00 16.58 ? 318 PRO A CA    1 
ATOM   761  C C     . PRO A 1 107 ? 29.570  6.025   -5.539  1.00 17.44 ? 318 PRO A C     1 
ATOM   762  O O     . PRO A 1 107 ? 30.700  5.605   -5.746  1.00 18.90 ? 318 PRO A O     1 
ATOM   763  C CB    . PRO A 1 107 ? 28.173  4.568   -7.105  1.00 16.81 ? 318 PRO A CB    1 
ATOM   764  C CG    . PRO A 1 107 ? 27.715  4.774   -8.549  1.00 15.50 ? 318 PRO A CG    1 
ATOM   765  C CD    . PRO A 1 107 ? 28.660  5.801   -9.059  1.00 15.10 ? 318 PRO A CD    1 
ATOM   766  N N     . PRO A 1 108 ? 29.229  6.588   -4.381  1.00 18.66 ? 319 PRO A N     1 
ATOM   767  C CA    . PRO A 1 108 ? 30.271  6.882   -3.388  1.00 19.33 ? 319 PRO A CA    1 
ATOM   768  C C     . PRO A 1 108 ? 30.774  5.675   -2.647  1.00 20.50 ? 319 PRO A C     1 
ATOM   769  O O     . PRO A 1 108 ? 30.017  4.738   -2.391  1.00 21.46 ? 319 PRO A O     1 
ATOM   770  C CB    . PRO A 1 108 ? 29.557  7.808   -2.407  1.00 19.06 ? 319 PRO A CB    1 
ATOM   771  C CG    . PRO A 1 108 ? 28.103  7.373   -2.490  1.00 18.27 ? 319 PRO A CG    1 
ATOM   772  C CD    . PRO A 1 108 ? 27.915  7.107   -3.960  1.00 18.49 ? 319 PRO A CD    1 
ATOM   773  N N     . LEU A 1 109 ? 32.046  5.713   -2.283  1.00 21.28 ? 320 LEU A N     1 
ATOM   774  C CA    . LEU A 1 109 ? 32.646  4.645   -1.502  1.00 23.03 ? 320 LEU A CA    1 
ATOM   775  C C     . LEU A 1 109 ? 32.056  4.568   -0.112  1.00 23.06 ? 320 LEU A C     1 
ATOM   776  O O     . LEU A 1 109 ? 31.574  5.568   0.456   1.00 23.32 ? 320 LEU A O     1 
ATOM   777  C CB    . LEU A 1 109 ? 34.168  4.814   -1.391  1.00 23.72 ? 320 LEU A CB    1 
ATOM   778  C CG    . LEU A 1 109 ? 34.937  4.656   -2.709  1.00 25.04 ? 320 LEU A CG    1 
ATOM   779  C CD1   . LEU A 1 109 ? 36.345  5.291   -2.608  1.00 26.85 ? 320 LEU A CD1   1 
ATOM   780  C CD2   . LEU A 1 109 ? 35.024  3.202   -3.079  1.00 24.53 ? 320 LEU A CD2   1 
ATOM   781  N N     . ILE A 1 110 ? 32.096  3.358   0.433   1.00 23.69 ? 321 ILE A N     1 
ATOM   782  C CA    . ILE A 1 110 ? 31.709  3.118   1.802   1.00 23.41 ? 321 ILE A CA    1 
ATOM   783  C C     . ILE A 1 110 ? 33.038  2.845   2.499   1.00 24.62 ? 321 ILE A C     1 
ATOM   784  O O     . ILE A 1 110 ? 33.705  1.879   2.215   1.00 24.12 ? 321 ILE A O     1 
ATOM   785  C CB    . ILE A 1 110 ? 30.692  1.952   1.874   1.00 23.48 ? 321 ILE A CB    1 
ATOM   786  C CG1   . ILE A 1 110 ? 29.421  2.330   1.093   1.00 21.88 ? 321 ILE A CG1   1 
ATOM   787  C CG2   . ILE A 1 110 ? 30.349  1.630   3.326   1.00 21.53 ? 321 ILE A CG2   1 
ATOM   788  C CD1   . ILE A 1 110 ? 28.721  1.185   0.440   1.00 20.39 ? 321 ILE A CD1   1 
ATOM   789  N N     . ARG A 1 111 ? 33.464  3.774   3.347   1.00 26.69 ? 322 ARG A N     1 
ATOM   790  C CA    . ARG A 1 111 ? 34.791  3.718   3.942   1.00 27.49 ? 322 ARG A CA    1 
ATOM   791  C C     . ARG A 1 111 ? 34.793  3.810   5.457   1.00 26.91 ? 322 ARG A C     1 
ATOM   792  O O     . ARG A 1 111 ? 35.720  3.317   6.080   1.00 27.56 ? 322 ARG A O     1 
ATOM   793  C CB    . ARG A 1 111 ? 35.661  4.858   3.382   1.00 28.47 ? 322 ARG A CB    1 
ATOM   794  C CG    . ARG A 1 111 ? 36.339  4.553   2.050   1.00 32.90 ? 322 ARG A CG    1 
ATOM   795  C CD    . ARG A 1 111 ? 37.078  5.794   1.494   1.00 40.08 ? 322 ARG A CD    1 
ATOM   796  N NE    . ARG A 1 111 ? 38.087  5.463   0.467   1.00 45.00 ? 322 ARG A NE    1 
ATOM   797  C CZ    . ARG A 1 111 ? 38.930  6.344   -0.092  1.00 48.00 ? 322 ARG A CZ    1 
ATOM   798  N NH1   . ARG A 1 111 ? 38.920  7.634   0.269   1.00 49.35 ? 322 ARG A NH1   1 
ATOM   799  N NH2   . ARG A 1 111 ? 39.797  5.931   -1.019  1.00 48.66 ? 322 ARG A NH2   1 
ATOM   800  N N     . THR A 1 112 ? 33.816  4.493   6.041   1.00 26.22 ? 323 THR A N     1 
ATOM   801  C CA    . THR A 1 112 ? 33.817  4.726   7.483   1.00 25.64 ? 323 THR A CA    1 
ATOM   802  C C     . THR A 1 112 ? 32.814  3.829   8.185   1.00 25.26 ? 323 THR A C     1 
ATOM   803  O O     . THR A 1 112 ? 31.884  3.292   7.549   1.00 24.62 ? 323 THR A O     1 
ATOM   804  C CB    . THR A 1 112 ? 33.499  6.179   7.855   1.00 25.56 ? 323 THR A CB    1 
ATOM   805  O OG1   . THR A 1 112 ? 32.193  6.530   7.385   1.00 27.35 ? 323 THR A OG1   1 
ATOM   806  C CG2   . THR A 1 112 ? 34.531  7.157   7.276   1.00 25.20 ? 323 THR A CG2   1 
ATOM   807  N N     . GLN A 1 113 ? 33.011  3.675   9.497   1.00 24.40 ? 324 GLN A N     1 
ATOM   808  C CA    . GLN A 1 113 ? 32.029  3.008   10.348  1.00 23.99 ? 324 GLN A CA    1 
ATOM   809  C C     . GLN A 1 113 ? 30.658  3.608   10.126  1.00 23.49 ? 324 GLN A C     1 
ATOM   810  O O     . GLN A 1 113 ? 29.667  2.885   10.017  1.00 23.18 ? 324 GLN A O     1 
ATOM   811  C CB    . GLN A 1 113 ? 32.374  3.164   11.826  1.00 24.11 ? 324 GLN A CB    1 
ATOM   812  C CG    . GLN A 1 113 ? 31.625  2.176   12.722  1.00 23.65 ? 324 GLN A CG    1 
ATOM   813  C CD    . GLN A 1 113 ? 30.235  2.625   13.132  1.00 22.58 ? 324 GLN A CD    1 
ATOM   814  O OE1   . GLN A 1 113 ? 29.925  3.829   13.166  1.00 22.42 ? 324 GLN A OE1   1 
ATOM   815  N NE2   . GLN A 1 113 ? 29.384  1.653   13.462  1.00 16.91 ? 324 GLN A NE2   1 
ATOM   816  N N     . LYS A 1 114 ? 30.605  4.933   10.073  1.00 22.54 ? 325 LYS A N     1 
ATOM   817  C CA    . LYS A 1 114 ? 29.348  5.623   9.857   1.00 23.12 ? 325 LYS A CA    1 
ATOM   818  C C     . LYS A 1 114 ? 28.678  5.179   8.537   1.00 21.88 ? 325 LYS A C     1 
ATOM   819  O O     . LYS A 1 114 ? 27.489  4.881   8.504   1.00 20.41 ? 325 LYS A O     1 
ATOM   820  C CB    . LYS A 1 114 ? 29.578  7.126   9.870   1.00 23.77 ? 325 LYS A CB    1 
ATOM   821  C CG    . LYS A 1 114 ? 28.301  7.969   9.801   1.00 26.97 ? 325 LYS A CG    1 
ATOM   822  C CD    . LYS A 1 114 ? 28.657  9.447   9.985   1.00 30.00 ? 325 LYS A CD    1 
ATOM   823  C CE    . LYS A 1 114 ? 27.649  10.184  10.844  1.00 32.75 ? 325 LYS A CE    1 
ATOM   824  N NZ    . LYS A 1 114 ? 26.375  10.440  10.120  1.00 34.59 ? 325 LYS A NZ    1 
ATOM   825  N N     . GLU A 1 115 ? 29.463  5.111   7.471   1.00 21.71 ? 326 GLU A N     1 
ATOM   826  C CA    . GLU A 1 115 ? 28.929  4.815   6.134   1.00 21.35 ? 326 GLU A CA    1 
ATOM   827  C C     . GLU A 1 115 ? 28.434  3.378   6.054   1.00 20.12 ? 326 GLU A C     1 
ATOM   828  O O     . GLU A 1 115 ? 27.398  3.090   5.443   1.00 19.00 ? 326 GLU A O     1 
ATOM   829  C CB    . GLU A 1 115 ? 29.990  5.118   5.072   1.00 21.76 ? 326 GLU A CB    1 
ATOM   830  C CG    . GLU A 1 115 ? 30.254  6.634   4.945   1.00 23.15 ? 326 GLU A CG    1 
ATOM   831  C CD    . GLU A 1 115 ? 31.453  6.985   4.058   1.00 25.87 ? 326 GLU A CD    1 
ATOM   832  O OE1   . GLU A 1 115 ? 32.331  6.121   3.819   1.00 26.62 ? 326 GLU A OE1   1 
ATOM   833  O OE2   . GLU A 1 115 ? 31.491  8.134   3.577   1.00 25.14 ? 326 GLU A OE2   1 
ATOM   834  N N     . LEU A 1 116 ? 29.170  2.493   6.711   1.00 18.86 ? 327 LEU A N     1 
ATOM   835  C CA    . LEU A 1 116 ? 28.808  1.097   6.822   1.00 18.67 ? 327 LEU A CA    1 
ATOM   836  C C     . LEU A 1 116 ? 27.506  0.950   7.658   1.00 17.85 ? 327 LEU A C     1 
ATOM   837  O O     . LEU A 1 116 ? 26.570  0.245   7.256   1.00 16.23 ? 327 LEU A O     1 
ATOM   838  C CB    . LEU A 1 116 ? 29.962  0.333   7.464   1.00 19.14 ? 327 LEU A CB    1 
ATOM   839  C CG    . LEU A 1 116 ? 30.208  -1.152  7.242   1.00 21.88 ? 327 LEU A CG    1 
ATOM   840  C CD1   . LEU A 1 116 ? 30.277  -1.565  5.755   1.00 22.22 ? 327 LEU A CD1   1 
ATOM   841  C CD2   . LEU A 1 116 ? 31.513  -1.559  7.959   1.00 23.82 ? 327 LEU A CD2   1 
ATOM   842  N N     . SER A 1 117 ? 27.459  1.625   8.802   1.00 16.13 ? 328 SER A N     1 
ATOM   843  C CA    . SER A 1 117 ? 26.271  1.657   9.615   1.00 15.83 ? 328 SER A CA    1 
ATOM   844  C C     . SER A 1 117 ? 25.028  2.137   8.868   1.00 15.28 ? 328 SER A C     1 
ATOM   845  O O     . SER A 1 117 ? 23.954  1.587   9.054   1.00 13.63 ? 328 SER A O     1 
ATOM   846  C CB    . SER A 1 117 ? 26.468  2.552   10.821  1.00 15.83 ? 328 SER A CB    1 
ATOM   847  O OG    . SER A 1 117 ? 25.278  2.565   11.584  1.00 17.43 ? 328 SER A OG    1 
ATOM   848  N N     . GLU A 1 118 ? 25.182  3.176   8.054   1.00 14.58 ? 329 GLU A N     1 
ATOM   849  C CA    . GLU A 1 118 ? 24.081  3.706   7.254   1.00 15.75 ? 329 GLU A CA    1 
ATOM   850  C C     . GLU A 1 118 ? 23.503  2.656   6.302   1.00 14.31 ? 329 GLU A C     1 
ATOM   851  O O     . GLU A 1 118 ? 22.280  2.575   6.116   1.00 13.33 ? 329 GLU A O     1 
ATOM   852  C CB    . GLU A 1 118 ? 24.555  4.914   6.451   1.00 16.67 ? 329 GLU A CB    1 
ATOM   853  C CG    . GLU A 1 118 ? 24.732  6.141   7.334   1.00 22.28 ? 329 GLU A CG    1 
ATOM   854  C CD    . GLU A 1 118 ? 25.457  7.279   6.640   1.00 28.83 ? 329 GLU A CD    1 
ATOM   855  O OE1   . GLU A 1 118 ? 25.911  7.104   5.475   1.00 30.70 ? 329 GLU A OE1   1 
ATOM   856  O OE2   . GLU A 1 118 ? 25.571  8.350   7.283   1.00 33.66 ? 329 GLU A OE2   1 
ATOM   857  N N     . LYS A 1 119 ? 24.391  1.878   5.692   1.00 12.94 ? 330 LYS A N     1 
ATOM   858  C CA    . LYS A 1 119 ? 23.988  0.790   4.805   1.00 13.40 ? 330 LYS A CA    1 
ATOM   859  C C     . LYS A 1 119 ? 23.301  -0.357  5.554   1.00 12.90 ? 330 LYS A C     1 
ATOM   860  O O     . LYS A 1 119 ? 22.362  -0.970  5.047   1.00 12.77 ? 330 LYS A O     1 
ATOM   861  C CB    . LYS A 1 119 ? 25.201  0.282   4.010   1.00 13.03 ? 330 LYS A CB    1 
ATOM   862  C CG    . LYS A 1 119 ? 25.808  1.320   3.060   1.00 14.77 ? 330 LYS A CG    1 
ATOM   863  C CD    . LYS A 1 119 ? 24.887  1.845   1.988   1.00 15.93 ? 330 LYS A CD    1 
ATOM   864  C CE    . LYS A 1 119 ? 24.355  3.197   2.337   1.00 17.77 ? 330 LYS A CE    1 
ATOM   865  N NZ    . LYS A 1 119 ? 23.419  3.801   1.347   1.00 21.50 ? 330 LYS A NZ    1 
ATOM   866  N N     . ILE A 1 120 ? 23.769  -0.638  6.760   1.00 12.58 ? 331 ILE A N     1 
ATOM   867  C CA    . ILE A 1 120 ? 23.147  -1.628  7.609   1.00 12.54 ? 331 ILE A CA    1 
ATOM   868  C C     . ILE A 1 120 ? 21.727  -1.192  7.965   1.00 12.68 ? 331 ILE A C     1 
ATOM   869  O O     . ILE A 1 120 ? 20.793  -1.991  7.921   1.00 11.28 ? 331 ILE A O     1 
ATOM   870  C CB    . ILE A 1 120 ? 23.949  -1.853  8.896   1.00 12.28 ? 331 ILE A CB    1 
ATOM   871  C CG1   . ILE A 1 120 ? 25.154  -2.720  8.566   1.00 14.52 ? 331 ILE A CG1   1 
ATOM   872  C CG2   . ILE A 1 120 ? 23.105  -2.541  9.961   1.00 11.72 ? 331 ILE A CG2   1 
ATOM   873  C CD1   . ILE A 1 120 ? 26.343  -2.451  9.395   1.00 13.91 ? 331 ILE A CD1   1 
ATOM   874  N N     . GLN A 1 121 ? 21.562  0.078   8.294   1.00 12.73 ? 332 GLN A N     1 
ATOM   875  C CA    . GLN A 1 121 ? 20.245  0.596   8.603   1.00 12.31 ? 332 GLN A CA    1 
ATOM   876  C C     . GLN A 1 121 ? 19.296  0.525   7.421   1.00 11.39 ? 332 GLN A C     1 
ATOM   877  O O     . GLN A 1 121 ? 18.082  0.299   7.605   1.00 9.16  ? 332 GLN A O     1 
ATOM   878  C CB    . GLN A 1 121 ? 20.339  2.011   9.126   1.00 12.96 ? 332 GLN A CB    1 
ATOM   879  C CG    . GLN A 1 121 ? 20.951  2.030   10.528  1.00 16.38 ? 332 GLN A CG    1 
ATOM   880  C CD    . GLN A 1 121 ? 21.157  3.434   11.018  1.00 23.30 ? 332 GLN A CD    1 
ATOM   881  O OE1   . GLN A 1 121 ? 20.248  4.265   10.953  1.00 26.17 ? 332 GLN A OE1   1 
ATOM   882  N NE2   . GLN A 1 121 ? 22.367  3.722   11.497  1.00 26.46 ? 332 GLN A NE2   1 
ATOM   883  N N     . LEU A 1 122 ? 19.835  0.744   6.228   1.00 10.38 ? 333 LEU A N     1 
ATOM   884  C CA    . LEU A 1 122 ? 19.069  0.587   5.018   1.00 10.67 ? 333 LEU A CA    1 
ATOM   885  C C     . LEU A 1 122 ? 18.562  -0.876  4.908   1.00 10.34 ? 333 LEU A C     1 
ATOM   886  O O     . LEU A 1 122 ? 17.396  -1.106  4.650   1.00 8.94  ? 333 LEU A O     1 
ATOM   887  C CB    . LEU A 1 122 ? 19.919  0.979   3.794   1.00 11.52 ? 333 LEU A CB    1 
ATOM   888  C CG    . LEU A 1 122 ? 19.342  0.681   2.415   1.00 13.18 ? 333 LEU A CG    1 
ATOM   889  C CD1   . LEU A 1 122 ? 17.940  1.163   2.342   1.00 15.91 ? 333 LEU A CD1   1 
ATOM   890  C CD2   . LEU A 1 122 ? 20.162  1.385   1.350   1.00 15.72 ? 333 LEU A CD2   1 
ATOM   891  N N     . LEU A 1 123 ? 19.453  -1.846  5.077   1.00 10.17 ? 334 LEU A N     1 
ATOM   892  C CA    . LEU A 1 123 ? 19.097  -3.261  4.983   1.00 10.00 ? 334 LEU A CA    1 
ATOM   893  C C     . LEU A 1 123 ? 18.165  -3.695  6.134   1.00 10.30 ? 334 LEU A C     1 
ATOM   894  O O     . LEU A 1 123 ? 17.274  -4.517  5.907   1.00 9.89  ? 334 LEU A O     1 
ATOM   895  C CB    . LEU A 1 123 ? 20.339  -4.172  5.017   1.00 10.42 ? 334 LEU A CB    1 
ATOM   896  C CG    . LEU A 1 123 ? 21.333  -4.142  3.853   1.00 10.84 ? 334 LEU A CG    1 
ATOM   897  C CD1   . LEU A 1 123 ? 22.369  -5.282  3.922   1.00 10.65 ? 334 LEU A CD1   1 
ATOM   898  C CD2   . LEU A 1 123 ? 20.615  -4.212  2.556   1.00 11.97 ? 334 LEU A CD2   1 
ATOM   899  N N     . GLU A 1 124 ? 18.359  -3.167  7.340   1.00 9.96  ? 335 GLU A N     1 
ATOM   900  C CA    . GLU A 1 124 ? 17.420  -3.435  8.429   1.00 11.81 ? 335 GLU A CA    1 
ATOM   901  C C     . GLU A 1 124 ? 15.992  -2.984  8.113   1.00 11.37 ? 335 GLU A C     1 
ATOM   902  O O     . GLU A 1 124 ? 15.041  -3.734  8.344   1.00 10.65 ? 335 GLU A O     1 
ATOM   903  C CB    . GLU A 1 124 ? 17.931  -2.837  9.752   1.00 12.44 ? 335 GLU A CB    1 
ATOM   904  C CG    . GLU A 1 124 ? 19.148  -3.622  10.215  1.00 14.79 ? 335 GLU A CG    1 
ATOM   905  C CD    . GLU A 1 124 ? 19.828  -3.092  11.436  1.00 19.72 ? 335 GLU A CD    1 
ATOM   906  O OE1   . GLU A 1 124 ? 19.554  -1.938  11.860  1.00 21.14 ? 335 GLU A OE1   1 
ATOM   907  O OE2   . GLU A 1 124 ? 20.673  -3.863  11.956  1.00 26.62 ? 335 GLU A OE2   1 
ATOM   908  N N     . ALA A 1 125 ? 15.846  -1.790  7.532   1.00 11.22 ? 336 ALA A N     1 
ATOM   909  C CA    . ALA A 1 125 ? 14.544  -1.309  7.098   1.00 11.41 ? 336 ALA A CA    1 
ATOM   910  C C     . ALA A 1 125 ? 13.934  -2.163  5.971   1.00 11.86 ? 336 ALA A C     1 
ATOM   911  O O     . ALA A 1 125 ? 12.734  -2.494  5.997   1.00 10.91 ? 336 ALA A O     1 
ATOM   912  C CB    . ALA A 1 125 ? 14.660  0.148   6.636   1.00 10.90 ? 336 ALA A CB    1 
ATOM   913  N N     . LEU A 1 126 ? 14.745  -2.491  4.965   1.00 11.31 ? 337 LEU A N     1 
ATOM   914  C CA    . LEU A 1 126 ? 14.285  -3.349  3.894   1.00 11.67 ? 337 LEU A CA    1 
ATOM   915  C C     . LEU A 1 126 ? 13.783  -4.694  4.433   1.00 12.27 ? 337 LEU A C     1 
ATOM   916  O O     . LEU A 1 126 ? 12.788  -5.220  3.934   1.00 12.25 ? 337 LEU A O     1 
ATOM   917  C CB    . LEU A 1 126 ? 15.373  -3.608  2.855   1.00 11.45 ? 337 LEU A CB    1 
ATOM   918  C CG    . LEU A 1 126 ? 15.831  -2.450  1.993   1.00 12.57 ? 337 LEU A CG    1 
ATOM   919  C CD1   . LEU A 1 126 ? 17.115  -2.896  1.243   1.00 10.58 ? 337 LEU A CD1   1 
ATOM   920  C CD2   . LEU A 1 126 ? 14.697  -2.041  1.048   1.00 11.75 ? 337 LEU A CD2   1 
ATOM   921  N N     . GLY A 1 127 ? 14.462  -5.232  5.445   1.00 12.36 ? 338 GLY A N     1 
ATOM   922  C CA    . GLY A 1 127 ? 14.046  -6.488  6.065   1.00 12.31 ? 338 GLY A CA    1 
ATOM   923  C C     . GLY A 1 127 ? 12.673  -6.357  6.704   1.00 12.17 ? 338 GLY A C     1 
ATOM   924  O O     . GLY A 1 127 ? 11.834  -7.237  6.576   1.00 12.20 ? 338 GLY A O     1 
ATOM   925  N N     . ASP A 1 128 ? 12.453  -5.268  7.419   1.00 11.17 ? 339 ASP A N     1 
ATOM   926  C CA    . ASP A 1 128 ? 11.146  -5.003  8.008   1.00 11.51 ? 339 ASP A CA    1 
ATOM   927  C C     . ASP A 1 128 ? 10.067  -4.688  6.974   1.00 10.45 ? 339 ASP A C     1 
ATOM   928  O O     . ASP A 1 128 ? 8.903   -5.049  7.165   1.00 9.69  ? 339 ASP A O     1 
ATOM   929  C CB    . ASP A 1 128 ? 11.263  -3.911  9.076   1.00 11.93 ? 339 ASP A CB    1 
ATOM   930  C CG    . ASP A 1 128 ? 11.882  -4.449  10.377  1.00 14.14 ? 339 ASP A CG    1 
ATOM   931  O OD1   . ASP A 1 128 ? 11.884  -5.680  10.592  1.00 17.67 ? 339 ASP A OD1   1 
ATOM   932  O OD2   . ASP A 1 128 ? 12.374  -3.653  11.182  1.00 15.18 ? 339 ASP A OD2   1 
ATOM   933  N N     . ILE A 1 129 ? 10.451  -4.049  5.873   1.00 10.94 ? 340 ILE A N     1 
ATOM   934  C CA    . ILE A 1 129 ? 9.522   -3.821  4.771   1.00 10.67 ? 340 ILE A CA    1 
ATOM   935  C C     . ILE A 1 129 ? 9.120   -5.144  4.078   1.00 11.52 ? 340 ILE A C     1 
ATOM   936  O O     . ILE A 1 129 ? 7.964   -5.345  3.771   1.00 8.78  ? 340 ILE A O     1 
ATOM   937  C CB    . ILE A 1 129 ? 10.073  -2.819  3.750   1.00 10.34 ? 340 ILE A CB    1 
ATOM   938  C CG1   . ILE A 1 129 ? 10.065  -1.404  4.337   1.00 11.49 ? 340 ILE A CG1   1 
ATOM   939  C CG2   . ILE A 1 129 ? 9.217   -2.829  2.539   1.00 11.24 ? 340 ILE A CG2   1 
ATOM   940  C CD1   . ILE A 1 129 ? 10.851  -0.347  3.442   1.00 8.84  ? 340 ILE A CD1   1 
ATOM   941  N N     . GLU A 1 130 ? 10.084  -6.037  3.822   1.00 12.85 ? 341 GLU A N     1 
ATOM   942  C CA    . GLU A 1 130 ? 9.763   -7.395  3.300   1.00 12.78 ? 341 GLU A CA    1 
ATOM   943  C C     . GLU A 1 130 ? 8.703   -8.093  4.178   1.00 12.87 ? 341 GLU A C     1 
ATOM   944  O O     . GLU A 1 130 ? 7.719   -8.660  3.673   1.00 12.96 ? 341 GLU A O     1 
ATOM   945  C CB    . GLU A 1 130 ? 11.028  -8.245  3.214   1.00 12.82 ? 341 GLU A CB    1 
ATOM   946  C CG    . GLU A 1 130 ? 10.875  -9.595  2.511   1.00 14.50 ? 341 GLU A CG    1 
ATOM   947  C CD    . GLU A 1 130 ? 10.370  -10.732 3.417   1.00 16.50 ? 341 GLU A CD    1 
ATOM   948  O OE1   . GLU A 1 130 ? 10.575  -10.698 4.650   1.00 15.03 ? 341 GLU A OE1   1 
ATOM   949  O OE2   . GLU A 1 130 ? 9.771   -11.687 2.870   1.00 16.43 ? 341 GLU A OE2   1 
ATOM   950  N N     . ILE A 1 131 ? 8.913   -8.047  5.488   1.00 12.53 ? 342 ILE A N     1 
ATOM   951  C CA    . ILE A 1 131 ? 7.944   -8.542  6.470   1.00 12.21 ? 342 ILE A CA    1 
ATOM   952  C C     . ILE A 1 131 ? 6.584   -7.884  6.333   1.00 12.16 ? 342 ILE A C     1 
ATOM   953  O O     . ILE A 1 131 ? 5.572   -8.590  6.204   1.00 11.55 ? 342 ILE A O     1 
ATOM   954  C CB    . ILE A 1 131 ? 8.493   -8.370  7.896   1.00 12.32 ? 342 ILE A CB    1 
ATOM   955  C CG1   . ILE A 1 131 ? 9.596   -9.412  8.125   1.00 11.99 ? 342 ILE A CG1   1 
ATOM   956  C CG2   . ILE A 1 131 ? 7.403   -8.568  9.015   1.00 10.95 ? 342 ILE A CG2   1 
ATOM   957  C CD1   . ILE A 1 131 ? 10.393  -9.185  9.396   1.00 13.74 ? 342 ILE A CD1   1 
ATOM   958  N N     . ALA A 1 132 ? 6.564   -6.550  6.327   1.00 11.22 ? 343 ALA A N     1 
ATOM   959  C CA    . ALA A 1 132 ? 5.325   -5.782  6.199   1.00 11.76 ? 343 ALA A CA    1 
ATOM   960  C C     . ALA A 1 132 ? 4.500   -6.088  4.933   1.00 11.89 ? 343 ALA A C     1 
ATOM   961  O O     . ALA A 1 132 ? 3.272   -6.206  5.013   1.00 11.01 ? 343 ALA A O     1 
ATOM   962  C CB    . ALA A 1 132 ? 5.610   -4.325  6.259   1.00 10.32 ? 343 ALA A CB    1 
ATOM   963  N N     . ILE A 1 133 ? 5.165   -6.159  3.777   1.00 12.29 ? 344 ILE A N     1 
ATOM   964  C CA    . ILE A 1 133 ? 4.481   -6.399  2.513   1.00 13.34 ? 344 ILE A CA    1 
ATOM   965  C C     . ILE A 1 133 ? 3.792   -7.757  2.512   1.00 14.78 ? 344 ILE A C     1 
ATOM   966  O O     . ILE A 1 133 ? 2.670   -7.846  2.009   1.00 16.62 ? 344 ILE A O     1 
ATOM   967  C CB    . ILE A 1 133 ? 5.410   -6.218  1.281   1.00 13.75 ? 344 ILE A CB    1 
ATOM   968  C CG1   . ILE A 1 133 ? 5.800   -4.743  1.145   1.00 14.91 ? 344 ILE A CG1   1 
ATOM   969  C CG2   . ILE A 1 133 ? 4.712   -6.634  -0.028  1.00 13.20 ? 344 ILE A CG2   1 
ATOM   970  C CD1   . ILE A 1 133 ? 6.731   -4.468  -0.046  1.00 18.78 ? 344 ILE A CD1   1 
ATOM   971  N N     . LYS A 1 134 ? 4.418   -8.783  3.096   1.00 15.79 ? 345 LYS A N     1 
ATOM   972  C CA    . LYS A 1 134 ? 3.784   -10.117 3.224   1.00 17.57 ? 345 LYS A CA    1 
ATOM   973  C C     . LYS A 1 134 ? 2.604   -10.032 4.202   1.00 17.38 ? 345 LYS A C     1 
ATOM   974  O O     . LYS A 1 134 ? 1.543   -10.553 3.948   1.00 15.84 ? 345 LYS A O     1 
ATOM   975  C CB    . LYS A 1 134 ? 4.743   -11.141 3.818   1.00 18.57 ? 345 LYS A CB    1 
ATOM   976  C CG    . LYS A 1 134 ? 5.525   -12.050 2.881   1.00 23.44 ? 345 LYS A CG    1 
ATOM   977  C CD    . LYS A 1 134 ? 6.401   -12.950 3.753   1.00 26.59 ? 345 LYS A CD    1 
ATOM   978  C CE    . LYS A 1 134 ? 7.341   -13.875 2.982   1.00 28.77 ? 345 LYS A CE    1 
ATOM   979  N NZ    . LYS A 1 134 ? 8.711   -14.007 3.663   1.00 27.49 ? 345 LYS A NZ    1 
ATOM   980  N N     . LEU A 1 135 ? 2.841   -9.381  5.342   1.00 16.64 ? 346 LEU A N     1 
ATOM   981  C CA    . LEU A 1 135 ? 1.861   -9.303  6.392   1.00 17.18 ? 346 LEU A CA    1 
ATOM   982  C C     . LEU A 1 135 ? 0.586   -8.593  5.943   1.00 16.99 ? 346 LEU A C     1 
ATOM   983  O O     . LEU A 1 135 ? -0.506  -8.995  6.342   1.00 18.11 ? 346 LEU A O     1 
ATOM   984  C CB    . LEU A 1 135 ? 2.470   -8.610  7.609   1.00 16.93 ? 346 LEU A CB    1 
ATOM   985  C CG    . LEU A 1 135 ? 1.572   -8.491  8.822   1.00 19.01 ? 346 LEU A CG    1 
ATOM   986  C CD1   . LEU A 1 135 ? 2.406   -8.620  10.099  1.00 18.07 ? 346 LEU A CD1   1 
ATOM   987  C CD2   . LEU A 1 135 ? 0.797   -7.168  8.744   1.00 20.41 ? 346 LEU A CD2   1 
ATOM   988  N N     . VAL A 1 136 ? 0.721   -7.545  5.139   1.00 16.48 ? 347 VAL A N     1 
ATOM   989  C CA    A VAL A 1 136 ? -0.398  -6.704  4.705   0.50 17.25 ? 347 VAL A CA    1 
ATOM   990  C CA    B VAL A 1 136 ? -0.444  -6.744  4.766   0.50 16.67 ? 347 VAL A CA    1 
ATOM   991  C C     . VAL A 1 136 ? -1.239  -7.332  3.590   1.00 17.18 ? 347 VAL A C     1 
ATOM   992  O O     . VAL A 1 136 ? -2.262  -6.797  3.210   1.00 17.00 ? 347 VAL A O     1 
ATOM   993  C CB    A VAL A 1 136 ? 0.091   -5.301  4.225   0.50 17.39 ? 347 VAL A CB    1 
ATOM   994  C CB    B VAL A 1 136 ? -0.083  -5.262  4.512   0.50 16.65 ? 347 VAL A CB    1 
ATOM   995  C CG1   A VAL A 1 136 ? 0.615   -5.335  2.792   0.50 17.51 ? 347 VAL A CG1   1 
ATOM   996  C CG1   B VAL A 1 136 ? 0.543   -4.660  5.776   0.50 14.01 ? 347 VAL A CG1   1 
ATOM   997  C CG2   A VAL A 1 136 ? -1.018  -4.291  4.314   0.50 18.48 ? 347 VAL A CG2   1 
ATOM   998  C CG2   B VAL A 1 136 ? 0.840   -5.104  3.300   0.50 16.62 ? 347 VAL A CG2   1 
ATOM   999  N N     . LYS A 1 137 ? -0.789  -8.444  3.037   1.00 18.28 ? 348 LYS A N     1 
ATOM   1000 C CA    . LYS A 1 137 ? -1.578  -9.134  1.983   1.00 19.98 ? 348 LYS A CA    1 
ATOM   1001 C C     . LYS A 1 137 ? -2.942  -9.563  2.548   1.00 20.53 ? 348 LYS A C     1 
ATOM   1002 O O     . LYS A 1 137 ? -3.022  -10.108 3.656   1.00 20.21 ? 348 LYS A O     1 
ATOM   1003 C CB    . LYS A 1 137 ? -0.846  -10.375 1.498   1.00 20.58 ? 348 LYS A CB    1 
ATOM   1004 C CG    . LYS A 1 137 ? 0.367   -10.098 0.649   1.00 23.24 ? 348 LYS A CG    1 
ATOM   1005 C CD    . LYS A 1 137 ? 0.980   -11.417 0.136   1.00 27.33 ? 348 LYS A CD    1 
ATOM   1006 C CE    . LYS A 1 137 ? 2.000   -11.160 -0.974  1.00 29.46 ? 348 LYS A CE    1 
ATOM   1007 N NZ    . LYS A 1 137 ? 2.551   -12.442 -1.547  1.00 31.28 ? 348 LYS A NZ    1 
ATOM   1008 N N     . THR A 1 138 ? -3.998  -9.277  1.804   1.00 21.72 ? 349 THR A N     1 
ATOM   1009 C CA    . THR A 1 138 ? -5.354  -9.549  2.241   1.00 22.75 ? 349 THR A CA    1 
ATOM   1010 C C     . THR A 1 138 ? -6.015  -10.665 1.437   1.00 23.77 ? 349 THR A C     1 
ATOM   1011 O O     . THR A 1 138 ? -5.700  -10.880 0.262   1.00 22.37 ? 349 THR A O     1 
ATOM   1012 C CB    . THR A 1 138 ? -6.223  -8.292  2.103   1.00 23.03 ? 349 THR A CB    1 
ATOM   1013 O OG1   . THR A 1 138 ? -6.231  -7.854  0.741   1.00 23.32 ? 349 THR A OG1   1 
ATOM   1014 C CG2   . THR A 1 138 ? -5.689  -7.147  3.042   1.00 22.47 ? 349 THR A CG2   1 
ATOM   1015 N N     . GLU A 1 139 ? -6.941  -11.379 2.076   1.00 24.77 ? 350 GLU A N     1 
ATOM   1016 C CA    . GLU A 1 139 ? -7.828  -12.281 1.346   1.00 25.84 ? 350 GLU A CA    1 
ATOM   1017 C C     . GLU A 1 139 ? -8.956  -11.421 0.834   1.00 26.54 ? 350 GLU A C     1 
ATOM   1018 O O     . GLU A 1 139 ? -9.762  -10.931 1.607   1.00 27.05 ? 350 GLU A O     1 
ATOM   1019 C CB    . GLU A 1 139 ? -8.415  -13.352 2.254   1.00 26.59 ? 350 GLU A CB    1 
ATOM   1020 C CG    . GLU A 1 139 ? -7.654  -14.633 2.303   1.00 27.73 ? 350 GLU A CG    1 
ATOM   1021 C CD    . GLU A 1 139 ? -8.200  -15.578 3.350   1.00 29.34 ? 350 GLU A CD    1 
ATOM   1022 O OE1   . GLU A 1 139 ? -7.413  -16.411 3.843   1.00 32.59 ? 350 GLU A OE1   1 
ATOM   1023 O OE2   . GLU A 1 139 ? -9.402  -15.492 3.684   1.00 30.08 ? 350 GLU A OE2   1 
ATOM   1024 N N     . LEU A 1 140 ? -9.022  -11.255 -0.467  1.00 27.04 ? 351 LEU A N     1 
ATOM   1025 C CA    . LEU A 1 140 ? -9.985  -10.347 -1.083  1.00 28.07 ? 351 LEU A CA    1 
ATOM   1026 C C     . LEU A 1 140 ? -11.467 -10.673 -0.763  1.00 27.21 ? 351 LEU A C     1 
ATOM   1027 O O     . LEU A 1 140 ? -12.254 -9.766  -0.486  1.00 26.71 ? 351 LEU A O     1 
ATOM   1028 C CB    . LEU A 1 140 ? -9.731  -10.307 -2.606  1.00 28.40 ? 351 LEU A CB    1 
ATOM   1029 C CG    . LEU A 1 140 ? -8.286  -9.849  -2.943  1.00 30.68 ? 351 LEU A CG    1 
ATOM   1030 C CD1   . LEU A 1 140 ? -7.786  -10.416 -4.308  1.00 32.72 ? 351 LEU A CD1   1 
ATOM   1031 C CD2   . LEU A 1 140 ? -8.127  -8.309  -2.850  1.00 30.72 ? 351 LEU A CD2   1 
ATOM   1032 N N     . GLN A 1 141 ? -11.835 -11.958 -0.787  1.00 26.75 ? 352 GLN A N     1 
ATOM   1033 C CA    . GLN A 1 141 ? -13.231 -12.364 -0.499  1.00 26.12 ? 352 GLN A CA    1 
ATOM   1034 C C     . GLN A 1 141 ? -13.501 -12.567 1.009   1.00 25.13 ? 352 GLN A C     1 
ATOM   1035 O O     . GLN A 1 141 ? -14.552 -13.083 1.396   1.00 23.96 ? 352 GLN A O     1 
ATOM   1036 C CB    . GLN A 1 141 ? -13.593 -13.641 -1.283  1.00 26.60 ? 352 GLN A CB    1 
ATOM   1037 C CG    . GLN A 1 141 ? -13.657 -13.474 -2.832  1.00 28.85 ? 352 GLN A CG    1 
ATOM   1038 C CD    . GLN A 1 141 ? -14.154 -14.758 -3.579  1.00 32.00 ? 352 GLN A CD    1 
ATOM   1039 O OE1   . GLN A 1 141 ? -14.975 -15.528 -3.054  1.00 34.89 ? 352 GLN A OE1   1 
ATOM   1040 N NE2   . GLN A 1 141 ? -13.662 -14.967 -4.805  1.00 32.76 ? 352 GLN A NE2   1 
ATOM   1041 N N     . SER A 1 142 ? -12.556 -12.194 1.870   1.00 23.27 ? 353 SER A N     1 
ATOM   1042 C CA    . SER A 1 142 ? -12.778 -12.341 3.313   1.00 22.74 ? 353 SER A CA    1 
ATOM   1043 C C     . SER A 1 142 ? -13.795 -11.330 3.860   1.00 21.53 ? 353 SER A C     1 
ATOM   1044 O O     . SER A 1 142 ? -13.852 -10.191 3.414   1.00 20.65 ? 353 SER A O     1 
ATOM   1045 C CB    . SER A 1 142 ? -11.469 -12.201 4.080   1.00 22.57 ? 353 SER A CB    1 
ATOM   1046 O OG    . SER A 1 142 ? -11.724 -12.202 5.463   1.00 24.53 ? 353 SER A OG    1 
ATOM   1047 N N     . PRO A 1 143 ? -14.618 -11.747 4.824   1.00 21.18 ? 354 PRO A N     1 
ATOM   1048 C CA    . PRO A 1 143 ? -15.531 -10.756 5.420   1.00 21.38 ? 354 PRO A CA    1 
ATOM   1049 C C     . PRO A 1 143 ? -14.837 -9.808  6.397   1.00 21.52 ? 354 PRO A C     1 
ATOM   1050 O O     . PRO A 1 143 ? -15.391 -8.766  6.717   1.00 21.87 ? 354 PRO A O     1 
ATOM   1051 C CB    . PRO A 1 143 ? -16.573 -11.613 6.167   1.00 21.79 ? 354 PRO A CB    1 
ATOM   1052 C CG    . PRO A 1 143 ? -15.987 -12.949 6.302   1.00 21.96 ? 354 PRO A CG    1 
ATOM   1053 C CD    . PRO A 1 143 ? -14.931 -13.122 5.221   1.00 21.56 ? 354 PRO A CD    1 
ATOM   1054 N N     . GLU A 1 144 ? -13.651 -10.183 6.882   1.00 21.20 ? 355 GLU A N     1 
ATOM   1055 C CA    . GLU A 1 144 ? -12.890 -9.347  7.815   1.00 21.37 ? 355 GLU A CA    1 
ATOM   1056 C C     . GLU A 1 144 ? -12.407 -8.070  7.146   1.00 20.39 ? 355 GLU A C     1 
ATOM   1057 O O     . GLU A 1 144 ? -11.863 -8.092  6.036   1.00 21.31 ? 355 GLU A O     1 
ATOM   1058 C CB    . GLU A 1 144 ? -11.656 -10.103 8.325   1.00 22.39 ? 355 GLU A CB    1 
ATOM   1059 C CG    . GLU A 1 144 ? -11.679 -10.630 9.742   1.00 26.60 ? 355 GLU A CG    1 
ATOM   1060 C CD    . GLU A 1 144 ? -10.285 -11.120 10.132  1.00 32.28 ? 355 GLU A CD    1 
ATOM   1061 O OE1   . GLU A 1 144 ? -9.755  -12.028 9.433   1.00 33.92 ? 355 GLU A OE1   1 
ATOM   1062 O OE2   . GLU A 1 144 ? -9.673  -10.581 11.089  1.00 35.28 ? 355 GLU A OE2   1 
ATOM   1063 N N     . HIS A 1 145 ? -12.583 -6.947  7.821   1.00 19.58 ? 356 HIS A N     1 
ATOM   1064 C CA    . HIS A 1 145 ? -11.947 -5.692  7.432   1.00 18.95 ? 356 HIS A CA    1 
ATOM   1065 C C     . HIS A 1 145 ? -10.413 -5.903  7.267   1.00 17.64 ? 356 HIS A C     1 
ATOM   1066 O O     . HIS A 1 145 ? -9.805  -6.639  8.035   1.00 16.71 ? 356 HIS A O     1 
ATOM   1067 C CB    . HIS A 1 145 ? -12.207 -4.607  8.478   1.00 18.96 ? 356 HIS A CB    1 
ATOM   1068 C CG    . HIS A 1 145 ? -12.005 -3.223  7.954   1.00 20.01 ? 356 HIS A CG    1 
ATOM   1069 N ND1   . HIS A 1 145 ? -10.753 -2.682  7.737   1.00 21.45 ? 356 HIS A ND1   1 
ATOM   1070 C CD2   . HIS A 1 145 ? -12.897 -2.269  7.602   1.00 20.79 ? 356 HIS A CD2   1 
ATOM   1071 C CE1   . HIS A 1 145 ? -10.888 -1.456  7.258   1.00 24.11 ? 356 HIS A CE1   1 
ATOM   1072 N NE2   . HIS A 1 145 ? -12.180 -1.178  7.181   1.00 22.03 ? 356 HIS A NE2   1 
ATOM   1073 N N     . PRO A 1 146 ? -9.817  -5.300  6.236   1.00 16.97 ? 357 PRO A N     1 
ATOM   1074 C CA    . PRO A 1 146 ? -8.361  -5.401  6.039   1.00 16.76 ? 357 PRO A CA    1 
ATOM   1075 C C     . PRO A 1 146 ? -7.533  -5.017  7.259   1.00 16.16 ? 357 PRO A C     1 
ATOM   1076 O O     . PRO A 1 146 ? -6.547  -5.686  7.570   1.00 16.54 ? 357 PRO A O     1 
ATOM   1077 C CB    . PRO A 1 146 ? -8.107  -4.425  4.880   1.00 16.58 ? 357 PRO A CB    1 
ATOM   1078 C CG    . PRO A 1 146 ? -9.354  -4.504  4.071   1.00 17.68 ? 357 PRO A CG    1 
ATOM   1079 C CD    . PRO A 1 146 ? -10.467 -4.615  5.095   1.00 16.79 ? 357 PRO A CD    1 
ATOM   1080 N N     . LEU A 1 147 ? -7.941  -3.986  7.979   1.00 16.20 ? 358 LEU A N     1 
ATOM   1081 C CA    . LEU A 1 147 ? -7.215  -3.610  9.196   1.00 15.99 ? 358 LEU A CA    1 
ATOM   1082 C C     . LEU A 1 147 ? -7.205  -4.696  10.253  1.00 16.19 ? 358 LEU A C     1 
ATOM   1083 O O     . LEU A 1 147 ? -6.153  -4.901  10.885  1.00 15.80 ? 358 LEU A O     1 
ATOM   1084 C CB    . LEU A 1 147 ? -7.715  -2.296  9.774   1.00 15.74 ? 358 LEU A CB    1 
ATOM   1085 C CG    . LEU A 1 147 ? -7.603  -1.142  8.773   1.00 16.91 ? 358 LEU A CG    1 
ATOM   1086 C CD1   . LEU A 1 147 ? -8.170  0.131   9.365   1.00 14.91 ? 358 LEU A CD1   1 
ATOM   1087 C CD2   . LEU A 1 147 ? -6.164  -0.938  8.290   1.00 18.03 ? 358 LEU A CD2   1 
ATOM   1088 N N     . ASP A 1 148 ? -8.339  -5.405  10.439  1.00 16.07 ? 359 ASP A N     1 
ATOM   1089 C CA    . ASP A 1 148 ? -8.397  -6.561  11.354  1.00 16.36 ? 359 ASP A CA    1 
ATOM   1090 C C     . ASP A 1 148 ? -7.478  -7.670  10.890  1.00 15.42 ? 359 ASP A C     1 
ATOM   1091 O O     . ASP A 1 148 ? -6.880  -8.361  11.701  1.00 15.57 ? 359 ASP A O     1 
ATOM   1092 C CB    . ASP A 1 148 ? -9.818  -7.184  11.473  1.00 17.14 ? 359 ASP A CB    1 
ATOM   1093 C CG    . ASP A 1 148 ? -10.801 -6.337  12.286  1.00 19.86 ? 359 ASP A CG    1 
ATOM   1094 O OD1   . ASP A 1 148 ? -10.441 -5.734  13.325  1.00 24.22 ? 359 ASP A OD1   1 
ATOM   1095 O OD2   . ASP A 1 148 ? -11.977 -6.287  11.887  1.00 23.28 ? 359 ASP A OD2   1 
ATOM   1096 N N     . GLN A 1 149 ? -7.419  -7.889  9.580   1.00 15.57 ? 360 GLN A N     1 
ATOM   1097 C CA    . GLN A 1 149 ? -6.518  -8.886  9.029   1.00 15.03 ? 360 GLN A CA    1 
ATOM   1098 C C     . GLN A 1 149 ? -5.062  -8.483  9.351   1.00 14.47 ? 360 GLN A C     1 
ATOM   1099 O O     . GLN A 1 149 ? -4.278  -9.291  9.869   1.00 13.78 ? 360 GLN A O     1 
ATOM   1100 C CB    . GLN A 1 149 ? -6.713  -9.024  7.516   1.00 15.95 ? 360 GLN A CB    1 
ATOM   1101 C CG    . GLN A 1 149 ? -8.035  -9.677  7.081   1.00 15.58 ? 360 GLN A CG    1 
ATOM   1102 C CD    . GLN A 1 149 ? -8.182  -9.721  5.581   1.00 16.79 ? 360 GLN A CD    1 
ATOM   1103 O OE1   . GLN A 1 149 ? -7.363  -10.347 4.890   1.00 15.85 ? 360 GLN A OE1   1 
ATOM   1104 N NE2   . GLN A 1 149 ? -9.201  -9.029  5.054   1.00 17.34 ? 360 GLN A NE2   1 
ATOM   1105 N N     . HIS A 1 150 ? -4.703  -7.233  9.089   1.00 13.78 ? 361 HIS A N     1 
ATOM   1106 C CA    . HIS A 1 150 ? -3.328  -6.783  9.434   1.00 13.46 ? 361 HIS A CA    1 
ATOM   1107 C C     . HIS A 1 150 ? -3.027  -6.970  10.918  1.00 13.76 ? 361 HIS A C     1 
ATOM   1108 O O     . HIS A 1 150 ? -2.002  -7.519  11.274  1.00 14.03 ? 361 HIS A O     1 
ATOM   1109 C CB    . HIS A 1 150 ? -3.072  -5.322  9.075   1.00 12.88 ? 361 HIS A CB    1 
ATOM   1110 C CG    . HIS A 1 150 ? -3.416  -4.955  7.668   1.00 10.58 ? 361 HIS A CG    1 
ATOM   1111 N ND1   . HIS A 1 150 ? -3.524  -5.875  6.655   1.00 10.74 ? 361 HIS A ND1   1 
ATOM   1112 C CD2   . HIS A 1 150 ? -3.647  -3.744  7.104   1.00 11.21 ? 361 HIS A CD2   1 
ATOM   1113 C CE1   . HIS A 1 150 ? -3.835  -5.251  5.532   1.00 11.32 ? 361 HIS A CE1   1 
ATOM   1114 N NE2   . HIS A 1 150 ? -3.910  -3.957  5.780   1.00 10.41 ? 361 HIS A NE2   1 
ATOM   1115 N N     . TYR A 1 151 ? -3.936  -6.505  11.773  1.00 14.73 ? 362 TYR A N     1 
ATOM   1116 C CA    . TYR A 1 151 ? -3.748  -6.517  13.220  1.00 15.26 ? 362 TYR A CA    1 
ATOM   1117 C C     . TYR A 1 151 ? -3.509  -7.910  13.763  1.00 15.30 ? 362 TYR A C     1 
ATOM   1118 O O     . TYR A 1 151 ? -2.549  -8.133  14.512  1.00 14.52 ? 362 TYR A O     1 
ATOM   1119 C CB    . TYR A 1 151 ? -4.959  -5.857  13.885  1.00 15.72 ? 362 TYR A CB    1 
ATOM   1120 C CG    . TYR A 1 151 ? -4.916  -5.800  15.374  1.00 17.69 ? 362 TYR A CG    1 
ATOM   1121 C CD1   . TYR A 1 151 ? -3.873  -5.179  16.032  1.00 17.99 ? 362 TYR A CD1   1 
ATOM   1122 C CD2   . TYR A 1 151 ? -5.942  -6.353  16.147  1.00 18.70 ? 362 TYR A CD2   1 
ATOM   1123 C CE1   . TYR A 1 151 ? -3.831  -5.117  17.414  1.00 18.79 ? 362 TYR A CE1   1 
ATOM   1124 C CE2   . TYR A 1 151 ? -5.910  -6.287  17.542  1.00 19.13 ? 362 TYR A CE2   1 
ATOM   1125 C CZ    . TYR A 1 151 ? -4.846  -5.674  18.167  1.00 17.83 ? 362 TYR A CZ    1 
ATOM   1126 O OH    . TYR A 1 151 ? -4.775  -5.600  19.543  1.00 13.61 ? 362 TYR A OH    1 
ATOM   1127 N N     . ARG A 1 152 ? -4.371  -8.852  13.379  1.00 15.46 ? 363 ARG A N     1 
ATOM   1128 C CA    . ARG A 1 152 ? -4.215  -10.271 13.758  1.00 16.02 ? 363 ARG A CA    1 
ATOM   1129 C C     . ARG A 1 152 ? -2.854  -10.846 13.388  1.00 15.16 ? 363 ARG A C     1 
ATOM   1130 O O     . ARG A 1 152 ? -2.252  -11.583 14.189  1.00 14.36 ? 363 ARG A O     1 
ATOM   1131 C CB    . ARG A 1 152 ? -5.319  -11.149 13.123  1.00 17.07 ? 363 ARG A CB    1 
ATOM   1132 C CG    . ARG A 1 152 ? -5.323  -12.646 13.616  1.00 22.01 ? 363 ARG A CG    1 
ATOM   1133 C CD    . ARG A 1 152 ? -6.404  -13.501 12.913  1.00 25.84 ? 363 ARG A CD    1 
ATOM   1134 N NE    . ARG A 1 152 ? -6.051  -13.712 11.501  1.00 29.88 ? 363 ARG A NE    1 
ATOM   1135 C CZ    . ARG A 1 152 ? -6.713  -13.213 10.460  1.00 32.93 ? 363 ARG A CZ    1 
ATOM   1136 N NH1   . ARG A 1 152 ? -7.797  -12.488 10.630  1.00 34.98 ? 363 ARG A NH1   1 
ATOM   1137 N NH2   . ARG A 1 152 ? -6.297  -13.454 9.222   1.00 35.84 ? 363 ARG A NH2   1 
ATOM   1138 N N     . ASN A 1 153 ? -2.361  -10.516 12.188  1.00 14.85 ? 364 ASN A N     1 
ATOM   1139 C CA    . ASN A 1 153 ? -1.068  -11.007 11.719  1.00 14.72 ? 364 ASN A CA    1 
ATOM   1140 C C     . ASN A 1 153 ? 0.090   -10.448 12.512  1.00 14.12 ? 364 ASN A C     1 
ATOM   1141 O O     . ASN A 1 153 ? 1.198   -10.974 12.448  1.00 14.33 ? 364 ASN A O     1 
ATOM   1142 C CB    . ASN A 1 153 ? -0.854  -10.688 10.229  1.00 15.66 ? 364 ASN A CB    1 
ATOM   1143 C CG    . ASN A 1 153 ? -1.720  -11.521 9.319   1.00 18.05 ? 364 ASN A CG    1 
ATOM   1144 O OD1   . ASN A 1 153 ? -2.297  -12.506 9.747   1.00 21.56 ? 364 ASN A OD1   1 
ATOM   1145 N ND2   . ASN A 1 153 ? -1.794  -11.143 8.038   1.00 22.54 ? 364 ASN A ND2   1 
ATOM   1146 N N     . LEU A 1 154 ? -0.142  -9.388  13.275  1.00 13.27 ? 365 LEU A N     1 
ATOM   1147 C CA    . LEU A 1 154 ? 0.918   -8.897  14.164  1.00 12.43 ? 365 LEU A CA    1 
ATOM   1148 C C     . LEU A 1 154 ? 1.179   -9.852  15.315  1.00 12.77 ? 365 LEU A C     1 
ATOM   1149 O O     . LEU A 1 154 ? 2.289   -9.890  15.820  1.00 12.17 ? 365 LEU A O     1 
ATOM   1150 C CB    . LEU A 1 154 ? 0.608   -7.494  14.724  1.00 11.01 ? 365 LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 154 ? 0.489   -6.316  13.746  1.00 11.58 ? 365 LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 154 ? 0.197   -4.932  14.462  1.00 8.78  ? 365 LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 154 ? 1.752   -6.195  12.876  1.00 9.31  ? 365 LEU A CD2   1 
ATOM   1154 N N     . HIS A 1 155 ? 0.157   -10.596 15.751  1.00 13.01 ? 366 HIS A N     1 
ATOM   1155 C CA    . HIS A 1 155 ? 0.282   -11.432 16.939  1.00 13.44 ? 366 HIS A CA    1 
ATOM   1156 C C     . HIS A 1 155 ? 0.778   -10.602 18.097  1.00 12.86 ? 366 HIS A C     1 
ATOM   1157 O O     . HIS A 1 155 ? 1.715   -10.990 18.818  1.00 11.57 ? 366 HIS A O     1 
ATOM   1158 C CB    . HIS A 1 155 ? 1.179   -12.646 16.648  1.00 14.93 ? 366 HIS A CB    1 
ATOM   1159 C CG    . HIS A 1 155 ? 0.530   -13.603 15.714  1.00 19.08 ? 366 HIS A CG    1 
ATOM   1160 N ND1   . HIS A 1 155 ? 0.884   -13.703 14.386  1.00 25.55 ? 366 HIS A ND1   1 
ATOM   1161 C CD2   . HIS A 1 155 ? -0.537  -14.421 15.883  1.00 24.26 ? 366 HIS A CD2   1 
ATOM   1162 C CE1   . HIS A 1 155 ? 0.101   -14.591 13.789  1.00 25.00 ? 366 HIS A CE1   1 
ATOM   1163 N NE2   . HIS A 1 155 ? -0.772  -15.036 14.674  1.00 24.30 ? 366 HIS A NE2   1 
ATOM   1164 N N     . CYS A 1 156 ? 0.119   -9.449  18.262  1.00 12.32 ? 367 CYS A N     1 
ATOM   1165 C CA    . CYS A 1 156 ? 0.525   -8.426  19.233  1.00 12.75 ? 367 CYS A CA    1 
ATOM   1166 C C     . CYS A 1 156 ? -0.659  -7.536  19.569  1.00 13.44 ? 367 CYS A C     1 
ATOM   1167 O O     . CYS A 1 156 ? -1.214  -6.844  18.689  1.00 14.50 ? 367 CYS A O     1 
ATOM   1168 C CB    . CYS A 1 156 ? 1.678   -7.588  18.639  1.00 12.67 ? 367 CYS A CB    1 
ATOM   1169 S SG    . CYS A 1 156 ? 2.458   -6.509  19.860  1.00 12.98 ? 367 CYS A SG    1 
ATOM   1170 N N     . ALA A 1 157 ? -1.077  -7.575  20.835  1.00 13.98 ? 368 ALA A N     1 
ATOM   1171 C CA    . ALA A 1 157 ? -2.151  -6.737  21.313  1.00 13.29 ? 368 ALA A CA    1 
ATOM   1172 C C     . ALA A 1 157 ? -1.680  -5.285  21.392  1.00 13.05 ? 368 ALA A C     1 
ATOM   1173 O O     . ALA A 1 157 ? -0.598  -5.020  21.863  1.00 13.02 ? 368 ALA A O     1 
ATOM   1174 C CB    . ALA A 1 157 ? -2.609  -7.211  22.702  1.00 13.35 ? 368 ALA A CB    1 
ATOM   1175 N N     . LEU A 1 158 ? -2.515  -4.376  20.917  1.00 11.92 ? 369 LEU A N     1 
ATOM   1176 C CA    . LEU A 1 158 ? -2.329  -2.943  21.038  1.00 12.65 ? 369 LEU A CA    1 
ATOM   1177 C C     . LEU A 1 158 ? -3.639  -2.366  21.611  1.00 13.35 ? 369 LEU A C     1 
ATOM   1178 O O     . LEU A 1 158 ? -4.684  -2.415  20.938  1.00 13.81 ? 369 LEU A O     1 
ATOM   1179 C CB    . LEU A 1 158 ? -2.050  -2.347  19.662  1.00 11.89 ? 369 LEU A CB    1 
ATOM   1180 C CG    . LEU A 1 158 ? -0.818  -2.905  18.943  1.00 10.97 ? 369 LEU A CG    1 
ATOM   1181 C CD1   . LEU A 1 158 ? -0.783  -2.526  17.461  1.00 12.77 ? 369 LEU A CD1   1 
ATOM   1182 C CD2   . LEU A 1 158 ? 0.448   -2.473  19.661  1.00 11.34 ? 369 LEU A CD2   1 
ATOM   1183 N N     . ARG A 1 159 ? -3.580  -1.830  22.834  1.00 13.94 ? 370 ARG A N     1 
ATOM   1184 C CA    . ARG A 1 159 ? -4.774  -1.305  23.520  1.00 14.79 ? 370 ARG A CA    1 
ATOM   1185 C C     . ARG A 1 159 ? -4.600  0.165   23.890  1.00 15.05 ? 370 ARG A C     1 
ATOM   1186 O O     . ARG A 1 159 ? -3.700  0.509   24.649  1.00 14.51 ? 370 ARG A O     1 
ATOM   1187 C CB    . ARG A 1 159 ? -5.066  -2.102  24.782  1.00 15.17 ? 370 ARG A CB    1 
ATOM   1188 C CG    . ARG A 1 159 ? -5.198  -3.557  24.524  1.00 17.09 ? 370 ARG A CG    1 
ATOM   1189 C CD    . ARG A 1 159 ? -5.435  -4.341  25.769  1.00 17.19 ? 370 ARG A CD    1 
ATOM   1190 N NE    . ARG A 1 159 ? -5.339  -5.773  25.463  1.00 20.10 ? 370 ARG A NE    1 
ATOM   1191 C CZ    . ARG A 1 159 ? -4.365  -6.573  25.869  1.00 20.61 ? 370 ARG A CZ    1 
ATOM   1192 N NH1   . ARG A 1 159 ? -3.388  -6.127  26.637  1.00 20.10 ? 370 ARG A NH1   1 
ATOM   1193 N NH2   . ARG A 1 159 ? -4.386  -7.843  25.520  1.00 24.84 ? 370 ARG A NH2   1 
ATOM   1194 N N     . PRO A 1 160 ? -5.471  1.035   23.373  1.00 15.49 ? 371 PRO A N     1 
ATOM   1195 C CA    . PRO A 1 160 ? -5.307  2.447   23.713  1.00 15.99 ? 371 PRO A CA    1 
ATOM   1196 C C     . PRO A 1 160 ? -5.515  2.717   25.192  1.00 16.57 ? 371 PRO A C     1 
ATOM   1197 O O     . PRO A 1 160 ? -6.414  2.146   25.795  1.00 17.09 ? 371 PRO A O     1 
ATOM   1198 C CB    . PRO A 1 160 ? -6.389  3.153   22.906  1.00 16.09 ? 371 PRO A CB    1 
ATOM   1199 C CG    . PRO A 1 160 ? -7.161  2.119   22.189  1.00 16.41 ? 371 PRO A CG    1 
ATOM   1200 C CD    . PRO A 1 160 ? -6.683  0.764   22.583  1.00 16.28 ? 371 PRO A CD    1 
ATOM   1201 N N     . LEU A 1 161 ? -4.696  3.586   25.752  1.00 17.09 ? 372 LEU A N     1 
ATOM   1202 C CA    . LEU A 1 161 ? -4.783  3.951   27.166  1.00 18.29 ? 372 LEU A CA    1 
ATOM   1203 C C     . LEU A 1 161 ? -5.456  5.302   27.368  1.00 18.43 ? 372 LEU A C     1 
ATOM   1204 O O     . LEU A 1 161 ? -5.418  6.176   26.516  1.00 19.94 ? 372 LEU A O     1 
ATOM   1205 C CB    . LEU A 1 161 ? -3.396  3.960   27.816  1.00 17.26 ? 372 LEU A CB    1 
ATOM   1206 C CG    . LEU A 1 161 ? -2.771  2.588   28.003  1.00 18.61 ? 372 LEU A CG    1 
ATOM   1207 C CD1   . LEU A 1 161 ? -1.435  2.777   28.751  1.00 17.37 ? 372 LEU A CD1   1 
ATOM   1208 C CD2   . LEU A 1 161 ? -3.703  1.618   28.779  1.00 19.28 ? 372 LEU A CD2   1 
ATOM   1209 N N     . ASP A 1 162 ? -6.081  5.455   28.510  1.00 19.41 ? 373 ASP A N     1 
ATOM   1210 C CA    . ASP A 1 162 ? -6.807  6.674   28.843  1.00 19.71 ? 373 ASP A CA    1 
ATOM   1211 C C     . ASP A 1 162 ? -5.798  7.764   29.138  1.00 19.08 ? 373 ASP A C     1 
ATOM   1212 O O     . ASP A 1 162 ? -4.921  7.562   29.983  1.00 17.46 ? 373 ASP A O     1 
ATOM   1213 C CB    . ASP A 1 162 ? -7.634  6.375   30.083  1.00 21.10 ? 373 ASP A CB    1 
ATOM   1214 C CG    . ASP A 1 162 ? -8.540  7.511   30.481  1.00 24.23 ? 373 ASP A CG    1 
ATOM   1215 O OD1   . ASP A 1 162 ? -8.290  8.680   30.116  1.00 27.41 ? 373 ASP A OD1   1 
ATOM   1216 O OD2   . ASP A 1 162 ? -9.509  7.208   31.202  1.00 31.25 ? 373 ASP A OD2   1 
ATOM   1217 N N     . HIS A 1 163 ? -5.910  8.902   28.452  1.00 18.30 ? 374 HIS A N     1 
ATOM   1218 C CA    . HIS A 1 163 ? -5.031  10.045  28.684  1.00 19.48 ? 374 HIS A CA    1 
ATOM   1219 C C     . HIS A 1 163 ? -5.152  10.697  30.069  1.00 20.73 ? 374 HIS A C     1 
ATOM   1220 O O     . HIS A 1 163 ? -4.287  11.445  30.438  1.00 20.41 ? 374 HIS A O     1 
ATOM   1221 C CB    . HIS A 1 163 ? -5.260  11.132  27.634  1.00 19.89 ? 374 HIS A CB    1 
ATOM   1222 C CG    . HIS A 1 163 ? -4.835  10.743  26.253  1.00 20.39 ? 374 HIS A CG    1 
ATOM   1223 N ND1   . HIS A 1 163 ? -4.390  11.664  25.329  1.00 19.98 ? 374 HIS A ND1   1 
ATOM   1224 C CD2   . HIS A 1 163 ? -4.753  9.532   25.650  1.00 19.73 ? 374 HIS A CD2   1 
ATOM   1225 C CE1   . HIS A 1 163 ? -4.097  11.044  24.201  1.00 18.00 ? 374 HIS A CE1   1 
ATOM   1226 N NE2   . HIS A 1 163 ? -4.287  9.749   24.377  1.00 18.05 ? 374 HIS A NE2   1 
ATOM   1227 N N     . GLU A 1 164 ? -6.211  10.419  30.827  1.00 22.17 ? 375 GLU A N     1 
ATOM   1228 C CA    . GLU A 1 164 ? -6.298  10.874  32.222  1.00 23.31 ? 375 GLU A CA    1 
ATOM   1229 C C     . GLU A 1 164 ? -5.764  9.813   33.202  1.00 22.88 ? 375 GLU A C     1 
ATOM   1230 O O     . GLU A 1 164 ? -5.995  9.915   34.398  1.00 22.12 ? 375 GLU A O     1 
ATOM   1231 C CB    . GLU A 1 164 ? -7.757  11.196  32.608  1.00 24.53 ? 375 GLU A CB    1 
ATOM   1232 C CG    . GLU A 1 164 ? -8.473  12.195  31.733  1.00 28.14 ? 375 GLU A CG    1 
ATOM   1233 C CD    . GLU A 1 164 ? -9.790  12.704  32.398  1.00 34.08 ? 375 GLU A CD    1 
ATOM   1234 O OE1   . GLU A 1 164 ? -10.892 12.465  31.848  1.00 35.92 ? 375 GLU A OE1   1 
ATOM   1235 O OE2   . GLU A 1 164 ? -9.716  13.327  33.490  1.00 38.22 ? 375 GLU A OE2   1 
ATOM   1236 N N     . SER A 1 165 ? -5.065  8.784   32.713  1.00 21.79 ? 376 SER A N     1 
ATOM   1237 C CA    . SER A 1 165 ? -4.587  7.723   33.593  1.00 21.24 ? 376 SER A CA    1 
ATOM   1238 C C     . SER A 1 165 ? -3.208  8.031   34.177  1.00 20.46 ? 376 SER A C     1 
ATOM   1239 O O     . SER A 1 165 ? -2.419  8.757   33.585  1.00 20.41 ? 376 SER A O     1 
ATOM   1240 C CB    . SER A 1 165 ? -4.530  6.386   32.838  1.00 21.56 ? 376 SER A CB    1 
ATOM   1241 O OG    . SER A 1 165 ? -3.533  6.423   31.806  1.00 21.83 ? 376 SER A OG    1 
ATOM   1242 N N     . TYR A 1 166 ? -2.914  7.449   35.336  1.00 19.45 ? 377 TYR A N     1 
ATOM   1243 C CA    . TYR A 1 166 ? -1.577  7.548   35.937  1.00 19.06 ? 377 TYR A CA    1 
ATOM   1244 C C     . TYR A 1 166 ? -0.478  7.077   34.974  1.00 18.54 ? 377 TYR A C     1 
ATOM   1245 O O     . TYR A 1 166 ? 0.534   7.742   34.811  1.00 18.27 ? 377 TYR A O     1 
ATOM   1246 C CB    . TYR A 1 166 ? -1.528  6.773   37.272  1.00 18.66 ? 377 TYR A CB    1 
ATOM   1247 C CG    . TYR A 1 166 ? -0.144  6.728   37.879  1.00 17.72 ? 377 TYR A CG    1 
ATOM   1248 C CD1   . TYR A 1 166 ? 0.423   7.852   38.462  1.00 16.59 ? 377 TYR A CD1   1 
ATOM   1249 C CD2   . TYR A 1 166 ? 0.610   5.577   37.833  1.00 17.74 ? 377 TYR A CD2   1 
ATOM   1250 C CE1   . TYR A 1 166 ? 1.687   7.827   38.981  1.00 16.25 ? 377 TYR A CE1   1 
ATOM   1251 C CE2   . TYR A 1 166 ? 1.873   5.538   38.359  1.00 15.86 ? 377 TYR A CE2   1 
ATOM   1252 C CZ    . TYR A 1 166 ? 2.397   6.654   38.942  1.00 16.38 ? 377 TYR A CZ    1 
ATOM   1253 O OH    . TYR A 1 166 ? 3.659   6.607   39.434  1.00 14.85 ? 377 TYR A OH    1 
ATOM   1254 N N     . GLU A 1 167 ? -0.687  5.927   34.335  1.00 18.47 ? 378 GLU A N     1 
ATOM   1255 C CA    A GLU A 1 167 ? 0.270   5.391   33.354  0.50 18.50 ? 378 GLU A CA    1 
ATOM   1256 C CA    B GLU A 1 167 ? 0.270   5.399   33.340  0.50 18.17 ? 378 GLU A CA    1 
ATOM   1257 C C     . GLU A 1 167 ? 0.601   6.449   32.292  1.00 17.95 ? 378 GLU A C     1 
ATOM   1258 O O     . GLU A 1 167 ? 1.768   6.701   31.998  1.00 18.09 ? 378 GLU A O     1 
ATOM   1259 C CB    A GLU A 1 167 ? -0.276  4.115   32.686  0.50 18.60 ? 378 GLU A CB    1 
ATOM   1260 C CB    B GLU A 1 167 ? -0.289  4.169   32.621  0.50 18.02 ? 378 GLU A CB    1 
ATOM   1261 C CG    A GLU A 1 167 ? -0.385  2.877   33.585  0.50 20.10 ? 378 GLU A CG    1 
ATOM   1262 C CG    B GLU A 1 167 ? 0.129   2.841   33.172  0.50 18.05 ? 378 GLU A CG    1 
ATOM   1263 C CD    A GLU A 1 167 ? -1.537  2.938   34.590  0.50 22.15 ? 378 GLU A CD    1 
ATOM   1264 C CD    B GLU A 1 167 ? -0.556  1.713   32.433  0.50 17.77 ? 378 GLU A CD    1 
ATOM   1265 O OE1   A GLU A 1 167 ? -2.492  3.726   34.367  0.50 22.17 ? 378 GLU A OE1   1 
ATOM   1266 O OE1   B GLU A 1 167 ? -1.716  1.913   32.048  0.50 19.16 ? 378 GLU A OE1   1 
ATOM   1267 O OE2   A GLU A 1 167 ? -1.470  2.214   35.619  0.50 23.23 ? 378 GLU A OE2   1 
ATOM   1268 O OE2   B GLU A 1 167 ? 0.052   0.643   32.220  0.50 17.65 ? 378 GLU A OE2   1 
ATOM   1269 N N     . PHE A 1 168 ? -0.426  7.070   31.723  1.00 16.77 ? 379 PHE A N     1 
ATOM   1270 C CA    . PHE A 1 168 ? -0.210  8.124   30.741  1.00 17.08 ? 379 PHE A CA    1 
ATOM   1271 C C     . PHE A 1 168 ? 0.584   9.276   31.340  1.00 16.83 ? 379 PHE A C     1 
ATOM   1272 O O     . PHE A 1 168 ? 1.503   9.784   30.702  1.00 15.45 ? 379 PHE A O     1 
ATOM   1273 C CB    . PHE A 1 168 ? -1.524  8.618   30.156  1.00 17.46 ? 379 PHE A CB    1 
ATOM   1274 C CG    . PHE A 1 168 ? -1.367  9.564   28.991  1.00 18.23 ? 379 PHE A CG    1 
ATOM   1275 C CD1   . PHE A 1 168 ? -1.504  9.109   27.683  1.00 20.01 ? 379 PHE A CD1   1 
ATOM   1276 C CD2   . PHE A 1 168 ? -1.154  10.927  29.206  1.00 20.18 ? 379 PHE A CD2   1 
ATOM   1277 C CE1   . PHE A 1 168 ? -1.380  9.992   26.601  1.00 21.54 ? 379 PHE A CE1   1 
ATOM   1278 C CE2   . PHE A 1 168 ? -0.995  11.801  28.152  1.00 21.19 ? 379 PHE A CE2   1 
ATOM   1279 C CZ    . PHE A 1 168 ? -1.119  11.340  26.834  1.00 22.08 ? 379 PHE A CZ    1 
ATOM   1280 N N     . LYS A 1 169 ? 0.281   9.660   32.581  1.00 16.02 ? 380 LYS A N     1 
ATOM   1281 C CA    . LYS A 1 169 ? 1.020   10.768  33.179  1.00 16.76 ? 380 LYS A CA    1 
ATOM   1282 C C     . LYS A 1 169 ? 2.511   10.439  33.410  1.00 16.23 ? 380 LYS A C     1 
ATOM   1283 O O     . LYS A 1 169 ? 3.384   11.263  33.123  1.00 16.68 ? 380 LYS A O     1 
ATOM   1284 C CB    . LYS A 1 169 ? 0.333   11.223  34.484  1.00 17.94 ? 380 LYS A CB    1 
ATOM   1285 C CG    . LYS A 1 169 ? 1.152   12.237  35.335  1.00 19.24 ? 380 LYS A CG    1 
ATOM   1286 C CD    . LYS A 1 169 ? 1.987   11.462  36.406  1.00 22.67 ? 380 LYS A CD    1 
ATOM   1287 C CE    . LYS A 1 169 ? 2.186   12.213  37.695  1.00 21.20 ? 380 LYS A CE    1 
ATOM   1288 N NZ    . LYS A 1 169 ? 2.495   11.242  38.767  1.00 22.96 ? 380 LYS A NZ    1 
ATOM   1289 N N     . VAL A 1 170 ? 2.812   9.252   33.917  1.00 15.67 ? 381 VAL A N     1 
ATOM   1290 C CA    . VAL A 1 170 ? 4.198   8.882   34.218  1.00 16.19 ? 381 VAL A CA    1 
ATOM   1291 C C     . VAL A 1 170 ? 5.008   8.758   32.929  1.00 14.66 ? 381 VAL A C     1 
ATOM   1292 O O     . VAL A 1 170 ? 6.156   9.198   32.835  1.00 13.90 ? 381 VAL A O     1 
ATOM   1293 C CB    . VAL A 1 170 ? 4.296   7.518   34.983  1.00 16.35 ? 381 VAL A CB    1 
ATOM   1294 C CG1   . VAL A 1 170 ? 5.750   6.979   34.932  1.00 18.30 ? 381 VAL A CG1   1 
ATOM   1295 C CG2   . VAL A 1 170 ? 3.837   7.668   36.398  1.00 18.35 ? 381 VAL A CG2   1 
ATOM   1296 N N     . ILE A 1 171 ? 4.406   8.132   31.940  1.00 14.69 ? 382 ILE A N     1 
ATOM   1297 C CA    . ILE A 1 171 ? 5.050   7.996   30.633  1.00 14.19 ? 382 ILE A CA    1 
ATOM   1298 C C     . ILE A 1 171 ? 5.267   9.373   29.983  1.00 14.74 ? 382 ILE A C     1 
ATOM   1299 O O     . ILE A 1 171 ? 6.315   9.620   29.386  1.00 14.00 ? 382 ILE A O     1 
ATOM   1300 C CB    . ILE A 1 171 ? 4.255   7.032   29.755  1.00 14.18 ? 382 ILE A CB    1 
ATOM   1301 C CG1   . ILE A 1 171 ? 4.423   5.633   30.303  1.00 14.38 ? 382 ILE A CG1   1 
ATOM   1302 C CG2   . ILE A 1 171 ? 4.715   7.043   28.247  1.00 12.73 ? 382 ILE A CG2   1 
ATOM   1303 C CD1   . ILE A 1 171 ? 3.378   4.718   29.787  1.00 12.93 ? 382 ILE A CD1   1 
ATOM   1304 N N     . SER A 1 172 ? 4.303   10.284  30.116  1.00 15.55 ? 383 SER A N     1 
ATOM   1305 C CA    . SER A 1 172 ? 4.505   11.642  29.612  1.00 16.07 ? 383 SER A CA    1 
ATOM   1306 C C     . SER A 1 172 ? 5.654   12.316  30.322  1.00 14.88 ? 383 SER A C     1 
ATOM   1307 O O     . SER A 1 172 ? 6.443   12.978  29.688  1.00 13.68 ? 383 SER A O     1 
ATOM   1308 C CB    . SER A 1 172 ? 3.271   12.541  29.767  1.00 16.13 ? 383 SER A CB    1 
ATOM   1309 O OG    . SER A 1 172 ? 2.277   12.139  28.880  1.00 21.29 ? 383 SER A OG    1 
ATOM   1310 N N     . GLN A 1 173 ? 5.713   12.191  31.640  1.00 14.84 ? 384 GLN A N     1 
ATOM   1311 C CA    . GLN A 1 173 ? 6.855   12.726  32.384  1.00 15.70 ? 384 GLN A CA    1 
ATOM   1312 C C     . GLN A 1 173 ? 8.182   12.095  31.979  1.00 13.98 ? 384 GLN A C     1 
ATOM   1313 O O     . GLN A 1 173 ? 9.208   12.765  31.941  1.00 14.41 ? 384 GLN A O     1 
ATOM   1314 C CB    . GLN A 1 173 ? 6.670   12.573  33.900  1.00 16.14 ? 384 GLN A CB    1 
ATOM   1315 C CG    . GLN A 1 173 ? 6.109   13.835  34.527  1.00 21.59 ? 384 GLN A CG    1 
ATOM   1316 C CD    . GLN A 1 173 ? 5.722   13.647  35.978  1.00 26.42 ? 384 GLN A CD    1 
ATOM   1317 O OE1   . GLN A 1 173 ? 6.214   12.736  36.664  1.00 30.38 ? 384 GLN A OE1   1 
ATOM   1318 N NE2   . GLN A 1 173 ? 4.817   14.487  36.445  1.00 26.88 ? 384 GLN A NE2   1 
ATOM   1319 N N     . TYR A 1 174 ? 8.174   10.792  31.734  1.00 13.38 ? 385 TYR A N     1 
ATOM   1320 C CA    . TYR A 1 174 ? 9.397   10.099  31.320  1.00 12.58 ? 385 TYR A CA    1 
ATOM   1321 C C     . TYR A 1 174 ? 9.863   10.672  29.985  1.00 12.08 ? 385 TYR A C     1 
ATOM   1322 O O     . TYR A 1 174 ? 11.016  11.037  29.827  1.00 13.36 ? 385 TYR A O     1 
ATOM   1323 C CB    . TYR A 1 174 ? 9.122   8.596   31.259  1.00 13.02 ? 385 TYR A CB    1 
ATOM   1324 C CG    . TYR A 1 174 ? 10.315  7.663   31.032  1.00 11.87 ? 385 TYR A CG    1 
ATOM   1325 C CD1   . TYR A 1 174 ? 11.618  8.078   31.244  1.00 10.72 ? 385 TYR A CD1   1 
ATOM   1326 C CD2   . TYR A 1 174 ? 10.101  6.322   30.674  1.00 9.50  ? 385 TYR A CD2   1 
ATOM   1327 C CE1   . TYR A 1 174 ? 12.693  7.221   31.033  1.00 12.26 ? 385 TYR A CE1   1 
ATOM   1328 C CE2   . TYR A 1 174 ? 11.163  5.446   30.505  1.00 11.40 ? 385 TYR A CE2   1 
ATOM   1329 C CZ    . TYR A 1 174 ? 12.452  5.907   30.658  1.00 11.10 ? 385 TYR A CZ    1 
ATOM   1330 O OH    . TYR A 1 174 ? 13.502  5.064   30.466  1.00 14.18 ? 385 TYR A OH    1 
ATOM   1331 N N     . LEU A 1 175 ? 8.940   10.816  29.049  1.00 11.51 ? 386 LEU A N     1 
ATOM   1332 C CA    . LEU A 1 175 ? 9.231   11.371  27.738  1.00 12.39 ? 386 LEU A CA    1 
ATOM   1333 C C     . LEU A 1 175 ? 9.877   12.767  27.815  1.00 12.92 ? 386 LEU A C     1 
ATOM   1334 O O     . LEU A 1 175 ? 10.899  13.033  27.175  1.00 13.01 ? 386 LEU A O     1 
ATOM   1335 C CB    . LEU A 1 175 ? 7.913   11.447  26.922  1.00 12.32 ? 386 LEU A CB    1 
ATOM   1336 C CG    . LEU A 1 175 ? 7.974   12.027  25.514  1.00 10.72 ? 386 LEU A CG    1 
ATOM   1337 C CD1   . LEU A 1 175 ? 8.953   11.236  24.585  1.00 11.02 ? 386 LEU A CD1   1 
ATOM   1338 C CD2   . LEU A 1 175 ? 6.578   12.158  24.948  1.00 13.27 ? 386 LEU A CD2   1 
ATOM   1339 N N     . GLN A 1 176 ? 9.261   13.650  28.606  1.00 14.02 ? 387 GLN A N     1 
ATOM   1340 C CA    . GLN A 1 176 ? 9.680   15.056  28.653  1.00 14.59 ? 387 GLN A CA    1 
ATOM   1341 C C     . GLN A 1 176 ? 10.918  15.236  29.517  1.00 14.37 ? 387 GLN A C     1 
ATOM   1342 O O     . GLN A 1 176 ? 11.833  15.925  29.127  1.00 14.02 ? 387 GLN A O     1 
ATOM   1343 C CB    . GLN A 1 176 ? 8.530   15.956  29.144  1.00 15.64 ? 387 GLN A CB    1 
ATOM   1344 C CG    . GLN A 1 176 ? 7.260   15.950  28.258  1.00 18.41 ? 387 GLN A CG    1 
ATOM   1345 C CD    . GLN A 1 176 ? 7.510   16.339  26.810  1.00 20.00 ? 387 GLN A CD    1 
ATOM   1346 O OE1   . GLN A 1 176 ? 8.416   17.125  26.514  1.00 20.12 ? 387 GLN A OE1   1 
ATOM   1347 N NE2   . GLN A 1 176 ? 6.691   15.795  25.891  1.00 19.42 ? 387 GLN A NE2   1 
ATOM   1348 N N     . SER A 1 177 ? 10.938  14.598  30.677  1.00 14.83 ? 388 SER A N     1 
ATOM   1349 C CA    . SER A 1 177 ? 12.015  14.749  31.658  1.00 14.96 ? 388 SER A CA    1 
ATOM   1350 C C     . SER A 1 177 ? 13.355  14.155  31.195  1.00 15.47 ? 388 SER A C     1 
ATOM   1351 O O     . SER A 1 177 ? 14.405  14.617  31.634  1.00 15.69 ? 388 SER A O     1 
ATOM   1352 C CB    . SER A 1 177 ? 11.602  14.126  32.999  1.00 16.13 ? 388 SER A CB    1 
ATOM   1353 O OG    . SER A 1 177 ? 11.671  12.692  33.006  1.00 14.28 ? 388 SER A OG    1 
ATOM   1354 N N     . THR A 1 178 ? 13.315  13.179  30.274  1.00 14.39 ? 389 THR A N     1 
ATOM   1355 C CA    . THR A 1 178 ? 14.543  12.603  29.712  1.00 13.68 ? 389 THR A CA    1 
ATOM   1356 C C     . THR A 1 178 ? 14.820  13.035  28.264  1.00 14.26 ? 389 THR A C     1 
ATOM   1357 O O     . THR A 1 178 ? 15.652  12.434  27.571  1.00 13.20 ? 389 THR A O     1 
ATOM   1358 C CB    . THR A 1 178 ? 14.560  11.044  29.879  1.00 13.24 ? 389 THR A CB    1 
ATOM   1359 O OG1   . THR A 1 178 ? 13.525  10.427  29.077  1.00 13.19 ? 389 THR A OG1   1 
ATOM   1360 C CG2   . THR A 1 178 ? 14.349  10.697  31.330  1.00 11.93 ? 389 THR A CG2   1 
ATOM   1361 N N     . HIS A 1 179 ? 14.137  14.081  27.803  1.00 14.76 ? 390 HIS A N     1 
ATOM   1362 C CA    . HIS A 1 179 ? 14.521  14.681  26.551  1.00 15.65 ? 390 HIS A CA    1 
ATOM   1363 C C     . HIS A 1 179 ? 15.873  15.344  26.808  1.00 17.13 ? 390 HIS A C     1 
ATOM   1364 O O     . HIS A 1 179 ? 15.976  16.251  27.654  1.00 17.61 ? 390 HIS A O     1 
ATOM   1365 C CB    . HIS A 1 179 ? 13.489  15.699  26.090  1.00 16.20 ? 390 HIS A CB    1 
ATOM   1366 C CG    . HIS A 1 179 ? 13.694  16.152  24.692  1.00 14.62 ? 390 HIS A CG    1 
ATOM   1367 N ND1   . HIS A 1 179 ? 12.669  16.224  23.783  1.00 14.32 ? 390 HIS A ND1   1 
ATOM   1368 C CD2   . HIS A 1 179 ? 14.815  16.510  24.029  1.00 12.27 ? 390 HIS A CD2   1 
ATOM   1369 C CE1   . HIS A 1 179 ? 13.144  16.650  22.629  1.00 12.25 ? 390 HIS A CE1   1 
ATOM   1370 N NE2   . HIS A 1 179 ? 14.446  16.816  22.749  1.00 10.77 ? 390 HIS A NE2   1 
ATOM   1371 N N     . ALA A 1 180 ? 16.905  14.907  26.088  1.00 17.31 ? 391 ALA A N     1 
ATOM   1372 C CA    . ALA A 1 180 ? 18.275  15.354  26.366  1.00 18.41 ? 391 ALA A CA    1 
ATOM   1373 C C     . ALA A 1 180 ? 18.555  16.813  25.981  1.00 19.41 ? 391 ALA A C     1 
ATOM   1374 O O     . ALA A 1 180 ? 18.011  17.320  24.991  1.00 18.32 ? 391 ALA A O     1 
ATOM   1375 C CB    . ALA A 1 180 ? 19.273  14.456  25.677  1.00 18.03 ? 391 ALA A CB    1 
ATOM   1376 N N     . PRO A 1 181 ? 19.450  17.480  26.740  1.00 21.37 ? 392 PRO A N     1 
ATOM   1377 C CA    . PRO A 1 181 ? 19.786  18.883  26.405  1.00 22.08 ? 392 PRO A CA    1 
ATOM   1378 C C     . PRO A 1 181 ? 20.450  19.019  25.039  1.00 22.56 ? 392 PRO A C     1 
ATOM   1379 O O     . PRO A 1 181 ? 20.183  19.992  24.327  1.00 23.85 ? 392 PRO A O     1 
ATOM   1380 C CB    . PRO A 1 181 ? 20.730  19.329  27.560  1.00 22.58 ? 392 PRO A CB    1 
ATOM   1381 C CG    . PRO A 1 181 ? 21.263  18.046  28.146  1.00 21.99 ? 392 PRO A CG    1 
ATOM   1382 C CD    . PRO A 1 181 ? 20.108  17.042  27.991  1.00 21.29 ? 392 PRO A CD    1 
ATOM   1383 N N     . THR A 1 182 ? 21.257  18.049  24.619  1.00 22.71 ? 393 THR A N     1 
ATOM   1384 C CA    . THR A 1 182 ? 21.912  18.197  23.316  1.00 22.55 ? 393 THR A CA    1 
ATOM   1385 C C     . THR A 1 182 ? 20.995  17.871  22.127  1.00 21.57 ? 393 THR A C     1 
ATOM   1386 O O     . THR A 1 182 ? 21.383  18.083  20.991  1.00 22.05 ? 393 THR A O     1 
ATOM   1387 C CB    . THR A 1 182 ? 23.249  17.463  23.232  1.00 23.12 ? 393 THR A CB    1 
ATOM   1388 O OG1   . THR A 1 182 ? 23.093  16.134  23.709  1.00 24.86 ? 393 THR A OG1   1 
ATOM   1389 C CG2   . THR A 1 182 ? 24.344  18.190  24.102  1.00 24.35 ? 393 THR A CG2   1 
ATOM   1390 N N     . HIS A 1 183 ? 19.779  17.383  22.373  1.00 19.84 ? 394 HIS A N     1 
ATOM   1391 C CA    . HIS A 1 183 ? 18.838  17.094  21.273  1.00 17.98 ? 394 HIS A CA    1 
ATOM   1392 C C     . HIS A 1 183 ? 17.781  18.177  21.133  1.00 16.56 ? 394 HIS A C     1 
ATOM   1393 O O     . HIS A 1 183 ? 16.594  17.896  21.162  1.00 16.73 ? 394 HIS A O     1 
ATOM   1394 C CB    . HIS A 1 183 ? 18.224  15.701  21.481  1.00 17.99 ? 394 HIS A CB    1 
ATOM   1395 C CG    . HIS A 1 183 ? 19.258  14.626  21.625  1.00 15.87 ? 394 HIS A CG    1 
ATOM   1396 N ND1   . HIS A 1 183 ? 19.111  13.549  22.467  1.00 14.42 ? 394 HIS A ND1   1 
ATOM   1397 C CD2   . HIS A 1 183 ? 20.485  14.503  21.065  1.00 15.85 ? 394 HIS A CD2   1 
ATOM   1398 C CE1   . HIS A 1 183 ? 20.186  12.785  22.389  1.00 15.91 ? 394 HIS A CE1   1 
ATOM   1399 N NE2   . HIS A 1 183 ? 21.039  13.348  21.550  1.00 17.15 ? 394 HIS A NE2   1 
ATOM   1400 N N     . SER A 1 184 ? 18.228  19.424  20.974  1.00 15.82 ? 395 SER A N     1 
ATOM   1401 C CA    . SER A 1 184 ? 17.361  20.627  21.112  1.00 15.05 ? 395 SER A CA    1 
ATOM   1402 C C     . SER A 1 184 ? 16.724  21.108  19.816  1.00 15.15 ? 395 SER A C     1 
ATOM   1403 O O     . SER A 1 184 ? 16.051  22.167  19.773  1.00 14.95 ? 395 SER A O     1 
ATOM   1404 C CB    . SER A 1 184 ? 18.158  21.787  21.715  1.00 15.76 ? 395 SER A CB    1 
ATOM   1405 O OG    . SER A 1 184 ? 19.214  22.201  20.848  1.00 13.08 ? 395 SER A OG    1 
ATOM   1406 N N     . ASP A 1 185 ? 16.949  20.352  18.750  1.00 14.34 ? 396 ASP A N     1 
ATOM   1407 C CA    . ASP A 1 185 ? 16.380  20.668  17.448  1.00 14.15 ? 396 ASP A CA    1 
ATOM   1408 C C     . ASP A 1 185 ? 14.893  20.362  17.370  1.00 13.97 ? 396 ASP A C     1 
ATOM   1409 O O     . ASP A 1 185 ? 14.233  20.750  16.425  1.00 14.65 ? 396 ASP A O     1 
ATOM   1410 C CB    . ASP A 1 185 ? 17.204  19.990  16.325  1.00 14.94 ? 396 ASP A CB    1 
ATOM   1411 C CG    . ASP A 1 185 ? 17.305  18.457  16.478  1.00 17.44 ? 396 ASP A CG    1 
ATOM   1412 O OD1   . ASP A 1 185 ? 17.830  17.968  17.506  1.00 16.72 ? 396 ASP A OD1   1 
ATOM   1413 O OD2   . ASP A 1 185 ? 16.856  17.757  15.550  1.00 20.55 ? 396 ASP A OD2   1 
ATOM   1414 N N     . TYR A 1 186 ? 14.330  19.719  18.395  1.00 13.32 ? 397 TYR A N     1 
ATOM   1415 C CA    . TYR A 1 186 ? 12.895  19.488  18.448  1.00 13.32 ? 397 TYR A CA    1 
ATOM   1416 C C     . TYR A 1 186 ? 12.478  19.276  19.884  1.00 13.00 ? 397 TYR A C     1 
ATOM   1417 O O     . TYR A 1 186 ? 13.321  19.037  20.763  1.00 12.01 ? 397 TYR A O     1 
ATOM   1418 C CB    . TYR A 1 186 ? 12.457  18.258  17.586  1.00 13.76 ? 397 TYR A CB    1 
ATOM   1419 C CG    . TYR A 1 186 ? 13.083  16.977  18.077  1.00 13.49 ? 397 TYR A CG    1 
ATOM   1420 C CD1   . TYR A 1 186 ? 12.429  16.152  18.970  1.00 13.28 ? 397 TYR A CD1   1 
ATOM   1421 C CD2   . TYR A 1 186 ? 14.351  16.621  17.681  1.00 11.54 ? 397 TYR A CD2   1 
ATOM   1422 C CE1   . TYR A 1 186 ? 13.047  14.976  19.454  1.00 13.38 ? 397 TYR A CE1   1 
ATOM   1423 C CE2   . TYR A 1 186 ? 14.955  15.472  18.133  1.00 10.76 ? 397 TYR A CE2   1 
ATOM   1424 C CZ    . TYR A 1 186 ? 14.308  14.656  19.044  1.00 12.35 ? 397 TYR A CZ    1 
ATOM   1425 O OH    . TYR A 1 186 ? 14.940  13.502  19.514  1.00 12.72 ? 397 TYR A OH    1 
ATOM   1426 N N     . THR A 1 187 ? 11.177  19.437  20.094  1.00 12.65 ? 398 THR A N     1 
ATOM   1427 C CA    . THR A 1 187 ? 10.476  18.923  21.250  1.00 13.01 ? 398 THR A CA    1 
ATOM   1428 C C     . THR A 1 187 ? 9.468   17.882  20.755  1.00 13.23 ? 398 THR A C     1 
ATOM   1429 O O     . THR A 1 187 ? 9.175   17.789  19.556  1.00 12.83 ? 398 THR A O     1 
ATOM   1430 C CB    . THR A 1 187 ? 9.709   20.022  22.001  1.00 13.24 ? 398 THR A CB    1 
ATOM   1431 O OG1   . THR A 1 187 ? 8.717   20.575  21.130  1.00 13.08 ? 398 THR A OG1   1 
ATOM   1432 C CG2   . THR A 1 187 ? 10.667  21.134  22.539  1.00 13.77 ? 398 THR A CG2   1 
ATOM   1433 N N     . MET A 1 188 ? 8.909   17.131  21.693  1.00 13.29 ? 399 MET A N     1 
ATOM   1434 C CA    . MET A 1 188 ? 7.989   16.034  21.373  1.00 13.64 ? 399 MET A CA    1 
ATOM   1435 C C     . MET A 1 188 ? 6.643   16.246  22.072  1.00 13.51 ? 399 MET A C     1 
ATOM   1436 O O     . MET A 1 188 ? 6.601   16.699  23.225  1.00 13.28 ? 399 MET A O     1 
ATOM   1437 C CB    . MET A 1 188 ? 8.608   14.720  21.854  1.00 12.90 ? 399 MET A CB    1 
ATOM   1438 C CG    . MET A 1 188 ? 9.727   14.236  20.972  1.00 15.27 ? 399 MET A CG    1 
ATOM   1439 S SD    . MET A 1 188 ? 10.514  12.684  21.452  1.00 14.03 ? 399 MET A SD    1 
ATOM   1440 C CE    . MET A 1 188 ? 11.222  13.195  23.010  1.00 12.58 ? 399 MET A CE    1 
ATOM   1441 N N     . THR A 1 189 ? 5.558   15.896  21.389  1.00 13.96 ? 400 THR A N     1 
ATOM   1442 C CA    . THR A 1 189 ? 4.211   15.989  21.972  1.00 14.58 ? 400 THR A CA    1 
ATOM   1443 C C     . THR A 1 189 ? 3.597   14.602  21.883  1.00 14.25 ? 400 THR A C     1 
ATOM   1444 O O     . THR A 1 189 ? 3.540   14.046  20.801  1.00 14.71 ? 400 THR A O     1 
ATOM   1445 C CB    . THR A 1 189 ? 3.324   16.978  21.172  1.00 14.52 ? 400 THR A CB    1 
ATOM   1446 O OG1   . THR A 1 189 ? 3.936   18.257  21.211  1.00 15.40 ? 400 THR A OG1   1 
ATOM   1447 C CG2   . THR A 1 189 ? 1.884   17.081  21.771  1.00 15.23 ? 400 THR A CG2   1 
ATOM   1448 N N     . LEU A 1 190 ? 3.180   14.040  23.015  1.00 14.02 ? 401 LEU A N     1 
ATOM   1449 C CA    . LEU A 1 190 ? 2.625   12.723  23.034  1.00 13.99 ? 401 LEU A CA    1 
ATOM   1450 C C     . LEU A 1 190 ? 1.218   12.814  22.501  1.00 14.73 ? 401 LEU A C     1 
ATOM   1451 O O     . LEU A 1 190 ? 0.334   13.361  23.161  1.00 15.43 ? 401 LEU A O     1 
ATOM   1452 C CB    . LEU A 1 190 ? 2.636   12.154  24.446  1.00 14.38 ? 401 LEU A CB    1 
ATOM   1453 C CG    . LEU A 1 190 ? 2.206   10.694  24.613  1.00 12.99 ? 401 LEU A CG    1 
ATOM   1454 C CD1   . LEU A 1 190 ? 2.956   9.747   23.675  1.00 12.15 ? 401 LEU A CD1   1 
ATOM   1455 C CD2   . LEU A 1 190 ? 2.399   10.315  26.046  1.00 13.99 ? 401 LEU A CD2   1 
ATOM   1456 N N     . LEU A 1 191 ? 0.998   12.277  21.310  1.00 14.14 ? 402 LEU A N     1 
ATOM   1457 C CA    . LEU A 1 191 ? -0.339  12.250  20.716  1.00 13.98 ? 402 LEU A CA    1 
ATOM   1458 C C     . LEU A 1 191 ? -1.253  11.140  21.229  1.00 14.15 ? 402 LEU A C     1 
ATOM   1459 O O     . LEU A 1 191 ? -2.457  11.345  21.388  1.00 14.46 ? 402 LEU A O     1 
ATOM   1460 C CB    . LEU A 1 191 ? -0.219  12.109  19.201  1.00 13.90 ? 402 LEU A CB    1 
ATOM   1461 C CG    . LEU A 1 191 ? 0.392   13.275  18.434  1.00 16.00 ? 402 LEU A CG    1 
ATOM   1462 C CD1   . LEU A 1 191 ? 0.477   12.891  16.930  1.00 15.11 ? 402 LEU A CD1   1 
ATOM   1463 C CD2   . LEU A 1 191 ? -0.391  14.610  18.655  1.00 15.69 ? 402 LEU A CD2   1 
ATOM   1464 N N     . ASP A 1 192 ? -0.710  9.947   21.423  1.00 13.56 ? 403 ASP A N     1 
ATOM   1465 C CA    . ASP A 1 192 ? -1.499  8.824   21.943  1.00 13.63 ? 403 ASP A CA    1 
ATOM   1466 C C     . ASP A 1 192 ? -0.559  7.758   22.524  1.00 12.62 ? 403 ASP A C     1 
ATOM   1467 O O     . ASP A 1 192 ? 0.657   7.824   22.342  1.00 12.55 ? 403 ASP A O     1 
ATOM   1468 C CB    . ASP A 1 192 ? -2.404  8.258   20.857  1.00 13.60 ? 403 ASP A CB    1 
ATOM   1469 C CG    . ASP A 1 192 ? -3.738  7.774   21.389  1.00 15.91 ? 403 ASP A CG    1 
ATOM   1470 O OD1   . ASP A 1 192 ? -3.859  7.556   22.630  1.00 16.08 ? 403 ASP A OD1   1 
ATOM   1471 O OD2   . ASP A 1 192 ? -4.657  7.564   20.541  1.00 14.62 ? 403 ASP A OD2   1 
ATOM   1472 N N     . LEU A 1 193 ? -1.126  6.808   23.254  1.00 12.47 ? 404 LEU A N     1 
ATOM   1473 C CA    . LEU A 1 193 ? -0.360  5.830   23.993  1.00 12.04 ? 404 LEU A CA    1 
ATOM   1474 C C     . LEU A 1 193 ? -1.096  4.501   23.939  1.00 12.83 ? 404 LEU A C     1 
ATOM   1475 O O     . LEU A 1 193 ? -2.314  4.423   24.229  1.00 12.38 ? 404 LEU A O     1 
ATOM   1476 C CB    . LEU A 1 193 ? -0.200  6.251   25.446  1.00 11.85 ? 404 LEU A CB    1 
ATOM   1477 C CG    . LEU A 1 193 ? 0.620   5.324   26.341  1.00 11.38 ? 404 LEU A CG    1 
ATOM   1478 C CD1   . LEU A 1 193 ? 2.051   5.228   25.842  1.00 8.74  ? 404 LEU A CD1   1 
ATOM   1479 C CD2   . LEU A 1 193 ? 0.555   5.823   27.811  1.00 12.20 ? 404 LEU A CD2   1 
ATOM   1480 N N     . PHE A 1 194 ? -0.367  3.452   23.582  1.00 11.40 ? 405 PHE A N     1 
ATOM   1481 C CA    . PHE A 1 194 ? -0.959  2.108   23.525  1.00 11.10 ? 405 PHE A CA    1 
ATOM   1482 C C     . PHE A 1 194 ? -0.183  1.166   24.408  1.00 10.95 ? 405 PHE A C     1 
ATOM   1483 O O     . PHE A 1 194 ? 1.027   1.203   24.432  1.00 10.32 ? 405 PHE A O     1 
ATOM   1484 C CB    . PHE A 1 194 ? -0.911  1.563   22.099  1.00 10.80 ? 405 PHE A CB    1 
ATOM   1485 C CG    . PHE A 1 194 ? -1.590  2.433   21.121  1.00 10.13 ? 405 PHE A CG    1 
ATOM   1486 C CD1   . PHE A 1 194 ? -2.901  2.161   20.718  1.00 10.46 ? 405 PHE A CD1   1 
ATOM   1487 C CD2   . PHE A 1 194 ? -0.953  3.518   20.604  1.00 10.17 ? 405 PHE A CD2   1 
ATOM   1488 C CE1   . PHE A 1 194 ? -3.521  2.962   19.820  1.00 9.69  ? 405 PHE A CE1   1 
ATOM   1489 C CE2   . PHE A 1 194 ? -1.576  4.337   19.737  1.00 11.13 ? 405 PHE A CE2   1 
ATOM   1490 C CZ    . PHE A 1 194 ? -2.862  4.064   19.329  1.00 12.73 ? 405 PHE A CZ    1 
ATOM   1491 N N     . GLU A 1 195 ? -0.899  0.301   25.113  1.00 12.11 ? 406 GLU A N     1 
ATOM   1492 C CA    . GLU A 1 195 ? -0.290  -0.832  25.800  1.00 13.38 ? 406 GLU A CA    1 
ATOM   1493 C C     . GLU A 1 195 ? 0.070   -1.894  24.765  1.00 13.04 ? 406 GLU A C     1 
ATOM   1494 O O     . GLU A 1 195 ? -0.720  -2.149  23.863  1.00 13.59 ? 406 GLU A O     1 
ATOM   1495 C CB    . GLU A 1 195 ? -1.277  -1.385  26.838  1.00 14.08 ? 406 GLU A CB    1 
ATOM   1496 C CG    . GLU A 1 195 ? -1.060  -2.824  27.301  1.00 20.63 ? 406 GLU A CG    1 
ATOM   1497 C CD    . GLU A 1 195 ? -2.079  -3.254  28.386  1.00 26.91 ? 406 GLU A CD    1 
ATOM   1498 O OE1   . GLU A 1 195 ? -2.862  -4.193  28.117  1.00 31.55 ? 406 GLU A OE1   1 
ATOM   1499 O OE2   . GLU A 1 195 ? -2.110  -2.636  29.473  1.00 31.76 ? 406 GLU A OE2   1 
ATOM   1500 N N     . VAL A 1 196 ? 1.252   -2.505  24.895  1.00 12.58 ? 407 VAL A N     1 
ATOM   1501 C CA    . VAL A 1 196 ? 1.684   -3.559  23.983  1.00 12.38 ? 407 VAL A CA    1 
ATOM   1502 C C     . VAL A 1 196 ? 1.762   -4.883  24.742  1.00 12.78 ? 407 VAL A C     1 
ATOM   1503 O O     . VAL A 1 196 ? 2.398   -4.945  25.781  1.00 12.75 ? 407 VAL A O     1 
ATOM   1504 C CB    . VAL A 1 196 ? 3.062   -3.261  23.365  1.00 12.32 ? 407 VAL A CB    1 
ATOM   1505 C CG1   . VAL A 1 196 ? 3.489   -4.394  22.375  1.00 12.18 ? 407 VAL A CG1   1 
ATOM   1506 C CG2   . VAL A 1 196 ? 3.100   -1.865  22.688  1.00 11.39 ? 407 VAL A CG2   1 
ATOM   1507 N N     . GLU A 1 197 ? 1.128   -5.926  24.194  1.00 13.37 ? 408 GLU A N     1 
ATOM   1508 C CA    . GLU A 1 197 ? 1.236   -7.290  24.702  1.00 13.70 ? 408 GLU A CA    1 
ATOM   1509 C C     . GLU A 1 197 ? 1.484   -8.236  23.527  1.00 13.98 ? 408 GLU A C     1 
ATOM   1510 O O     . GLU A 1 197 ? 0.565   -8.658  22.800  1.00 12.71 ? 408 GLU A O     1 
ATOM   1511 C CB    . GLU A 1 197 ? -0.025  -7.678  25.487  1.00 14.47 ? 408 GLU A CB    1 
ATOM   1512 C CG    . GLU A 1 197 ? 0.052   -9.045  26.157  1.00 17.10 ? 408 GLU A CG    1 
ATOM   1513 C CD    . GLU A 1 197 ? -1.110  -9.324  27.140  1.00 21.70 ? 408 GLU A CD    1 
ATOM   1514 O OE1   . GLU A 1 197 ? -0.953  -10.251 27.968  1.00 23.94 ? 408 GLU A OE1   1 
ATOM   1515 O OE2   . GLU A 1 197 ? -2.150  -8.616  27.097  1.00 23.93 ? 408 GLU A OE2   1 
ATOM   1516 N N     . LYS A 1 198 ? 2.770   -8.473  23.288  1.00 13.79 ? 409 LYS A N     1 
ATOM   1517 C CA    . LYS A 1 198 ? 3.220   -9.331  22.227  1.00 13.78 ? 409 LYS A CA    1 
ATOM   1518 C C     . LYS A 1 198 ? 3.087   -10.819 22.660  1.00 13.41 ? 409 LYS A C     1 
ATOM   1519 O O     . LYS A 1 198 ? 3.627   -11.217 23.685  1.00 11.16 ? 409 LYS A O     1 
ATOM   1520 C CB    . LYS A 1 198 ? 4.682   -8.974  21.893  1.00 13.95 ? 409 LYS A CB    1 
ATOM   1521 C CG    . LYS A 1 198 ? 5.387   -9.902  20.919  1.00 16.21 ? 409 LYS A CG    1 
ATOM   1522 C CD    . LYS A 1 198 ? 4.835   -9.736  19.574  1.00 18.46 ? 409 LYS A CD    1 
ATOM   1523 C CE    . LYS A 1 198 ? 5.294   -10.794 18.636  1.00 17.69 ? 409 LYS A CE    1 
ATOM   1524 N NZ    . LYS A 1 198 ? 4.276   -10.849 17.540  1.00 18.22 ? 409 LYS A NZ    1 
ATOM   1525 N N     . ASP A 1 199 ? 2.369   -11.606 21.870  1.00 14.47 ? 410 ASP A N     1 
ATOM   1526 C CA    . ASP A 1 199 ? 2.156   -13.059 22.142  1.00 16.18 ? 410 ASP A CA    1 
ATOM   1527 C C     . ASP A 1 199 ? 3.468   -13.738 22.471  1.00 15.46 ? 410 ASP A C     1 
ATOM   1528 O O     . ASP A 1 199 ? 4.385   -13.657 21.691  1.00 15.22 ? 410 ASP A O     1 
ATOM   1529 C CB    . ASP A 1 199 ? 1.605   -13.794 20.896  1.00 16.51 ? 410 ASP A CB    1 
ATOM   1530 C CG    . ASP A 1 199 ? 0.201   -13.371 20.484  1.00 20.47 ? 410 ASP A CG    1 
ATOM   1531 O OD1   . ASP A 1 199 ? -0.392  -12.419 21.040  1.00 24.84 ? 410 ASP A OD1   1 
ATOM   1532 O OD2   . ASP A 1 199 ? -0.321  -14.006 19.525  1.00 27.68 ? 410 ASP A OD2   1 
ATOM   1533 N N     . GLY A 1 200 ? 3.580   -14.382 23.625  1.00 16.34 ? 411 GLY A N     1 
ATOM   1534 C CA    . GLY A 1 200 ? 4.781   -15.158 23.956  1.00 16.48 ? 411 GLY A CA    1 
ATOM   1535 C C     . GLY A 1 200 ? 5.810   -14.480 24.839  1.00 17.56 ? 411 GLY A C     1 
ATOM   1536 O O     . GLY A 1 200 ? 6.610   -15.144 25.517  1.00 16.14 ? 411 GLY A O     1 
ATOM   1537 N N     . GLU A 1 201 ? 5.801   -13.149 24.855  1.00 18.29 ? 412 GLU A N     1 
ATOM   1538 C CA    . GLU A 1 201 ? 6.841   -12.417 25.570  1.00 18.34 ? 412 GLU A CA    1 
ATOM   1539 C C     . GLU A 1 201 ? 6.748   -12.518 27.073  1.00 19.00 ? 412 GLU A C     1 
ATOM   1540 O O     . GLU A 1 201 ? 7.769   -12.525 27.751  1.00 18.66 ? 412 GLU A O     1 
ATOM   1541 C CB    . GLU A 1 201 ? 6.842   -10.938 25.166  1.00 18.19 ? 412 GLU A CB    1 
ATOM   1542 C CG    . GLU A 1 201 ? 7.580   -10.701 23.868  1.00 18.56 ? 412 GLU A CG    1 
ATOM   1543 C CD    . GLU A 1 201 ? 7.947   -9.230  23.614  1.00 18.10 ? 412 GLU A CD    1 
ATOM   1544 O OE1   . GLU A 1 201 ? 7.365   -8.341  24.250  1.00 14.66 ? 412 GLU A OE1   1 
ATOM   1545 O OE2   . GLU A 1 201 ? 8.807   -8.981  22.738  1.00 19.69 ? 412 GLU A OE2   1 
ATOM   1546 N N     . LYS A 1 202 ? 5.535   -12.552 27.601  1.00 20.25 ? 413 LYS A N     1 
ATOM   1547 C CA    . LYS A 1 202 ? 5.366   -12.579 29.041  1.00 21.92 ? 413 LYS A CA    1 
ATOM   1548 C C     . LYS A 1 202 ? 5.940   -13.878 29.607  1.00 21.84 ? 413 LYS A C     1 
ATOM   1549 O O     . LYS A 1 202 ? 6.629   -13.856 30.610  1.00 21.73 ? 413 LYS A O     1 
ATOM   1550 C CB    . LYS A 1 202 ? 3.902   -12.416 29.427  1.00 22.60 ? 413 LYS A CB    1 
ATOM   1551 C CG    . LYS A 1 202 ? 3.667   -12.459 30.917  1.00 26.75 ? 413 LYS A CG    1 
ATOM   1552 C CD    . LYS A 1 202 ? 2.228   -12.088 31.274  1.00 30.65 ? 413 LYS A CD    1 
ATOM   1553 C CE    . LYS A 1 202 ? 2.146   -11.600 32.722  1.00 33.07 ? 413 LYS A CE    1 
ATOM   1554 N NZ    . LYS A 1 202 ? 2.813   -12.561 33.659  1.00 36.70 ? 413 LYS A NZ    1 
ATOM   1555 N N     . GLU A 1 203 ? 5.676   -14.985 28.926  1.00 21.97 ? 414 GLU A N     1 
ATOM   1556 C CA    . GLU A 1 203 ? 6.171   -16.315 29.344  1.00 22.43 ? 414 GLU A CA    1 
ATOM   1557 C C     . GLU A 1 203 ? 7.681   -16.499 29.138  1.00 21.60 ? 414 GLU A C     1 
ATOM   1558 O O     . GLU A 1 203 ? 8.352   -17.136 29.940  1.00 21.73 ? 414 GLU A O     1 
ATOM   1559 C CB    . GLU A 1 203 ? 5.433   -17.397 28.554  1.00 23.40 ? 414 GLU A CB    1 
ATOM   1560 C CG    . GLU A 1 203 ? 3.915   -17.489 28.838  1.00 25.82 ? 414 GLU A CG    1 
ATOM   1561 C CD    . GLU A 1 203 ? 3.054   -16.291 28.312  1.00 30.30 ? 414 GLU A CD    1 
ATOM   1562 O OE1   . GLU A 1 203 ? 3.397   -15.626 27.284  1.00 27.43 ? 414 GLU A OE1   1 
ATOM   1563 O OE2   . GLU A 1 203 ? 2.026   -16.013 28.981  1.00 31.96 ? 414 GLU A OE2   1 
ATOM   1564 N N     . ALA A 1 204 ? 8.215   -15.922 28.065  1.00 19.70 ? 415 ALA A N     1 
ATOM   1565 C CA    . ALA A 1 204 ? 9.624   -16.041 27.748  1.00 18.56 ? 415 ALA A CA    1 
ATOM   1566 C C     . ALA A 1 204 ? 10.521  -15.159 28.613  1.00 17.50 ? 415 ALA A C     1 
ATOM   1567 O O     . ALA A 1 204 ? 11.703  -15.456 28.794  1.00 15.88 ? 415 ALA A O     1 
ATOM   1568 C CB    . ALA A 1 204 ? 9.845   -15.737 26.252  1.00 18.32 ? 415 ALA A CB    1 
ATOM   1569 N N     . PHE A 1 205 ? 9.958   -14.105 29.195  1.00 16.84 ? 416 PHE A N     1 
ATOM   1570 C CA    . PHE A 1 205 ? 10.755  -13.034 29.782  1.00 16.70 ? 416 PHE A CA    1 
ATOM   1571 C C     . PHE A 1 205 ? 11.578  -13.463 30.990  1.00 17.47 ? 416 PHE A C     1 
ATOM   1572 O O     . PHE A 1 205 ? 11.103  -14.228 31.821  1.00 18.04 ? 416 PHE A O     1 
ATOM   1573 C CB    . PHE A 1 205 ? 9.808   -11.899 30.156  1.00 16.80 ? 416 PHE A CB    1 
ATOM   1574 C CG    . PHE A 1 205 ? 10.476  -10.691 30.687  1.00 16.14 ? 416 PHE A CG    1 
ATOM   1575 C CD1   . PHE A 1 205 ? 11.304  -9.910  29.869  1.00 17.00 ? 416 PHE A CD1   1 
ATOM   1576 C CD2   . PHE A 1 205 ? 10.258  -10.290 31.984  1.00 17.13 ? 416 PHE A CD2   1 
ATOM   1577 C CE1   . PHE A 1 205 ? 11.907  -8.738  30.361  1.00 16.70 ? 416 PHE A CE1   1 
ATOM   1578 C CE2   . PHE A 1 205 ? 10.863  -9.121  32.479  1.00 18.27 ? 416 PHE A CE2   1 
ATOM   1579 C CZ    . PHE A 1 205 ? 11.669  -8.346  31.666  1.00 18.05 ? 416 PHE A CZ    1 
ATOM   1580 N N     . ARG A 1 206 ? 12.814  -12.989 31.075  1.00 17.30 ? 417 ARG A N     1 
ATOM   1581 C CA    . ARG A 1 206 ? 13.681  -13.241 32.247  1.00 18.56 ? 417 ARG A CA    1 
ATOM   1582 C C     . ARG A 1 206 ? 13.266  -12.432 33.488  1.00 18.61 ? 417 ARG A C     1 
ATOM   1583 O O     . ARG A 1 206 ? 13.985  -11.556 33.968  1.00 18.06 ? 417 ARG A O     1 
ATOM   1584 C CB    . ARG A 1 206 ? 15.167  -12.990 31.924  1.00 18.25 ? 417 ARG A CB    1 
ATOM   1585 C CG    . ARG A 1 206 ? 15.776  -13.836 30.765  1.00 19.83 ? 417 ARG A CG    1 
ATOM   1586 C CD    . ARG A 1 206 ? 15.917  -15.284 31.120  1.00 21.30 ? 417 ARG A CD    1 
ATOM   1587 N NE    . ARG A 1 206 ? 16.685  -15.465 32.345  1.00 22.88 ? 417 ARG A NE    1 
ATOM   1588 C CZ    . ARG A 1 206 ? 18.014  -15.528 32.421  1.00 23.22 ? 417 ARG A CZ    1 
ATOM   1589 N NH1   . ARG A 1 206 ? 18.778  -15.446 31.340  1.00 23.17 ? 417 ARG A NH1   1 
ATOM   1590 N NH2   . ARG A 1 206 ? 18.575  -15.702 33.601  1.00 23.75 ? 417 ARG A NH2   1 
ATOM   1591 N N     . GLU A 1 207 ? 12.120  -12.798 34.034  1.00 20.64 ? 418 GLU A N     1 
ATOM   1592 C CA    . GLU A 1 207 ? 11.608  -12.215 35.262  1.00 22.83 ? 418 GLU A CA    1 
ATOM   1593 C C     . GLU A 1 207 ? 12.548  -12.365 36.440  1.00 22.96 ? 418 GLU A C     1 
ATOM   1594 O O     . GLU A 1 207 ? 12.470  -11.593 37.375  1.00 23.49 ? 418 GLU A O     1 
ATOM   1595 C CB    . GLU A 1 207 ? 10.295  -12.890 35.656  1.00 23.79 ? 418 GLU A CB    1 
ATOM   1596 C CG    . GLU A 1 207 ? 9.082   -12.481 34.839  1.00 28.22 ? 418 GLU A CG    1 
ATOM   1597 C CD    . GLU A 1 207 ? 7.759   -12.906 35.512  1.00 34.76 ? 418 GLU A CD    1 
ATOM   1598 O OE1   . GLU A 1 207 ? 7.811   -13.744 36.448  1.00 36.34 ? 418 GLU A OE1   1 
ATOM   1599 O OE2   . GLU A 1 207 ? 6.679   -12.390 35.113  1.00 37.78 ? 418 GLU A OE2   1 
ATOM   1600 N N     . ASP A 1 208 ? 13.412  -13.372 36.401  1.00 23.12 ? 419 ASP A N     1 
ATOM   1601 C CA    . ASP A 1 208 ? 14.307  -13.680 37.508  1.00 23.39 ? 419 ASP A CA    1 
ATOM   1602 C C     . ASP A 1 208 ? 15.434  -12.677 37.651  1.00 22.87 ? 419 ASP A C     1 
ATOM   1603 O O     . ASP A 1 208 ? 15.991  -12.535 38.744  1.00 23.31 ? 419 ASP A O     1 
ATOM   1604 C CB    . ASP A 1 208 ? 14.901  -15.094 37.338  1.00 24.18 ? 419 ASP A CB    1 
ATOM   1605 C CG    . ASP A 1 208 ? 15.695  -15.259 36.022  1.00 25.80 ? 419 ASP A CG    1 
ATOM   1606 O OD1   . ASP A 1 208 ? 15.219  -14.806 34.948  1.00 25.37 ? 419 ASP A OD1   1 
ATOM   1607 O OD2   . ASP A 1 208 ? 16.795  -15.849 36.059  1.00 29.07 ? 419 ASP A OD2   1 
ATOM   1608 N N     . LEU A 1 209 ? 15.791  -11.984 36.566  1.00 21.12 ? 420 LEU A N     1 
ATOM   1609 C CA    . LEU A 1 209 ? 16.950  -11.122 36.603  1.00 20.37 ? 420 LEU A CA    1 
ATOM   1610 C C     . LEU A 1 209 ? 16.635  -9.848  37.344  1.00 20.39 ? 420 LEU A C     1 
ATOM   1611 O O     . LEU A 1 209 ? 15.522  -9.355  37.314  1.00 20.85 ? 420 LEU A O     1 
ATOM   1612 C CB    . LEU A 1 209 ? 17.448  -10.783 35.200  1.00 19.60 ? 420 LEU A CB    1 
ATOM   1613 C CG    . LEU A 1 209 ? 18.104  -11.941 34.447  1.00 19.62 ? 420 LEU A CG    1 
ATOM   1614 C CD1   . LEU A 1 209 ? 18.384  -11.542 32.968  1.00 14.65 ? 420 LEU A CD1   1 
ATOM   1615 C CD2   . LEU A 1 209 ? 19.408  -12.384 35.175  1.00 15.81 ? 420 LEU A CD2   1 
ATOM   1616 N N     . HIS A 1 210 ? 17.632  -9.317  38.014  1.00 20.34 ? 421 HIS A N     1 
ATOM   1617 C CA    . HIS A 1 210 ? 17.467  -8.072  38.748  1.00 21.65 ? 421 HIS A CA    1 
ATOM   1618 C C     . HIS A 1 210 ? 17.703  -6.898  37.781  1.00 20.83 ? 421 HIS A C     1 
ATOM   1619 O O     . HIS A 1 210 ? 18.028  -7.122  36.616  1.00 21.13 ? 421 HIS A O     1 
ATOM   1620 C CB    . HIS A 1 210 ? 18.466  -8.039  39.914  1.00 22.59 ? 421 HIS A CB    1 
ATOM   1621 C CG    . HIS A 1 210 ? 19.869  -8.398  39.511  1.00 25.18 ? 421 HIS A CG    1 
ATOM   1622 N ND1   . HIS A 1 210 ? 20.208  -9.636  39.001  1.00 28.85 ? 421 HIS A ND1   1 
ATOM   1623 C CD2   . HIS A 1 210 ? 21.016  -7.680  39.541  1.00 28.90 ? 421 HIS A CD2   1 
ATOM   1624 C CE1   . HIS A 1 210 ? 21.496  -9.660  38.722  1.00 29.99 ? 421 HIS A CE1   1 
ATOM   1625 N NE2   . HIS A 1 210 ? 22.016  -8.489  39.055  1.00 30.78 ? 421 HIS A NE2   1 
ATOM   1626 N N     . ASN A 1 211 ? 17.542  -5.666  38.268  1.00 20.09 ? 422 ASN A N     1 
ATOM   1627 C CA    A ASN A 1 211 ? 17.809  -4.478  37.465  0.50 19.88 ? 422 ASN A CA    1 
ATOM   1628 C CA    B ASN A 1 211 ? 17.764  -4.444  37.482  0.50 19.88 ? 422 ASN A CA    1 
ATOM   1629 C C     . ASN A 1 211 ? 16.889  -4.412  36.237  1.00 19.32 ? 422 ASN A C     1 
ATOM   1630 O O     . ASN A 1 211 ? 17.350  -4.181  35.119  1.00 19.30 ? 422 ASN A O     1 
ATOM   1631 C CB    A ASN A 1 211 ? 19.286  -4.475  37.048  0.50 20.20 ? 422 ASN A CB    1 
ATOM   1632 C CB    B ASN A 1 211 ? 19.236  -4.262  37.108  0.50 20.15 ? 422 ASN A CB    1 
ATOM   1633 C CG    A ASN A 1 211 ? 19.730  -3.161  36.460  0.50 20.23 ? 422 ASN A CG    1 
ATOM   1634 C CG    B ASN A 1 211 ? 20.130  -4.098  38.317  0.50 20.28 ? 422 ASN A CG    1 
ATOM   1635 O OD1   A ASN A 1 211 ? 19.032  -2.165  36.549  0.50 21.33 ? 422 ASN A OD1   1 
ATOM   1636 O OD1   B ASN A 1 211 ? 19.781  -3.409  39.272  0.50 20.55 ? 422 ASN A OD1   1 
ATOM   1637 N ND2   A ASN A 1 211 ? 20.906  -3.160  35.845  0.50 20.30 ? 422 ASN A ND2   1 
ATOM   1638 N ND2   B ASN A 1 211 ? 21.300  -4.721  38.271  0.50 20.27 ? 422 ASN A ND2   1 
ATOM   1639 N N     . ARG A 1 212 ? 15.596  -4.643  36.450  1.00 17.70 ? 423 ARG A N     1 
ATOM   1640 C CA    . ARG A 1 212 ? 14.622  -4.560  35.395  1.00 16.24 ? 423 ARG A CA    1 
ATOM   1641 C C     . ARG A 1 212 ? 14.183  -3.099  35.252  1.00 15.93 ? 423 ARG A C     1 
ATOM   1642 O O     . ARG A 1 212 ? 13.592  -2.528  36.190  1.00 15.87 ? 423 ARG A O     1 
ATOM   1643 C CB    . ARG A 1 212 ? 13.426  -5.430  35.719  1.00 15.80 ? 423 ARG A CB    1 
ATOM   1644 C CG    . ARG A 1 212 ? 12.439  -5.519  34.577  1.00 15.92 ? 423 ARG A CG    1 
ATOM   1645 C CD    . ARG A 1 212 ? 11.143  -6.192  35.006  1.00 16.97 ? 423 ARG A CD    1 
ATOM   1646 N NE    . ARG A 1 212 ? 11.394  -7.465  35.684  1.00 17.15 ? 423 ARG A NE    1 
ATOM   1647 C CZ    . ARG A 1 212 ? 10.523  -8.081  36.482  1.00 17.96 ? 423 ARG A CZ    1 
ATOM   1648 N NH1   . ARG A 1 212 ? 9.333   -7.548  36.733  1.00 18.09 ? 423 ARG A NH1   1 
ATOM   1649 N NH2   . ARG A 1 212 ? 10.851  -9.229  37.042  1.00 17.65 ? 423 ARG A NH2   1 
ATOM   1650 N N     . MET A 1 213 ? 14.468  -2.512  34.084  1.00 14.87 ? 424 MET A N     1 
ATOM   1651 C CA    . MET A 1 213 ? 14.220  -1.099  33.783  1.00 14.36 ? 424 MET A CA    1 
ATOM   1652 C C     . MET A 1 213 ? 13.262  -0.940  32.568  1.00 13.70 ? 424 MET A C     1 
ATOM   1653 O O     . MET A 1 213 ? 13.290  -1.735  31.616  1.00 13.02 ? 424 MET A O     1 
ATOM   1654 C CB    . MET A 1 213 ? 15.538  -0.362  33.465  1.00 14.96 ? 424 MET A CB    1 
ATOM   1655 C CG    . MET A 1 213 ? 16.617  -0.377  34.571  1.00 17.61 ? 424 MET A CG    1 
ATOM   1656 S SD    . MET A 1 213 ? 17.984  0.756   34.192  1.00 21.76 ? 424 MET A SD    1 
ATOM   1657 C CE    . MET A 1 213 ? 17.196  2.329   34.516  1.00 20.42 ? 424 MET A CE    1 
ATOM   1658 N N     . LEU A 1 214 ? 12.436  0.108   32.604  1.00 12.34 ? 425 LEU A N     1 
ATOM   1659 C CA    . LEU A 1 214 ? 11.565  0.462   31.496  1.00 11.05 ? 425 LEU A CA    1 
ATOM   1660 C C     . LEU A 1 214 ? 12.366  1.428   30.628  1.00 11.50 ? 425 LEU A C     1 
ATOM   1661 O O     . LEU A 1 214 ? 12.705  2.560   31.054  1.00 11.96 ? 425 LEU A O     1 
ATOM   1662 C CB    . LEU A 1 214 ? 10.282  1.116   31.987  1.00 10.35 ? 425 LEU A CB    1 
ATOM   1663 C CG    . LEU A 1 214 ? 9.157   1.352   30.975  1.00 9.73  ? 425 LEU A CG    1 
ATOM   1664 C CD1   . LEU A 1 214 ? 8.575   -0.011  30.563  1.00 11.34 ? 425 LEU A CD1   1 
ATOM   1665 C CD2   . LEU A 1 214 ? 8.058   2.302   31.542  1.00 9.97  ? 425 LEU A CD2   1 
ATOM   1666 N N     . LEU A 1 215 ? 12.710  0.971   29.432  1.00 10.24 ? 426 LEU A N     1 
ATOM   1667 C CA    . LEU A 1 215 ? 13.635  1.694   28.595  1.00 9.70  ? 426 LEU A CA    1 
ATOM   1668 C C     . LEU A 1 215 ? 13.111  1.948   27.181  1.00 8.81  ? 426 LEU A C     1 
ATOM   1669 O O     . LEU A 1 215 ? 12.203  1.252   26.668  1.00 6.75  ? 426 LEU A O     1 
ATOM   1670 C CB    . LEU A 1 215 ? 14.972  0.938   28.525  1.00 10.49 ? 426 LEU A CB    1 
ATOM   1671 C CG    . LEU A 1 215 ? 15.742  0.771   29.821  1.00 9.96  ? 426 LEU A CG    1 
ATOM   1672 C CD1   . LEU A 1 215 ? 17.066  0.009   29.553  1.00 8.07  ? 426 LEU A CD1   1 
ATOM   1673 C CD2   . LEU A 1 215 ? 16.015  2.134   30.397  1.00 7.32  ? 426 LEU A CD2   1 
ATOM   1674 N N     . TRP A 1 216 ? 13.718  2.951   26.548  1.00 8.82  ? 427 TRP A N     1 
ATOM   1675 C CA    . TRP A 1 216 ? 13.288  3.433   25.228  1.00 8.52  ? 427 TRP A CA    1 
ATOM   1676 C C     . TRP A 1 216 ? 13.913  2.686   24.071  1.00 8.02  ? 427 TRP A C     1 
ATOM   1677 O O     . TRP A 1 216 ? 15.033  2.227   24.173  1.00 8.03  ? 427 TRP A O     1 
ATOM   1678 C CB    . TRP A 1 216 ? 13.671  4.889   25.011  1.00 8.47  ? 427 TRP A CB    1 
ATOM   1679 C CG    . TRP A 1 216 ? 13.117  5.817   26.009  1.00 9.22  ? 427 TRP A CG    1 
ATOM   1680 C CD1   . TRP A 1 216 ? 13.785  6.403   27.042  1.00 9.80  ? 427 TRP A CD1   1 
ATOM   1681 C CD2   . TRP A 1 216 ? 11.783  6.318   26.046  1.00 10.16 ? 427 TRP A CD2   1 
ATOM   1682 N NE1   . TRP A 1 216 ? 12.926  7.206   27.756  1.00 9.99  ? 427 TRP A NE1   1 
ATOM   1683 C CE2   . TRP A 1 216 ? 11.699  7.194   27.152  1.00 9.83  ? 427 TRP A CE2   1 
ATOM   1684 C CE3   . TRP A 1 216 ? 10.647  6.117   25.254  1.00 7.91  ? 427 TRP A CE3   1 
ATOM   1685 C CZ2   . TRP A 1 216 ? 10.516  7.857   27.491  1.00 12.05 ? 427 TRP A CZ2   1 
ATOM   1686 C CZ3   . TRP A 1 216 ? 9.464   6.771   25.609  1.00 10.30 ? 427 TRP A CZ3   1 
ATOM   1687 C CH2   . TRP A 1 216 ? 9.420   7.631   26.715  1.00 10.52 ? 427 TRP A CH2   1 
ATOM   1688 N N     . HIS A 1 217 ? 13.188  2.665   22.955  1.00 8.20  ? 428 HIS A N     1 
ATOM   1689 C CA    . HIS A 1 217 ? 13.719  2.234   21.649  1.00 7.24  ? 428 HIS A CA    1 
ATOM   1690 C C     . HIS A 1 217 ? 12.960  2.973   20.542  1.00 7.45  ? 428 HIS A C     1 
ATOM   1691 O O     . HIS A 1 217 ? 11.721  2.927   20.488  1.00 8.25  ? 428 HIS A O     1 
ATOM   1692 C CB    . HIS A 1 217 ? 13.593  0.715   21.484  1.00 6.58  ? 428 HIS A CB    1 
ATOM   1693 C CG    . HIS A 1 217 ? 14.180  0.197   20.202  1.00 5.81  ? 428 HIS A CG    1 
ATOM   1694 N ND1   . HIS A 1 217 ? 15.494  -0.211  20.100  1.00 3.30  ? 428 HIS A ND1   1 
ATOM   1695 C CD2   . HIS A 1 217 ? 13.648  0.068   18.962  1.00 6.26  ? 428 HIS A CD2   1 
ATOM   1696 C CE1   . HIS A 1 217 ? 15.745  -0.565  18.849  1.00 7.49  ? 428 HIS A CE1   1 
ATOM   1697 N NE2   . HIS A 1 217 ? 14.636  -0.431  18.141  1.00 6.75  ? 428 HIS A NE2   1 
ATOM   1698 N N     . GLY A 1 218 ? 13.696  3.644   19.664  1.00 7.25  ? 429 GLY A N     1 
ATOM   1699 C CA    . GLY A 1 218 ? 13.136  4.296   18.500  1.00 7.43  ? 429 GLY A CA    1 
ATOM   1700 C C     . GLY A 1 218 ? 13.549  3.589   17.217  1.00 8.32  ? 429 GLY A C     1 
ATOM   1701 O O     . GLY A 1 218 ? 14.596  2.947   17.147  1.00 8.29  ? 429 GLY A O     1 
ATOM   1702 N N     . SER A 1 219 ? 12.726  3.703   16.183  1.00 8.50  ? 430 SER A N     1 
ATOM   1703 C CA    . SER A 1 219 ? 13.073  3.140   14.884  1.00 8.91  ? 430 SER A CA    1 
ATOM   1704 C C     . SER A 1 219 ? 12.286  3.899   13.853  1.00 9.42  ? 430 SER A C     1 
ATOM   1705 O O     . SER A 1 219 ? 11.325  4.572   14.189  1.00 9.83  ? 430 SER A O     1 
ATOM   1706 C CB    . SER A 1 219 ? 12.705  1.641   14.810  1.00 8.96  ? 430 SER A CB    1 
ATOM   1707 O OG    . SER A 1 219 ? 13.487  0.988   13.799  1.00 9.51  ? 430 SER A OG    1 
ATOM   1708 N N     . ARG A 1 220 ? 12.687  3.754   12.600  1.00 10.46 ? 431 ARG A N     1 
ATOM   1709 C CA    . ARG A 1 220 ? 12.012  4.351   11.472  1.00 10.85 ? 431 ARG A CA    1 
ATOM   1710 C C     . ARG A 1 220 ? 10.611  3.812   11.345  1.00 10.85 ? 431 ARG A C     1 
ATOM   1711 O O     . ARG A 1 220 ? 10.323  2.697   11.750  1.00 10.22 ? 431 ARG A O     1 
ATOM   1712 C CB    . ARG A 1 220 ? 12.779  4.062   10.177  1.00 11.54 ? 431 ARG A CB    1 
ATOM   1713 C CG    . ARG A 1 220 ? 14.119  4.779   10.104  1.00 13.07 ? 431 ARG A CG    1 
ATOM   1714 C CD    . ARG A 1 220 ? 14.944  4.346   8.904   1.00 14.37 ? 431 ARG A CD    1 
ATOM   1715 N NE    . ARG A 1 220 ? 16.322  4.845   8.961   1.00 16.65 ? 431 ARG A NE    1 
ATOM   1716 C CZ    . ARG A 1 220 ? 16.729  6.009   8.450   1.00 17.91 ? 431 ARG A CZ    1 
ATOM   1717 N NH1   . ARG A 1 220 ? 15.880  6.817   7.836   1.00 19.40 ? 431 ARG A NH1   1 
ATOM   1718 N NH2   . ARG A 1 220 ? 18.014  6.361   8.536   1.00 21.62 ? 431 ARG A NH2   1 
ATOM   1719 N N     . MET A 1 221 ? 9.759   4.605   10.728  1.00 11.42 ? 432 MET A N     1 
ATOM   1720 C CA    . MET A 1 221 ? 8.326   4.305   10.648  1.00 11.60 ? 432 MET A CA    1 
ATOM   1721 C C     . MET A 1 221 ? 8.055   3.056   9.853   1.00 11.78 ? 432 MET A C     1 
ATOM   1722 O O     . MET A 1 221 ? 7.008   2.421   10.048  1.00 12.05 ? 432 MET A O     1 
ATOM   1723 C CB    . MET A 1 221 ? 7.553   5.489   10.036  1.00 11.82 ? 432 MET A CB    1 
ATOM   1724 C CG    . MET A 1 221 ? 7.256   6.560   11.027  1.00 13.03 ? 432 MET A CG    1 
ATOM   1725 S SD    . MET A 1 221 ? 6.262   5.945   12.405  1.00 16.25 ? 432 MET A SD    1 
ATOM   1726 C CE    . MET A 1 221 ? 4.797   5.373   11.577  1.00 8.87  ? 432 MET A CE    1 
ATOM   1727 N N     . SER A 1 222 ? 9.001   2.709   8.971   1.00 11.47 ? 433 SER A N     1 
ATOM   1728 C CA    . SER A 1 222 ? 8.916   1.537   8.118   1.00 11.73 ? 433 SER A CA    1 
ATOM   1729 C C     . SER A 1 222 ? 9.117   0.247   8.882   1.00 11.58 ? 433 SER A C     1 
ATOM   1730 O O     . SER A 1 222 ? 8.815   -0.819  8.358   1.00 11.71 ? 433 SER A O     1 
ATOM   1731 C CB    . SER A 1 222 ? 9.997   1.596   7.036   1.00 12.36 ? 433 SER A CB    1 
ATOM   1732 O OG    . SER A 1 222 ? 11.288  1.723   7.631   1.00 12.55 ? 433 SER A OG    1 
ATOM   1733 N N     . ASN A 1 223 ? 9.631   0.334   10.106  1.00 10.43 ? 434 ASN A N     1 
ATOM   1734 C CA    . ASN A 1 223 ? 10.048  -0.849  10.822  1.00 10.30 ? 434 ASN A CA    1 
ATOM   1735 C C     . ASN A 1 223 ? 9.060   -1.426  11.842  1.00 10.19 ? 434 ASN A C     1 
ATOM   1736 O O     . ASN A 1 223 ? 9.281   -2.541  12.341  1.00 9.46  ? 434 ASN A O     1 
ATOM   1737 C CB    . ASN A 1 223 ? 11.361  -0.596  11.528  1.00 10.04 ? 434 ASN A CB    1 
ATOM   1738 C CG    . ASN A 1 223 ? 12.472  -0.177  10.574  1.00 12.34 ? 434 ASN A CG    1 
ATOM   1739 O OD1   . ASN A 1 223 ? 12.354  -0.264  9.341   1.00 12.34 ? 434 ASN A OD1   1 
ATOM   1740 N ND2   . ASN A 1 223 ? 13.534  0.346   11.148  1.00 12.42 ? 434 ASN A ND2   1 
ATOM   1741 N N     . TRP A 1 224 ? 7.990   -0.697  12.142  1.00 9.24  ? 435 TRP A N     1 
ATOM   1742 C CA    . TRP A 1 224 ? 7.115   -1.088  13.255  1.00 9.81  ? 435 TRP A CA    1 
ATOM   1743 C C     . TRP A 1 224 ? 6.329   -2.362  13.039  1.00 9.28  ? 435 TRP A C     1 
ATOM   1744 O O     . TRP A 1 224 ? 6.126   -3.101  14.002  1.00 10.67 ? 435 TRP A O     1 
ATOM   1745 C CB    . TRP A 1 224 ? 6.204   0.070   13.688  1.00 8.66  ? 435 TRP A CB    1 
ATOM   1746 C CG    . TRP A 1 224 ? 7.009   1.179   14.197  1.00 7.72  ? 435 TRP A CG    1 
ATOM   1747 C CD1   . TRP A 1 224 ? 7.154   2.393   13.622  1.00 9.19  ? 435 TRP A CD1   1 
ATOM   1748 C CD2   . TRP A 1 224 ? 7.807   1.194   15.371  1.00 7.90  ? 435 TRP A CD2   1 
ATOM   1749 N NE1   . TRP A 1 224 ? 7.981   3.162   14.359  1.00 10.55 ? 435 TRP A NE1   1 
ATOM   1750 C CE2   . TRP A 1 224 ? 8.418   2.452   15.434  1.00 9.90  ? 435 TRP A CE2   1 
ATOM   1751 C CE3   . TRP A 1 224 ? 8.077   0.269   16.371  1.00 9.28  ? 435 TRP A CE3   1 
ATOM   1752 C CZ2   . TRP A 1 224 ? 9.280   2.817   16.462  1.00 11.64 ? 435 TRP A CZ2   1 
ATOM   1753 C CZ3   . TRP A 1 224 ? 8.944   0.631   17.397  1.00 11.57 ? 435 TRP A CZ3   1 
ATOM   1754 C CH2   . TRP A 1 224 ? 9.526   1.885   17.434  1.00 11.90 ? 435 TRP A CH2   1 
ATOM   1755 N N     . VAL A 1 225 ? 5.935   -2.650  11.807  1.00 9.56  ? 436 VAL A N     1 
ATOM   1756 C CA    . VAL A 1 225 ? 5.209   -3.897  11.528  1.00 9.52  ? 436 VAL A CA    1 
ATOM   1757 C C     . VAL A 1 225 ? 6.129   -5.063  11.799  1.00 8.75  ? 436 VAL A C     1 
ATOM   1758 O O     . VAL A 1 225 ? 5.741   -6.008  12.433  1.00 9.21  ? 436 VAL A O     1 
ATOM   1759 C CB    . VAL A 1 225 ? 4.620   -3.950  10.072  1.00 9.01  ? 436 VAL A CB    1 
ATOM   1760 C CG1   . VAL A 1 225 ? 4.154   -5.367  9.743   1.00 8.06  ? 436 VAL A CG1   1 
ATOM   1761 C CG2   . VAL A 1 225 ? 3.477   -2.955  9.948   1.00 8.91  ? 436 VAL A CG2   1 
ATOM   1762 N N     . GLY A 1 226 ? 7.379   -4.970  11.359  1.00 9.44  ? 437 GLY A N     1 
ATOM   1763 C CA    . GLY A 1 226 ? 8.390   -5.977  11.689  1.00 8.84  ? 437 GLY A CA    1 
ATOM   1764 C C     . GLY A 1 226 ? 8.631   -6.122  13.185  1.00 9.22  ? 437 GLY A C     1 
ATOM   1765 O O     . GLY A 1 226 ? 8.679   -7.251  13.743  1.00 8.14  ? 437 GLY A O     1 
ATOM   1766 N N     . ILE A 1 227 ? 8.774   -4.986  13.854  1.00 9.44  ? 438 ILE A N     1 
ATOM   1767 C CA    . ILE A 1 227 ? 9.071   -4.999  15.279  1.00 9.45  ? 438 ILE A CA    1 
ATOM   1768 C C     . ILE A 1 227 ? 7.929   -5.592  16.121  1.00 10.04 ? 438 ILE A C     1 
ATOM   1769 O O     . ILE A 1 227 ? 8.162   -6.418  17.007  1.00 10.02 ? 438 ILE A O     1 
ATOM   1770 C CB    . ILE A 1 227 ? 9.464   -3.613  15.771  1.00 10.06 ? 438 ILE A CB    1 
ATOM   1771 C CG1   . ILE A 1 227 ? 10.836  -3.232  15.189  1.00 8.62  ? 438 ILE A CG1   1 
ATOM   1772 C CG2   . ILE A 1 227 ? 9.489   -3.623  17.300  1.00 10.25 ? 438 ILE A CG2   1 
ATOM   1773 C CD1   . ILE A 1 227 ? 11.208  -1.684  15.251  1.00 9.60  ? 438 ILE A CD1   1 
ATOM   1774 N N     . LEU A 1 228 ? 6.709   -5.185  15.833  1.00 10.27 ? 439 LEU A N     1 
ATOM   1775 C CA    . LEU A 1 228 ? 5.552   -5.665  16.562  1.00 11.00 ? 439 LEU A CA    1 
ATOM   1776 C C     . LEU A 1 228 ? 5.242   -7.145  16.224  1.00 11.47 ? 439 LEU A C     1 
ATOM   1777 O O     . LEU A 1 228 ? 4.844   -7.919  17.093  1.00 11.69 ? 439 LEU A O     1 
ATOM   1778 C CB    . LEU A 1 228 ? 4.350   -4.759  16.274  1.00 11.01 ? 439 LEU A CB    1 
ATOM   1779 C CG    . LEU A 1 228 ? 4.527   -3.317  16.774  1.00 11.08 ? 439 LEU A CG    1 
ATOM   1780 C CD1   . LEU A 1 228 ? 3.350   -2.455  16.379  1.00 10.31 ? 439 LEU A CD1   1 
ATOM   1781 C CD2   . LEU A 1 228 ? 4.730   -3.313  18.318  1.00 12.12 ? 439 LEU A CD2   1 
ATOM   1782 N N     . SER A 1 229 ? 5.484   -7.537  14.984  1.00 12.28 ? 440 SER A N     1 
ATOM   1783 C CA    . SER A 1 229 ? 5.150   -8.891  14.545  1.00 12.65 ? 440 SER A CA    1 
ATOM   1784 C C     . SER A 1 229 ? 6.205   -9.910  14.938  1.00 12.88 ? 440 SER A C     1 
ATOM   1785 O O     . SER A 1 229 ? 5.862   -11.059 15.304  1.00 12.11 ? 440 SER A O     1 
ATOM   1786 C CB    . SER A 1 229 ? 4.838   -8.928  13.046  1.00 12.77 ? 440 SER A CB    1 
ATOM   1787 O OG    . SER A 1 229 ? 5.947   -8.560  12.229  1.00 13.50 ? 440 SER A OG    1 
ATOM   1788 N N     . HIS A 1 230 ? 7.466   -9.487  14.953  1.00 12.09 ? 441 HIS A N     1 
ATOM   1789 C CA    . HIS A 1 230 ? 8.591   -10.384 15.305  1.00 13.56 ? 441 HIS A CA    1 
ATOM   1790 C C     . HIS A 1 230 ? 9.292   -10.094 16.639  1.00 13.12 ? 441 HIS A C     1 
ATOM   1791 O O     . HIS A 1 230 ? 10.209  -10.839 17.068  1.00 12.90 ? 441 HIS A O     1 
ATOM   1792 C CB    . HIS A 1 230 ? 9.643   -10.399 14.176  1.00 13.22 ? 441 HIS A CB    1 
ATOM   1793 C CG    . HIS A 1 230 ? 9.173   -11.093 12.934  1.00 15.75 ? 441 HIS A CG    1 
ATOM   1794 N ND1   . HIS A 1 230 ? 8.081   -10.661 12.210  1.00 18.08 ? 441 HIS A ND1   1 
ATOM   1795 C CD2   . HIS A 1 230 ? 9.646   -12.189 12.285  1.00 18.02 ? 441 HIS A CD2   1 
ATOM   1796 C CE1   . HIS A 1 230 ? 7.889   -11.477 11.181  1.00 19.98 ? 441 HIS A CE1   1 
ATOM   1797 N NE2   . HIS A 1 230 ? 8.835   -12.401 11.196  1.00 19.10 ? 441 HIS A NE2   1 
ATOM   1798 N N     . GLY A 1 231 ? 8.913   -8.992  17.275  1.00 12.14 ? 442 GLY A N     1 
ATOM   1799 C CA    . GLY A 1 231 ? 9.633   -8.528  18.455  1.00 11.58 ? 442 GLY A CA    1 
ATOM   1800 C C     . GLY A 1 231 ? 10.904  -7.813  18.042  1.00 10.82 ? 442 GLY A C     1 
ATOM   1801 O O     . GLY A 1 231 ? 11.311  -7.835  16.878  1.00 12.16 ? 442 GLY A O     1 
ATOM   1802 N N     . LEU A 1 232 ? 11.514  -7.122  18.977  1.00 10.62 ? 443 LEU A N     1 
ATOM   1803 C CA    . LEU A 1 232 ? 12.850  -6.586  18.742  1.00 11.08 ? 443 LEU A CA    1 
ATOM   1804 C C     . LEU A 1 232 ? 13.814  -7.788  18.549  1.00 11.68 ? 443 LEU A C     1 
ATOM   1805 O O     . LEU A 1 232 ? 13.764  -8.754  19.309  1.00 11.13 ? 443 LEU A O     1 
ATOM   1806 C CB    . LEU A 1 232 ? 13.311  -5.710  19.910  1.00 10.14 ? 443 LEU A CB    1 
ATOM   1807 C CG    . LEU A 1 232 ? 12.589  -4.370  20.113  1.00 11.07 ? 443 LEU A CG    1 
ATOM   1808 C CD1   . LEU A 1 232 ? 12.996  -3.725  21.422  1.00 10.36 ? 443 LEU A CD1   1 
ATOM   1809 C CD2   . LEU A 1 232 ? 12.861  -3.409  18.926  1.00 7.19  ? 443 LEU A CD2   1 
ATOM   1810 N N     . ARG A 1 233 ? 14.690  -7.691  17.554  1.00 12.23 ? 444 ARG A N     1 
ATOM   1811 C CA    . ARG A 1 233 ? 15.602  -8.774  17.171  1.00 13.15 ? 444 ARG A CA    1 
ATOM   1812 C C     . ARG A 1 233 ? 17.049  -8.269  17.199  1.00 13.84 ? 444 ARG A C     1 
ATOM   1813 O O     . ARG A 1 233 ? 17.315  -7.064  17.043  1.00 12.42 ? 444 ARG A O     1 
ATOM   1814 C CB    . ARG A 1 233 ? 15.266  -9.259  15.742  1.00 13.77 ? 444 ARG A CB    1 
ATOM   1815 C CG    . ARG A 1 233 ? 13.953  -10.001 15.594  1.00 14.08 ? 444 ARG A CG    1 
ATOM   1816 C CD    . ARG A 1 233 ? 13.259  -9.634  14.258  1.00 14.94 ? 444 ARG A CD    1 
ATOM   1817 N NE    . ARG A 1 233 ? 12.707  -8.264  14.318  1.00 14.34 ? 444 ARG A NE    1 
ATOM   1818 C CZ    . ARG A 1 233 ? 12.472  -7.462  13.266  1.00 15.13 ? 444 ARG A CZ    1 
ATOM   1819 N NH1   . ARG A 1 233 ? 12.699  -7.853  12.018  1.00 16.10 ? 444 ARG A NH1   1 
ATOM   1820 N NH2   . ARG A 1 233 ? 11.995  -6.237  13.469  1.00 14.99 ? 444 ARG A NH2   1 
ATOM   1821 N N     . ILE A 1 234 ? 17.989  -9.190  17.397  1.00 14.60 ? 445 ILE A N     1 
ATOM   1822 C CA    . ILE A 1 234 ? 19.387  -8.830  17.277  1.00 14.33 ? 445 ILE A CA    1 
ATOM   1823 C C     . ILE A 1 234 ? 19.700  -8.710  15.767  1.00 14.71 ? 445 ILE A C     1 
ATOM   1824 O O     . ILE A 1 234 ? 18.925  -9.136  14.914  1.00 13.66 ? 445 ILE A O     1 
ATOM   1825 C CB    . ILE A 1 234 ? 20.308  -9.841  17.989  1.00 15.57 ? 445 ILE A CB    1 
ATOM   1826 C CG1   . ILE A 1 234 ? 20.350  -11.163 17.216  1.00 15.83 ? 445 ILE A CG1   1 
ATOM   1827 C CG2   . ILE A 1 234 ? 19.890  -10.047 19.503  1.00 14.62 ? 445 ILE A CG2   1 
ATOM   1828 C CD1   . ILE A 1 234 ? 21.524  -12.080 17.654  1.00 16.00 ? 445 ILE A CD1   1 
ATOM   1829 N N     . ALA A 1 235 ? 20.824  -8.098  15.447  1.00 15.11 ? 446 ALA A N     1 
ATOM   1830 C CA    . ALA A 1 235 ? 21.262  -7.927  14.053  1.00 14.36 ? 446 ALA A CA    1 
ATOM   1831 C C     . ALA A 1 235 ? 21.387  -9.236  13.260  1.00 14.76 ? 446 ALA A C     1 
ATOM   1832 O O     . ALA A 1 235 ? 21.697  -10.306 13.793  1.00 14.34 ? 446 ALA A O     1 
ATOM   1833 C CB    . ALA A 1 235 ? 22.586  -7.210  14.038  1.00 13.54 ? 446 ALA A CB    1 
ATOM   1834 N N     . HIS A 1 236 ? 21.178  -9.127  11.961  1.00 15.18 ? 447 HIS A N     1 
ATOM   1835 C CA    . HIS A 1 236 ? 21.404  -10.218 11.069  1.00 15.81 ? 447 HIS A CA    1 
ATOM   1836 C C     . HIS A 1 236 ? 22.811  -10.833 11.294  1.00 15.86 ? 447 HIS A C     1 
ATOM   1837 O O     . HIS A 1 236 ? 23.772  -10.089 11.478  1.00 16.54 ? 447 HIS A O     1 
ATOM   1838 C CB    . HIS A 1 236 ? 21.256  -9.736  9.621   1.00 16.27 ? 447 HIS A CB    1 
ATOM   1839 C CG    . HIS A 1 236 ? 21.112  -10.860 8.649   1.00 16.31 ? 447 HIS A CG    1 
ATOM   1840 N ND1   . HIS A 1 236 ? 22.161  -11.684 8.320   1.00 15.29 ? 447 HIS A ND1   1 
ATOM   1841 C CD2   . HIS A 1 236 ? 20.029  -11.342 7.990   1.00 18.71 ? 447 HIS A CD2   1 
ATOM   1842 C CE1   . HIS A 1 236 ? 21.743  -12.612 7.473   1.00 17.84 ? 447 HIS A CE1   1 
ATOM   1843 N NE2   . HIS A 1 236 ? 20.450  -12.435 7.266   1.00 17.76 ? 447 HIS A NE2   1 
ATOM   1844 N N     . PRO A 1 237 ? 22.930  -12.181 11.322  1.00 16.48 ? 448 PRO A N     1 
ATOM   1845 C CA    . PRO A 1 237 ? 24.234  -12.850 11.484  1.00 17.28 ? 448 PRO A CA    1 
ATOM   1846 C C     . PRO A 1 237 ? 25.307  -12.500 10.440  1.00 17.04 ? 448 PRO A C     1 
ATOM   1847 O O     . PRO A 1 237 ? 26.474  -12.431 10.777  1.00 18.41 ? 448 PRO A O     1 
ATOM   1848 C CB    . PRO A 1 237 ? 23.880  -14.346 11.425  1.00 18.12 ? 448 PRO A CB    1 
ATOM   1849 C CG    . PRO A 1 237 ? 22.508  -14.398 10.876  1.00 17.62 ? 448 PRO A CG    1 
ATOM   1850 C CD    . PRO A 1 237 ? 21.833  -13.164 11.315  1.00 17.17 ? 448 PRO A CD    1 
ATOM   1851 N N     . GLU A 1 238 ? 24.923  -12.215 9.213   1.00 17.95 ? 449 GLU A N     1 
ATOM   1852 C CA    . GLU A 1 238 ? 25.910  -11.843 8.183   1.00 18.80 ? 449 GLU A CA    1 
ATOM   1853 C C     . GLU A 1 238 ? 26.279  -10.349 8.191   1.00 18.42 ? 449 GLU A C     1 
ATOM   1854 O O     . GLU A 1 238 ? 27.221  -9.935  7.497   1.00 18.24 ? 449 GLU A O     1 
ATOM   1855 C CB    . GLU A 1 238 ? 25.412  -12.253 6.797   1.00 19.95 ? 449 GLU A CB    1 
ATOM   1856 C CG    . GLU A 1 238 ? 25.113  -13.744 6.644   1.00 22.87 ? 449 GLU A CG    1 
ATOM   1857 C CD    . GLU A 1 238 ? 26.355  -14.598 6.416   1.00 28.19 ? 449 GLU A CD    1 
ATOM   1858 O OE1   . GLU A 1 238 ? 27.353  -14.104 5.842   1.00 26.69 ? 449 GLU A OE1   1 
ATOM   1859 O OE2   . GLU A 1 238 ? 26.320  -15.794 6.804   1.00 34.81 ? 449 GLU A OE2   1 
ATOM   1860 N N     . ALA A 1 239 ? 25.558  -9.538  8.972   1.00 17.06 ? 450 ALA A N     1 
ATOM   1861 C CA    . ALA A 1 239 ? 25.902  -8.115  9.091   1.00 16.62 ? 450 ALA A CA    1 
ATOM   1862 C C     . ALA A 1 239 ? 27.312  -7.906  9.642   1.00 15.75 ? 450 ALA A C     1 
ATOM   1863 O O     . ALA A 1 239 ? 27.773  -8.673  10.494  1.00 15.30 ? 450 ALA A O     1 
ATOM   1864 C CB    . ALA A 1 239 ? 24.909  -7.391  9.965   1.00 15.70 ? 450 ALA A CB    1 
ATOM   1865 N N     . PRO A 1 240 ? 28.005  -6.869  9.151   1.00 16.48 ? 451 PRO A N     1 
ATOM   1866 C CA    . PRO A 1 240 ? 29.322  -6.481  9.658   1.00 15.91 ? 451 PRO A CA    1 
ATOM   1867 C C     . PRO A 1 240 ? 29.277  -6.147  11.121  1.00 15.63 ? 451 PRO A C     1 
ATOM   1868 O O     . PRO A 1 240 ? 28.400  -5.371  11.529  1.00 13.97 ? 451 PRO A O     1 
ATOM   1869 C CB    . PRO A 1 240 ? 29.657  -5.221  8.856   1.00 16.07 ? 451 PRO A CB    1 
ATOM   1870 C CG    . PRO A 1 240 ? 28.776  -5.218  7.710   1.00 16.47 ? 451 PRO A CG    1 
ATOM   1871 C CD    . PRO A 1 240 ? 27.568  -5.998  8.033   1.00 15.68 ? 451 PRO A CD    1 
ATOM   1872 N N     . ILE A 1 241 ? 30.188  -6.736  11.914  1.00 15.77 ? 452 ILE A N     1 
ATOM   1873 C CA    . ILE A 1 241 ? 30.185  -6.486  13.350  1.00 15.95 ? 452 ILE A CA    1 
ATOM   1874 C C     . ILE A 1 241 ? 30.469  -5.032  13.647  1.00 15.86 ? 452 ILE A C     1 
ATOM   1875 O O     . ILE A 1 241 ? 29.936  -4.481  14.626  1.00 14.60 ? 452 ILE A O     1 
ATOM   1876 C CB    . ILE A 1 241 ? 31.145  -7.396  14.161  1.00 16.34 ? 452 ILE A CB    1 
ATOM   1877 C CG1   . ILE A 1 241 ? 30.820  -7.309  15.654  1.00 17.13 ? 452 ILE A CG1   1 
ATOM   1878 C CG2   . ILE A 1 241 ? 32.626  -7.006  13.954  1.00 17.95 ? 452 ILE A CG2   1 
ATOM   1879 C CD1   . ILE A 1 241 ? 29.655  -8.121  16.096  1.00 18.25 ? 452 ILE A CD1   1 
ATOM   1880 N N     . THR A 1 242 ? 31.264  -4.386  12.787  1.00 15.56 ? 453 THR A N     1 
ATOM   1881 C CA    . THR A 1 242 ? 31.633  -2.993  13.012  1.00 15.65 ? 453 THR A CA    1 
ATOM   1882 C C     . THR A 1 242 ? 30.436  -2.053  12.908  1.00 15.03 ? 453 THR A C     1 
ATOM   1883 O O     . THR A 1 242 ? 30.525  -0.895  13.284  1.00 14.96 ? 453 THR A O     1 
ATOM   1884 C CB    . THR A 1 242 ? 32.797  -2.539  12.086  1.00 16.63 ? 453 THR A CB    1 
ATOM   1885 O OG1   . THR A 1 242 ? 32.408  -2.630  10.715  1.00 17.14 ? 453 THR A OG1   1 
ATOM   1886 C CG2   . THR A 1 242 ? 34.032  -3.470  12.302  1.00 16.83 ? 453 THR A CG2   1 
ATOM   1887 N N     . GLY A 1 243 ? 29.299  -2.552  12.439  1.00 14.43 ? 454 GLY A N     1 
ATOM   1888 C CA    . GLY A 1 243 ? 28.104  -1.739  12.416  1.00 14.29 ? 454 GLY A CA    1 
ATOM   1889 C C     . GLY A 1 243 ? 27.512  -1.442  13.794  1.00 13.81 ? 454 GLY A C     1 
ATOM   1890 O O     . GLY A 1 243 ? 26.595  -0.646  13.893  1.00 13.82 ? 454 GLY A O     1 
ATOM   1891 N N     . TYR A 1 244 ? 28.029  -2.085  14.839  1.00 13.23 ? 455 TYR A N     1 
ATOM   1892 C CA    . TYR A 1 244 ? 27.384  -2.126  16.161  1.00 13.44 ? 455 TYR A CA    1 
ATOM   1893 C C     . TYR A 1 244 ? 28.365  -1.750  17.265  1.00 13.49 ? 455 TYR A C     1 
ATOM   1894 O O     . TYR A 1 244 ? 29.307  -2.515  17.563  1.00 13.14 ? 455 TYR A O     1 
ATOM   1895 C CB    . TYR A 1 244 ? 26.802  -3.542  16.415  1.00 13.13 ? 455 TYR A CB    1 
ATOM   1896 C CG    . TYR A 1 244 ? 25.929  -3.946  15.285  1.00 12.43 ? 455 TYR A CG    1 
ATOM   1897 C CD1   . TYR A 1 244 ? 24.573  -3.610  15.268  1.00 12.36 ? 455 TYR A CD1   1 
ATOM   1898 C CD2   . TYR A 1 244 ? 26.466  -4.587  14.181  1.00 11.81 ? 455 TYR A CD2   1 
ATOM   1899 C CE1   . TYR A 1 244 ? 23.780  -3.920  14.175  1.00 13.32 ? 455 TYR A CE1   1 
ATOM   1900 C CE2   . TYR A 1 244 ? 25.679  -4.906  13.093  1.00 12.99 ? 455 TYR A CE2   1 
ATOM   1901 C CZ    . TYR A 1 244 ? 24.348  -4.581  13.097  1.00 11.62 ? 455 TYR A CZ    1 
ATOM   1902 O OH    . TYR A 1 244 ? 23.613  -4.885  11.994  1.00 14.76 ? 455 TYR A OH    1 
ATOM   1903 N N     . MET A 1 245 ? 28.132  -0.600  17.889  1.00 12.50 ? 456 MET A N     1 
ATOM   1904 C CA    . MET A 1 245 ? 29.037  -0.049  18.886  1.00 13.14 ? 456 MET A CA    1 
ATOM   1905 C C     . MET A 1 245 ? 29.375  -1.032  20.010  1.00 13.19 ? 456 MET A C     1 
ATOM   1906 O O     . MET A 1 245 ? 30.530  -1.069  20.465  1.00 12.99 ? 456 MET A O     1 
ATOM   1907 C CB    . MET A 1 245 ? 28.444  1.225   19.483  1.00 14.11 ? 456 MET A CB    1 
ATOM   1908 C CG    . MET A 1 245 ? 29.360  1.940   20.457  1.00 16.81 ? 456 MET A CG    1 
ATOM   1909 S SD    . MET A 1 245 ? 28.670  3.529   20.980  1.00 22.06 ? 456 MET A SD    1 
ATOM   1910 C CE    . MET A 1 245 ? 30.162  4.399   21.493  1.00 21.88 ? 456 MET A CE    1 
ATOM   1911 N N     . PHE A 1 246 ? 28.389  -1.836  20.422  1.00 11.82 ? 457 PHE A N     1 
ATOM   1912 C CA    . PHE A 1 246 ? 28.559  -2.852  21.439  1.00 12.01 ? 457 PHE A CA    1 
ATOM   1913 C C     . PHE A 1 246 ? 28.114  -4.254  20.998  1.00 11.15 ? 457 PHE A C     1 
ATOM   1914 O O     . PHE A 1 246 ? 27.699  -5.079  21.826  1.00 11.37 ? 457 PHE A O     1 
ATOM   1915 C CB    . PHE A 1 246 ? 27.846  -2.392  22.721  1.00 12.38 ? 457 PHE A CB    1 
ATOM   1916 C CG    . PHE A 1 246 ? 28.450  -1.140  23.312  1.00 13.31 ? 457 PHE A CG    1 
ATOM   1917 C CD1   . PHE A 1 246 ? 29.720  -1.176  23.850  1.00 15.98 ? 457 PHE A CD1   1 
ATOM   1918 C CD2   . PHE A 1 246 ? 27.780  0.075   23.281  1.00 14.53 ? 457 PHE A CD2   1 
ATOM   1919 C CE1   . PHE A 1 246 ? 30.323  -0.026  24.371  1.00 15.56 ? 457 PHE A CE1   1 
ATOM   1920 C CE2   . PHE A 1 246 ? 28.384  1.229   23.798  1.00 14.11 ? 457 PHE A CE2   1 
ATOM   1921 C CZ    . PHE A 1 246 ? 29.649  1.169   24.346  1.00 13.82 ? 457 PHE A CZ    1 
ATOM   1922 N N     . GLY A 1 247 ? 28.232  -4.532  19.703  1.00 10.63 ? 458 GLY A N     1 
ATOM   1923 C CA    . GLY A 1 247 ? 27.913  -5.850  19.162  1.00 10.31 ? 458 GLY A CA    1 
ATOM   1924 C C     . GLY A 1 247 ? 26.432  -6.037  18.879  1.00 10.51 ? 458 GLY A C     1 
ATOM   1925 O O     . GLY A 1 247 ? 25.614  -5.104  18.996  1.00 9.87  ? 458 GLY A O     1 
ATOM   1926 N N     . LYS A 1 248 ? 26.078  -7.265  18.530  1.00 10.57 ? 459 LYS A N     1 
ATOM   1927 C CA    . LYS A 1 248 ? 24.776  -7.551  17.945  1.00 10.29 ? 459 LYS A CA    1 
ATOM   1928 C C     . LYS A 1 248 ? 23.769  -7.907  19.028  1.00 10.68 ? 459 LYS A C     1 
ATOM   1929 O O     . LYS A 1 248 ? 23.416  -9.091  19.232  1.00 10.77 ? 459 LYS A O     1 
ATOM   1930 C CB    . LYS A 1 248 ? 24.928  -8.677  16.928  1.00 10.55 ? 459 LYS A CB    1 
ATOM   1931 C CG    . LYS A 1 248 ? 25.800  -8.294  15.732  1.00 12.35 ? 459 LYS A CG    1 
ATOM   1932 C CD    . LYS A 1 248 ? 25.664  -9.336  14.643  1.00 10.89 ? 459 LYS A CD    1 
ATOM   1933 C CE    . LYS A 1 248 ? 26.570  -9.045  13.462  1.00 12.79 ? 459 LYS A CE    1 
ATOM   1934 N NZ    . LYS A 1 248 ? 26.483  -10.152 12.437  1.00 11.03 ? 459 LYS A NZ    1 
ATOM   1935 N N     . GLY A 1 249 ? 23.374  -6.872  19.768  1.00 11.03 ? 460 GLY A N     1 
ATOM   1936 C CA    . GLY A 1 249 ? 22.312  -6.933  20.748  1.00 10.05 ? 460 GLY A CA    1 
ATOM   1937 C C     . GLY A 1 249 ? 21.120  -6.043  20.366  1.00 9.95  ? 460 GLY A C     1 
ATOM   1938 O O     . GLY A 1 249 ? 21.001  -5.570  19.247  1.00 10.68 ? 460 GLY A O     1 
ATOM   1939 N N     . ILE A 1 250 ? 20.212  -5.884  21.309  1.00 9.01  ? 461 ILE A N     1 
ATOM   1940 C CA    . ILE A 1 250 ? 19.050  -5.009  21.180  1.00 8.39  ? 461 ILE A CA    1 
ATOM   1941 C C     . ILE A 1 250 ? 19.384  -3.786  22.036  1.00 9.42  ? 461 ILE A C     1 
ATOM   1942 O O     . ILE A 1 250 ? 19.705  -3.911  23.218  1.00 8.67  ? 461 ILE A O     1 
ATOM   1943 C CB    . ILE A 1 250 ? 17.772  -5.731  21.669  1.00 8.24  ? 461 ILE A CB    1 
ATOM   1944 C CG1   . ILE A 1 250 ? 17.543  -7.024  20.863  1.00 7.61  ? 461 ILE A CG1   1 
ATOM   1945 C CG2   . ILE A 1 250 ? 16.525  -4.821  21.596  1.00 6.00  ? 461 ILE A CG2   1 
ATOM   1946 C CD1   . ILE A 1 250 ? 16.467  -7.930  21.455  1.00 8.89  ? 461 ILE A CD1   1 
ATOM   1947 N N     . TYR A 1 251 ? 19.305  -2.604  21.420  1.00 9.93  ? 462 TYR A N     1 
ATOM   1948 C CA    . TYR A 1 251 ? 19.775  -1.355  22.028  1.00 10.41 ? 462 TYR A CA    1 
ATOM   1949 C C     . TYR A 1 251 ? 18.638  -0.539  22.610  1.00 10.73 ? 462 TYR A C     1 
ATOM   1950 O O     . TYR A 1 251 ? 17.588  -0.401  21.980  1.00 11.48 ? 462 TYR A O     1 
ATOM   1951 C CB    . TYR A 1 251 ? 20.486  -0.520  20.977  1.00 10.65 ? 462 TYR A CB    1 
ATOM   1952 C CG    . TYR A 1 251 ? 21.855  -1.019  20.621  1.00 10.98 ? 462 TYR A CG    1 
ATOM   1953 C CD1   . TYR A 1 251 ? 22.030  -2.231  19.942  1.00 10.44 ? 462 TYR A CD1   1 
ATOM   1954 C CD2   . TYR A 1 251 ? 23.003  -0.296  21.000  1.00 8.97  ? 462 TYR A CD2   1 
ATOM   1955 C CE1   . TYR A 1 251 ? 23.316  -2.699  19.640  1.00 8.74  ? 462 TYR A CE1   1 
ATOM   1956 C CE2   . TYR A 1 251 ? 24.249  -0.741  20.694  1.00 8.93  ? 462 TYR A CE2   1 
ATOM   1957 C CZ    . TYR A 1 251 ? 24.411  -1.943  20.017  1.00 8.73  ? 462 TYR A CZ    1 
ATOM   1958 O OH    . TYR A 1 251 ? 25.674  -2.395  19.725  1.00 9.25  ? 462 TYR A OH    1 
ATOM   1959 N N     . PHE A 1 252 ? 18.863  -0.011  23.814  1.00 10.76 ? 463 PHE A N     1 
ATOM   1960 C CA    . PHE A 1 252 ? 17.897  0.782   24.546  1.00 11.01 ? 463 PHE A CA    1 
ATOM   1961 C C     . PHE A 1 252 ? 18.562  2.028   25.176  1.00 11.50 ? 463 PHE A C     1 
ATOM   1962 O O     . PHE A 1 252 ? 19.750  1.993   25.552  1.00 10.74 ? 463 PHE A O     1 
ATOM   1963 C CB    . PHE A 1 252 ? 17.273  -0.056  25.693  1.00 11.02 ? 463 PHE A CB    1 
ATOM   1964 C CG    . PHE A 1 252 ? 16.520  -1.296  25.231  1.00 11.47 ? 463 PHE A CG    1 
ATOM   1965 C CD1   . PHE A 1 252 ? 15.178  -1.212  24.816  1.00 9.04  ? 463 PHE A CD1   1 
ATOM   1966 C CD2   . PHE A 1 252 ? 17.140  -2.529  25.215  1.00 10.02 ? 463 PHE A CD2   1 
ATOM   1967 C CE1   . PHE A 1 252 ? 14.486  -2.341  24.376  1.00 7.55  ? 463 PHE A CE1   1 
ATOM   1968 C CE2   . PHE A 1 252 ? 16.463  -3.652  24.784  1.00 10.26 ? 463 PHE A CE2   1 
ATOM   1969 C CZ    . PHE A 1 252 ? 15.107  -3.552  24.373  1.00 7.64  ? 463 PHE A CZ    1 
ATOM   1970 N N     . ALA A 1 253 ? 17.799  3.118   25.311  1.00 11.42 ? 464 ALA A N     1 
ATOM   1971 C CA    . ALA A 1 253 ? 18.283  4.353   26.012  1.00 10.92 ? 464 ALA A CA    1 
ATOM   1972 C C     . ALA A 1 253 ? 17.406  4.668   27.233  1.00 11.30 ? 464 ALA A C     1 
ATOM   1973 O O     . ALA A 1 253 ? 16.237  4.253   27.308  1.00 9.00  ? 464 ALA A O     1 
ATOM   1974 C CB    . ALA A 1 253 ? 18.316  5.576   25.045  1.00 11.50 ? 464 ALA A CB    1 
ATOM   1975 N N     . ASP A 1 254 ? 17.978  5.406   28.190  1.00 11.75 ? 465 ASP A N     1 
ATOM   1976 C CA    . ASP A 1 254 ? 17.185  5.945   29.297  1.00 12.06 ? 465 ASP A CA    1 
ATOM   1977 C C     . ASP A 1 254 ? 16.814  7.406   29.040  1.00 11.68 ? 465 ASP A C     1 
ATOM   1978 O O     . ASP A 1 254 ? 16.128  8.032   29.855  1.00 12.49 ? 465 ASP A O     1 
ATOM   1979 C CB    . ASP A 1 254 ? 17.868  5.703   30.655  1.00 12.69 ? 465 ASP A CB    1 
ATOM   1980 C CG    . ASP A 1 254 ? 19.230  6.339   30.771  1.00 12.79 ? 465 ASP A CG    1 
ATOM   1981 O OD1   . ASP A 1 254 ? 19.528  7.263   30.007  1.00 14.92 ? 465 ASP A OD1   1 
ATOM   1982 O OD2   . ASP A 1 254 ? 20.003  5.916   31.650  1.00 13.74 ? 465 ASP A OD2   1 
ATOM   1983 N N     . MET A 1 255 ? 17.236  7.932   27.897  1.00 11.09 ? 466 MET A N     1 
ATOM   1984 C CA    . MET A 1 255 ? 16.908  9.295   27.482  1.00 11.65 ? 466 MET A CA    1 
ATOM   1985 C C     . MET A 1 255 ? 16.044  9.205   26.239  1.00 11.50 ? 466 MET A C     1 
ATOM   1986 O O     . MET A 1 255 ? 16.516  8.743   25.180  1.00 11.64 ? 466 MET A O     1 
ATOM   1987 C CB    . MET A 1 255 ? 18.177  10.112  27.178  1.00 10.89 ? 466 MET A CB    1 
ATOM   1988 C CG    . MET A 1 255 ? 19.112  10.291  28.395  1.00 13.23 ? 466 MET A CG    1 
ATOM   1989 S SD    . MET A 1 255 ? 18.468  11.300  29.759  1.00 16.08 ? 466 MET A SD    1 
ATOM   1990 C CE    . MET A 1 255 ? 18.358  12.946  28.991  1.00 13.69 ? 466 MET A CE    1 
ATOM   1991 N N     . SER A 1 256 ? 14.798  9.669   26.371  1.00 11.35 ? 467 SER A N     1 
ATOM   1992 C CA    . SER A 1 256 ? 13.773  9.546   25.329  1.00 10.49 ? 467 SER A CA    1 
ATOM   1993 C C     . SER A 1 256 ? 14.265  10.005  23.952  1.00 10.32 ? 467 SER A C     1 
ATOM   1994 O O     . SER A 1 256 ? 13.989  9.390   22.914  1.00 9.70  ? 467 SER A O     1 
ATOM   1995 C CB    . SER A 1 256 ? 12.508  10.351  25.742  1.00 11.37 ? 467 SER A CB    1 
ATOM   1996 O OG    . SER A 1 256 ? 12.768  11.755  25.720  1.00 9.87  ? 467 SER A OG    1 
ATOM   1997 N N     . SER A 1 257 ? 15.029  11.096  23.919  1.00 10.67 ? 468 SER A N     1 
ATOM   1998 C CA    . SER A 1 257 ? 15.384  11.718  22.659  1.00 9.42  ? 468 SER A CA    1 
ATOM   1999 C C     . SER A 1 257 ? 16.565  11.011  22.003  1.00 8.96  ? 468 SER A C     1 
ATOM   2000 O O     . SER A 1 257 ? 16.714  11.083  20.800  1.00 8.83  ? 468 SER A O     1 
ATOM   2001 C CB    . SER A 1 257 ? 15.700  13.217  22.847  1.00 10.30 ? 468 SER A CB    1 
ATOM   2002 O OG    . SER A 1 257 ? 16.769  13.386  23.776  1.00 10.74 ? 468 SER A OG    1 
ATOM   2003 N N     . LYS A 1 258 ? 17.414  10.344  22.774  1.00 8.37  ? 469 LYS A N     1 
ATOM   2004 C CA    . LYS A 1 258 ? 18.447  9.506   22.174  1.00 7.87  ? 469 LYS A CA    1 
ATOM   2005 C C     . LYS A 1 258 ? 17.800  8.449   21.262  1.00 7.68  ? 469 LYS A C     1 
ATOM   2006 O O     . LYS A 1 258 ? 18.250  8.197   20.130  1.00 6.24  ? 469 LYS A O     1 
ATOM   2007 C CB    . LYS A 1 258 ? 19.289  8.825   23.229  1.00 8.69  ? 469 LYS A CB    1 
ATOM   2008 C CG    . LYS A 1 258 ? 20.418  7.987   22.643  1.00 9.35  ? 469 LYS A CG    1 
ATOM   2009 C CD    . LYS A 1 258 ? 21.463  7.548   23.670  1.00 9.61  ? 469 LYS A CD    1 
ATOM   2010 C CE    . LYS A 1 258 ? 22.551  6.667   23.040  1.00 10.98 ? 469 LYS A CE    1 
ATOM   2011 N NZ    . LYS A 1 258 ? 23.725  6.391   23.971  1.00 11.38 ? 469 LYS A NZ    1 
ATOM   2012 N N     . SER A 1 259 ? 16.733  7.848   21.756  1.00 7.74  ? 470 SER A N     1 
ATOM   2013 C CA    . SER A 1 259 ? 16.006  6.857   20.956  1.00 8.17  ? 470 SER A CA    1 
ATOM   2014 C C     . SER A 1 259 ? 15.191  7.518   19.872  1.00 8.90  ? 470 SER A C     1 
ATOM   2015 O O     . SER A 1 259 ? 15.160  7.032   18.735  1.00 9.42  ? 470 SER A O     1 
ATOM   2016 C CB    . SER A 1 259 ? 15.087  5.997   21.847  1.00 7.79  ? 470 SER A CB    1 
ATOM   2017 O OG    . SER A 1 259 ? 15.833  5.095   22.628  1.00 9.08  ? 470 SER A OG    1 
ATOM   2018 N N     . ALA A 1 260 ? 14.529  8.634   20.212  1.00 9.08  ? 471 ALA A N     1 
ATOM   2019 C CA    . ALA A 1 260 ? 13.720  9.360   19.272  1.00 9.15  ? 471 ALA A CA    1 
ATOM   2020 C C     . ALA A 1 260 ? 14.491  9.843   18.081  1.00 10.16 ? 471 ALA A C     1 
ATOM   2021 O O     . ALA A 1 260 ? 13.911  9.994   16.999  1.00 9.95  ? 471 ALA A O     1 
ATOM   2022 C CB    . ALA A 1 260 ? 12.988  10.576  19.961  1.00 8.32  ? 471 ALA A CB    1 
ATOM   2023 N N     . ASN A 1 261 ? 15.783  10.128  18.257  1.00 10.75 ? 472 ASN A N     1 
ATOM   2024 C CA    . ASN A 1 261 ? 16.619  10.447  17.102  1.00 11.36 ? 472 ASN A CA    1 
ATOM   2025 C C     . ASN A 1 261 ? 16.580  9.323   16.043  1.00 11.76 ? 472 ASN A C     1 
ATOM   2026 O O     . ASN A 1 261 ? 16.616  9.599   14.834  1.00 12.48 ? 472 ASN A O     1 
ATOM   2027 C CB    . ASN A 1 261 ? 18.055  10.778  17.507  1.00 11.06 ? 472 ASN A CB    1 
ATOM   2028 C CG    . ASN A 1 261 ? 18.168  12.099  18.265  1.00 11.30 ? 472 ASN A CG    1 
ATOM   2029 O OD1   . ASN A 1 261 ? 17.297  12.986  18.182  1.00 9.91  ? 472 ASN A OD1   1 
ATOM   2030 N ND2   . ASN A 1 261 ? 19.256  12.236  18.989  1.00 12.38 ? 472 ASN A ND2   1 
ATOM   2031 N N     . TYR A 1 262 ? 16.451  8.076   16.487  1.00 12.21 ? 473 TYR A N     1 
ATOM   2032 C CA    . TYR A 1 262 ? 16.409  6.917   15.547  1.00 12.24 ? 473 TYR A CA    1 
ATOM   2033 C C     . TYR A 1 262 ? 15.068  6.712   14.866  1.00 12.20 ? 473 TYR A C     1 
ATOM   2034 O O     . TYR A 1 262 ? 14.908  5.775   14.070  1.00 11.42 ? 473 TYR A O     1 
ATOM   2035 C CB    . TYR A 1 262 ? 16.895  5.643   16.252  1.00 12.59 ? 473 TYR A CB    1 
ATOM   2036 C CG    . TYR A 1 262 ? 18.387  5.711   16.470  1.00 13.79 ? 473 TYR A CG    1 
ATOM   2037 C CD1   . TYR A 1 262 ? 19.270  5.342   15.476  1.00 17.66 ? 473 TYR A CD1   1 
ATOM   2038 C CD2   . TYR A 1 262 ? 18.897  6.246   17.623  1.00 17.39 ? 473 TYR A CD2   1 
ATOM   2039 C CE1   . TYR A 1 262 ? 20.638  5.467   15.657  1.00 19.85 ? 473 TYR A CE1   1 
ATOM   2040 C CE2   . TYR A 1 262 ? 20.238  6.374   17.812  1.00 20.49 ? 473 TYR A CE2   1 
ATOM   2041 C CZ    . TYR A 1 262 ? 21.104  5.995   16.828  1.00 21.45 ? 473 TYR A CZ    1 
ATOM   2042 O OH    . TYR A 1 262 ? 22.449  6.131   17.058  1.00 26.79 ? 473 TYR A OH    1 
ATOM   2043 N N     . CYS A 1 263 ? 14.112  7.600   15.142  1.00 11.85 ? 474 CYS A N     1 
ATOM   2044 C CA    . CYS A 1 263 ? 12.863  7.631   14.412  1.00 12.09 ? 474 CYS A CA    1 
ATOM   2045 C C     . CYS A 1 263 ? 13.082  8.267   13.053  1.00 12.27 ? 474 CYS A C     1 
ATOM   2046 O O     . CYS A 1 263 ? 12.332  8.012   12.107  1.00 12.42 ? 474 CYS A O     1 
ATOM   2047 C CB    . CYS A 1 263 ? 11.813  8.437   15.167  1.00 12.63 ? 474 CYS A CB    1 
ATOM   2048 S SG    . CYS A 1 263 ? 11.310  7.709   16.692  1.00 11.55 ? 474 CYS A SG    1 
ATOM   2049 N N     . PHE A 1 264 ? 14.098  9.120   12.968  1.00 11.91 ? 475 PHE A N     1 
ATOM   2050 C CA    . PHE A 1 264 ? 14.387  9.885   11.761  1.00 12.99 ? 475 PHE A CA    1 
ATOM   2051 C C     . PHE A 1 264 ? 13.171  10.633  11.265  1.00 13.43 ? 475 PHE A C     1 
ATOM   2052 O O     . PHE A 1 264 ? 12.930  10.702  10.070  1.00 13.77 ? 475 PHE A O     1 
ATOM   2053 C CB    . PHE A 1 264 ? 15.007  8.991   10.685  1.00 12.24 ? 475 PHE A CB    1 
ATOM   2054 C CG    . PHE A 1 264 ? 16.357  8.533   11.046  1.00 13.24 ? 475 PHE A CG    1 
ATOM   2055 C CD1   . PHE A 1 264 ? 17.454  9.359   10.818  1.00 16.30 ? 475 PHE A CD1   1 
ATOM   2056 C CD2   . PHE A 1 264 ? 16.549  7.309   11.682  1.00 14.07 ? 475 PHE A CD2   1 
ATOM   2057 C CE1   . PHE A 1 264 ? 18.735  8.959   11.196  1.00 17.15 ? 475 PHE A CE1   1 
ATOM   2058 C CE2   . PHE A 1 264 ? 17.810  6.900   12.059  1.00 16.50 ? 475 PHE A CE2   1 
ATOM   2059 C CZ    . PHE A 1 264 ? 18.918  7.740   11.825  1.00 17.63 ? 475 PHE A CZ    1 
ATOM   2060 N N     . ALA A 1 265 ? 12.395  11.175  12.207  1.00 13.69 ? 476 ALA A N     1 
ATOM   2061 C CA    . ALA A 1 265 ? 11.304  12.092  11.885  1.00 14.64 ? 476 ALA A CA    1 
ATOM   2062 C C     . ALA A 1 265 ? 11.881  13.387  11.315  1.00 15.79 ? 476 ALA A C     1 
ATOM   2063 O O     . ALA A 1 265 ? 13.062  13.645  11.419  1.00 15.35 ? 476 ALA A O     1 
ATOM   2064 C CB    . ALA A 1 265 ? 10.463  12.413  13.120  1.00 13.62 ? 476 ALA A CB    1 
ATOM   2065 N N     . SER A 1 266 ? 11.030  14.215  10.744  1.00 17.37 ? 477 SER A N     1 
ATOM   2066 C CA    . SER A 1 266 ? 11.503  15.486  10.224  1.00 19.28 ? 477 SER A CA    1 
ATOM   2067 C C     . SER A 1 266 ? 10.336  16.445  10.121  1.00 20.47 ? 477 SER A C     1 
ATOM   2068 O O     . SER A 1 266 ? 9.186   16.079  10.310  1.00 20.56 ? 477 SER A O     1 
ATOM   2069 C CB    . SER A 1 266 ? 12.159  15.279  8.834   1.00 19.56 ? 477 SER A CB    1 
ATOM   2070 O OG    . SER A 1 266 ? 11.171  15.009  7.842   1.00 17.56 ? 477 SER A OG    1 
ATOM   2071 N N     . ARG A 1 267 ? 10.648  17.693  9.818   1.00 22.33 ? 478 ARG A N     1 
ATOM   2072 C CA    . ARG A 1 267 ? 9.630   18.699  9.549   1.00 22.77 ? 478 ARG A CA    1 
ATOM   2073 C C     . ARG A 1 267 ? 8.659   18.243  8.466   1.00 22.62 ? 478 ARG A C     1 
ATOM   2074 O O     . ARG A 1 267 ? 7.469   18.508  8.574   1.00 22.62 ? 478 ARG A O     1 
ATOM   2075 C CB    . ARG A 1 267 ? 10.291  20.049  9.199   1.00 23.52 ? 478 ARG A CB    1 
ATOM   2076 C CG    . ARG A 1 267 ? 11.309  19.940  8.116   1.00 25.19 ? 478 ARG A CG    1 
ATOM   2077 C CD    . ARG A 1 267 ? 12.246  21.152  8.023   1.00 29.68 ? 478 ARG A CD    1 
ATOM   2078 N NE    . ARG A 1 267 ? 13.122  20.963  6.862   1.00 31.89 ? 478 ARG A NE    1 
ATOM   2079 C CZ    . ARG A 1 267 ? 12.734  21.093  5.594   1.00 33.91 ? 478 ARG A CZ    1 
ATOM   2080 N NH1   . ARG A 1 267 ? 11.484  21.441  5.289   1.00 33.66 ? 478 ARG A NH1   1 
ATOM   2081 N NH2   . ARG A 1 267 ? 13.605  20.864  4.619   1.00 35.53 ? 478 ARG A NH2   1 
ATOM   2082 N N     . LEU A 1 268 ? 9.136   17.524  7.451   1.00 22.86 ? 479 LEU A N     1 
ATOM   2083 C CA    . LEU A 1 268 ? 8.230   16.936  6.436   1.00 23.12 ? 479 LEU A CA    1 
ATOM   2084 C C     . LEU A 1 268 ? 7.343   15.812  6.998   1.00 22.29 ? 479 LEU A C     1 
ATOM   2085 O O     . LEU A 1 268 ? 6.172   15.711  6.662   1.00 22.35 ? 479 LEU A O     1 
ATOM   2086 C CB    . LEU A 1 268 ? 9.024   16.330  5.252   1.00 23.99 ? 479 LEU A CB    1 
ATOM   2087 C CG    . LEU A 1 268 ? 9.849   17.139  4.217   1.00 28.17 ? 479 LEU A CG    1 
ATOM   2088 C CD1   . LEU A 1 268 ? 11.347  17.248  4.573   1.00 29.28 ? 479 LEU A CD1   1 
ATOM   2089 C CD2   . LEU A 1 268 ? 9.679   16.485  2.810   1.00 30.46 ? 479 LEU A CD2   1 
ATOM   2090 N N     . LYS A 1 269 ? 7.926   14.920  7.794   1.00 21.27 ? 480 LYS A N     1 
ATOM   2091 C CA    . LYS A 1 269 ? 7.186   13.749  8.323   1.00 20.49 ? 480 LYS A CA    1 
ATOM   2092 C C     . LYS A 1 269 ? 7.368   13.779  9.814   1.00 18.58 ? 480 LYS A C     1 
ATOM   2093 O O     . LYS A 1 269 ? 8.292   13.182  10.350  1.00 16.79 ? 480 LYS A O     1 
ATOM   2094 C CB    . LYS A 1 269 ? 7.755   12.435  7.765   1.00 20.94 ? 480 LYS A CB    1 
ATOM   2095 C CG    . LYS A 1 269 ? 7.970   12.394  6.250   1.00 23.91 ? 480 LYS A CG    1 
ATOM   2096 C CD    . LYS A 1 269 ? 6.872   11.649  5.490   1.00 27.47 ? 480 LYS A CD    1 
ATOM   2097 C CE    . LYS A 1 269 ? 5.692   12.515  5.189   1.00 28.72 ? 480 LYS A CE    1 
ATOM   2098 N NZ    . LYS A 1 269 ? 4.827   11.871  4.182   1.00 30.29 ? 480 LYS A NZ    1 
ATOM   2099 N N     . ASN A 1 270 ? 6.496   14.511  10.485  1.00 16.87 ? 481 ASN A N     1 
ATOM   2100 C CA    . ASN A 1 270 ? 6.720   14.844  11.865  1.00 16.62 ? 481 ASN A CA    1 
ATOM   2101 C C     . ASN A 1 270 ? 6.059   13.907  12.870  1.00 15.19 ? 481 ASN A C     1 
ATOM   2102 O O     . ASN A 1 270 ? 6.092   14.172  14.061  1.00 15.85 ? 481 ASN A O     1 
ATOM   2103 C CB    . ASN A 1 270 ? 6.357   16.327  12.122  1.00 17.15 ? 481 ASN A CB    1 
ATOM   2104 C CG    . ASN A 1 270 ? 4.860   16.569  12.277  1.00 18.04 ? 481 ASN A CG    1 
ATOM   2105 O OD1   . ASN A 1 270 ? 4.020   15.801  11.819  1.00 20.54 ? 481 ASN A OD1   1 
ATOM   2106 N ND2   . ASN A 1 270 ? 4.526   17.665  12.946  1.00 21.46 ? 481 ASN A ND2   1 
ATOM   2107 N N     . THR A 1 271 ? 5.505   12.788  12.406  1.00 13.99 ? 482 THR A N     1 
ATOM   2108 C CA    . THR A 1 271 ? 4.925   11.793  13.321  1.00 13.37 ? 482 THR A CA    1 
ATOM   2109 C C     . THR A 1 271 ? 5.803   10.555  13.395  1.00 12.14 ? 482 THR A C     1 
ATOM   2110 O O     . THR A 1 271 ? 6.130   9.973   12.370  1.00 13.05 ? 482 THR A O     1 
ATOM   2111 C CB    . THR A 1 271 ? 3.500   11.381  12.883  1.00 13.69 ? 482 THR A CB    1 
ATOM   2112 O OG1   . THR A 1 271 ? 2.666   12.528  12.917  1.00 15.89 ? 482 THR A OG1   1 
ATOM   2113 C CG2   . THR A 1 271 ? 2.923   10.336  13.829  1.00 13.98 ? 482 THR A CG2   1 
ATOM   2114 N N     . GLY A 1 272 ? 6.193   10.177  14.608  1.00 10.73 ? 483 GLY A N     1 
ATOM   2115 C CA    . GLY A 1 272 ? 6.981   8.985   14.856  1.00 10.33 ? 483 GLY A CA    1 
ATOM   2116 C C     . GLY A 1 272 ? 6.453   8.180   16.030  1.00 10.17 ? 483 GLY A C     1 
ATOM   2117 O O     . GLY A 1 272 ? 5.596   8.663   16.816  1.00 9.90  ? 483 GLY A O     1 
ATOM   2118 N N     . LEU A 1 273 ? 6.986   6.969   16.183  1.00 9.53  ? 484 LEU A N     1 
ATOM   2119 C CA    . LEU A 1 273 ? 6.630   6.142   17.314  1.00 9.74  ? 484 LEU A CA    1 
ATOM   2120 C C     . LEU A 1 273 ? 7.833   5.871   18.169  1.00 9.42  ? 484 LEU A C     1 
ATOM   2121 O O     . LEU A 1 273 ? 8.966   5.768   17.665  1.00 8.37  ? 484 LEU A O     1 
ATOM   2122 C CB    . LEU A 1 273 ? 6.023   4.816   16.840  1.00 9.66  ? 484 LEU A CB    1 
ATOM   2123 C CG    . LEU A 1 273 ? 4.808   4.890   15.903  1.00 11.72 ? 484 LEU A CG    1 
ATOM   2124 C CD1   . LEU A 1 273 ? 4.307   3.477   15.560  1.00 9.01  ? 484 LEU A CD1   1 
ATOM   2125 C CD2   . LEU A 1 273 ? 3.679   5.725   16.511  1.00 12.60 ? 484 LEU A CD2   1 
ATOM   2126 N N     . LEU A 1 274 ? 7.577   5.711   19.465  1.00 9.59  ? 485 LEU A N     1 
ATOM   2127 C CA    . LEU A 1 274 ? 8.593   5.330   20.417  1.00 9.50  ? 485 LEU A CA    1 
ATOM   2128 C C     . LEU A 1 274 ? 8.074   4.178   21.220  1.00 9.82  ? 485 LEU A C     1 
ATOM   2129 O O     . LEU A 1 274 ? 6.897   4.169   21.635  1.00 8.23  ? 485 LEU A O     1 
ATOM   2130 C CB    . LEU A 1 274 ? 8.891   6.449   21.408  1.00 10.11 ? 485 LEU A CB    1 
ATOM   2131 C CG    . LEU A 1 274 ? 9.971   7.444   21.094  1.00 10.97 ? 485 LEU A CG    1 
ATOM   2132 C CD1   . LEU A 1 274 ? 9.943   8.505   22.197  1.00 10.80 ? 485 LEU A CD1   1 
ATOM   2133 C CD2   . LEU A 1 274 ? 11.330  6.738   20.993  1.00 13.53 ? 485 LEU A CD2   1 
ATOM   2134 N N     . LEU A 1 275 ? 8.973   3.235   21.480  1.00 9.25  ? 486 LEU A N     1 
ATOM   2135 C CA    . LEU A 1 275 ? 8.625   2.029   22.197  1.00 9.30  ? 486 LEU A CA    1 
ATOM   2136 C C     . LEU A 1 275 ? 9.235   2.003   23.591  1.00 8.46  ? 486 LEU A C     1 
ATOM   2137 O O     . LEU A 1 275 ? 10.418  2.279   23.752  1.00 10.78 ? 486 LEU A O     1 
ATOM   2138 C CB    . LEU A 1 275 ? 9.105   0.819   21.383  1.00 9.10  ? 486 LEU A CB    1 
ATOM   2139 C CG    . LEU A 1 275 ? 8.796   -0.584  21.888  1.00 9.89  ? 486 LEU A CG    1 
ATOM   2140 C CD1   . LEU A 1 275 ? 7.275   -0.891  21.763  1.00 9.49  ? 486 LEU A CD1   1 
ATOM   2141 C CD2   . LEU A 1 275 ? 9.668   -1.624  21.119  1.00 11.09 ? 486 LEU A CD2   1 
ATOM   2142 N N     . LEU A 1 276 ? 8.435   1.647   24.593  1.00 8.70  ? 487 LEU A N     1 
ATOM   2143 C CA    . LEU A 1 276 ? 8.936   1.327   25.926  1.00 7.97  ? 487 LEU A CA    1 
ATOM   2144 C C     . LEU A 1 276 ? 8.816   -0.157  26.195  1.00 8.51  ? 487 LEU A C     1 
ATOM   2145 O O     . LEU A 1 276 ? 7.762   -0.762  25.921  1.00 7.65  ? 487 LEU A O     1 
ATOM   2146 C CB    . LEU A 1 276 ? 8.186   2.096   26.997  1.00 8.71  ? 487 LEU A CB    1 
ATOM   2147 C CG    . LEU A 1 276 ? 8.519   3.586   27.064  1.00 8.86  ? 487 LEU A CG    1 
ATOM   2148 C CD1   . LEU A 1 276 ? 7.512   4.304   27.931  1.00 10.73 ? 487 LEU A CD1   1 
ATOM   2149 C CD2   . LEU A 1 276 ? 9.946   3.768   27.587  1.00 7.82  ? 487 LEU A CD2   1 
ATOM   2150 N N     . SER A 1 277 ? 9.903   -0.724  26.728  1.00 8.11  ? 488 SER A N     1 
ATOM   2151 C CA    . SER A 1 277 ? 10.023  -2.141  26.988  1.00 8.38  ? 488 SER A CA    1 
ATOM   2152 C C     . SER A 1 277 ? 10.600  -2.335  28.376  1.00 8.58  ? 488 SER A C     1 
ATOM   2153 O O     . SER A 1 277 ? 11.384  -1.550  28.837  1.00 7.55  ? 488 SER A O     1 
ATOM   2154 C CB    . SER A 1 277 ? 10.951  -2.837  25.980  1.00 8.20  ? 488 SER A CB    1 
ATOM   2155 O OG    . SER A 1 277 ? 10.554  -2.627  24.617  1.00 8.12  ? 488 SER A OG    1 
ATOM   2156 N N     . GLU A 1 278 ? 10.151  -3.375  29.048  1.00 8.67  ? 489 GLU A N     1 
ATOM   2157 C CA    . GLU A 1 278 ? 10.797  -3.830  30.243  1.00 9.39  ? 489 GLU A CA    1 
ATOM   2158 C C     . GLU A 1 278 ? 12.034  -4.612  29.813  1.00 9.43  ? 489 GLU A C     1 
ATOM   2159 O O     . GLU A 1 278 ? 11.953  -5.543  29.009  1.00 10.43 ? 489 GLU A O     1 
ATOM   2160 C CB    . GLU A 1 278 ? 9.854   -4.714  31.037  1.00 9.45  ? 489 GLU A CB    1 
ATOM   2161 C CG    . GLU A 1 278 ? 8.610   -3.982  31.447  1.00 13.69 ? 489 GLU A CG    1 
ATOM   2162 C CD    . GLU A 1 278 ? 7.617   -4.843  32.206  1.00 17.88 ? 489 GLU A CD    1 
ATOM   2163 O OE1   . GLU A 1 278 ? 7.719   -6.084  32.126  1.00 20.73 ? 489 GLU A OE1   1 
ATOM   2164 O OE2   . GLU A 1 278 ? 6.706   -4.247  32.828  1.00 20.37 ? 489 GLU A OE2   1 
ATOM   2165 N N     . VAL A 1 279 ? 13.176  -4.231  30.342  1.00 9.75  ? 490 VAL A N     1 
ATOM   2166 C CA    . VAL A 1 279 ? 14.457  -4.833  29.949  1.00 9.82  ? 490 VAL A CA    1 
ATOM   2167 C C     . VAL A 1 279 ? 15.106  -5.453  31.164  1.00 10.59 ? 490 VAL A C     1 
ATOM   2168 O O     . VAL A 1 279 ? 15.361  -4.764  32.179  1.00 10.93 ? 490 VAL A O     1 
ATOM   2169 C CB    . VAL A 1 279 ? 15.367  -3.803  29.286  1.00 9.71  ? 490 VAL A CB    1 
ATOM   2170 C CG1   . VAL A 1 279 ? 16.648  -4.430  28.788  1.00 10.79 ? 490 VAL A CG1   1 
ATOM   2171 C CG2   . VAL A 1 279 ? 14.599  -3.093  28.144  1.00 9.64  ? 490 VAL A CG2   1 
ATOM   2172 N N     . ALA A 1 280 ? 15.315  -6.770  31.089  1.00 10.37 ? 491 ALA A N     1 
ATOM   2173 C CA    . ALA A 1 280 ? 15.940  -7.499  32.165  1.00 11.89 ? 491 ALA A CA    1 
ATOM   2174 C C     . ALA A 1 280 ? 17.464  -7.415  32.037  1.00 12.40 ? 491 ALA A C     1 
ATOM   2175 O O     . ALA A 1 280 ? 18.095  -8.276  31.408  1.00 13.19 ? 491 ALA A O     1 
ATOM   2176 C CB    . ALA A 1 280 ? 15.466  -8.925  32.176  1.00 11.47 ? 491 ALA A CB    1 
ATOM   2177 N N     . LEU A 1 281 ? 18.034  -6.379  32.645  1.00 12.42 ? 492 LEU A N     1 
ATOM   2178 C CA    . LEU A 1 281 ? 19.465  -6.069  32.524  1.00 13.30 ? 492 LEU A CA    1 
ATOM   2179 C C     . LEU A 1 281 ? 20.353  -7.020  33.287  1.00 14.26 ? 492 LEU A C     1 
ATOM   2180 O O     . LEU A 1 281 ? 21.475  -7.287  32.859  1.00 12.99 ? 492 LEU A O     1 
ATOM   2181 C CB    . LEU A 1 281 ? 19.785  -4.645  32.973  1.00 13.25 ? 492 LEU A CB    1 
ATOM   2182 C CG    . LEU A 1 281 ? 19.112  -3.524  32.181  1.00 12.56 ? 492 LEU A CG    1 
ATOM   2183 C CD1   . LEU A 1 281 ? 19.366  -2.182  32.846  1.00 10.86 ? 492 LEU A CD1   1 
ATOM   2184 C CD2   . LEU A 1 281 ? 19.634  -3.515  30.726  1.00 9.51  ? 492 LEU A CD2   1 
ATOM   2185 N N     . GLY A 1 282 ? 19.868  -7.567  34.399  1.00 15.78 ? 493 GLY A N     1 
ATOM   2186 C CA    . GLY A 1 282 ? 20.746  -8.398  35.208  1.00 16.85 ? 493 GLY A CA    1 
ATOM   2187 C C     . GLY A 1 282 ? 21.958  -7.592  35.629  1.00 17.97 ? 493 GLY A C     1 
ATOM   2188 O O     . GLY A 1 282 ? 21.851  -6.424  35.932  1.00 18.27 ? 493 GLY A O     1 
ATOM   2189 N N     . GLN A 1 283 ? 23.123  -8.221  35.635  1.00 19.73 ? 494 GLN A N     1 
ATOM   2190 C CA    . GLN A 1 283 ? 24.376  -7.529  35.921  1.00 20.83 ? 494 GLN A CA    1 
ATOM   2191 C C     . GLN A 1 283 ? 24.911  -6.948  34.632  1.00 20.62 ? 494 GLN A C     1 
ATOM   2192 O O     . GLN A 1 283 ? 25.160  -7.707  33.678  1.00 20.46 ? 494 GLN A O     1 
ATOM   2193 C CB    . GLN A 1 283 ? 25.425  -8.518  36.461  1.00 21.89 ? 494 GLN A CB    1 
ATOM   2194 C CG    . GLN A 1 283 ? 25.192  -8.985  37.878  1.00 25.23 ? 494 GLN A CG    1 
ATOM   2195 C CD    . GLN A 1 283 ? 25.473  -7.872  38.857  1.00 29.37 ? 494 GLN A CD    1 
ATOM   2196 O OE1   . GLN A 1 283 ? 24.579  -7.432  39.569  1.00 32.86 ? 494 GLN A OE1   1 
ATOM   2197 N NE2   . GLN A 1 283 ? 26.721  -7.369  38.853  1.00 31.60 ? 494 GLN A NE2   1 
ATOM   2198 N N     . CYS A 1 284 ? 25.093  -5.629  34.605  1.00 20.17 ? 495 CYS A N     1 
ATOM   2199 C CA    . CYS A 1 284 ? 25.651  -4.959  33.446  1.00 20.62 ? 495 CYS A CA    1 
ATOM   2200 C C     . CYS A 1 284 ? 27.187  -4.990  33.463  1.00 20.96 ? 495 CYS A C     1 
ATOM   2201 O O     . CYS A 1 284 ? 27.829  -4.724  34.492  1.00 20.03 ? 495 CYS A O     1 
ATOM   2202 C CB    . CYS A 1 284 ? 25.221  -3.480  33.394  1.00 20.75 ? 495 CYS A CB    1 
ATOM   2203 S SG    . CYS A 1 284 ? 23.435  -3.137  33.428  1.00 22.10 ? 495 CYS A SG    1 
ATOM   2204 N N     . ASN A 1 285 ? 27.767  -5.276  32.303  1.00 20.74 ? 496 ASN A N     1 
ATOM   2205 C CA    . ASN A 1 285 ? 29.177  -5.012  32.082  1.00 20.73 ? 496 ASN A CA    1 
ATOM   2206 C C     . ASN A 1 285 ? 29.288  -3.582  31.563  1.00 21.42 ? 496 ASN A C     1 
ATOM   2207 O O     . ASN A 1 285 ? 28.800  -3.278  30.465  1.00 21.23 ? 496 ASN A O     1 
ATOM   2208 C CB    . ASN A 1 285 ? 29.760  -5.998  31.079  1.00 20.68 ? 496 ASN A CB    1 
ATOM   2209 C CG    . ASN A 1 285 ? 31.266  -5.915  30.995  1.00 20.67 ? 496 ASN A CG    1 
ATOM   2210 O OD1   . ASN A 1 285 ? 31.937  -5.815  32.007  1.00 17.83 ? 496 ASN A OD1   1 
ATOM   2211 N ND2   . ASN A 1 285 ? 31.801  -5.970  29.789  1.00 20.73 ? 496 ASN A ND2   1 
ATOM   2212 N N     . GLU A 1 286 ? 29.923  -2.706  32.342  1.00 20.99 ? 497 GLU A N     1 
ATOM   2213 C CA    . GLU A 1 286 ? 29.922  -1.297  32.017  1.00 21.44 ? 497 GLU A CA    1 
ATOM   2214 C C     . GLU A 1 286 ? 31.148  -0.970  31.194  1.00 21.72 ? 497 GLU A C     1 
ATOM   2215 O O     . GLU A 1 286 ? 32.241  -1.368  31.543  1.00 21.63 ? 497 GLU A O     1 
ATOM   2216 C CB    . GLU A 1 286 ? 29.851  -0.449  33.290  1.00 21.71 ? 497 GLU A CB    1 
ATOM   2217 C CG    . GLU A 1 286 ? 28.625  -0.753  34.142  1.00 22.14 ? 497 GLU A CG    1 
ATOM   2218 C CD    . GLU A 1 286 ? 28.524  0.129   35.390  1.00 25.14 ? 497 GLU A CD    1 
ATOM   2219 O OE1   . GLU A 1 286 ? 29.407  0.968   35.635  1.00 25.73 ? 497 GLU A OE1   1 
ATOM   2220 O OE2   . GLU A 1 286 ? 27.540  -0.018  36.132  1.00 28.18 ? 497 GLU A OE2   1 
ATOM   2221 N N     . LEU A 1 287 ? 30.944  -0.283  30.071  1.00 21.60 ? 498 LEU A N     1 
ATOM   2222 C CA    . LEU A 1 287 ? 32.017  0.062   29.155  1.00 21.21 ? 498 LEU A CA    1 
ATOM   2223 C C     . LEU A 1 287 ? 32.008  1.568   28.874  1.00 22.40 ? 498 LEU A C     1 
ATOM   2224 O O     . LEU A 1 287 ? 30.948  2.229   28.878  1.00 22.04 ? 498 LEU A O     1 
ATOM   2225 C CB    . LEU A 1 287 ? 31.887  -0.722  27.849  1.00 20.35 ? 498 LEU A CB    1 
ATOM   2226 C CG    . LEU A 1 287 ? 32.154  -2.226  27.912  1.00 19.60 ? 498 LEU A CG    1 
ATOM   2227 C CD1   . LEU A 1 287 ? 32.028  -2.844  26.517  1.00 16.94 ? 498 LEU A CD1   1 
ATOM   2228 C CD2   . LEU A 1 287 ? 33.561  -2.523  28.513  1.00 15.92 ? 498 LEU A CD2   1 
ATOM   2229 N N     . LEU A 1 288 ? 33.195  2.096   28.596  1.00 23.87 ? 499 LEU A N     1 
ATOM   2230 C CA    . LEU A 1 288 ? 33.401  3.540   28.441  1.00 24.75 ? 499 LEU A CA    1 
ATOM   2231 C C     . LEU A 1 288 ? 33.552  3.959   27.012  1.00 24.64 ? 499 LEU A C     1 
ATOM   2232 O O     . LEU A 1 288 ? 33.308  5.107   26.689  1.00 25.35 ? 499 LEU A O     1 
ATOM   2233 C CB    . LEU A 1 288 ? 34.639  3.987   29.218  1.00 25.54 ? 499 LEU A CB    1 
ATOM   2234 C CG    . LEU A 1 288 ? 34.419  4.232   30.706  1.00 26.74 ? 499 LEU A CG    1 
ATOM   2235 C CD1   . LEU A 1 288 ? 35.766  4.143   31.458  1.00 28.89 ? 499 LEU A CD1   1 
ATOM   2236 C CD2   . LEU A 1 288 ? 33.785  5.603   30.906  1.00 28.46 ? 499 LEU A CD2   1 
ATOM   2237 N N     . GLU A 1 289 ? 34.006  3.060   26.160  1.00 24.60 ? 500 GLU A N     1 
ATOM   2238 C CA    . GLU A 1 289 ? 34.072  3.367   24.735  1.00 24.50 ? 500 GLU A CA    1 
ATOM   2239 C C     . GLU A 1 289 ? 33.676  2.165   23.896  1.00 22.54 ? 500 GLU A C     1 
ATOM   2240 O O     . GLU A 1 289 ? 33.524  1.056   24.406  1.00 21.89 ? 500 GLU A O     1 
ATOM   2241 C CB    . GLU A 1 289 ? 35.472  3.855   24.351  1.00 24.78 ? 500 GLU A CB    1 
ATOM   2242 C CG    . GLU A 1 289 ? 36.518  2.782   24.340  1.00 27.37 ? 500 GLU A CG    1 
ATOM   2243 C CD    . GLU A 1 289 ? 37.941  3.347   24.277  1.00 30.63 ? 500 GLU A CD    1 
ATOM   2244 O OE1   . GLU A 1 289 ? 38.132  4.552   23.967  1.00 31.47 ? 500 GLU A OE1   1 
ATOM   2245 O OE2   . GLU A 1 289 ? 38.867  2.561   24.538  1.00 32.41 ? 500 GLU A OE2   1 
ATOM   2246 N N     . ALA A 1 290 ? 33.535  2.416   22.606  1.00 21.60 ? 501 ALA A N     1 
ATOM   2247 C CA    . ALA A 1 290 ? 33.016  1.444   21.654  1.00 20.57 ? 501 ALA A CA    1 
ATOM   2248 C C     . ALA A 1 290 ? 33.800  0.136   21.700  1.00 19.69 ? 501 ALA A C     1 
ATOM   2249 O O     . ALA A 1 290 ? 35.014  0.120   21.889  1.00 18.86 ? 501 ALA A O     1 
ATOM   2250 C CB    . ALA A 1 290 ? 33.040  2.027   20.267  1.00 20.09 ? 501 ALA A CB    1 
ATOM   2251 N N     . ASN A 1 291 ? 33.077  -0.965  21.576  1.00 18.90 ? 502 ASN A N     1 
ATOM   2252 C CA    . ASN A 1 291 ? 33.699  -2.260  21.340  1.00 18.33 ? 502 ASN A CA    1 
ATOM   2253 C C     . ASN A 1 291 ? 32.698  -3.193  20.717  1.00 17.27 ? 502 ASN A C     1 
ATOM   2254 O O     . ASN A 1 291 ? 31.865  -3.733  21.421  1.00 16.61 ? 502 ASN A O     1 
ATOM   2255 C CB    . ASN A 1 291 ? 34.216  -2.882  22.626  1.00 18.93 ? 502 ASN A CB    1 
ATOM   2256 C CG    . ASN A 1 291 ? 35.041  -4.125  22.368  1.00 19.69 ? 502 ASN A CG    1 
ATOM   2257 O OD1   . ASN A 1 291 ? 35.099  -4.623  21.244  1.00 23.43 ? 502 ASN A OD1   1 
ATOM   2258 N ND2   . ASN A 1 291 ? 35.696  -4.623  23.400  1.00 22.18 ? 502 ASN A ND2   1 
ATOM   2259 N N     . PRO A 1 292 ? 32.756  -3.362  19.392  1.00 17.21 ? 503 PRO A N     1 
ATOM   2260 C CA    . PRO A 1 292 ? 31.851  -4.273  18.714  1.00 16.90 ? 503 PRO A CA    1 
ATOM   2261 C C     . PRO A 1 292 ? 31.913  -5.691  19.242  1.00 16.50 ? 503 PRO A C     1 
ATOM   2262 O O     . PRO A 1 292 ? 30.962  -6.429  19.044  1.00 15.89 ? 503 PRO A O     1 
ATOM   2263 C CB    . PRO A 1 292 ? 32.342  -4.231  17.283  1.00 16.78 ? 503 PRO A CB    1 
ATOM   2264 C CG    . PRO A 1 292 ? 32.920  -2.886  17.154  1.00 17.77 ? 503 PRO A CG    1 
ATOM   2265 C CD    . PRO A 1 292 ? 33.624  -2.673  18.419  1.00 17.82 ? 503 PRO A CD    1 
ATOM   2266 N N     . LYS A 1 293 ? 33.005  -6.052  19.919  1.00 16.53 ? 504 LYS A N     1 
ATOM   2267 C CA    . LYS A 1 293 ? 33.181  -7.419  20.452  1.00 17.33 ? 504 LYS A CA    1 
ATOM   2268 C C     . LYS A 1 293 ? 32.737  -7.569  21.902  1.00 17.06 ? 504 LYS A C     1 
ATOM   2269 O O     . LYS A 1 293 ? 32.978  -8.597  22.548  1.00 16.76 ? 504 LYS A O     1 
ATOM   2270 C CB    . LYS A 1 293 ? 34.621  -7.900  20.221  1.00 17.96 ? 504 LYS A CB    1 
ATOM   2271 C CG    . LYS A 1 293 ? 34.986  -7.750  18.731  1.00 21.02 ? 504 LYS A CG    1 
ATOM   2272 C CD    . LYS A 1 293 ? 36.013  -8.765  18.230  1.00 28.04 ? 504 LYS A CD    1 
ATOM   2273 C CE    . LYS A 1 293 ? 35.870  -9.003  16.719  1.00 29.49 ? 504 LYS A CE    1 
ATOM   2274 N NZ    . LYS A 1 293 ? 34.528  -9.615  16.407  1.00 34.23 ? 504 LYS A NZ    1 
ATOM   2275 N N     . ALA A 1 294 ? 31.989  -6.575  22.379  1.00 16.43 ? 505 ALA A N     1 
ATOM   2276 C CA    . ALA A 1 294 ? 31.555  -6.530  23.750  1.00 15.93 ? 505 ALA A CA    1 
ATOM   2277 C C     . ALA A 1 294 ? 30.788  -7.770  24.185  1.00 15.94 ? 505 ALA A C     1 
ATOM   2278 O O     . ALA A 1 294 ? 30.841  -8.121  25.340  1.00 16.05 ? 505 ALA A O     1 
ATOM   2279 C CB    . ALA A 1 294 ? 30.720  -5.284  23.997  1.00 15.62 ? 505 ALA A CB    1 
ATOM   2280 N N     . GLU A 1 295 ? 30.087  -8.446  23.282  1.00 16.28 ? 506 GLU A N     1 
ATOM   2281 C CA    . GLU A 1 295 ? 29.266  -9.556  23.719  1.00 16.49 ? 506 GLU A CA    1 
ATOM   2282 C C     . GLU A 1 295 ? 30.141  -10.643 24.324  1.00 16.91 ? 506 GLU A C     1 
ATOM   2283 O O     . GLU A 1 295 ? 29.730  -11.307 25.253  1.00 16.25 ? 506 GLU A O     1 
ATOM   2284 C CB    . GLU A 1 295 ? 28.419  -10.136 22.607  1.00 16.25 ? 506 GLU A CB    1 
ATOM   2285 C CG    . GLU A 1 295 ? 27.441  -11.188 23.114  1.00 15.58 ? 506 GLU A CG    1 
ATOM   2286 C CD    . GLU A 1 295 ? 26.535  -11.733 22.036  1.00 14.80 ? 506 GLU A CD    1 
ATOM   2287 O OE1   . GLU A 1 295 ? 26.667  -11.311 20.857  1.00 16.07 ? 506 GLU A OE1   1 
ATOM   2288 O OE2   . GLU A 1 295 ? 25.701  -12.623 22.362  1.00 15.82 ? 506 GLU A OE2   1 
ATOM   2289 N N     . GLY A 1 296 ? 31.333  -10.813 23.781  1.00 18.41 ? 507 GLY A N     1 
ATOM   2290 C CA    . GLY A 1 296 ? 32.274  -11.834 24.281  1.00 19.40 ? 507 GLY A CA    1 
ATOM   2291 C C     . GLY A 1 296 ? 32.886  -11.476 25.621  1.00 20.40 ? 507 GLY A C     1 
ATOM   2292 O O     . GLY A 1 296 ? 33.557  -12.316 26.242  1.00 20.83 ? 507 GLY A O     1 
ATOM   2293 N N     . LEU A 1 297 ? 32.722  -10.224 26.052  1.00 20.09 ? 508 LEU A N     1 
ATOM   2294 C CA    . LEU A 1 297 ? 33.232  -9.790  27.352  1.00 20.95 ? 508 LEU A CA    1 
ATOM   2295 C C     . LEU A 1 297 ? 32.270  -10.023 28.521  1.00 21.62 ? 508 LEU A C     1 
ATOM   2296 O O     . LEU A 1 297 ? 32.652  -9.841  29.670  1.00 21.47 ? 508 LEU A O     1 
ATOM   2297 C CB    . LEU A 1 297 ? 33.604  -8.306  27.308  1.00 21.12 ? 508 LEU A CB    1 
ATOM   2298 C CG    . LEU A 1 297 ? 34.660  -7.901  26.272  1.00 21.41 ? 508 LEU A CG    1 
ATOM   2299 C CD1   . LEU A 1 297 ? 34.896  -6.397  26.380  1.00 23.84 ? 508 LEU A CD1   1 
ATOM   2300 C CD2   . LEU A 1 297 ? 35.969  -8.702  26.470  1.00 22.61 ? 508 LEU A CD2   1 
ATOM   2301 N N     . LEU A 1 298 ? 31.028  -10.425 28.253  1.00 21.88 ? 509 LEU A N     1 
ATOM   2302 C CA    . LEU A 1 298 ? 30.067  -10.560 29.337  1.00 22.25 ? 509 LEU A CA    1 
ATOM   2303 C C     . LEU A 1 298 ? 30.538  -11.539 30.406  1.00 23.55 ? 509 LEU A C     1 
ATOM   2304 O O     . LEU A 1 298 ? 30.369  -11.264 31.573  1.00 22.42 ? 509 LEU A O     1 
ATOM   2305 C CB    . LEU A 1 298 ? 28.711  -11.033 28.830  1.00 21.77 ? 509 LEU A CB    1 
ATOM   2306 C CG    . LEU A 1 298 ? 27.921  -10.054 27.970  1.00 21.08 ? 509 LEU A CG    1 
ATOM   2307 C CD1   . LEU A 1 298 ? 26.679  -10.772 27.467  1.00 19.46 ? 509 LEU A CD1   1 
ATOM   2308 C CD2   . LEU A 1 298 ? 27.561  -8.789  28.757  1.00 17.81 ? 509 LEU A CD2   1 
ATOM   2309 N N     . GLN A 1 299 ? 31.063  -12.690 29.981  1.00 24.96 ? 510 GLN A N     1 
ATOM   2310 C CA    . GLN A 1 299 ? 31.548  -13.737 30.900  1.00 26.68 ? 510 GLN A CA    1 
ATOM   2311 C C     . GLN A 1 299 ? 30.536  -13.977 32.027  1.00 27.38 ? 510 GLN A C     1 
ATOM   2312 O O     . GLN A 1 299 ? 30.842  -13.804 33.214  1.00 28.42 ? 510 GLN A O     1 
ATOM   2313 C CB    . GLN A 1 299 ? 32.921  -13.340 31.463  1.00 27.36 ? 510 GLN A CB    1 
ATOM   2314 C CG    . GLN A 1 299 ? 33.986  -13.001 30.387  1.00 29.06 ? 510 GLN A CG    1 
ATOM   2315 C CD    . GLN A 1 299 ? 34.729  -14.221 29.872  1.00 33.46 ? 510 GLN A CD    1 
ATOM   2316 O OE1   . GLN A 1 299 ? 34.131  -15.275 29.637  1.00 36.21 ? 510 GLN A OE1   1 
ATOM   2317 N NE2   . GLN A 1 299 ? 36.050  -14.090 29.700  1.00 35.82 ? 510 GLN A NE2   1 
ATOM   2318 N N     . GLY A 1 300 ? 29.302  -14.281 31.633  1.00 27.81 ? 511 GLY A N     1 
ATOM   2319 C CA    . GLY A 1 300 ? 28.224  -14.552 32.588  1.00 27.99 ? 511 GLY A CA    1 
ATOM   2320 C C     . GLY A 1 300 ? 27.344  -13.383 32.999  1.00 27.17 ? 511 GLY A C     1 
ATOM   2321 O O     . GLY A 1 300 ? 26.243  -13.611 33.462  1.00 28.12 ? 511 GLY A O     1 
ATOM   2322 N N     . LYS A 1 301 ? 27.820  -12.144 32.875  1.00 26.07 ? 512 LYS A N     1 
ATOM   2323 C CA    . LYS A 1 301 ? 26.950  -10.971 33.076  1.00 24.65 ? 512 LYS A CA    1 
ATOM   2324 C C     . LYS A 1 301 ? 25.893  -10.950 31.998  1.00 22.78 ? 512 LYS A C     1 
ATOM   2325 O O     . LYS A 1 301 ? 26.011  -11.674 31.021  1.00 22.43 ? 512 LYS A O     1 
ATOM   2326 C CB    . LYS A 1 301 ? 27.749  -9.672  33.085  1.00 25.32 ? 512 LYS A CB    1 
ATOM   2327 C CG    . LYS A 1 301 ? 28.620  -9.553  34.323  1.00 26.76 ? 512 LYS A CG    1 
ATOM   2328 C CD    . LYS A 1 301 ? 29.370  -8.261  34.374  1.00 26.98 ? 512 LYS A CD    1 
ATOM   2329 C CE    . LYS A 1 301 ? 30.104  -8.104  35.714  1.00 28.00 ? 512 LYS A CE    1 
ATOM   2330 N NZ    . LYS A 1 301 ? 30.304  -6.657  36.058  1.00 28.40 ? 512 LYS A NZ    1 
ATOM   2331 N N     . HIS A 1 302 ? 24.844  -10.149 32.167  1.00 21.07 ? 513 HIS A N     1 
ATOM   2332 C CA    . HIS A 1 302 ? 23.642  -10.301 31.310  1.00 19.88 ? 513 HIS A CA    1 
ATOM   2333 C C     . HIS A 1 302 ? 23.420  -9.189  30.294  1.00 18.39 ? 513 HIS A C     1 
ATOM   2334 O O     . HIS A 1 302 ? 22.559  -9.307  29.414  1.00 18.10 ? 513 HIS A O     1 
ATOM   2335 C CB    . HIS A 1 302 ? 22.392  -10.447 32.184  1.00 19.28 ? 513 HIS A CB    1 
ATOM   2336 C CG    . HIS A 1 302 ? 22.566  -11.419 33.305  1.00 20.76 ? 513 HIS A CG    1 
ATOM   2337 N ND1   . HIS A 1 302 ? 22.976  -11.032 34.559  1.00 19.85 ? 513 HIS A ND1   1 
ATOM   2338 C CD2   . HIS A 1 302 ? 22.427  -12.768 33.351  1.00 20.71 ? 513 HIS A CD2   1 
ATOM   2339 C CE1   . HIS A 1 302 ? 23.064  -12.097 35.341  1.00 22.34 ? 513 HIS A CE1   1 
ATOM   2340 N NE2   . HIS A 1 302 ? 22.742  -13.164 34.631  1.00 22.13 ? 513 HIS A NE2   1 
ATOM   2341 N N     . SER A 1 303 ? 24.159  -8.100  30.421  1.00 17.27 ? 514 SER A N     1 
ATOM   2342 C CA    . SER A 1 303 ? 23.933  -6.947  29.541  1.00 16.53 ? 514 SER A CA    1 
ATOM   2343 C C     . SER A 1 303 ? 25.187  -6.113  29.469  1.00 15.66 ? 514 SER A C     1 
ATOM   2344 O O     . SER A 1 303 ? 26.045  -6.217  30.329  1.00 16.04 ? 514 SER A O     1 
ATOM   2345 C CB    . SER A 1 303 ? 22.754  -6.102  30.063  1.00 15.44 ? 514 SER A CB    1 
ATOM   2346 O OG    . SER A 1 303 ? 22.989  -5.648  31.395  1.00 16.23 ? 514 SER A OG    1 
ATOM   2347 N N     . THR A 1 304 ? 25.301  -5.303  28.432  1.00 15.28 ? 515 THR A N     1 
ATOM   2348 C CA    . THR A 1 304 ? 26.354  -4.291  28.349  1.00 15.16 ? 515 THR A CA    1 
ATOM   2349 C C     . THR A 1 304 ? 25.696  -2.935  28.582  1.00 15.59 ? 515 THR A C     1 
ATOM   2350 O O     . THR A 1 304 ? 24.597  -2.682  28.068  1.00 14.83 ? 515 THR A O     1 
ATOM   2351 C CB    . THR A 1 304 ? 27.000  -4.273  26.979  1.00 15.14 ? 515 THR A CB    1 
ATOM   2352 O OG1   . THR A 1 304 ? 27.584  -5.545  26.694  1.00 14.23 ? 515 THR A OG1   1 
ATOM   2353 C CG2   . THR A 1 304 ? 28.076  -3.204  26.877  1.00 14.33 ? 515 THR A CG2   1 
ATOM   2354 N N     . LYS A 1 305 ? 26.341  -2.095  29.381  1.00 15.93 ? 516 LYS A N     1 
ATOM   2355 C CA    . LYS A 1 305 ? 25.903  -0.727  29.574  1.00 16.62 ? 516 LYS A CA    1 
ATOM   2356 C C     . LYS A 1 305 ? 26.987  0.227   29.081  1.00 17.28 ? 516 LYS A C     1 
ATOM   2357 O O     . LYS A 1 305 ? 28.080  0.295   29.650  1.00 18.21 ? 516 LYS A O     1 
ATOM   2358 C CB    . LYS A 1 305 ? 25.579  -0.444  31.042  1.00 16.42 ? 516 LYS A CB    1 
ATOM   2359 C CG    . LYS A 1 305 ? 25.189  1.036   31.285  1.00 16.40 ? 516 LYS A CG    1 
ATOM   2360 C CD    . LYS A 1 305 ? 24.765  1.279   32.712  1.00 16.64 ? 516 LYS A CD    1 
ATOM   2361 C CE    . LYS A 1 305 ? 24.302  2.730   32.937  1.00 14.55 ? 516 LYS A CE    1 
ATOM   2362 N NZ    . LYS A 1 305 ? 23.902  2.877   34.369  1.00 13.83 ? 516 LYS A NZ    1 
ATOM   2363 N N     . GLY A 1 306 ? 26.705  0.940   27.999  1.00 17.82 ? 517 GLY A N     1 
ATOM   2364 C CA    . GLY A 1 306 ? 27.587  2.013   27.543  1.00 17.93 ? 517 GLY A CA    1 
ATOM   2365 C C     . GLY A 1 306 ? 27.379  3.201   28.457  1.00 18.18 ? 517 GLY A C     1 
ATOM   2366 O O     . GLY A 1 306 ? 26.247  3.699   28.548  1.00 18.01 ? 517 GLY A O     1 
ATOM   2367 N N     . LEU A 1 307 ? 28.440  3.644   29.155  1.00 18.35 ? 518 LEU A N     1 
ATOM   2368 C CA    . LEU A 1 307 ? 28.312  4.697   30.193  1.00 18.58 ? 518 LEU A CA    1 
ATOM   2369 C C     . LEU A 1 307 ? 28.303  6.073   29.572  1.00 18.84 ? 518 LEU A C     1 
ATOM   2370 O O     . LEU A 1 307 ? 29.201  6.405   28.812  1.00 18.92 ? 518 LEU A O     1 
ATOM   2371 C CB    . LEU A 1 307 ? 29.431  4.622   31.250  1.00 18.70 ? 518 LEU A CB    1 
ATOM   2372 C CG    . LEU A 1 307 ? 29.485  3.377   32.133  1.00 19.11 ? 518 LEU A CG    1 
ATOM   2373 C CD1   . LEU A 1 307 ? 30.556  3.473   33.225  1.00 22.42 ? 518 LEU A CD1   1 
ATOM   2374 C CD2   . LEU A 1 307 ? 28.086  3.060   32.753  1.00 20.55 ? 518 LEU A CD2   1 
ATOM   2375 N N     . GLY A 1 308 ? 27.278  6.865   29.888  1.00 19.29 ? 519 GLY A N     1 
ATOM   2376 C CA    . GLY A 1 308 ? 27.177  8.244   29.401  1.00 19.82 ? 519 GLY A CA    1 
ATOM   2377 C C     . GLY A 1 308 ? 27.659  9.261   30.438  1.00 19.98 ? 519 GLY A C     1 
ATOM   2378 O O     . GLY A 1 308 ? 27.795  8.933   31.609  1.00 18.87 ? 519 GLY A O     1 
ATOM   2379 N N     . LYS A 1 309 ? 27.915  10.483  29.983  1.00 20.75 ? 520 LYS A N     1 
ATOM   2380 C CA    . LYS A 1 309 ? 28.360  11.589  30.847  1.00 22.17 ? 520 LYS A CA    1 
ATOM   2381 C C     . LYS A 1 309 ? 27.207  12.174  31.663  1.00 22.20 ? 520 LYS A C     1 
ATOM   2382 O O     . LYS A 1 309 ? 27.425  12.804  32.716  1.00 22.44 ? 520 LYS A O     1 
ATOM   2383 C CB    . LYS A 1 309 ? 28.982  12.716  29.991  1.00 22.45 ? 520 LYS A CB    1 
ATOM   2384 C CG    . LYS A 1 309 ? 30.446  12.467  29.635  1.00 25.97 ? 520 LYS A CG    1 
ATOM   2385 C CD    . LYS A 1 309 ? 30.801  12.834  28.190  1.00 28.44 ? 520 LYS A CD    1 
ATOM   2386 C CE    . LYS A 1 309 ? 30.658  14.327  27.866  1.00 29.23 ? 520 LYS A CE    1 
ATOM   2387 N NZ    . LYS A 1 309 ? 30.742  14.500  26.371  1.00 29.85 ? 520 LYS A NZ    1 
ATOM   2388 N N     . MET A 1 310 ? 25.991  12.006  31.137  1.00 21.99 ? 521 MET A N     1 
ATOM   2389 C CA    . MET A 1 310 ? 24.781  12.553  31.729  1.00 21.77 ? 521 MET A CA    1 
ATOM   2390 C C     . MET A 1 310 ? 23.710  11.473  31.782  1.00 21.65 ? 521 MET A C     1 
ATOM   2391 O O     . MET A 1 310 ? 23.571  10.688  30.844  1.00 20.43 ? 521 MET A O     1 
ATOM   2392 C CB    . MET A 1 310 ? 24.336  13.741  30.907  1.00 22.71 ? 521 MET A CB    1 
ATOM   2393 C CG    . MET A 1 310 ? 25.285  14.953  31.034  1.00 24.47 ? 521 MET A CG    1 
ATOM   2394 S SD    . MET A 1 310 ? 24.881  15.989  32.449  1.00 33.28 ? 521 MET A SD    1 
ATOM   2395 C CE    . MET A 1 310 ? 23.252  16.579  31.956  1.00 30.93 ? 521 MET A CE    1 
ATOM   2396 N N     . ALA A 1 311 ? 22.990  11.406  32.898  1.00 21.39 ? 522 ALA A N     1 
ATOM   2397 C CA    . ALA A 1 311 ? 21.981  10.362  33.105  1.00 22.22 ? 522 ALA A CA    1 
ATOM   2398 C C     . ALA A 1 311 ? 21.026  10.773  34.208  1.00 22.79 ? 522 ALA A C     1 
ATOM   2399 O O     . ALA A 1 311 ? 21.422  11.491  35.108  1.00 22.14 ? 522 ALA A O     1 
ATOM   2400 C CB    . ALA A 1 311 ? 22.644  9.039   33.508  1.00 21.09 ? 522 ALA A CB    1 
ATOM   2401 N N     . PRO A 1 312 ? 19.777  10.286  34.146  1.00 23.63 ? 523 PRO A N     1 
ATOM   2402 C CA    . PRO A 1 312 ? 18.833  10.366  35.254  1.00 24.46 ? 523 PRO A CA    1 
ATOM   2403 C C     . PRO A 1 312 ? 19.479  9.800   36.523  1.00 25.79 ? 523 PRO A C     1 
ATOM   2404 O O     . PRO A 1 312 ? 20.337  8.926   36.413  1.00 25.50 ? 523 PRO A O     1 
ATOM   2405 C CB    . PRO A 1 312 ? 17.689  9.461   34.802  1.00 24.21 ? 523 PRO A CB    1 
ATOM   2406 C CG    . PRO A 1 312 ? 17.783  9.417   33.318  1.00 23.79 ? 523 PRO A CG    1 
ATOM   2407 C CD    . PRO A 1 312 ? 19.230  9.543   32.998  1.00 23.91 ? 523 PRO A CD    1 
ATOM   2408 N N     . SER A 1 313 ? 19.091  10.296  37.700  1.00 26.67 ? 524 SER A N     1 
ATOM   2409 C CA    . SER A 1 313 ? 19.646  9.790   38.976  1.00 27.57 ? 524 SER A CA    1 
ATOM   2410 C C     . SER A 1 313 ? 18.588  9.076   39.789  1.00 27.68 ? 524 SER A C     1 
ATOM   2411 O O     . SER A 1 313 ? 17.396  9.367   39.677  1.00 27.61 ? 524 SER A O     1 
ATOM   2412 C CB    . SER A 1 313 ? 20.276  10.914  39.814  1.00 28.05 ? 524 SER A CB    1 
ATOM   2413 O OG    . SER A 1 313 ? 19.707  12.179  39.510  1.00 30.03 ? 524 SER A OG    1 
ATOM   2414 N N     . SER A 1 314 ? 19.036  8.150   40.631  1.00 28.22 ? 525 SER A N     1 
ATOM   2415 C CA    . SER A 1 314 ? 18.137  7.236   41.324  1.00 28.57 ? 525 SER A CA    1 
ATOM   2416 C C     . SER A 1 314 ? 17.172  7.935   42.267  1.00 29.14 ? 525 SER A C     1 
ATOM   2417 O O     . SER A 1 314 ? 16.121  7.391   42.586  1.00 28.57 ? 525 SER A O     1 
ATOM   2418 C CB    . SER A 1 314 ? 18.942  6.179   42.077  1.00 29.34 ? 525 SER A CB    1 
ATOM   2419 O OG    . SER A 1 314 ? 19.957  6.780   42.872  1.00 29.49 ? 525 SER A OG    1 
ATOM   2420 N N     . ALA A 1 315 ? 17.520  9.149   42.692  1.00 29.58 ? 526 ALA A N     1 
ATOM   2421 C CA    . ALA A 1 315 ? 16.659  9.948   43.562  1.00 30.25 ? 526 ALA A CA    1 
ATOM   2422 C C     . ALA A 1 315 ? 15.269  10.110  42.957  1.00 30.58 ? 526 ALA A C     1 
ATOM   2423 O O     . ALA A 1 315 ? 14.270  10.044  43.667  1.00 30.25 ? 526 ALA A O     1 
ATOM   2424 C CB    . ALA A 1 315 ? 17.301  11.331  43.832  1.00 30.65 ? 526 ALA A CB    1 
ATOM   2425 N N     . HIS A 1 316 ? 15.214  10.255  41.632  1.00 30.46 ? 527 HIS A N     1 
ATOM   2426 C CA    . HIS A 1 316 ? 13.979  10.577  40.933  1.00 30.42 ? 527 HIS A CA    1 
ATOM   2427 C C     . HIS A 1 316 ? 13.260  9.373   40.290  1.00 29.51 ? 527 HIS A C     1 
ATOM   2428 O O     . HIS A 1 316 ? 12.268  9.550   39.597  1.00 29.15 ? 527 HIS A O     1 
ATOM   2429 C CB    . HIS A 1 316 ? 14.290  11.627  39.863  1.00 30.97 ? 527 HIS A CB    1 
ATOM   2430 C CG    . HIS A 1 316 ? 14.947  12.857  40.409  1.00 33.44 ? 527 HIS A CG    1 
ATOM   2431 N ND1   . HIS A 1 316 ? 16.244  13.219  40.092  1.00 35.84 ? 527 HIS A ND1   1 
ATOM   2432 C CD2   . HIS A 1 316 ? 14.489  13.800  41.267  1.00 34.13 ? 527 HIS A CD2   1 
ATOM   2433 C CE1   . HIS A 1 316 ? 16.550  14.335  40.732  1.00 35.49 ? 527 HIS A CE1   1 
ATOM   2434 N NE2   . HIS A 1 316 ? 15.501  14.709  41.447  1.00 35.05 ? 527 HIS A NE2   1 
ATOM   2435 N N     . PHE A 1 317 ? 13.753  8.165   40.526  1.00 28.35 ? 528 PHE A N     1 
ATOM   2436 C CA    . PHE A 1 317 ? 13.173  6.972   39.919  1.00 27.68 ? 528 PHE A CA    1 
ATOM   2437 C C     . PHE A 1 317 ? 11.806  6.633   40.554  1.00 26.54 ? 528 PHE A C     1 
ATOM   2438 O O     . PHE A 1 317 ? 11.588  6.838   41.751  1.00 26.18 ? 528 PHE A O     1 
ATOM   2439 C CB    . PHE A 1 317 ? 14.139  5.787   40.085  1.00 27.71 ? 528 PHE A CB    1 
ATOM   2440 C CG    . PHE A 1 317 ? 15.429  5.905   39.281  1.00 28.56 ? 528 PHE A CG    1 
ATOM   2441 C CD1   . PHE A 1 317 ? 15.743  7.051   38.537  1.00 28.10 ? 528 PHE A CD1   1 
ATOM   2442 C CD2   . PHE A 1 317 ? 16.343  4.863   39.292  1.00 29.26 ? 528 PHE A CD2   1 
ATOM   2443 C CE1   . PHE A 1 317 ? 16.922  7.131   37.814  1.00 28.88 ? 528 PHE A CE1   1 
ATOM   2444 C CE2   . PHE A 1 317 ? 17.533  4.950   38.567  1.00 29.58 ? 528 PHE A CE2   1 
ATOM   2445 C CZ    . PHE A 1 317 ? 17.817  6.083   37.833  1.00 29.03 ? 528 PHE A CZ    1 
ATOM   2446 N N     . VAL A 1 318 ? 10.872  6.168   39.733  1.00 25.33 ? 529 VAL A N     1 
ATOM   2447 C CA    . VAL A 1 318 ? 9.645   5.540   40.229  1.00 24.56 ? 529 VAL A CA    1 
ATOM   2448 C C     . VAL A 1 318 ? 9.574   4.115   39.668  1.00 24.80 ? 529 VAL A C     1 
ATOM   2449 O O     . VAL A 1 318 ? 10.338  3.760   38.769  1.00 23.78 ? 529 VAL A O     1 
ATOM   2450 C CB    . VAL A 1 318 ? 8.357   6.347   39.878  1.00 24.82 ? 529 VAL A CB    1 
ATOM   2451 C CG1   . VAL A 1 318 ? 8.343   7.709   40.631  1.00 23.23 ? 529 VAL A CG1   1 
ATOM   2452 C CG2   . VAL A 1 318 ? 8.222   6.573   38.376  1.00 23.41 ? 529 VAL A CG2   1 
ATOM   2453 N N     . THR A 1 319 ? 8.675   3.314   40.226  1.00 24.57 ? 530 THR A N     1 
ATOM   2454 C CA    . THR A 1 319 ? 8.479   1.928   39.807  1.00 24.96 ? 530 THR A CA    1 
ATOM   2455 C C     . THR A 1 319 ? 7.144   1.835   39.124  1.00 23.89 ? 530 THR A C     1 
ATOM   2456 O O     . THR A 1 319 ? 6.190   2.443   39.569  1.00 23.99 ? 530 THR A O     1 
ATOM   2457 C CB    . THR A 1 319 ? 8.549   0.971   41.018  1.00 24.96 ? 530 THR A CB    1 
ATOM   2458 O OG1   . THR A 1 319 ? 9.925   0.658   41.245  1.00 27.97 ? 530 THR A OG1   1 
ATOM   2459 C CG2   . THR A 1 319 ? 7.781   -0.325  40.762  1.00 25.70 ? 530 THR A CG2   1 
ATOM   2460 N N     . LEU A 1 320 ? 7.092   1.129   38.002  1.00 22.82 ? 531 LEU A N     1 
ATOM   2461 C CA    . LEU A 1 320 ? 5.833   0.928   37.278  1.00 21.30 ? 531 LEU A CA    1 
ATOM   2462 C C     . LEU A 1 320 ? 5.727   -0.557  36.971  1.00 21.48 ? 531 LEU A C     1 
ATOM   2463 O O     . LEU A 1 320 ? 6.463   -1.109  36.122  1.00 18.95 ? 531 LEU A O     1 
ATOM   2464 C CB    . LEU A 1 320 ? 5.796   1.769   36.006  1.00 21.33 ? 531 LEU A CB    1 
ATOM   2465 C CG    . LEU A 1 320 ? 4.503   1.841   35.179  1.00 20.11 ? 531 LEU A CG    1 
ATOM   2466 C CD1   . LEU A 1 320 ? 3.347   2.484   35.965  1.00 18.78 ? 531 LEU A CD1   1 
ATOM   2467 C CD2   . LEU A 1 320 ? 4.752   2.615   33.913  1.00 17.48 ? 531 LEU A CD2   1 
ATOM   2468 N N     . ASN A 1 321 ? 4.837   -1.203  37.727  1.00 21.36 ? 532 ASN A N     1 
ATOM   2469 C CA    . ASN A 1 321 ? 4.523   -2.613  37.583  1.00 21.36 ? 532 ASN A CA    1 
ATOM   2470 C C     . ASN A 1 321 ? 5.774   -3.471  37.629  1.00 20.60 ? 532 ASN A C     1 
ATOM   2471 O O     . ASN A 1 321 ? 5.951   -4.362  36.814  1.00 19.47 ? 532 ASN A O     1 
ATOM   2472 C CB    . ASN A 1 321 ? 3.744   -2.834  36.288  1.00 22.18 ? 532 ASN A CB    1 
ATOM   2473 C CG    . ASN A 1 321 ? 2.355   -2.225  36.329  1.00 25.57 ? 532 ASN A CG    1 
ATOM   2474 O OD1   . ASN A 1 321 ? 1.603   -2.424  37.309  1.00 27.34 ? 532 ASN A OD1   1 
ATOM   2475 N ND2   . ASN A 1 321 ? 1.986   -1.501  35.260  1.00 22.09 ? 532 ASN A ND2   1 
ATOM   2476 N N     . GLY A 1 322 ? 6.660   -3.169  38.568  1.00 19.98 ? 533 GLY A N     1 
ATOM   2477 C CA    . GLY A 1 322 ? 7.824   -4.011  38.806  1.00 20.45 ? 533 GLY A CA    1 
ATOM   2478 C C     . GLY A 1 322 ? 9.061   -3.697  37.988  1.00 20.03 ? 533 GLY A C     1 
ATOM   2479 O O     . GLY A 1 322 ? 10.040  -4.431  38.086  1.00 20.76 ? 533 GLY A O     1 
ATOM   2480 N N     . SER A 1 323 ? 9.015   -2.630  37.183  1.00 19.16 ? 534 SER A N     1 
ATOM   2481 C CA    . SER A 1 323 ? 10.176  -2.117  36.457  1.00 18.72 ? 534 SER A CA    1 
ATOM   2482 C C     . SER A 1 323 ? 10.488  -0.699  36.866  1.00 18.90 ? 534 SER A C     1 
ATOM   2483 O O     . SER A 1 323 ? 9.564   0.091   37.092  1.00 19.48 ? 534 SER A O     1 
ATOM   2484 C CB    . SER A 1 323 ? 9.918   -2.107  34.953  1.00 18.84 ? 534 SER A CB    1 
ATOM   2485 O OG    . SER A 1 323 ? 9.808   -3.410  34.457  1.00 17.19 ? 534 SER A OG    1 
ATOM   2486 N N     . THR A 1 324 ? 11.780  -0.368  36.919  1.00 18.61 ? 535 THR A N     1 
ATOM   2487 C CA    . THR A 1 324 ? 12.220  0.988   37.261  1.00 18.12 ? 535 THR A CA    1 
ATOM   2488 C C     . THR A 1 324 ? 12.099  1.947   36.092  1.00 17.75 ? 535 THR A C     1 
ATOM   2489 O O     . THR A 1 324 ? 12.538  1.641   34.967  1.00 16.58 ? 535 THR A O     1 
ATOM   2490 C CB    . THR A 1 324 ? 13.666  0.992   37.753  1.00 18.72 ? 535 THR A CB    1 
ATOM   2491 O OG1   . THR A 1 324 ? 13.750  0.178   38.924  1.00 19.88 ? 535 THR A OG1   1 
ATOM   2492 C CG2   . THR A 1 324 ? 14.129  2.410   38.115  1.00 18.14 ? 535 THR A CG2   1 
ATOM   2493 N N     . VAL A 1 325 ? 11.505  3.110   36.364  1.00 16.50 ? 536 VAL A N     1 
ATOM   2494 C CA    . VAL A 1 325 ? 11.381  4.192   35.389  1.00 15.70 ? 536 VAL A CA    1 
ATOM   2495 C C     . VAL A 1 325 ? 12.345  5.274   35.791  1.00 16.28 ? 536 VAL A C     1 
ATOM   2496 O O     . VAL A 1 325 ? 12.155  5.888   36.837  1.00 16.64 ? 536 VAL A O     1 
ATOM   2497 C CB    . VAL A 1 325 ? 9.984   4.787   35.341  1.00 15.37 ? 536 VAL A CB    1 
ATOM   2498 C CG1   . VAL A 1 325 ? 9.840   5.750   34.135  1.00 14.95 ? 536 VAL A CG1   1 
ATOM   2499 C CG2   . VAL A 1 325 ? 8.967   3.706   35.242  1.00 15.08 ? 536 VAL A CG2   1 
ATOM   2500 N N     . PRO A 1 326 ? 13.389  5.516   34.977  1.00 15.80 ? 537 PRO A N     1 
ATOM   2501 C CA    . PRO A 1 326 ? 14.469  6.433   35.337  1.00 15.79 ? 537 PRO A CA    1 
ATOM   2502 C C     . PRO A 1 326 ? 14.140  7.856   34.927  1.00 15.94 ? 537 PRO A C     1 
ATOM   2503 O O     . PRO A 1 326 ? 14.759  8.387   34.016  1.00 15.19 ? 537 PRO A O     1 
ATOM   2504 C CB    . PRO A 1 326 ? 15.645  5.913   34.526  1.00 15.50 ? 537 PRO A CB    1 
ATOM   2505 C CG    . PRO A 1 326 ? 15.019  5.333   33.336  1.00 15.66 ? 537 PRO A CG    1 
ATOM   2506 C CD    . PRO A 1 326 ? 13.687  4.791   33.738  1.00 15.41 ? 537 PRO A CD    1 
ATOM   2507 N N     . LEU A 1 327 ? 13.131  8.429   35.574  1.00 16.40 ? 538 LEU A N     1 
ATOM   2508 C CA    . LEU A 1 327 ? 12.722  9.810   35.324  1.00 16.89 ? 538 LEU A CA    1 
ATOM   2509 C C     . LEU A 1 327 ? 13.900  10.801  35.397  1.00 17.26 ? 538 LEU A C     1 
ATOM   2510 O O     . LEU A 1 327 ? 14.857  10.638  36.183  1.00 17.11 ? 538 LEU A O     1 
ATOM   2511 C CB    . LEU A 1 327 ? 11.624  10.232  36.302  1.00 16.32 ? 538 LEU A CB    1 
ATOM   2512 C CG    . LEU A 1 327 ? 10.288  9.520   36.175  1.00 16.91 ? 538 LEU A CG    1 
ATOM   2513 C CD1   . LEU A 1 327 ? 9.336   9.988   37.277  1.00 17.37 ? 538 LEU A CD1   1 
ATOM   2514 C CD2   . LEU A 1 327 ? 9.670   9.735   34.744  1.00 17.74 ? 538 LEU A CD2   1 
ATOM   2515 N N     . GLY A 1 328 ? 13.822  11.813  34.551  1.00 17.94 ? 539 GLY A N     1 
ATOM   2516 C CA    . GLY A 1 328 ? 14.818  12.851  34.505  1.00 19.38 ? 539 GLY A CA    1 
ATOM   2517 C C     . GLY A 1 328 ? 14.572  13.878  35.593  1.00 20.83 ? 539 GLY A C     1 
ATOM   2518 O O     . GLY A 1 328 ? 13.726  13.657  36.468  1.00 19.84 ? 539 GLY A O     1 
ATOM   2519 N N     . PRO A 1 329 ? 15.331  14.993  35.560  1.00 22.79 ? 540 PRO A N     1 
ATOM   2520 C CA    . PRO A 1 329 ? 16.318  15.297  34.521  1.00 23.81 ? 540 PRO A CA    1 
ATOM   2521 C C     . PRO A 1 329 ? 17.634  14.552  34.683  1.00 24.01 ? 540 PRO A C     1 
ATOM   2522 O O     . PRO A 1 329 ? 17.934  14.001  35.751  1.00 24.25 ? 540 PRO A O     1 
ATOM   2523 C CB    . PRO A 1 329 ? 16.512  16.818  34.659  1.00 24.04 ? 540 PRO A CB    1 
ATOM   2524 C CG    . PRO A 1 329 ? 16.263  17.093  36.095  1.00 24.01 ? 540 PRO A CG    1 
ATOM   2525 C CD    . PRO A 1 329 ? 15.241  16.078  36.561  1.00 23.72 ? 540 PRO A CD    1 
ATOM   2526 N N     . ALA A 1 330 ? 18.375  14.501  33.590  1.00 24.80 ? 541 ALA A N     1 
ATOM   2527 C CA    . ALA A 1 330 ? 19.715  13.952  33.554  1.00 25.84 ? 541 ALA A CA    1 
ATOM   2528 C C     . ALA A 1 330 ? 20.665  14.868  34.308  1.00 26.50 ? 541 ALA A C     1 
ATOM   2529 O O     . ALA A 1 330 ? 20.469  16.070  34.326  1.00 26.42 ? 541 ALA A O     1 
ATOM   2530 C CB    . ALA A 1 330 ? 20.180  13.815  32.097  1.00 25.66 ? 541 ALA A CB    1 
ATOM   2531 N N     . SER A 1 331 ? 21.689  14.300  34.930  1.00 27.92 ? 542 SER A N     1 
ATOM   2532 C CA    . SER A 1 331 ? 22.766  15.102  35.524  1.00 28.84 ? 542 SER A CA    1 
ATOM   2533 C C     . SER A 1 331 ? 24.081  14.374  35.392  1.00 29.71 ? 542 SER A C     1 
ATOM   2534 O O     . SER A 1 331 ? 24.112  13.199  35.029  1.00 28.69 ? 542 SER A O     1 
ATOM   2535 C CB    . SER A 1 331 ? 22.471  15.442  36.990  1.00 28.63 ? 542 SER A CB    1 
ATOM   2536 O OG    . SER A 1 331 ? 22.127  14.290  37.725  1.00 29.15 ? 542 SER A OG    1 
ATOM   2537 N N     . ASP A 1 332 ? 25.166  15.093  35.673  1.00 31.13 ? 543 ASP A N     1 
ATOM   2538 C CA    . ASP A 1 332 ? 26.531  14.586  35.510  1.00 32.05 ? 543 ASP A CA    1 
ATOM   2539 C C     . ASP A 1 332 ? 26.743  13.274  36.234  1.00 32.49 ? 543 ASP A C     1 
ATOM   2540 O O     . ASP A 1 332 ? 26.415  13.157  37.412  1.00 32.02 ? 543 ASP A O     1 
ATOM   2541 C CB    . ASP A 1 332 ? 27.544  15.609  36.029  1.00 32.99 ? 543 ASP A CB    1 
ATOM   2542 C CG    . ASP A 1 332 ? 28.931  15.417  35.430  1.00 35.14 ? 543 ASP A CG    1 
ATOM   2543 O OD1   . ASP A 1 332 ? 29.468  14.279  35.431  1.00 37.45 ? 543 ASP A OD1   1 
ATOM   2544 O OD2   . ASP A 1 332 ? 29.490  16.433  34.964  1.00 40.58 ? 543 ASP A OD2   1 
ATOM   2545 N N     . THR A 1 333 ? 27.297  12.284  35.531  1.00 32.74 ? 544 THR A N     1 
ATOM   2546 C CA    . THR A 1 333 ? 27.533  10.966  36.134  1.00 33.08 ? 544 THR A CA    1 
ATOM   2547 C C     . THR A 1 333 ? 28.940  10.819  36.742  1.00 34.72 ? 544 THR A C     1 
ATOM   2548 O O     . THR A 1 333 ? 29.261  9.784   37.335  1.00 34.82 ? 544 THR A O     1 
ATOM   2549 C CB    . THR A 1 333 ? 27.352  9.842   35.096  1.00 32.86 ? 544 THR A CB    1 
ATOM   2550 O OG1   . THR A 1 333 ? 28.204  10.097  33.981  1.00 30.90 ? 544 THR A OG1   1 
ATOM   2551 C CG2   . THR A 1 333 ? 25.890  9.757   34.617  1.00 31.27 ? 544 THR A CG2   1 
ATOM   2552 N N     . GLY A 1 334 ? 29.784  11.834  36.574  1.00 36.34 ? 545 GLY A N     1 
ATOM   2553 C CA    . GLY A 1 334 ? 31.163  11.758  37.031  1.00 37.62 ? 545 GLY A CA    1 
ATOM   2554 C C     . GLY A 1 334 ? 32.026  10.869  36.157  1.00 38.84 ? 545 GLY A C     1 
ATOM   2555 O O     . GLY A 1 334 ? 33.146  10.538  36.541  1.00 39.25 ? 545 GLY A O     1 
ATOM   2556 N N     . ILE A 1 335 ? 31.517  10.498  34.978  1.00 39.83 ? 546 ILE A N     1 
ATOM   2557 C CA    . ILE A 1 335 ? 32.200  9.560   34.090  1.00 40.67 ? 546 ILE A CA    1 
ATOM   2558 C C     . ILE A 1 335 ? 32.818  10.280  32.900  1.00 41.57 ? 546 ILE A C     1 
ATOM   2559 O O     . ILE A 1 335 ? 32.165  11.106  32.257  1.00 42.16 ? 546 ILE A O     1 
ATOM   2560 C CB    . ILE A 1 335 ? 31.232  8.427   33.622  1.00 40.97 ? 546 ILE A CB    1 
ATOM   2561 C CG1   . ILE A 1 335 ? 31.256  7.269   34.635  1.00 41.01 ? 546 ILE A CG1   1 
ATOM   2562 C CG2   . ILE A 1 335 ? 31.599  7.935   32.233  1.00 40.08 ? 546 ILE A CG2   1 
ATOM   2563 C CD1   . ILE A 1 335 ? 29.997  6.455   34.695  1.00 41.47 ? 546 ILE A CD1   1 
ATOM   2564 N N     . LEU A 1 336 ? 34.084  9.959   32.621  1.00 42.55 ? 547 LEU A N     1 
ATOM   2565 C CA    . LEU A 1 336 ? 34.859  10.608  31.569  1.00 43.45 ? 547 LEU A CA    1 
ATOM   2566 C C     . LEU A 1 336 ? 36.217  9.921   31.380  1.00 43.79 ? 547 LEU A C     1 
ATOM   2567 O O     . LEU A 1 336 ? 37.181  10.225  32.086  1.00 44.56 ? 547 LEU A O     1 
ATOM   2568 C CB    . LEU A 1 336 ? 35.053  12.106  31.882  1.00 43.89 ? 547 LEU A CB    1 
ATOM   2569 C CG    . LEU A 1 336 ? 35.807  12.932  30.825  1.00 44.50 ? 547 LEU A CG    1 
ATOM   2570 C CD1   . LEU A 1 336 ? 35.068  14.241  30.546  1.00 44.18 ? 547 LEU A CD1   1 
ATOM   2571 C CD2   . LEU A 1 336 ? 37.285  13.198  31.238  1.00 44.82 ? 547 LEU A CD2   1 
ATOM   2572 N N     . GLY A 1 340 ? 39.795  8.650   25.385  1.00 39.76 ? 551 GLY A N     1 
ATOM   2573 C CA    . GLY A 1 340 ? 39.241  9.298   24.204  1.00 39.72 ? 551 GLY A CA    1 
ATOM   2574 C C     . GLY A 1 340 ? 37.814  9.781   24.421  1.00 39.69 ? 551 GLY A C     1 
ATOM   2575 O O     . GLY A 1 340 ? 37.414  10.033  25.547  1.00 39.93 ? 551 GLY A O     1 
ATOM   2576 N N     . TYR A 1 341 ? 37.063  9.899   23.321  1.00 39.57 ? 552 TYR A N     1 
ATOM   2577 C CA    . TYR A 1 341 ? 35.671  10.377  23.312  1.00 38.82 ? 552 TYR A CA    1 
ATOM   2578 C C     . TYR A 1 341 ? 34.764  9.477   24.147  1.00 37.73 ? 552 TYR A C     1 
ATOM   2579 O O     . TYR A 1 341 ? 34.975  8.270   24.238  1.00 38.12 ? 552 TYR A O     1 
ATOM   2580 C CB    . TYR A 1 341 ? 35.129  10.451  21.872  1.00 39.14 ? 552 TYR A CB    1 
ATOM   2581 C CG    . TYR A 1 341 ? 35.828  11.468  20.989  1.00 39.16 ? 552 TYR A CG    1 
ATOM   2582 N N     . THR A 1 342 ? 33.746  10.078  24.748  1.00 35.95 ? 553 THR A N     1 
ATOM   2583 C CA    . THR A 1 342 ? 32.906  9.392   25.720  1.00 34.37 ? 553 THR A CA    1 
ATOM   2584 C C     . THR A 1 342 ? 31.427  9.665   25.386  1.00 31.93 ? 553 THR A C     1 
ATOM   2585 O O     . THR A 1 342 ? 31.091  10.749  24.908  1.00 31.73 ? 553 THR A O     1 
ATOM   2586 C CB    . THR A 1 342 ? 33.312  9.848   27.152  1.00 34.96 ? 553 THR A CB    1 
ATOM   2587 O OG1   . THR A 1 342 ? 33.487  11.258  27.165  1.00 36.90 ? 553 THR A OG1   1 
ATOM   2588 C CG2   . THR A 1 342 ? 34.671  9.258   27.562  1.00 35.38 ? 553 THR A CG2   1 
ATOM   2589 N N     . LEU A 1 343 ? 30.558  8.674   25.580  1.00 28.54 ? 554 LEU A N     1 
ATOM   2590 C CA    . LEU A 1 343 ? 29.119  8.839   25.272  1.00 26.39 ? 554 LEU A CA    1 
ATOM   2591 C C     . LEU A 1 343 ? 28.488  10.027  26.024  1.00 24.51 ? 554 LEU A C     1 
ATOM   2592 O O     . LEU A 1 343 ? 28.801  10.274  27.188  1.00 23.28 ? 554 LEU A O     1 
ATOM   2593 C CB    . LEU A 1 343 ? 28.336  7.544   25.595  1.00 25.52 ? 554 LEU A CB    1 
ATOM   2594 C CG    . LEU A 1 343 ? 28.467  6.406   24.574  1.00 24.24 ? 554 LEU A CG    1 
ATOM   2595 C CD1   . LEU A 1 343 ? 28.023  5.053   25.161  1.00 23.29 ? 554 LEU A CD1   1 
ATOM   2596 C CD2   . LEU A 1 343 ? 27.688  6.732   23.305  1.00 21.06 ? 554 LEU A CD2   1 
ATOM   2597 N N     . ASN A 1 344 ? 27.590  10.743  25.348  1.00 22.57 ? 555 ASN A N     1 
ATOM   2598 C CA    . ASN A 1 344 ? 26.809  11.782  26.000  1.00 21.20 ? 555 ASN A CA    1 
ATOM   2599 C C     . ASN A 1 344 ? 25.810  11.166  26.966  1.00 19.31 ? 555 ASN A C     1 
ATOM   2600 O O     . ASN A 1 344 ? 25.660  11.643  28.084  1.00 18.35 ? 555 ASN A O     1 
ATOM   2601 C CB    . ASN A 1 344 ? 26.114  12.673  24.968  1.00 21.14 ? 555 ASN A CB    1 
ATOM   2602 C CG    . ASN A 1 344 ? 27.117  13.408  24.078  1.00 24.18 ? 555 ASN A CG    1 
ATOM   2603 O OD1   . ASN A 1 344 ? 28.122  13.922  24.566  1.00 28.07 ? 555 ASN A OD1   1 
ATOM   2604 N ND2   . ASN A 1 344 ? 26.855  13.443  22.774  1.00 25.92 ? 555 ASN A ND2   1 
ATOM   2605 N N     . TYR A 1 345 ? 25.156  10.084  26.533  1.00 17.28 ? 556 TYR A N     1 
ATOM   2606 C CA    . TYR A 1 345 ? 24.116  9.427   27.300  1.00 15.69 ? 556 TYR A CA    1 
ATOM   2607 C C     . TYR A 1 345 ? 24.309  7.906   27.283  1.00 15.26 ? 556 TYR A C     1 
ATOM   2608 O O     . TYR A 1 345 ? 24.925  7.349   26.373  1.00 15.52 ? 556 TYR A O     1 
ATOM   2609 C CB    . TYR A 1 345 ? 22.729  9.806   26.754  1.00 15.42 ? 556 TYR A CB    1 
ATOM   2610 C CG    . TYR A 1 345 ? 22.614  11.289  26.582  1.00 16.14 ? 556 TYR A CG    1 
ATOM   2611 C CD1   . TYR A 1 345 ? 22.529  12.129  27.691  1.00 17.03 ? 556 TYR A CD1   1 
ATOM   2612 C CD2   . TYR A 1 345 ? 22.677  11.867  25.326  1.00 16.00 ? 556 TYR A CD2   1 
ATOM   2613 C CE1   . TYR A 1 345 ? 22.465  13.509  27.548  1.00 17.05 ? 556 TYR A CE1   1 
ATOM   2614 C CE2   . TYR A 1 345 ? 22.618  13.242  25.166  1.00 16.17 ? 556 TYR A CE2   1 
ATOM   2615 C CZ    . TYR A 1 345 ? 22.515  14.056  26.281  1.00 16.89 ? 556 TYR A CZ    1 
ATOM   2616 O OH    . TYR A 1 345 ? 22.439  15.416  26.103  1.00 15.29 ? 556 TYR A OH    1 
ATOM   2617 N N     . ASN A 1 346 ? 23.790  7.270   28.328  1.00 14.06 ? 557 ASN A N     1 
ATOM   2618 C CA    . ASN A 1 346 ? 23.861  5.831   28.521  1.00 13.43 ? 557 ASN A CA    1 
ATOM   2619 C C     . ASN A 1 346 ? 23.280  5.108   27.330  1.00 13.15 ? 557 ASN A C     1 
ATOM   2620 O O     . ASN A 1 346 ? 22.480  5.663   26.567  1.00 13.55 ? 557 ASN A O     1 
ATOM   2621 C CB    . ASN A 1 346 ? 23.068  5.418   29.748  1.00 12.56 ? 557 ASN A CB    1 
ATOM   2622 C CG    . ASN A 1 346 ? 23.757  5.747   31.049  1.00 15.96 ? 557 ASN A CG    1 
ATOM   2623 O OD1   . ASN A 1 346 ? 24.995  5.816   31.120  1.00 18.30 ? 557 ASN A OD1   1 
ATOM   2624 N ND2   . ASN A 1 346 ? 22.955  5.896   32.122  1.00 16.20 ? 557 ASN A ND2   1 
ATOM   2625 N N     . GLU A 1 347 ? 23.706  3.877   27.133  1.00 13.08 ? 558 GLU A N     1 
ATOM   2626 C CA    . GLU A 1 347 ? 22.907  2.958   26.304  1.00 12.45 ? 558 GLU A CA    1 
ATOM   2627 C C     . GLU A 1 347 ? 23.074  1.576   26.877  1.00 12.90 ? 558 GLU A C     1 
ATOM   2628 O O     . GLU A 1 347 ? 24.112  1.270   27.516  1.00 12.74 ? 558 GLU A O     1 
ATOM   2629 C CB    . GLU A 1 347 ? 23.276  3.031   24.830  1.00 12.46 ? 558 GLU A CB    1 
ATOM   2630 C CG    . GLU A 1 347 ? 24.733  2.743   24.455  1.00 12.56 ? 558 GLU A CG    1 
ATOM   2631 C CD    . GLU A 1 347 ? 24.994  3.120   23.008  1.00 14.94 ? 558 GLU A CD    1 
ATOM   2632 O OE1   . GLU A 1 347 ? 25.227  2.217   22.159  1.00 14.97 ? 558 GLU A OE1   1 
ATOM   2633 O OE2   . GLU A 1 347 ? 24.884  4.333   22.698  1.00 14.95 ? 558 GLU A OE2   1 
ATOM   2634 N N     . TYR A 1 348 ? 22.024  0.781   26.707  1.00 12.32 ? 559 TYR A N     1 
ATOM   2635 C CA    . TYR A 1 348 ? 21.931  -0.549  27.293  1.00 12.14 ? 559 TYR A CA    1 
ATOM   2636 C C     . TYR A 1 348 ? 21.698  -1.573  26.181  1.00 11.37 ? 559 TYR A C     1 
ATOM   2637 O O     . TYR A 1 348 ? 20.881  -1.344  25.286  1.00 10.00 ? 559 TYR A O     1 
ATOM   2638 C CB    . TYR A 1 348 ? 20.760  -0.616  28.270  1.00 12.27 ? 559 TYR A CB    1 
ATOM   2639 C CG    . TYR A 1 348 ? 20.759  0.414   29.407  1.00 13.60 ? 559 TYR A CG    1 
ATOM   2640 C CD1   . TYR A 1 348 ? 21.169  0.080   30.690  1.00 16.93 ? 559 TYR A CD1   1 
ATOM   2641 C CD2   . TYR A 1 348 ? 20.334  1.704   29.183  1.00 16.61 ? 559 TYR A CD2   1 
ATOM   2642 C CE1   . TYR A 1 348 ? 21.143  1.021   31.739  1.00 18.07 ? 559 TYR A CE1   1 
ATOM   2643 C CE2   . TYR A 1 348 ? 20.319  2.646   30.207  1.00 18.81 ? 559 TYR A CE2   1 
ATOM   2644 C CZ    . TYR A 1 348 ? 20.698  2.297   31.474  1.00 19.21 ? 559 TYR A CZ    1 
ATOM   2645 O OH    . TYR A 1 348 ? 20.663  3.265   32.454  1.00 22.09 ? 559 TYR A OH    1 
ATOM   2646 N N     . ILE A 1 349 ? 22.418  -2.694  26.240  1.00 10.86 ? 560 ILE A N     1 
ATOM   2647 C CA    . ILE A 1 349 ? 22.322  -3.730  25.210  1.00 9.83  ? 560 ILE A CA    1 
ATOM   2648 C C     . ILE A 1 349 ? 22.108  -5.074  25.885  1.00 10.67 ? 560 ILE A C     1 
ATOM   2649 O O     . ILE A 1 349 ? 22.860  -5.457  26.799  1.00 11.99 ? 560 ILE A O     1 
ATOM   2650 C CB    . ILE A 1 349 ? 23.576  -3.781  24.334  1.00 10.08 ? 560 ILE A CB    1 
ATOM   2651 C CG1   . ILE A 1 349 ? 23.901  -2.414  23.742  1.00 9.46  ? 560 ILE A CG1   1 
ATOM   2652 C CG2   . ILE A 1 349 ? 23.396  -4.779  23.145  1.00 8.09  ? 560 ILE A CG2   1 
ATOM   2653 C CD1   . ILE A 1 349 ? 24.703  -1.476  24.685  1.00 12.34 ? 560 ILE A CD1   1 
ATOM   2654 N N     . VAL A 1 350 ? 21.070  -5.782  25.476  1.00 10.60 ? 561 VAL A N     1 
ATOM   2655 C CA    . VAL A 1 350 ? 20.889  -7.170  25.872  1.00 10.86 ? 561 VAL A CA    1 
ATOM   2656 C C     . VAL A 1 350 ? 21.004  -7.990  24.616  1.00 11.36 ? 561 VAL A C     1 
ATOM   2657 O O     . VAL A 1 350 ? 20.688  -7.500  23.516  1.00 11.41 ? 561 VAL A O     1 
ATOM   2658 C CB    . VAL A 1 350 ? 19.545  -7.428  26.584  1.00 11.76 ? 561 VAL A CB    1 
ATOM   2659 C CG1   . VAL A 1 350 ? 19.499  -6.666  27.913  1.00 9.88  ? 561 VAL A CG1   1 
ATOM   2660 C CG2   . VAL A 1 350 ? 18.357  -7.057  25.675  1.00 11.66 ? 561 VAL A CG2   1 
ATOM   2661 N N     . TYR A 1 351 ? 21.452  -9.236  24.761  1.00 11.29 ? 562 TYR A N     1 
ATOM   2662 C CA    . TYR A 1 351 ? 21.785  -10.070 23.610  1.00 11.12 ? 562 TYR A CA    1 
ATOM   2663 C C     . TYR A 1 351 ? 20.865  -11.269 23.378  1.00 12.23 ? 562 TYR A C     1 
ATOM   2664 O O     . TYR A 1 351 ? 21.146  -12.113 22.524  1.00 12.95 ? 562 TYR A O     1 
ATOM   2665 C CB    . TYR A 1 351 ? 23.263  -10.495 23.699  1.00 11.75 ? 562 TYR A CB    1 
ATOM   2666 C CG    . TYR A 1 351 ? 24.184  -9.323  23.811  1.00 9.63  ? 562 TYR A CG    1 
ATOM   2667 C CD1   . TYR A 1 351 ? 24.730  -8.743  22.689  1.00 9.20  ? 562 TYR A CD1   1 
ATOM   2668 C CD2   . TYR A 1 351 ? 24.539  -8.817  25.051  1.00 10.37 ? 562 TYR A CD2   1 
ATOM   2669 C CE1   . TYR A 1 351 ? 25.587  -7.668  22.783  1.00 12.23 ? 562 TYR A CE1   1 
ATOM   2670 C CE2   . TYR A 1 351 ? 25.395  -7.744  25.166  1.00 11.01 ? 562 TYR A CE2   1 
ATOM   2671 C CZ    . TYR A 1 351 ? 25.929  -7.184  24.038  1.00 11.55 ? 562 TYR A CZ    1 
ATOM   2672 O OH    . TYR A 1 351 ? 26.764  -6.111  24.164  1.00 12.37 ? 562 TYR A OH    1 
ATOM   2673 N N     . ASN A 1 352 ? 19.755  -11.324 24.109  1.00 12.22 ? 563 ASN A N     1 
ATOM   2674 C CA    . ASN A 1 352 ? 18.726  -12.353 23.948  1.00 12.17 ? 563 ASN A CA    1 
ATOM   2675 C C     . ASN A 1 352 ? 17.363  -11.654 24.047  1.00 11.14 ? 563 ASN A C     1 
ATOM   2676 O O     . ASN A 1 352 ? 17.146  -10.862 24.948  1.00 9.34  ? 563 ASN A O     1 
ATOM   2677 C CB    . ASN A 1 352 ? 18.852  -13.396 25.051  1.00 12.23 ? 563 ASN A CB    1 
ATOM   2678 C CG    . ASN A 1 352 ? 17.981  -14.657 24.816  1.00 15.01 ? 563 ASN A CG    1 
ATOM   2679 O OD1   . ASN A 1 352 ? 16.867  -14.617 24.259  1.00 13.45 ? 563 ASN A OD1   1 
ATOM   2680 N ND2   . ASN A 1 352 ? 18.493  -15.786 25.297  1.00 18.88 ? 563 ASN A ND2   1 
ATOM   2681 N N     . PRO A 1 353 ? 16.461  -11.938 23.112  1.00 11.03 ? 564 PRO A N     1 
ATOM   2682 C CA    . PRO A 1 353 ? 15.190  -11.269 23.124  1.00 11.28 ? 564 PRO A CA    1 
ATOM   2683 C C     . PRO A 1 353 ? 14.339  -11.616 24.341  1.00 10.87 ? 564 PRO A C     1 
ATOM   2684 O O     . PRO A 1 353 ? 13.386  -10.905 24.630  1.00 10.74 ? 564 PRO A O     1 
ATOM   2685 C CB    . PRO A 1 353 ? 14.507  -11.771 21.853  1.00 11.32 ? 564 PRO A CB    1 
ATOM   2686 C CG    . PRO A 1 353 ? 15.464  -12.495 21.131  1.00 12.00 ? 564 PRO A CG    1 
ATOM   2687 C CD    . PRO A 1 353 ? 16.723  -12.594 21.825  1.00 11.88 ? 564 PRO A CD    1 
ATOM   2688 N N     . ASN A 1 354 ? 14.680  -12.692 25.040  1.00 11.07 ? 565 ASN A N     1 
ATOM   2689 C CA    . ASN A 1 354 ? 13.962  -13.045 26.251  1.00 11.64 ? 565 ASN A CA    1 
ATOM   2690 C C     . ASN A 1 354 ? 14.308  -12.136 27.435  1.00 10.99 ? 565 ASN A C     1 
ATOM   2691 O O     . ASN A 1 354 ? 13.774  -12.315 28.533  1.00 12.66 ? 565 ASN A O     1 
ATOM   2692 C CB    . ASN A 1 354 ? 14.097  -14.535 26.584  1.00 11.61 ? 565 ASN A CB    1 
ATOM   2693 C CG    . ASN A 1 354 ? 15.435  -14.904 27.148  1.00 12.31 ? 565 ASN A CG    1 
ATOM   2694 O OD1   . ASN A 1 354 ? 16.308  -14.070 27.310  1.00 11.89 ? 565 ASN A OD1   1 
ATOM   2695 N ND2   . ASN A 1 354 ? 15.603  -16.197 27.464  1.00 14.13 ? 565 ASN A ND2   1 
ATOM   2696 N N     . GLN A 1 355 ? 15.175  -11.152 27.213  1.00 10.50 ? 566 GLN A N     1 
ATOM   2697 C CA    . GLN A 1 355 ? 15.395  -10.087 28.192  1.00 10.42 ? 566 GLN A CA    1 
ATOM   2698 C C     . GLN A 1 355 ? 14.550  -8.821  27.915  1.00 10.37 ? 566 GLN A C     1 
ATOM   2699 O O     . GLN A 1 355 ? 14.758  -7.741  28.546  1.00 8.88  ? 566 GLN A O     1 
ATOM   2700 C CB    . GLN A 1 355 ? 16.890  -9.765  28.279  1.00 10.39 ? 566 GLN A CB    1 
ATOM   2701 C CG    . GLN A 1 355 ? 17.636  -10.803 29.096  1.00 11.49 ? 566 GLN A CG    1 
ATOM   2702 C CD    . GLN A 1 355 ? 19.097  -10.744 28.891  1.00 15.35 ? 566 GLN A CD    1 
ATOM   2703 O OE1   . GLN A 1 355 ? 19.641  -11.482 28.058  1.00 16.49 ? 566 GLN A OE1   1 
ATOM   2704 N NE2   . GLN A 1 355 ? 19.770  -9.866  29.639  1.00 11.66 ? 566 GLN A NE2   1 
ATOM   2705 N N     . VAL A 1 356 ? 13.611  -8.945  26.985  1.00 9.85  ? 567 VAL A N     1 
ATOM   2706 C CA    . VAL A 1 356 ? 12.794  -7.823  26.588  1.00 10.23 ? 567 VAL A CA    1 
ATOM   2707 C C     . VAL A 1 356 ? 11.316  -8.205  26.647  1.00 11.11 ? 567 VAL A C     1 
ATOM   2708 O O     . VAL A 1 356 ? 10.916  -9.273  26.167  1.00 10.81 ? 567 VAL A O     1 
ATOM   2709 C CB    . VAL A 1 356 ? 13.123  -7.397  25.149  1.00 10.48 ? 567 VAL A CB    1 
ATOM   2710 C CG1   . VAL A 1 356 ? 12.217  -6.254  24.713  1.00 10.79 ? 567 VAL A CG1   1 
ATOM   2711 C CG2   . VAL A 1 356 ? 14.611  -6.992  25.011  1.00 7.67  ? 567 VAL A CG2   1 
ATOM   2712 N N     . ARG A 1 357 ? 10.506  -7.321  27.217  1.00 11.03 ? 568 ARG A N     1 
ATOM   2713 C CA    . ARG A 1 357 ? 9.049   -7.420  27.089  1.00 10.83 ? 568 ARG A CA    1 
ATOM   2714 C C     . ARG A 1 357 ? 8.470   -6.039  26.742  1.00 11.27 ? 568 ARG A C     1 
ATOM   2715 O O     . ARG A 1 357 ? 8.472   -5.122  27.565  1.00 11.72 ? 568 ARG A O     1 
ATOM   2716 C CB    . ARG A 1 357 ? 8.472   -7.960  28.390  1.00 11.75 ? 568 ARG A CB    1 
ATOM   2717 C CG    . ARG A 1 357 ? 6.990   -8.254  28.313  1.00 13.75 ? 568 ARG A CG    1 
ATOM   2718 C CD    . ARG A 1 357 ? 6.331   -8.384  29.681  1.00 18.55 ? 568 ARG A CD    1 
ATOM   2719 N NE    . ARG A 1 357 ? 4.874   -8.421  29.535  1.00 23.82 ? 568 ARG A NE    1 
ATOM   2720 C CZ    . ARG A 1 357 ? 4.006   -8.421  30.546  1.00 29.10 ? 568 ARG A CZ    1 
ATOM   2721 N NH1   . ARG A 1 357 ? 4.442   -8.394  31.808  1.00 30.40 ? 568 ARG A NH1   1 
ATOM   2722 N NH2   . ARG A 1 357 ? 2.693   -8.483  30.292  1.00 29.16 ? 568 ARG A NH2   1 
ATOM   2723 N N     . MET A 1 358 ? 8.048   -5.879  25.504  1.00 11.35 ? 569 MET A N     1 
ATOM   2724 C CA    . MET A 1 358 ? 7.533   -4.619  25.020  1.00 11.80 ? 569 MET A CA    1 
ATOM   2725 C C     . MET A 1 358 ? 6.290   -4.312  25.825  1.00 12.54 ? 569 MET A C     1 
ATOM   2726 O O     . MET A 1 358 ? 5.510   -5.223  26.155  1.00 11.58 ? 569 MET A O     1 
ATOM   2727 C CB    . MET A 1 358 ? 7.177   -4.699  23.527  1.00 11.68 ? 569 MET A CB    1 
ATOM   2728 C CG    . MET A 1 358 ? 8.341   -5.014  22.644  1.00 12.07 ? 569 MET A CG    1 
ATOM   2729 S SD    . MET A 1 358 ? 7.985   -4.943  20.900  1.00 14.05 ? 569 MET A SD    1 
ATOM   2730 C CE    . MET A 1 358 ? 6.950   -6.388  20.625  1.00 14.78 ? 569 MET A CE    1 
ATOM   2731 N N     . ARG A 1 359 ? 6.099   -3.034  26.138  1.00 12.49 ? 570 ARG A N     1 
ATOM   2732 C CA    . ARG A 1 359 ? 5.054   -2.647  27.061  1.00 13.05 ? 570 ARG A CA    1 
ATOM   2733 C C     . ARG A 1 359 ? 4.186   -1.444  26.610  1.00 12.11 ? 570 ARG A C     1 
ATOM   2734 O O     . ARG A 1 359 ? 2.953   -1.444  26.787  1.00 10.90 ? 570 ARG A O     1 
ATOM   2735 C CB    . ARG A 1 359 ? 5.760   -2.415  28.379  1.00 14.44 ? 570 ARG A CB    1 
ATOM   2736 C CG    . ARG A 1 359 ? 4.932   -2.508  29.582  1.00 20.48 ? 570 ARG A CG    1 
ATOM   2737 C CD    . ARG A 1 359 ? 4.187   -3.859  29.748  1.00 24.85 ? 570 ARG A CD    1 
ATOM   2738 N NE    . ARG A 1 359 ? 3.102   -3.609  30.698  1.00 31.26 ? 570 ARG A NE    1 
ATOM   2739 C CZ    . ARG A 1 359 ? 1.982   -2.924  30.420  1.00 35.07 ? 570 ARG A CZ    1 
ATOM   2740 N NH1   . ARG A 1 359 ? 1.762   -2.424  29.204  1.00 35.95 ? 570 ARG A NH1   1 
ATOM   2741 N NH2   . ARG A 1 359 ? 1.059   -2.744  31.362  1.00 36.79 ? 570 ARG A NH2   1 
ATOM   2742 N N     . TYR A 1 360 ? 4.804   -0.417  26.026  1.00 10.81 ? 571 TYR A N     1 
ATOM   2743 C CA    . TYR A 1 360 ? 4.059   0.751   25.556  1.00 9.29  ? 571 TYR A CA    1 
ATOM   2744 C C     . TYR A 1 360 ? 4.575   1.244   24.205  1.00 8.86  ? 571 TYR A C     1 
ATOM   2745 O O     . TYR A 1 360 ? 5.808   1.269   23.933  1.00 8.31  ? 571 TYR A O     1 
ATOM   2746 C CB    . TYR A 1 360 ? 4.109   1.888   26.587  1.00 9.21  ? 571 TYR A CB    1 
ATOM   2747 C CG    . TYR A 1 360 ? 3.647   1.544   28.003  1.00 7.51  ? 571 TYR A CG    1 
ATOM   2748 C CD1   . TYR A 1 360 ? 2.299   1.519   28.336  1.00 11.55 ? 571 TYR A CD1   1 
ATOM   2749 C CD2   . TYR A 1 360 ? 4.573   1.294   29.013  1.00 7.70  ? 571 TYR A CD2   1 
ATOM   2750 C CE1   . TYR A 1 360 ? 1.883   1.211   29.649  1.00 12.51 ? 571 TYR A CE1   1 
ATOM   2751 C CE2   . TYR A 1 360 ? 4.183   0.955   30.291  1.00 11.27 ? 571 TYR A CE2   1 
ATOM   2752 C CZ    . TYR A 1 360 ? 2.836   0.931   30.617  1.00 13.22 ? 571 TYR A CZ    1 
ATOM   2753 O OH    . TYR A 1 360 ? 2.486   0.638   31.926  1.00 17.86 ? 571 TYR A OH    1 
ATOM   2754 N N     . LEU A 1 361 ? 3.619   1.660   23.381  1.00 8.72  ? 572 LEU A N     1 
ATOM   2755 C CA    . LEU A 1 361 ? 3.891   2.282   22.112  1.00 9.41  ? 572 LEU A CA    1 
ATOM   2756 C C     . LEU A 1 361 ? 3.357   3.704   22.130  1.00 9.84  ? 572 LEU A C     1 
ATOM   2757 O O     . LEU A 1 361 ? 2.152   3.899   22.329  1.00 10.61 ? 572 LEU A O     1 
ATOM   2758 C CB    . LEU A 1 361 ? 3.247   1.466   21.000  1.00 8.42  ? 572 LEU A CB    1 
ATOM   2759 C CG    . LEU A 1 361 ? 3.735   1.848   19.608  1.00 11.01 ? 572 LEU A CG    1 
ATOM   2760 C CD1   . LEU A 1 361 ? 5.260   1.670   19.471  1.00 6.04  ? 572 LEU A CD1   1 
ATOM   2761 C CD2   . LEU A 1 361 ? 2.942   1.029   18.544  1.00 10.21 ? 572 LEU A CD2   1 
ATOM   2762 N N     . LEU A 1 362 ? 4.255   4.692   21.981  1.00 9.89  ? 573 LEU A N     1 
ATOM   2763 C CA    . LEU A 1 362 ? 3.893   6.099   22.026  1.00 9.86  ? 573 LEU A CA    1 
ATOM   2764 C C     . LEU A 1 362 ? 3.777   6.675   20.626  1.00 10.30 ? 573 LEU A C     1 
ATOM   2765 O O     . LEU A 1 362 ? 4.690   6.546   19.831  1.00 11.17 ? 573 LEU A O     1 
ATOM   2766 C CB    . LEU A 1 362 ? 4.952   6.926   22.777  1.00 9.76  ? 573 LEU A CB    1 
ATOM   2767 C CG    . LEU A 1 362 ? 5.075   6.774   24.293  1.00 10.42 ? 573 LEU A CG    1 
ATOM   2768 C CD1   . LEU A 1 362 ? 5.640   5.397   24.645  1.00 9.80  ? 573 LEU A CD1   1 
ATOM   2769 C CD2   . LEU A 1 362 ? 5.947   7.901   24.866  1.00 8.57  ? 573 LEU A CD2   1 
ATOM   2770 N N     . LYS A 1 363 ? 2.683   7.348   20.328  1.00 10.21 ? 574 LYS A N     1 
ATOM   2771 C CA    . LYS A 1 363 ? 2.576   8.071   19.050  1.00 10.64 ? 574 LYS A CA    1 
ATOM   2772 C C     . LYS A 1 363 ? 2.980   9.498   19.353  1.00 11.10 ? 574 LYS A C     1 
ATOM   2773 O O     . LYS A 1 363 ? 2.354   10.153  20.190  1.00 9.99  ? 574 LYS A O     1 
ATOM   2774 C CB    . LYS A 1 363 ? 1.176   7.976   18.458  1.00 9.90  ? 574 LYS A CB    1 
ATOM   2775 C CG    . LYS A 1 363 ? 1.025   8.621   17.068  1.00 12.31 ? 574 LYS A CG    1 
ATOM   2776 C CD    . LYS A 1 363 ? -0.433  8.619   16.610  1.00 15.61 ? 574 LYS A CD    1 
ATOM   2777 C CE    . LYS A 1 363 ? -0.640  9.256   15.224  1.00 19.90 ? 574 LYS A CE    1 
ATOM   2778 N NZ    . LYS A 1 363 ? -2.049  9.086   14.737  1.00 21.01 ? 574 LYS A NZ    1 
ATOM   2779 N N     . VAL A 1 364 ? 4.057   9.949   18.706  1.00 10.79 ? 575 VAL A N     1 
ATOM   2780 C CA    . VAL A 1 364 ? 4.695   11.191  19.043  1.00 11.31 ? 575 VAL A CA    1 
ATOM   2781 C C     . VAL A 1 364 ? 4.734   12.149  17.867  1.00 11.81 ? 575 VAL A C     1 
ATOM   2782 O O     . VAL A 1 364 ? 5.042   11.768  16.716  1.00 11.65 ? 575 VAL A O     1 
ATOM   2783 C CB    . VAL A 1 364 ? 6.132   10.971  19.549  1.00 12.34 ? 575 VAL A CB    1 
ATOM   2784 C CG1   . VAL A 1 364 ? 6.787   12.290  19.805  1.00 12.97 ? 575 VAL A CG1   1 
ATOM   2785 C CG2   . VAL A 1 364 ? 6.131   10.059  20.804  1.00 12.75 ? 575 VAL A CG2   1 
ATOM   2786 N N     . GLN A 1 365 ? 4.402   13.395  18.184  1.00 12.41 ? 576 GLN A N     1 
ATOM   2787 C CA    . GLN A 1 365 ? 4.544   14.530  17.279  1.00 13.26 ? 576 GLN A CA    1 
ATOM   2788 C C     . GLN A 1 365 ? 5.859   15.250  17.576  1.00 12.60 ? 576 GLN A C     1 
ATOM   2789 O O     . GLN A 1 365 ? 6.106   15.656  18.701  1.00 12.56 ? 576 GLN A O     1 
ATOM   2790 C CB    . GLN A 1 365 ? 3.385   15.507  17.478  1.00 13.66 ? 576 GLN A CB    1 
ATOM   2791 C CG    . GLN A 1 365 ? 3.463   16.802  16.642  1.00 16.74 ? 576 GLN A CG    1 
ATOM   2792 C CD    . GLN A 1 365 ? 2.287   17.718  16.946  1.00 20.20 ? 576 GLN A CD    1 
ATOM   2793 O OE1   . GLN A 1 365 ? 1.160   17.393  16.611  1.00 24.57 ? 576 GLN A OE1   1 
ATOM   2794 N NE2   . GLN A 1 365 ? 2.545   18.854  17.615  1.00 20.52 ? 576 GLN A NE2   1 
ATOM   2795 N N     . PHE A 1 366 ? 6.691   15.391  16.554  1.00 12.88 ? 577 PHE A N     1 
ATOM   2796 C CA    . PHE A 1 366 ? 7.975   16.037  16.683  1.00 13.12 ? 577 PHE A CA    1 
ATOM   2797 C C     . PHE A 1 366 ? 7.776   17.528  16.300  1.00 13.80 ? 577 PHE A C     1 
ATOM   2798 O O     . PHE A 1 366 ? 7.278   17.814  15.236  1.00 13.46 ? 577 PHE A O     1 
ATOM   2799 C CB    . PHE A 1 366 ? 8.996   15.367  15.739  1.00 13.27 ? 577 PHE A CB    1 
ATOM   2800 C CG    . PHE A 1 366 ? 9.501   14.012  16.221  1.00 13.11 ? 577 PHE A CG    1 
ATOM   2801 C CD1   . PHE A 1 366 ? 10.736  13.893  16.842  1.00 14.18 ? 577 PHE A CD1   1 
ATOM   2802 C CD2   . PHE A 1 366 ? 8.722   12.886  16.098  1.00 12.66 ? 577 PHE A CD2   1 
ATOM   2803 C CE1   . PHE A 1 366 ? 11.207  12.650  17.296  1.00 14.45 ? 577 PHE A CE1   1 
ATOM   2804 C CE2   . PHE A 1 366 ? 9.172   11.654  16.556  1.00 14.10 ? 577 PHE A CE2   1 
ATOM   2805 C CZ    . PHE A 1 366 ? 10.409  11.539  17.164  1.00 14.22 ? 577 PHE A CZ    1 
ATOM   2806 N N     . ASN A 1 367 ? 8.154   18.459  17.162  1.00 14.69 ? 578 ASN A N     1 
ATOM   2807 C CA    . ASN A 1 367 ? 7.969   19.889  16.871  1.00 16.48 ? 578 ASN A CA    1 
ATOM   2808 C C     . ASN A 1 367 ? 9.320   20.535  16.548  1.00 16.85 ? 578 ASN A C     1 
ATOM   2809 O O     . ASN A 1 367 ? 10.107  20.822  17.454  1.00 17.33 ? 578 ASN A O     1 
ATOM   2810 C CB    . ASN A 1 367 ? 7.303   20.586  18.058  1.00 16.59 ? 578 ASN A CB    1 
ATOM   2811 C CG    . ASN A 1 367 ? 6.151   19.775  18.644  1.00 16.88 ? 578 ASN A CG    1 
ATOM   2812 O OD1   . ASN A 1 367 ? 5.122   19.595  18.009  1.00 14.08 ? 578 ASN A OD1   1 
ATOM   2813 N ND2   . ASN A 1 367 ? 6.334   19.282  19.869  1.00 15.82 ? 578 ASN A ND2   1 
ATOM   2814 N N     . PHE A 1 368 ? 9.604   20.713  15.261  1.00 17.58 ? 579 PHE A N     1 
ATOM   2815 C CA    . PHE A 1 368 ? 10.903  21.290  14.799  1.00 18.13 ? 579 PHE A CA    1 
ATOM   2816 C C     . PHE A 1 368 ? 10.921  22.828  14.689  1.00 19.36 ? 579 PHE A C     1 
ATOM   2817 O O     . PHE A 1 368 ? 9.857   23.447  14.813  1.00 19.70 ? 579 PHE A O     1 
ATOM   2818 C CB    . PHE A 1 368 ? 11.285  20.706  13.444  1.00 17.86 ? 579 PHE A CB    1 
ATOM   2819 C CG    . PHE A 1 368 ? 11.593  19.267  13.503  1.00 17.62 ? 579 PHE A CG    1 
ATOM   2820 C CD1   . PHE A 1 368 ? 12.855  18.841  13.853  1.00 18.33 ? 579 PHE A CD1   1 
ATOM   2821 C CD2   . PHE A 1 368 ? 10.600  18.322  13.275  1.00 16.93 ? 579 PHE A CD2   1 
ATOM   2822 C CE1   . PHE A 1 368 ? 13.141  17.496  13.925  1.00 16.96 ? 579 PHE A CE1   1 
ATOM   2823 C CE2   . PHE A 1 368 ? 10.873  16.982  13.339  1.00 14.28 ? 579 PHE A CE2   1 
ATOM   2824 C CZ    . PHE A 1 368 ? 12.139  16.562  13.667  1.00 16.99 ? 579 PHE A CZ    1 
ATOM   2825 O OXT   . PHE A 1 368 ? 12.007  23.451  14.505  1.00 19.15 ? 579 PHE A OXT   1 
ATOM   2826 N N     . THR B 1 15  ? 6.581   -36.309 -22.376 1.00 41.51 ? 226 THR B N     1 
ATOM   2827 C CA    . THR B 1 15  ? 6.843   -35.401 -21.234 1.00 41.85 ? 226 THR B CA    1 
ATOM   2828 C C     . THR B 1 15  ? 8.375   -35.379 -20.930 1.00 41.78 ? 226 THR B C     1 
ATOM   2829 O O     . THR B 1 15  ? 8.796   -35.158 -19.793 1.00 41.59 ? 226 THR B O     1 
ATOM   2830 C CB    . THR B 1 15  ? 5.969   -35.817 -19.984 1.00 42.34 ? 226 THR B CB    1 
ATOM   2831 O OG1   . THR B 1 15  ? 5.675   -34.673 -19.160 1.00 41.30 ? 226 THR B OG1   1 
ATOM   2832 C CG2   . THR B 1 15  ? 6.633   -36.962 -19.138 1.00 42.63 ? 226 THR B CG2   1 
ATOM   2833 N N     . GLU B 1 16  ? 9.187   -35.587 -21.974 1.00 41.33 ? 227 GLU B N     1 
ATOM   2834 C CA    . GLU B 1 16  ? 10.648  -35.574 -21.881 1.00 40.91 ? 227 GLU B CA    1 
ATOM   2835 C C     . GLU B 1 16  ? 11.200  -34.220 -21.476 1.00 40.18 ? 227 GLU B C     1 
ATOM   2836 O O     . GLU B 1 16  ? 10.514  -33.183 -21.560 1.00 39.36 ? 227 GLU B O     1 
ATOM   2837 C CB    . GLU B 1 16  ? 11.297  -35.962 -23.222 1.00 41.35 ? 227 GLU B CB    1 
ATOM   2838 C CG    . GLU B 1 16  ? 11.667  -37.426 -23.349 1.00 43.07 ? 227 GLU B CG    1 
ATOM   2839 C CD    . GLU B 1 16  ? 11.898  -37.813 -24.794 1.00 45.98 ? 227 GLU B CD    1 
ATOM   2840 O OE1   . GLU B 1 16  ? 10.991  -38.428 -25.389 1.00 47.82 ? 227 GLU B OE1   1 
ATOM   2841 O OE2   . GLU B 1 16  ? 12.965  -37.477 -25.353 1.00 49.80 ? 227 GLU B OE2   1 
ATOM   2842 N N     . ASN B 1 17  ? 12.468  -34.253 -21.072 1.00 39.25 ? 228 ASN B N     1 
ATOM   2843 C CA    . ASN B 1 17  ? 13.219  -33.056 -20.708 1.00 39.09 ? 228 ASN B CA    1 
ATOM   2844 C C     . ASN B 1 17  ? 13.587  -32.177 -21.904 1.00 37.91 ? 228 ASN B C     1 
ATOM   2845 O O     . ASN B 1 17  ? 13.990  -31.022 -21.716 1.00 37.54 ? 228 ASN B O     1 
ATOM   2846 C CB    . ASN B 1 17  ? 14.500  -33.423 -19.925 1.00 39.57 ? 228 ASN B CB    1 
ATOM   2847 C CG    . ASN B 1 17  ? 14.439  -32.987 -18.472 1.00 41.53 ? 228 ASN B CG    1 
ATOM   2848 O OD1   . ASN B 1 17  ? 15.294  -32.222 -18.006 1.00 44.14 ? 228 ASN B OD1   1 
ATOM   2849 N ND2   . ASN B 1 17  ? 13.410  -33.450 -17.748 1.00 43.33 ? 228 ASN B ND2   1 
ATOM   2850 N N     . LEU B 1 18  ? 13.457  -32.713 -23.119 1.00 36.85 ? 229 LEU B N     1 
ATOM   2851 C CA    . LEU B 1 18  ? 13.689  -31.917 -24.330 1.00 36.59 ? 229 LEU B CA    1 
ATOM   2852 C C     . LEU B 1 18  ? 12.622  -30.835 -24.465 1.00 36.03 ? 229 LEU B C     1 
ATOM   2853 O O     . LEU B 1 18  ? 12.871  -29.752 -24.997 1.00 35.17 ? 229 LEU B O     1 
ATOM   2854 C CB    . LEU B 1 18  ? 13.694  -32.813 -25.582 1.00 36.61 ? 229 LEU B CB    1 
ATOM   2855 C CG    . LEU B 1 18  ? 14.846  -33.814 -25.709 1.00 37.79 ? 229 LEU B CG    1 
ATOM   2856 C CD1   . LEU B 1 18  ? 14.651  -34.738 -26.908 1.00 38.22 ? 229 LEU B CD1   1 
ATOM   2857 C CD2   . LEU B 1 18  ? 16.226  -33.106 -25.762 1.00 38.37 ? 229 LEU B CD2   1 
ATOM   2858 N N     . TYR B 1 19  ? 11.425  -31.150 -23.979 1.00 35.42 ? 230 TYR B N     1 
ATOM   2859 C CA    . TYR B 1 19  ? 10.301  -30.249 -24.064 1.00 35.36 ? 230 TYR B CA    1 
ATOM   2860 C C     . TYR B 1 19  ? 10.174  -29.409 -22.791 1.00 35.94 ? 230 TYR B C     1 
ATOM   2861 O O     . TYR B 1 19  ? 10.139  -28.171 -22.857 1.00 35.60 ? 230 TYR B O     1 
ATOM   2862 C CB    . TYR B 1 19  ? 9.036   -31.060 -24.324 1.00 35.06 ? 230 TYR B CB    1 
ATOM   2863 C CG    . TYR B 1 19  ? 9.076   -31.791 -25.645 1.00 33.60 ? 230 TYR B CG    1 
ATOM   2864 C CD1   . TYR B 1 19  ? 9.454   -33.128 -25.715 1.00 32.74 ? 230 TYR B CD1   1 
ATOM   2865 C CD2   . TYR B 1 19  ? 8.735   -31.143 -26.828 1.00 32.50 ? 230 TYR B CD2   1 
ATOM   2866 C CE1   . TYR B 1 19  ? 9.480   -33.811 -26.926 1.00 32.60 ? 230 TYR B CE1   1 
ATOM   2867 C CE2   . TYR B 1 19  ? 8.749   -31.821 -28.053 1.00 32.60 ? 230 TYR B CE2   1 
ATOM   2868 C CZ    . TYR B 1 19  ? 9.131   -33.152 -28.092 1.00 33.09 ? 230 TYR B CZ    1 
ATOM   2869 O OH    . TYR B 1 19  ? 9.164   -33.820 -29.290 1.00 32.25 ? 230 TYR B OH    1 
ATOM   2870 N N     . PHE B 1 20  ? 10.130  -30.085 -21.642 1.00 36.72 ? 231 PHE B N     1 
ATOM   2871 C CA    . PHE B 1 20  ? 9.971   -29.432 -20.330 1.00 37.16 ? 231 PHE B CA    1 
ATOM   2872 C C     . PHE B 1 20  ? 11.227  -29.636 -19.477 1.00 38.11 ? 231 PHE B C     1 
ATOM   2873 O O     . PHE B 1 20  ? 11.486  -30.745 -18.992 1.00 38.63 ? 231 PHE B O     1 
ATOM   2874 C CB    . PHE B 1 20  ? 8.769   -30.038 -19.601 1.00 36.88 ? 231 PHE B CB    1 
ATOM   2875 C CG    . PHE B 1 20  ? 7.576   -30.250 -20.477 1.00 36.27 ? 231 PHE B CG    1 
ATOM   2876 C CD1   . PHE B 1 20  ? 6.765   -29.174 -20.839 1.00 36.39 ? 231 PHE B CD1   1 
ATOM   2877 C CD2   . PHE B 1 20  ? 7.252   -31.523 -20.948 1.00 35.55 ? 231 PHE B CD2   1 
ATOM   2878 C CE1   . PHE B 1 20  ? 5.651   -29.357 -21.662 1.00 35.84 ? 231 PHE B CE1   1 
ATOM   2879 C CE2   . PHE B 1 20  ? 6.128   -31.716 -21.775 1.00 35.36 ? 231 PHE B CE2   1 
ATOM   2880 C CZ    . PHE B 1 20  ? 5.328   -30.629 -22.127 1.00 35.31 ? 231 PHE B CZ    1 
ATOM   2881 N N     . GLN B 1 21  ? 12.016  -28.587 -19.286 1.00 38.75 ? 232 GLN B N     1 
ATOM   2882 C CA    . GLN B 1 21  ? 13.230  -28.726 -18.479 1.00 39.37 ? 232 GLN B CA    1 
ATOM   2883 C C     . GLN B 1 21  ? 12.846  -28.909 -17.012 1.00 38.69 ? 232 GLN B C     1 
ATOM   2884 O O     . GLN B 1 21  ? 12.305  -27.991 -16.385 1.00 39.43 ? 232 GLN B O     1 
ATOM   2885 C CB    . GLN B 1 21  ? 14.165  -27.531 -18.664 1.00 40.09 ? 232 GLN B CB    1 
ATOM   2886 C CG    . GLN B 1 21  ? 14.507  -27.256 -20.146 1.00 42.17 ? 232 GLN B CG    1 
ATOM   2887 C CD    . GLN B 1 21  ? 16.004  -27.131 -20.413 1.00 44.87 ? 232 GLN B CD    1 
ATOM   2888 O OE1   . GLN B 1 21  ? 16.843  -27.604 -19.627 1.00 47.69 ? 232 GLN B OE1   1 
ATOM   2889 N NE2   . GLN B 1 21  ? 16.348  -26.505 -21.535 1.00 44.50 ? 232 GLN B NE2   1 
ATOM   2890 N N     . SER B 1 22  ? 13.075  -30.118 -16.499 1.00 37.36 ? 233 SER B N     1 
ATOM   2891 C CA    . SER B 1 22  ? 12.755  -30.455 -15.115 1.00 36.20 ? 233 SER B CA    1 
ATOM   2892 C C     . SER B 1 22  ? 14.001  -30.900 -14.375 1.00 34.69 ? 233 SER B C     1 
ATOM   2893 O O     . SER B 1 22  ? 15.000  -31.295 -14.971 1.00 34.24 ? 233 SER B O     1 
ATOM   2894 C CB    . SER B 1 22  ? 11.708  -31.567 -15.057 1.00 36.26 ? 233 SER B CB    1 
ATOM   2895 O OG    . SER B 1 22  ? 12.307  -32.820 -15.337 1.00 37.63 ? 233 SER B OG    1 
ATOM   2896 N N     . MET B 1 23  ? 13.922  -30.859 -13.056 1.00 33.37 ? 234 MET B N     1 
ATOM   2897 C CA    . MET B 1 23  ? 15.026  -31.300 -12.209 1.00 32.37 ? 234 MET B CA    1 
ATOM   2898 C C     . MET B 1 23  ? 15.406  -32.764 -12.513 1.00 31.46 ? 234 MET B C     1 
ATOM   2899 O O     . MET B 1 23  ? 14.552  -33.643 -12.549 1.00 30.93 ? 234 MET B O     1 
ATOM   2900 C CB    . MET B 1 23  ? 14.637  -31.132 -10.732 1.00 32.11 ? 234 MET B CB    1 
ATOM   2901 C CG    . MET B 1 23  ? 15.767  -31.419 -9.733  1.00 31.35 ? 234 MET B CG    1 
ATOM   2902 S SD    . MET B 1 23  ? 15.242  -31.164 -8.007  1.00 29.26 ? 234 MET B SD    1 
ATOM   2903 C CE    . MET B 1 23  ? 15.071  -29.381 -8.007  1.00 27.71 ? 234 MET B CE    1 
ATOM   2904 N N     . ASP B 1 24  ? 16.691  -33.012 -12.744 1.00 30.96 ? 235 ASP B N     1 
ATOM   2905 C CA    . ASP B 1 24  ? 17.185  -34.374 -12.930 1.00 30.64 ? 235 ASP B CA    1 
ATOM   2906 C C     . ASP B 1 24  ? 16.646  -35.227 -11.777 1.00 30.27 ? 235 ASP B C     1 
ATOM   2907 O O     . ASP B 1 24  ? 16.660  -34.782 -10.621 1.00 29.99 ? 235 ASP B O     1 
ATOM   2908 C CB    . ASP B 1 24  ? 18.728  -34.370 -12.961 1.00 30.91 ? 235 ASP B CB    1 
ATOM   2909 C CG    . ASP B 1 24  ? 19.337  -35.739 -13.264 1.00 31.71 ? 235 ASP B CG    1 
ATOM   2910 O OD1   . ASP B 1 24  ? 19.102  -36.687 -12.496 1.00 34.28 ? 235 ASP B OD1   1 
ATOM   2911 O OD2   . ASP B 1 24  ? 20.091  -35.869 -14.247 1.00 32.53 ? 235 ASP B OD2   1 
ATOM   2912 N N     . LEU B 1 25  ? 16.163  -36.429 -12.095 1.00 28.91 ? 236 LEU B N     1 
ATOM   2913 C CA    . LEU B 1 25  ? 15.646  -37.384 -11.089 1.00 28.73 ? 236 LEU B CA    1 
ATOM   2914 C C     . LEU B 1 25  ? 16.527  -37.575 -9.863  1.00 27.04 ? 236 LEU B C     1 
ATOM   2915 O O     . LEU B 1 25  ? 16.048  -37.653 -8.749  1.00 27.10 ? 236 LEU B O     1 
ATOM   2916 C CB    . LEU B 1 25  ? 15.429  -38.771 -11.719 1.00 29.04 ? 236 LEU B CB    1 
ATOM   2917 C CG    . LEU B 1 25  ? 14.048  -39.051 -12.295 1.00 31.32 ? 236 LEU B CG    1 
ATOM   2918 C CD1   . LEU B 1 25  ? 13.029  -39.227 -11.155 1.00 34.15 ? 236 LEU B CD1   1 
ATOM   2919 C CD2   . LEU B 1 25  ? 13.637  -37.929 -13.263 1.00 33.66 ? 236 LEU B CD2   1 
ATOM   2920 N N     . ARG B 1 26  ? 17.820  -37.667 -10.099 1.00 25.88 ? 237 ARG B N     1 
ATOM   2921 C CA    . ARG B 1 26  ? 18.791  -37.956 -9.063  1.00 25.31 ? 237 ARG B CA    1 
ATOM   2922 C C     . ARG B 1 26  ? 18.944  -36.781 -8.101  1.00 23.76 ? 237 ARG B C     1 
ATOM   2923 O O     . ARG B 1 26  ? 19.061  -36.973 -6.901  1.00 23.05 ? 237 ARG B O     1 
ATOM   2924 C CB    . ARG B 1 26  ? 20.116  -38.314 -9.722  1.00 25.82 ? 237 ARG B CB    1 
ATOM   2925 C CG    . ARG B 1 26  ? 20.002  -39.588 -10.564 1.00 26.34 ? 237 ARG B CG    1 
ATOM   2926 C CD    . ARG B 1 26  ? 20.827  -39.484 -11.823 1.00 27.25 ? 237 ARG B CD    1 
ATOM   2927 N NE    . ARG B 1 26  ? 22.238  -39.614 -11.544 1.00 25.14 ? 237 ARG B NE    1 
ATOM   2928 C CZ    . ARG B 1 26  ? 23.205  -39.385 -12.430 1.00 27.44 ? 237 ARG B CZ    1 
ATOM   2929 N NH1   . ARG B 1 26  ? 24.484  -39.534 -12.065 1.00 28.17 ? 237 ARG B NH1   1 
ATOM   2930 N NH2   . ARG B 1 26  ? 22.910  -38.985 -13.659 1.00 25.22 ? 237 ARG B NH2   1 
ATOM   2931 N N     . VAL B 1 27  ? 18.917  -35.572 -8.640  1.00 22.56 ? 238 VAL B N     1 
ATOM   2932 C CA    . VAL B 1 27  ? 18.909  -34.366 -7.816  1.00 21.97 ? 238 VAL B CA    1 
ATOM   2933 C C     . VAL B 1 27  ? 17.604  -34.323 -7.037  1.00 21.75 ? 238 VAL B C     1 
ATOM   2934 O O     . VAL B 1 27  ? 17.601  -33.980 -5.867  1.00 20.65 ? 238 VAL B O     1 
ATOM   2935 C CB    . VAL B 1 27  ? 19.079  -33.096 -8.669  1.00 21.57 ? 238 VAL B CB    1 
ATOM   2936 C CG1   . VAL B 1 27  ? 18.928  -31.868 -7.834  1.00 22.16 ? 238 VAL B CG1   1 
ATOM   2937 C CG2   . VAL B 1 27  ? 20.450  -33.092 -9.349  1.00 20.37 ? 238 VAL B CG2   1 
ATOM   2938 N N     . GLN B 1 28  ? 16.496  -34.704 -7.680  1.00 21.83 ? 239 GLN B N     1 
ATOM   2939 C CA    . GLN B 1 28  ? 15.199  -34.739 -7.007  1.00 22.20 ? 239 GLN B CA    1 
ATOM   2940 C C     . GLN B 1 28  ? 15.247  -35.637 -5.776  1.00 21.29 ? 239 GLN B C     1 
ATOM   2941 O O     . GLN B 1 28  ? 14.825  -35.228 -4.700  1.00 20.89 ? 239 GLN B O     1 
ATOM   2942 C CB    . GLN B 1 28  ? 14.061  -35.214 -7.935  1.00 22.96 ? 239 GLN B CB    1 
ATOM   2943 C CG    . GLN B 1 28  ? 13.535  -34.179 -8.927  1.00 24.97 ? 239 GLN B CG    1 
ATOM   2944 C CD    . GLN B 1 28  ? 12.386  -34.748 -9.780  1.00 28.58 ? 239 GLN B CD    1 
ATOM   2945 O OE1   . GLN B 1 28  ? 11.374  -35.215 -9.250  1.00 28.43 ? 239 GLN B OE1   1 
ATOM   2946 N NE2   . GLN B 1 28  ? 12.559  -34.718 -11.108 1.00 26.70 ? 239 GLN B NE2   1 
ATOM   2947 N N     . GLU B 1 29  ? 15.766  -36.847 -5.937  1.00 21.13 ? 240 GLU B N     1 
ATOM   2948 C CA    . GLU B 1 29  ? 15.876  -37.780 -4.813  1.00 21.26 ? 240 GLU B CA    1 
ATOM   2949 C C     . GLU B 1 29  ? 16.846  -37.315 -3.730  1.00 20.08 ? 240 GLU B C     1 
ATOM   2950 O O     . GLU B 1 29  ? 16.656  -37.614 -2.529  1.00 19.04 ? 240 GLU B O     1 
ATOM   2951 C CB    . GLU B 1 29  ? 16.275  -39.176 -5.284  1.00 22.38 ? 240 GLU B CB    1 
ATOM   2952 C CG    . GLU B 1 29  ? 15.246  -39.880 -6.207  1.00 26.42 ? 240 GLU B CG    1 
ATOM   2953 C CD    . GLU B 1 29  ? 13.875  -40.097 -5.569  1.00 31.00 ? 240 GLU B CD    1 
ATOM   2954 O OE1   . GLU B 1 29  ? 13.830  -40.529 -4.395  1.00 34.32 ? 240 GLU B OE1   1 
ATOM   2955 O OE2   . GLU B 1 29  ? 12.847  -39.839 -6.247  1.00 33.44 ? 240 GLU B OE2   1 
ATOM   2956 N N     . LEU B 1 30  ? 17.891  -36.604 -4.142  1.00 18.21 ? 241 LEU B N     1 
ATOM   2957 C CA    . LEU B 1 30  ? 18.806  -35.991 -3.185  1.00 17.54 ? 241 LEU B CA    1 
ATOM   2958 C C     . LEU B 1 30  ? 18.091  -34.940 -2.337  1.00 17.65 ? 241 LEU B C     1 
ATOM   2959 O O     . LEU B 1 30  ? 18.211  -34.934 -1.108  1.00 17.68 ? 241 LEU B O     1 
ATOM   2960 C CB    . LEU B 1 30  ? 19.989  -35.361 -3.901  1.00 16.60 ? 241 LEU B CB    1 
ATOM   2961 C CG    . LEU B 1 30  ? 21.061  -34.698 -3.046  1.00 15.76 ? 241 LEU B CG    1 
ATOM   2962 C CD1   . LEU B 1 30  ? 21.700  -35.658 -2.021  1.00 16.94 ? 241 LEU B CD1   1 
ATOM   2963 C CD2   . LEU B 1 30  ? 22.088  -34.131 -3.981  1.00 17.64 ? 241 LEU B CD2   1 
ATOM   2964 N N     . ILE B 1 31  ? 17.358  -34.047 -3.002  1.00 18.24 ? 242 ILE B N     1 
ATOM   2965 C CA    . ILE B 1 31  ? 16.631  -32.990 -2.322  1.00 18.07 ? 242 ILE B CA    1 
ATOM   2966 C C     . ILE B 1 31  ? 15.590  -33.578 -1.364  1.00 18.61 ? 242 ILE B C     1 
ATOM   2967 O O     . ILE B 1 31  ? 15.502  -33.154 -0.218  1.00 17.60 ? 242 ILE B O     1 
ATOM   2968 C CB    . ILE B 1 31  ? 15.953  -32.000 -3.318  1.00 18.87 ? 242 ILE B CB    1 
ATOM   2969 C CG1   . ILE B 1 31  ? 16.991  -31.229 -4.137  1.00 18.60 ? 242 ILE B CG1   1 
ATOM   2970 C CG2   . ILE B 1 31  ? 15.079  -31.000 -2.573  1.00 17.76 ? 242 ILE B CG2   1 
ATOM   2971 C CD1   . ILE B 1 31  ? 18.101  -30.579 -3.328  1.00 19.55 ? 242 ILE B CD1   1 
ATOM   2972 N N     . LYS B 1 32  ? 14.820  -34.561 -1.817  1.00 18.59 ? 243 LYS B N     1 
ATOM   2973 C CA    . LYS B 1 32  ? 13.790  -35.152 -0.971  1.00 19.33 ? 243 LYS B CA    1 
ATOM   2974 C C     . LYS B 1 32  ? 14.448  -35.726 0.265   1.00 18.37 ? 243 LYS B C     1 
ATOM   2975 O O     . LYS B 1 32  ? 13.881  -35.670 1.340   1.00 19.34 ? 243 LYS B O     1 
ATOM   2976 C CB    . LYS B 1 32  ? 13.057  -36.305 -1.644  1.00 19.76 ? 243 LYS B CB    1 
ATOM   2977 C CG    . LYS B 1 32  ? 12.058  -35.967 -2.706  1.00 23.45 ? 243 LYS B CG    1 
ATOM   2978 C CD    . LYS B 1 32  ? 11.299  -37.243 -3.098  1.00 27.19 ? 243 LYS B CD    1 
ATOM   2979 C CE    . LYS B 1 32  ? 10.378  -37.030 -4.311  1.00 30.35 ? 243 LYS B CE    1 
ATOM   2980 N NZ    . LYS B 1 32  ? 10.227  -38.296 -5.124  1.00 30.19 ? 243 LYS B NZ    1 
ATOM   2981 N N     . LEU B 1 33  ? 15.622  -36.308 0.085   1.00 17.49 ? 244 LEU B N     1 
ATOM   2982 C CA    . LEU B 1 33  ? 16.327  -36.951 1.156   1.00 17.49 ? 244 LEU B CA    1 
ATOM   2983 C C     . LEU B 1 33  ? 16.772  -35.936 2.212   1.00 16.70 ? 244 LEU B C     1 
ATOM   2984 O O     . LEU B 1 33  ? 16.450  -36.080 3.385   1.00 17.61 ? 244 LEU B O     1 
ATOM   2985 C CB    . LEU B 1 33  ? 17.553  -37.691 0.619   1.00 17.34 ? 244 LEU B CB    1 
ATOM   2986 C CG    . LEU B 1 33  ? 18.242  -38.614 1.622   1.00 17.69 ? 244 LEU B CG    1 
ATOM   2987 C CD1   . LEU B 1 33  ? 17.237  -39.633 2.252   1.00 18.18 ? 244 LEU B CD1   1 
ATOM   2988 C CD2   . LEU B 1 33  ? 19.377  -39.342 0.950   1.00 19.93 ? 244 LEU B CD2   1 
ATOM   2989 N N     . ILE B 1 34  ? 17.507  -34.918 1.790   1.00 15.17 ? 245 ILE B N     1 
ATOM   2990 C CA    . ILE B 1 34  ? 18.093  -34.002 2.754   1.00 14.18 ? 245 ILE B CA    1 
ATOM   2991 C C     . ILE B 1 34  ? 17.042  -33.099 3.373   1.00 14.20 ? 245 ILE B C     1 
ATOM   2992 O O     . ILE B 1 34  ? 17.240  -32.610 4.490   1.00 13.21 ? 245 ILE B O     1 
ATOM   2993 C CB    . ILE B 1 34  ? 19.248  -33.194 2.167   1.00 14.22 ? 245 ILE B CB    1 
ATOM   2994 C CG1   . ILE B 1 34  ? 18.784  -32.221 1.060   1.00 13.04 ? 245 ILE B CG1   1 
ATOM   2995 C CG2   . ILE B 1 34  ? 20.338  -34.141 1.646   1.00 14.24 ? 245 ILE B CG2   1 
ATOM   2996 C CD1   . ILE B 1 34  ? 19.939  -31.353 0.491   1.00 15.39 ? 245 ILE B CD1   1 
ATOM   2997 N N     . CYS B 1 35  ? 15.947  -32.863 2.650   1.00 13.70 ? 246 CYS B N     1 
ATOM   2998 C CA    . CYS B 1 35  ? 14.853  -32.025 3.162   1.00 14.69 ? 246 CYS B CA    1 
ATOM   2999 C C     . CYS B 1 35  ? 13.780  -32.736 4.014   1.00 14.69 ? 246 CYS B C     1 
ATOM   3000 O O     . CYS B 1 35  ? 12.885  -32.080 4.499   1.00 15.35 ? 246 CYS B O     1 
ATOM   3001 C CB    . CYS B 1 35  ? 14.183  -31.228 2.037   1.00 14.59 ? 246 CYS B CB    1 
ATOM   3002 S SG    . CYS B 1 35  ? 15.281  -30.093 1.163   1.00 17.55 ? 246 CYS B SG    1 
ATOM   3003 N N     . ASN B 1 36  ? 13.882  -34.044 4.222   1.00 15.31 ? 247 ASN B N     1 
ATOM   3004 C CA    . ASN B 1 36  ? 12.907  -34.800 5.029   1.00 16.62 ? 247 ASN B CA    1 
ATOM   3005 C C     . ASN B 1 36  ? 12.942  -34.353 6.509   1.00 16.96 ? 247 ASN B C     1 
ATOM   3006 O O     . ASN B 1 36  ? 13.889  -34.669 7.241   1.00 16.49 ? 247 ASN B O     1 
ATOM   3007 C CB    . ASN B 1 36  ? 13.242  -36.283 4.943   1.00 17.63 ? 247 ASN B CB    1 
ATOM   3008 C CG    . ASN B 1 36  ? 12.149  -37.175 5.466   1.00 20.51 ? 247 ASN B CG    1 
ATOM   3009 O OD1   . ASN B 1 36  ? 11.440  -36.852 6.426   1.00 23.27 ? 247 ASN B OD1   1 
ATOM   3010 N ND2   . ASN B 1 36  ? 12.039  -38.351 4.857   1.00 22.70 ? 247 ASN B ND2   1 
ATOM   3011 N N     . VAL B 1 37  ? 11.935  -33.596 6.920   1.00 17.42 ? 248 VAL B N     1 
ATOM   3012 C CA    . VAL B 1 37  ? 11.839  -33.087 8.295   1.00 17.99 ? 248 VAL B CA    1 
ATOM   3013 C C     . VAL B 1 37  ? 11.488  -34.203 9.290   1.00 17.70 ? 248 VAL B C     1 
ATOM   3014 O O     . VAL B 1 37  ? 11.964  -34.203 10.431  1.00 17.68 ? 248 VAL B O     1 
ATOM   3015 C CB    . VAL B 1 37  ? 10.819  -31.948 8.388   1.00 18.34 ? 248 VAL B CB    1 
ATOM   3016 C CG1   . VAL B 1 37  ? 10.674  -31.439 9.837   1.00 19.22 ? 248 VAL B CG1   1 
ATOM   3017 C CG2   . VAL B 1 37  ? 11.219  -30.797 7.480   1.00 18.09 ? 248 VAL B CG2   1 
ATOM   3018 N N     . GLN B 1 38  ? 10.678  -35.163 8.870   1.00 17.79 ? 249 GLN B N     1 
ATOM   3019 C CA    . GLN B 1 38  ? 10.409  -36.337 9.696   1.00 18.09 ? 249 GLN B CA    1 
ATOM   3020 C C     . GLN B 1 38  ? 11.711  -37.079 10.069  1.00 16.43 ? 249 GLN B C     1 
ATOM   3021 O O     . GLN B 1 38  ? 11.918  -37.461 11.226  1.00 15.57 ? 249 GLN B O     1 
ATOM   3022 C CB    . GLN B 1 38  ? 9.424   -37.277 8.990   1.00 19.18 ? 249 GLN B CB    1 
ATOM   3023 C CG    . GLN B 1 38  ? 9.201   -38.626 9.706   1.00 23.77 ? 249 GLN B CG    1 
ATOM   3024 C CD    . GLN B 1 38  ? 8.266   -38.546 10.917  1.00 28.64 ? 249 GLN B CD    1 
ATOM   3025 O OE1   . GLN B 1 38  ? 7.085   -38.888 10.815  1.00 34.27 ? 249 GLN B OE1   1 
ATOM   3026 N NE2   . GLN B 1 38  ? 8.789   -38.118 12.060  1.00 31.06 ? 249 GLN B NE2   1 
ATOM   3027 N N     . ALA B 1 39  ? 12.595  -37.279 9.100   1.00 15.07 ? 250 ALA B N     1 
ATOM   3028 C CA    . ALA B 1 39  ? 13.880  -37.869 9.390   1.00 13.77 ? 250 ALA B CA    1 
ATOM   3029 C C     . ALA B 1 39  ? 14.628  -36.980 10.403  1.00 13.59 ? 250 ALA B C     1 
ATOM   3030 O O     . ALA B 1 39  ? 15.295  -37.479 11.299  1.00 12.96 ? 250 ALA B O     1 
ATOM   3031 C CB    . ALA B 1 39  ? 14.706  -38.088 8.087   1.00 14.48 ? 250 ALA B CB    1 
ATOM   3032 N N     . MET B 1 40  ? 14.534  -35.659 10.298  1.00 13.22 ? 251 MET B N     1 
ATOM   3033 C CA    . MET B 1 40  ? 15.301  -34.852 11.258  1.00 13.54 ? 251 MET B CA    1 
ATOM   3034 C C     . MET B 1 40  ? 14.762  -35.071 12.676  1.00 13.67 ? 251 MET B C     1 
ATOM   3035 O O     . MET B 1 40  ? 15.525  -35.167 13.620  1.00 12.65 ? 251 MET B O     1 
ATOM   3036 C CB    . MET B 1 40  ? 15.277  -33.374 10.915  1.00 13.67 ? 251 MET B CB    1 
ATOM   3037 C CG    . MET B 1 40  ? 15.899  -33.068 9.569   1.00 11.87 ? 251 MET B CG    1 
ATOM   3038 S SD    . MET B 1 40  ? 15.455  -31.400 9.132   1.00 14.63 ? 251 MET B SD    1 
ATOM   3039 C CE    . MET B 1 40  ? 16.122  -31.336 7.479   1.00 13.32 ? 251 MET B CE    1 
ATOM   3040 N N     . GLU B 1 41  ? 13.443  -35.131 12.802  1.00 15.26 ? 252 GLU B N     1 
ATOM   3041 C CA    . GLU B 1 41  ? 12.786  -35.432 14.090  1.00 17.14 ? 252 GLU B CA    1 
ATOM   3042 C C     . GLU B 1 41  ? 13.258  -36.758 14.670  1.00 16.46 ? 252 GLU B C     1 
ATOM   3043 O O     . GLU B 1 41  ? 13.549  -36.840 15.858  1.00 16.11 ? 252 GLU B O     1 
ATOM   3044 C CB    . GLU B 1 41  ? 11.256  -35.464 13.967  1.00 18.06 ? 252 GLU B CB    1 
ATOM   3045 C CG    . GLU B 1 41  ? 10.627  -34.107 13.721  1.00 22.46 ? 252 GLU B CG    1 
ATOM   3046 C CD    . GLU B 1 41  ? 9.161   -34.168 13.263  1.00 28.87 ? 252 GLU B CD    1 
ATOM   3047 O OE1   . GLU B 1 41  ? 8.634   -35.291 13.086  1.00 29.63 ? 252 GLU B OE1   1 
ATOM   3048 O OE2   . GLU B 1 41  ? 8.554   -33.078 13.073  1.00 30.46 ? 252 GLU B OE2   1 
ATOM   3049 N N     . GLU B 1 42  ? 13.327  -37.787 13.832  1.00 16.34 ? 253 GLU B N     1 
ATOM   3050 C CA    . GLU B 1 42  ? 13.745  -39.112 14.286  1.00 16.95 ? 253 GLU B CA    1 
ATOM   3051 C C     . GLU B 1 42  ? 15.202  -39.124 14.679  1.00 15.70 ? 253 GLU B C     1 
ATOM   3052 O O     . GLU B 1 42  ? 15.572  -39.792 15.641  1.00 14.73 ? 253 GLU B O     1 
ATOM   3053 C CB    . GLU B 1 42  ? 13.526  -40.194 13.205  1.00 17.97 ? 253 GLU B CB    1 
ATOM   3054 C CG    . GLU B 1 42  ? 12.065  -40.621 13.038  1.00 21.07 ? 253 GLU B CG    1 
ATOM   3055 C CD    . GLU B 1 42  ? 11.796  -41.305 11.736  1.00 24.84 ? 253 GLU B CD    1 
ATOM   3056 O OE1   . GLU B 1 42  ? 12.764  -41.803 11.112  1.00 26.16 ? 253 GLU B OE1   1 
ATOM   3057 O OE2   . GLU B 1 42  ? 10.612  -41.321 11.320  1.00 29.35 ? 253 GLU B OE2   1 
ATOM   3058 N N     . MET B 1 43  ? 16.041  -38.409 13.933  1.00 15.01 ? 254 MET B N     1 
ATOM   3059 C CA    . MET B 1 43  ? 17.447  -38.330 14.296  1.00 14.86 ? 254 MET B CA    1 
ATOM   3060 C C     . MET B 1 43  ? 17.615  -37.630 15.650  1.00 14.61 ? 254 MET B C     1 
ATOM   3061 O O     . MET B 1 43  ? 18.468  -38.042 16.463  1.00 14.36 ? 254 MET B O     1 
ATOM   3062 C CB    . MET B 1 43  ? 18.294  -37.599 13.240  1.00 16.01 ? 254 MET B CB    1 
ATOM   3063 C CG    . MET B 1 43  ? 18.432  -38.281 11.862  1.00 17.75 ? 254 MET B CG    1 
ATOM   3064 S SD    . MET B 1 43  ? 19.564  -37.446 10.680  1.00 19.15 ? 254 MET B SD    1 
ATOM   3065 C CE    . MET B 1 43  ? 18.398  -36.894 9.373   1.00 14.76 ? 254 MET B CE    1 
ATOM   3066 N N     . MET B 1 44  ? 16.842  -36.576 15.906  1.00 14.16 ? 255 MET B N     1 
ATOM   3067 C CA    . MET B 1 44  ? 17.039  -35.836 17.159  1.00 14.19 ? 255 MET B CA    1 
ATOM   3068 C C     . MET B 1 44  ? 16.543  -36.686 18.345  1.00 15.06 ? 255 MET B C     1 
ATOM   3069 O O     . MET B 1 44  ? 17.155  -36.702 19.418  1.00 13.92 ? 255 MET B O     1 
ATOM   3070 C CB    . MET B 1 44  ? 16.352  -34.461 17.148  1.00 13.89 ? 255 MET B CB    1 
ATOM   3071 C CG    . MET B 1 44  ? 16.982  -33.420 16.229  1.00 13.64 ? 255 MET B CG    1 
ATOM   3072 S SD    . MET B 1 44  ? 18.771  -33.242 16.342  1.00 15.39 ? 255 MET B SD    1 
ATOM   3073 C CE    . MET B 1 44  ? 19.360  -34.472 15.227  1.00 16.17 ? 255 MET B CE    1 
ATOM   3074 N N     . MET B 1 45  ? 15.461  -37.420 18.140  1.00 16.32 ? 256 MET B N     1 
ATOM   3075 C CA    . MET B 1 45  ? 14.956  -38.319 19.198  1.00 17.87 ? 256 MET B CA    1 
ATOM   3076 C C     . MET B 1 45  ? 15.983  -39.387 19.539  1.00 17.94 ? 256 MET B C     1 
ATOM   3077 O O     . MET B 1 45  ? 16.153  -39.727 20.698  1.00 18.28 ? 256 MET B O     1 
ATOM   3078 C CB    . MET B 1 45  ? 13.627  -38.959 18.794  1.00 18.53 ? 256 MET B CB    1 
ATOM   3079 C CG    . MET B 1 45  ? 12.489  -37.963 18.756  1.00 22.67 ? 256 MET B CG    1 
ATOM   3080 S SD    . MET B 1 45  ? 10.915  -38.657 18.173  1.00 33.05 ? 256 MET B SD    1 
ATOM   3081 C CE    . MET B 1 45  ? 10.627  -39.775 19.542  1.00 30.20 ? 256 MET B CE    1 
ATOM   3082 N N     . GLU B 1 46  ? 16.704  -39.856 18.527  1.00 17.64 ? 257 GLU B N     1 
ATOM   3083 C CA    . GLU B 1 46  ? 17.760  -40.830 18.725  1.00 17.74 ? 257 GLU B CA    1 
ATOM   3084 C C     . GLU B 1 46  ? 18.872  -40.224 19.550  1.00 17.49 ? 257 GLU B C     1 
ATOM   3085 O O     . GLU B 1 46  ? 19.456  -40.914 20.351  1.00 17.34 ? 257 GLU B O     1 
ATOM   3086 C CB    . GLU B 1 46  ? 18.282  -41.387 17.385  1.00 18.21 ? 257 GLU B CB    1 
ATOM   3087 N N     . MET B 1 47  ? 19.136  -38.915 19.397  1.00 16.77 ? 258 MET B N     1 
ATOM   3088 C CA    . MET B 1 47  ? 20.142  -38.231 20.211  1.00 16.11 ? 258 MET B CA    1 
ATOM   3089 C C     . MET B 1 47  ? 19.592  -37.799 21.595  1.00 15.89 ? 258 MET B C     1 
ATOM   3090 O O     . MET B 1 47  ? 20.248  -37.074 22.326  1.00 15.78 ? 258 MET B O     1 
ATOM   3091 C CB    . MET B 1 47  ? 20.752  -37.023 19.453  1.00 16.23 ? 258 MET B CB    1 
ATOM   3092 C CG    . MET B 1 47  ? 21.420  -37.334 18.104  1.00 15.94 ? 258 MET B CG    1 
ATOM   3093 S SD    . MET B 1 47  ? 22.015  -35.850 17.225  1.00 18.53 ? 258 MET B SD    1 
ATOM   3094 C CE    . MET B 1 47  ? 23.440  -35.543 18.260  1.00 14.43 ? 258 MET B CE    1 
ATOM   3095 N N     . LYS B 1 48  ? 18.386  -38.236 21.939  1.00 15.61 ? 259 LYS B N     1 
ATOM   3096 C CA    . LYS B 1 48  ? 17.769  -37.987 23.253  1.00 15.15 ? 259 LYS B CA    1 
ATOM   3097 C C     . LYS B 1 48  ? 17.172  -36.605 23.433  1.00 14.94 ? 259 LYS B C     1 
ATOM   3098 O O     . LYS B 1 48  ? 16.737  -36.233 24.552  1.00 13.22 ? 259 LYS B O     1 
ATOM   3099 C CB    . LYS B 1 48  ? 18.736  -38.299 24.402  1.00 15.82 ? 259 LYS B CB    1 
ATOM   3100 C CG    . LYS B 1 48  ? 19.330  -39.691 24.340  1.00 19.67 ? 259 LYS B CG    1 
ATOM   3101 C CD    . LYS B 1 48  ? 18.177  -40.672 24.141  1.00 24.70 ? 259 LYS B CD    1 
ATOM   3102 C CE    . LYS B 1 48  ? 18.382  -42.054 24.777  1.00 27.72 ? 259 LYS B CE    1 
ATOM   3103 N NZ    . LYS B 1 48  ? 17.018  -42.551 25.136  1.00 27.28 ? 259 LYS B NZ    1 
ATOM   3104 N N     . TYR B 1 49  ? 17.074  -35.862 22.332  1.00 13.64 ? 260 TYR B N     1 
ATOM   3105 C CA    . TYR B 1 49  ? 16.396  -34.565 22.372  1.00 13.14 ? 260 TYR B CA    1 
ATOM   3106 C C     . TYR B 1 49  ? 14.908  -34.802 22.436  1.00 13.67 ? 260 TYR B C     1 
ATOM   3107 O O     . TYR B 1 49  ? 14.368  -35.641 21.697  1.00 12.84 ? 260 TYR B O     1 
ATOM   3108 C CB    . TYR B 1 49  ? 16.773  -33.735 21.138  1.00 13.00 ? 260 TYR B CB    1 
ATOM   3109 C CG    . TYR B 1 49  ? 16.120  -32.381 21.081  1.00 13.65 ? 260 TYR B CG    1 
ATOM   3110 C CD1   . TYR B 1 49  ? 16.627  -31.300 21.810  1.00 13.64 ? 260 TYR B CD1   1 
ATOM   3111 C CD2   . TYR B 1 49  ? 15.000  -32.179 20.305  1.00 13.64 ? 260 TYR B CD2   1 
ATOM   3112 C CE1   . TYR B 1 49  ? 16.029  -30.047 21.751  1.00 16.36 ? 260 TYR B CE1   1 
ATOM   3113 C CE2   . TYR B 1 49  ? 14.388  -30.931 20.252  1.00 16.78 ? 260 TYR B CE2   1 
ATOM   3114 C CZ    . TYR B 1 49  ? 14.901  -29.883 20.958  1.00 16.38 ? 260 TYR B CZ    1 
ATOM   3115 O OH    . TYR B 1 49  ? 14.259  -28.685 20.882  1.00 19.95 ? 260 TYR B OH    1 
ATOM   3116 N N     . ASN B 1 50  ? 14.233  -34.028 23.276  1.00 13.89 ? 261 ASN B N     1 
ATOM   3117 C CA    . ASN B 1 50  ? 12.798  -34.167 23.467  1.00 14.82 ? 261 ASN B CA    1 
ATOM   3118 C C     . ASN B 1 50  ? 11.948  -33.302 22.492  1.00 15.48 ? 261 ASN B C     1 
ATOM   3119 O O     . ASN B 1 50  ? 11.545  -32.185 22.829  1.00 14.52 ? 261 ASN B O     1 
ATOM   3120 C CB    . ASN B 1 50  ? 12.462  -33.825 24.915  1.00 14.73 ? 261 ASN B CB    1 
ATOM   3121 C CG    . ASN B 1 50  ? 11.099  -34.319 25.340  1.00 16.97 ? 261 ASN B CG    1 
ATOM   3122 O OD1   . ASN B 1 50  ? 10.182  -34.467 24.515  1.00 17.48 ? 261 ASN B OD1   1 
ATOM   3123 N ND2   . ASN B 1 50  ? 10.934  -34.521 26.656  1.00 14.08 ? 261 ASN B ND2   1 
ATOM   3124 N N     . THR B 1 51  ? 11.657  -33.856 21.316  1.00 16.38 ? 262 THR B N     1 
ATOM   3125 C CA    . THR B 1 51  ? 10.882  -33.172 20.294  1.00 18.42 ? 262 THR B CA    1 
ATOM   3126 C C     . THR B 1 51  ? 9.426   -32.905 20.706  1.00 19.79 ? 262 THR B C     1 
ATOM   3127 O O     . THR B 1 51  ? 8.815   -31.963 20.191  1.00 19.79 ? 262 THR B O     1 
ATOM   3128 C CB    . THR B 1 51  ? 10.856  -33.973 18.979  1.00 18.59 ? 262 THR B CB    1 
ATOM   3129 O OG1   . THR B 1 51  ? 10.444  -35.307 19.265  1.00 19.37 ? 262 THR B OG1   1 
ATOM   3130 C CG2   . THR B 1 51  ? 12.258  -33.991 18.305  1.00 20.39 ? 262 THR B CG2   1 
ATOM   3131 N N     . LYS B 1 52  ? 8.879   -33.690 21.640  1.00 21.02 ? 263 LYS B N     1 
ATOM   3132 C CA    . LYS B 1 52  ? 7.513   -33.460 22.105  1.00 22.86 ? 263 LYS B CA    1 
ATOM   3133 C C     . LYS B 1 52  ? 7.428   -32.197 22.939  1.00 22.32 ? 263 LYS B C     1 
ATOM   3134 O O     . LYS B 1 52  ? 6.584   -31.341 22.703  1.00 21.87 ? 263 LYS B O     1 
ATOM   3135 C CB    . LYS B 1 52  ? 6.973   -34.643 22.931  1.00 23.93 ? 263 LYS B CB    1 
ATOM   3136 C CG    . LYS B 1 52  ? 6.981   -35.986 22.202  1.00 28.34 ? 263 LYS B CG    1 
ATOM   3137 C CD    . LYS B 1 52  ? 6.179   -36.005 20.878  1.00 33.22 ? 263 LYS B CD    1 
ATOM   3138 C CE    . LYS B 1 52  ? 6.016   -37.438 20.317  1.00 35.35 ? 263 LYS B CE    1 
ATOM   3139 N NZ    . LYS B 1 52  ? 7.295   -38.224 20.348  1.00 37.71 ? 263 LYS B NZ    1 
ATOM   3140 N N     . LYS B 1 53  ? 8.313   -32.081 23.915  1.00 21.45 ? 264 LYS B N     1 
ATOM   3141 C CA    . LYS B 1 53  ? 8.345   -30.892 24.764  1.00 21.71 ? 264 LYS B CA    1 
ATOM   3142 C C     . LYS B 1 53  ? 8.860   -29.658 24.045  1.00 19.98 ? 264 LYS B C     1 
ATOM   3143 O O     . LYS B 1 53  ? 8.477   -28.558 24.406  1.00 19.09 ? 264 LYS B O     1 
ATOM   3144 C CB    . LYS B 1 53  ? 9.209   -31.109 26.022  1.00 22.50 ? 264 LYS B CB    1 
ATOM   3145 C CG    . LYS B 1 53  ? 8.412   -31.294 27.331  1.00 27.39 ? 264 LYS B CG    1 
ATOM   3146 C CD    . LYS B 1 53  ? 7.747   -32.696 27.439  1.00 32.22 ? 264 LYS B CD    1 
ATOM   3147 C CE    . LYS B 1 53  ? 7.083   -32.943 28.812  1.00 34.15 ? 264 LYS B CE    1 
ATOM   3148 N NZ    . LYS B 1 53  ? 8.044   -32.896 29.974  1.00 36.77 ? 264 LYS B NZ    1 
ATOM   3149 N N     . ALA B 1 54  ? 9.750   -29.833 23.065  1.00 18.82 ? 265 ALA B N     1 
ATOM   3150 C CA    . ALA B 1 54  ? 10.388  -28.692 22.394  1.00 17.97 ? 265 ALA B CA    1 
ATOM   3151 C C     . ALA B 1 54  ? 10.385  -28.948 20.886  1.00 17.95 ? 265 ALA B C     1 
ATOM   3152 O O     . ALA B 1 54  ? 11.399  -29.345 20.298  1.00 17.92 ? 265 ALA B O     1 
ATOM   3153 C CB    . ALA B 1 54  ? 11.808  -28.446 22.931  1.00 17.44 ? 265 ALA B CB    1 
ATOM   3154 N N     . PRO B 1 55  ? 9.225   -28.741 20.249  1.00 17.78 ? 266 PRO B N     1 
ATOM   3155 C CA    . PRO B 1 55  ? 9.165   -29.089 18.836  1.00 18.03 ? 266 PRO B CA    1 
ATOM   3156 C C     . PRO B 1 55  ? 10.224  -28.342 18.040  1.00 17.39 ? 266 PRO B C     1 
ATOM   3157 O O     . PRO B 1 55  ? 10.482  -27.155 18.293  1.00 17.45 ? 266 PRO B O     1 
ATOM   3158 C CB    . PRO B 1 55  ? 7.737   -28.667 18.395  1.00 17.12 ? 266 PRO B CB    1 
ATOM   3159 C CG    . PRO B 1 55  ? 6.957   -28.516 19.627  1.00 18.61 ? 266 PRO B CG    1 
ATOM   3160 C CD    . PRO B 1 55  ? 7.978   -28.128 20.722  1.00 18.64 ? 266 PRO B CD    1 
ATOM   3161 N N     . LEU B 1 56  ? 10.808  -29.044 17.077  1.00 17.65 ? 267 LEU B N     1 
ATOM   3162 C CA    . LEU B 1 56  ? 11.881  -28.515 16.259  1.00 17.82 ? 267 LEU B CA    1 
ATOM   3163 C C     . LEU B 1 56  ? 11.467  -27.234 15.522  1.00 17.55 ? 267 LEU B C     1 
ATOM   3164 O O     . LEU B 1 56  ? 12.241  -26.299 15.421  1.00 18.38 ? 267 LEU B O     1 
ATOM   3165 C CB    . LEU B 1 56  ? 12.338  -29.604 15.283  1.00 17.88 ? 267 LEU B CB    1 
ATOM   3166 C CG    . LEU B 1 56  ? 12.994  -30.788 16.003  1.00 17.80 ? 267 LEU B CG    1 
ATOM   3167 C CD1   . LEU B 1 56  ? 13.338  -31.905 15.051  1.00 17.15 ? 267 LEU B CD1   1 
ATOM   3168 C CD2   . LEU B 1 56  ? 14.217  -30.319 16.736  1.00 18.71 ? 267 LEU B CD2   1 
ATOM   3169 N N     . GLY B 1 57  ? 10.232  -27.208 15.050  1.00 18.06 ? 268 GLY B N     1 
ATOM   3170 C CA    . GLY B 1 57  ? 9.605   -26.042 14.427  1.00 17.60 ? 268 GLY B CA    1 
ATOM   3171 C C     . GLY B 1 57  ? 9.580   -24.775 15.247  1.00 18.30 ? 268 GLY B C     1 
ATOM   3172 O O     . GLY B 1 57  ? 9.449   -23.700 14.679  1.00 17.26 ? 268 GLY B O     1 
ATOM   3173 N N     . LYS B 1 58  ? 9.724   -24.877 16.572  1.00 17.35 ? 269 LYS B N     1 
ATOM   3174 C CA    . LYS B 1 58  ? 9.704   -23.700 17.408  1.00 17.85 ? 269 LYS B CA    1 
ATOM   3175 C C     . LYS B 1 58  ? 11.095  -23.371 17.994  1.00 17.39 ? 269 LYS B C     1 
ATOM   3176 O O     . LYS B 1 58  ? 11.237  -22.411 18.739  1.00 17.22 ? 269 LYS B O     1 
ATOM   3177 C CB    . LYS B 1 58  ? 8.627   -23.835 18.518  1.00 18.37 ? 269 LYS B CB    1 
ATOM   3178 C CG    . LYS B 1 58  ? 7.174   -23.829 17.977  1.00 21.06 ? 269 LYS B CG    1 
ATOM   3179 C CD    . LYS B 1 58  ? 6.152   -24.216 19.063  1.00 26.05 ? 269 LYS B CD    1 
ATOM   3180 C CE    . LYS B 1 58  ? 4.687   -23.894 18.672  1.00 28.72 ? 269 LYS B CE    1 
ATOM   3181 N NZ    . LYS B 1 58  ? 4.482   -23.885 17.177  1.00 30.33 ? 269 LYS B NZ    1 
ATOM   3182 N N     . LEU B 1 59  ? 12.123  -24.125 17.624  1.00 16.63 ? 270 LEU B N     1 
ATOM   3183 C CA    . LEU B 1 59  ? 13.456  -23.827 18.115  1.00 16.98 ? 270 LEU B CA    1 
ATOM   3184 C C     . LEU B 1 59  ? 13.970  -22.588 17.429  1.00 15.32 ? 270 LEU B C     1 
ATOM   3185 O O     . LEU B 1 59  ? 13.719  -22.362 16.241  1.00 16.29 ? 270 LEU B O     1 
ATOM   3186 C CB    . LEU B 1 59  ? 14.402  -25.016 17.918  1.00 17.72 ? 270 LEU B CB    1 
ATOM   3187 C CG    . LEU B 1 59  ? 15.635  -25.028 18.829  1.00 18.58 ? 270 LEU B CG    1 
ATOM   3188 C CD1   . LEU B 1 59  ? 15.302  -24.848 20.341  1.00 22.45 ? 270 LEU B CD1   1 
ATOM   3189 C CD2   . LEU B 1 59  ? 16.415  -26.303 18.608  1.00 18.36 ? 270 LEU B CD2   1 
ATOM   3190 N N     . THR B 1 60  ? 14.584  -21.715 18.206  1.00 14.60 ? 271 THR B N     1 
ATOM   3191 C CA    . THR B 1 60  ? 15.121  -20.484 17.661  1.00 13.39 ? 271 THR B CA    1 
ATOM   3192 C C     . THR B 1 60  ? 16.627  -20.492 17.829  1.00 12.67 ? 271 THR B C     1 
ATOM   3193 O O     . THR B 1 60  ? 17.163  -21.245 18.640  1.00 10.62 ? 271 THR B O     1 
ATOM   3194 C CB    . THR B 1 60  ? 14.560  -19.289 18.386  1.00 13.44 ? 271 THR B CB    1 
ATOM   3195 O OG1   . THR B 1 60  ? 15.056  -19.303 19.737  1.00 14.01 ? 271 THR B OG1   1 
ATOM   3196 C CG2   . THR B 1 60  ? 13.017  -19.319 18.381  1.00 13.55 ? 271 THR B CG2   1 
ATOM   3197 N N     . VAL B 1 61  ? 17.301  -19.624 17.083  1.00 12.47 ? 272 VAL B N     1 
ATOM   3198 C CA    . VAL B 1 61  ? 18.746  -19.507 17.189  1.00 13.21 ? 272 VAL B CA    1 
ATOM   3199 C C     . VAL B 1 61  ? 19.126  -19.002 18.566  1.00 12.46 ? 272 VAL B C     1 
ATOM   3200 O O     . VAL B 1 61  ? 20.135  -19.420 19.128  1.00 11.40 ? 272 VAL B O     1 
ATOM   3201 C CB    . VAL B 1 61  ? 19.321  -18.631 16.073  1.00 14.34 ? 272 VAL B CB    1 
ATOM   3202 C CG1   . VAL B 1 61  ? 19.016  -19.277 14.693  1.00 15.57 ? 272 VAL B CG1   1 
ATOM   3203 C CG2   . VAL B 1 61  ? 18.774  -17.206 16.155  1.00 16.30 ? 272 VAL B CG2   1 
ATOM   3204 N N     . ALA B 1 62  ? 18.312  -18.109 19.126  1.00 11.92 ? 273 ALA B N     1 
ATOM   3205 C CA    . ALA B 1 62  ? 18.580  -17.555 20.469  1.00 12.72 ? 273 ALA B CA    1 
ATOM   3206 C C     . ALA B 1 62  ? 18.560  -18.660 21.548  1.00 12.64 ? 273 ALA B C     1 
ATOM   3207 O O     . ALA B 1 62  ? 19.372  -18.669 22.476  1.00 12.45 ? 273 ALA B O     1 
ATOM   3208 C CB    . ALA B 1 62  ? 17.540  -16.443 20.801  1.00 12.86 ? 273 ALA B CB    1 
ATOM   3209 N N     . GLN B 1 63  ? 17.636  -19.597 21.419  1.00 13.66 ? 274 GLN B N     1 
ATOM   3210 C CA    . GLN B 1 63  ? 17.581  -20.745 22.358  1.00 13.79 ? 274 GLN B CA    1 
ATOM   3211 C C     . GLN B 1 63  ? 18.792  -21.671 22.252  1.00 12.48 ? 274 GLN B C     1 
ATOM   3212 O O     . GLN B 1 63  ? 19.273  -22.160 23.247  1.00 11.10 ? 274 GLN B O     1 
ATOM   3213 C CB    . GLN B 1 63  ? 16.282  -21.516 22.156  1.00 14.49 ? 274 GLN B CB    1 
ATOM   3214 C CG    . GLN B 1 63  ? 15.058  -20.737 22.714  1.00 18.01 ? 274 GLN B CG    1 
ATOM   3215 C CD    . GLN B 1 63  ? 13.719  -21.150 22.093  1.00 22.77 ? 274 GLN B CD    1 
ATOM   3216 O OE1   . GLN B 1 63  ? 13.658  -22.014 21.211  1.00 23.84 ? 274 GLN B OE1   1 
ATOM   3217 N NE2   . GLN B 1 63  ? 12.617  -20.507 22.568  1.00 25.00 ? 274 GLN B NE2   1 
ATOM   3218 N N     . ILE B 1 64  ? 19.268  -21.912 21.032  1.00 12.30 ? 275 ILE B N     1 
ATOM   3219 C CA    . ILE B 1 64  ? 20.478  -22.745 20.820  1.00 11.72 ? 275 ILE B CA    1 
ATOM   3220 C C     . ILE B 1 64  ? 21.699  -22.047 21.420  1.00 11.89 ? 275 ILE B C     1 
ATOM   3221 O O     . ILE B 1 64  ? 22.527  -22.665 22.123  1.00 11.30 ? 275 ILE B O     1 
ATOM   3222 C CB    . ILE B 1 64  ? 20.702  -23.029 19.315  1.00 11.34 ? 275 ILE B CB    1 
ATOM   3223 C CG1   . ILE B 1 64  ? 19.554  -23.886 18.773  1.00 11.68 ? 275 ILE B CG1   1 
ATOM   3224 C CG2   . ILE B 1 64  ? 22.042  -23.667 19.072  1.00 10.72 ? 275 ILE B CG2   1 
ATOM   3225 C CD1   . ILE B 1 64  ? 19.541  -24.030 17.257  1.00 11.29 ? 275 ILE B CD1   1 
ATOM   3226 N N     . LYS B 1 65  ? 21.806  -20.749 21.156  1.00 11.84 ? 276 LYS B N     1 
ATOM   3227 C CA    . LYS B 1 65  ? 22.871  -19.960 21.749  1.00 11.49 ? 276 LYS B CA    1 
ATOM   3228 C C     . LYS B 1 65  ? 22.825  -20.038 23.263  1.00 11.20 ? 276 LYS B C     1 
ATOM   3229 O O     . LYS B 1 65  ? 23.853  -20.207 23.889  1.00 10.18 ? 276 LYS B O     1 
ATOM   3230 C CB    . LYS B 1 65  ? 22.785  -18.515 21.327  1.00 11.67 ? 276 LYS B CB    1 
ATOM   3231 C CG    . LYS B 1 65  ? 23.789  -17.579 22.022  1.00 12.77 ? 276 LYS B CG    1 
ATOM   3232 C CD    . LYS B 1 65  ? 23.973  -16.297 21.171  1.00 17.44 ? 276 LYS B CD    1 
ATOM   3233 C CE    . LYS B 1 65  ? 23.684  -15.032 21.931  1.00 20.13 ? 276 LYS B CE    1 
ATOM   3234 N NZ    . LYS B 1 65  ? 23.362  -13.857 21.005  1.00 19.58 ? 276 LYS B NZ    1 
ATOM   3235 N N     . ALA B 1 66  ? 21.634  -19.914 23.837  1.00 10.82 ? 277 ALA B N     1 
ATOM   3236 C CA    . ALA B 1 66  ? 21.467  -20.057 25.282  1.00 10.88 ? 277 ALA B CA    1 
ATOM   3237 C C     . ALA B 1 66  ? 21.937  -21.426 25.738  1.00 10.91 ? 277 ALA B C     1 
ATOM   3238 O O     . ALA B 1 66  ? 22.551  -21.537 26.788  1.00 11.40 ? 277 ALA B O     1 
ATOM   3239 C CB    . ALA B 1 66  ? 20.016  -19.843 25.689  1.00 10.12 ? 277 ALA B CB    1 
ATOM   3240 N N     . GLY B 1 67  ? 21.636  -22.465 24.954  1.00 10.67 ? 278 GLY B N     1 
ATOM   3241 C CA    . GLY B 1 67  ? 22.178  -23.824 25.192  1.00 10.30 ? 278 GLY B CA    1 
ATOM   3242 C C     . GLY B 1 67  ? 23.699  -23.902 25.273  1.00 9.96  ? 278 GLY B C     1 
ATOM   3243 O O     . GLY B 1 67  ? 24.267  -24.488 26.218  1.00 8.31  ? 278 GLY B O     1 
ATOM   3244 N N     . TYR B 1 68  ? 24.373  -23.337 24.278  1.00 9.60  ? 279 TYR B N     1 
ATOM   3245 C CA    . TYR B 1 68  ? 25.824  -23.273 24.297  1.00 9.62  ? 279 TYR B CA    1 
ATOM   3246 C C     . TYR B 1 68  ? 26.338  -22.594 25.580  1.00 9.67  ? 279 TYR B C     1 
ATOM   3247 O O     . TYR B 1 68  ? 27.339  -23.023 26.173  1.00 9.13  ? 279 TYR B O     1 
ATOM   3248 C CB    . TYR B 1 68  ? 26.335  -22.471 23.102  1.00 10.30 ? 279 TYR B CB    1 
ATOM   3249 C CG    . TYR B 1 68  ? 26.368  -23.221 21.776  1.00 11.51 ? 279 TYR B CG    1 
ATOM   3250 C CD1   . TYR B 1 68  ? 27.153  -24.344 21.610  1.00 10.03 ? 279 TYR B CD1   1 
ATOM   3251 C CD2   . TYR B 1 68  ? 25.660  -22.744 20.665  1.00 11.57 ? 279 TYR B CD2   1 
ATOM   3252 C CE1   . TYR B 1 68  ? 27.203  -25.018 20.384  1.00 11.42 ? 279 TYR B CE1   1 
ATOM   3253 C CE2   . TYR B 1 68  ? 25.698  -23.418 19.443  1.00 12.88 ? 279 TYR B CE2   1 
ATOM   3254 C CZ    . TYR B 1 68  ? 26.472  -24.560 19.321  1.00 11.09 ? 279 TYR B CZ    1 
ATOM   3255 O OH    . TYR B 1 68  ? 26.544  -25.242 18.135  1.00 12.72 ? 279 TYR B OH    1 
ATOM   3256 N N     . GLN B 1 69  ? 25.685  -21.507 25.972  1.00 9.16  ? 280 GLN B N     1 
ATOM   3257 C CA    . GLN B 1 69  ? 26.132  -20.764 27.152  1.00 10.61 ? 280 GLN B CA    1 
ATOM   3258 C C     . GLN B 1 69  ? 26.019  -21.606 28.417  1.00 11.02 ? 280 GLN B C     1 
ATOM   3259 O O     . GLN B 1 69  ? 26.906  -21.553 29.282  1.00 10.90 ? 280 GLN B O     1 
ATOM   3260 C CB    . GLN B 1 69  ? 25.378  -19.444 27.281  1.00 11.45 ? 280 GLN B CB    1 
ATOM   3261 C CG    . GLN B 1 69  ? 25.848  -18.459 26.255  1.00 11.87 ? 280 GLN B CG    1 
ATOM   3262 C CD    . GLN B 1 69  ? 24.935  -17.282 26.076  1.00 14.57 ? 280 GLN B CD    1 
ATOM   3263 O OE1   . GLN B 1 69  ? 23.757  -17.310 26.459  1.00 15.71 ? 280 GLN B OE1   1 
ATOM   3264 N NE2   . GLN B 1 69  ? 25.479  -16.226 25.471  1.00 11.36 ? 280 GLN B NE2   1 
ATOM   3265 N N     . SER B 1 70  ? 24.982  -22.433 28.505  1.00 11.08 ? 281 SER B N     1 
ATOM   3266 C CA    . SER B 1 70  ? 24.894  -23.368 29.632  1.00 11.73 ? 281 SER B CA    1 
ATOM   3267 C C     . SER B 1 70  ? 25.993  -24.414 29.565  1.00 11.93 ? 281 SER B C     1 
ATOM   3268 O O     . SER B 1 70  ? 26.527  -24.795 30.610  1.00 11.89 ? 281 SER B O     1 
ATOM   3269 C CB    . SER B 1 70  ? 23.528  -24.055 29.719  1.00 11.63 ? 281 SER B CB    1 
ATOM   3270 O OG    . SER B 1 70  ? 22.504  -23.093 29.870  1.00 12.98 ? 281 SER B OG    1 
ATOM   3271 N N     . LEU B 1 71  ? 26.339  -24.891 28.363  1.00 11.48 ? 282 LEU B N     1 
ATOM   3272 C CA    . LEU B 1 71  ? 27.442  -25.849 28.206  1.00 10.69 ? 282 LEU B CA    1 
ATOM   3273 C C     . LEU B 1 71  ? 28.783  -25.219 28.636  1.00 11.99 ? 282 LEU B C     1 
ATOM   3274 O O     . LEU B 1 71  ? 29.664  -25.911 29.150  1.00 11.63 ? 282 LEU B O     1 
ATOM   3275 C CB    . LEU B 1 71  ? 27.548  -26.375 26.752  1.00 10.45 ? 282 LEU B CB    1 
ATOM   3276 C CG    . LEU B 1 71  ? 26.448  -27.273 26.164  1.00 7.65  ? 282 LEU B CG    1 
ATOM   3277 C CD1   . LEU B 1 71  ? 26.745  -27.675 24.671  1.00 10.44 ? 282 LEU B CD1   1 
ATOM   3278 C CD2   . LEU B 1 71  ? 26.252  -28.564 26.992  1.00 9.75  ? 282 LEU B CD2   1 
ATOM   3279 N N     . LYS B 1 72  ? 28.928  -23.918 28.427  1.00 12.92 ? 283 LYS B N     1 
ATOM   3280 C CA    . LYS B 1 72  ? 30.124  -23.202 28.862  1.00 15.07 ? 283 LYS B CA    1 
ATOM   3281 C C     . LYS B 1 72  ? 30.193  -23.192 30.395  1.00 15.69 ? 283 LYS B C     1 
ATOM   3282 O O     . LYS B 1 72  ? 31.265  -23.399 30.962  1.00 16.77 ? 283 LYS B O     1 
ATOM   3283 C CB    . LYS B 1 72  ? 30.151  -21.793 28.267  1.00 15.65 ? 283 LYS B CB    1 
ATOM   3284 C CG    . LYS B 1 72  ? 31.143  -20.777 28.876  1.00 18.79 ? 283 LYS B CG    1 
ATOM   3285 C CD    . LYS B 1 72  ? 32.562  -21.218 28.804  1.00 22.71 ? 283 LYS B CD    1 
ATOM   3286 C CE    . LYS B 1 72  ? 33.487  -20.101 29.305  1.00 25.56 ? 283 LYS B CE    1 
ATOM   3287 N NZ    . LYS B 1 72  ? 34.644  -20.715 29.968  1.00 30.19 ? 283 LYS B NZ    1 
ATOM   3288 N N     . LYS B 1 73  ? 29.049  -23.004 31.051  1.00 16.23 ? 284 LYS B N     1 
ATOM   3289 C CA    . LYS B 1 73  ? 28.973  -23.138 32.502  1.00 17.02 ? 284 LYS B CA    1 
ATOM   3290 C C     . LYS B 1 73  ? 29.399  -24.540 32.957  1.00 16.44 ? 284 LYS B C     1 
ATOM   3291 O O     . LYS B 1 73  ? 30.126  -24.696 33.957  1.00 16.19 ? 284 LYS B O     1 
ATOM   3292 C CB    . LYS B 1 73  ? 27.557  -22.872 32.991  1.00 18.36 ? 284 LYS B CB    1 
ATOM   3293 C CG    . LYS B 1 73  ? 27.136  -21.425 33.082  1.00 21.50 ? 284 LYS B CG    1 
ATOM   3294 C CD    . LYS B 1 73  ? 25.784  -21.357 33.788  1.00 24.99 ? 284 LYS B CD    1 
ATOM   3295 C CE    . LYS B 1 73  ? 25.765  -20.385 34.946  1.00 28.70 ? 284 LYS B CE    1 
ATOM   3296 N NZ    . LYS B 1 73  ? 24.453  -20.494 35.662  1.00 30.29 ? 284 LYS B NZ    1 
ATOM   3297 N N     . ILE B 1 74  ? 28.929  -25.558 32.237  1.00 15.27 ? 285 ILE B N     1 
ATOM   3298 C CA    . ILE B 1 74  ? 29.342  -26.926 32.506  1.00 14.51 ? 285 ILE B CA    1 
ATOM   3299 C C     . ILE B 1 74  ? 30.857  -27.068 32.296  1.00 15.50 ? 285 ILE B C     1 
ATOM   3300 O O     . ILE B 1 74  ? 31.549  -27.678 33.110  1.00 15.55 ? 285 ILE B O     1 
ATOM   3301 C CB    . ILE B 1 74  ? 28.578  -27.941 31.619  1.00 14.40 ? 285 ILE B CB    1 
ATOM   3302 C CG1   . ILE B 1 74  ? 27.090  -27.913 31.941  1.00 13.99 ? 285 ILE B CG1   1 
ATOM   3303 C CG2   . ILE B 1 74  ? 29.189  -29.356 31.749  1.00 11.39 ? 285 ILE B CG2   1 
ATOM   3304 C CD1   . ILE B 1 74  ? 26.242  -28.796 31.051  1.00 11.78 ? 285 ILE B CD1   1 
ATOM   3305 N N     . GLU B 1 75  ? 31.382  -26.512 31.206  1.00 16.18 ? 286 GLU B N     1 
ATOM   3306 C CA    . GLU B 1 75  ? 32.820  -26.594 30.955  1.00 17.22 ? 286 GLU B CA    1 
ATOM   3307 C C     . GLU B 1 75  ? 33.625  -26.000 32.139  1.00 18.04 ? 286 GLU B C     1 
ATOM   3308 O O     . GLU B 1 75  ? 34.622  -26.596 32.549  1.00 17.11 ? 286 GLU B O     1 
ATOM   3309 C CB    . GLU B 1 75  ? 33.199  -25.878 29.655  1.00 17.37 ? 286 GLU B CB    1 
ATOM   3310 C CG    . GLU B 1 75  ? 34.705  -25.865 29.348  1.00 18.70 ? 286 GLU B CG    1 
ATOM   3311 C CD    . GLU B 1 75  ? 35.067  -24.997 28.132  1.00 19.73 ? 286 GLU B CD    1 
ATOM   3312 O OE1   . GLU B 1 75  ? 34.843  -23.786 28.170  1.00 19.50 ? 286 GLU B OE1   1 
ATOM   3313 O OE2   . GLU B 1 75  ? 35.547  -25.541 27.120  1.00 22.70 ? 286 GLU B OE2   1 
ATOM   3314 N N     . ASP B 1 76  ? 33.186  -24.836 32.639  1.00 19.29 ? 287 ASP B N     1 
ATOM   3315 C CA    . ASP B 1 76  ? 33.811  -24.152 33.791  1.00 20.65 ? 287 ASP B CA    1 
ATOM   3316 C C     . ASP B 1 76  ? 33.842  -25.075 35.003  1.00 22.03 ? 287 ASP B C     1 
ATOM   3317 O O     . ASP B 1 76  ? 34.834  -25.093 35.731  1.00 21.61 ? 287 ASP B O     1 
ATOM   3318 C CB    . ASP B 1 76  ? 33.064  -22.872 34.227  1.00 21.41 ? 287 ASP B CB    1 
ATOM   3319 C CG    . ASP B 1 76  ? 33.073  -21.773 33.198  1.00 21.08 ? 287 ASP B CG    1 
ATOM   3320 O OD1   . ASP B 1 76  ? 33.992  -21.713 32.365  1.00 23.48 ? 287 ASP B OD1   1 
ATOM   3321 O OD2   . ASP B 1 76  ? 32.130  -20.946 33.232  1.00 24.09 ? 287 ASP B OD2   1 
ATOM   3322 N N     . CYS B 1 77  ? 32.749  -25.824 35.218  1.00 22.42 ? 288 CYS B N     1 
ATOM   3323 C CA    . CYS B 1 77  ? 32.670  -26.744 36.344  1.00 23.02 ? 288 CYS B CA    1 
ATOM   3324 C C     . CYS B 1 77  ? 33.638  -27.900 36.170  1.00 23.56 ? 288 CYS B C     1 
ATOM   3325 O O     . CYS B 1 77  ? 34.369  -28.236 37.102  1.00 22.75 ? 288 CYS B O     1 
ATOM   3326 C CB    . CYS B 1 77  ? 31.241  -27.270 36.526  1.00 22.86 ? 288 CYS B CB    1 
ATOM   3327 S SG    . CYS B 1 77  ? 30.113  -26.010 37.066  1.00 24.91 ? 288 CYS B SG    1 
ATOM   3328 N N     . ILE B 1 78  ? 33.657  -28.493 34.971  1.00 24.06 ? 289 ILE B N     1 
ATOM   3329 C CA    . ILE B 1 78  ? 34.600  -29.538 34.640  1.00 24.58 ? 289 ILE B CA    1 
ATOM   3330 C C     . ILE B 1 78  ? 36.059  -29.069 34.780  1.00 27.08 ? 289 ILE B C     1 
ATOM   3331 O O     . ILE B 1 78  ? 36.907  -29.799 35.287  1.00 27.25 ? 289 ILE B O     1 
ATOM   3332 C CB    . ILE B 1 78  ? 34.382  -30.078 33.205  1.00 24.65 ? 289 ILE B CB    1 
ATOM   3333 C CG1   . ILE B 1 78  ? 33.007  -30.755 33.077  1.00 23.61 ? 289 ILE B CG1   1 
ATOM   3334 C CG2   . ILE B 1 78  ? 35.502  -31.047 32.843  1.00 24.39 ? 289 ILE B CG2   1 
ATOM   3335 C CD1   . ILE B 1 78  ? 32.532  -31.017 31.618  1.00 22.57 ? 289 ILE B CD1   1 
ATOM   3336 N N     . ARG B 1 79  ? 36.351  -27.861 34.315  1.00 29.19 ? 290 ARG B N     1 
ATOM   3337 C CA    . ARG B 1 79  ? 37.706  -27.318 34.396  1.00 31.48 ? 290 ARG B CA    1 
ATOM   3338 C C     . ARG B 1 79  ? 38.165  -27.134 35.865  1.00 32.08 ? 290 ARG B C     1 
ATOM   3339 O O     . ARG B 1 79  ? 39.327  -27.389 36.180  1.00 32.15 ? 290 ARG B O     1 
ATOM   3340 C CB    . ARG B 1 79  ? 37.799  -26.009 33.584  1.00 31.93 ? 290 ARG B CB    1 
ATOM   3341 C CG    . ARG B 1 79  ? 38.968  -25.092 33.920  1.00 35.18 ? 290 ARG B CG    1 
ATOM   3342 C CD    . ARG B 1 79  ? 39.281  -24.145 32.767  1.00 38.38 ? 290 ARG B CD    1 
ATOM   3343 N NE    . ARG B 1 79  ? 40.020  -24.886 31.745  1.00 42.11 ? 290 ARG B NE    1 
ATOM   3344 C CZ    . ARG B 1 79  ? 39.631  -25.104 30.490  1.00 43.85 ? 290 ARG B CZ    1 
ATOM   3345 N NH1   . ARG B 1 79  ? 40.416  -25.826 29.698  1.00 43.80 ? 290 ARG B NH1   1 
ATOM   3346 N NH2   . ARG B 1 79  ? 38.492  -24.598 30.006  1.00 45.97 ? 290 ARG B NH2   1 
ATOM   3347 N N     . ALA B 1 80  ? 37.239  -26.734 36.738  1.00 32.72 ? 291 ALA B N     1 
ATOM   3348 C CA    . ALA B 1 80  ? 37.514  -26.532 38.160  1.00 34.06 ? 291 ALA B CA    1 
ATOM   3349 C C     . ALA B 1 80  ? 37.447  -27.819 38.994  1.00 35.07 ? 291 ALA B C     1 
ATOM   3350 O O     . ALA B 1 80  ? 37.743  -27.785 40.182  1.00 36.10 ? 291 ALA B O     1 
ATOM   3351 C CB    . ALA B 1 80  ? 36.543  -25.496 38.736  1.00 34.06 ? 291 ALA B CB    1 
ATOM   3352 N N     . GLY B 1 81  ? 37.066  -28.939 38.380  1.00 36.11 ? 292 GLY B N     1 
ATOM   3353 C CA    . GLY B 1 81  ? 36.853  -30.185 39.095  1.00 36.96 ? 292 GLY B CA    1 
ATOM   3354 C C     . GLY B 1 81  ? 35.682  -30.103 40.057  1.00 38.05 ? 292 GLY B C     1 
ATOM   3355 O O     . GLY B 1 81  ? 35.608  -30.880 41.010  1.00 38.19 ? 292 GLY B O     1 
ATOM   3356 N N     . GLN B 1 82  ? 34.777  -29.150 39.834  1.00 38.90 ? 293 GLN B N     1 
ATOM   3357 C CA    . GLN B 1 82  ? 33.569  -29.037 40.653  1.00 39.80 ? 293 GLN B CA    1 
ATOM   3358 C C     . GLN B 1 82  ? 32.626  -30.193 40.283  1.00 40.60 ? 293 GLN B C     1 
ATOM   3359 O O     . GLN B 1 82  ? 32.517  -30.567 39.105  1.00 41.06 ? 293 GLN B O     1 
ATOM   3360 C CB    . GLN B 1 82  ? 32.899  -27.674 40.457  1.00 39.65 ? 293 GLN B CB    1 
ATOM   3361 N N     . HIS B 1 83  ? 32.010  -30.802 41.300  1.00 41.26 ? 294 HIS B N     1 
ATOM   3362 C CA    . HIS B 1 83  ? 31.005  -31.868 41.107  1.00 41.56 ? 294 HIS B CA    1 
ATOM   3363 C C     . HIS B 1 83  ? 29.859  -31.797 42.135  1.00 40.65 ? 294 HIS B C     1 
ATOM   3364 O O     . HIS B 1 83  ? 29.233  -32.816 42.444  1.00 41.23 ? 294 HIS B O     1 
ATOM   3365 C CB    . HIS B 1 83  ? 31.667  -33.257 41.157  1.00 42.28 ? 294 HIS B CB    1 
ATOM   3366 C CG    . HIS B 1 83  ? 32.378  -33.644 39.891  1.00 44.76 ? 294 HIS B CG    1 
ATOM   3367 N ND1   . HIS B 1 83  ? 31.780  -34.401 38.905  1.00 46.96 ? 294 HIS B ND1   1 
ATOM   3368 C CD2   . HIS B 1 83  ? 33.643  -33.400 39.463  1.00 47.68 ? 294 HIS B CD2   1 
ATOM   3369 C CE1   . HIS B 1 83  ? 32.640  -34.592 37.917  1.00 47.96 ? 294 HIS B CE1   1 
ATOM   3370 N NE2   . HIS B 1 83  ? 33.777  -33.992 38.228  1.00 48.20 ? 294 HIS B NE2   1 
ATOM   3371 N N     . GLY B 1 84  ? 29.600  -30.595 42.655  1.00 39.17 ? 295 GLY B N     1 
ATOM   3372 C CA    . GLY B 1 84  ? 28.480  -30.339 43.562  1.00 38.01 ? 295 GLY B CA    1 
ATOM   3373 C C     . GLY B 1 84  ? 27.448  -29.383 42.968  1.00 36.79 ? 295 GLY B C     1 
ATOM   3374 O O     . GLY B 1 84  ? 27.084  -29.499 41.789  1.00 35.87 ? 295 GLY B O     1 
ATOM   3375 N N     . ARG B 1 85  ? 26.994  -28.429 43.790  1.00 35.38 ? 296 ARG B N     1 
ATOM   3376 C CA    . ARG B 1 85  ? 25.884  -27.523 43.439  1.00 34.58 ? 296 ARG B CA    1 
ATOM   3377 C C     . ARG B 1 85  ? 26.051  -26.800 42.086  1.00 33.24 ? 296 ARG B C     1 
ATOM   3378 O O     . ARG B 1 85  ? 25.095  -26.751 41.301  1.00 32.94 ? 296 ARG B O     1 
ATOM   3379 C CB    . ARG B 1 85  ? 25.624  -26.470 44.543  1.00 34.92 ? 296 ARG B CB    1 
ATOM   3380 C CG    . ARG B 1 85  ? 24.496  -25.491 44.168  1.00 36.44 ? 296 ARG B CG    1 
ATOM   3381 C CD    . ARG B 1 85  ? 23.671  -24.969 45.351  1.00 39.29 ? 296 ARG B CD    1 
ATOM   3382 N NE    . ARG B 1 85  ? 23.941  -23.562 45.676  1.00 42.02 ? 296 ARG B NE    1 
ATOM   3383 C CZ    . ARG B 1 85  ? 23.016  -22.629 45.958  1.00 43.96 ? 296 ARG B CZ    1 
ATOM   3384 N NH1   . ARG B 1 85  ? 21.708  -22.893 45.923  1.00 44.04 ? 296 ARG B NH1   1 
ATOM   3385 N NH2   . ARG B 1 85  ? 23.406  -21.391 46.254  1.00 45.22 ? 296 ARG B NH2   1 
ATOM   3386 N N     . ALA B 1 86  ? 27.239  -26.246 41.830  1.00 30.78 ? 297 ALA B N     1 
ATOM   3387 C CA    . ALA B 1 86  ? 27.480  -25.454 40.610  1.00 29.72 ? 297 ALA B CA    1 
ATOM   3388 C C     . ALA B 1 86  ? 27.226  -26.300 39.347  1.00 28.27 ? 297 ALA B C     1 
ATOM   3389 O O     . ALA B 1 86  ? 26.518  -25.869 38.454  1.00 26.65 ? 297 ALA B O     1 
ATOM   3390 C CB    . ALA B 1 86  ? 28.917  -24.850 40.595  1.00 29.11 ? 297 ALA B CB    1 
ATOM   3391 N N     . LEU B 1 87  ? 27.762  -27.516 39.329  1.00 27.42 ? 298 LEU B N     1 
ATOM   3392 C CA    . LEU B 1 87  ? 27.631  -28.394 38.186  1.00 27.24 ? 298 LEU B CA    1 
ATOM   3393 C C     . LEU B 1 87  ? 26.176  -28.881 37.991  1.00 28.13 ? 298 LEU B C     1 
ATOM   3394 O O     . LEU B 1 87  ? 25.663  -28.902 36.845  1.00 27.48 ? 298 LEU B O     1 
ATOM   3395 C CB    . LEU B 1 87  ? 28.593  -29.585 38.314  1.00 26.53 ? 298 LEU B CB    1 
ATOM   3396 C CG    . LEU B 1 87  ? 28.496  -30.595 37.170  1.00 26.91 ? 298 LEU B CG    1 
ATOM   3397 C CD1   . LEU B 1 87  ? 28.701  -29.911 35.822  1.00 26.21 ? 298 LEU B CD1   1 
ATOM   3398 C CD2   . LEU B 1 87  ? 29.462  -31.765 37.319  1.00 26.39 ? 298 LEU B CD2   1 
ATOM   3399 N N     . MET B 1 88  ? 25.534  -29.280 39.099  1.00 28.03 ? 299 MET B N     1 
ATOM   3400 C CA    . MET B 1 88  ? 24.129  -29.699 39.091  1.00 28.30 ? 299 MET B CA    1 
ATOM   3401 C C     . MET B 1 88  ? 23.305  -28.586 38.510  1.00 27.69 ? 299 MET B C     1 
ATOM   3402 O O     . MET B 1 88  ? 22.505  -28.809 37.593  1.00 27.33 ? 299 MET B O     1 
ATOM   3403 C CB    . MET B 1 88  ? 23.610  -30.015 40.515  1.00 29.17 ? 299 MET B CB    1 
ATOM   3404 C CG    . MET B 1 88  ? 22.049  -30.074 40.634  1.00 31.56 ? 299 MET B CG    1 
ATOM   3405 S SD    . MET B 1 88  ? 21.367  -29.845 42.305  1.00 35.93 ? 299 MET B SD    1 
ATOM   3406 C CE    . MET B 1 88  ? 21.366  -28.053 42.538  1.00 34.86 ? 299 MET B CE    1 
ATOM   3407 N N     . GLU B 1 89  ? 23.484  -27.392 39.064  1.00 26.53 ? 300 GLU B N     1 
ATOM   3408 C CA    . GLU B 1 89  ? 22.751  -26.205 38.601  1.00 26.71 ? 300 GLU B CA    1 
ATOM   3409 C C     . GLU B 1 89  ? 22.990  -25.954 37.094  1.00 25.52 ? 300 GLU B C     1 
ATOM   3410 O O     . GLU B 1 89  ? 22.070  -25.575 36.378  1.00 25.22 ? 300 GLU B O     1 
ATOM   3411 C CB    . GLU B 1 89  ? 23.112  -24.967 39.429  1.00 26.51 ? 300 GLU B CB    1 
ATOM   3412 C CG    . GLU B 1 89  ? 22.488  -24.958 40.854  1.00 30.36 ? 300 GLU B CG    1 
ATOM   3413 C CD    . GLU B 1 89  ? 22.426  -23.562 41.493  1.00 34.42 ? 300 GLU B CD    1 
ATOM   3414 O OE1   . GLU B 1 89  ? 23.193  -22.667 41.066  1.00 38.91 ? 300 GLU B OE1   1 
ATOM   3415 O OE2   . GLU B 1 89  ? 21.616  -23.366 42.438  1.00 37.45 ? 300 GLU B OE2   1 
ATOM   3416 N N     . ALA B 1 90  ? 24.221  -26.192 36.650  1.00 24.60 ? 301 ALA B N     1 
ATOM   3417 C CA    . ALA B 1 90  ? 24.631  -26.008 35.246  1.00 23.43 ? 301 ALA B CA    1 
ATOM   3418 C C     . ALA B 1 90  ? 23.998  -27.066 34.327  1.00 22.02 ? 301 ALA B C     1 
ATOM   3419 O O     . ALA B 1 90  ? 23.434  -26.730 33.301  1.00 20.91 ? 301 ALA B O     1 
ATOM   3420 C CB    . ALA B 1 90  ? 26.167  -26.067 35.139  1.00 23.02 ? 301 ALA B CB    1 
ATOM   3421 N N     . CYS B 1 91  ? 24.095  -28.338 34.704  1.00 21.45 ? 302 CYS B N     1 
ATOM   3422 C CA    . CYS B 1 91  ? 23.464  -29.405 33.927  1.00 21.01 ? 302 CYS B CA    1 
ATOM   3423 C C     . CYS B 1 91  ? 21.945  -29.247 33.892  1.00 20.83 ? 302 CYS B C     1 
ATOM   3424 O O     . CYS B 1 91  ? 21.345  -29.432 32.839  1.00 20.31 ? 302 CYS B O     1 
ATOM   3425 C CB    . CYS B 1 91  ? 23.910  -30.774 34.392  1.00 21.43 ? 302 CYS B CB    1 
ATOM   3426 S SG    . CYS B 1 91  ? 25.661  -31.143 34.010  1.00 21.83 ? 302 CYS B SG    1 
ATOM   3427 N N     . ASN B 1 92  ? 21.334  -28.816 34.996  1.00 19.91 ? 303 ASN B N     1 
ATOM   3428 C CA    . ASN B 1 92  ? 19.889  -28.589 35.021  1.00 20.12 ? 303 ASN B CA    1 
ATOM   3429 C C     . ASN B 1 92  ? 19.466  -27.445 34.119  1.00 19.07 ? 303 ASN B C     1 
ATOM   3430 O O     . ASN B 1 92  ? 18.462  -27.531 33.446  1.00 18.43 ? 303 ASN B O     1 
ATOM   3431 C CB    . ASN B 1 92  ? 19.381  -28.307 36.455  1.00 20.48 ? 303 ASN B CB    1 
ATOM   3432 C CG    . ASN B 1 92  ? 19.352  -29.547 37.325  1.00 22.78 ? 303 ASN B CG    1 
ATOM   3433 O OD1   . ASN B 1 92  ? 19.486  -30.666 36.827  1.00 22.62 ? 303 ASN B OD1   1 
ATOM   3434 N ND2   . ASN B 1 92  ? 19.173  -29.352 38.651  1.00 25.64 ? 303 ASN B ND2   1 
ATOM   3435 N N     . GLU B 1 93  ? 20.224  -26.356 34.149  1.00 18.77 ? 304 GLU B N     1 
ATOM   3436 C CA    . GLU B 1 93  ? 19.996  -25.251 33.243  1.00 18.95 ? 304 GLU B CA    1 
ATOM   3437 C C     . GLU B 1 93  ? 20.080  -25.716 31.794  1.00 17.28 ? 304 GLU B C     1 
ATOM   3438 O O     . GLU B 1 93  ? 19.224  -25.356 30.986  1.00 17.50 ? 304 GLU B O     1 
ATOM   3439 C CB    . GLU B 1 93  ? 21.040  -24.145 33.458  1.00 19.31 ? 304 GLU B CB    1 
ATOM   3440 C CG    . GLU B 1 93  ? 20.772  -22.890 32.662  1.00 20.82 ? 304 GLU B CG    1 
ATOM   3441 C CD    . GLU B 1 93  ? 21.849  -21.865 32.921  1.00 24.04 ? 304 GLU B CD    1 
ATOM   3442 O OE1   . GLU B 1 93  ? 21.787  -21.180 33.966  1.00 25.69 ? 304 GLU B OE1   1 
ATOM   3443 O OE2   . GLU B 1 93  ? 22.775  -21.781 32.112  1.00 21.57 ? 304 GLU B OE2   1 
ATOM   3444 N N     . PHE B 1 94  ? 21.106  -26.489 31.456  1.00 15.84 ? 305 PHE B N     1 
ATOM   3445 C CA    . PHE B 1 94  ? 21.184  -26.984 30.064  1.00 15.41 ? 305 PHE B CA    1 
ATOM   3446 C C     . PHE B 1 94  ? 19.987  -27.835 29.644  1.00 14.75 ? 305 PHE B C     1 
ATOM   3447 O O     . PHE B 1 94  ? 19.404  -27.633 28.563  1.00 14.14 ? 305 PHE B O     1 
ATOM   3448 C CB    . PHE B 1 94  ? 22.455  -27.748 29.809  1.00 14.49 ? 305 PHE B CB    1 
ATOM   3449 C CG    . PHE B 1 94  ? 22.504  -28.369 28.441  1.00 13.77 ? 305 PHE B CG    1 
ATOM   3450 C CD1   . PHE B 1 94  ? 22.687  -27.579 27.319  1.00 13.52 ? 305 PHE B CD1   1 
ATOM   3451 C CD2   . PHE B 1 94  ? 22.369  -29.748 28.283  1.00 12.55 ? 305 PHE B CD2   1 
ATOM   3452 C CE1   . PHE B 1 94  ? 22.763  -28.157 26.042  1.00 14.68 ? 305 PHE B CE1   1 
ATOM   3453 C CE2   . PHE B 1 94  ? 22.433  -30.334 27.035  1.00 14.01 ? 305 PHE B CE2   1 
ATOM   3454 C CZ    . PHE B 1 94  ? 22.623  -29.541 25.899  1.00 13.56 ? 305 PHE B CZ    1 
ATOM   3455 N N     . TYR B 1 95  ? 19.614  -28.783 30.496  1.00 15.04 ? 306 TYR B N     1 
ATOM   3456 C CA    . TYR B 1 95  ? 18.483  -29.676 30.180  1.00 14.62 ? 306 TYR B CA    1 
ATOM   3457 C C     . TYR B 1 95  ? 17.142  -28.949 30.193  1.00 14.41 ? 306 TYR B C     1 
ATOM   3458 O O     . TYR B 1 95  ? 16.179  -29.376 29.560  1.00 14.10 ? 306 TYR B O     1 
ATOM   3459 C CB    . TYR B 1 95  ? 18.440  -30.853 31.158  1.00 15.62 ? 306 TYR B CB    1 
ATOM   3460 C CG    . TYR B 1 95  ? 19.542  -31.876 31.029  1.00 13.76 ? 306 TYR B CG    1 
ATOM   3461 C CD1   . TYR B 1 95  ? 19.925  -32.368 29.782  1.00 14.88 ? 306 TYR B CD1   1 
ATOM   3462 C CD2   . TYR B 1 95  ? 20.160  -32.404 32.155  1.00 14.97 ? 306 TYR B CD2   1 
ATOM   3463 C CE1   . TYR B 1 95  ? 20.916  -33.285 29.653  1.00 14.49 ? 306 TYR B CE1   1 
ATOM   3464 C CE2   . TYR B 1 95  ? 21.149  -33.373 32.035  1.00 13.76 ? 306 TYR B CE2   1 
ATOM   3465 C CZ    . TYR B 1 95  ? 21.526  -33.810 30.784  1.00 14.71 ? 306 TYR B CZ    1 
ATOM   3466 O OH    . TYR B 1 95  ? 22.516  -34.772 30.605  1.00 15.02 ? 306 TYR B OH    1 
ATOM   3467 N N     . THR B 1 96  ? 17.065  -27.843 30.916  1.00 14.67 ? 307 THR B N     1 
ATOM   3468 C CA    . THR B 1 96  ? 15.871  -27.021 30.892  1.00 14.58 ? 307 THR B CA    1 
ATOM   3469 C C     . THR B 1 96  ? 15.775  -26.272 29.571  1.00 14.32 ? 307 THR B C     1 
ATOM   3470 O O     . THR B 1 96  ? 14.688  -26.160 28.995  1.00 14.43 ? 307 THR B O     1 
ATOM   3471 C CB    . THR B 1 96  ? 15.880  -25.978 32.017  1.00 14.46 ? 307 THR B CB    1 
ATOM   3472 O OG1   . THR B 1 96  ? 15.956  -26.636 33.280  1.00 17.10 ? 307 THR B OG1   1 
ATOM   3473 C CG2   . THR B 1 96  ? 14.636  -25.080 31.944  1.00 17.73 ? 307 THR B CG2   1 
ATOM   3474 N N     . ARG B 1 97  ? 16.906  -25.749 29.106  1.00 13.72 ? 308 ARG B N     1 
ATOM   3475 C CA    . ARG B 1 97  ? 16.949  -24.980 27.852  1.00 13.22 ? 308 ARG B CA    1 
ATOM   3476 C C     . ARG B 1 97  ? 16.906  -25.843 26.602  1.00 12.51 ? 308 ARG B C     1 
ATOM   3477 O O     . ARG B 1 97  ? 16.395  -25.398 25.576  1.00 11.26 ? 308 ARG B O     1 
ATOM   3478 C CB    . ARG B 1 97  ? 18.190  -24.124 27.810  1.00 13.15 ? 308 ARG B CB    1 
ATOM   3479 C CG    . ARG B 1 97  ? 18.098  -22.933 28.767  1.00 15.69 ? 308 ARG B CG    1 
ATOM   3480 C CD    . ARG B 1 97  ? 19.478  -22.306 28.990  1.00 17.22 ? 308 ARG B CD    1 
ATOM   3481 N NE    . ARG B 1 97  ? 19.409  -21.178 29.927  1.00 16.50 ? 308 ARG B NE    1 
ATOM   3482 C CZ    . ARG B 1 97  ? 20.338  -20.239 30.059  1.00 17.57 ? 308 ARG B CZ    1 
ATOM   3483 N NH1   . ARG B 1 97  ? 21.448  -20.261 29.300  1.00 17.68 ? 308 ARG B NH1   1 
ATOM   3484 N NH2   . ARG B 1 97  ? 20.159  -19.258 30.954  1.00 16.38 ? 308 ARG B NH2   1 
ATOM   3485 N N     . ILE B 1 98  ? 17.471  -27.050 26.682  1.00 11.06 ? 309 ILE B N     1 
ATOM   3486 C CA    . ILE B 1 98  ? 17.558  -27.963 25.556  1.00 10.62 ? 309 ILE B CA    1 
ATOM   3487 C C     . ILE B 1 98  ? 16.984  -29.293 26.041  1.00 11.18 ? 309 ILE B C     1 
ATOM   3488 O O     . ILE B 1 98  ? 17.733  -30.172 26.480  1.00 10.83 ? 309 ILE B O     1 
ATOM   3489 C CB    . ILE B 1 98  ? 19.008  -28.111 25.069  1.00 10.08 ? 309 ILE B CB    1 
ATOM   3490 C CG1   . ILE B 1 98  ? 19.600  -26.734 24.756  1.00 10.73 ? 309 ILE B CG1   1 
ATOM   3491 C CG2   . ILE B 1 98  ? 19.119  -29.017 23.838  1.00 8.19  ? 309 ILE B CG2   1 
ATOM   3492 C CD1   . ILE B 1 98  ? 19.039  -26.042 23.513  1.00 8.86  ? 309 ILE B CD1   1 
ATOM   3493 N N     . PRO B 1 99  ? 15.625  -29.424 26.003  1.00 11.64 ? 310 PRO B N     1 
ATOM   3494 C CA    . PRO B 1 99  ? 14.971  -30.539 26.663  1.00 11.92 ? 310 PRO B CA    1 
ATOM   3495 C C     . PRO B 1 99  ? 15.447  -31.891 26.142  1.00 11.94 ? 310 PRO B C     1 
ATOM   3496 O O     . PRO B 1 99  ? 15.567  -32.086 24.939  1.00 10.78 ? 310 PRO B O     1 
ATOM   3497 C CB    . PRO B 1 99  ? 13.484  -30.305 26.366  1.00 12.15 ? 310 PRO B CB    1 
ATOM   3498 C CG    . PRO B 1 99  ? 13.385  -28.823 26.217  1.00 11.82 ? 310 PRO B CG    1 
ATOM   3499 C CD    . PRO B 1 99  ? 14.658  -28.401 25.579  1.00 10.89 ? 310 PRO B CD    1 
ATOM   3500 N N     . HIS B 1 100 ? 15.674  -32.823 27.063  1.00 12.62 ? 311 HIS B N     1 
ATOM   3501 C CA    . HIS B 1 100 ? 16.098  -34.190 26.720  1.00 12.84 ? 311 HIS B CA    1 
ATOM   3502 C C     . HIS B 1 100 ? 15.077  -35.187 27.288  1.00 14.46 ? 311 HIS B C     1 
ATOM   3503 O O     . HIS B 1 100 ? 14.377  -34.877 28.244  1.00 14.13 ? 311 HIS B O     1 
ATOM   3504 C CB    . HIS B 1 100 ? 17.447  -34.536 27.368  1.00 13.04 ? 311 HIS B CB    1 
ATOM   3505 C CG    . HIS B 1 100 ? 18.651  -34.060 26.626  1.00 12.02 ? 311 HIS B CG    1 
ATOM   3506 N ND1   . HIS B 1 100 ? 18.832  -32.749 26.254  1.00 11.21 ? 311 HIS B ND1   1 
ATOM   3507 C CD2   . HIS B 1 100 ? 19.782  -34.718 26.262  1.00 14.64 ? 311 HIS B CD2   1 
ATOM   3508 C CE1   . HIS B 1 100 ? 20.014  -32.625 25.667  1.00 13.42 ? 311 HIS B CE1   1 
ATOM   3509 N NE2   . HIS B 1 100 ? 20.608  -33.809 25.657  1.00 13.63 ? 311 HIS B NE2   1 
ATOM   3510 N N     . ASP B 1 101 ? 15.031  -36.394 26.725  1.00 15.17 ? 312 ASP B N     1 
ATOM   3511 C CA    . ASP B 1 101 ? 14.076  -37.404 27.180  1.00 16.69 ? 312 ASP B CA    1 
ATOM   3512 C C     . ASP B 1 101 ? 14.869  -38.627 27.614  1.00 16.19 ? 312 ASP B C     1 
ATOM   3513 O O     . ASP B 1 101 ? 15.324  -39.396 26.781  1.00 18.16 ? 312 ASP B O     1 
ATOM   3514 C CB    . ASP B 1 101 ? 13.068  -37.757 26.069  1.00 17.04 ? 312 ASP B CB    1 
ATOM   3515 C CG    . ASP B 1 101 ? 12.004  -38.771 26.530  1.00 20.12 ? 312 ASP B CG    1 
ATOM   3516 O OD1   . ASP B 1 101 ? 12.003  -39.161 27.726  1.00 18.83 ? 312 ASP B OD1   1 
ATOM   3517 O OD2   . ASP B 1 101 ? 11.164  -39.156 25.688  1.00 22.84 ? 312 ASP B OD2   1 
ATOM   3518 N N     . PHE B 1 102 ? 15.082  -38.775 28.916  1.00 15.06 ? 313 PHE B N     1 
ATOM   3519 C CA    . PHE B 1 102 ? 15.800  -39.925 29.426  1.00 14.98 ? 313 PHE B CA    1 
ATOM   3520 C C     . PHE B 1 102 ? 14.839  -40.979 30.029  1.00 15.02 ? 313 PHE B C     1 
ATOM   3521 O O     . PHE B 1 102 ? 15.250  -41.837 30.809  1.00 15.76 ? 313 PHE B O     1 
ATOM   3522 C CB    . PHE B 1 102 ? 16.834  -39.454 30.457  1.00 14.44 ? 313 PHE B CB    1 
ATOM   3523 C CG    . PHE B 1 102 ? 17.943  -38.594 29.881  1.00 14.75 ? 313 PHE B CG    1 
ATOM   3524 C CD1   . PHE B 1 102 ? 18.890  -39.133 29.037  1.00 15.44 ? 313 PHE B CD1   1 
ATOM   3525 C CD2   . PHE B 1 102 ? 18.049  -37.246 30.224  1.00 16.63 ? 313 PHE B CD2   1 
ATOM   3526 C CE1   . PHE B 1 102 ? 19.939  -38.332 28.530  1.00 17.37 ? 313 PHE B CE1   1 
ATOM   3527 C CE2   . PHE B 1 102 ? 19.081  -36.446 29.727  1.00 15.62 ? 313 PHE B CE2   1 
ATOM   3528 C CZ    . PHE B 1 102 ? 20.020  -36.989 28.878  1.00 14.87 ? 313 PHE B CZ    1 
ATOM   3529 N N     . GLY B 1 103 ? 13.560  -40.908 29.673  1.00 15.26 ? 314 GLY B N     1 
ATOM   3530 C CA    . GLY B 1 103 ? 12.508  -41.697 30.308  1.00 14.77 ? 314 GLY B CA    1 
ATOM   3531 C C     . GLY B 1 103 ? 12.525  -41.673 31.843  1.00 14.94 ? 314 GLY B C     1 
ATOM   3532 O O     . GLY B 1 103 ? 12.474  -40.609 32.481  1.00 13.50 ? 314 GLY B O     1 
ATOM   3533 N N     . LEU B 1 104 ? 12.651  -42.855 32.433  1.00 14.01 ? 315 LEU B N     1 
ATOM   3534 C CA    . LEU B 1 104 ? 12.626  -43.009 33.884  1.00 14.99 ? 315 LEU B CA    1 
ATOM   3535 C C     . LEU B 1 104 ? 14.032  -42.983 34.510  1.00 14.64 ? 315 LEU B C     1 
ATOM   3536 O O     . LEU B 1 104 ? 14.187  -43.153 35.715  1.00 15.52 ? 315 LEU B O     1 
ATOM   3537 C CB    . LEU B 1 104 ? 11.896  -44.330 34.236  1.00 15.08 ? 315 LEU B CB    1 
ATOM   3538 C CG    . LEU B 1 104 ? 10.383  -44.357 33.948  1.00 17.41 ? 315 LEU B CG    1 
ATOM   3539 C CD1   . LEU B 1 104 ? 9.781   -45.733 34.083  1.00 18.01 ? 315 LEU B CD1   1 
ATOM   3540 C CD2   . LEU B 1 104 ? 9.696   -43.422 34.912  1.00 18.95 ? 315 LEU B CD2   1 
ATOM   3541 N N     . ARG B 1 105 ? 15.065  -42.807 33.696  1.00 14.03 ? 316 ARG B N     1 
ATOM   3542 C CA    . ARG B 1 105 ? 16.430  -42.902 34.187  1.00 13.68 ? 316 ARG B CA    1 
ATOM   3543 C C     . ARG B 1 105 ? 16.871  -41.532 34.700  1.00 13.46 ? 316 ARG B C     1 
ATOM   3544 O O     . ARG B 1 105 ? 16.475  -40.520 34.151  1.00 12.13 ? 316 ARG B O     1 
ATOM   3545 C CB    . ARG B 1 105 ? 17.346  -43.355 33.041  1.00 14.41 ? 316 ARG B CB    1 
ATOM   3546 C CG    . ARG B 1 105 ? 18.796  -43.286 33.340  1.00 15.85 ? 316 ARG B CG    1 
ATOM   3547 C CD    . ARG B 1 105 ? 19.589  -44.170 32.435  1.00 20.04 ? 316 ARG B CD    1 
ATOM   3548 N NE    . ARG B 1 105 ? 19.744  -43.602 31.093  1.00 23.01 ? 316 ARG B NE    1 
ATOM   3549 C CZ    . ARG B 1 105 ? 20.777  -42.859 30.690  1.00 24.10 ? 316 ARG B CZ    1 
ATOM   3550 N NH1   . ARG B 1 105 ? 21.776  -42.554 31.511  1.00 24.51 ? 316 ARG B NH1   1 
ATOM   3551 N NH2   . ARG B 1 105 ? 20.815  -42.439 29.439  1.00 26.03 ? 316 ARG B NH2   1 
ATOM   3552 N N     . THR B 1 106 ? 17.700  -41.515 35.735  1.00 14.33 ? 317 THR B N     1 
ATOM   3553 C CA    . THR B 1 106 ? 18.270  -40.284 36.263  1.00 15.09 ? 317 THR B CA    1 
ATOM   3554 C C     . THR B 1 106 ? 19.008  -39.515 35.164  1.00 15.61 ? 317 THR B C     1 
ATOM   3555 O O     . THR B 1 106 ? 19.867  -40.079 34.502  1.00 15.32 ? 317 THR B O     1 
ATOM   3556 C CB    . THR B 1 106 ? 19.293  -40.583 37.383  1.00 14.59 ? 317 THR B CB    1 
ATOM   3557 O OG1   . THR B 1 106 ? 18.741  -41.522 38.294  1.00 16.10 ? 317 THR B OG1   1 
ATOM   3558 C CG2   . THR B 1 106 ? 19.617  -39.339 38.138  1.00 16.04 ? 317 THR B CG2   1 
ATOM   3559 N N     . PRO B 1 107 ? 18.699  -38.224 34.972  1.00 16.81 ? 318 PRO B N     1 
ATOM   3560 C CA    . PRO B 1 107 ? 19.445  -37.537 33.910  1.00 18.18 ? 318 PRO B CA    1 
ATOM   3561 C C     . PRO B 1 107 ? 20.940  -37.529 34.191  1.00 18.81 ? 318 PRO B C     1 
ATOM   3562 O O     . PRO B 1 107 ? 21.338  -37.187 35.280  1.00 19.11 ? 318 PRO B O     1 
ATOM   3563 C CB    . PRO B 1 107 ? 18.870  -36.116 33.935  1.00 17.66 ? 318 PRO B CB    1 
ATOM   3564 C CG    . PRO B 1 107 ? 17.462  -36.310 34.356  1.00 18.23 ? 318 PRO B CG    1 
ATOM   3565 C CD    . PRO B 1 107 ? 17.588  -37.395 35.456  1.00 17.49 ? 318 PRO B CD    1 
ATOM   3566 N N     . PRO B 1 108 ? 21.754  -37.945 33.228  1.00 20.26 ? 319 PRO B N     1 
ATOM   3567 C CA    . PRO B 1 108 ? 23.163  -38.059 33.502  1.00 21.31 ? 319 PRO B CA    1 
ATOM   3568 C C     . PRO B 1 108 ? 23.883  -36.715 33.553  1.00 22.99 ? 319 PRO B C     1 
ATOM   3569 O O     . PRO B 1 108 ? 23.527  -35.771 32.811  1.00 22.48 ? 319 PRO B O     1 
ATOM   3570 C CB    . PRO B 1 108 ? 23.674  -38.884 32.321  1.00 21.85 ? 319 PRO B CB    1 
ATOM   3571 C CG    . PRO B 1 108 ? 22.716  -38.651 31.233  1.00 21.40 ? 319 PRO B CG    1 
ATOM   3572 C CD    . PRO B 1 108 ? 21.406  -38.428 31.876  1.00 20.03 ? 319 PRO B CD    1 
ATOM   3573 N N     . LEU B 1 109 ? 24.897  -36.632 34.417  1.00 23.74 ? 320 LEU B N     1 
ATOM   3574 C CA    . LEU B 1 109 ? 25.712  -35.434 34.503  1.00 24.78 ? 320 LEU B CA    1 
ATOM   3575 C C     . LEU B 1 109 ? 26.600  -35.389 33.243  1.00 24.80 ? 320 LEU B C     1 
ATOM   3576 O O     . LEU B 1 109 ? 26.871  -36.409 32.604  1.00 25.73 ? 320 LEU B O     1 
ATOM   3577 C CB    . LEU B 1 109 ? 26.527  -35.388 35.824  1.00 25.17 ? 320 LEU B CB    1 
ATOM   3578 C CG    . LEU B 1 109 ? 25.793  -35.003 37.134  1.00 25.11 ? 320 LEU B CG    1 
ATOM   3579 C CD1   . LEU B 1 109 ? 26.676  -35.270 38.356  1.00 26.35 ? 320 LEU B CD1   1 
ATOM   3580 C CD2   . LEU B 1 109 ? 25.274  -33.549 37.205  1.00 25.02 ? 320 LEU B CD2   1 
ATOM   3581 N N     . ILE B 1 110 ? 27.004  -34.196 32.844  1.00 24.53 ? 321 ILE B N     1 
ATOM   3582 C CA    . ILE B 1 110 ? 27.900  -34.049 31.706  1.00 24.32 ? 321 ILE B CA    1 
ATOM   3583 C C     . ILE B 1 110 ? 29.241  -33.690 32.322  1.00 24.78 ? 321 ILE B C     1 
ATOM   3584 O O     . ILE B 1 110 ? 29.390  -32.606 32.867  1.00 24.42 ? 321 ILE B O     1 
ATOM   3585 C CB    . ILE B 1 110 ? 27.407  -32.951 30.741  1.00 23.96 ? 321 ILE B CB    1 
ATOM   3586 C CG1   . ILE B 1 110 ? 26.040  -33.348 30.160  1.00 23.02 ? 321 ILE B CG1   1 
ATOM   3587 C CG2   . ILE B 1 110 ? 28.463  -32.695 29.629  1.00 22.50 ? 321 ILE B CG2   1 
ATOM   3588 C CD1   . ILE B 1 110 ? 25.136  -32.182 29.779  1.00 24.41 ? 321 ILE B CD1   1 
ATOM   3589 N N     . ARG B 1 111 ? 30.195  -34.603 32.270  1.00 26.06 ? 322 ARG B N     1 
ATOM   3590 C CA    . ARG B 1 111 ? 31.444  -34.392 33.016  1.00 27.50 ? 322 ARG B CA    1 
ATOM   3591 C C     . ARG B 1 111 ? 32.726  -34.679 32.256  1.00 26.86 ? 322 ARG B C     1 
ATOM   3592 O O     . ARG B 1 111 ? 33.804  -34.391 32.768  1.00 28.03 ? 322 ARG B O     1 
ATOM   3593 C CB    . ARG B 1 111 ? 31.406  -35.143 34.365  1.00 28.24 ? 322 ARG B CB    1 
ATOM   3594 C CG    . ARG B 1 111 ? 30.924  -36.601 34.330  1.00 31.84 ? 322 ARG B CG    1 
ATOM   3595 C CD    . ARG B 1 111 ? 30.739  -37.145 35.776  1.00 35.73 ? 322 ARG B CD    1 
ATOM   3596 N NE    . ARG B 1 111 ? 29.558  -38.010 35.947  1.00 40.57 ? 322 ARG B NE    1 
ATOM   3597 C CZ    . ARG B 1 111 ? 28.946  -38.247 37.118  1.00 43.06 ? 322 ARG B CZ    1 
ATOM   3598 N NH1   . ARG B 1 111 ? 29.377  -37.686 38.258  1.00 43.57 ? 322 ARG B NH1   1 
ATOM   3599 N NH2   . ARG B 1 111 ? 27.881  -39.037 37.156  1.00 43.53 ? 322 ARG B NH2   1 
ATOM   3600 N N     . THR B 1 112 ? 32.639  -35.221 31.049  1.00 26.12 ? 323 THR B N     1 
ATOM   3601 C CA    . THR B 1 112 ? 33.839  -35.464 30.241  1.00 25.61 ? 323 THR B CA    1 
ATOM   3602 C C     . THR B 1 112 ? 33.878  -34.614 28.976  1.00 25.01 ? 323 THR B C     1 
ATOM   3603 O O     . THR B 1 112 ? 32.878  -34.012 28.576  1.00 23.42 ? 323 THR B O     1 
ATOM   3604 C CB    . THR B 1 112 ? 34.000  -36.952 29.811  1.00 25.81 ? 323 THR B CB    1 
ATOM   3605 O OG1   . THR B 1 112 ? 35.201  -37.092 29.038  1.00 30.10 ? 323 THR B OG1   1 
ATOM   3606 C CG2   . THR B 1 112 ? 32.874  -37.431 28.955  1.00 23.10 ? 323 THR B CG2   1 
ATOM   3607 N N     . GLN B 1 113 ? 35.050  -34.593 28.349  1.00 24.41 ? 324 GLN B N     1 
ATOM   3608 C CA    . GLN B 1 113 ? 35.232  -33.861 27.106  1.00 24.25 ? 324 GLN B CA    1 
ATOM   3609 C C     . GLN B 1 113 ? 34.375  -34.530 26.022  1.00 23.61 ? 324 GLN B C     1 
ATOM   3610 O O     . GLN B 1 113 ? 33.695  -33.864 25.254  1.00 22.57 ? 324 GLN B O     1 
ATOM   3611 C CB    . GLN B 1 113 ? 36.709  -33.819 26.730  1.00 24.68 ? 324 GLN B CB    1 
ATOM   3612 C CG    . GLN B 1 113 ? 37.057  -32.886 25.577  1.00 24.83 ? 324 GLN B CG    1 
ATOM   3613 C CD    . GLN B 1 113 ? 36.632  -33.418 24.225  1.00 24.54 ? 324 GLN B CD    1 
ATOM   3614 O OE1   . GLN B 1 113 ? 36.561  -34.630 24.018  1.00 25.80 ? 324 GLN B OE1   1 
ATOM   3615 N NE2   . GLN B 1 113 ? 36.338  -32.511 23.294  1.00 22.17 ? 324 GLN B NE2   1 
ATOM   3616 N N     . LYS B 1 114 ? 34.369  -35.854 26.010  1.00 22.85 ? 325 LYS B N     1 
ATOM   3617 C CA    . LYS B 1 114 ? 33.551  -36.614 25.075  1.00 22.89 ? 325 LYS B CA    1 
ATOM   3618 C C     . LYS B 1 114 ? 32.042  -36.312 25.258  1.00 21.90 ? 325 LYS B C     1 
ATOM   3619 O O     . LYS B 1 114 ? 31.327  -36.136 24.283  1.00 21.26 ? 325 LYS B O     1 
ATOM   3620 C CB    . LYS B 1 114 ? 33.823  -38.107 25.251  1.00 23.65 ? 325 LYS B CB    1 
ATOM   3621 C CG    . LYS B 1 114 ? 33.020  -39.058 24.309  1.00 26.02 ? 325 LYS B CG    1 
ATOM   3622 C CD    . LYS B 1 114 ? 32.678  -40.398 25.019  1.00 31.51 ? 325 LYS B CD    1 
ATOM   3623 C CE    . LYS B 1 114 ? 31.417  -40.251 25.912  1.00 33.13 ? 325 LYS B CE    1 
ATOM   3624 N NZ    . LYS B 1 114 ? 31.297  -41.261 27.001  1.00 33.17 ? 325 LYS B NZ    1 
ATOM   3625 N N     . GLU B 1 115 ? 31.590  -36.229 26.504  1.00 20.35 ? 326 GLU B N     1 
ATOM   3626 C CA    . GLU B 1 115 ? 30.199  -35.946 26.811  1.00 20.24 ? 326 GLU B CA    1 
ATOM   3627 C C     . GLU B 1 115 ? 29.840  -34.511 26.468  1.00 19.24 ? 326 GLU B C     1 
ATOM   3628 O O     . GLU B 1 115 ? 28.728  -34.246 25.996  1.00 16.99 ? 326 GLU B O     1 
ATOM   3629 C CB    . GLU B 1 115 ? 29.858  -36.258 28.270  1.00 20.38 ? 326 GLU B CB    1 
ATOM   3630 C CG    . GLU B 1 115 ? 29.766  -37.780 28.560  1.00 23.44 ? 326 GLU B CG    1 
ATOM   3631 C CD    . GLU B 1 115 ? 29.808  -38.145 30.045  1.00 26.01 ? 326 GLU B CD    1 
ATOM   3632 O OE1   . GLU B 1 115 ? 30.064  -37.267 30.897  1.00 28.28 ? 326 GLU B OE1   1 
ATOM   3633 O OE2   . GLU B 1 115 ? 29.557  -39.325 30.365  1.00 28.39 ? 326 GLU B OE2   1 
ATOM   3634 N N     . LEU B 1 116 ? 30.782  -33.599 26.714  1.00 18.56 ? 327 LEU B N     1 
ATOM   3635 C CA    . LEU B 1 116 ? 30.602  -32.195 26.388  1.00 18.32 ? 327 LEU B CA    1 
ATOM   3636 C C     . LEU B 1 116 ? 30.469  -32.087 24.874  1.00 17.98 ? 327 LEU B C     1 
ATOM   3637 O O     . LEU B 1 116 ? 29.578  -31.391 24.369  1.00 17.50 ? 327 LEU B O     1 
ATOM   3638 C CB    . LEU B 1 116 ? 31.781  -31.345 26.898  1.00 18.75 ? 327 LEU B CB    1 
ATOM   3639 C CG    . LEU B 1 116 ? 31.660  -29.818 26.957  1.00 18.65 ? 327 LEU B CG    1 
ATOM   3640 C CD1   . LEU B 1 116 ? 30.415  -29.428 27.680  1.00 17.48 ? 327 LEU B CD1   1 
ATOM   3641 C CD2   . LEU B 1 116 ? 32.848  -29.236 27.701  1.00 18.76 ? 327 LEU B CD2   1 
ATOM   3642 N N     . SER B 1 117 ? 31.347  -32.789 24.166  1.00 16.58 ? 328 SER B N     1 
ATOM   3643 C CA    . SER B 1 117 ? 31.342  -32.785 22.714  1.00 16.61 ? 328 SER B CA    1 
ATOM   3644 C C     . SER B 1 117 ? 30.050  -33.333 22.089  1.00 16.50 ? 328 SER B C     1 
ATOM   3645 O O     . SER B 1 117 ? 29.588  -32.782 21.081  1.00 14.68 ? 328 SER B O     1 
ATOM   3646 C CB    . SER B 1 117 ? 32.535  -33.580 22.172  1.00 16.14 ? 328 SER B CB    1 
ATOM   3647 O OG    . SER B 1 117 ? 32.495  -33.646 20.761  1.00 18.24 ? 328 SER B OG    1 
ATOM   3648 N N     . GLU B 1 118 ? 29.512  -34.426 22.654  1.00 16.25 ? 329 GLU B N     1 
ATOM   3649 C CA    . GLU B 1 118 ? 28.235  -34.967 22.189  1.00 16.88 ? 329 GLU B CA    1 
ATOM   3650 C C     . GLU B 1 118 ? 27.149  -33.921 22.275  1.00 15.48 ? 329 GLU B C     1 
ATOM   3651 O O     . GLU B 1 118 ? 26.289  -33.849 21.408  1.00 14.62 ? 329 GLU B O     1 
ATOM   3652 C CB    . GLU B 1 118 ? 27.784  -36.209 22.994  1.00 17.42 ? 329 GLU B CB    1 
ATOM   3653 C CG    . GLU B 1 118 ? 28.605  -37.441 22.670  1.00 21.79 ? 329 GLU B CG    1 
ATOM   3654 C CD    . GLU B 1 118 ? 28.427  -38.603 23.658  1.00 25.07 ? 329 GLU B CD    1 
ATOM   3655 O OE1   . GLU B 1 118 ? 27.921  -38.418 24.786  1.00 29.00 ? 329 GLU B OE1   1 
ATOM   3656 O OE2   . GLU B 1 118 ? 28.814  -39.715 23.278  1.00 31.11 ? 329 GLU B OE2   1 
ATOM   3657 N N     . LYS B 1 119 ? 27.165  -33.136 23.342  1.00 14.12 ? 330 LYS B N     1 
ATOM   3658 C CA    . LYS B 1 119 ? 26.135  -32.107 23.498  1.00 14.02 ? 330 LYS B CA    1 
ATOM   3659 C C     . LYS B 1 119 ? 26.333  -30.964 22.497  1.00 13.28 ? 330 LYS B C     1 
ATOM   3660 O O     . LYS B 1 119 ? 25.376  -30.435 21.948  1.00 11.65 ? 330 LYS B O     1 
ATOM   3661 C CB    . LYS B 1 119 ? 26.117  -31.582 24.935  1.00 13.85 ? 330 LYS B CB    1 
ATOM   3662 C CG    . LYS B 1 119 ? 25.728  -32.638 25.975  1.00 15.06 ? 330 LYS B CG    1 
ATOM   3663 C CD    . LYS B 1 119 ? 24.331  -33.249 25.755  1.00 16.07 ? 330 LYS B CD    1 
ATOM   3664 C CE    . LYS B 1 119 ? 24.373  -34.580 25.047  1.00 17.17 ? 330 LYS B CE    1 
ATOM   3665 N NZ    . LYS B 1 119 ? 23.094  -35.274 25.219  1.00 15.26 ? 330 LYS B NZ    1 
ATOM   3666 N N     . ILE B 1 120 ? 27.586  -30.614 22.244  1.00 13.19 ? 331 ILE B N     1 
ATOM   3667 C CA    . ILE B 1 120 ? 27.908  -29.657 21.186  1.00 13.37 ? 331 ILE B CA    1 
ATOM   3668 C C     . ILE B 1 120 ? 27.404  -30.147 19.830  1.00 12.87 ? 331 ILE B C     1 
ATOM   3669 O O     . ILE B 1 120 ? 26.780  -29.391 19.082  1.00 10.77 ? 331 ILE B O     1 
ATOM   3670 C CB    . ILE B 1 120 ? 29.431  -29.320 21.166  1.00 14.58 ? 331 ILE B CB    1 
ATOM   3671 C CG1   . ILE B 1 120 ? 29.769  -28.500 22.406  1.00 14.36 ? 331 ILE B CG1   1 
ATOM   3672 C CG2   . ILE B 1 120 ? 29.823  -28.509 19.917  1.00 14.90 ? 331 ILE B CG2   1 
ATOM   3673 C CD1   . ILE B 1 120 ? 31.232  -28.246 22.603  1.00 18.90 ? 331 ILE B CD1   1 
ATOM   3674 N N     . GLN B 1 121 ? 27.621  -31.425 19.532  1.00 12.13 ? 332 GLN B N     1 
ATOM   3675 C CA    . GLN B 1 121 ? 27.172  -31.972 18.250  1.00 12.12 ? 332 GLN B CA    1 
ATOM   3676 C C     . GLN B 1 121 ? 25.658  -31.911 18.142  1.00 11.59 ? 332 GLN B C     1 
ATOM   3677 O O     . GLN B 1 121 ? 25.131  -31.615 17.061  1.00 12.37 ? 332 GLN B O     1 
ATOM   3678 C CB    . GLN B 1 121 ? 27.682  -33.409 18.053  1.00 13.21 ? 332 GLN B CB    1 
ATOM   3679 C CG    . GLN B 1 121 ? 29.131  -33.435 17.669  1.00 15.98 ? 332 GLN B CG    1 
ATOM   3680 C CD    . GLN B 1 121 ? 29.703  -34.840 17.573  1.00 21.14 ? 332 GLN B CD    1 
ATOM   3681 O OE1   . GLN B 1 121 ? 29.282  -35.657 16.742  1.00 22.79 ? 332 GLN B OE1   1 
ATOM   3682 N NE2   . GLN B 1 121 ? 30.664  -35.130 18.447  1.00 22.65 ? 332 GLN B NE2   1 
ATOM   3683 N N     . LEU B 1 122 ? 24.953  -32.166 19.247  1.00 10.55 ? 333 LEU B N     1 
ATOM   3684 C CA    . LEU B 1 122 ? 23.502  -32.061 19.247  1.00 11.71 ? 333 LEU B CA    1 
ATOM   3685 C C     . LEU B 1 122 ? 23.062  -30.623 18.906  1.00 10.95 ? 333 LEU B C     1 
ATOM   3686 O O     . LEU B 1 122 ? 22.150  -30.423 18.121  1.00 12.13 ? 333 LEU B O     1 
ATOM   3687 C CB    . LEU B 1 122 ? 22.917  -32.503 20.596  1.00 11.98 ? 333 LEU B CB    1 
ATOM   3688 C CG    . LEU B 1 122 ? 21.440  -32.202 20.895  1.00 15.09 ? 333 LEU B CG    1 
ATOM   3689 C CD1   . LEU B 1 122 ? 20.528  -32.686 19.787  1.00 18.82 ? 333 LEU B CD1   1 
ATOM   3690 C CD2   . LEU B 1 122 ? 21.085  -32.879 22.223  1.00 19.25 ? 333 LEU B CD2   1 
ATOM   3691 N N     . LEU B 1 123 ? 23.714  -29.631 19.498  1.00 11.12 ? 334 LEU B N     1 
ATOM   3692 C CA    . LEU B 1 123 ? 23.351  -28.241 19.250  1.00 10.06 ? 334 LEU B CA    1 
ATOM   3693 C C     . LEU B 1 123 ? 23.734  -27.833 17.824  1.00 10.39 ? 334 LEU B C     1 
ATOM   3694 O O     . LEU B 1 123 ? 22.998  -27.085 17.197  1.00 9.25  ? 334 LEU B O     1 
ATOM   3695 C CB    . LEU B 1 123 ? 24.028  -27.291 20.241  1.00 9.97  ? 334 LEU B CB    1 
ATOM   3696 C CG    . LEU B 1 123 ? 23.593  -27.294 21.708  1.00 10.39 ? 334 LEU B CG    1 
ATOM   3697 C CD1   . LEU B 1 123 ? 24.150  -26.052 22.409  1.00 10.39 ? 334 LEU B CD1   1 
ATOM   3698 C CD2   . LEU B 1 123 ? 22.125  -27.309 21.856  1.00 12.31 ? 334 LEU B CD2   1 
ATOM   3699 N N     . GLU B 1 124 ? 24.886  -28.294 17.327  1.00 10.52 ? 335 GLU B N     1 
ATOM   3700 C CA    . GLU B 1 124 ? 25.241  -28.078 15.905  1.00 10.96 ? 335 GLU B CA    1 
ATOM   3701 C C     . GLU B 1 124 ? 24.175  -28.671 14.971  1.00 9.88  ? 335 GLU B C     1 
ATOM   3702 O O     . GLU B 1 124 ? 23.787  -28.047 14.002  1.00 10.16 ? 335 GLU B O     1 
ATOM   3703 C CB    . GLU B 1 124 ? 26.672  -28.594 15.586  1.00 11.28 ? 335 GLU B CB    1 
ATOM   3704 C CG    . GLU B 1 124 ? 27.722  -27.713 16.286  1.00 12.91 ? 335 GLU B CG    1 
ATOM   3705 C CD    . GLU B 1 124 ? 29.163  -28.167 16.172  1.00 18.25 ? 335 GLU B CD    1 
ATOM   3706 O OE1   . GLU B 1 124 ? 29.393  -29.376 15.924  1.00 20.93 ? 335 GLU B OE1   1 
ATOM   3707 O OE2   . GLU B 1 124 ? 30.071  -27.299 16.366  1.00 20.28 ? 335 GLU B OE2   1 
ATOM   3708 N N     . ALA B 1 125 ? 23.665  -29.858 15.274  1.00 9.71  ? 336 ALA B N     1 
ATOM   3709 C CA    . ALA B 1 125 ? 22.579  -30.426 14.475  1.00 9.00  ? 336 ALA B CA    1 
ATOM   3710 C C     . ALA B 1 125 ? 21.274  -29.613 14.613  1.00 9.13  ? 336 ALA B C     1 
ATOM   3711 O O     . ALA B 1 125 ? 20.579  -29.372 13.623  1.00 8.40  ? 336 ALA B O     1 
ATOM   3712 C CB    . ALA B 1 125 ? 22.350  -31.877 14.826  1.00 9.30  ? 336 ALA B CB    1 
ATOM   3713 N N     . LEU B 1 126 ? 20.925  -29.208 15.827  1.00 8.54  ? 337 LEU B N     1 
ATOM   3714 C CA    . LEU B 1 126 ? 19.781  -28.331 16.007  1.00 8.73  ? 337 LEU B CA    1 
ATOM   3715 C C     . LEU B 1 126 ? 19.889  -27.051 15.165  1.00 9.51  ? 337 LEU B C     1 
ATOM   3716 O O     . LEU B 1 126 ? 18.883  -26.611 14.566  1.00 9.84  ? 337 LEU B O     1 
ATOM   3717 C CB    . LEU B 1 126 ? 19.545  -27.977 17.469  1.00 8.71  ? 337 LEU B CB    1 
ATOM   3718 C CG    . LEU B 1 126 ? 19.079  -29.140 18.360  1.00 10.22 ? 337 LEU B CG    1 
ATOM   3719 C CD1   . LEU B 1 126 ? 19.046  -28.708 19.828  1.00 10.65 ? 337 LEU B CD1   1 
ATOM   3720 C CD2   . LEU B 1 126 ? 17.713  -29.642 17.918  1.00 9.59  ? 337 LEU B CD2   1 
ATOM   3721 N N     . GLY B 1 127 ? 21.067  -26.452 15.160  1.00 9.50  ? 338 GLY B N     1 
ATOM   3722 C CA    . GLY B 1 127 ? 21.355  -25.281 14.333  1.00 9.86  ? 338 GLY B CA    1 
ATOM   3723 C C     . GLY B 1 127 ? 21.086  -25.562 12.861  1.00 10.08 ? 338 GLY B C     1 
ATOM   3724 O O     . GLY B 1 127 ? 20.445  -24.754 12.176  1.00 10.76 ? 338 GLY B O     1 
ATOM   3725 N N     . ASP B 1 128 ? 21.540  -26.704 12.353  1.00 10.36 ? 339 ASP B N     1 
ATOM   3726 C CA    . ASP B 1 128 ? 21.272  -26.997 10.931  1.00 10.77 ? 339 ASP B CA    1 
ATOM   3727 C C     . ASP B 1 128 ? 19.795  -27.283 10.619  1.00 10.63 ? 339 ASP B C     1 
ATOM   3728 O O     . ASP B 1 128 ? 19.306  -26.988 9.519   1.00 10.01 ? 339 ASP B O     1 
ATOM   3729 C CB    . ASP B 1 128 ? 22.215  -28.053 10.399  1.00 10.61 ? 339 ASP B CB    1 
ATOM   3730 C CG    . ASP B 1 128 ? 23.663  -27.503 10.189  1.00 14.08 ? 339 ASP B CG    1 
ATOM   3731 O OD1   . ASP B 1 128 ? 23.831  -26.332 9.849   1.00 18.23 ? 339 ASP B OD1   1 
ATOM   3732 O OD2   . ASP B 1 128 ? 24.647  -28.232 10.349  1.00 16.85 ? 339 ASP B OD2   1 
ATOM   3733 N N     . ILE B 1 129 ? 19.097  -27.881 11.580  1.00 10.58 ? 340 ILE B N     1 
ATOM   3734 C CA    . ILE B 1 129 ? 17.680  -28.139 11.475  1.00 10.01 ? 340 ILE B CA    1 
ATOM   3735 C C     . ILE B 1 129 ? 16.878  -26.862 11.487  1.00 10.95 ? 340 ILE B C     1 
ATOM   3736 O O     . ILE B 1 129 ? 15.908  -26.741 10.740  1.00 11.58 ? 340 ILE B O     1 
ATOM   3737 C CB    . ILE B 1 129 ? 17.205  -29.127 12.582  1.00 10.23 ? 340 ILE B CB    1 
ATOM   3738 C CG1   . ILE B 1 129 ? 17.777  -30.511 12.303  1.00 9.88  ? 340 ILE B CG1   1 
ATOM   3739 C CG2   . ILE B 1 129 ? 15.741  -29.172 12.669  1.00 9.98  ? 340 ILE B CG2   1 
ATOM   3740 C CD1   . ILE B 1 129 ? 17.765  -31.495 13.526  1.00 11.10 ? 340 ILE B CD1   1 
ATOM   3741 N N     . GLU B 1 130 ? 17.269  -25.891 12.323  1.00 10.76 ? 341 GLU B N     1 
ATOM   3742 C CA    . GLU B 1 130 ? 16.574  -24.615 12.382  1.00 10.84 ? 341 GLU B CA    1 
ATOM   3743 C C     . GLU B 1 130 ? 16.635  -23.962 10.991  1.00 10.34 ? 341 GLU B C     1 
ATOM   3744 O O     . GLU B 1 130 ? 15.639  -23.432 10.497  1.00 11.36 ? 341 GLU B O     1 
ATOM   3745 C CB    . GLU B 1 130 ? 17.223  -23.707 13.451  1.00 11.11 ? 341 GLU B CB    1 
ATOM   3746 C CG    . GLU B 1 130 ? 16.552  -22.356 13.655  1.00 12.04 ? 341 GLU B CG    1 
ATOM   3747 C CD    . GLU B 1 130 ? 16.988  -21.311 12.635  1.00 13.12 ? 341 GLU B CD    1 
ATOM   3748 O OE1   . GLU B 1 130 ? 18.101  -21.386 12.111  1.00 11.71 ? 341 GLU B OE1   1 
ATOM   3749 O OE2   . GLU B 1 130 ? 16.194  -20.410 12.357  1.00 15.18 ? 341 GLU B OE2   1 
ATOM   3750 N N     . ILE B 1 131 ? 17.811  -24.027 10.375  1.00 10.64 ? 342 ILE B N     1 
ATOM   3751 C CA    . ILE B 1 131 ? 18.029  -23.567 9.021   1.00 11.12 ? 342 ILE B CA    1 
ATOM   3752 C C     . ILE B 1 131 ? 17.132  -24.308 8.023   1.00 10.68 ? 342 ILE B C     1 
ATOM   3753 O O     . ILE B 1 131 ? 16.468  -23.672 7.228   1.00 9.95  ? 342 ILE B O     1 
ATOM   3754 C CB    . ILE B 1 131 ? 19.514  -23.688 8.602   1.00 10.97 ? 342 ILE B CB    1 
ATOM   3755 C CG1   . ILE B 1 131 ? 20.335  -22.615 9.294   1.00 10.81 ? 342 ILE B CG1   1 
ATOM   3756 C CG2   . ILE B 1 131 ? 19.681  -23.514 7.092   1.00 12.99 ? 342 ILE B CG2   1 
ATOM   3757 C CD1   . ILE B 1 131 ? 21.776  -22.958 9.380   1.00 10.15 ? 342 ILE B CD1   1 
ATOM   3758 N N     . ALA B 1 132 ? 17.111  -25.633 8.071   1.00 10.28 ? 343 ALA B N     1 
ATOM   3759 C CA    . ALA B 1 132 ? 16.373  -26.418 7.079   1.00 10.21 ? 343 ALA B CA    1 
ATOM   3760 C C     . ALA B 1 132 ? 14.866  -26.210 7.167   1.00 11.19 ? 343 ALA B C     1 
ATOM   3761 O O     . ALA B 1 132 ? 14.172  -26.116 6.133   1.00 10.30 ? 343 ALA B O     1 
ATOM   3762 C CB    . ALA B 1 132 ? 16.697  -27.922 7.213   1.00 9.79  ? 343 ALA B CB    1 
ATOM   3763 N N     . ILE B 1 133 ? 14.346  -26.169 8.394   1.00 12.45 ? 344 ILE B N     1 
ATOM   3764 C CA    . ILE B 1 133 ? 12.909  -26.050 8.576   1.00 13.82 ? 344 ILE B CA    1 
ATOM   3765 C C     . ILE B 1 133 ? 12.433  -24.736 7.961   1.00 15.18 ? 344 ILE B C     1 
ATOM   3766 O O     . ILE B 1 133 ? 11.397  -24.694 7.288   1.00 16.28 ? 344 ILE B O     1 
ATOM   3767 C CB    . ILE B 1 133 ? 12.499  -26.186 10.056  1.00 13.41 ? 344 ILE B CB    1 
ATOM   3768 C CG1   . ILE B 1 133 ? 12.637  -27.644 10.498  1.00 14.82 ? 344 ILE B CG1   1 
ATOM   3769 C CG2   . ILE B 1 133 ? 11.051  -25.663 10.269  1.00 15.03 ? 344 ILE B CG2   1 
ATOM   3770 C CD1   . ILE B 1 133 ? 12.243  -27.906 11.952  1.00 16.67 ? 344 ILE B CD1   1 
ATOM   3771 N N     . LYS B 1 134 ? 13.203  -23.679 8.160   1.00 16.68 ? 345 LYS B N     1 
ATOM   3772 C CA    . LYS B 1 134 ? 12.928  -22.386 7.533   1.00 18.81 ? 345 LYS B CA    1 
ATOM   3773 C C     . LYS B 1 134 ? 13.089  -22.430 6.010   1.00 19.27 ? 345 LYS B C     1 
ATOM   3774 O O     . LYS B 1 134 ? 12.275  -21.869 5.267   1.00 19.51 ? 345 LYS B O     1 
ATOM   3775 C CB    . LYS B 1 134 ? 13.818  -21.278 8.113   1.00 19.64 ? 345 LYS B CB    1 
ATOM   3776 C CG    . LYS B 1 134 ? 13.185  -20.590 9.309   1.00 24.28 ? 345 LYS B CG    1 
ATOM   3777 C CD    . LYS B 1 134 ? 14.057  -19.494 9.910   1.00 26.94 ? 345 LYS B CD    1 
ATOM   3778 C CE    . LYS B 1 134 ? 13.467  -19.085 11.264  1.00 28.52 ? 345 LYS B CE    1 
ATOM   3779 N NZ    . LYS B 1 134 ? 13.584  -20.140 12.335  1.00 26.70 ? 345 LYS B NZ    1 
ATOM   3780 N N     . LEU B 1 135 ? 14.111  -23.123 5.541   1.00 19.21 ? 346 LEU B N     1 
ATOM   3781 C CA    . LEU B 1 135 ? 14.352  -23.186 4.113   1.00 19.84 ? 346 LEU B CA    1 
ATOM   3782 C C     . LEU B 1 135 ? 13.234  -23.918 3.356   1.00 20.57 ? 346 LEU B C     1 
ATOM   3783 O O     . LEU B 1 135 ? 12.878  -23.524 2.242   1.00 20.78 ? 346 LEU B O     1 
ATOM   3784 C CB    . LEU B 1 135 ? 15.723  -23.806 3.847   1.00 19.61 ? 346 LEU B CB    1 
ATOM   3785 C CG    . LEU B 1 135 ? 16.118  -23.869 2.365   1.00 20.23 ? 346 LEU B CG    1 
ATOM   3786 C CD1   . LEU B 1 135 ? 17.603  -23.659 2.202   1.00 21.74 ? 346 LEU B CD1   1 
ATOM   3787 C CD2   . LEU B 1 135 ? 15.687  -25.184 1.805   1.00 16.45 ? 346 LEU B CD2   1 
ATOM   3788 N N     . VAL B 1 136 ? 12.674  -24.957 3.950   1.00 20.86 ? 347 VAL B N     1 
ATOM   3789 C CA    . VAL B 1 136 ? 11.695  -25.778 3.261   1.00 22.39 ? 347 VAL B CA    1 
ATOM   3790 C C     . VAL B 1 136 ? 10.252  -25.285 3.401   1.00 25.00 ? 347 VAL B C     1 
ATOM   3791 O O     . VAL B 1 136 ? 9.339   -25.941 2.883   1.00 24.71 ? 347 VAL B O     1 
ATOM   3792 C CB    . VAL B 1 136 ? 11.711  -27.252 3.730   1.00 21.75 ? 347 VAL B CB    1 
ATOM   3793 C CG1   . VAL B 1 136 ? 13.096  -27.875 3.566   1.00 19.87 ? 347 VAL B CG1   1 
ATOM   3794 C CG2   . VAL B 1 136 ? 11.213  -27.354 5.150   1.00 22.48 ? 347 VAL B CG2   1 
ATOM   3795 N N     . LYS B 1 137 ? 10.023  -24.176 4.100   1.00 28.03 ? 348 LYS B N     1 
ATOM   3796 C CA    . LYS B 1 137 ? 8.663   -23.609 4.133   1.00 31.59 ? 348 LYS B CA    1 
ATOM   3797 C C     . LYS B 1 137 ? 8.198   -23.292 2.706   1.00 33.70 ? 348 LYS B C     1 
ATOM   3798 O O     . LYS B 1 137 ? 8.922   -22.666 1.931   1.00 34.00 ? 348 LYS B O     1 
ATOM   3799 C CB    . LYS B 1 137 ? 8.581   -22.342 4.962   1.00 31.52 ? 348 LYS B CB    1 
ATOM   3800 C CG    . LYS B 1 137 ? 8.590   -22.576 6.444   1.00 34.17 ? 348 LYS B CG    1 
ATOM   3801 C CD    . LYS B 1 137 ? 8.210   -21.292 7.172   1.00 36.26 ? 348 LYS B CD    1 
ATOM   3802 C CE    . LYS B 1 137 ? 8.472   -21.383 8.673   1.00 38.58 ? 348 LYS B CE    1 
ATOM   3803 N NZ    . LYS B 1 137 ? 9.924   -21.472 9.026   1.00 40.76 ? 348 LYS B NZ    1 
ATOM   3804 N N     . THR B 1 138 ? 6.993   -23.736 2.376   1.00 36.86 ? 349 THR B N     1 
ATOM   3805 C CA    . THR B 1 138 ? 6.408   -23.489 1.053   1.00 39.20 ? 349 THR B CA    1 
ATOM   3806 C C     . THR B 1 138 ? 5.392   -22.357 1.109   1.00 40.87 ? 349 THR B C     1 
ATOM   3807 O O     . THR B 1 138 ? 4.913   -21.988 2.190   1.00 41.31 ? 349 THR B O     1 
ATOM   3808 C CB    . THR B 1 138 ? 5.703   -24.738 0.540   1.00 39.35 ? 349 THR B CB    1 
ATOM   3809 O OG1   . THR B 1 138 ? 4.715   -25.140 1.503   1.00 40.93 ? 349 THR B OG1   1 
ATOM   3810 C CG2   . THR B 1 138 ? 6.704   -25.868 0.319   1.00 39.08 ? 349 THR B CG2   1 
ATOM   3811 N N     . GLU B 1 139 ? 5.070   -21.811 -0.060  1.00 42.65 ? 350 GLU B N     1 
ATOM   3812 C CA    . GLU B 1 139 ? 4.092   -20.734 -0.180  1.00 44.28 ? 350 GLU B CA    1 
ATOM   3813 C C     . GLU B 1 139 ? 2.770   -21.329 -0.669  1.00 45.12 ? 350 GLU B C     1 
ATOM   3814 O O     . GLU B 1 139 ? 2.718   -21.906 -1.762  1.00 45.27 ? 350 GLU B O     1 
ATOM   3815 C CB    . GLU B 1 139 ? 4.621   -19.676 -1.147  1.00 44.51 ? 350 GLU B CB    1 
ATOM   3816 C CG    . GLU B 1 139 ? 5.982   -19.113 -0.708  1.00 46.78 ? 350 GLU B CG    1 
ATOM   3817 C CD    . GLU B 1 139 ? 6.919   -18.792 -1.862  1.00 49.86 ? 350 GLU B CD    1 
ATOM   3818 O OE1   . GLU B 1 139 ? 6.446   -18.597 -3.010  1.00 52.35 ? 350 GLU B OE1   1 
ATOM   3819 O OE2   . GLU B 1 139 ? 8.143   -18.721 -1.609  1.00 51.12 ? 350 GLU B OE2   1 
ATOM   3820 N N     . LEU B 1 140 ? 1.716   -21.208 0.148   1.00 46.03 ? 351 LEU B N     1 
ATOM   3821 C CA    . LEU B 1 140 ? 0.396   -21.797 -0.156  1.00 46.48 ? 351 LEU B CA    1 
ATOM   3822 C C     . LEU B 1 140 ? 0.111   -21.848 -1.665  1.00 46.79 ? 351 LEU B C     1 
ATOM   3823 O O     . LEU B 1 140 ? -0.100  -22.927 -2.226  1.00 46.53 ? 351 LEU B O     1 
ATOM   3824 C CB    . LEU B 1 140 ? -0.727  -21.032 0.570   1.00 46.73 ? 351 LEU B CB    1 
ATOM   3825 N N     . GLN B 1 141 ? 0.127   -20.683 -2.315  1.00 47.21 ? 352 GLN B N     1 
ATOM   3826 C CA    . GLN B 1 141 ? -0.079  -20.610 -3.763  1.00 47.50 ? 352 GLN B CA    1 
ATOM   3827 C C     . GLN B 1 141 ? 1.184   -20.099 -4.455  1.00 47.62 ? 352 GLN B C     1 
ATOM   3828 O O     . GLN B 1 141 ? 1.354   -18.887 -4.637  1.00 47.87 ? 352 GLN B O     1 
ATOM   3829 C CB    . GLN B 1 141 ? -1.284  -19.717 -4.104  1.00 47.65 ? 352 GLN B CB    1 
ATOM   3830 N N     . SER B 1 142 ? 2.080   -21.033 -4.800  1.00 47.37 ? 353 SER B N     1 
ATOM   3831 C CA    . SER B 1 142 ? 3.189   -20.767 -5.728  1.00 46.80 ? 353 SER B CA    1 
ATOM   3832 C C     . SER B 1 142 ? 3.129   -21.802 -6.843  1.00 46.15 ? 353 SER B C     1 
ATOM   3833 O O     . SER B 1 142 ? 2.852   -22.984 -6.585  1.00 46.29 ? 353 SER B O     1 
ATOM   3834 C CB    . SER B 1 142 ? 4.561   -20.830 -5.044  1.00 47.10 ? 353 SER B CB    1 
ATOM   3835 O OG    . SER B 1 142 ? 4.867   -22.149 -4.608  1.00 47.93 ? 353 SER B OG    1 
ATOM   3836 N N     . PRO B 1 143 ? 3.382   -21.360 -8.090  1.00 44.87 ? 354 PRO B N     1 
ATOM   3837 C CA    . PRO B 1 143 ? 3.343   -22.287 -9.223  1.00 43.85 ? 354 PRO B CA    1 
ATOM   3838 C C     . PRO B 1 143 ? 4.528   -23.262 -9.207  1.00 42.12 ? 354 PRO B C     1 
ATOM   3839 O O     . PRO B 1 143 ? 4.464   -24.329 -9.832  1.00 42.24 ? 354 PRO B O     1 
ATOM   3840 C CB    . PRO B 1 143 ? 3.407   -21.351 -10.443 1.00 44.14 ? 354 PRO B CB    1 
ATOM   3841 C CG    . PRO B 1 143 ? 4.176   -20.129 -9.948  1.00 44.79 ? 354 PRO B CG    1 
ATOM   3842 C CD    . PRO B 1 143 ? 3.888   -20.019 -8.469  1.00 44.78 ? 354 PRO B CD    1 
ATOM   3843 N N     . GLU B 1 144 ? 5.585   -22.887 -8.485  1.00 39.85 ? 355 GLU B N     1 
ATOM   3844 C CA    . GLU B 1 144 ? 6.798   -23.689 -8.352  1.00 37.77 ? 355 GLU B CA    1 
ATOM   3845 C C     . GLU B 1 144 ? 6.613   -24.935 -7.468  1.00 35.63 ? 355 GLU B C     1 
ATOM   3846 O O     . GLU B 1 144 ? 6.056   -24.856 -6.385  1.00 34.98 ? 355 GLU B O     1 
ATOM   3847 C CB    . GLU B 1 144 ? 7.898   -22.809 -7.768  1.00 37.88 ? 355 GLU B CB    1 
ATOM   3848 C CG    . GLU B 1 144 ? 9.278   -23.396 -7.874  1.00 38.51 ? 355 GLU B CG    1 
ATOM   3849 C CD    . GLU B 1 144 ? 10.335  -22.426 -7.420  1.00 38.87 ? 355 GLU B CD    1 
ATOM   3850 O OE1   . GLU B 1 144 ? 11.472  -22.502 -7.927  1.00 39.95 ? 355 GLU B OE1   1 
ATOM   3851 O OE2   . GLU B 1 144 ? 10.029  -21.579 -6.557  1.00 39.53 ? 355 GLU B OE2   1 
ATOM   3852 N N     . HIS B 1 145 ? 7.095   -26.079 -7.956  1.00 33.55 ? 356 HIS B N     1 
ATOM   3853 C CA    . HIS B 1 145 ? 7.093   -27.336 -7.206  1.00 32.13 ? 356 HIS B CA    1 
ATOM   3854 C C     . HIS B 1 145 ? 8.008   -27.216 -5.968  1.00 30.98 ? 356 HIS B C     1 
ATOM   3855 O O     . HIS B 1 145 ? 9.073   -26.615 -6.054  1.00 29.53 ? 356 HIS B O     1 
ATOM   3856 C CB    . HIS B 1 145 ? 7.593   -28.470 -8.101  1.00 31.94 ? 356 HIS B CB    1 
ATOM   3857 C CG    . HIS B 1 145 ? 7.335   -29.838 -7.552  1.00 33.20 ? 356 HIS B CG    1 
ATOM   3858 N ND1   . HIS B 1 145 ? 8.297   -30.571 -6.881  1.00 34.18 ? 356 HIS B ND1   1 
ATOM   3859 C CD2   . HIS B 1 145 ? 6.222   -30.608 -7.572  1.00 33.37 ? 356 HIS B CD2   1 
ATOM   3860 C CE1   . HIS B 1 145 ? 7.786   -31.732 -6.515  1.00 33.90 ? 356 HIS B CE1   1 
ATOM   3861 N NE2   . HIS B 1 145 ? 6.530   -31.781 -6.924  1.00 33.94 ? 356 HIS B NE2   1 
ATOM   3862 N N     . PRO B 1 146 ? 7.590   -27.785 -4.821  1.00 30.27 ? 357 PRO B N     1 
ATOM   3863 C CA    . PRO B 1 146 ? 8.426   -27.693 -3.617  1.00 29.77 ? 357 PRO B CA    1 
ATOM   3864 C C     . PRO B 1 146 ? 9.886   -28.074 -3.824  1.00 28.72 ? 357 PRO B C     1 
ATOM   3865 O O     . PRO B 1 146 ? 10.766  -27.414 -3.265  1.00 29.20 ? 357 PRO B O     1 
ATOM   3866 C CB    . PRO B 1 146 ? 7.751   -28.672 -2.656  1.00 29.94 ? 357 PRO B CB    1 
ATOM   3867 C CG    . PRO B 1 146 ? 6.292   -28.584 -3.029  1.00 30.68 ? 357 PRO B CG    1 
ATOM   3868 C CD    . PRO B 1 146 ? 6.325   -28.499 -4.544  1.00 30.66 ? 357 PRO B CD    1 
ATOM   3869 N N     . LEU B 1 147 ? 10.160  -29.109 -4.617  1.00 27.34 ? 358 LEU B N     1 
ATOM   3870 C CA    . LEU B 1 147 ? 11.541  -29.564 -4.774  1.00 26.60 ? 358 LEU B CA    1 
ATOM   3871 C C     . LEU B 1 147 ? 12.399  -28.528 -5.500  1.00 26.01 ? 358 LEU B C     1 
ATOM   3872 O O     . LEU B 1 147 ? 13.561  -28.334 -5.140  1.00 25.44 ? 358 LEU B O     1 
ATOM   3873 C CB    . LEU B 1 147 ? 11.629  -30.923 -5.464  1.00 26.35 ? 358 LEU B CB    1 
ATOM   3874 C CG    . LEU B 1 147 ? 10.978  -32.110 -4.733  1.00 27.58 ? 358 LEU B CG    1 
ATOM   3875 C CD1   . LEU B 1 147 ? 11.202  -33.372 -5.519  1.00 26.72 ? 358 LEU B CD1   1 
ATOM   3876 C CD2   . LEU B 1 147 ? 11.468  -32.280 -3.266  1.00 26.18 ? 358 LEU B CD2   1 
ATOM   3877 N N     . ASP B 1 148 ? 11.841  -27.874 -6.522  1.00 25.49 ? 359 ASP B N     1 
ATOM   3878 C CA    . ASP B 1 148 ? 12.567  -26.798 -7.210  1.00 25.49 ? 359 ASP B CA    1 
ATOM   3879 C C     . ASP B 1 148 ? 12.765  -25.594 -6.292  1.00 23.67 ? 359 ASP B C     1 
ATOM   3880 O O     . ASP B 1 148 ? 13.782  -24.921 -6.341  1.00 23.82 ? 359 ASP B O     1 
ATOM   3881 C CB    . ASP B 1 148 ? 11.848  -26.372 -8.493  1.00 26.29 ? 359 ASP B CB    1 
ATOM   3882 C CG    . ASP B 1 148 ? 11.905  -27.445 -9.583  1.00 28.69 ? 359 ASP B CG    1 
ATOM   3883 O OD1   . ASP B 1 148 ? 13.021  -27.894 -9.947  1.00 31.86 ? 359 ASP B OD1   1 
ATOM   3884 O OD2   . ASP B 1 148 ? 10.822  -27.815 -10.074 1.00 31.55 ? 359 ASP B OD2   1 
ATOM   3885 N N     . GLN B 1 149 ? 11.773  -25.338 -5.461  1.00 22.58 ? 360 GLN B N     1 
ATOM   3886 C CA    . GLN B 1 149 ? 11.839  -24.276 -4.488  1.00 22.44 ? 360 GLN B CA    1 
ATOM   3887 C C     . GLN B 1 149 ? 12.959  -24.564 -3.461  1.00 21.00 ? 360 GLN B C     1 
ATOM   3888 O O     . GLN B 1 149 ? 13.803  -23.701 -3.193  1.00 19.48 ? 360 GLN B O     1 
ATOM   3889 C CB    . GLN B 1 149 ? 10.484  -24.143 -3.801  1.00 23.04 ? 360 GLN B CB    1 
ATOM   3890 C CG    . GLN B 1 149 ? 10.355  -22.922 -2.934  1.00 27.00 ? 360 GLN B CG    1 
ATOM   3891 C CD    . GLN B 1 149 ? 9.095   -22.949 -2.108  1.00 31.44 ? 360 GLN B CD    1 
ATOM   3892 O OE1   . GLN B 1 149 ? 9.155   -23.178 -0.903  1.00 35.73 ? 360 GLN B OE1   1 
ATOM   3893 N NE2   . GLN B 1 149 ? 7.940   -22.752 -2.753  1.00 33.96 ? 360 GLN B NE2   1 
ATOM   3894 N N     . HIS B 1 150 ? 12.982  -25.780 -2.916  1.00 19.86 ? 361 HIS B N     1 
ATOM   3895 C CA    . HIS B 1 150 ? 14.048  -26.139 -1.949  1.00 18.87 ? 361 HIS B CA    1 
ATOM   3896 C C     . HIS B 1 150 ? 15.419  -26.002 -2.601  1.00 18.48 ? 361 HIS B C     1 
ATOM   3897 O O     . HIS B 1 150 ? 16.325  -25.388 -2.050  1.00 19.10 ? 361 HIS B O     1 
ATOM   3898 C CB    . HIS B 1 150 ? 13.895  -27.557 -1.417  1.00 18.29 ? 361 HIS B CB    1 
ATOM   3899 C CG    . HIS B 1 150 ? 12.582  -27.839 -0.776  1.00 17.62 ? 361 HIS B CG    1 
ATOM   3900 N ND1   . HIS B 1 150 ? 11.776  -26.856 -0.245  1.00 16.76 ? 361 HIS B ND1   1 
ATOM   3901 C CD2   . HIS B 1 150 ? 11.936  -29.011 -0.568  1.00 17.74 ? 361 HIS B CD2   1 
ATOM   3902 C CE1   . HIS B 1 150 ? 10.677  -27.410 0.230   1.00 15.25 ? 361 HIS B CE1   1 
ATOM   3903 N NE2   . HIS B 1 150 ? 10.755  -28.718 0.050   1.00 15.50 ? 361 HIS B NE2   1 
ATOM   3904 N N     . TYR B 1 151 ? 15.570  -26.570 -3.790  1.00 18.65 ? 362 TYR B N     1 
ATOM   3905 C CA    . TYR B 1 151 ? 16.839  -26.522 -4.493  1.00 19.01 ? 362 TYR B CA    1 
ATOM   3906 C C     . TYR B 1 151 ? 17.289  -25.098 -4.761  1.00 19.69 ? 362 TYR B C     1 
ATOM   3907 O O     . TYR B 1 151 ? 18.467  -24.752 -4.543  1.00 18.78 ? 362 TYR B O     1 
ATOM   3908 C CB    . TYR B 1 151 ? 16.744  -27.313 -5.804  1.00 19.68 ? 362 TYR B CB    1 
ATOM   3909 C CG    . TYR B 1 151 ? 18.012  -27.319 -6.621  1.00 20.01 ? 362 TYR B CG    1 
ATOM   3910 C CD1   . TYR B 1 151 ? 19.167  -27.860 -6.123  1.00 19.53 ? 362 TYR B CD1   1 
ATOM   3911 C CD2   . TYR B 1 151 ? 18.051  -26.778 -7.902  1.00 21.86 ? 362 TYR B CD2   1 
ATOM   3912 C CE1   . TYR B 1 151 ? 20.337  -27.884 -6.867  1.00 19.53 ? 362 TYR B CE1   1 
ATOM   3913 C CE2   . TYR B 1 151 ? 19.222  -26.789 -8.652  1.00 20.04 ? 362 TYR B CE2   1 
ATOM   3914 C CZ    . TYR B 1 151 ? 20.354  -27.340 -8.127  1.00 19.18 ? 362 TYR B CZ    1 
ATOM   3915 O OH    . TYR B 1 151 ? 21.516  -27.385 -8.825  1.00 16.05 ? 362 TYR B OH    1 
ATOM   3916 N N     . ARG B 1 152 ? 16.353  -24.265 -5.226  1.00 20.14 ? 363 ARG B N     1 
ATOM   3917 C CA    . ARG B 1 152 ? 16.648  -22.864 -5.496  1.00 20.13 ? 363 ARG B CA    1 
ATOM   3918 C C     . ARG B 1 152 ? 17.134  -22.201 -4.221  1.00 19.55 ? 363 ARG B C     1 
ATOM   3919 O O     . ARG B 1 152 ? 18.150  -21.530 -4.230  1.00 19.65 ? 363 ARG B O     1 
ATOM   3920 C CB    . ARG B 1 152 ? 15.423  -22.128 -6.055  1.00 20.75 ? 363 ARG B CB    1 
ATOM   3921 C CG    . ARG B 1 152 ? 15.703  -20.698 -6.521  1.00 22.98 ? 363 ARG B CG    1 
ATOM   3922 C CD    . ARG B 1 152 ? 14.530  -20.119 -7.350  1.00 26.22 ? 363 ARG B CD    1 
ATOM   3923 N NE    . ARG B 1 152 ? 13.218  -20.298 -6.728  1.00 28.67 ? 363 ARG B NE    1 
ATOM   3924 C CZ    . ARG B 1 152 ? 12.794  -19.654 -5.638  1.00 30.28 ? 363 ARG B CZ    1 
ATOM   3925 N NH1   . ARG B 1 152 ? 11.576  -19.877 -5.161  1.00 30.24 ? 363 ARG B NH1   1 
ATOM   3926 N NH2   . ARG B 1 152 ? 13.583  -18.787 -5.011  1.00 32.47 ? 363 ARG B NH2   1 
ATOM   3927 N N     . ASN B 1 153 ? 16.444  -22.449 -3.118  1.00 19.36 ? 364 ASN B N     1 
ATOM   3928 C CA    . ASN B 1 153 ? 16.796  -21.820 -1.857  1.00 19.37 ? 364 ASN B CA    1 
ATOM   3929 C C     . ASN B 1 153 ? 18.135  -22.228 -1.249  1.00 19.13 ? 364 ASN B C     1 
ATOM   3930 O O     . ASN B 1 153 ? 18.622  -21.549 -0.345  1.00 19.70 ? 364 ASN B O     1 
ATOM   3931 C CB    . ASN B 1 153 ? 15.649  -21.970 -0.876  1.00 19.40 ? 364 ASN B CB    1 
ATOM   3932 C CG    . ASN B 1 153 ? 14.487  -21.063 -1.236  1.00 20.61 ? 364 ASN B CG    1 
ATOM   3933 O OD1   . ASN B 1 153 ? 14.694  -20.029 -1.855  1.00 24.26 ? 364 ASN B OD1   1 
ATOM   3934 N ND2   . ASN B 1 153 ? 13.283  -21.437 -0.861  1.00 20.52 ? 364 ASN B ND2   1 
ATOM   3935 N N     . LEU B 1 154 ? 18.756  -23.280 -1.772  1.00 17.65 ? 365 LEU B N     1 
ATOM   3936 C CA    . LEU B 1 154 ? 20.097  -23.670 -1.314  1.00 17.67 ? 365 LEU B CA    1 
ATOM   3937 C C     . LEU B 1 154 ? 21.193  -22.765 -1.856  1.00 17.51 ? 365 LEU B C     1 
ATOM   3938 O O     . LEU B 1 154 ? 22.251  -22.648 -1.257  1.00 17.13 ? 365 LEU B O     1 
ATOM   3939 C CB    . LEU B 1 154 ? 20.425  -25.098 -1.732  1.00 17.42 ? 365 LEU B CB    1 
ATOM   3940 C CG    . LEU B 1 154 ? 19.681  -26.295 -1.154  1.00 16.28 ? 365 LEU B CG    1 
ATOM   3941 C CD1   . LEU B 1 154 ? 20.266  -27.563 -1.793  1.00 12.59 ? 365 LEU B CD1   1 
ATOM   3942 C CD2   . LEU B 1 154 ? 19.806  -26.351 0.350   1.00 13.15 ? 365 LEU B CD2   1 
ATOM   3943 N N     . HIS B 1 155 ? 20.946  -22.130 -2.994  1.00 17.48 ? 366 HIS B N     1 
ATOM   3944 C CA    . HIS B 1 155 ? 21.947  -21.302 -3.642  1.00 18.07 ? 366 HIS B CA    1 
ATOM   3945 C C     . HIS B 1 155 ? 23.230  -22.082 -3.765  1.00 17.70 ? 366 HIS B C     1 
ATOM   3946 O O     . HIS B 1 155 ? 24.302  -21.602 -3.405  1.00 17.94 ? 366 HIS B O     1 
ATOM   3947 C CB    . HIS B 1 155 ? 22.109  -19.955 -2.927  1.00 18.93 ? 366 HIS B CB    1 
ATOM   3948 C CG    . HIS B 1 155 ? 20.878  -19.112 -2.996  1.00 20.96 ? 366 HIS B CG    1 
ATOM   3949 N ND1   . HIS B 1 155 ? 19.905  -19.140 -2.019  1.00 24.30 ? 366 HIS B ND1   1 
ATOM   3950 C CD2   . HIS B 1 155 ? 20.440  -18.243 -3.936  1.00 23.80 ? 366 HIS B CD2   1 
ATOM   3951 C CE1   . HIS B 1 155 ? 18.923  -18.321 -2.348  1.00 23.47 ? 366 HIS B CE1   1 
ATOM   3952 N NE2   . HIS B 1 155 ? 19.219  -17.766 -3.510  1.00 24.57 ? 366 HIS B NE2   1 
ATOM   3953 N N     . CYS B 1 156 ? 23.075  -23.314 -4.273  1.00 17.09 ? 367 CYS B N     1 
ATOM   3954 C CA    . CYS B 1 156 ? 24.153  -24.281 -4.412  1.00 17.15 ? 367 CYS B CA    1 
ATOM   3955 C C     . CYS B 1 156 ? 23.795  -25.279 -5.512  1.00 17.46 ? 367 CYS B C     1 
ATOM   3956 O O     . CYS B 1 156 ? 22.876  -26.085 -5.362  1.00 18.51 ? 367 CYS B O     1 
ATOM   3957 C CB    . CYS B 1 156 ? 24.356  -25.028 -3.087  1.00 16.83 ? 367 CYS B CB    1 
ATOM   3958 S SG    . CYS B 1 156 ? 25.767  -26.125 -3.123  1.00 17.18 ? 367 CYS B SG    1 
ATOM   3959 N N     . ALA B 1 157 ? 24.478  -25.168 -6.640  1.00 18.24 ? 368 ALA B N     1 
ATOM   3960 C CA    . ALA B 1 157 ? 24.280  -26.048 -7.769  1.00 17.78 ? 368 ALA B CA    1 
ATOM   3961 C C     . ALA B 1 157 ? 24.764  -27.431 -7.377  1.00 17.13 ? 368 ALA B C     1 
ATOM   3962 O O     . ALA B 1 157 ? 25.804  -27.569 -6.702  1.00 16.29 ? 368 ALA B O     1 
ATOM   3963 C CB    . ALA B 1 157 ? 25.052  -25.522 -9.011  1.00 18.35 ? 368 ALA B CB    1 
ATOM   3964 N N     . LEU B 1 158 ? 23.968  -28.439 -7.730  1.00 17.41 ? 369 LEU B N     1 
ATOM   3965 C CA    . LEU B 1 158 ? 24.316  -29.849 -7.531  1.00 18.06 ? 369 LEU B CA    1 
ATOM   3966 C C     . LEU B 1 158 ? 24.133  -30.593 -8.868  1.00 19.16 ? 369 LEU B C     1 
ATOM   3967 O O     . LEU B 1 158 ? 23.022  -30.711 -9.377  1.00 18.31 ? 369 LEU B O     1 
ATOM   3968 C CB    . LEU B 1 158 ? 23.413  -30.493 -6.471  1.00 17.29 ? 369 LEU B CB    1 
ATOM   3969 C CG    . LEU B 1 158 ? 23.474  -29.845 -5.085  1.00 16.92 ? 369 LEU B CG    1 
ATOM   3970 C CD1   . LEU B 1 158 ? 22.344  -30.338 -4.218  1.00 16.27 ? 369 LEU B CD1   1 
ATOM   3971 C CD2   . LEU B 1 158 ? 24.828  -30.134 -4.437  1.00 15.00 ? 369 LEU B CD2   1 
ATOM   3972 N N     . ARG B 1 159 ? 25.220  -31.100 -9.424  1.00 20.51 ? 370 ARG B N     1 
ATOM   3973 C CA    . ARG B 1 159 ? 25.152  -31.616 -10.779 1.00 21.65 ? 370 ARG B CA    1 
ATOM   3974 C C     . ARG B 1 159 ? 25.575  -33.069 -10.798 1.00 20.81 ? 370 ARG B C     1 
ATOM   3975 O O     . ARG B 1 159 ? 26.715  -33.367 -10.513 1.00 20.55 ? 370 ARG B O     1 
ATOM   3976 C CB    . ARG B 1 159 ? 26.021  -30.772 -11.716 1.00 22.15 ? 370 ARG B CB    1 
ATOM   3977 C CG    . ARG B 1 159 ? 25.403  -29.399 -11.962 1.00 25.17 ? 370 ARG B CG    1 
ATOM   3978 C CD    . ARG B 1 159 ? 26.238  -28.547 -12.915 1.00 26.98 ? 370 ARG B CD    1 
ATOM   3979 N NE    . ARG B 1 159 ? 25.810  -27.147 -12.814 1.00 29.29 ? 370 ARG B NE    1 
ATOM   3980 C CZ    . ARG B 1 159 ? 26.494  -26.169 -12.223 1.00 28.63 ? 370 ARG B CZ    1 
ATOM   3981 N NH1   . ARG B 1 159 ? 27.686  -26.387 -11.673 1.00 28.64 ? 370 ARG B NH1   1 
ATOM   3982 N NH2   . ARG B 1 159 ? 25.971  -24.948 -12.191 1.00 31.55 ? 370 ARG B NH2   1 
ATOM   3983 N N     . PRO B 1 160 ? 24.649  -33.968 -11.150 1.00 21.10 ? 371 PRO B N     1 
ATOM   3984 C CA    . PRO B 1 160 ? 24.972  -35.398 -11.244 1.00 21.36 ? 371 PRO B CA    1 
ATOM   3985 C C     . PRO B 1 160 ? 26.109  -35.665 -12.239 1.00 21.52 ? 371 PRO B C     1 
ATOM   3986 O O     . PRO B 1 160 ? 26.163  -35.048 -13.295 1.00 21.22 ? 371 PRO B O     1 
ATOM   3987 C CB    . PRO B 1 160 ? 23.674  -36.042 -11.741 1.00 22.06 ? 371 PRO B CB    1 
ATOM   3988 C CG    . PRO B 1 160 ? 22.693  -34.944 -11.965 1.00 22.29 ? 371 PRO B CG    1 
ATOM   3989 C CD    . PRO B 1 160 ? 23.311  -33.633 -11.667 1.00 21.32 ? 371 PRO B CD    1 
ATOM   3990 N N     . LEU B 1 161 ? 27.016  -36.560 -11.897 1.00 21.37 ? 372 LEU B N     1 
ATOM   3991 C CA    . LEU B 1 161 ? 28.115  -36.907 -12.786 1.00 21.55 ? 372 LEU B CA    1 
ATOM   3992 C C     . LEU B 1 161 ? 27.940  -38.333 -13.309 1.00 22.46 ? 372 LEU B C     1 
ATOM   3993 O O     . LEU B 1 161 ? 27.358  -39.187 -12.643 1.00 21.61 ? 372 LEU B O     1 
ATOM   3994 C CB    . LEU B 1 161 ? 29.450  -36.775 -12.064 1.00 21.53 ? 372 LEU B CB    1 
ATOM   3995 C CG    . LEU B 1 161 ? 29.791  -35.370 -11.537 1.00 21.17 ? 372 LEU B CG    1 
ATOM   3996 C CD1   . LEU B 1 161 ? 31.168  -35.401 -10.969 1.00 21.30 ? 372 LEU B CD1   1 
ATOM   3997 C CD2   . LEU B 1 161 ? 29.669  -34.265 -12.634 1.00 22.17 ? 372 LEU B CD2   1 
ATOM   3998 N N     . ASP B 1 162 ? 28.480  -38.583 -14.494 1.00 23.47 ? 373 ASP B N     1 
ATOM   3999 C CA    . ASP B 1 162 ? 28.405  -39.904 -15.121 1.00 24.66 ? 373 ASP B CA    1 
ATOM   4000 C C     . ASP B 1 162 ? 29.251  -40.908 -14.336 1.00 24.36 ? 373 ASP B C     1 
ATOM   4001 O O     . ASP B 1 162 ? 30.401  -40.624 -13.984 1.00 25.17 ? 373 ASP B O     1 
ATOM   4002 C CB    . ASP B 1 162 ? 28.893  -39.770 -16.580 1.00 26.00 ? 373 ASP B CB    1 
ATOM   4003 C CG    . ASP B 1 162 ? 28.529  -40.959 -17.441 1.00 28.54 ? 373 ASP B CG    1 
ATOM   4004 O OD1   . ASP B 1 162 ? 28.367  -42.071 -16.896 1.00 30.08 ? 373 ASP B OD1   1 
ATOM   4005 O OD2   . ASP B 1 162 ? 28.435  -40.776 -18.685 1.00 33.75 ? 373 ASP B OD2   1 
ATOM   4006 N N     . HIS B 1 163 ? 28.692  -42.084 -14.076 1.00 24.21 ? 374 HIS B N     1 
ATOM   4007 C CA    . HIS B 1 163 ? 29.398  -43.148 -13.359 1.00 24.50 ? 374 HIS B CA    1 
ATOM   4008 C C     . HIS B 1 163 ? 30.593  -43.730 -14.142 1.00 24.68 ? 374 HIS B C     1 
ATOM   4009 O O     . HIS B 1 163 ? 31.480  -44.367 -13.570 1.00 24.45 ? 374 HIS B O     1 
ATOM   4010 C CB    . HIS B 1 163 ? 28.422  -44.269 -12.999 1.00 24.79 ? 374 HIS B CB    1 
ATOM   4011 C CG    . HIS B 1 163 ? 27.484  -43.930 -11.881 1.00 25.90 ? 374 HIS B CG    1 
ATOM   4012 N ND1   . HIS B 1 163 ? 27.150  -44.833 -10.898 1.00 27.49 ? 374 HIS B ND1   1 
ATOM   4013 C CD2   . HIS B 1 163 ? 26.814  -42.790 -11.584 1.00 28.57 ? 374 HIS B CD2   1 
ATOM   4014 C CE1   . HIS B 1 163 ? 26.301  -44.272 -10.055 1.00 27.52 ? 374 HIS B CE1   1 
ATOM   4015 N NE2   . HIS B 1 163 ? 26.080  -43.032 -10.449 1.00 28.55 ? 374 HIS B NE2   1 
ATOM   4016 N N     . GLU B 1 164 ? 30.605  -43.485 -15.445 1.00 25.11 ? 375 GLU B N     1 
ATOM   4017 C CA    . GLU B 1 164 ? 31.720  -43.846 -16.327 1.00 25.91 ? 375 GLU B CA    1 
ATOM   4018 C C     . GLU B 1 164 ? 32.683  -42.667 -16.571 1.00 24.88 ? 375 GLU B C     1 
ATOM   4019 O O     . GLU B 1 164 ? 33.553  -42.742 -17.437 1.00 24.62 ? 375 GLU B O     1 
ATOM   4020 C CB    . GLU B 1 164 ? 31.161  -44.350 -17.681 1.00 26.15 ? 375 GLU B CB    1 
ATOM   4021 C CG    . GLU B 1 164 ? 30.079  -45.435 -17.563 1.00 29.79 ? 375 GLU B CG    1 
ATOM   4022 C CD    . GLU B 1 164 ? 29.525  -45.910 -18.929 1.00 34.81 ? 375 GLU B CD    1 
ATOM   4023 O OE1   . GLU B 1 164 ? 29.395  -45.082 -19.862 1.00 35.50 ? 375 GLU B OE1   1 
ATOM   4024 O OE2   . GLU B 1 164 ? 29.202  -47.121 -19.054 1.00 38.86 ? 375 GLU B OE2   1 
ATOM   4025 N N     . SER B 1 165 ? 32.553  -41.574 -15.812 1.00 24.10 ? 376 SER B N     1 
ATOM   4026 C CA    . SER B 1 165 ? 33.489  -40.448 -15.956 1.00 22.71 ? 376 SER B CA    1 
ATOM   4027 C C     . SER B 1 165 ? 34.789  -40.657 -15.180 1.00 22.38 ? 376 SER B C     1 
ATOM   4028 O O     . SER B 1 165 ? 34.861  -41.429 -14.215 1.00 22.28 ? 376 SER B O     1 
ATOM   4029 C CB    . SER B 1 165 ? 32.839  -39.142 -15.505 1.00 23.45 ? 376 SER B CB    1 
ATOM   4030 O OG    . SER B 1 165 ? 32.613  -39.144 -14.096 1.00 21.02 ? 376 SER B OG    1 
ATOM   4031 N N     . TYR B 1 166 ? 35.825  -39.955 -15.616 1.00 21.08 ? 377 TYR B N     1 
ATOM   4032 C CA    . TYR B 1 166 ? 37.113  -39.957 -14.942 1.00 20.69 ? 377 TYR B CA    1 
ATOM   4033 C C     . TYR B 1 166 ? 36.999  -39.537 -13.479 1.00 20.17 ? 377 TYR B C     1 
ATOM   4034 O O     . TYR B 1 166 ? 37.599  -40.120 -12.601 1.00 18.82 ? 377 TYR B O     1 
ATOM   4035 C CB    . TYR B 1 166 ? 38.075  -39.012 -15.672 1.00 20.75 ? 377 TYR B CB    1 
ATOM   4036 C CG    . TYR B 1 166 ? 39.417  -38.883 -14.995 1.00 20.35 ? 377 TYR B CG    1 
ATOM   4037 C CD1   . TYR B 1 166 ? 40.328  -39.934 -15.023 1.00 17.95 ? 377 TYR B CD1   1 
ATOM   4038 C CD2   . TYR B 1 166 ? 39.770  -37.723 -14.306 1.00 18.96 ? 377 TYR B CD2   1 
ATOM   4039 C CE1   . TYR B 1 166 ? 41.546  -39.844 -14.399 1.00 18.53 ? 377 TYR B CE1   1 
ATOM   4040 C CE2   . TYR B 1 166 ? 40.991  -37.623 -13.681 1.00 18.02 ? 377 TYR B CE2   1 
ATOM   4041 C CZ    . TYR B 1 166 ? 41.878  -38.699 -13.732 1.00 18.66 ? 377 TYR B CZ    1 
ATOM   4042 O OH    . TYR B 1 166 ? 43.103  -38.637 -13.129 1.00 20.51 ? 377 TYR B OH    1 
ATOM   4043 N N     . GLU B 1 167 ? 36.214  -38.497 -13.253 1.00 20.56 ? 378 GLU B N     1 
ATOM   4044 C CA    . GLU B 1 167 ? 35.976  -37.950 -11.916 1.00 21.05 ? 378 GLU B CA    1 
ATOM   4045 C C     . GLU B 1 167 ? 35.403  -39.041 -11.000 1.00 19.73 ? 378 GLU B C     1 
ATOM   4046 O O     . GLU B 1 167 ? 35.888  -39.241 -9.869  1.00 19.19 ? 378 GLU B O     1 
ATOM   4047 C CB    . GLU B 1 167 ? 35.006  -36.767 -12.010 1.00 21.40 ? 378 GLU B CB    1 
ATOM   4048 C CG    . GLU B 1 167 ? 35.556  -35.507 -12.703 1.00 25.67 ? 378 GLU B CG    1 
ATOM   4049 C CD    . GLU B 1 167 ? 35.517  -35.539 -14.248 1.00 30.79 ? 378 GLU B CD    1 
ATOM   4050 O OE1   . GLU B 1 167 ? 34.696  -36.278 -14.862 1.00 31.98 ? 378 GLU B OE1   1 
ATOM   4051 O OE2   . GLU B 1 167 ? 36.326  -34.797 -14.861 1.00 35.62 ? 378 GLU B OE2   1 
ATOM   4052 N N     . PHE B 1 168 ? 34.385  -39.755 -11.511 1.00 18.44 ? 379 PHE B N     1 
ATOM   4053 C CA    . PHE B 1 168 ? 33.730  -40.809 -10.742 1.00 17.70 ? 379 PHE B CA    1 
ATOM   4054 C C     . PHE B 1 168 ? 34.744  -41.885 -10.386 1.00 17.01 ? 379 PHE B C     1 
ATOM   4055 O O     . PHE B 1 168 ? 34.764  -42.382 -9.260  1.00 16.47 ? 379 PHE B O     1 
ATOM   4056 C CB    . PHE B 1 168 ? 32.525  -41.391 -11.502 1.00 17.64 ? 379 PHE B CB    1 
ATOM   4057 C CG    . PHE B 1 168 ? 31.650  -42.299 -10.667 1.00 18.10 ? 379 PHE B CG    1 
ATOM   4058 C CD1   . PHE B 1 168 ? 30.500  -41.810 -10.062 1.00 18.55 ? 379 PHE B CD1   1 
ATOM   4059 C CD2   . PHE B 1 168 ? 31.989  -43.640 -10.474 1.00 18.29 ? 379 PHE B CD2   1 
ATOM   4060 C CE1   . PHE B 1 168 ? 29.707  -42.640 -9.281  1.00 18.55 ? 379 PHE B CE1   1 
ATOM   4061 C CE2   . PHE B 1 168 ? 31.208  -44.471 -9.696  1.00 19.22 ? 379 PHE B CE2   1 
ATOM   4062 C CZ    . PHE B 1 168 ? 30.060  -43.967 -9.096  1.00 19.10 ? 379 PHE B CZ    1 
ATOM   4063 N N     . LYS B 1 169 ? 35.627  -42.203 -11.332 1.00 16.59 ? 380 LYS B N     1 
ATOM   4064 C CA    . LYS B 1 169 ? 36.644  -43.205 -11.100 1.00 16.05 ? 380 LYS B CA    1 
ATOM   4065 C C     . LYS B 1 169 ? 37.602  -42.797 -9.994  1.00 15.48 ? 380 LYS B C     1 
ATOM   4066 O O     . LYS B 1 169 ? 37.849  -43.570 -9.089  1.00 15.43 ? 380 LYS B O     1 
ATOM   4067 C CB    . LYS B 1 169 ? 37.425  -43.499 -12.379 1.00 17.01 ? 380 LYS B CB    1 
ATOM   4068 C CG    . LYS B 1 169 ? 38.415  -44.675 -12.260 1.00 18.36 ? 380 LYS B CG    1 
ATOM   4069 C CD    . LYS B 1 169 ? 39.685  -44.432 -13.090 1.00 19.89 ? 380 LYS B CD    1 
ATOM   4070 C CE    . LYS B 1 169 ? 40.683  -43.510 -12.353 1.00 21.19 ? 380 LYS B CE    1 
ATOM   4071 N NZ    . LYS B 1 169 ? 41.964  -43.316 -13.083 1.00 20.23 ? 380 LYS B NZ    1 
ATOM   4072 N N     . VAL B 1 170 ? 38.152  -41.597 -10.072 1.00 14.61 ? 381 VAL B N     1 
ATOM   4073 C CA    . VAL B 1 170 ? 39.141  -41.155 -9.084  1.00 15.09 ? 381 VAL B CA    1 
ATOM   4074 C C     . VAL B 1 170 ? 38.523  -41.071 -7.665  1.00 14.13 ? 381 VAL B C     1 
ATOM   4075 O O     . VAL B 1 170 ? 39.129  -41.468 -6.653  1.00 14.15 ? 381 VAL B O     1 
ATOM   4076 C CB    . VAL B 1 170 ? 39.731  -39.779 -9.507  1.00 15.30 ? 381 VAL B CB    1 
ATOM   4077 C CG1   . VAL B 1 170 ? 40.467  -39.120 -8.363  1.00 15.03 ? 381 VAL B CG1   1 
ATOM   4078 C CG2   . VAL B 1 170 ? 40.620  -39.942 -10.725 1.00 17.12 ? 381 VAL B CG2   1 
ATOM   4079 N N     . ILE B 1 171 ? 37.309  -40.583 -7.606  1.00 13.93 ? 382 ILE B N     1 
ATOM   4080 C CA    . ILE B 1 171 ? 36.605  -40.421 -6.327  1.00 14.56 ? 382 ILE B CA    1 
ATOM   4081 C C     . ILE B 1 171 ? 36.223  -41.773 -5.725  1.00 15.02 ? 382 ILE B C     1 
ATOM   4082 O O     . ILE B 1 171 ? 36.471  -41.985 -4.552  1.00 16.05 ? 382 ILE B O     1 
ATOM   4083 C CB    . ILE B 1 171 ? 35.415  -39.456 -6.482  1.00 14.37 ? 382 ILE B CB    1 
ATOM   4084 C CG1   . ILE B 1 171 ? 35.971  -38.045 -6.736  1.00 14.46 ? 382 ILE B CG1   1 
ATOM   4085 C CG2   . ILE B 1 171 ? 34.487  -39.475 -5.234  1.00 13.95 ? 382 ILE B CG2   1 
ATOM   4086 C CD1   . ILE B 1 171 ? 34.958  -37.013 -7.135  1.00 14.26 ? 382 ILE B CD1   1 
ATOM   4087 N N     . SER B 1 172 ? 35.714  -42.715 -6.522  1.00 15.82 ? 383 SER B N     1 
ATOM   4088 C CA    . SER B 1 172 ? 35.519  -44.101 -6.040  1.00 15.45 ? 383 SER B CA    1 
ATOM   4089 C C     . SER B 1 172 ? 36.812  -44.675 -5.484  1.00 15.64 ? 383 SER B C     1 
ATOM   4090 O O     . SER B 1 172 ? 36.809  -45.268 -4.420  1.00 14.55 ? 383 SER B O     1 
ATOM   4091 C CB    . SER B 1 172 ? 34.997  -45.040 -7.125  1.00 15.91 ? 383 SER B CB    1 
ATOM   4092 O OG    . SER B 1 172 ? 33.870  -44.480 -7.767  1.00 19.20 ? 383 SER B OG    1 
ATOM   4093 N N     . GLN B 1 173 ? 37.914  -44.525 -6.218  1.00 16.03 ? 384 GLN B N     1 
ATOM   4094 C CA    . GLN B 1 173 ? 39.220  -44.994 -5.739  1.00 16.25 ? 384 GLN B CA    1 
ATOM   4095 C C     . GLN B 1 173 ? 39.586  -44.341 -4.425  1.00 15.05 ? 384 GLN B C     1 
ATOM   4096 O O     . GLN B 1 173 ? 40.092  -44.996 -3.513  1.00 15.09 ? 384 GLN B O     1 
ATOM   4097 C CB    . GLN B 1 173 ? 40.339  -44.690 -6.764  1.00 16.81 ? 384 GLN B CB    1 
ATOM   4098 C CG    . GLN B 1 173 ? 40.314  -45.632 -7.967  1.00 18.52 ? 384 GLN B CG    1 
ATOM   4099 C CD    . GLN B 1 173 ? 41.481  -45.440 -8.934  1.00 22.10 ? 384 GLN B CD    1 
ATOM   4100 O OE1   . GLN B 1 173 ? 42.399  -44.651 -8.704  1.00 26.64 ? 384 GLN B OE1   1 
ATOM   4101 N NE2   . GLN B 1 173 ? 41.445  -46.176 -10.020 1.00 24.03 ? 384 GLN B NE2   1 
ATOM   4102 N N     . TYR B 1 174 ? 39.371  -43.034 -4.354  1.00 14.32 ? 385 TYR B N     1 
ATOM   4103 C CA    . TYR B 1 174 ? 39.724  -42.279 -3.147  1.00 13.67 ? 385 TYR B CA    1 
ATOM   4104 C C     . TYR B 1 174 ? 38.862  -42.831 -1.994  1.00 12.86 ? 385 TYR B C     1 
ATOM   4105 O O     . TYR B 1 174 ? 39.372  -43.095 -0.932  1.00 12.63 ? 385 TYR B O     1 
ATOM   4106 C CB    . TYR B 1 174 ? 39.487  -40.777 -3.400  1.00 13.48 ? 385 TYR B CB    1 
ATOM   4107 C CG    . TYR B 1 174 ? 39.955  -39.786 -2.340  1.00 12.55 ? 385 TYR B CG    1 
ATOM   4108 C CD1   . TYR B 1 174 ? 40.839  -40.152 -1.335  1.00 13.00 ? 385 TYR B CD1   1 
ATOM   4109 C CD2   . TYR B 1 174 ? 39.522  -38.459 -2.376  1.00 11.67 ? 385 TYR B CD2   1 
ATOM   4110 C CE1   . TYR B 1 174 ? 41.278  -39.215 -0.369  1.00 12.86 ? 385 TYR B CE1   1 
ATOM   4111 C CE2   . TYR B 1 174 ? 39.955  -37.518 -1.381  1.00 10.15 ? 385 TYR B CE2   1 
ATOM   4112 C CZ    . TYR B 1 174 ? 40.814  -37.909 -0.417  1.00 11.18 ? 385 TYR B CZ    1 
ATOM   4113 O OH    . TYR B 1 174 ? 41.236  -37.006 0.533   1.00 12.16 ? 385 TYR B OH    1 
ATOM   4114 N N     . LEU B 1 175 ? 37.566  -43.011 -2.241  1.00 12.44 ? 386 LEU B N     1 
ATOM   4115 C CA    . LEU B 1 175 ? 36.636  -43.539 -1.224  1.00 12.76 ? 386 LEU B CA    1 
ATOM   4116 C C     . LEU B 1 175 ? 37.080  -44.881 -0.658  1.00 13.21 ? 386 LEU B C     1 
ATOM   4117 O O     . LEU B 1 175 ? 37.148  -45.061 0.562   1.00 12.46 ? 386 LEU B O     1 
ATOM   4118 C CB    . LEU B 1 175 ? 35.229  -43.680 -1.818  1.00 13.13 ? 386 LEU B CB    1 
ATOM   4119 C CG    . LEU B 1 175 ? 34.097  -44.169 -0.915  1.00 13.55 ? 386 LEU B CG    1 
ATOM   4120 C CD1   . LEU B 1 175 ? 33.878  -43.214 0.277   1.00 12.41 ? 386 LEU B CD1   1 
ATOM   4121 C CD2   . LEU B 1 175 ? 32.813  -44.308 -1.732  1.00 14.54 ? 386 LEU B CD2   1 
ATOM   4122 N N     . GLN B 1 176 ? 37.367  -45.823 -1.552  1.00 13.48 ? 387 GLN B N     1 
ATOM   4123 C CA    . GLN B 1 176 ? 37.693  -47.214 -1.153  1.00 14.52 ? 387 GLN B CA    1 
ATOM   4124 C C     . GLN B 1 176 ? 39.095  -47.308 -0.592  1.00 14.17 ? 387 GLN B C     1 
ATOM   4125 O O     . GLN B 1 176 ? 39.319  -47.927 0.443   1.00 14.54 ? 387 GLN B O     1 
ATOM   4126 C CB    . GLN B 1 176 ? 37.561  -48.169 -2.366  1.00 14.25 ? 387 GLN B CB    1 
ATOM   4127 C CG    . GLN B 1 176 ? 36.152  -48.277 -2.949  1.00 17.89 ? 387 GLN B CG    1 
ATOM   4128 C CD    . GLN B 1 176 ? 35.137  -48.648 -1.878  1.00 19.76 ? 387 GLN B CD    1 
ATOM   4129 O OE1   . GLN B 1 176 ? 35.486  -49.321 -0.892  1.00 18.53 ? 387 GLN B OE1   1 
ATOM   4130 N NE2   . GLN B 1 176 ? 33.900  -48.181 -2.032  1.00 19.93 ? 387 GLN B NE2   1 
ATOM   4131 N N     . SER B 1 177 ? 40.047  -46.679 -1.274  1.00 14.89 ? 388 SER B N     1 
ATOM   4132 C CA    . SER B 1 177 ? 41.460  -46.833 -0.919  1.00 15.35 ? 388 SER B CA    1 
ATOM   4133 C C     . SER B 1 177 ? 41.856  -46.137 0.382   1.00 15.81 ? 388 SER B C     1 
ATOM   4134 O O     . SER B 1 177 ? 42.914  -46.438 0.938   1.00 15.01 ? 388 SER B O     1 
ATOM   4135 C CB    . SER B 1 177 ? 42.352  -46.323 -2.044  1.00 16.11 ? 388 SER B CB    1 
ATOM   4136 O OG    . SER B 1 177 ? 42.332  -44.914 -2.081  1.00 13.72 ? 388 SER B OG    1 
ATOM   4137 N N     . THR B 1 178 ? 41.038  -45.184 0.852   1.00 16.20 ? 389 THR B N     1 
ATOM   4138 C CA    . THR B 1 178 ? 41.352  -44.490 2.117   1.00 15.75 ? 389 THR B CA    1 
ATOM   4139 C C     . THR B 1 178 ? 40.368  -44.888 3.231   1.00 16.46 ? 389 THR B C     1 
ATOM   4140 O O     . THR B 1 178 ? 40.243  -44.196 4.236   1.00 16.40 ? 389 THR B O     1 
ATOM   4141 C CB    . THR B 1 178 ? 41.424  -42.940 1.928   1.00 16.22 ? 389 THR B CB    1 
ATOM   4142 O OG1   . THR B 1 178 ? 40.147  -42.415 1.530   1.00 14.79 ? 389 THR B OG1   1 
ATOM   4143 C CG2   . THR B 1 178 ? 42.501  -42.596 0.865   1.00 15.66 ? 389 THR B CG2   1 
ATOM   4144 N N     . HIS B 1 179 ? 39.688  -46.021 3.047   1.00 16.73 ? 390 HIS B N     1 
ATOM   4145 C CA    . HIS B 1 179 ? 38.885  -46.623 4.105   1.00 16.99 ? 390 HIS B CA    1 
ATOM   4146 C C     . HIS B 1 179 ? 39.830  -47.291 5.072   1.00 18.00 ? 390 HIS B C     1 
ATOM   4147 O O     . HIS B 1 179 ? 40.542  -48.220 4.714   1.00 17.69 ? 390 HIS B O     1 
ATOM   4148 C CB    . HIS B 1 179 ? 37.867  -47.622 3.543   1.00 16.86 ? 390 HIS B CB    1 
ATOM   4149 C CG    . HIS B 1 179 ? 36.825  -48.022 4.537   1.00 15.78 ? 390 HIS B CG    1 
ATOM   4150 N ND1   . HIS B 1 179 ? 35.485  -48.100 4.220   1.00 15.34 ? 390 HIS B ND1   1 
ATOM   4151 C CD2   . HIS B 1 179 ? 36.923  -48.336 5.850   1.00 14.80 ? 390 HIS B CD2   1 
ATOM   4152 C CE1   . HIS B 1 179 ? 34.805  -48.443 5.299   1.00 18.09 ? 390 HIS B CE1   1 
ATOM   4153 N NE2   . HIS B 1 179 ? 35.654  -48.584 6.303   1.00 15.43 ? 390 HIS B NE2   1 
ATOM   4154 N N     . ALA B 1 180 ? 39.829  -46.806 6.306   1.00 18.18 ? 391 ALA B N     1 
ATOM   4155 C CA    . ALA B 1 180 ? 40.850  -47.152 7.245   1.00 19.43 ? 391 ALA B CA    1 
ATOM   4156 C C     . ALA B 1 180 ? 40.621  -48.552 7.818   1.00 20.97 ? 391 ALA B C     1 
ATOM   4157 O O     . ALA B 1 180 ? 39.459  -49.013 7.936   1.00 21.23 ? 391 ALA B O     1 
ATOM   4158 C CB    . ALA B 1 180 ? 40.916  -46.125 8.378   1.00 19.08 ? 391 ALA B CB    1 
ATOM   4159 N N     . PRO B 1 181 ? 41.727  -49.217 8.196   1.00 22.15 ? 392 PRO B N     1 
ATOM   4160 C CA    . PRO B 1 181 ? 41.681  -50.576 8.741   1.00 23.20 ? 392 PRO B CA    1 
ATOM   4161 C C     . PRO B 1 181 ? 40.899  -50.679 10.036  1.00 22.99 ? 392 PRO B C     1 
ATOM   4162 O O     . PRO B 1 181 ? 40.291  -51.703 10.282  1.00 22.81 ? 392 PRO B O     1 
ATOM   4163 C CB    . PRO B 1 181 ? 43.168  -50.938 8.993   1.00 23.48 ? 392 PRO B CB    1 
ATOM   4164 C CG    . PRO B 1 181 ? 43.963  -49.705 8.723   1.00 24.26 ? 392 PRO B CG    1 
ATOM   4165 C CD    . PRO B 1 181 ? 43.105  -48.782 7.884   1.00 22.44 ? 392 PRO B CD    1 
ATOM   4166 N N     . THR B 1 182 ? 40.918  -49.642 10.870  1.00 23.22 ? 393 THR B N     1 
ATOM   4167 C CA    . THR B 1 182 ? 40.240  -49.737 12.164  1.00 22.89 ? 393 THR B CA    1 
ATOM   4168 C C     . THR B 1 182 ? 38.762  -49.334 12.111  1.00 21.55 ? 393 THR B C     1 
ATOM   4169 O O     . THR B 1 182 ? 38.130  -49.224 13.158  1.00 22.07 ? 393 THR B O     1 
ATOM   4170 C CB    . THR B 1 182 ? 40.941  -48.895 13.218  1.00 23.26 ? 393 THR B CB    1 
ATOM   4171 O OG1   . THR B 1 182 ? 41.091  -47.572 12.715  1.00 25.10 ? 393 THR B OG1   1 
ATOM   4172 C CG2   . THR B 1 182 ? 42.339  -49.478 13.551  1.00 23.83 ? 393 THR B CG2   1 
ATOM   4173 N N     . HIS B 1 183 ? 38.234  -49.091 10.908  1.00 19.37 ? 394 HIS B N     1 
ATOM   4174 C CA    . HIS B 1 183 ? 36.827  -48.759 10.693  1.00 17.83 ? 394 HIS B CA    1 
ATOM   4175 C C     . HIS B 1 183 ? 36.173  -49.912 9.925   1.00 17.13 ? 394 HIS B C     1 
ATOM   4176 O O     . HIS B 1 183 ? 35.512  -49.705 8.914   1.00 16.73 ? 394 HIS B O     1 
ATOM   4177 C CB    . HIS B 1 183 ? 36.698  -47.401 9.959   1.00 17.34 ? 394 HIS B CB    1 
ATOM   4178 C CG    . HIS B 1 183 ? 37.360  -46.267 10.692  1.00 16.18 ? 394 HIS B CG    1 
ATOM   4179 N ND1   . HIS B 1 183 ? 37.833  -45.138 10.063  1.00 14.75 ? 394 HIS B ND1   1 
ATOM   4180 C CD2   . HIS B 1 183 ? 37.662  -46.114 12.007  1.00 17.25 ? 394 HIS B CD2   1 
ATOM   4181 C CE1   . HIS B 1 183 ? 38.387  -44.333 10.955  1.00 15.60 ? 394 HIS B CE1   1 
ATOM   4182 N NE2   . HIS B 1 183 ? 38.316  -44.911 12.142  1.00 15.69 ? 394 HIS B NE2   1 
ATOM   4183 N N     . SER B 1 184 ? 36.377  -51.139 10.421  1.00 16.46 ? 395 SER B N     1 
ATOM   4184 C CA    . SER B 1 184 ? 36.022  -52.345 9.675   1.00 16.66 ? 395 SER B CA    1 
ATOM   4185 C C     . SER B 1 184 ? 34.600  -52.819 9.884   1.00 16.23 ? 395 SER B C     1 
ATOM   4186 O O     . SER B 1 184 ? 34.205  -53.862 9.320   1.00 15.86 ? 395 SER B O     1 
ATOM   4187 C CB    . SER B 1 184 ? 36.966  -53.491 10.041  1.00 17.35 ? 395 SER B CB    1 
ATOM   4188 O OG    . SER B 1 184 ? 36.767  -53.856 11.385  1.00 20.48 ? 395 SER B OG    1 
ATOM   4189 N N     . ASP B 1 185 ? 33.811  -52.067 10.655  1.00 14.98 ? 396 ASP B N     1 
ATOM   4190 C CA    . ASP B 1 185 ? 32.420  -52.423 10.897  1.00 14.32 ? 396 ASP B CA    1 
ATOM   4191 C C     . ASP B 1 185 ? 31.480  -52.119 9.706   1.00 13.69 ? 396 ASP B C     1 
ATOM   4192 O O     . ASP B 1 185 ? 30.297  -52.441 9.738   1.00 12.09 ? 396 ASP B O     1 
ATOM   4193 C CB    . ASP B 1 185 ? 31.932  -51.745 12.183  1.00 14.93 ? 396 ASP B CB    1 
ATOM   4194 C CG    . ASP B 1 185 ? 32.058  -50.209 12.138  1.00 15.95 ? 396 ASP B CG    1 
ATOM   4195 O OD1   . ASP B 1 185 ? 33.189  -49.697 11.974  1.00 14.71 ? 396 ASP B OD1   1 
ATOM   4196 O OD2   . ASP B 1 185 ? 31.024  -49.528 12.302  1.00 16.54 ? 396 ASP B OD2   1 
ATOM   4197 N N     . TYR B 1 186 ? 31.998  -51.495 8.653   1.00 13.38 ? 397 TYR B N     1 
ATOM   4198 C CA    . TYR B 1 186 ? 31.228  -51.305 7.431   1.00 13.83 ? 397 TYR B CA    1 
ATOM   4199 C C     . TYR B 1 186 ? 32.130  -51.155 6.209   1.00 13.19 ? 397 TYR B C     1 
ATOM   4200 O O     . TYR B 1 186 ? 33.304  -50.879 6.333   1.00 13.65 ? 397 TYR B O     1 
ATOM   4201 C CB    . TYR B 1 186 ? 30.293  -50.072 7.544   1.00 14.50 ? 397 TYR B CB    1 
ATOM   4202 C CG    . TYR B 1 186 ? 31.046  -48.750 7.773   1.00 14.41 ? 397 TYR B CG    1 
ATOM   4203 C CD1   . TYR B 1 186 ? 31.419  -47.930 6.704   1.00 14.42 ? 397 TYR B CD1   1 
ATOM   4204 C CD2   . TYR B 1 186 ? 31.361  -48.328 9.049   1.00 14.05 ? 397 TYR B CD2   1 
ATOM   4205 C CE1   . TYR B 1 186 ? 32.120  -46.719 6.903   1.00 13.97 ? 397 TYR B CE1   1 
ATOM   4206 C CE2   . TYR B 1 186 ? 32.065  -47.109 9.267   1.00 15.18 ? 397 TYR B CE2   1 
ATOM   4207 C CZ    . TYR B 1 186 ? 32.451  -46.326 8.191   1.00 12.76 ? 397 TYR B CZ    1 
ATOM   4208 O OH    . TYR B 1 186 ? 33.148  -45.154 8.413   1.00 14.12 ? 397 TYR B OH    1 
ATOM   4209 N N     . THR B 1 187 ? 31.546  -51.346 5.035   1.00 13.76 ? 398 THR B N     1 
ATOM   4210 C CA    . THR B 1 187 ? 32.138  -50.863 3.790   1.00 14.48 ? 398 THR B CA    1 
ATOM   4211 C C     . THR B 1 187 ? 31.151  -49.870 3.204   1.00 14.38 ? 398 THR B C     1 
ATOM   4212 O O     . THR B 1 187 ? 30.005  -49.771 3.668   1.00 14.19 ? 398 THR B O     1 
ATOM   4213 C CB    . THR B 1 187 ? 32.377  -51.973 2.777   1.00 14.10 ? 398 THR B CB    1 
ATOM   4214 O OG1   . THR B 1 187 ? 31.126  -52.528 2.371   1.00 15.70 ? 398 THR B OG1   1 
ATOM   4215 C CG2   . THR B 1 187 ? 33.322  -53.094 3.346   1.00 15.58 ? 398 THR B CG2   1 
ATOM   4216 N N     . MET B 1 188 ? 31.601  -49.144 2.181   1.00 14.20 ? 399 MET B N     1 
ATOM   4217 C CA    . MET B 1 188 ? 30.819  -48.108 1.562   1.00 14.30 ? 399 MET B CA    1 
ATOM   4218 C C     . MET B 1 188 ? 30.672  -48.411 0.074   1.00 14.22 ? 399 MET B C     1 
ATOM   4219 O O     . MET B 1 188 ? 31.634  -48.872 -0.555  1.00 13.53 ? 399 MET B O     1 
ATOM   4220 C CB    . MET B 1 188 ? 31.525  -46.763 1.758   1.00 14.18 ? 399 MET B CB    1 
ATOM   4221 C CG    . MET B 1 188 ? 31.399  -46.246 3.181   1.00 14.54 ? 399 MET B CG    1 
ATOM   4222 S SD    . MET B 1 188 ? 32.054  -44.591 3.459   1.00 14.48 ? 399 MET B SD    1 
ATOM   4223 C CE    . MET B 1 188 ? 33.783  -44.949 3.584   1.00 9.10  ? 399 MET B CE    1 
ATOM   4224 N N     . THR B 1 189 ? 29.473  -48.139 -0.454  1.00 13.69 ? 400 THR B N     1 
ATOM   4225 C CA    . THR B 1 189 ? 29.167  -48.281 -1.869  1.00 13.76 ? 400 THR B CA    1 
ATOM   4226 C C     . THR B 1 189 ? 28.700  -46.914 -2.355  1.00 13.90 ? 400 THR B C     1 
ATOM   4227 O O     . THR B 1 189 ? 27.815  -46.314 -1.756  1.00 13.72 ? 400 THR B O     1 
ATOM   4228 C CB    . THR B 1 189 ? 28.114  -49.357 -2.114  1.00 13.45 ? 400 THR B CB    1 
ATOM   4229 O OG1   . THR B 1 189 ? 28.615  -50.595 -1.616  1.00 12.55 ? 400 THR B OG1   1 
ATOM   4230 C CG2   . THR B 1 189 ? 27.806  -49.537 -3.611  1.00 15.23 ? 400 THR B CG2   1 
ATOM   4231 N N     . LEU B 1 190 ? 29.356  -46.404 -3.390  1.00 14.10 ? 401 LEU B N     1 
ATOM   4232 C CA    . LEU B 1 190 ? 28.998  -45.107 -3.962  1.00 15.38 ? 401 LEU B CA    1 
ATOM   4233 C C     . LEU B 1 190 ? 27.771  -45.253 -4.851  1.00 15.51 ? 401 LEU B C     1 
ATOM   4234 O O     . LEU B 1 190 ? 27.815  -45.915 -5.898  1.00 15.14 ? 401 LEU B O     1 
ATOM   4235 C CB    . LEU B 1 190 ? 30.188  -44.541 -4.743  1.00 15.46 ? 401 LEU B CB    1 
ATOM   4236 C CG    . LEU B 1 190 ? 30.102  -43.092 -5.244  1.00 15.76 ? 401 LEU B CG    1 
ATOM   4237 C CD1   . LEU B 1 190 ? 29.728  -42.087 -4.107  1.00 12.74 ? 401 LEU B CD1   1 
ATOM   4238 C CD2   . LEU B 1 190 ? 31.424  -42.688 -5.934  1.00 13.78 ? 401 LEU B CD2   1 
ATOM   4239 N N     . LEU B 1 191 ? 26.660  -44.653 -4.438  1.00 15.41 ? 402 LEU B N     1 
ATOM   4240 C CA    . LEU B 1 191 ? 25.413  -44.743 -5.191  1.00 15.87 ? 402 LEU B CA    1 
ATOM   4241 C C     . LEU B 1 191 ? 25.324  -43.653 -6.244  1.00 16.91 ? 402 LEU B C     1 
ATOM   4242 O O     . LEU B 1 191 ? 24.873  -43.880 -7.359  1.00 16.29 ? 402 LEU B O     1 
ATOM   4243 C CB    . LEU B 1 191 ? 24.207  -44.622 -4.255  1.00 16.08 ? 402 LEU B CB    1 
ATOM   4244 C CG    . LEU B 1 191 ? 24.062  -45.651 -3.112  1.00 17.59 ? 402 LEU B CG    1 
ATOM   4245 C CD1   . LEU B 1 191 ? 22.826  -45.340 -2.277  1.00 19.12 ? 402 LEU B CD1   1 
ATOM   4246 C CD2   . LEU B 1 191 ? 23.992  -47.085 -3.626  1.00 16.48 ? 402 LEU B CD2   1 
ATOM   4247 N N     . ASP B 1 192 ? 25.717  -42.436 -5.881  1.00 17.56 ? 403 ASP B N     1 
ATOM   4248 C CA    . ASP B 1 192 ? 25.706  -41.373 -6.841  1.00 18.05 ? 403 ASP B CA    1 
ATOM   4249 C C     . ASP B 1 192 ? 26.714  -40.301 -6.451  1.00 17.00 ? 403 ASP B C     1 
ATOM   4250 O O     . ASP B 1 192 ? 27.266  -40.328 -5.350  1.00 17.02 ? 403 ASP B O     1 
ATOM   4251 C CB    . ASP B 1 192 ? 24.294  -40.814 -6.982  1.00 18.76 ? 403 ASP B CB    1 
ATOM   4252 C CG    . ASP B 1 192 ? 23.855  -40.722 -8.424  1.00 24.20 ? 403 ASP B CG    1 
ATOM   4253 O OD1   . ASP B 1 192 ? 24.760  -40.762 -9.293  1.00 29.62 ? 403 ASP B OD1   1 
ATOM   4254 O OD2   . ASP B 1 192 ? 22.630  -40.599 -8.679  1.00 26.95 ? 403 ASP B OD2   1 
ATOM   4255 N N     . LEU B 1 193 ? 26.973  -39.393 -7.381  1.00 15.65 ? 404 LEU B N     1 
ATOM   4256 C CA    . LEU B 1 193 ? 28.010  -38.412 -7.228  1.00 14.89 ? 404 LEU B CA    1 
ATOM   4257 C C     . LEU B 1 193 ? 27.525  -37.122 -7.837  1.00 14.77 ? 404 LEU B C     1 
ATOM   4258 O O     . LEU B 1 193 ? 26.969  -37.128 -8.961  1.00 14.29 ? 404 LEU B O     1 
ATOM   4259 C CB    . LEU B 1 193 ? 29.288  -38.912 -7.889  1.00 15.15 ? 404 LEU B CB    1 
ATOM   4260 C CG    . LEU B 1 193 ? 30.522  -38.012 -7.753  1.00 15.07 ? 404 LEU B CG    1 
ATOM   4261 C CD1   . LEU B 1 193 ? 30.922  -37.897 -6.290  1.00 14.41 ? 404 LEU B CD1   1 
ATOM   4262 C CD2   . LEU B 1 193 ? 31.681  -38.554 -8.612  1.00 13.83 ? 404 LEU B CD2   1 
ATOM   4263 N N     . PHE B 1 194 ? 27.675  -36.027 -7.081  1.00 14.04 ? 405 PHE B N     1 
ATOM   4264 C CA    . PHE B 1 194 ? 27.226  -34.707 -7.543  1.00 15.03 ? 405 PHE B CA    1 
ATOM   4265 C C     . PHE B 1 194 ? 28.361  -33.732 -7.454  1.00 16.00 ? 405 PHE B C     1 
ATOM   4266 O O     . PHE B 1 194 ? 29.141  -33.773 -6.502  1.00 15.96 ? 405 PHE B O     1 
ATOM   4267 C CB    . PHE B 1 194 ? 26.045  -34.178 -6.748  1.00 14.91 ? 405 PHE B CB    1 
ATOM   4268 C CG    . PHE B 1 194 ? 24.894  -35.104 -6.705  1.00 13.96 ? 405 PHE B CG    1 
ATOM   4269 C CD1   . PHE B 1 194 ? 23.816  -34.925 -7.562  1.00 13.20 ? 405 PHE B CD1   1 
ATOM   4270 C CD2   . PHE B 1 194 ? 24.858  -36.136 -5.786  1.00 11.93 ? 405 PHE B CD2   1 
ATOM   4271 C CE1   . PHE B 1 194 ? 22.737  -35.785 -7.531  1.00 12.53 ? 405 PHE B CE1   1 
ATOM   4272 C CE2   . PHE B 1 194 ? 23.780  -36.995 -5.744  1.00 13.18 ? 405 PHE B CE2   1 
ATOM   4273 C CZ    . PHE B 1 194 ? 22.731  -36.835 -6.631  1.00 14.42 ? 405 PHE B CZ    1 
ATOM   4274 N N     . GLU B 1 195 ? 28.495  -32.898 -8.485  1.00 16.29 ? 406 GLU B N     1 
ATOM   4275 C CA    . GLU B 1 195 ? 29.427  -31.792 -8.427  1.00 17.27 ? 406 GLU B CA    1 
ATOM   4276 C C     . GLU B 1 195 ? 28.737  -30.663 -7.684  1.00 16.35 ? 406 GLU B C     1 
ATOM   4277 O O     . GLU B 1 195 ? 27.599  -30.375 -7.940  1.00 16.64 ? 406 GLU B O     1 
ATOM   4278 C CB    . GLU B 1 195 ? 29.807  -31.348 -9.836  1.00 18.27 ? 406 GLU B CB    1 
ATOM   4279 C CG    . GLU B 1 195 ? 30.561  -30.033 -9.946  1.00 21.71 ? 406 GLU B CG    1 
ATOM   4280 C CD    . GLU B 1 195 ? 30.797  -29.678 -11.415 1.00 25.78 ? 406 GLU B CD    1 
ATOM   4281 O OE1   . GLU B 1 195 ? 29.910  -29.044 -12.011 1.00 27.40 ? 406 GLU B OE1   1 
ATOM   4282 O OE2   . GLU B 1 195 ? 31.832  -30.109 -11.979 1.00 31.44 ? 406 GLU B OE2   1 
ATOM   4283 N N     . VAL B 1 196 ? 29.452  -30.023 -6.775  1.00 15.58 ? 407 VAL B N     1 
ATOM   4284 C CA    . VAL B 1 196 ? 28.881  -28.980 -5.933  1.00 14.80 ? 407 VAL B CA    1 
ATOM   4285 C C     . VAL B 1 196 ? 29.483  -27.648 -6.358  1.00 14.59 ? 407 VAL B C     1 
ATOM   4286 O O     . VAL B 1 196 ? 30.672  -27.555 -6.532  1.00 13.70 ? 407 VAL B O     1 
ATOM   4287 C CB    . VAL B 1 196 ? 29.190  -29.244 -4.446  1.00 14.93 ? 407 VAL B CB    1 
ATOM   4288 C CG1   . VAL B 1 196 ? 28.568  -28.157 -3.560  1.00 14.15 ? 407 VAL B CG1   1 
ATOM   4289 C CG2   . VAL B 1 196 ? 28.705  -30.632 -4.046  1.00 13.59 ? 407 VAL B CG2   1 
ATOM   4290 N N     . GLU B 1 197 ? 28.643  -26.642 -6.564  1.00 15.27 ? 408 GLU B N     1 
ATOM   4291 C CA    . GLU B 1 197 ? 29.118  -25.293 -6.861  1.00 16.76 ? 408 GLU B CA    1 
ATOM   4292 C C     . GLU B 1 197 ? 28.271  -24.333 -6.034  1.00 16.51 ? 408 GLU B C     1 
ATOM   4293 O O     . GLU B 1 197 ? 27.160  -23.940 -6.444  1.00 16.24 ? 408 GLU B O     1 
ATOM   4294 C CB    . GLU B 1 197 ? 29.027  -24.999 -8.371  1.00 17.15 ? 408 GLU B CB    1 
ATOM   4295 C CG    . GLU B 1 197 ? 29.526  -23.616 -8.731  1.00 20.79 ? 408 GLU B CG    1 
ATOM   4296 C CD    . GLU B 1 197 ? 29.812  -23.448 -10.208 1.00 25.62 ? 408 GLU B CD    1 
ATOM   4297 O OE1   . GLU B 1 197 ? 30.517  -22.482 -10.534 1.00 28.01 ? 408 GLU B OE1   1 
ATOM   4298 O OE2   . GLU B 1 197 ? 29.316  -24.263 -11.039 1.00 29.55 ? 408 GLU B OE2   1 
ATOM   4299 N N     . LYS B 1 198 ? 28.765  -24.047 -4.825  1.00 16.94 ? 409 LYS B N     1 
ATOM   4300 C CA    . LYS B 1 198 ? 28.126  -23.093 -3.922  1.00 17.90 ? 409 LYS B CA    1 
ATOM   4301 C C     . LYS B 1 198 ? 28.411  -21.665 -4.374  1.00 17.89 ? 409 LYS B C     1 
ATOM   4302 O O     . LYS B 1 198 ? 29.561  -21.307 -4.565  1.00 18.00 ? 409 LYS B O     1 
ATOM   4303 C CB    . LYS B 1 198 ? 28.633  -23.267 -2.482  1.00 17.93 ? 409 LYS B CB    1 
ATOM   4304 C CG    . LYS B 1 198 ? 28.034  -22.286 -1.469  1.00 19.51 ? 409 LYS B CG    1 
ATOM   4305 C CD    . LYS B 1 198 ? 26.534  -22.370 -1.399  1.00 21.82 ? 409 LYS B CD    1 
ATOM   4306 C CE    . LYS B 1 198 ? 25.967  -21.344 -0.431  1.00 24.23 ? 409 LYS B CE    1 
ATOM   4307 N NZ    . LYS B 1 198 ? 24.489  -21.177 -0.508  1.00 24.95 ? 409 LYS B NZ    1 
ATOM   4308 N N     . ASP B 1 199 ? 27.362  -20.866 -4.497  1.00 19.58 ? 410 ASP B N     1 
ATOM   4309 C CA    . ASP B 1 199 ? 27.479  -19.440 -4.829  1.00 21.13 ? 410 ASP B CA    1 
ATOM   4310 C C     . ASP B 1 199 ? 28.496  -18.746 -3.908  1.00 21.16 ? 410 ASP B C     1 
ATOM   4311 O O     . ASP B 1 199 ? 28.403  -18.847 -2.678  1.00 21.20 ? 410 ASP B O     1 
ATOM   4312 C CB    . ASP B 1 199 ? 26.116  -18.732 -4.693  1.00 22.24 ? 410 ASP B CB    1 
ATOM   4313 C CG    . ASP B 1 199 ? 25.040  -19.307 -5.624  1.00 25.53 ? 410 ASP B CG    1 
ATOM   4314 O OD1   . ASP B 1 199 ? 25.346  -20.197 -6.443  1.00 30.37 ? 410 ASP B OD1   1 
ATOM   4315 O OD2   . ASP B 1 199 ? 23.883  -18.855 -5.545  1.00 29.29 ? 410 ASP B OD2   1 
ATOM   4316 N N     . GLY B 1 200 ? 29.476  -18.082 -4.510  1.00 21.09 ? 411 GLY B N     1 
ATOM   4317 C CA    . GLY B 1 200 ? 30.431  -17.236 -3.785  1.00 21.43 ? 411 GLY B CA    1 
ATOM   4318 C C     . GLY B 1 200 ? 31.762  -17.900 -3.479  1.00 22.03 ? 411 GLY B C     1 
ATOM   4319 O O     . GLY B 1 200 ? 32.799  -17.225 -3.324  1.00 22.17 ? 411 GLY B O     1 
ATOM   4320 N N     . GLU B 1 201 ? 31.757  -19.231 -3.387  1.00 21.96 ? 412 GLU B N     1 
ATOM   4321 C CA    . GLU B 1 201 ? 32.930  -19.937 -2.891  1.00 22.13 ? 412 GLU B CA    1 
ATOM   4322 C C     . GLU B 1 201 ? 34.140  -19.867 -3.802  1.00 22.52 ? 412 GLU B C     1 
ATOM   4323 O O     . GLU B 1 201 ? 35.260  -19.782 -3.329  1.00 22.55 ? 412 GLU B O     1 
ATOM   4324 C CB    . GLU B 1 201 ? 32.589  -21.402 -2.559  1.00 21.84 ? 412 GLU B CB    1 
ATOM   4325 C CG    . GLU B 1 201 ? 31.941  -21.572 -1.197  1.00 20.31 ? 412 GLU B CG    1 
ATOM   4326 C CD    . GLU B 1 201 ? 32.007  -23.001 -0.691  1.00 19.40 ? 412 GLU B CD    1 
ATOM   4327 O OE1   . GLU B 1 201 ? 32.125  -23.943 -1.514  1.00 14.46 ? 412 GLU B OE1   1 
ATOM   4328 O OE2   . GLU B 1 201 ? 31.933  -23.170 0.531   1.00 18.62 ? 412 GLU B OE2   1 
ATOM   4329 N N     . LYS B 1 202 ? 33.907  -19.902 -5.101  1.00 23.61 ? 413 LYS B N     1 
ATOM   4330 C CA    . LYS B 1 202 ? 34.987  -19.890 -6.102  1.00 24.61 ? 413 LYS B CA    1 
ATOM   4331 C C     . LYS B 1 202 ? 35.742  -18.559 -6.015  1.00 24.92 ? 413 LYS B C     1 
ATOM   4332 O O     . LYS B 1 202 ? 36.980  -18.512 -5.933  1.00 25.12 ? 413 LYS B O     1 
ATOM   4333 C CB    . LYS B 1 202 ? 34.344  -20.089 -7.486  1.00 25.36 ? 413 LYS B CB    1 
ATOM   4334 C CG    . LYS B 1 202 ? 35.285  -20.355 -8.665  1.00 28.45 ? 413 LYS B CG    1 
ATOM   4335 C CD    . LYS B 1 202 ? 34.587  -20.008 -9.996  1.00 31.87 ? 413 LYS B CD    1 
ATOM   4336 C CE    . LYS B 1 202 ? 35.380  -20.485 -11.222 1.00 34.54 ? 413 LYS B CE    1 
ATOM   4337 N NZ    . LYS B 1 202 ? 36.842  -20.125 -11.152 1.00 35.66 ? 413 LYS B NZ    1 
ATOM   4338 N N     . GLU B 1 203 ? 34.965  -17.485 -5.984  1.00 25.32 ? 414 GLU B N     1 
ATOM   4339 C CA    . GLU B 1 203 ? 35.470  -16.116 -5.894  1.00 25.86 ? 414 GLU B CA    1 
ATOM   4340 C C     . GLU B 1 203 ? 36.201  -15.868 -4.565  1.00 25.15 ? 414 GLU B C     1 
ATOM   4341 O O     . GLU B 1 203 ? 37.257  -15.242 -4.545  1.00 25.70 ? 414 GLU B O     1 
ATOM   4342 C CB    . GLU B 1 203 ? 34.302  -15.123 -6.027  1.00 26.54 ? 414 GLU B CB    1 
ATOM   4343 C CG    . GLU B 1 203 ? 33.604  -15.099 -7.387  1.00 28.44 ? 414 GLU B CG    1 
ATOM   4344 C CD    . GLU B 1 203 ? 32.777  -16.366 -7.717  1.00 31.87 ? 414 GLU B CD    1 
ATOM   4345 O OE1   . GLU B 1 203 ? 32.191  -17.016 -6.806  1.00 31.43 ? 414 GLU B OE1   1 
ATOM   4346 O OE2   . GLU B 1 203 ? 32.729  -16.706 -8.917  1.00 32.45 ? 414 GLU B OE2   1 
ATOM   4347 N N     . ALA B 1 204 ? 35.673  -16.388 -3.458  1.00 23.66 ? 415 ALA B N     1 
ATOM   4348 C CA    . ALA B 1 204 ? 36.269  -16.098 -2.149  1.00 22.65 ? 415 ALA B CA    1 
ATOM   4349 C C     . ALA B 1 204 ? 37.504  -16.948 -1.864  1.00 21.88 ? 415 ALA B C     1 
ATOM   4350 O O     . ALA B 1 204 ? 38.345  -16.561 -1.058  1.00 21.49 ? 415 ALA B O     1 
ATOM   4351 C CB    . ALA B 1 204 ? 35.209  -16.265 -1.021  1.00 22.71 ? 415 ALA B CB    1 
ATOM   4352 N N     . PHE B 1 205 ? 37.651  -18.070 -2.568  1.00 20.82 ? 416 PHE B N     1 
ATOM   4353 C CA    . PHE B 1 205 ? 38.649  -19.097 -2.229  1.00 20.48 ? 416 PHE B CA    1 
ATOM   4354 C C     . PHE B 1 205 ? 40.115  -18.635 -2.226  1.00 20.71 ? 416 PHE B C     1 
ATOM   4355 O O     . PHE B 1 205 ? 40.537  -17.892 -3.102  1.00 21.01 ? 416 PHE B O     1 
ATOM   4356 C CB    . PHE B 1 205 ? 38.473  -20.298 -3.197  1.00 20.17 ? 416 PHE B CB    1 
ATOM   4357 C CG    . PHE B 1 205 ? 39.309  -21.514 -2.851  1.00 19.52 ? 416 PHE B CG    1 
ATOM   4358 C CD1   . PHE B 1 205 ? 39.101  -22.215 -1.659  1.00 17.81 ? 416 PHE B CD1   1 
ATOM   4359 C CD2   . PHE B 1 205 ? 40.278  -21.986 -3.745  1.00 18.53 ? 416 PHE B CD2   1 
ATOM   4360 C CE1   . PHE B 1 205 ? 39.881  -23.348 -1.333  1.00 16.61 ? 416 PHE B CE1   1 
ATOM   4361 C CE2   . PHE B 1 205 ? 41.056  -23.106 -3.431  1.00 20.97 ? 416 PHE B CE2   1 
ATOM   4362 C CZ    . PHE B 1 205 ? 40.855  -23.787 -2.213  1.00 19.47 ? 416 PHE B CZ    1 
ATOM   4363 N N     . ARG B 1 206 ? 40.904  -19.109 -1.267  1.00 20.78 ? 417 ARG B N     1 
ATOM   4364 C CA    . ARG B 1 206 ? 42.337  -18.801 -1.236  1.00 21.16 ? 417 ARG B CA    1 
ATOM   4365 C C     . ARG B 1 206 ? 43.124  -19.649 -2.253  1.00 21.56 ? 417 ARG B C     1 
ATOM   4366 O O     . ARG B 1 206 ? 43.897  -20.524 -1.883  1.00 22.30 ? 417 ARG B O     1 
ATOM   4367 C CB    . ARG B 1 206 ? 42.912  -18.953 0.169   1.00 20.59 ? 417 ARG B CB    1 
ATOM   4368 C CG    . ARG B 1 206 ? 42.426  -17.886 1.173   1.00 20.98 ? 417 ARG B CG    1 
ATOM   4369 C CD    . ARG B 1 206 ? 42.975  -16.476 0.847   1.00 21.27 ? 417 ARG B CD    1 
ATOM   4370 N NE    . ARG B 1 206 ? 44.440  -16.404 0.812   1.00 19.44 ? 417 ARG B NE    1 
ATOM   4371 C CZ    . ARG B 1 206 ? 45.229  -16.241 1.868   1.00 22.33 ? 417 ARG B CZ    1 
ATOM   4372 N NH1   . ARG B 1 206 ? 44.720  -16.144 3.090   1.00 22.31 ? 417 ARG B NH1   1 
ATOM   4373 N NH2   . ARG B 1 206 ? 46.552  -16.159 1.709   1.00 23.24 ? 417 ARG B NH2   1 
ATOM   4374 N N     . GLU B 1 207 ? 42.945  -19.319 -3.529  1.00 23.78 ? 418 GLU B N     1 
ATOM   4375 C CA    . GLU B 1 207 ? 43.662  -19.948 -4.659  1.00 25.33 ? 418 GLU B CA    1 
ATOM   4376 C C     . GLU B 1 207 ? 45.170  -19.856 -4.506  1.00 25.14 ? 418 GLU B C     1 
ATOM   4377 O O     . GLU B 1 207 ? 45.895  -20.767 -4.932  1.00 25.13 ? 418 GLU B O     1 
ATOM   4378 C CB    . GLU B 1 207 ? 43.287  -19.288 -5.991  1.00 26.16 ? 418 GLU B CB    1 
ATOM   4379 C CG    . GLU B 1 207 ? 41.810  -19.393 -6.361  1.00 31.09 ? 418 GLU B CG    1 
ATOM   4380 C CD    . GLU B 1 207 ? 41.533  -19.164 -7.867  1.00 36.55 ? 418 GLU B CD    1 
ATOM   4381 O OE1   . GLU B 1 207 ? 40.763  -18.231 -8.198  1.00 39.15 ? 418 GLU B OE1   1 
ATOM   4382 O OE2   . GLU B 1 207 ? 42.077  -19.924 -8.714  1.00 40.84 ? 418 GLU B OE2   1 
ATOM   4383 N N     . ASP B 1 208 ? 45.647  -18.758 -3.925  1.00 24.61 ? 419 ASP B N     1 
ATOM   4384 C CA    . ASP B 1 208 ? 47.090  -18.517 -3.777  1.00 24.08 ? 419 ASP B CA    1 
ATOM   4385 C C     . ASP B 1 208 ? 47.830  -19.532 -2.939  1.00 23.94 ? 419 ASP B C     1 
ATOM   4386 O O     . ASP B 1 208 ? 49.013  -19.807 -3.188  1.00 24.29 ? 419 ASP B O     1 
ATOM   4387 C CB    . ASP B 1 208 ? 47.374  -17.105 -3.227  1.00 24.52 ? 419 ASP B CB    1 
ATOM   4388 C CG    . ASP B 1 208 ? 46.750  -16.856 -1.852  1.00 24.68 ? 419 ASP B CG    1 
ATOM   4389 O OD1   . ASP B 1 208 ? 45.582  -17.251 -1.611  1.00 28.48 ? 419 ASP B OD1   1 
ATOM   4390 O OD2   . ASP B 1 208 ? 47.424  -16.236 -1.016  1.00 25.97 ? 419 ASP B OD2   1 
ATOM   4391 N N     . LEU B 1 209 ? 47.167  -20.116 -1.950  1.00 22.76 ? 420 LEU B N     1 
ATOM   4392 C CA    . LEU B 1 209 ? 47.901  -20.922 -0.999  1.00 22.10 ? 420 LEU B CA    1 
ATOM   4393 C C     . LEU B 1 209 ? 48.360  -22.227 -1.634  1.00 21.42 ? 420 LEU B C     1 
ATOM   4394 O O     . LEU B 1 209 ? 47.650  -22.820 -2.434  1.00 19.97 ? 420 LEU B O     1 
ATOM   4395 C CB    . LEU B 1 209 ? 47.070  -21.179 0.275   1.00 21.93 ? 420 LEU B CB    1 
ATOM   4396 C CG    . LEU B 1 209 ? 46.837  -19.931 1.144   1.00 22.71 ? 420 LEU B CG    1 
ATOM   4397 C CD1   . LEU B 1 209 ? 45.816  -20.165 2.266   1.00 22.81 ? 420 LEU B CD1   1 
ATOM   4398 C CD2   . LEU B 1 209 ? 48.161  -19.459 1.739   1.00 22.27 ? 420 LEU B CD2   1 
ATOM   4399 N N     . HIS B 1 210 ? 49.568  -22.635 -1.267  1.00 21.12 ? 421 HIS B N     1 
ATOM   4400 C CA    . HIS B 1 210 ? 50.084  -23.958 -1.593  1.00 21.27 ? 421 HIS B CA    1 
ATOM   4401 C C     . HIS B 1 210 ? 49.398  -25.071 -0.771  1.00 21.52 ? 421 HIS B C     1 
ATOM   4402 O O     . HIS B 1 210 ? 48.636  -24.810 0.187   1.00 20.36 ? 421 HIS B O     1 
ATOM   4403 C CB    . HIS B 1 210 ? 51.593  -24.011 -1.359  1.00 21.69 ? 421 HIS B CB    1 
ATOM   4404 C CG    . HIS B 1 210 ? 52.016  -23.623 0.023   1.00 21.83 ? 421 HIS B CG    1 
ATOM   4405 N ND1   . HIS B 1 210 ? 51.908  -22.328 0.503   1.00 25.36 ? 421 HIS B ND1   1 
ATOM   4406 C CD2   . HIS B 1 210 ? 52.575  -24.351 1.020   1.00 23.29 ? 421 HIS B CD2   1 
ATOM   4407 C CE1   . HIS B 1 210 ? 52.378  -22.282 1.738   1.00 25.54 ? 421 HIS B CE1   1 
ATOM   4408 N NE2   . HIS B 1 210 ? 52.788  -23.496 2.076   1.00 25.02 ? 421 HIS B NE2   1 
ATOM   4409 N N     . ASN B 1 211 ? 49.662  -26.312 -1.156  1.00 21.41 ? 422 ASN B N     1 
ATOM   4410 C CA    . ASN B 1 211 ? 49.171  -27.447 -0.403  1.00 21.63 ? 422 ASN B CA    1 
ATOM   4411 C C     . ASN B 1 211 ? 47.630  -27.437 -0.463  1.00 21.06 ? 422 ASN B C     1 
ATOM   4412 O O     . ASN B 1 211 ? 46.930  -27.563 0.551   1.00 21.65 ? 422 ASN B O     1 
ATOM   4413 C CB    . ASN B 1 211 ? 49.719  -27.366 1.028   1.00 22.52 ? 422 ASN B CB    1 
ATOM   4414 C CG    . ASN B 1 211 ? 49.610  -28.660 1.779   1.00 24.62 ? 422 ASN B CG    1 
ATOM   4415 O OD1   . ASN B 1 211 ? 49.384  -29.722 1.190   1.00 30.31 ? 422 ASN B OD1   1 
ATOM   4416 N ND2   . ASN B 1 211 ? 49.765  -28.586 3.097   1.00 23.82 ? 422 ASN B ND2   1 
ATOM   4417 N N     . ARG B 1 212 ? 47.099  -27.268 -1.668  1.00 19.31 ? 423 ARG B N     1 
ATOM   4418 C CA    . ARG B 1 212 ? 45.681  -27.452 -1.886  1.00 19.13 ? 423 ARG B CA    1 
ATOM   4419 C C     . ARG B 1 212 ? 45.369  -28.954 -2.042  1.00 18.07 ? 423 ARG B C     1 
ATOM   4420 O O     . ARG B 1 212 ? 45.908  -29.624 -2.919  1.00 16.84 ? 423 ARG B O     1 
ATOM   4421 C CB    . ARG B 1 212 ? 45.198  -26.665 -3.085  1.00 18.84 ? 423 ARG B CB    1 
ATOM   4422 C CG    . ARG B 1 212 ? 43.684  -26.547 -3.162  1.00 19.99 ? 423 ARG B CG    1 
ATOM   4423 C CD    . ARG B 1 212 ? 43.269  -26.084 -4.543  1.00 19.96 ? 423 ARG B CD    1 
ATOM   4424 N NE    . ARG B 1 212 ? 43.926  -24.819 -4.857  1.00 22.22 ? 423 ARG B NE    1 
ATOM   4425 C CZ    . ARG B 1 212 ? 43.995  -24.266 -6.071  1.00 25.02 ? 423 ARG B CZ    1 
ATOM   4426 N NH1   . ARG B 1 212 ? 43.468  -24.866 -7.139  1.00 24.16 ? 423 ARG B NH1   1 
ATOM   4427 N NH2   . ARG B 1 212 ? 44.615  -23.098 -6.216  1.00 23.66 ? 423 ARG B NH2   1 
ATOM   4428 N N     . MET B 1 213 ? 44.512  -29.469 -1.157  1.00 16.73 ? 424 MET B N     1 
ATOM   4429 C CA    . MET B 1 213 ? 44.180  -30.895 -1.118  1.00 16.07 ? 424 MET B CA    1 
ATOM   4430 C C     . MET B 1 213 ? 42.674  -31.100 -1.177  1.00 14.56 ? 424 MET B C     1 
ATOM   4431 O O     . MET B 1 213 ? 41.913  -30.268 -0.669  1.00 14.95 ? 424 MET B O     1 
ATOM   4432 C CB    . MET B 1 213 ? 44.718  -31.521 0.165   1.00 16.22 ? 424 MET B CB    1 
ATOM   4433 C CG    . MET B 1 213 ? 46.253  -31.588 0.270   1.00 17.59 ? 424 MET B CG    1 
ATOM   4434 S SD    . MET B 1 213 ? 46.655  -32.538 1.722   1.00 24.12 ? 424 MET B SD    1 
ATOM   4435 C CE    . MET B 1 213 ? 46.753  -34.215 1.019   1.00 19.89 ? 424 MET B CE    1 
ATOM   4436 N N     . LEU B 1 214 ? 42.241  -32.222 -1.741  1.00 13.64 ? 425 LEU B N     1 
ATOM   4437 C CA    . LEU B 1 214 ? 40.824  -32.544 -1.831  1.00 12.41 ? 425 LEU B CA    1 
ATOM   4438 C C     . LEU B 1 214 ? 40.531  -33.464 -0.644  1.00 11.60 ? 425 LEU B C     1 
ATOM   4439 O O     . LEU B 1 214 ? 41.054  -34.597 -0.557  1.00 10.63 ? 425 LEU B O     1 
ATOM   4440 C CB    . LEU B 1 214 ? 40.479  -33.213 -3.161  1.00 11.76 ? 425 LEU B CB    1 
ATOM   4441 C CG    . LEU B 1 214 ? 38.985  -33.381 -3.511  1.00 11.67 ? 425 LEU B CG    1 
ATOM   4442 C CD1   . LEU B 1 214 ? 38.378  -32.099 -3.907  1.00 11.73 ? 425 LEU B CD1   1 
ATOM   4443 C CD2   . LEU B 1 214 ? 38.790  -34.404 -4.647  1.00 10.32 ? 425 LEU B CD2   1 
ATOM   4444 N N     . LEU B 1 215 ? 39.716  -32.980 0.293   1.00 10.43 ? 426 LEU B N     1 
ATOM   4445 C CA    . LEU B 1 215 ? 39.596  -33.681 1.571   1.00 10.34 ? 426 LEU B CA    1 
ATOM   4446 C C     . LEU B 1 215 ? 38.155  -33.924 1.945   1.00 9.53  ? 426 LEU B C     1 
ATOM   4447 O O     . LEU B 1 215 ? 37.256  -33.243 1.464   1.00 10.92 ? 426 LEU B O     1 
ATOM   4448 C CB    . LEU B 1 215 ? 40.295  -32.909 2.690   1.00 10.44 ? 426 LEU B CB    1 
ATOM   4449 C CG    . LEU B 1 215 ? 41.767  -32.578 2.524   1.00 12.04 ? 426 LEU B CG    1 
ATOM   4450 C CD1   . LEU B 1 215 ? 42.185  -31.690 3.697   1.00 8.40  ? 426 LEU B CD1   1 
ATOM   4451 C CD2   . LEU B 1 215 ? 42.644  -33.837 2.465   1.00 11.44 ? 426 LEU B CD2   1 
ATOM   4452 N N     . TRP B 1 216 ? 37.973  -34.910 2.813   1.00 9.08  ? 427 TRP B N     1 
ATOM   4453 C CA    . TRP B 1 216 ? 36.674  -35.390 3.244   1.00 9.64  ? 427 TRP B CA    1 
ATOM   4454 C C     . TRP B 1 216 ? 36.095  -34.596 4.427   1.00 9.35  ? 427 TRP B C     1 
ATOM   4455 O O     . TRP B 1 216 ? 36.811  -34.138 5.309   1.00 9.68  ? 427 TRP B O     1 
ATOM   4456 C CB    . TRP B 1 216 ? 36.766  -36.867 3.698   1.00 10.19 ? 427 TRP B CB    1 
ATOM   4457 C CG    . TRP B 1 216 ? 37.302  -37.849 2.661   1.00 10.08 ? 427 TRP B CG    1 
ATOM   4458 C CD1   . TRP B 1 216 ? 38.531  -38.420 2.646   1.00 9.96  ? 427 TRP B CD1   1 
ATOM   4459 C CD2   . TRP B 1 216 ? 36.578  -38.423 1.566   1.00 9.49  ? 427 TRP B CD2   1 
ATOM   4460 N NE1   . TRP B 1 216 ? 38.643  -39.289 1.596   1.00 10.93 ? 427 TRP B NE1   1 
ATOM   4461 C CE2   . TRP B 1 216 ? 37.456  -39.315 0.914   1.00 10.80 ? 427 TRP B CE2   1 
ATOM   4462 C CE3   . TRP B 1 216 ? 35.290  -38.252 1.062   1.00 10.13 ? 427 TRP B CE3   1 
ATOM   4463 C CZ2   . TRP B 1 216 ? 37.092  -40.025 -0.224  1.00 9.70  ? 427 TRP B CZ2   1 
ATOM   4464 C CZ3   . TRP B 1 216 ? 34.921  -38.950 -0.097  1.00 10.80 ? 427 TRP B CZ3   1 
ATOM   4465 C CH2   . TRP B 1 216 ? 35.826  -39.828 -0.718  1.00 10.86 ? 427 TRP B CH2   1 
ATOM   4466 N N     . HIS B 1 217 ? 34.775  -34.499 4.426   1.00 9.51  ? 428 HIS B N     1 
ATOM   4467 C CA    . HIS B 1 217 ? 34.017  -34.076 5.565   1.00 9.13  ? 428 HIS B CA    1 
ATOM   4468 C C     . HIS B 1 217 ? 32.715  -34.871 5.606   1.00 8.95  ? 428 HIS B C     1 
ATOM   4469 O O     . HIS B 1 217 ? 31.951  -34.910 4.620   1.00 9.23  ? 428 HIS B O     1 
ATOM   4470 C CB    . HIS B 1 217 ? 33.707  -32.600 5.454   1.00 9.51  ? 428 HIS B CB    1 
ATOM   4471 C CG    . HIS B 1 217 ? 32.988  -32.055 6.645   1.00 9.67  ? 428 HIS B CG    1 
ATOM   4472 N ND1   . HIS B 1 217 ? 33.650  -31.560 7.748   1.00 9.12  ? 428 HIS B ND1   1 
ATOM   4473 C CD2   . HIS B 1 217 ? 31.663  -31.988 6.935   1.00 11.90 ? 428 HIS B CD2   1 
ATOM   4474 C CE1   . HIS B 1 217 ? 32.760  -31.161 8.646   1.00 10.38 ? 428 HIS B CE1   1 
ATOM   4475 N NE2   . HIS B 1 217 ? 31.547  -31.426 8.184   1.00 9.61  ? 428 HIS B NE2   1 
ATOM   4476 N N     . GLY B 1 218 ? 32.454  -35.508 6.745   1.00 7.76  ? 429 GLY B N     1 
ATOM   4477 C CA    . GLY B 1 218 ? 31.187  -36.192 6.960   1.00 7.23  ? 429 GLY B CA    1 
ATOM   4478 C C     . GLY B 1 218 ? 30.324  -35.462 7.989   1.00 7.30  ? 429 GLY B C     1 
ATOM   4479 O O     . GLY B 1 218 ? 30.818  -34.723 8.795   1.00 8.02  ? 429 GLY B O     1 
ATOM   4480 N N     . SER B 1 219 ? 29.022  -35.640 7.911   1.00 7.63  ? 430 SER B N     1 
ATOM   4481 C CA    . SER B 1 219 ? 28.107  -35.031 8.850   1.00 8.42  ? 430 SER B CA    1 
ATOM   4482 C C     . SER B 1 219 ? 26.825  -35.834 8.839   1.00 8.74  ? 430 SER B C     1 
ATOM   4483 O O     . SER B 1 219 ? 26.592  -36.617 7.918   1.00 8.20  ? 430 SER B O     1 
ATOM   4484 C CB    . SER B 1 219 ? 27.862  -33.553 8.491   1.00 8.76  ? 430 SER B CB    1 
ATOM   4485 O OG    . SER B 1 219 ? 27.366  -32.845 9.632   1.00 9.50  ? 430 SER B OG    1 
ATOM   4486 N N     . ARG B 1 220 ? 26.021  -35.645 9.894   1.00 8.70  ? 431 ARG B N     1 
ATOM   4487 C CA    . ARG B 1 220 ? 24.739  -36.290 10.055  1.00 9.00  ? 431 ARG B CA    1 
ATOM   4488 C C     . ARG B 1 220 ? 23.799  -35.858 8.941   1.00 9.42  ? 431 ARG B C     1 
ATOM   4489 O O     . ARG B 1 220 ? 23.918  -34.744 8.438   1.00 7.83  ? 431 ARG B O     1 
ATOM   4490 C CB    . ARG B 1 220 ? 24.155  -35.883 11.415  1.00 9.53  ? 431 ARG B CB    1 
ATOM   4491 C CG    . ARG B 1 220 ? 24.881  -36.517 12.564  1.00 10.36 ? 431 ARG B CG    1 
ATOM   4492 C CD    . ARG B 1 220 ? 24.368  -36.044 13.931  1.00 14.20 ? 431 ARG B CD    1 
ATOM   4493 N NE    . ARG B 1 220 ? 25.104  -36.666 15.047  1.00 16.65 ? 431 ARG B NE    1 
ATOM   4494 C CZ    . ARG B 1 220 ? 24.795  -37.840 15.600  1.00 18.11 ? 431 ARG B CZ    1 
ATOM   4495 N NH1   . ARG B 1 220 ? 23.757  -38.560 15.174  1.00 18.37 ? 431 ARG B NH1   1 
ATOM   4496 N NH2   . ARG B 1 220 ? 25.548  -38.310 16.587  1.00 19.79 ? 431 ARG B NH2   1 
ATOM   4497 N N     . MET B 1 221 ? 22.855  -36.729 8.570   1.00 10.43 ? 432 MET B N     1 
ATOM   4498 C CA    . MET B 1 221 ? 21.921  -36.443 7.462   1.00 11.56 ? 432 MET B CA    1 
ATOM   4499 C C     . MET B 1 221 ? 21.081  -35.196 7.693   1.00 10.68 ? 432 MET B C     1 
ATOM   4500 O O     . MET B 1 221 ? 20.593  -34.610 6.737   1.00 11.81 ? 432 MET B O     1 
ATOM   4501 C CB    . MET B 1 221 ? 20.962  -37.608 7.225   1.00 12.00 ? 432 MET B CB    1 
ATOM   4502 C CG    . MET B 1 221 ? 21.532  -38.718 6.348   1.00 15.31 ? 432 MET B CG    1 
ATOM   4503 S SD    . MET B 1 221 ? 21.982  -38.158 4.685   1.00 16.68 ? 432 MET B SD    1 
ATOM   4504 C CE    . MET B 1 221 ? 20.536  -37.265 4.195   1.00 8.68  ? 432 MET B CE    1 
ATOM   4505 N N     . SER B 1 222 ? 20.849  -34.863 8.967   1.00 9.48  ? 433 SER B N     1 
ATOM   4506 C CA    . SER B 1 222 ? 20.111  -33.685 9.376   1.00 8.95  ? 433 SER B CA    1 
ATOM   4507 C C     . SER B 1 222 ? 20.782  -32.381 8.949   1.00 8.92  ? 433 SER B C     1 
ATOM   4508 O O     . SER B 1 222 ? 20.146  -31.315 8.919   1.00 9.67  ? 433 SER B O     1 
ATOM   4509 C CB    . SER B 1 222 ? 19.941  -33.701 10.907  1.00 9.55  ? 433 SER B CB    1 
ATOM   4510 O OG    . SER B 1 222 ? 21.195  -33.661 11.571  1.00 8.33  ? 433 SER B OG    1 
ATOM   4511 N N     . ASN B 1 223 ? 22.076  -32.428 8.682   1.00 8.38  ? 434 ASN B N     1 
ATOM   4512 C CA    . ASN B 1 223 ? 22.849  -31.218 8.582   1.00 8.67  ? 434 ASN B CA    1 
ATOM   4513 C C     . ASN B 1 223 ? 23.074  -30.693 7.154   1.00 9.43  ? 434 ASN B C     1 
ATOM   4514 O O     . ASN B 1 223 ? 23.600  -29.579 6.982   1.00 9.71  ? 434 ASN B O     1 
ATOM   4515 C CB    . ASN B 1 223 ? 24.180  -31.436 9.282   1.00 8.87  ? 434 ASN B CB    1 
ATOM   4516 C CG    . ASN B 1 223 ? 24.013  -31.776 10.767  1.00 8.70  ? 434 ASN B CG    1 
ATOM   4517 O OD1   . ASN B 1 223 ? 22.947  -31.571 11.362  1.00 9.94  ? 434 ASN B OD1   1 
ATOM   4518 N ND2   . ASN B 1 223 ? 25.071  -32.261 11.365  1.00 10.82 ? 434 ASN B ND2   1 
ATOM   4519 N N     . TRP B 1 224 ? 22.713  -31.475 6.137   1.00 9.45  ? 435 TRP B N     1 
ATOM   4520 C CA    . TRP B 1 224 ? 23.152  -31.150 4.766   1.00 9.80  ? 435 TRP B CA    1 
ATOM   4521 C C     . TRP B 1 224 ? 22.461  -29.907 4.156   1.00 9.89  ? 435 TRP B C     1 
ATOM   4522 O O     . TRP B 1 224 ? 23.079  -29.165 3.416   1.00 10.49 ? 435 TRP B O     1 
ATOM   4523 C CB    . TRP B 1 224 ? 23.050  -32.371 3.842   1.00 10.17 ? 435 TRP B CB    1 
ATOM   4524 C CG    . TRP B 1 224 ? 23.983  -33.421 4.251   1.00 10.57 ? 435 TRP B CG    1 
ATOM   4525 C CD1   . TRP B 1 224 ? 23.666  -34.623 4.828   1.00 13.56 ? 435 TRP B CD1   1 
ATOM   4526 C CD2   . TRP B 1 224 ? 25.412  -33.360 4.209   1.00 12.01 ? 435 TRP B CD2   1 
ATOM   4527 N NE1   . TRP B 1 224 ? 24.824  -35.319 5.126   1.00 14.28 ? 435 TRP B NE1   1 
ATOM   4528 C CE2   . TRP B 1 224 ? 25.903  -34.568 4.751   1.00 12.94 ? 435 TRP B CE2   1 
ATOM   4529 C CE3   . TRP B 1 224 ? 26.322  -32.418 3.744   1.00 13.09 ? 435 TRP B CE3   1 
ATOM   4530 C CZ2   . TRP B 1 224 ? 27.261  -34.842 4.844   1.00 15.71 ? 435 TRP B CZ2   1 
ATOM   4531 C CZ3   . TRP B 1 224 ? 27.666  -32.689 3.848   1.00 15.32 ? 435 TRP B CZ3   1 
ATOM   4532 C CH2   . TRP B 1 224 ? 28.125  -33.887 4.388   1.00 14.30 ? 435 TRP B CH2   1 
ATOM   4533 N N     . VAL B 1 225 ? 21.210  -29.651 4.503   1.00 10.72 ? 436 VAL B N     1 
ATOM   4534 C CA    . VAL B 1 225 ? 20.566  -28.421 4.080   1.00 10.99 ? 436 VAL B CA    1 
ATOM   4535 C C     . VAL B 1 225 ? 21.355  -27.215 4.594   1.00 11.70 ? 436 VAL B C     1 
ATOM   4536 O O     . VAL B 1 225 ? 21.664  -26.315 3.818   1.00 11.01 ? 436 VAL B O     1 
ATOM   4537 C CB    . VAL B 1 225 ? 19.102  -28.350 4.495   1.00 11.36 ? 436 VAL B CB    1 
ATOM   4538 C CG1   . VAL B 1 225 ? 18.567  -26.961 4.270   1.00 9.53  ? 436 VAL B CG1   1 
ATOM   4539 C CG2   . VAL B 1 225 ? 18.303  -29.364 3.707   1.00 10.68 ? 436 VAL B CG2   1 
ATOM   4540 N N     . GLY B 1 226 ? 21.768  -27.243 5.862   1.00 11.31 ? 437 GLY B N     1 
ATOM   4541 C CA    . GLY B 1 226 ? 22.560  -26.140 6.421   1.00 11.27 ? 437 GLY B CA    1 
ATOM   4542 C C     . GLY B 1 226 ? 23.901  -25.993 5.755   1.00 11.43 ? 437 GLY B C     1 
ATOM   4543 O O     . GLY B 1 226 ? 24.280  -24.892 5.350   1.00 11.76 ? 437 GLY B O     1 
ATOM   4544 N N     . ILE B 1 227 ? 24.612  -27.109 5.603   1.00 10.96 ? 438 ILE B N     1 
ATOM   4545 C CA    . ILE B 1 227 ? 25.933  -27.119 5.017   1.00 11.47 ? 438 ILE B CA    1 
ATOM   4546 C C     . ILE B 1 227 ? 25.968  -26.651 3.552   1.00 13.28 ? 438 ILE B C     1 
ATOM   4547 O O     . ILE B 1 227 ? 26.871  -25.918 3.143   1.00 13.04 ? 438 ILE B O     1 
ATOM   4548 C CB    . ILE B 1 227 ? 26.581  -28.524 5.145   1.00 11.31 ? 438 ILE B CB    1 
ATOM   4549 C CG1   . ILE B 1 227 ? 26.891  -28.806 6.625   1.00 10.37 ? 438 ILE B CG1   1 
ATOM   4550 C CG2   . ILE B 1 227 ? 27.877  -28.627 4.304   1.00 10.26 ? 438 ILE B CG2   1 
ATOM   4551 C CD1   . ILE B 1 227 ? 27.347  -30.290 6.927   1.00 8.68  ? 438 ILE B CD1   1 
ATOM   4552 N N     . LEU B 1 228 ? 24.990  -27.081 2.768   1.00 14.61 ? 439 LEU B N     1 
ATOM   4553 C CA    . LEU B 1 228 ? 24.945  -26.712 1.380   1.00 15.31 ? 439 LEU B CA    1 
ATOM   4554 C C     . LEU B 1 228 ? 24.479  -25.263 1.252   1.00 15.85 ? 439 LEU B C     1 
ATOM   4555 O O     . LEU B 1 228 ? 25.085  -24.497 0.502   1.00 16.61 ? 439 LEU B O     1 
ATOM   4556 C CB    . LEU B 1 228 ? 24.038  -27.650 0.599   1.00 15.86 ? 439 LEU B CB    1 
ATOM   4557 C CG    . LEU B 1 228 ? 24.532  -29.099 0.526   1.00 14.98 ? 439 LEU B CG    1 
ATOM   4558 C CD1   . LEU B 1 228 ? 23.510  -29.950 -0.168  1.00 14.30 ? 439 LEU B CD1   1 
ATOM   4559 C CD2   . LEU B 1 228 ? 25.879  -29.196 -0.183  1.00 17.25 ? 439 LEU B CD2   1 
ATOM   4560 N N     . SER B 1 229 ? 23.448  -24.880 2.002   1.00 14.86 ? 440 SER B N     1 
ATOM   4561 C CA    . SER B 1 229 ? 22.932  -23.528 1.914   1.00 14.78 ? 440 SER B CA    1 
ATOM   4562 C C     . SER B 1 229 ? 23.859  -22.469 2.543   1.00 14.40 ? 440 SER B C     1 
ATOM   4563 O O     . SER B 1 229 ? 23.934  -21.359 2.033   1.00 13.85 ? 440 SER B O     1 
ATOM   4564 C CB    . SER B 1 229 ? 21.520  -23.424 2.502   1.00 14.55 ? 440 SER B CB    1 
ATOM   4565 O OG    . SER B 1 229 ? 21.475  -23.774 3.882   1.00 15.84 ? 440 SER B OG    1 
ATOM   4566 N N     . HIS B 1 230 ? 24.565  -22.814 3.616   1.00 14.51 ? 441 HIS B N     1 
ATOM   4567 C CA    . HIS B 1 230 ? 25.410  -21.867 4.359   1.00 14.91 ? 441 HIS B CA    1 
ATOM   4568 C C     . HIS B 1 230 ? 26.907  -22.144 4.265   1.00 15.31 ? 441 HIS B C     1 
ATOM   4569 O O     . HIS B 1 230 ? 27.703  -21.359 4.783   1.00 16.69 ? 441 HIS B O     1 
ATOM   4570 C CB    . HIS B 1 230 ? 25.046  -21.894 5.841   1.00 16.16 ? 441 HIS B CB    1 
ATOM   4571 C CG    . HIS B 1 230 ? 23.805  -21.145 6.177   1.00 16.43 ? 441 HIS B CG    1 
ATOM   4572 N ND1   . HIS B 1 230 ? 22.604  -21.382 5.555   1.00 20.24 ? 441 HIS B ND1   1 
ATOM   4573 C CD2   . HIS B 1 230 ? 23.571  -20.175 7.091   1.00 21.41 ? 441 HIS B CD2   1 
ATOM   4574 C CE1   . HIS B 1 230 ? 21.682  -20.577 6.056   1.00 18.11 ? 441 HIS B CE1   1 
ATOM   4575 N NE2   . HIS B 1 230 ? 22.245  -19.832 6.987   1.00 20.66 ? 441 HIS B NE2   1 
ATOM   4576 N N     . GLY B 1 231 ? 27.296  -23.259 3.646   1.00 14.34 ? 442 GLY B N     1 
ATOM   4577 C CA    . GLY B 1 231 ? 28.689  -23.693 3.613   1.00 13.70 ? 442 GLY B CA    1 
ATOM   4578 C C     . GLY B 1 231 ? 29.118  -24.292 4.944   1.00 13.26 ? 442 GLY B C     1 
ATOM   4579 O O     . GLY B 1 231 ? 28.393  -24.217 5.924   1.00 13.42 ? 442 GLY B O     1 
ATOM   4580 N N     . LEU B 1 232 ? 30.294  -24.899 4.971   1.00 12.85 ? 443 LEU B N     1 
ATOM   4581 C CA    . LEU B 1 232 ? 30.870  -25.363 6.210   1.00 13.25 ? 443 LEU B CA    1 
ATOM   4582 C C     . LEU B 1 232 ? 31.240  -24.140 7.059   1.00 13.21 ? 443 LEU B C     1 
ATOM   4583 O O     . LEU B 1 232 ? 31.753  -23.155 6.550   1.00 11.84 ? 443 LEU B O     1 
ATOM   4584 C CB    . LEU B 1 232 ? 32.072  -26.244 5.963   1.00 12.70 ? 443 LEU B CB    1 
ATOM   4585 C CG    . LEU B 1 232 ? 31.774  -27.583 5.251   1.00 14.20 ? 443 LEU B CG    1 
ATOM   4586 C CD1   . LEU B 1 232 ? 33.090  -28.279 4.929   1.00 12.51 ? 443 LEU B CD1   1 
ATOM   4587 C CD2   . LEU B 1 232 ? 30.867  -28.483 6.130   1.00 12.73 ? 443 LEU B CD2   1 
ATOM   4588 N N     . ARG B 1 233 ? 30.955  -24.224 8.350   1.00 13.56 ? 444 ARG B N     1 
ATOM   4589 C CA    . ARG B 1 233 ? 31.085  -23.083 9.250   1.00 14.01 ? 444 ARG B CA    1 
ATOM   4590 C C     . ARG B 1 233 ? 31.966  -23.400 10.431  1.00 13.68 ? 444 ARG B C     1 
ATOM   4591 O O     . ARG B 1 233 ? 32.020  -24.550 10.880  1.00 11.71 ? 444 ARG B O     1 
ATOM   4592 C CB    . ARG B 1 233 ? 29.714  -22.672 9.769   1.00 14.24 ? 444 ARG B CB    1 
ATOM   4593 C CG    . ARG B 1 233 ? 28.903  -21.816 8.766   1.00 16.47 ? 444 ARG B CG    1 
ATOM   4594 C CD    . ARG B 1 233 ? 27.398  -22.175 8.884   1.00 16.58 ? 444 ARG B CD    1 
ATOM   4595 N NE    . ARG B 1 233 ? 27.216  -23.544 8.408   1.00 17.97 ? 444 ARG B NE    1 
ATOM   4596 C CZ    . ARG B 1 233 ? 26.261  -24.377 8.801   1.00 17.87 ? 444 ARG B CZ    1 
ATOM   4597 N NH1   . ARG B 1 233 ? 25.372  -24.019 9.713   1.00 17.01 ? 444 ARG B NH1   1 
ATOM   4598 N NH2   . ARG B 1 233 ? 26.220  -25.600 8.290   1.00 20.22 ? 444 ARG B NH2   1 
ATOM   4599 N N     . ILE B 1 234 ? 32.646  -22.378 10.941  1.00 14.20 ? 445 ILE B N     1 
ATOM   4600 C CA    . ILE B 1 234 ? 33.359  -22.542 12.202  1.00 14.34 ? 445 ILE B CA    1 
ATOM   4601 C C     . ILE B 1 234 ? 32.304  -22.576 13.366  1.00 13.94 ? 445 ILE B C     1 
ATOM   4602 O O     . ILE B 1 234 ? 31.175  -22.087 13.225  1.00 12.35 ? 445 ILE B O     1 
ATOM   4603 C CB    . ILE B 1 234 ? 34.467  -21.468 12.418  1.00 15.46 ? 445 ILE B CB    1 
ATOM   4604 C CG1   . ILE B 1 234 ? 33.934  -20.202 13.057  1.00 16.36 ? 445 ILE B CG1   1 
ATOM   4605 C CG2   . ILE B 1 234 ? 35.258  -21.130 11.091  1.00 15.64 ? 445 ILE B CG2   1 
ATOM   4606 C CD1   . ILE B 1 234 ? 35.005  -19.444 13.750  1.00 17.06 ? 445 ILE B CD1   1 
ATOM   4607 N N     . ALA B 1 235 ? 32.685  -23.179 14.481  1.00 13.55 ? 446 ALA B N     1 
ATOM   4608 C CA    . ALA B 1 235 ? 31.800  -23.359 15.626  1.00 14.08 ? 446 ALA B CA    1 
ATOM   4609 C C     . ALA B 1 235 ? 31.251  -22.032 16.170  1.00 14.17 ? 446 ALA B C     1 
ATOM   4610 O O     . ALA B 1 235 ? 31.876  -20.969 16.026  1.00 13.87 ? 446 ALA B O     1 
ATOM   4611 C CB    . ALA B 1 235 ? 32.554  -24.096 16.726  1.00 14.29 ? 446 ALA B CB    1 
ATOM   4612 N N     . HIS B 1 236 ? 30.074  -22.110 16.791  1.00 14.39 ? 447 HIS B N     1 
ATOM   4613 C CA    . HIS B 1 236 ? 29.452  -20.959 17.448  1.00 14.26 ? 447 HIS B CA    1 
ATOM   4614 C C     . HIS B 1 236 ? 30.432  -20.272 18.421  1.00 14.19 ? 447 HIS B C     1 
ATOM   4615 O O     . HIS B 1 236 ? 31.154  -20.949 19.171  1.00 14.10 ? 447 HIS B O     1 
ATOM   4616 C CB    . HIS B 1 236 ? 28.190  -21.411 18.187  1.00 14.64 ? 447 HIS B CB    1 
ATOM   4617 C CG    . HIS B 1 236 ? 27.255  -20.298 18.508  1.00 15.69 ? 447 HIS B CG    1 
ATOM   4618 N ND1   . HIS B 1 236 ? 27.523  -19.362 19.486  1.00 16.30 ? 447 HIS B ND1   1 
ATOM   4619 C CD2   . HIS B 1 236 ? 26.059  -19.952 17.968  1.00 18.28 ? 447 HIS B CD2   1 
ATOM   4620 C CE1   . HIS B 1 236 ? 26.538  -18.486 19.527  1.00 19.57 ? 447 HIS B CE1   1 
ATOM   4621 N NE2   . HIS B 1 236 ? 25.634  -18.823 18.620  1.00 17.88 ? 447 HIS B NE2   1 
ATOM   4622 N N     . PRO B 1 237 ? 30.477  -18.932 18.417  1.00 14.56 ? 448 PRO B N     1 
ATOM   4623 C CA    . PRO B 1 237 ? 31.377  -18.261 19.371  1.00 15.31 ? 448 PRO B CA    1 
ATOM   4624 C C     . PRO B 1 237 ? 31.113  -18.608 20.843  1.00 14.96 ? 448 PRO B C     1 
ATOM   4625 O O     . PRO B 1 237 ? 32.036  -18.587 21.649  1.00 14.68 ? 448 PRO B O     1 
ATOM   4626 C CB    . PRO B 1 237 ? 31.124  -16.759 19.132  1.00 15.94 ? 448 PRO B CB    1 
ATOM   4627 C CG    . PRO B 1 237 ? 29.964  -16.664 18.229  1.00 16.44 ? 448 PRO B CG    1 
ATOM   4628 C CD    . PRO B 1 237 ? 29.848  -17.978 17.488  1.00 15.43 ? 448 PRO B CD    1 
ATOM   4629 N N     . GLU B 1 238 ? 29.877  -18.944 21.187  1.00 13.98 ? 449 GLU B N     1 
ATOM   4630 C CA    . GLU B 1 238 ? 29.538  -19.289 22.588  1.00 14.77 ? 449 GLU B CA    1 
ATOM   4631 C C     . GLU B 1 238 ? 29.803  -20.764 22.956  1.00 14.26 ? 449 GLU B C     1 
ATOM   4632 O O     . GLU B 1 238 ? 29.677  -21.138 24.118  1.00 14.24 ? 449 GLU B O     1 
ATOM   4633 C CB    . GLU B 1 238 ? 28.087  -18.923 22.882  1.00 14.58 ? 449 GLU B CB    1 
ATOM   4634 C CG    . GLU B 1 238 ? 27.740  -17.445 22.725  1.00 17.26 ? 449 GLU B CG    1 
ATOM   4635 C CD    . GLU B 1 238 ? 28.495  -16.562 23.695  1.00 22.07 ? 449 GLU B CD    1 
ATOM   4636 O OE1   . GLU B 1 238 ? 28.679  -16.953 24.871  1.00 22.03 ? 449 GLU B OE1   1 
ATOM   4637 O OE2   . GLU B 1 238 ? 28.930  -15.480 23.257  1.00 29.41 ? 449 GLU B OE2   1 
ATOM   4638 N N     . ALA B 1 239 ? 30.185  -21.589 21.983  1.00 13.90 ? 450 ALA B N     1 
ATOM   4639 C CA    . ALA B 1 239 ? 30.446  -22.996 22.231  1.00 14.24 ? 450 ALA B CA    1 
ATOM   4640 C C     . ALA B 1 239 ? 31.707  -23.124 23.092  1.00 14.97 ? 450 ALA B C     1 
ATOM   4641 O O     . ALA B 1 239 ? 32.658  -22.361 22.908  1.00 15.93 ? 450 ALA B O     1 
ATOM   4642 C CB    . ALA B 1 239 ? 30.608  -23.759 20.918  1.00 14.20 ? 450 ALA B CB    1 
ATOM   4643 N N     . PRO B 1 240 ? 31.722  -24.077 24.037  1.00 14.98 ? 451 PRO B N     1 
ATOM   4644 C CA    . PRO B 1 240 ? 32.965  -24.296 24.781  1.00 15.31 ? 451 PRO B CA    1 
ATOM   4645 C C     . PRO B 1 240 ? 34.082  -24.743 23.862  1.00 14.94 ? 451 PRO B C     1 
ATOM   4646 O O     . PRO B 1 240 ? 33.890  -25.629 23.009  1.00 14.64 ? 451 PRO B O     1 
ATOM   4647 C CB    . PRO B 1 240 ? 32.624  -25.407 25.781  1.00 15.05 ? 451 PRO B CB    1 
ATOM   4648 C CG    . PRO B 1 240 ? 31.271  -25.849 25.486  1.00 15.72 ? 451 PRO B CG    1 
ATOM   4649 C CD    . PRO B 1 240 ? 30.624  -24.939 24.487  1.00 15.13 ? 451 PRO B CD    1 
ATOM   4650 N N     . ILE B 1 241 ? 35.238  -24.141 24.043  1.00 15.06 ? 452 ILE B N     1 
ATOM   4651 C CA    . ILE B 1 241 ? 36.382  -24.430 23.203  1.00 15.25 ? 452 ILE B CA    1 
ATOM   4652 C C     . ILE B 1 241 ? 36.867  -25.842 23.374  1.00 14.83 ? 452 ILE B C     1 
ATOM   4653 O O     . ILE B 1 241 ? 37.402  -26.442 22.433  1.00 13.48 ? 452 ILE B O     1 
ATOM   4654 C CB    . ILE B 1 241 ? 37.554  -23.438 23.433  1.00 15.46 ? 452 ILE B CB    1 
ATOM   4655 C CG1   . ILE B 1 241 ? 38.528  -23.561 22.236  1.00 17.71 ? 452 ILE B CG1   1 
ATOM   4656 C CG2   . ILE B 1 241 ? 38.230  -23.655 24.838  1.00 16.64 ? 452 ILE B CG2   1 
ATOM   4657 C CD1   . ILE B 1 241 ? 39.219  -22.292 21.876  1.00 21.61 ? 452 ILE B CD1   1 
ATOM   4658 N N     . THR B 1 242 ? 36.648  -26.421 24.552  1.00 14.75 ? 453 THR B N     1 
ATOM   4659 C CA    . THR B 1 242 ? 37.116  -27.779 24.767  1.00 14.75 ? 453 THR B CA    1 
ATOM   4660 C C     . THR B 1 242 ? 36.312  -28.833 23.996  1.00 14.51 ? 453 THR B C     1 
ATOM   4661 O O     . THR B 1 242 ? 36.700  -29.994 23.964  1.00 14.71 ? 453 THR B O     1 
ATOM   4662 C CB    . THR B 1 242 ? 37.164  -28.158 26.261  1.00 15.13 ? 453 THR B CB    1 
ATOM   4663 O OG1   . THR B 1 242 ? 35.864  -27.972 26.834  1.00 16.95 ? 453 THR B OG1   1 
ATOM   4664 C CG2   . THR B 1 242 ? 38.180  -27.315 27.009  1.00 14.33 ? 453 THR B CG2   1 
ATOM   4665 N N     . GLY B 1 243 ? 35.226  -28.442 23.339  1.00 14.35 ? 454 GLY B N     1 
ATOM   4666 C CA    . GLY B 1 243 ? 34.571  -29.326 22.391  1.00 14.58 ? 454 GLY B CA    1 
ATOM   4667 C C     . GLY B 1 243 ? 35.377  -29.622 21.137  1.00 14.54 ? 454 GLY B C     1 
ATOM   4668 O O     . GLY B 1 243 ? 35.040  -30.500 20.365  1.00 15.01 ? 454 GLY B O     1 
ATOM   4669 N N     . TYR B 1 244 ? 36.470  -28.913 20.931  1.00 14.62 ? 455 TYR B N     1 
ATOM   4670 C CA    . TYR B 1 244 ? 37.118  -28.891 19.629  1.00 15.08 ? 455 TYR B CA    1 
ATOM   4671 C C     . TYR B 1 244 ? 38.585  -29.230 19.802  1.00 15.62 ? 455 TYR B C     1 
ATOM   4672 O O     . TYR B 1 244 ? 39.346  -28.441 20.356  1.00 16.22 ? 455 TYR B O     1 
ATOM   4673 C CB    . TYR B 1 244 ? 36.937  -27.520 19.005  1.00 14.15 ? 455 TYR B CB    1 
ATOM   4674 C CG    . TYR B 1 244 ? 35.486  -27.189 18.858  1.00 14.96 ? 455 TYR B CG    1 
ATOM   4675 C CD1   . TYR B 1 244 ? 34.727  -27.649 17.762  1.00 15.51 ? 455 TYR B CD1   1 
ATOM   4676 C CD2   . TYR B 1 244 ? 34.850  -26.461 19.837  1.00 13.77 ? 455 TYR B CD2   1 
ATOM   4677 C CE1   . TYR B 1 244 ? 33.365  -27.348 17.665  1.00 13.66 ? 455 TYR B CE1   1 
ATOM   4678 C CE2   . TYR B 1 244 ? 33.549  -26.161 19.749  1.00 14.37 ? 455 TYR B CE2   1 
ATOM   4679 C CZ    . TYR B 1 244 ? 32.807  -26.582 18.677  1.00 13.23 ? 455 TYR B CZ    1 
ATOM   4680 O OH    . TYR B 1 244 ? 31.523  -26.226 18.723  1.00 13.30 ? 455 TYR B OH    1 
ATOM   4681 N N     . MET B 1 245 ? 38.968  -30.413 19.341  1.00 15.46 ? 456 MET B N     1 
ATOM   4682 C CA    . MET B 1 245 ? 40.316  -30.939 19.592  1.00 16.21 ? 456 MET B CA    1 
ATOM   4683 C C     . MET B 1 245 ? 41.429  -29.964 19.201  1.00 15.20 ? 456 MET B C     1 
ATOM   4684 O O     . MET B 1 245 ? 42.444  -29.850 19.925  1.00 15.60 ? 456 MET B O     1 
ATOM   4685 C CB    . MET B 1 245 ? 40.495  -32.301 18.902  1.00 16.38 ? 456 MET B CB    1 
ATOM   4686 C CG    . MET B 1 245 ? 41.843  -32.955 19.184  1.00 21.84 ? 456 MET B CG    1 
ATOM   4687 S SD    . MET B 1 245 ? 42.035  -34.650 18.547  1.00 29.31 ? 456 MET B SD    1 
ATOM   4688 C CE    . MET B 1 245 ? 40.385  -35.314 18.937  1.00 28.01 ? 456 MET B CE    1 
ATOM   4689 N N     . PHE B 1 246 ? 41.233  -29.254 18.089  1.00 13.66 ? 457 PHE B N     1 
ATOM   4690 C CA    . PHE B 1 246 ? 42.194  -28.267 17.614  1.00 13.85 ? 457 PHE B CA    1 
ATOM   4691 C C     . PHE B 1 246 ? 41.588  -26.883 17.406  1.00 13.28 ? 457 PHE B C     1 
ATOM   4692 O O     . PHE B 1 246 ? 41.986  -26.155 16.511  1.00 14.47 ? 457 PHE B O     1 
ATOM   4693 C CB    . PHE B 1 246 ? 42.876  -28.763 16.330  1.00 14.17 ? 457 PHE B CB    1 
ATOM   4694 C CG    . PHE B 1 246 ? 43.685  -29.989 16.537  1.00 14.68 ? 457 PHE B CG    1 
ATOM   4695 C CD1   . PHE B 1 246 ? 44.837  -29.939 17.318  1.00 17.40 ? 457 PHE B CD1   1 
ATOM   4696 C CD2   . PHE B 1 246 ? 43.301  -31.200 15.985  1.00 16.64 ? 457 PHE B CD2   1 
ATOM   4697 C CE1   . PHE B 1 246 ? 45.604  -31.099 17.550  1.00 18.79 ? 457 PHE B CE1   1 
ATOM   4698 C CE2   . PHE B 1 246 ? 44.072  -32.376 16.194  1.00 18.45 ? 457 PHE B CE2   1 
ATOM   4699 C CZ    . PHE B 1 246 ? 45.219  -32.323 16.980  1.00 17.03 ? 457 PHE B CZ    1 
ATOM   4700 N N     . GLY B 1 247 ? 40.631  -26.516 18.246  1.00 12.54 ? 458 GLY B N     1 
ATOM   4701 C CA    . GLY B 1 247 ? 40.003  -25.204 18.162  1.00 12.63 ? 458 GLY B CA    1 
ATOM   4702 C C     . GLY B 1 247 ? 38.851  -25.113 17.176  1.00 12.43 ? 458 GLY B C     1 
ATOM   4703 O O     . GLY B 1 247 ? 38.453  -26.097 16.564  1.00 12.08 ? 458 GLY B O     1 
ATOM   4704 N N     . LYS B 1 248 ? 38.342  -23.897 17.004  1.00 12.47 ? 459 LYS B N     1 
ATOM   4705 C CA    . LYS B 1 248 ? 37.118  -23.677 16.257  1.00 11.99 ? 459 LYS B CA    1 
ATOM   4706 C C     . LYS B 1 248 ? 37.425  -23.437 14.772  1.00 12.22 ? 459 LYS B C     1 
ATOM   4707 O O     . LYS B 1 248 ? 37.348  -22.312 14.268  1.00 12.41 ? 459 LYS B O     1 
ATOM   4708 C CB    . LYS B 1 248 ? 36.337  -22.511 16.860  1.00 12.22 ? 459 LYS B CB    1 
ATOM   4709 C CG    . LYS B 1 248 ? 35.936  -22.745 18.301  1.00 11.33 ? 459 LYS B CG    1 
ATOM   4710 C CD    . LYS B 1 248 ? 34.932  -21.696 18.788  1.00 12.54 ? 459 LYS B CD    1 
ATOM   4711 C CE    . LYS B 1 248 ? 34.332  -22.044 20.131  1.00 11.64 ? 459 LYS B CE    1 
ATOM   4712 N NZ    . LYS B 1 248 ? 33.577  -20.915 20.747  1.00 9.24  ? 459 LYS B NZ    1 
ATOM   4713 N N     . GLY B 1 249 ? 37.778  -24.506 14.078  1.00 11.55 ? 460 GLY B N     1 
ATOM   4714 C CA    . GLY B 1 249 ? 38.026  -24.425 12.648  1.00 12.09 ? 460 GLY B CA    1 
ATOM   4715 C C     . GLY B 1 249 ? 37.055  -25.362 11.940  1.00 11.93 ? 460 GLY B C     1 
ATOM   4716 O O     . GLY B 1 249 ? 36.093  -25.850 12.541  1.00 11.93 ? 460 GLY B O     1 
ATOM   4717 N N     . ILE B 1 250 ? 37.314  -25.591 10.665  1.00 11.58 ? 461 ILE B N     1 
ATOM   4718 C CA    . ILE B 1 250 ? 36.568  -26.546 9.859   1.00 10.56 ? 461 ILE B CA    1 
ATOM   4719 C C     . ILE B 1 250 ? 37.462  -27.767 9.690   1.00 10.92 ? 461 ILE B C     1 
ATOM   4720 O O     . ILE B 1 250 ? 38.606  -27.641 9.251   1.00 10.83 ? 461 ILE B O     1 
ATOM   4721 C CB    . ILE B 1 250 ? 36.183  -25.947 8.518   1.00 9.99  ? 461 ILE B CB    1 
ATOM   4722 C CG1   . ILE B 1 250 ? 35.435  -24.637 8.744   1.00 11.50 ? 461 ILE B CG1   1 
ATOM   4723 C CG2   . ILE B 1 250 ? 35.260  -26.901 7.722   1.00 7.80  ? 461 ILE B CG2   1 
ATOM   4724 C CD1   . ILE B 1 250 ? 35.125  -23.868 7.497   1.00 9.03  ? 461 ILE B CD1   1 
ATOM   4725 N N     . TYR B 1 251 ? 36.922  -28.939 10.036  1.00 11.07 ? 462 TYR B N     1 
ATOM   4726 C CA    . TYR B 1 251 ? 37.670  -30.192 10.163  1.00 11.08 ? 462 TYR B CA    1 
ATOM   4727 C C     . TYR B 1 251 ? 37.544  -31.075 8.914   1.00 11.82 ? 462 TYR B C     1 
ATOM   4728 O O     . TYR B 1 251 ? 36.446  -31.234 8.373   1.00 12.85 ? 462 TYR B O     1 
ATOM   4729 C CB    . TYR B 1 251 ? 37.172  -30.949 11.417  1.00 11.56 ? 462 TYR B CB    1 
ATOM   4730 C CG    . TYR B 1 251 ? 37.669  -30.330 12.720  1.00 11.11 ? 462 TYR B CG    1 
ATOM   4731 C CD1   . TYR B 1 251 ? 37.205  -29.072 13.154  1.00 10.48 ? 462 TYR B CD1   1 
ATOM   4732 C CD2   . TYR B 1 251 ? 38.599  -30.979 13.505  1.00 10.75 ? 462 TYR B CD2   1 
ATOM   4733 C CE1   . TYR B 1 251 ? 37.671  -28.502 14.333  1.00 10.06 ? 462 TYR B CE1   1 
ATOM   4734 C CE2   . TYR B 1 251 ? 39.065  -30.416 14.699  1.00 12.44 ? 462 TYR B CE2   1 
ATOM   4735 C CZ    . TYR B 1 251 ? 38.613  -29.184 15.116  1.00 14.07 ? 462 TYR B CZ    1 
ATOM   4736 O OH    . TYR B 1 251 ? 39.117  -28.636 16.318  1.00 15.23 ? 462 TYR B OH    1 
ATOM   4737 N N     . PHE B 1 252 ? 38.670  -31.622 8.470   1.00 11.32 ? 463 PHE B N     1 
ATOM   4738 C CA    . PHE B 1 252 ? 38.761  -32.480 7.283   1.00 10.78 ? 463 PHE B CA    1 
ATOM   4739 C C     . PHE B 1 252 ? 39.631  -33.711 7.529   1.00 11.20 ? 463 PHE B C     1 
ATOM   4740 O O     . PHE B 1 252 ? 40.547  -33.692 8.362   1.00 11.65 ? 463 PHE B O     1 
ATOM   4741 C CB    . PHE B 1 252 ? 39.343  -31.718 6.085   1.00 11.02 ? 463 PHE B CB    1 
ATOM   4742 C CG    . PHE B 1 252 ? 38.507  -30.580 5.628   1.00 8.69  ? 463 PHE B CG    1 
ATOM   4743 C CD1   . PHE B 1 252 ? 37.446  -30.783 4.756   1.00 10.21 ? 463 PHE B CD1   1 
ATOM   4744 C CD2   . PHE B 1 252 ? 38.774  -29.303 6.073   1.00 7.97  ? 463 PHE B CD2   1 
ATOM   4745 C CE1   . PHE B 1 252 ? 36.669  -29.750 4.338   1.00 9.47  ? 463 PHE B CE1   1 
ATOM   4746 C CE2   . PHE B 1 252 ? 38.005  -28.253 5.680   1.00 7.98  ? 463 PHE B CE2   1 
ATOM   4747 C CZ    . PHE B 1 252 ? 36.933  -28.464 4.802   1.00 9.14  ? 463 PHE B CZ    1 
ATOM   4748 N N     . ALA B 1 253 ? 39.349  -34.788 6.805   1.00 11.73 ? 464 ALA B N     1 
ATOM   4749 C CA    . ALA B 1 253 ? 40.182  -35.982 6.865   1.00 12.01 ? 464 ALA B CA    1 
ATOM   4750 C C     . ALA B 1 253 ? 40.698  -36.367 5.473   1.00 11.73 ? 464 ALA B C     1 
ATOM   4751 O O     . ALA B 1 253 ? 40.100  -36.000 4.459   1.00 11.35 ? 464 ALA B O     1 
ATOM   4752 C CB    . ALA B 1 253 ? 39.405  -37.124 7.473   1.00 12.01 ? 464 ALA B CB    1 
ATOM   4753 N N     . ASP B 1 254 ? 41.823  -37.095 5.446   1.00 12.20 ? 465 ASP B N     1 
ATOM   4754 C CA    . ASP B 1 254 ? 42.322  -37.738 4.229   1.00 12.03 ? 465 ASP B CA    1 
ATOM   4755 C C     . ASP B 1 254 ? 41.976  -39.243 4.186   1.00 11.57 ? 465 ASP B C     1 
ATOM   4756 O O     . ASP B 1 254 ? 42.285  -39.913 3.217   1.00 10.91 ? 465 ASP B O     1 
ATOM   4757 C CB    . ASP B 1 254 ? 43.818  -37.503 4.001   1.00 12.56 ? 465 ASP B CB    1 
ATOM   4758 C CG    . ASP B 1 254 ? 44.700  -38.027 5.136   1.00 14.78 ? 465 ASP B CG    1 
ATOM   4759 O OD1   . ASP B 1 254 ? 44.284  -38.920 5.924   1.00 16.24 ? 465 ASP B OD1   1 
ATOM   4760 O OD2   . ASP B 1 254 ? 45.841  -37.538 5.232   1.00 18.76 ? 465 ASP B OD2   1 
ATOM   4761 N N     . MET B 1 255 ? 41.284  -39.743 5.202   1.00 11.62 ? 466 MET B N     1 
ATOM   4762 C CA    . MET B 1 255 ? 40.762  -41.092 5.187   1.00 11.39 ? 466 MET B CA    1 
ATOM   4763 C C     . MET B 1 255 ? 39.247  -41.026 5.151   1.00 12.44 ? 466 MET B C     1 
ATOM   4764 O O     . MET B 1 255 ? 38.600  -40.496 6.087   1.00 13.53 ? 466 MET B O     1 
ATOM   4765 C CB    . MET B 1 255 ? 41.227  -41.870 6.408   1.00 12.43 ? 466 MET B CB    1 
ATOM   4766 C CG    . MET B 1 255 ? 42.760  -41.987 6.569   1.00 13.97 ? 466 MET B CG    1 
ATOM   4767 S SD    . MET B 1 255 ? 43.492  -43.092 5.302   1.00 17.48 ? 466 MET B SD    1 
ATOM   4768 C CE    . MET B 1 255 ? 43.153  -44.703 6.029   1.00 13.56 ? 466 MET B CE    1 
ATOM   4769 N N     . SER B 1 256 ? 38.667  -41.608 4.106   1.00 12.03 ? 467 SER B N     1 
ATOM   4770 C CA    . SER B 1 256 ? 37.242  -41.500 3.855   1.00 12.15 ? 467 SER B CA    1 
ATOM   4771 C C     . SER B 1 256 ? 36.392  -41.895 5.075   1.00 12.34 ? 467 SER B C     1 
ATOM   4772 O O     . SER B 1 256 ? 35.398  -41.225 5.417   1.00 11.96 ? 467 SER B O     1 
ATOM   4773 C CB    . SER B 1 256 ? 36.847  -42.356 2.658   1.00 12.87 ? 467 SER B CB    1 
ATOM   4774 O OG    . SER B 1 256 ? 37.093  -43.723 2.917   1.00 11.00 ? 467 SER B OG    1 
ATOM   4775 N N     . SER B 1 257 ? 36.791  -42.973 5.735   1.00 11.42 ? 468 SER B N     1 
ATOM   4776 C CA    . SER B 1 257 ? 35.998  -43.540 6.798   1.00 11.19 ? 468 SER B CA    1 
ATOM   4777 C C     . SER B 1 257 ? 36.136  -42.764 8.103   1.00 11.63 ? 468 SER B C     1 
ATOM   4778 O O     . SER B 1 257 ? 35.224  -42.810 8.919   1.00 10.98 ? 468 SER B O     1 
ATOM   4779 C CB    . SER B 1 257 ? 36.405  -44.996 7.019   1.00 11.50 ? 468 SER B CB    1 
ATOM   4780 O OG    . SER B 1 257 ? 37.770  -45.074 7.353   1.00 10.91 ? 468 SER B OG    1 
ATOM   4781 N N     . LYS B 1 258 ? 37.265  -42.082 8.325   1.00 12.05 ? 469 LYS B N     1 
ATOM   4782 C CA    . LYS B 1 258 ? 37.368  -41.188 9.489   1.00 12.74 ? 469 LYS B CA    1 
ATOM   4783 C C     . LYS B 1 258 ? 36.223  -40.180 9.439   1.00 12.61 ? 469 LYS B C     1 
ATOM   4784 O O     . LYS B 1 258 ? 35.521  -39.999 10.426  1.00 12.42 ? 469 LYS B O     1 
ATOM   4785 C CB    . LYS B 1 258 ? 38.709  -40.448 9.561   1.00 12.55 ? 469 LYS B CB    1 
ATOM   4786 C CG    . LYS B 1 258 ? 38.868  -39.592 10.825  1.00 13.63 ? 469 LYS B CG    1 
ATOM   4787 C CD    . LYS B 1 258 ? 40.276  -39.068 11.041  1.00 14.13 ? 469 LYS B CD    1 
ATOM   4788 C CE    . LYS B 1 258 ? 40.324  -38.053 12.163  1.00 16.54 ? 469 LYS B CE    1 
ATOM   4789 N NZ    . LYS B 1 258 ? 41.723  -37.790 12.601  1.00 16.45 ? 469 LYS B NZ    1 
ATOM   4790 N N     . SER B 1 259 ? 36.040  -39.533 8.286   1.00 11.85 ? 470 SER B N     1 
ATOM   4791 C CA    . SER B 1 259 ? 34.887  -38.639 8.054   1.00 11.42 ? 470 SER B CA    1 
ATOM   4792 C C     . SER B 1 259 ? 33.498  -39.322 8.011   1.00 11.21 ? 470 SER B C     1 
ATOM   4793 O O     . SER B 1 259 ? 32.528  -38.793 8.570   1.00 9.74  ? 470 SER B O     1 
ATOM   4794 C CB    . SER B 1 259 ? 35.063  -37.819 6.764   1.00 11.31 ? 470 SER B CB    1 
ATOM   4795 O OG    . SER B 1 259 ? 36.095  -36.855 6.909   1.00 10.16 ? 470 SER B OG    1 
ATOM   4796 N N     . ALA B 1 260 ? 33.403  -40.473 7.340   1.00 10.85 ? 471 ALA B N     1 
ATOM   4797 C CA    . ALA B 1 260 ? 32.132  -41.199 7.188   1.00 10.73 ? 471 ALA B CA    1 
ATOM   4798 C C     . ALA B 1 260 ? 31.550  -41.665 8.503   1.00 10.81 ? 471 ALA B C     1 
ATOM   4799 O O     . ALA B 1 260 ? 30.327  -41.823 8.624   1.00 10.45 ? 471 ALA B O     1 
ATOM   4800 C CB    . ALA B 1 260 ? 32.285  -42.385 6.262   1.00 9.70  ? 471 ALA B CB    1 
ATOM   4801 N N     . ASN B 1 261 ? 32.404  -41.877 9.489   1.00 10.97 ? 472 ASN B N     1 
ATOM   4802 C CA    . ASN B 1 261 ? 31.928  -42.187 10.839  1.00 11.48 ? 472 ASN B CA    1 
ATOM   4803 C C     . ASN B 1 261 ? 31.104  -41.044 11.413  1.00 12.16 ? 472 ASN B C     1 
ATOM   4804 O O     . ASN B 1 261 ? 30.209  -41.267 12.239  1.00 12.75 ? 472 ASN B O     1 
ATOM   4805 C CB    . ASN B 1 261 ? 33.084  -42.457 11.796  1.00 11.27 ? 472 ASN B CB    1 
ATOM   4806 C CG    . ASN B 1 261 ? 33.816  -43.769 11.524  1.00 11.01 ? 472 ASN B CG    1 
ATOM   4807 O OD1   . ASN B 1 261 ? 33.300  -44.689 10.888  1.00 11.71 ? 472 ASN B OD1   1 
ATOM   4808 N ND2   . ASN B 1 261 ? 35.032  -43.871 12.077  1.00 12.21 ? 472 ASN B ND2   1 
ATOM   4809 N N     . TYR B 1 262 ? 31.414  -39.814 11.015  1.00 11.36 ? 473 TYR B N     1 
ATOM   4810 C CA    . TYR B 1 262 ? 30.614  -38.672 11.459  1.00 11.63 ? 473 TYR B CA    1 
ATOM   4811 C C     . TYR B 1 262 ? 29.284  -38.509 10.717  1.00 10.85 ? 473 TYR B C     1 
ATOM   4812 O O     . TYR B 1 262 ? 28.548  -37.551 10.968  1.00 9.79  ? 473 TYR B O     1 
ATOM   4813 C CB    . TYR B 1 262 ? 31.448  -37.399 11.380  1.00 11.91 ? 473 TYR B CB    1 
ATOM   4814 C CG    . TYR B 1 262 ? 32.465  -37.361 12.464  1.00 15.42 ? 473 TYR B CG    1 
ATOM   4815 C CD1   . TYR B 1 262 ? 32.126  -36.911 13.729  1.00 19.88 ? 473 TYR B CD1   1 
ATOM   4816 C CD2   . TYR B 1 262 ? 33.755  -37.794 12.250  1.00 18.01 ? 473 TYR B CD2   1 
ATOM   4817 C CE1   . TYR B 1 262 ? 33.064  -36.872 14.752  1.00 23.06 ? 473 TYR B CE1   1 
ATOM   4818 C CE2   . TYR B 1 262 ? 34.695  -37.763 13.259  1.00 20.62 ? 473 TYR B CE2   1 
ATOM   4819 C CZ    . TYR B 1 262 ? 34.343  -37.306 14.509  1.00 23.72 ? 473 TYR B CZ    1 
ATOM   4820 O OH    . TYR B 1 262 ? 35.268  -37.279 15.523  1.00 25.80 ? 473 TYR B OH    1 
ATOM   4821 N N     . CYS B 1 263 ? 28.990  -39.415 9.787   1.00 10.15 ? 474 CYS B N     1 
ATOM   4822 C CA    . CYS B 1 263 ? 27.668  -39.526 9.208   1.00 10.27 ? 474 CYS B CA    1 
ATOM   4823 C C     . CYS B 1 263 ? 26.685  -40.156 10.186  1.00 11.05 ? 474 CYS B C     1 
ATOM   4824 O O     . CYS B 1 263 ? 25.479  -39.969 10.061  1.00 12.71 ? 474 CYS B O     1 
ATOM   4825 C CB    . CYS B 1 263 ? 27.696  -40.362 7.940   1.00 10.11 ? 474 CYS B CB    1 
ATOM   4826 S SG    . CYS B 1 263 ? 28.682  -39.596 6.593   1.00 12.30 ? 474 CYS B SG    1 
ATOM   4827 N N     . PHE B 1 264 ? 27.204  -40.941 11.118  1.00 11.58 ? 475 PHE B N     1 
ATOM   4828 C CA    . PHE B 1 264 ? 26.402  -41.643 12.075  1.00 12.12 ? 475 PHE B CA    1 
ATOM   4829 C C     . PHE B 1 264 ? 25.328  -42.427 11.355  1.00 12.88 ? 475 PHE B C     1 
ATOM   4830 O O     . PHE B 1 264 ? 24.174  -42.446 11.748  1.00 13.42 ? 475 PHE B O     1 
ATOM   4831 C CB    . PHE B 1 264 ? 25.878  -40.661 13.142  1.00 11.94 ? 475 PHE B CB    1 
ATOM   4832 C CG    . PHE B 1 264 ? 26.948  -40.149 14.029  1.00 12.20 ? 475 PHE B CG    1 
ATOM   4833 C CD1   . PHE B 1 264 ? 27.427  -40.935 15.072  1.00 14.69 ? 475 PHE B CD1   1 
ATOM   4834 C CD2   . PHE B 1 264 ? 27.528  -38.920 13.806  1.00 13.31 ? 475 PHE B CD2   1 
ATOM   4835 C CE1   . PHE B 1 264 ? 28.444  -40.494 15.874  1.00 15.46 ? 475 PHE B CE1   1 
ATOM   4836 C CE2   . PHE B 1 264 ? 28.545  -38.470 14.606  1.00 14.61 ? 475 PHE B CE2   1 
ATOM   4837 C CZ    . PHE B 1 264 ? 29.005  -39.252 15.645  1.00 15.97 ? 475 PHE B CZ    1 
ATOM   4838 N N     . ALA B 1 265 ? 25.719  -43.069 10.257  1.00 13.09 ? 476 ALA B N     1 
ATOM   4839 C CA    . ALA B 1 265 ? 24.850  -43.991 9.554   1.00 13.34 ? 476 ALA B CA    1 
ATOM   4840 C C     . ALA B 1 265 ? 24.696  -45.278 10.375  1.00 14.93 ? 476 ALA B C     1 
ATOM   4841 O O     . ALA B 1 265 ? 25.495  -45.557 11.266  1.00 15.46 ? 476 ALA B O     1 
ATOM   4842 C CB    . ALA B 1 265 ? 25.420  -44.318 8.169   1.00 13.05 ? 476 ALA B CB    1 
ATOM   4843 N N     . SER B 1 266 ? 23.685  -46.066 10.054  1.00 16.20 ? 477 SER B N     1 
ATOM   4844 C CA    . SER B 1 266 ? 23.397  -47.267 10.838  1.00 17.77 ? 477 SER B CA    1 
ATOM   4845 C C     . SER B 1 266 ? 22.754  -48.301 9.954   1.00 18.78 ? 477 SER B C     1 
ATOM   4846 O O     . SER B 1 266 ? 22.381  -48.029 8.817   1.00 16.56 ? 477 SER B O     1 
ATOM   4847 C CB    . SER B 1 266 ? 22.469  -46.941 12.029  1.00 17.47 ? 477 SER B CB    1 
ATOM   4848 O OG    . SER B 1 266 ? 21.131  -46.727 11.604  1.00 17.83 ? 477 SER B OG    1 
ATOM   4849 N N     . ARG B 1 267 ? 22.646  -49.522 10.470  1.00 21.03 ? 478 ARG B N     1 
ATOM   4850 C CA    . ARG B 1 267 ? 22.061  -50.585 9.670   1.00 22.49 ? 478 ARG B CA    1 
ATOM   4851 C C     . ARG B 1 267 ? 20.599  -50.265 9.363   1.00 22.71 ? 478 ARG B C     1 
ATOM   4852 O O     . ARG B 1 267 ? 20.091  -50.649 8.331   1.00 23.15 ? 478 ARG B O     1 
ATOM   4853 C CB    . ARG B 1 267 ? 22.269  -51.979 10.309  1.00 23.53 ? 478 ARG B CB    1 
ATOM   4854 C CG    . ARG B 1 267 ? 21.900  -52.072 11.748  1.00 25.87 ? 478 ARG B CG    1 
ATOM   4855 C CD    . ARG B 1 267 ? 22.416  -53.341 12.433  1.00 29.55 ? 478 ARG B CD    1 
ATOM   4856 N NE    . ARG B 1 267 ? 22.304  -53.117 13.867  1.00 32.19 ? 478 ARG B NE    1 
ATOM   4857 C CZ    . ARG B 1 267 ? 21.163  -53.164 14.558  1.00 34.16 ? 478 ARG B CZ    1 
ATOM   4858 N NH1   . ARG B 1 267 ? 19.997  -53.474 13.980  1.00 34.54 ? 478 ARG B NH1   1 
ATOM   4859 N NH2   . ARG B 1 267 ? 21.193  -52.928 15.855  1.00 36.72 ? 478 ARG B NH2   1 
ATOM   4860 N N     . LEU B 1 268 ? 19.942  -49.497 10.227  1.00 23.85 ? 479 LEU B N     1 
ATOM   4861 C CA    . LEU B 1 268 ? 18.581  -49.036 9.941   1.00 24.07 ? 479 LEU B CA    1 
ATOM   4862 C C     . LEU B 1 268 ? 18.563  -47.885 8.943   1.00 23.48 ? 479 LEU B C     1 
ATOM   4863 O O     . LEU B 1 268 ? 17.722  -47.833 8.067   1.00 23.52 ? 479 LEU B O     1 
ATOM   4864 C CB    . LEU B 1 268 ? 17.879  -48.595 11.236  1.00 25.22 ? 479 LEU B CB    1 
ATOM   4865 C CG    . LEU B 1 268 ? 16.449  -48.019 11.111  1.00 27.21 ? 479 LEU B CG    1 
ATOM   4866 C CD1   . LEU B 1 268 ? 15.508  -48.886 10.257  1.00 28.14 ? 479 LEU B CD1   1 
ATOM   4867 C CD2   . LEU B 1 268 ? 15.843  -47.766 12.514  1.00 27.57 ? 479 LEU B CD2   1 
ATOM   4868 N N     . LYS B 1 269 ? 19.471  -46.944 9.094   1.00 22.56 ? 480 LYS B N     1 
ATOM   4869 C CA    . LYS B 1 269 ? 19.539  -45.807 8.165   1.00 22.23 ? 480 LYS B CA    1 
ATOM   4870 C C     . LYS B 1 269 ? 20.894  -45.813 7.515   1.00 20.29 ? 480 LYS B C     1 
ATOM   4871 O O     . LYS B 1 269 ? 21.817  -45.174 7.992   1.00 19.11 ? 480 LYS B O     1 
ATOM   4872 C CB    . LYS B 1 269 ? 19.297  -44.500 8.928   1.00 22.62 ? 480 LYS B CB    1 
ATOM   4873 C CG    . LYS B 1 269 ? 17.814  -44.227 9.062   1.00 25.17 ? 480 LYS B CG    1 
ATOM   4874 C CD    . LYS B 1 269 ? 17.398  -43.949 10.444  1.00 27.90 ? 480 LYS B CD    1 
ATOM   4875 C CE    . LYS B 1 269 ? 15.924  -43.521 10.434  1.00 30.76 ? 480 LYS B CE    1 
ATOM   4876 N NZ    . LYS B 1 269 ? 14.996  -44.555 9.871   1.00 30.77 ? 480 LYS B NZ    1 
ATOM   4877 N N     . ASN B 1 270 ? 21.006  -46.563 6.426   1.00 18.82 ? 481 ASN B N     1 
ATOM   4878 C CA    . ASN B 1 270 ? 22.329  -46.883 5.858   1.00 18.48 ? 481 ASN B CA    1 
ATOM   4879 C C     . ASN B 1 270 ? 22.780  -45.993 4.673   1.00 16.77 ? 481 ASN B C     1 
ATOM   4880 O O     . ASN B 1 270 ? 23.808  -46.249 4.082   1.00 16.41 ? 481 ASN B O     1 
ATOM   4881 C CB    . ASN B 1 270 ? 22.389  -48.386 5.500   1.00 18.38 ? 481 ASN B CB    1 
ATOM   4882 C CG    . ASN B 1 270 ? 21.554  -48.751 4.285   1.00 21.69 ? 481 ASN B CG    1 
ATOM   4883 O OD1   . ASN B 1 270 ? 20.679  -48.014 3.864   1.00 21.92 ? 481 ASN B OD1   1 
ATOM   4884 N ND2   . ASN B 1 270 ? 21.860  -49.902 3.691   1.00 25.03 ? 481 ASN B ND2   1 
ATOM   4885 N N     . THR B 1 271 ? 22.005  -44.964 4.350   1.00 16.71 ? 482 THR B N     1 
ATOM   4886 C CA    . THR B 1 271 ? 22.361  -43.998 3.311   1.00 17.10 ? 482 THR B CA    1 
ATOM   4887 C C     . THR B 1 271 ? 22.846  -42.737 3.968   1.00 16.58 ? 482 THR B C     1 
ATOM   4888 O O     . THR B 1 271 ? 22.093  -42.109 4.719   1.00 18.22 ? 482 THR B O     1 
ATOM   4889 C CB    . THR B 1 271 ? 21.149  -43.622 2.461   1.00 17.49 ? 482 THR B CB    1 
ATOM   4890 O OG1   . THR B 1 271 ? 20.601  -44.797 1.875   1.00 19.25 ? 482 THR B OG1   1 
ATOM   4891 C CG2   . THR B 1 271 ? 21.557  -42.655 1.355   1.00 16.74 ? 482 THR B CG2   1 
ATOM   4892 N N     . GLY B 1 272 ? 24.096  -42.370 3.717   1.00 15.25 ? 483 GLY B N     1 
ATOM   4893 C CA    . GLY B 1 272 ? 24.657  -41.110 4.179   1.00 14.46 ? 483 GLY B CA    1 
ATOM   4894 C C     . GLY B 1 272 ? 25.259  -40.297 3.039   1.00 13.65 ? 483 GLY B C     1 
ATOM   4895 O O     . GLY B 1 272 ? 25.297  -40.743 1.895   1.00 13.46 ? 483 GLY B O     1 
ATOM   4896 N N     . LEU B 1 273 ? 25.721  -39.095 3.347   1.00 12.63 ? 484 LEU B N     1 
ATOM   4897 C CA    . LEU B 1 273 ? 26.460  -38.298 2.357   1.00 12.71 ? 484 LEU B CA    1 
ATOM   4898 C C     . LEU B 1 273 ? 27.847  -38.000 2.871   1.00 12.02 ? 484 LEU B C     1 
ATOM   4899 O O     . LEU B 1 273 ? 28.074  -37.886 4.073   1.00 12.72 ? 484 LEU B O     1 
ATOM   4900 C CB    . LEU B 1 273 ? 25.716  -37.015 2.008   1.00 12.12 ? 484 LEU B CB    1 
ATOM   4901 C CG    . LEU B 1 273 ? 24.244  -37.127 1.595   1.00 14.68 ? 484 LEU B CG    1 
ATOM   4902 C CD1   . LEU B 1 273 ? 23.649  -35.794 1.364   1.00 12.42 ? 484 LEU B CD1   1 
ATOM   4903 C CD2   . LEU B 1 273 ? 24.077  -37.999 0.326   1.00 14.48 ? 484 LEU B CD2   1 
ATOM   4904 N N     . LEU B 1 274 ? 28.787  -37.868 1.952   1.00 12.49 ? 485 LEU B N     1 
ATOM   4905 C CA    . LEU B 1 274 ? 30.150  -37.448 2.245   1.00 12.18 ? 485 LEU B CA    1 
ATOM   4906 C C     . LEU B 1 274 ? 30.525  -36.334 1.273   1.00 12.33 ? 485 LEU B C     1 
ATOM   4907 O O     . LEU B 1 274 ? 30.214  -36.402 0.063   1.00 10.93 ? 485 LEU B O     1 
ATOM   4908 C CB    . LEU B 1 274 ? 31.139  -38.585 1.995   1.00 12.98 ? 485 LEU B CB    1 
ATOM   4909 C CG    . LEU B 1 274 ? 31.549  -39.587 3.038   1.00 15.31 ? 485 LEU B CG    1 
ATOM   4910 C CD1   . LEU B 1 274 ? 32.562  -40.592 2.399   1.00 10.78 ? 485 LEU B CD1   1 
ATOM   4911 C CD2   . LEU B 1 274 ? 32.141  -38.838 4.257   1.00 14.57 ? 485 LEU B CD2   1 
ATOM   4912 N N     . LEU B 1 275 ? 31.233  -35.341 1.800   1.00 11.69 ? 486 LEU B N     1 
ATOM   4913 C CA    . LEU B 1 275 ? 31.577  -34.142 1.058   1.00 11.71 ? 486 LEU B CA    1 
ATOM   4914 C C     . LEU B 1 275 ? 33.069  -34.146 0.745   1.00 11.24 ? 486 LEU B C     1 
ATOM   4915 O O     . LEU B 1 275 ? 33.880  -34.404 1.613   1.00 12.00 ? 486 LEU B O     1 
ATOM   4916 C CB    . LEU B 1 275 ? 31.228  -32.911 1.893   1.00 10.65 ? 486 LEU B CB    1 
ATOM   4917 C CG    . LEU B 1 275 ? 31.362  -31.515 1.274   1.00 12.04 ? 486 LEU B CG    1 
ATOM   4918 C CD1   . LEU B 1 275 ? 30.399  -31.331 0.117   1.00 9.25  ? 486 LEU B CD1   1 
ATOM   4919 C CD2   . LEU B 1 275 ? 31.065  -30.501 2.371   1.00 12.85 ? 486 LEU B CD2   1 
ATOM   4920 N N     . LEU B 1 276 ? 33.399  -33.858 -0.506  1.00 11.18 ? 487 LEU B N     1 
ATOM   4921 C CA    . LEU B 1 276 ? 34.750  -33.548 -0.887  1.00 11.07 ? 487 LEU B CA    1 
ATOM   4922 C C     . LEU B 1 276 ? 34.860  -32.039 -1.156  1.00 10.57 ? 487 LEU B C     1 
ATOM   4923 O O     . LEU B 1 276 ? 33.994  -31.437 -1.792  1.00 10.28 ? 487 LEU B O     1 
ATOM   4924 C CB    . LEU B 1 276 ? 35.192  -34.379 -2.107  1.00 11.24 ? 487 LEU B CB    1 
ATOM   4925 C CG    . LEU B 1 276 ? 35.578  -35.832 -1.832  1.00 11.68 ? 487 LEU B CG    1 
ATOM   4926 C CD1   . LEU B 1 276 ? 35.928  -36.493 -3.172  1.00 12.80 ? 487 LEU B CD1   1 
ATOM   4927 C CD2   . LEU B 1 276 ? 36.727  -35.982 -0.794  1.00 11.40 ? 487 LEU B CD2   1 
ATOM   4928 N N     . SER B 1 277 ? 35.933  -31.445 -0.633  1.00 10.90 ? 488 SER B N     1 
ATOM   4929 C CA    . SER B 1 277 ? 36.186  -30.006 -0.746  1.00 10.75 ? 488 SER B CA    1 
ATOM   4930 C C     . SER B 1 277 ? 37.634  -29.775 -1.018  1.00 11.06 ? 488 SER B C     1 
ATOM   4931 O O     . SER B 1 277 ? 38.493  -30.466 -0.492  1.00 11.20 ? 488 SER B O     1 
ATOM   4932 C CB    . SER B 1 277 ? 35.870  -29.266 0.552   1.00 10.29 ? 488 SER B CB    1 
ATOM   4933 O OG    . SER B 1 277 ? 34.523  -29.397 0.910   1.00 9.23  ? 488 SER B OG    1 
ATOM   4934 N N     . GLU B 1 278 ? 37.892  -28.744 -1.791  1.00 11.99 ? 489 GLU B N     1 
ATOM   4935 C CA    . GLU B 1 278 ? 39.239  -28.237 -1.964  1.00 13.56 ? 489 GLU B CA    1 
ATOM   4936 C C     . GLU B 1 278 ? 39.637  -27.422 -0.733  1.00 13.82 ? 489 GLU B C     1 
ATOM   4937 O O     . GLU B 1 278 ? 38.916  -26.523 -0.348  1.00 15.36 ? 489 GLU B O     1 
ATOM   4938 C CB    . GLU B 1 278 ? 39.300  -27.419 -3.247  1.00 13.28 ? 489 GLU B CB    1 
ATOM   4939 C CG    . GLU B 1 278 ? 38.903  -28.295 -4.475  1.00 17.04 ? 489 GLU B CG    1 
ATOM   4940 C CD    . GLU B 1 278 ? 39.098  -27.620 -5.813  1.00 20.76 ? 489 GLU B CD    1 
ATOM   4941 O OE1   . GLU B 1 278 ? 39.126  -26.379 -5.851  1.00 22.82 ? 489 GLU B OE1   1 
ATOM   4942 O OE2   . GLU B 1 278 ? 39.201  -28.346 -6.826  1.00 23.56 ? 489 GLU B OE2   1 
ATOM   4943 N N     . VAL B 1 279 ? 40.744  -27.793 -0.086  1.00 15.03 ? 490 VAL B N     1 
ATOM   4944 C CA    . VAL B 1 279 ? 41.164  -27.143 1.143   1.00 14.33 ? 490 VAL B CA    1 
ATOM   4945 C C     . VAL B 1 279 ? 42.537  -26.526 0.928   1.00 14.94 ? 490 VAL B C     1 
ATOM   4946 O O     . VAL B 1 279 ? 43.507  -27.213 0.614   1.00 13.58 ? 490 VAL B O     1 
ATOM   4947 C CB    . VAL B 1 279 ? 41.129  -28.084 2.336   1.00 14.83 ? 490 VAL B CB    1 
ATOM   4948 C CG1   . VAL B 1 279 ? 41.345  -27.291 3.650   1.00 13.45 ? 490 VAL B CG1   1 
ATOM   4949 C CG2   . VAL B 1 279 ? 39.769  -28.816 2.392   1.00 14.56 ? 490 VAL B CG2   1 
ATOM   4950 N N     . ALA B 1 280 ? 42.582  -25.204 1.063   1.00 14.91 ? 491 ALA B N     1 
ATOM   4951 C CA    . ALA B 1 280 ? 43.810  -24.457 0.929   1.00 15.14 ? 491 ALA B CA    1 
ATOM   4952 C C     . ALA B 1 280 ? 44.574  -24.499 2.242   1.00 15.25 ? 491 ALA B C     1 
ATOM   4953 O O     . ALA B 1 280 ? 44.423  -23.601 3.082   1.00 16.11 ? 491 ALA B O     1 
ATOM   4954 C CB    . ALA B 1 280 ? 43.492  -23.014 0.556   1.00 14.17 ? 491 ALA B CB    1 
ATOM   4955 N N     . LEU B 1 281 ? 45.403  -25.506 2.419   1.00 15.37 ? 492 LEU B N     1 
ATOM   4956 C CA    . LEU B 1 281 ? 46.064  -25.707 3.698   1.00 16.53 ? 492 LEU B CA    1 
ATOM   4957 C C     . LEU B 1 281 ? 47.216  -24.733 3.942   1.00 17.16 ? 492 LEU B C     1 
ATOM   4958 O O     . LEU B 1 281 ? 47.492  -24.381 5.083   1.00 17.09 ? 492 LEU B O     1 
ATOM   4959 C CB    . LEU B 1 281 ? 46.584  -27.146 3.841   1.00 16.32 ? 492 LEU B CB    1 
ATOM   4960 C CG    . LEU B 1 281 ? 45.544  -28.252 3.828   1.00 15.94 ? 492 LEU B CG    1 
ATOM   4961 C CD1   . LEU B 1 281 ? 46.238  -29.579 3.686   1.00 15.06 ? 492 LEU B CD1   1 
ATOM   4962 C CD2   . LEU B 1 281 ? 44.728  -28.180 5.128   1.00 16.97 ? 492 LEU B CD2   1 
ATOM   4963 N N     . GLY B 1 282 ? 47.888  -24.306 2.875   1.00 17.96 ? 493 GLY B N     1 
ATOM   4964 C CA    . GLY B 1 282 ? 49.119  -23.534 3.017   1.00 18.57 ? 493 GLY B CA    1 
ATOM   4965 C C     . GLY B 1 282 ? 50.118  -24.281 3.888   1.00 19.58 ? 493 GLY B C     1 
ATOM   4966 O O     . GLY B 1 282 ? 50.245  -25.512 3.797   1.00 19.33 ? 493 GLY B O     1 
ATOM   4967 N N     . GLN B 1 283 ? 50.816  -23.539 4.750   1.00 20.08 ? 494 GLN B N     1 
ATOM   4968 C CA    . GLN B 1 283 ? 51.706  -24.139 5.729   1.00 21.02 ? 494 GLN B CA    1 
ATOM   4969 C C     . GLN B 1 283 ? 50.868  -24.655 6.875   1.00 20.70 ? 494 GLN B C     1 
ATOM   4970 O O     . GLN B 1 283 ? 50.069  -23.901 7.443   1.00 20.47 ? 494 GLN B O     1 
ATOM   4971 C CB    . GLN B 1 283 ? 52.722  -23.117 6.288   1.00 21.42 ? 494 GLN B CB    1 
ATOM   4972 C CG    . GLN B 1 283 ? 53.783  -22.628 5.309   1.00 25.61 ? 494 GLN B CG    1 
ATOM   4973 C CD    . GLN B 1 283 ? 54.651  -23.755 4.727   1.00 30.80 ? 494 GLN B CD    1 
ATOM   4974 O OE1   . GLN B 1 283 ? 54.491  -24.137 3.561   1.00 34.82 ? 494 GLN B OE1   1 
ATOM   4975 N NE2   . GLN B 1 283 ? 55.554  -24.294 5.538   1.00 33.07 ? 494 GLN B NE2   1 
ATOM   4976 N N     . CYS B 1 284 ? 51.076  -25.911 7.241   1.00 21.05 ? 495 CYS B N     1 
ATOM   4977 C CA    . CYS B 1 284 ? 50.369  -26.517 8.377   1.00 21.77 ? 495 CYS B CA    1 
ATOM   4978 C C     . CYS B 1 284 ? 51.193  -26.364 9.630   1.00 21.41 ? 495 CYS B C     1 
ATOM   4979 O O     . CYS B 1 284 ? 52.401  -26.586 9.592   1.00 21.17 ? 495 CYS B O     1 
ATOM   4980 C CB    . CYS B 1 284 ? 50.175  -28.013 8.154   1.00 21.86 ? 495 CYS B CB    1 
ATOM   4981 S SG    . CYS B 1 284 ? 49.229  -28.447 6.717   1.00 23.37 ? 495 CYS B SG    1 
ATOM   4982 N N     . ASN B 1 285 ? 50.554  -26.005 10.739  1.00 21.73 ? 496 ASN B N     1 
ATOM   4983 C CA    . ASN B 1 285 ? 51.173  -26.139 12.039  1.00 21.26 ? 496 ASN B CA    1 
ATOM   4984 C C     . ASN B 1 285 ? 50.885  -27.575 12.433  1.00 21.86 ? 496 ASN B C     1 
ATOM   4985 O O     . ASN B 1 285 ? 49.719  -27.934 12.667  1.00 21.24 ? 496 ASN B O     1 
ATOM   4986 C CB    . ASN B 1 285 ? 50.589  -25.159 13.061  1.00 21.49 ? 496 ASN B CB    1 
ATOM   4987 C CG    . ASN B 1 285 ? 51.417  -25.090 14.354  1.00 21.49 ? 496 ASN B CG    1 
ATOM   4988 O OD1   . ASN B 1 285 ? 52.642  -25.066 14.304  1.00 21.97 ? 496 ASN B OD1   1 
ATOM   4989 N ND2   . ASN B 1 285 ? 50.751  -25.091 15.504  1.00 21.39 ? 496 ASN B ND2   1 
ATOM   4990 N N     . GLU B 1 286 ? 51.924  -28.407 12.480  1.00 21.83 ? 497 GLU B N     1 
ATOM   4991 C CA    . GLU B 1 286 ? 51.745  -29.834 12.769  1.00 22.69 ? 497 GLU B CA    1 
ATOM   4992 C C     . GLU B 1 286 ? 51.756  -30.107 14.262  1.00 22.93 ? 497 GLU B C     1 
ATOM   4993 O O     . GLU B 1 286 ? 52.712  -29.738 14.922  1.00 22.46 ? 497 GLU B O     1 
ATOM   4994 C CB    . GLU B 1 286 ? 52.834  -30.668 12.094  1.00 23.05 ? 497 GLU B CB    1 
ATOM   4995 C CG    . GLU B 1 286 ? 52.911  -30.436 10.597  1.00 24.22 ? 497 GLU B CG    1 
ATOM   4996 C CD    . GLU B 1 286 ? 53.857  -31.393 9.867   1.00 26.87 ? 497 GLU B CD    1 
ATOM   4997 O OE1   . GLU B 1 286 ? 54.785  -31.954 10.498  1.00 28.44 ? 497 GLU B OE1   1 
ATOM   4998 O OE2   . GLU B 1 286 ? 53.654  -31.567 8.647   1.00 28.68 ? 497 GLU B OE2   1 
ATOM   4999 N N     . LEU B 1 287 ? 50.715  -30.787 14.768  1.00 22.71 ? 498 LEU B N     1 
ATOM   5000 C CA    . LEU B 1 287 ? 50.591  -31.100 16.188  1.00 23.30 ? 498 LEU B CA    1 
ATOM   5001 C C     . LEU B 1 287 ? 50.365  -32.605 16.405  1.00 24.03 ? 498 LEU B C     1 
ATOM   5002 O O     . LEU B 1 287 ? 49.704  -33.268 15.619  1.00 23.27 ? 498 LEU B O     1 
ATOM   5003 C CB    . LEU B 1 287 ? 49.451  -30.283 16.842  1.00 22.44 ? 498 LEU B CB    1 
ATOM   5004 C CG    . LEU B 1 287 ? 49.541  -28.748 16.849  1.00 23.00 ? 498 LEU B CG    1 
ATOM   5005 C CD1   . LEU B 1 287 ? 48.265  -28.136 17.446  1.00 22.62 ? 498 LEU B CD1   1 
ATOM   5006 C CD2   . LEU B 1 287 ? 50.794  -28.190 17.578  1.00 22.20 ? 498 LEU B CD2   1 
ATOM   5007 N N     . LEU B 1 288 ? 50.902  -33.116 17.502  1.00 25.43 ? 499 LEU B N     1 
ATOM   5008 C CA    . LEU B 1 288 ? 50.884  -34.558 17.815  1.00 26.34 ? 499 LEU B CA    1 
ATOM   5009 C C     . LEU B 1 288 ? 49.705  -34.971 18.699  1.00 26.27 ? 499 LEU B C     1 
ATOM   5010 O O     . LEU B 1 288 ? 49.377  -36.155 18.778  1.00 26.86 ? 499 LEU B O     1 
ATOM   5011 C CB    . LEU B 1 288 ? 52.208  -34.972 18.505  1.00 27.03 ? 499 LEU B CB    1 
ATOM   5012 C CG    . LEU B 1 288 ? 53.513  -34.812 17.695  1.00 28.17 ? 499 LEU B CG    1 
ATOM   5013 C CD1   . LEU B 1 288 ? 54.776  -35.082 18.544  1.00 29.56 ? 499 LEU B CD1   1 
ATOM   5014 C CD2   . LEU B 1 288 ? 53.507  -35.735 16.500  1.00 30.47 ? 499 LEU B CD2   1 
ATOM   5015 N N     . GLU B 1 289 ? 49.095  -34.003 19.377  1.00 25.73 ? 500 GLU B N     1 
ATOM   5016 C CA    . GLU B 1 289 ? 48.018  -34.278 20.333  1.00 25.81 ? 500 GLU B CA    1 
ATOM   5017 C C     . GLU B 1 289 ? 47.131  -33.076 20.452  1.00 24.69 ? 500 GLU B C     1 
ATOM   5018 O O     . GLU B 1 289 ? 47.515  -31.969 20.046  1.00 24.06 ? 500 GLU B O     1 
ATOM   5019 C CB    . GLU B 1 289 ? 48.565  -34.605 21.716  1.00 26.34 ? 500 GLU B CB    1 
ATOM   5020 C CG    . GLU B 1 289 ? 49.437  -33.497 22.311  1.00 28.53 ? 500 GLU B CG    1 
ATOM   5021 C CD    . GLU B 1 289 ? 50.139  -33.914 23.597  1.00 31.32 ? 500 GLU B CD    1 
ATOM   5022 O OE1   . GLU B 1 289 ? 50.035  -35.109 23.967  1.00 31.25 ? 500 GLU B OE1   1 
ATOM   5023 O OE2   . GLU B 1 289 ? 50.788  -33.035 24.235  1.00 33.07 ? 500 GLU B OE2   1 
ATOM   5024 N N     . ALA B 1 290 ? 45.961  -33.312 21.048  1.00 23.55 ? 501 ALA B N     1 
ATOM   5025 C CA    . ALA B 1 290 ? 44.904  -32.318 21.150  1.00 22.53 ? 501 ALA B CA    1 
ATOM   5026 C C     . ALA B 1 290 ? 45.389  -31.042 21.840  1.00 21.32 ? 501 ALA B C     1 
ATOM   5027 O O     . ALA B 1 290 ? 46.113  -31.090 22.836  1.00 20.73 ? 501 ALA B O     1 
ATOM   5028 C CB    . ALA B 1 290 ? 43.722  -32.897 21.892  1.00 22.23 ? 501 ALA B CB    1 
ATOM   5029 N N     . ASN B 1 291 ? 45.004  -29.910 21.277  1.00 20.08 ? 502 ASN B N     1 
ATOM   5030 C CA    . ASN B 1 291 ? 45.160  -28.624 21.925  1.00 19.33 ? 502 ASN B CA    1 
ATOM   5031 C C     . ASN B 1 291 ? 44.060  -27.693 21.415  1.00 18.51 ? 502 ASN B C     1 
ATOM   5032 O O     . ASN B 1 291 ? 44.157  -27.125 20.330  1.00 17.31 ? 502 ASN B O     1 
ATOM   5033 C CB    . ASN B 1 291 ? 46.536  -28.010 21.671  1.00 19.97 ? 502 ASN B CB    1 
ATOM   5034 C CG    . ASN B 1 291 ? 46.736  -26.690 22.428  1.00 20.87 ? 502 ASN B CG    1 
ATOM   5035 O OD1   . ASN B 1 291 ? 45.811  -26.172 23.043  1.00 22.44 ? 502 ASN B OD1   1 
ATOM   5036 N ND2   . ASN B 1 291 ? 47.943  -26.162 22.395  1.00 23.62 ? 502 ASN B ND2   1 
ATOM   5037 N N     . PRO B 1 292 ? 42.986  -27.556 22.193  1.00 18.23 ? 503 PRO B N     1 
ATOM   5038 C CA    . PRO B 1 292 ? 41.883  -26.714 21.798  1.00 18.12 ? 503 PRO B CA    1 
ATOM   5039 C C     . PRO B 1 292 ? 42.246  -25.255 21.547  1.00 17.47 ? 503 PRO B C     1 
ATOM   5040 O O     . PRO B 1 292 ? 41.496  -24.582 20.892  1.00 17.08 ? 503 PRO B O     1 
ATOM   5041 C CB    . PRO B 1 292 ? 40.936  -26.824 22.990  1.00 17.79 ? 503 PRO B CB    1 
ATOM   5042 C CG    . PRO B 1 292 ? 41.149  -28.210 23.456  1.00 18.90 ? 503 PRO B CG    1 
ATOM   5043 C CD    . PRO B 1 292 ? 42.640  -28.380 23.370  1.00 19.29 ? 503 PRO B CD    1 
ATOM   5044 N N     . LYS B 1 293 ? 43.374  -24.775 22.059  1.00 17.89 ? 504 LYS B N     1 
ATOM   5045 C CA    . LYS B 1 293 ? 43.867  -23.431 21.727  1.00 19.31 ? 504 LYS B CA    1 
ATOM   5046 C C     . LYS B 1 293 ? 44.821  -23.424 20.514  1.00 19.30 ? 504 LYS B C     1 
ATOM   5047 O O     . LYS B 1 293 ? 45.521  -22.428 20.271  1.00 19.00 ? 504 LYS B O     1 
ATOM   5048 C CB    . LYS B 1 293 ? 44.580  -22.808 22.928  1.00 20.10 ? 504 LYS B CB    1 
ATOM   5049 C CG    . LYS B 1 293 ? 43.670  -22.581 24.143  1.00 23.46 ? 504 LYS B CG    1 
ATOM   5050 C CD    . LYS B 1 293 ? 44.252  -21.530 25.125  1.00 27.84 ? 504 LYS B CD    1 
ATOM   5051 C CE    . LYS B 1 293 ? 45.228  -22.161 26.115  1.00 29.83 ? 504 LYS B CE    1 
ATOM   5052 N NZ    . LYS B 1 293 ? 44.499  -23.117 27.017  1.00 30.65 ? 504 LYS B NZ    1 
ATOM   5053 N N     . ALA B 1 294 ? 44.816  -24.502 19.728  1.00 18.81 ? 505 ALA B N     1 
ATOM   5054 C CA    . ALA B 1 294 ? 45.681  -24.589 18.529  1.00 18.82 ? 505 ALA B CA    1 
ATOM   5055 C C     . ALA B 1 294 ? 45.621  -23.387 17.594  1.00 18.25 ? 505 ALA B C     1 
ATOM   5056 O O     . ALA B 1 294 ? 46.633  -23.038 16.972  1.00 17.81 ? 505 ALA B O     1 
ATOM   5057 C CB    . ALA B 1 294 ? 45.406  -25.891 17.732  1.00 18.92 ? 505 ALA B CB    1 
ATOM   5058 N N     . GLU B 1 295 ? 44.468  -22.736 17.490  1.00 18.53 ? 506 GLU B N     1 
ATOM   5059 C CA    . GLU B 1 295 ? 44.318  -21.628 16.549  1.00 18.82 ? 506 GLU B CA    1 
ATOM   5060 C C     . GLU B 1 295 ? 45.318  -20.496 16.821  1.00 20.10 ? 506 GLU B C     1 
ATOM   5061 O O     . GLU B 1 295 ? 45.875  -19.899 15.894  1.00 20.37 ? 506 GLU B O     1 
ATOM   5062 C CB    . GLU B 1 295 ? 42.885  -21.059 16.545  1.00 18.73 ? 506 GLU B CB    1 
ATOM   5063 C CG    . GLU B 1 295 ? 42.693  -20.123 15.381  1.00 17.74 ? 506 GLU B CG    1 
ATOM   5064 C CD    . GLU B 1 295 ? 41.340  -19.508 15.266  1.00 18.39 ? 506 GLU B CD    1 
ATOM   5065 O OE1   . GLU B 1 295 ? 40.395  -19.847 16.025  1.00 17.66 ? 506 GLU B OE1   1 
ATOM   5066 O OE2   . GLU B 1 295 ? 41.230  -18.656 14.379  1.00 17.98 ? 506 GLU B OE2   1 
ATOM   5067 N N     . GLY B 1 296 ? 45.541  -20.201 18.092  1.00 21.14 ? 507 GLY B N     1 
ATOM   5068 C CA    . GLY B 1 296 ? 46.473  -19.134 18.478  1.00 22.31 ? 507 GLY B CA    1 
ATOM   5069 C C     . GLY B 1 296 ? 47.940  -19.516 18.312  1.00 22.99 ? 507 GLY B C     1 
ATOM   5070 O O     . GLY B 1 296 ? 48.811  -18.681 18.444  1.00 23.10 ? 507 GLY B O     1 
ATOM   5071 N N     . LEU B 1 297 ? 48.206  -20.775 17.999  1.00 24.13 ? 508 LEU B N     1 
ATOM   5072 C CA    . LEU B 1 297 ? 49.562  -21.251 17.748  1.00 24.68 ? 508 LEU B CA    1 
ATOM   5073 C C     . LEU B 1 297 ? 49.964  -21.159 16.259  1.00 25.14 ? 508 LEU B C     1 
ATOM   5074 O O     . LEU B 1 297 ? 51.131  -21.403 15.907  1.00 25.17 ? 508 LEU B O     1 
ATOM   5075 C CB    . LEU B 1 297 ? 49.710  -22.672 18.295  1.00 25.14 ? 508 LEU B CB    1 
ATOM   5076 C CG    . LEU B 1 297 ? 49.885  -22.803 19.832  1.00 28.28 ? 508 LEU B CG    1 
ATOM   5077 C CD1   . LEU B 1 297 ? 48.799  -22.074 20.637  1.00 32.07 ? 508 LEU B CD1   1 
ATOM   5078 C CD2   . LEU B 1 297 ? 49.950  -24.268 20.252  1.00 28.91 ? 508 LEU B CD2   1 
ATOM   5079 N N     . LEU B 1 298 ? 49.029  -20.768 15.383  1.00 24.91 ? 509 LEU B N     1 
ATOM   5080 C CA    . LEU B 1 298 ? 49.314  -20.704 13.935  1.00 24.98 ? 509 LEU B CA    1 
ATOM   5081 C C     . LEU B 1 298 ? 50.517  -19.804 13.622  1.00 26.35 ? 509 LEU B C     1 
ATOM   5082 O O     . LEU B 1 298 ? 51.519  -20.262 13.036  1.00 25.41 ? 509 LEU B O     1 
ATOM   5083 C CB    . LEU B 1 298 ? 48.089  -20.232 13.145  1.00 24.09 ? 509 LEU B CB    1 
ATOM   5084 C CG    . LEU B 1 298 ? 46.935  -21.233 13.010  1.00 22.52 ? 509 LEU B CG    1 
ATOM   5085 C CD1   . LEU B 1 298 ? 45.785  -20.634 12.188  1.00 20.71 ? 509 LEU B CD1   1 
ATOM   5086 C CD2   . LEU B 1 298 ? 47.410  -22.521 12.397  1.00 19.65 ? 509 LEU B CD2   1 
ATOM   5087 N N     . GLN B 1 299 ? 50.380  -18.536 14.023  1.00 27.63 ? 510 GLN B N     1 
ATOM   5088 C CA    . GLN B 1 299 ? 51.422  -17.513 13.942  1.00 28.62 ? 510 GLN B CA    1 
ATOM   5089 C C     . GLN B 1 299 ? 51.978  -17.370 12.542  1.00 28.66 ? 510 GLN B C     1 
ATOM   5090 O O     . GLN B 1 299 ? 53.173  -17.494 12.309  1.00 28.71 ? 510 GLN B O     1 
ATOM   5091 C CB    . GLN B 1 299 ? 52.522  -17.781 14.974  1.00 29.02 ? 510 GLN B CB    1 
ATOM   5092 C CG    . GLN B 1 299 ? 52.003  -17.545 16.409  1.00 32.09 ? 510 GLN B CG    1 
ATOM   5093 C CD    . GLN B 1 299 ? 53.058  -17.723 17.475  1.00 34.97 ? 510 GLN B CD    1 
ATOM   5094 O OE1   . GLN B 1 299 ? 54.230  -17.998 17.173  1.00 39.04 ? 510 GLN B OE1   1 
ATOM   5095 N NE2   . GLN B 1 299 ? 52.653  -17.565 18.747  1.00 36.78 ? 510 GLN B NE2   1 
ATOM   5096 N N     . GLY B 1 300 ? 51.085  -17.092 11.608  1.00 28.44 ? 511 GLY B N     1 
ATOM   5097 C CA    . GLY B 1 300 ? 51.496  -16.936 10.231  1.00 28.55 ? 511 GLY B CA    1 
ATOM   5098 C C     . GLY B 1 300 ? 51.149  -18.161 9.410   1.00 27.62 ? 511 GLY B C     1 
ATOM   5099 O O     . GLY B 1 300 ? 50.841  -18.034 8.229   1.00 28.35 ? 511 GLY B O     1 
ATOM   5100 N N     . LYS B 1 301 ? 51.184  -19.343 10.032  1.00 26.49 ? 512 LYS B N     1 
ATOM   5101 C CA    . LYS B 1 301 ? 50.742  -20.561 9.351   1.00 25.06 ? 512 LYS B CA    1 
ATOM   5102 C C     . LYS B 1 301 ? 49.234  -20.503 9.063   1.00 23.96 ? 512 LYS B C     1 
ATOM   5103 O O     . LYS B 1 301 ? 48.504  -19.679 9.624   1.00 24.25 ? 512 LYS B O     1 
ATOM   5104 C CB    . LYS B 1 301 ? 51.149  -21.797 10.159  1.00 25.31 ? 512 LYS B CB    1 
ATOM   5105 C CG    . LYS B 1 301 ? 52.673  -22.007 10.168  1.00 26.09 ? 512 LYS B CG    1 
ATOM   5106 C CD    . LYS B 1 301 ? 53.110  -23.107 11.101  1.00 28.27 ? 512 LYS B CD    1 
ATOM   5107 C CE    . LYS B 1 301 ? 54.654  -23.126 11.316  1.00 29.09 ? 512 LYS B CE    1 
ATOM   5108 N NZ    . LYS B 1 301 ? 55.043  -24.156 12.366  1.00 28.90 ? 512 LYS B NZ    1 
ATOM   5109 N N     . HIS B 1 302 ? 48.768  -21.367 8.166   1.00 22.15 ? 513 HIS B N     1 
ATOM   5110 C CA    . HIS B 1 302 ? 47.422  -21.250 7.626   1.00 20.83 ? 513 HIS B CA    1 
ATOM   5111 C C     . HIS B 1 302 ? 46.455  -22.355 8.072   1.00 19.37 ? 513 HIS B C     1 
ATOM   5112 O O     . HIS B 1 302 ? 45.238  -22.226 7.857   1.00 18.29 ? 513 HIS B O     1 
ATOM   5113 C CB    . HIS B 1 302 ? 47.484  -21.207 6.106   1.00 20.86 ? 513 HIS B CB    1 
ATOM   5114 C CG    . HIS B 1 302 ? 48.538  -20.288 5.578   1.00 21.32 ? 513 HIS B CG    1 
ATOM   5115 N ND1   . HIS B 1 302 ? 49.819  -20.714 5.299   1.00 22.37 ? 513 HIS B ND1   1 
ATOM   5116 C CD2   . HIS B 1 302 ? 48.511  -18.966 5.290   1.00 22.06 ? 513 HIS B CD2   1 
ATOM   5117 C CE1   . HIS B 1 302 ? 50.531  -19.699 4.846   1.00 21.93 ? 513 HIS B CE1   1 
ATOM   5118 N NE2   . HIS B 1 302 ? 49.760  -18.627 4.826   1.00 21.79 ? 513 HIS B NE2   1 
ATOM   5119 N N     . SER B 1 303 ? 46.985  -23.423 8.663   1.00 17.65 ? 514 SER B N     1 
ATOM   5120 C CA    . SER B 1 303 ? 46.162  -24.540 9.093   1.00 16.92 ? 514 SER B CA    1 
ATOM   5121 C C     . SER B 1 303 ? 46.837  -25.358 10.152  1.00 16.91 ? 514 SER B C     1 
ATOM   5122 O O     . SER B 1 303 ? 48.038  -25.200 10.427  1.00 17.40 ? 514 SER B O     1 
ATOM   5123 C CB    . SER B 1 303 ? 45.836  -25.429 7.900   1.00 17.24 ? 514 SER B CB    1 
ATOM   5124 O OG    . SER B 1 303 ? 47.029  -25.912 7.319   1.00 15.60 ? 514 SER B OG    1 
ATOM   5125 N N     . THR B 1 304 ? 46.052  -26.220 10.776  1.00 16.56 ? 515 THR B N     1 
ATOM   5126 C CA    . THR B 1 304 ? 46.562  -27.143 11.775  1.00 16.18 ? 515 THR B CA    1 
ATOM   5127 C C     . THR B 1 304 ? 46.425  -28.513 11.156  1.00 17.38 ? 515 THR B C     1 
ATOM   5128 O O     . THR B 1 304 ? 45.413  -28.801 10.502  1.00 16.69 ? 515 THR B O     1 
ATOM   5129 C CB    . THR B 1 304 ? 45.757  -27.104 13.074  1.00 15.96 ? 515 THR B CB    1 
ATOM   5130 O OG1   . THR B 1 304 ? 45.930  -25.825 13.714  1.00 14.18 ? 515 THR B OG1   1 
ATOM   5131 C CG2   . THR B 1 304 ? 46.229  -28.211 13.992  1.00 13.12 ? 515 THR B CG2   1 
ATOM   5132 N N     . LYS B 1 305 ? 47.455  -29.344 11.323  1.00 17.48 ? 516 LYS B N     1 
ATOM   5133 C CA    . LYS B 1 305 ? 47.353  -30.743 10.948  1.00 17.84 ? 516 LYS B CA    1 
ATOM   5134 C C     . LYS B 1 305 ? 47.628  -31.541 12.188  1.00 18.14 ? 516 LYS B C     1 
ATOM   5135 O O     . LYS B 1 305 ? 48.699  -31.445 12.772  1.00 18.34 ? 516 LYS B O     1 
ATOM   5136 C CB    . LYS B 1 305 ? 48.351  -31.089 9.849   1.00 18.03 ? 516 LYS B CB    1 
ATOM   5137 C CG    . LYS B 1 305 ? 48.277  -32.515 9.322   1.00 19.15 ? 516 LYS B CG    1 
ATOM   5138 C CD    . LYS B 1 305 ? 49.249  -32.698 8.146   1.00 20.94 ? 516 LYS B CD    1 
ATOM   5139 C CE    . LYS B 1 305 ? 49.290  -34.161 7.686   1.00 21.92 ? 516 LYS B CE    1 
ATOM   5140 N NZ    . LYS B 1 305 ? 50.443  -34.480 6.810   1.00 22.12 ? 516 LYS B NZ    1 
ATOM   5141 N N     . GLY B 1 306 ? 46.646  -32.311 12.618  1.00 18.12 ? 517 GLY B N     1 
ATOM   5142 C CA    . GLY B 1 306 ? 46.882  -33.332 13.619  1.00 18.63 ? 517 GLY B CA    1 
ATOM   5143 C C     . GLY B 1 306 ? 47.518  -34.510 12.895  1.00 19.63 ? 517 GLY B C     1 
ATOM   5144 O O     . GLY B 1 306 ? 46.966  -35.011 11.908  1.00 19.00 ? 517 GLY B O     1 
ATOM   5145 N N     . LEU B 1 307 ? 48.677  -34.949 13.380  1.00 20.90 ? 518 LEU B N     1 
ATOM   5146 C CA    . LEU B 1 307 ? 49.435  -36.006 12.709  1.00 21.93 ? 518 LEU B CA    1 
ATOM   5147 C C     . LEU B 1 307 ? 48.982  -37.370 13.182  1.00 22.14 ? 518 LEU B C     1 
ATOM   5148 O O     . LEU B 1 307 ? 48.947  -37.618 14.376  1.00 22.16 ? 518 LEU B O     1 
ATOM   5149 C CB    . LEU B 1 307 ? 50.939  -35.829 12.970  1.00 22.06 ? 518 LEU B CB    1 
ATOM   5150 C CG    . LEU B 1 307 ? 51.567  -34.556 12.379  1.00 22.10 ? 518 LEU B CG    1 
ATOM   5151 C CD1   . LEU B 1 307 ? 53.035  -34.344 12.881  1.00 23.09 ? 518 LEU B CD1   1 
ATOM   5152 C CD2   . LEU B 1 307 ? 51.489  -34.553 10.837  1.00 20.43 ? 518 LEU B CD2   1 
ATOM   5153 N N     . GLY B 1 308 ? 48.617  -38.253 12.250  1.00 22.88 ? 519 GLY B N     1 
ATOM   5154 C CA    . GLY B 1 308 ? 48.185  -39.609 12.604  1.00 23.09 ? 519 GLY B CA    1 
ATOM   5155 C C     . GLY B 1 308 ? 49.271  -40.648 12.393  1.00 23.73 ? 519 GLY B C     1 
ATOM   5156 O O     . GLY B 1 308 ? 50.210  -40.397 11.658  1.00 23.81 ? 519 GLY B O     1 
ATOM   5157 N N     . LYS B 1 309 ? 49.151  -41.799 13.058  1.00 25.45 ? 520 LYS B N     1 
ATOM   5158 C CA    . LYS B 1 309 ? 50.099  -42.920 12.889  1.00 26.51 ? 520 LYS B CA    1 
ATOM   5159 C C     . LYS B 1 309 ? 50.101  -43.424 11.456  1.00 26.52 ? 520 LYS B C     1 
ATOM   5160 O O     . LYS B 1 309 ? 51.118  -43.914 10.983  1.00 27.64 ? 520 LYS B O     1 
ATOM   5161 C CB    . LYS B 1 309 ? 49.711  -44.149 13.730  1.00 27.55 ? 520 LYS B CB    1 
ATOM   5162 C CG    . LYS B 1 309 ? 49.762  -44.081 15.250  1.00 30.12 ? 520 LYS B CG    1 
ATOM   5163 C CD    . LYS B 1 309 ? 48.923  -45.291 15.805  1.00 34.19 ? 520 LYS B CD    1 
ATOM   5164 C CE    . LYS B 1 309 ? 48.843  -45.394 17.340  1.00 37.54 ? 520 LYS B CE    1 
ATOM   5165 N NZ    . LYS B 1 309 ? 49.766  -46.473 17.868  1.00 40.16 ? 520 LYS B NZ    1 
ATOM   5166 N N     . MET B 1 310 ? 48.938  -43.388 10.804  1.00 26.09 ? 521 MET B N     1 
ATOM   5167 C CA    . MET B 1 310 ? 48.757  -43.984 9.489   1.00 26.23 ? 521 MET B CA    1 
ATOM   5168 C C     . MET B 1 310 ? 48.146  -42.980 8.545   1.00 25.57 ? 521 MET B C     1 
ATOM   5169 O O     . MET B 1 310 ? 47.162  -42.299 8.892   1.00 24.60 ? 521 MET B O     1 
ATOM   5170 C CB    . MET B 1 310 ? 47.860  -45.216 9.575   1.00 26.69 ? 521 MET B CB    1 
ATOM   5171 C CG    . MET B 1 310 ? 48.465  -46.389 10.338  1.00 29.96 ? 521 MET B CG    1 
ATOM   5172 S SD    . MET B 1 310 ? 49.487  -47.438 9.281   1.00 36.27 ? 521 MET B SD    1 
ATOM   5173 C CE    . MET B 1 310 ? 48.198  -48.343 8.400   1.00 33.16 ? 521 MET B CE    1 
ATOM   5174 N N     . ALA B 1 311 ? 48.730  -42.880 7.355   1.00 25.08 ? 522 ALA B N     1 
ATOM   5175 C CA    . ALA B 1 311 ? 48.224  -41.985 6.322   1.00 25.43 ? 522 ALA B CA    1 
ATOM   5176 C C     . ALA B 1 311 ? 48.603  -42.407 4.899   1.00 25.70 ? 522 ALA B C     1 
ATOM   5177 O O     . ALA B 1 311 ? 49.523  -43.198 4.696   1.00 25.31 ? 522 ALA B O     1 
ATOM   5178 C CB    . ALA B 1 311 ? 48.686  -40.544 6.571   1.00 24.90 ? 522 ALA B CB    1 
ATOM   5179 N N     . PRO B 1 312 ? 47.868  -41.874 3.910   1.00 26.49 ? 523 PRO B N     1 
ATOM   5180 C CA    . PRO B 1 312 ? 48.214  -42.014 2.508   1.00 27.48 ? 523 PRO B CA    1 
ATOM   5181 C C     . PRO B 1 312 ? 49.600  -41.446 2.267   1.00 28.29 ? 523 PRO B C     1 
ATOM   5182 O O     . PRO B 1 312 ? 49.929  -40.434 2.858   1.00 28.20 ? 523 PRO B O     1 
ATOM   5183 C CB    . PRO B 1 312 ? 47.180  -41.151 1.798   1.00 27.29 ? 523 PRO B CB    1 
ATOM   5184 C CG    . PRO B 1 312 ? 46.025  -41.102 2.716   1.00 27.52 ? 523 PRO B CG    1 
ATOM   5185 C CD    . PRO B 1 312 ? 46.543  -41.266 4.102   1.00 26.35 ? 523 PRO B CD    1 
ATOM   5186 N N     . SER B 1 313 ? 50.404  -42.084 1.420   1.00 29.58 ? 524 SER B N     1 
ATOM   5187 C CA    . SER B 1 313 ? 51.769  -41.595 1.145   1.00 30.39 ? 524 SER B CA    1 
ATOM   5188 C C     . SER B 1 313 ? 51.870  -40.970 -0.249  1.00 30.69 ? 524 SER B C     1 
ATOM   5189 O O     . SER B 1 313 ? 51.211  -41.416 -1.195  1.00 30.31 ? 524 SER B O     1 
ATOM   5190 C CB    . SER B 1 313 ? 52.796  -42.723 1.306   1.00 31.04 ? 524 SER B CB    1 
ATOM   5191 O OG    . SER B 1 313 ? 52.611  -43.720 0.314   1.00 32.28 ? 524 SER B OG    1 
ATOM   5192 N N     . SER B 1 314 ? 52.703  -39.935 -0.354  1.00 30.87 ? 525 SER B N     1 
ATOM   5193 C CA    . SER B 1 314 ? 52.842  -39.126 -1.572  1.00 31.43 ? 525 SER B CA    1 
ATOM   5194 C C     . SER B 1 314 ? 53.055  -39.904 -2.865  1.00 31.21 ? 525 SER B C     1 
ATOM   5195 O O     . SER B 1 314 ? 52.592  -39.472 -3.934  1.00 30.93 ? 525 SER B O     1 
ATOM   5196 C CB    . SER B 1 314 ? 53.988  -38.110 -1.409  1.00 31.84 ? 525 SER B CB    1 
ATOM   5197 O OG    . SER B 1 314 ? 54.513  -37.716 -2.688  1.00 34.54 ? 525 SER B OG    1 
ATOM   5198 N N     . ALA B 1 315 ? 53.752  -41.038 -2.772  1.00 31.42 ? 526 ALA B N     1 
ATOM   5199 C CA    . ALA B 1 315 ? 54.065  -41.864 -3.953  1.00 31.44 ? 526 ALA B CA    1 
ATOM   5200 C C     . ALA B 1 315 ? 52.805  -42.340 -4.674  1.00 31.56 ? 526 ALA B C     1 
ATOM   5201 O O     . ALA B 1 315 ? 52.856  -42.653 -5.865  1.00 31.78 ? 526 ALA B O     1 
ATOM   5202 C CB    . ALA B 1 315 ? 54.947  -43.074 -3.557  1.00 31.38 ? 526 ALA B CB    1 
ATOM   5203 N N     . HIS B 1 316 ? 51.671  -42.374 -3.965  1.00 31.18 ? 527 HIS B N     1 
ATOM   5204 C CA    . HIS B 1 316 ? 50.391  -42.781 -4.568  1.00 30.95 ? 527 HIS B CA    1 
ATOM   5205 C C     . HIS B 1 316 ? 49.438  -41.644 -4.959  1.00 29.94 ? 527 HIS B C     1 
ATOM   5206 O O     . HIS B 1 316 ? 48.379  -41.923 -5.509  1.00 29.70 ? 527 HIS B O     1 
ATOM   5207 C CB    . HIS B 1 316 ? 49.652  -43.752 -3.629  1.00 31.45 ? 527 HIS B CB    1 
ATOM   5208 C CG    . HIS B 1 316 ? 50.446  -44.966 -3.265  1.00 33.06 ? 527 HIS B CG    1 
ATOM   5209 N ND1   . HIS B 1 316 ? 50.841  -45.240 -1.971  1.00 35.48 ? 527 HIS B ND1   1 
ATOM   5210 C CD2   . HIS B 1 316 ? 50.938  -45.972 -4.030  1.00 34.84 ? 527 HIS B CD2   1 
ATOM   5211 C CE1   . HIS B 1 316 ? 51.531  -46.367 -1.952  1.00 35.81 ? 527 HIS B CE1   1 
ATOM   5212 N NE2   . HIS B 1 316 ? 51.597  -46.835 -3.187  1.00 36.55 ? 527 HIS B NE2   1 
ATOM   5213 N N     . PHE B 1 317 ? 49.786  -40.382 -4.707  1.00 29.04 ? 528 PHE B N     1 
ATOM   5214 C CA    . PHE B 1 317 ? 48.838  -39.283 -4.960  1.00 28.77 ? 528 PHE B CA    1 
ATOM   5215 C C     . PHE B 1 317 ? 48.627  -38.960 -6.438  1.00 28.27 ? 528 PHE B C     1 
ATOM   5216 O O     . PHE B 1 317 ? 49.547  -39.078 -7.235  1.00 29.20 ? 528 PHE B O     1 
ATOM   5217 C CB    . PHE B 1 317 ? 49.278  -37.975 -4.286  1.00 28.54 ? 528 PHE B CB    1 
ATOM   5218 C CG    . PHE B 1 317 ? 49.362  -38.034 -2.782  1.00 29.81 ? 528 PHE B CG    1 
ATOM   5219 C CD1   . PHE B 1 317 ? 49.814  -36.923 -2.088  1.00 30.03 ? 528 PHE B CD1   1 
ATOM   5220 C CD2   . PHE B 1 317 ? 49.030  -39.195 -2.055  1.00 31.48 ? 528 PHE B CD2   1 
ATOM   5221 C CE1   . PHE B 1 317 ? 49.917  -36.947 -0.704  1.00 31.27 ? 528 PHE B CE1   1 
ATOM   5222 C CE2   . PHE B 1 317 ? 49.146  -39.225 -0.671  1.00 30.38 ? 528 PHE B CE2   1 
ATOM   5223 C CZ    . PHE B 1 317 ? 49.584  -38.097 0.002   1.00 31.34 ? 528 PHE B CZ    1 
ATOM   5224 N N     . VAL B 1 318 ? 47.418  -38.522 -6.785  1.00 27.48 ? 529 VAL B N     1 
ATOM   5225 C CA    . VAL B 1 318 ? 47.147  -37.871 -8.065  1.00 26.78 ? 529 VAL B CA    1 
ATOM   5226 C C     . VAL B 1 318 ? 46.609  -36.499 -7.723  1.00 27.21 ? 529 VAL B C     1 
ATOM   5227 O O     . VAL B 1 318 ? 46.535  -36.129 -6.540  1.00 26.29 ? 529 VAL B O     1 
ATOM   5228 C CB    . VAL B 1 318 ? 46.107  -38.620 -8.955  1.00 27.13 ? 529 VAL B CB    1 
ATOM   5229 C CG1   . VAL B 1 318 ? 46.631  -40.006 -9.358  1.00 26.41 ? 529 VAL B CG1   1 
ATOM   5230 C CG2   . VAL B 1 318 ? 44.741  -38.722 -8.245  1.00 26.63 ? 529 VAL B CG2   1 
ATOM   5231 N N     . THR B 1 319 ? 46.283  -35.731 -8.754  1.00 26.81 ? 530 THR B N     1 
ATOM   5232 C CA    . THR B 1 319 ? 45.690  -34.448 -8.572  1.00 27.12 ? 530 THR B CA    1 
ATOM   5233 C C     . THR B 1 319 ? 44.465  -34.400 -9.450  1.00 26.94 ? 530 THR B C     1 
ATOM   5234 O O     . THR B 1 319 ? 44.376  -35.123 -10.448 1.00 26.76 ? 530 THR B O     1 
ATOM   5235 C CB    . THR B 1 319 ? 46.671  -33.315 -8.917  1.00 27.45 ? 530 THR B CB    1 
ATOM   5236 O OG1   . THR B 1 319 ? 47.062  -33.405 -10.286 1.00 28.13 ? 530 THR B OG1   1 
ATOM   5237 C CG2   . THR B 1 319 ? 47.912  -33.387 -8.050  1.00 28.43 ? 530 THR B CG2   1 
ATOM   5238 N N     . LEU B 1 320 ? 43.507  -33.571 -9.053  1.00 26.25 ? 531 LEU B N     1 
ATOM   5239 C CA    . LEU B 1 320 ? 42.244  -33.412 -9.762  1.00 26.04 ? 531 LEU B CA    1 
ATOM   5240 C C     . LEU B 1 320 ? 41.950  -31.931 -9.819  1.00 26.11 ? 531 LEU B C     1 
ATOM   5241 O O     . LEU B 1 320 ? 41.591  -31.317 -8.806  1.00 24.72 ? 531 LEU B O     1 
ATOM   5242 C CB    . LEU B 1 320 ? 41.137  -34.150 -9.019  1.00 25.69 ? 531 LEU B CB    1 
ATOM   5243 C CG    . LEU B 1 320 ? 39.801  -34.407 -9.704  1.00 26.37 ? 531 LEU B CG    1 
ATOM   5244 C CD1   . LEU B 1 320 ? 39.976  -35.217 -10.997 1.00 26.85 ? 531 LEU B CD1   1 
ATOM   5245 C CD2   . LEU B 1 320 ? 38.873  -35.138 -8.746  1.00 22.66 ? 531 LEU B CD2   1 
ATOM   5246 N N     . ASN B 1 321 ? 42.150  -31.349 -11.002 1.00 26.19 ? 532 ASN B N     1 
ATOM   5247 C CA    . ASN B 1 321 ? 41.881  -29.932 -11.245 1.00 25.92 ? 532 ASN B CA    1 
ATOM   5248 C C     . ASN B 1 321 ? 42.566  -29.000 -10.273 1.00 25.37 ? 532 ASN B C     1 
ATOM   5249 O O     . ASN B 1 321 ? 41.974  -28.058 -9.800  1.00 25.43 ? 532 ASN B O     1 
ATOM   5250 C CB    . ASN B 1 321 ? 40.371  -29.696 -11.246 1.00 26.42 ? 532 ASN B CB    1 
ATOM   5251 C CG    . ASN B 1 321 ? 39.679  -30.465 -12.334 1.00 28.35 ? 532 ASN B CG    1 
ATOM   5252 O OD1   . ASN B 1 321 ? 40.227  -30.608 -13.446 1.00 29.90 ? 532 ASN B OD1   1 
ATOM   5253 N ND2   . ASN B 1 321 ? 38.466  -30.962 -12.046 1.00 27.33 ? 532 ASN B ND2   1 
ATOM   5254 N N     . GLY B 1 322 ? 43.823  -29.274 -9.957  1.00 24.94 ? 533 GLY B N     1 
ATOM   5255 C CA    . GLY B 1 322 ? 44.594  -28.371 -9.120  1.00 23.98 ? 533 GLY B CA    1 
ATOM   5256 C C     . GLY B 1 322 ? 44.766  -28.825 -7.693  1.00 23.06 ? 533 GLY B C     1 
ATOM   5257 O O     . GLY B 1 322 ? 45.633  -28.313 -7.005  1.00 23.56 ? 533 GLY B O     1 
ATOM   5258 N N     . SER B 1 323 ? 43.977  -29.804 -7.249  1.00 21.23 ? 534 SER B N     1 
ATOM   5259 C CA    . SER B 1 323 ? 44.081  -30.281 -5.883  1.00 20.16 ? 534 SER B CA    1 
ATOM   5260 C C     . SER B 1 323 ? 44.691  -31.669 -5.761  1.00 19.16 ? 534 SER B C     1 
ATOM   5261 O O     . SER B 1 323 ? 44.340  -32.563 -6.475  1.00 17.93 ? 534 SER B O     1 
ATOM   5262 C CB    . SER B 1 323 ? 42.704  -30.251 -5.228  1.00 19.79 ? 534 SER B CB    1 
ATOM   5263 O OG    . SER B 1 323 ? 42.240  -28.922 -5.129  1.00 17.84 ? 534 SER B OG    1 
ATOM   5264 N N     . THR B 1 324 ? 45.597  -31.830 -4.810  1.00 19.56 ? 535 THR B N     1 
ATOM   5265 C CA    . THR B 1 324 ? 46.176  -33.136 -4.479  1.00 20.18 ? 535 THR B CA    1 
ATOM   5266 C C     . THR B 1 324 ? 45.116  -34.071 -3.898  1.00 20.00 ? 535 THR B C     1 
ATOM   5267 O O     . THR B 1 324 ? 44.395  -33.713 -2.932  1.00 20.44 ? 535 THR B O     1 
ATOM   5268 C CB    . THR B 1 324 ? 47.364  -32.955 -3.508  1.00 20.34 ? 535 THR B CB    1 
ATOM   5269 O OG1   . THR B 1 324 ? 48.443  -32.349 -4.217  1.00 22.29 ? 535 THR B OG1   1 
ATOM   5270 C CG2   . THR B 1 324 ? 47.867  -34.276 -2.898  1.00 21.95 ? 535 THR B CG2   1 
ATOM   5271 N N     . VAL B 1 325 ? 44.990  -35.245 -4.508  1.00 18.47 ? 536 VAL B N     1 
ATOM   5272 C CA    . VAL B 1 325 ? 44.075  -36.278 -4.030  1.00 17.36 ? 536 VAL B CA    1 
ATOM   5273 C C     . VAL B 1 325 ? 44.939  -37.347 -3.389  1.00 17.60 ? 536 VAL B C     1 
ATOM   5274 O O     . VAL B 1 325 ? 45.726  -38.021 -4.092  1.00 17.97 ? 536 VAL B O     1 
ATOM   5275 C CB    . VAL B 1 325 ? 43.244  -36.886 -5.165  1.00 17.47 ? 536 VAL B CB    1 
ATOM   5276 C CG1   . VAL B 1 325 ? 42.369  -38.081 -4.649  1.00 17.36 ? 536 VAL B CG1   1 
ATOM   5277 C CG2   . VAL B 1 325 ? 42.407  -35.851 -5.810  1.00 16.14 ? 536 VAL B CG2   1 
ATOM   5278 N N     . PRO B 1 326 ? 44.838  -37.500 -2.063  1.00 16.90 ? 537 PRO B N     1 
ATOM   5279 C CA    . PRO B 1 326 ? 45.732  -38.418 -1.361  1.00 17.76 ? 537 PRO B CA    1 
ATOM   5280 C C     . PRO B 1 326 ? 45.241  -39.870 -1.347  1.00 18.30 ? 537 PRO B C     1 
ATOM   5281 O O     . PRO B 1 326 ? 44.821  -40.393 -0.294  1.00 17.94 ? 537 PRO B O     1 
ATOM   5282 C CB    . PRO B 1 326 ? 45.788  -37.830 0.048   1.00 17.59 ? 537 PRO B CB    1 
ATOM   5283 C CG    . PRO B 1 326 ? 44.413  -37.245 0.227   1.00 17.67 ? 537 PRO B CG    1 
ATOM   5284 C CD    . PRO B 1 326 ? 43.977  -36.750 -1.130  1.00 17.05 ? 537 PRO B CD    1 
ATOM   5285 N N     . LEU B 1 327 ? 45.349  -40.532 -2.499  1.00 18.75 ? 538 LEU B N     1 
ATOM   5286 C CA    . LEU B 1 327 ? 44.930  -41.920 -2.626  1.00 19.58 ? 538 LEU B CA    1 
ATOM   5287 C C     . LEU B 1 327 ? 45.722  -42.784 -1.675  1.00 20.17 ? 538 LEU B C     1 
ATOM   5288 O O     . LEU B 1 327 ? 46.922  -42.569 -1.456  1.00 19.94 ? 538 LEU B O     1 
ATOM   5289 C CB    . LEU B 1 327 ? 45.115  -42.446 -4.058  1.00 19.80 ? 538 LEU B CB    1 
ATOM   5290 C CG    . LEU B 1 327 ? 44.276  -41.798 -5.148  1.00 20.43 ? 538 LEU B CG    1 
ATOM   5291 C CD1   . LEU B 1 327 ? 44.642  -42.438 -6.503  1.00 21.72 ? 538 LEU B CD1   1 
ATOM   5292 C CD2   . LEU B 1 327 ? 42.751  -41.868 -4.852  1.00 18.01 ? 538 LEU B CD2   1 
ATOM   5293 N N     . GLY B 1 328 ? 45.033  -43.771 -1.121  1.00 20.90 ? 539 GLY B N     1 
ATOM   5294 C CA    . GLY B 1 328 ? 45.627  -44.748 -0.231  1.00 22.04 ? 539 GLY B CA    1 
ATOM   5295 C C     . GLY B 1 328 ? 46.337  -45.854 -1.009  1.00 23.19 ? 539 GLY B C     1 
ATOM   5296 O O     . GLY B 1 328 ? 46.452  -45.788 -2.227  1.00 22.39 ? 539 GLY B O     1 
ATOM   5297 N N     . PRO B 1 329 ? 46.755  -46.911 -0.316  1.00 24.75 ? 540 PRO B N     1 
ATOM   5298 C CA    . PRO B 1 329 ? 46.389  -47.212 1.054   1.00 25.46 ? 540 PRO B CA    1 
ATOM   5299 C C     . PRO B 1 329 ? 47.171  -46.376 2.056   1.00 25.94 ? 540 PRO B C     1 
ATOM   5300 O O     . PRO B 1 329 ? 48.198  -45.789 1.721   1.00 26.79 ? 540 PRO B O     1 
ATOM   5301 C CB    . PRO B 1 329 ? 46.760  -48.708 1.187   1.00 25.95 ? 540 PRO B CB    1 
ATOM   5302 C CG    . PRO B 1 329 ? 47.964  -48.847 0.288   1.00 26.03 ? 540 PRO B CG    1 
ATOM   5303 C CD    . PRO B 1 329 ? 47.737  -47.878 -0.857  1.00 25.48 ? 540 PRO B CD    1 
ATOM   5304 N N     . ALA B 1 330 ? 46.694  -46.328 3.283   1.00 26.44 ? 541 ALA B N     1 
ATOM   5305 C CA    . ALA B 1 330 ? 47.440  -45.670 4.338   1.00 27.60 ? 541 ALA B CA    1 
ATOM   5306 C C     . ALA B 1 330 ? 48.591  -46.573 4.752   1.00 28.46 ? 541 ALA B C     1 
ATOM   5307 O O     . ALA B 1 330 ? 48.474  -47.793 4.693   1.00 27.98 ? 541 ALA B O     1 
ATOM   5308 C CB    . ALA B 1 330 ? 46.549  -45.390 5.521   1.00 27.31 ? 541 ALA B CB    1 
ATOM   5309 N N     . SER B 1 331 ? 49.689  -45.959 5.183   1.00 29.70 ? 542 SER B N     1 
ATOM   5310 C CA    . SER B 1 331 ? 50.776  -46.681 5.804   1.00 30.60 ? 542 SER B CA    1 
ATOM   5311 C C     . SER B 1 331 ? 51.396  -45.844 6.921   1.00 31.71 ? 542 SER B C     1 
ATOM   5312 O O     . SER B 1 331 ? 51.104  -44.643 7.082   1.00 31.53 ? 542 SER B O     1 
ATOM   5313 C CB    . SER B 1 331 ? 51.831  -47.053 4.760   1.00 30.59 ? 542 SER B CB    1 
ATOM   5314 O OG    . SER B 1 331 ? 52.170  -45.920 3.983   1.00 30.62 ? 542 SER B OG    1 
ATOM   5315 N N     . ASP B 1 332 ? 52.257  -46.505 7.684   1.00 32.59 ? 543 ASP B N     1 
ATOM   5316 C CA    . ASP B 1 332 ? 52.843  -45.973 8.905   1.00 33.66 ? 543 ASP B CA    1 
ATOM   5317 C C     . ASP B 1 332 ? 53.603  -44.680 8.587   1.00 33.97 ? 543 ASP B C     1 
ATOM   5318 O O     . ASP B 1 332 ? 54.259  -44.568 7.546   1.00 34.40 ? 543 ASP B O     1 
ATOM   5319 C CB    . ASP B 1 332 ? 53.713  -47.085 9.527   1.00 34.22 ? 543 ASP B CB    1 
ATOM   5320 C CG    . ASP B 1 332 ? 54.569  -46.616 10.688  1.00 36.60 ? 543 ASP B CG    1 
ATOM   5321 O OD1   . ASP B 1 332 ? 54.196  -45.669 11.414  1.00 38.12 ? 543 ASP B OD1   1 
ATOM   5322 O OD2   . ASP B 1 332 ? 55.644  -47.233 10.875  1.00 41.12 ? 543 ASP B OD2   1 
ATOM   5323 N N     . THR B 1 333 ? 53.467  -43.680 9.450   1.00 33.73 ? 544 THR B N     1 
ATOM   5324 C CA    . THR B 1 333 ? 54.045  -42.365 9.179   1.00 33.82 ? 544 THR B CA    1 
ATOM   5325 C C     . THR B 1 333 ? 55.322  -42.033 9.979   1.00 34.49 ? 544 THR B C     1 
ATOM   5326 O O     . THR B 1 333 ? 56.095  -41.183 9.559   1.00 34.85 ? 544 THR B O     1 
ATOM   5327 C CB    . THR B 1 333 ? 53.003  -41.272 9.471   1.00 33.62 ? 544 THR B CB    1 
ATOM   5328 O OG1   . THR B 1 333 ? 52.539  -41.416 10.820  1.00 32.29 ? 544 THR B OG1   1 
ATOM   5329 C CG2   . THR B 1 333 ? 51.805  -41.384 8.506   1.00 32.92 ? 544 THR B CG2   1 
ATOM   5330 N N     . GLY B 1 334 ? 55.546  -42.700 11.111  1.00 35.30 ? 545 GLY B N     1 
ATOM   5331 C CA    . GLY B 1 334 ? 56.423  -42.166 12.168  1.00 35.76 ? 545 GLY B CA    1 
ATOM   5332 C C     . GLY B 1 334 ? 55.737  -40.997 12.877  1.00 35.97 ? 545 GLY B C     1 
ATOM   5333 O O     . GLY B 1 334 ? 54.944  -41.180 13.825  1.00 36.42 ? 545 GLY B O     1 
ATOM   5334 N N     . TYR B 1 341 ? 49.811  -40.799 23.771  1.00 36.10 ? 552 TYR B N     1 
ATOM   5335 C CA    . TYR B 1 341 ? 48.627  -41.046 22.950  1.00 36.16 ? 552 TYR B CA    1 
ATOM   5336 C C     . TYR B 1 341 ? 48.787  -40.339 21.594  1.00 35.34 ? 552 TYR B C     1 
ATOM   5337 O O     . TYR B 1 341 ? 49.158  -39.167 21.549  1.00 35.93 ? 552 TYR B O     1 
ATOM   5338 C CB    . TYR B 1 341 ? 47.357  -40.545 23.666  1.00 36.70 ? 552 TYR B CB    1 
ATOM   5339 C CG    . TYR B 1 341 ? 47.277  -40.901 25.149  1.00 37.05 ? 552 TYR B CG    1 
ATOM   5340 N N     . THR B 1 342 ? 48.537  -41.046 20.492  1.00 34.02 ? 553 THR B N     1 
ATOM   5341 C CA    . THR B 1 342 ? 48.723  -40.465 19.148  1.00 33.01 ? 553 THR B CA    1 
ATOM   5342 C C     . THR B 1 342 ? 47.489  -40.747 18.280  1.00 31.30 ? 553 THR B C     1 
ATOM   5343 O O     . THR B 1 342 ? 46.887  -41.805 18.383  1.00 30.87 ? 553 THR B O     1 
ATOM   5344 C CB    . THR B 1 342 ? 49.993  -41.019 18.444  1.00 33.11 ? 553 THR B CB    1 
ATOM   5345 O OG1   . THR B 1 342 ? 49.658  -42.178 17.680  1.00 35.18 ? 553 THR B OG1   1 
ATOM   5346 C CG2   . THR B 1 342 ? 51.085  -41.391 19.439  1.00 33.28 ? 553 THR B CG2   1 
ATOM   5347 N N     . LEU B 1 343 ? 47.118  -39.797 17.428  1.00 29.45 ? 554 LEU B N     1 
ATOM   5348 C CA    . LEU B 1 343 ? 45.958  -39.965 16.558  1.00 27.95 ? 554 LEU B CA    1 
ATOM   5349 C C     . LEU B 1 343 ? 46.189  -41.145 15.628  1.00 26.38 ? 554 LEU B C     1 
ATOM   5350 O O     . LEU B 1 343 ? 47.300  -41.348 15.135  1.00 25.60 ? 554 LEU B O     1 
ATOM   5351 C CB    . LEU B 1 343 ? 45.725  -38.712 15.701  1.00 28.11 ? 554 LEU B CB    1 
ATOM   5352 C CG    . LEU B 1 343 ? 45.075  -37.475 16.328  1.00 28.69 ? 554 LEU B CG    1 
ATOM   5353 C CD1   . LEU B 1 343 ? 45.327  -36.259 15.438  1.00 25.99 ? 554 LEU B CD1   1 
ATOM   5354 C CD2   . LEU B 1 343 ? 43.566  -37.676 16.556  1.00 29.19 ? 554 LEU B CD2   1 
ATOM   5355 N N     . ASN B 1 344 ? 45.140  -41.906 15.363  1.00 24.23 ? 555 ASN B N     1 
ATOM   5356 C CA    . ASN B 1 344 ? 45.255  -42.978 14.394  1.00 23.60 ? 555 ASN B CA    1 
ATOM   5357 C C     . ASN B 1 344 ? 45.507  -42.453 12.988  1.00 22.28 ? 555 ASN B C     1 
ATOM   5358 O O     . ASN B 1 344 ? 46.396  -42.950 12.312  1.00 21.05 ? 555 ASN B O     1 
ATOM   5359 C CB    . ASN B 1 344 ? 44.045  -43.911 14.473  1.00 24.26 ? 555 ASN B CB    1 
ATOM   5360 C CG    . ASN B 1 344 ? 44.116  -44.831 15.709  1.00 25.24 ? 555 ASN B CG    1 
ATOM   5361 O OD1   . ASN B 1 344 ? 45.183  -45.308 16.079  1.00 30.48 ? 555 ASN B OD1   1 
ATOM   5362 N ND2   . ASN B 1 344 ? 43.008  -45.044 16.345  1.00 25.98 ? 555 ASN B ND2   1 
ATOM   5363 N N     . TYR B 1 345 ? 44.781  -41.391 12.613  1.00 20.32 ? 556 TYR B N     1 
ATOM   5364 C CA    . TYR B 1 345 ? 44.801  -40.817 11.285  1.00 19.36 ? 556 TYR B CA    1 
ATOM   5365 C C     . TYR B 1 345 ? 44.836  -39.286 11.365  1.00 18.68 ? 556 TYR B C     1 
ATOM   5366 O O     . TYR B 1 345 ? 44.444  -38.686 12.382  1.00 18.66 ? 556 TYR B O     1 
ATOM   5367 C CB    . TYR B 1 345 ? 43.561  -41.300 10.495  1.00 19.40 ? 556 TYR B CB    1 
ATOM   5368 C CG    . TYR B 1 345 ? 43.355  -42.812 10.595  1.00 18.84 ? 556 TYR B CG    1 
ATOM   5369 C CD1   . TYR B 1 345 ? 44.218  -43.701 9.938   1.00 20.90 ? 556 TYR B CD1   1 
ATOM   5370 C CD2   . TYR B 1 345 ? 42.346  -43.349 11.364  1.00 18.39 ? 556 TYR B CD2   1 
ATOM   5371 C CE1   . TYR B 1 345 ? 44.061  -45.083 10.042  1.00 20.13 ? 556 TYR B CE1   1 
ATOM   5372 C CE2   . TYR B 1 345 ? 42.173  -44.741 11.473  1.00 19.56 ? 556 TYR B CE2   1 
ATOM   5373 C CZ    . TYR B 1 345 ? 43.056  -45.599 10.827  1.00 20.61 ? 556 TYR B CZ    1 
ATOM   5374 O OH    . TYR B 1 345 ? 42.885  -46.965 10.920  1.00 19.79 ? 556 TYR B OH    1 
ATOM   5375 N N     . ASN B 1 346 ? 45.342  -38.672 10.301  1.00 17.39 ? 557 ASN B N     1 
ATOM   5376 C CA    . ASN B 1 346 ? 45.465  -37.214 10.197  1.00 17.21 ? 557 ASN B CA    1 
ATOM   5377 C C     . ASN B 1 346 ? 44.127  -36.505 10.323  1.00 15.82 ? 557 ASN B C     1 
ATOM   5378 O O     . ASN B 1 346 ? 43.080  -37.078 10.089  1.00 16.24 ? 557 ASN B O     1 
ATOM   5379 C CB    . ASN B 1 346 ? 46.047  -36.790 8.827   1.00 16.86 ? 557 ASN B CB    1 
ATOM   5380 C CG    . ASN B 1 346 ? 47.536  -37.112 8.668   1.00 18.49 ? 557 ASN B CG    1 
ATOM   5381 O OD1   . ASN B 1 346 ? 48.293  -37.170 9.646   1.00 17.37 ? 557 ASN B OD1   1 
ATOM   5382 N ND2   . ASN B 1 346 ? 47.956  -37.310 7.418   1.00 17.88 ? 557 ASN B ND2   1 
ATOM   5383 N N     . GLU B 1 347 ? 44.178  -35.239 10.685  1.00 15.06 ? 558 GLU B N     1 
ATOM   5384 C CA    . GLU B 1 347 ? 43.052  -34.358 10.461  1.00 14.20 ? 558 GLU B CA    1 
ATOM   5385 C C     . GLU B 1 347 ? 43.582  -32.965 10.184  1.00 13.91 ? 558 GLU B C     1 
ATOM   5386 O O     . GLU B 1 347 ? 44.672  -32.606 10.596  1.00 13.96 ? 558 GLU B O     1 
ATOM   5387 C CB    . GLU B 1 347 ? 42.042  -34.408 11.619  1.00 14.02 ? 558 GLU B CB    1 
ATOM   5388 C CG    . GLU B 1 347 ? 42.525  -34.027 12.985  1.00 13.21 ? 558 GLU B CG    1 
ATOM   5389 C CD    . GLU B 1 347 ? 41.489  -34.397 14.060  1.00 16.73 ? 558 GLU B CD    1 
ATOM   5390 O OE1   . GLU B 1 347 ? 40.932  -33.464 14.674  1.00 16.32 ? 558 GLU B OE1   1 
ATOM   5391 O OE2   . GLU B 1 347 ? 41.208  -35.621 14.278  1.00 15.64 ? 558 GLU B OE2   1 
ATOM   5392 N N     . TYR B 1 348 ? 42.839  -32.218 9.402   1.00 13.67 ? 559 TYR B N     1 
ATOM   5393 C CA    . TYR B 1 348 ? 43.309  -30.946 8.918   1.00 13.51 ? 559 TYR B CA    1 
ATOM   5394 C C     . TYR B 1 348 ? 42.261  -29.948 9.287   1.00 12.58 ? 559 TYR B C     1 
ATOM   5395 O O     . TYR B 1 348 ? 41.070  -30.204 9.077   1.00 11.13 ? 559 TYR B O     1 
ATOM   5396 C CB    . TYR B 1 348 ? 43.390  -30.973 7.416   1.00 14.86 ? 559 TYR B CB    1 
ATOM   5397 C CG    . TYR B 1 348 ? 44.309  -32.007 6.858   1.00 16.53 ? 559 TYR B CG    1 
ATOM   5398 C CD1   . TYR B 1 348 ? 45.585  -31.663 6.441   1.00 19.48 ? 559 TYR B CD1   1 
ATOM   5399 C CD2   . TYR B 1 348 ? 43.881  -33.327 6.690   1.00 19.88 ? 559 TYR B CD2   1 
ATOM   5400 C CE1   . TYR B 1 348 ? 46.438  -32.598 5.889   1.00 21.20 ? 559 TYR B CE1   1 
ATOM   5401 C CE2   . TYR B 1 348 ? 44.731  -34.279 6.154   1.00 20.88 ? 559 TYR B CE2   1 
ATOM   5402 C CZ    . TYR B 1 348 ? 46.010  -33.908 5.742   1.00 21.96 ? 559 TYR B CZ    1 
ATOM   5403 O OH    . TYR B 1 348 ? 46.879  -34.850 5.193   1.00 24.71 ? 559 TYR B OH    1 
ATOM   5404 N N     . ILE B 1 349 ? 42.692  -28.821 9.831   1.00 12.35 ? 560 ILE B N     1 
ATOM   5405 C CA    . ILE B 1 349 ? 41.764  -27.778 10.248  1.00 12.18 ? 560 ILE B CA    1 
ATOM   5406 C C     . ILE B 1 349 ? 42.114  -26.421 9.701   1.00 12.11 ? 560 ILE B C     1 
ATOM   5407 O O     . ILE B 1 349 ? 43.228  -25.970 9.880   1.00 14.13 ? 560 ILE B O     1 
ATOM   5408 C CB    . ILE B 1 349 ? 41.727  -27.674 11.796  1.00 12.23 ? 560 ILE B CB    1 
ATOM   5409 C CG1   . ILE B 1 349 ? 41.344  -29.015 12.435  1.00 12.39 ? 560 ILE B CG1   1 
ATOM   5410 C CG2   . ILE B 1 349 ? 40.715  -26.618 12.244  1.00 9.35  ? 560 ILE B CG2   1 
ATOM   5411 C CD1   . ILE B 1 349 ? 42.493  -30.020 12.612  1.00 14.00 ? 560 ILE B CD1   1 
ATOM   5412 N N     . VAL B 1 350 ? 41.161  -25.764 9.044   1.00 11.79 ? 561 VAL B N     1 
ATOM   5413 C CA    . VAL B 1 350 ? 41.330  -24.399 8.607   1.00 11.21 ? 561 VAL B CA    1 
ATOM   5414 C C     . VAL B 1 350 ? 40.382  -23.520 9.402   1.00 12.13 ? 561 VAL B C     1 
ATOM   5415 O O     . VAL B 1 350 ? 39.279  -23.955 9.782   1.00 11.47 ? 561 VAL B O     1 
ATOM   5416 C CB    . VAL B 1 350 ? 41.119  -24.213 7.070   1.00 11.74 ? 561 VAL B CB    1 
ATOM   5417 C CG1   . VAL B 1 350 ? 42.175  -25.001 6.294   1.00 10.65 ? 561 VAL B CG1   1 
ATOM   5418 C CG2   . VAL B 1 350 ? 39.703  -24.560 6.621   1.00 10.55 ? 561 VAL B CG2   1 
ATOM   5419 N N     . TYR B 1 351 ? 40.779  -22.269 9.654   1.00 12.48 ? 562 TYR B N     1 
ATOM   5420 C CA    . TYR B 1 351 ? 39.967  -21.426 10.537  1.00 13.02 ? 562 TYR B CA    1 
ATOM   5421 C C     . TYR B 1 351 ? 39.239  -20.290 9.840   1.00 14.30 ? 562 TYR B C     1 
ATOM   5422 O O     . TYR B 1 351 ? 38.694  -19.413 10.509  1.00 13.07 ? 562 TYR B O     1 
ATOM   5423 C CB    . TYR B 1 351 ? 40.848  -20.919 11.676  1.00 13.42 ? 562 TYR B CB    1 
ATOM   5424 C CG    . TYR B 1 351 ? 41.513  -22.056 12.410  1.00 12.24 ? 562 TYR B CG    1 
ATOM   5425 C CD1   . TYR B 1 351 ? 40.968  -22.565 13.582  1.00 9.96  ? 562 TYR B CD1   1 
ATOM   5426 C CD2   . TYR B 1 351 ? 42.700  -22.602 11.956  1.00 11.04 ? 562 TYR B CD2   1 
ATOM   5427 C CE1   . TYR B 1 351 ? 41.541  -23.554 14.246  1.00 10.72 ? 562 TYR B CE1   1 
ATOM   5428 C CE2   . TYR B 1 351 ? 43.309  -23.627 12.639  1.00 11.39 ? 562 TYR B CE2   1 
ATOM   5429 C CZ    . TYR B 1 351 ? 42.728  -24.103 13.786  1.00 12.85 ? 562 TYR B CZ    1 
ATOM   5430 O OH    . TYR B 1 351 ? 43.300  -25.146 14.480  1.00 12.95 ? 562 TYR B OH    1 
ATOM   5431 N N     . ASN B 1 352 ? 39.244  -20.310 8.501   1.00 14.82 ? 563 ASN B N     1 
ATOM   5432 C CA    . ASN B 1 352 ? 38.505  -19.354 7.673   1.00 15.96 ? 563 ASN B CA    1 
ATOM   5433 C C     . ASN B 1 352 ? 37.825  -20.111 6.550   1.00 16.00 ? 563 ASN B C     1 
ATOM   5434 O O     . ASN B 1 352 ? 38.505  -20.855 5.820   1.00 16.33 ? 563 ASN B O     1 
ATOM   5435 C CB    . ASN B 1 352 ? 39.452  -18.299 7.066   1.00 16.34 ? 563 ASN B CB    1 
ATOM   5436 C CG    . ASN B 1 352 ? 38.713  -17.073 6.499   1.00 17.86 ? 563 ASN B CG    1 
ATOM   5437 O OD1   . ASN B 1 352 ? 37.672  -17.190 5.836   1.00 17.46 ? 563 ASN B OD1   1 
ATOM   5438 N ND2   . ASN B 1 352 ? 39.285  -15.879 6.738   1.00 17.18 ? 563 ASN B ND2   1 
ATOM   5439 N N     . PRO B 1 353 ? 36.504  -19.923 6.382   1.00 15.57 ? 564 PRO B N     1 
ATOM   5440 C CA    . PRO B 1 353 ? 35.787  -20.597 5.315   1.00 16.17 ? 564 PRO B CA    1 
ATOM   5441 C C     . PRO B 1 353 ? 36.258  -20.299 3.898   1.00 15.57 ? 564 PRO B C     1 
ATOM   5442 O O     . PRO B 1 353 ? 35.918  -21.078 2.976   1.00 14.93 ? 564 PRO B O     1 
ATOM   5443 C CB    . PRO B 1 353 ? 34.333  -20.160 5.495   1.00 16.07 ? 564 PRO B CB    1 
ATOM   5444 C CG    . PRO B 1 353 ? 34.351  -19.031 6.433   1.00 18.39 ? 564 PRO B CG    1 
ATOM   5445 C CD    . PRO B 1 353 ? 35.607  -19.147 7.248   1.00 16.52 ? 564 PRO B CD    1 
ATOM   5446 N N     . ASN B 1 354 ? 37.023  -19.211 3.713   1.00 14.49 ? 565 ASN B N     1 
ATOM   5447 C CA    . ASN B 1 354 ? 37.604  -18.898 2.409   1.00 14.34 ? 565 ASN B CA    1 
ATOM   5448 C C     . ASN B 1 354 ? 38.769  -19.828 2.008   1.00 14.35 ? 565 ASN B C     1 
ATOM   5449 O O     . ASN B 1 354 ? 39.322  -19.731 0.902   1.00 14.62 ? 565 ASN B O     1 
ATOM   5450 C CB    . ASN B 1 354 ? 37.948  -17.382 2.295   1.00 14.56 ? 565 ASN B CB    1 
ATOM   5451 C CG    . ASN B 1 354 ? 39.214  -16.989 2.976   1.00 12.34 ? 565 ASN B CG    1 
ATOM   5452 O OD1   . ASN B 1 354 ? 39.892  -17.780 3.622   1.00 13.74 ? 565 ASN B OD1   1 
ATOM   5453 N ND2   . ASN B 1 354 ? 39.553  -15.713 2.842   1.00 16.55 ? 565 ASN B ND2   1 
ATOM   5454 N N     . GLN B 1 355 ? 39.131  -20.743 2.901   1.00 14.24 ? 566 GLN B N     1 
ATOM   5455 C CA    . GLN B 1 355 ? 40.071  -21.782 2.581   1.00 14.20 ? 566 GLN B CA    1 
ATOM   5456 C C     . GLN B 1 355 ? 39.361  -23.084 2.162   1.00 13.51 ? 566 GLN B C     1 
ATOM   5457 O O     . GLN B 1 355 ? 39.997  -24.130 2.066   1.00 13.68 ? 566 GLN B O     1 
ATOM   5458 C CB    . GLN B 1 355 ? 40.995  -21.999 3.762   1.00 14.35 ? 566 GLN B CB    1 
ATOM   5459 C CG    . GLN B 1 355 ? 42.089  -20.940 3.872   1.00 15.20 ? 566 GLN B CG    1 
ATOM   5460 C CD    . GLN B 1 355 ? 42.776  -21.011 5.206   1.00 15.78 ? 566 GLN B CD    1 
ATOM   5461 O OE1   . GLN B 1 355 ? 42.347  -20.360 6.167   1.00 20.58 ? 566 GLN B OE1   1 
ATOM   5462 N NE2   . GLN B 1 355 ? 43.808  -21.842 5.300   1.00 12.82 ? 566 GLN B NE2   1 
ATOM   5463 N N     . VAL B 1 356 ? 38.046  -22.994 1.941   1.00 12.54 ? 567 VAL B N     1 
ATOM   5464 C CA    . VAL B 1 356 ? 37.221  -24.123 1.562   1.00 11.82 ? 567 VAL B CA    1 
ATOM   5465 C C     . VAL B 1 356 ? 36.435  -23.830 0.310   1.00 11.97 ? 567 VAL B C     1 
ATOM   5466 O O     . VAL B 1 356 ? 35.732  -22.836 0.208   1.00 12.50 ? 567 VAL B O     1 
ATOM   5467 C CB    . VAL B 1 356 ? 36.226  -24.536 2.672   1.00 11.40 ? 567 VAL B CB    1 
ATOM   5468 C CG1   . VAL B 1 356 ? 35.446  -25.791 2.243   1.00 9.04  ? 567 VAL B CG1   1 
ATOM   5469 C CG2   . VAL B 1 356 ? 36.960  -24.792 3.962   1.00 9.85  ? 567 VAL B CG2   1 
ATOM   5470 N N     . ARG B 1 357 ? 36.521  -24.747 -0.636  1.00 12.59 ? 568 ARG B N     1 
ATOM   5471 C CA    . ARG B 1 357 ? 35.602  -24.781 -1.748  1.00 13.15 ? 568 ARG B CA    1 
ATOM   5472 C C     . ARG B 1 357 ? 35.005  -26.180 -1.900  1.00 13.45 ? 568 ARG B C     1 
ATOM   5473 O O     . ARG B 1 357 ? 35.724  -27.118 -2.272  1.00 12.19 ? 568 ARG B O     1 
ATOM   5474 C CB    . ARG B 1 357 ? 36.326  -24.417 -3.041  1.00 14.21 ? 568 ARG B CB    1 
ATOM   5475 C CG    . ARG B 1 357 ? 35.375  -24.330 -4.234  1.00 17.75 ? 568 ARG B CG    1 
ATOM   5476 C CD    . ARG B 1 357 ? 36.144  -23.931 -5.524  1.00 23.84 ? 568 ARG B CD    1 
ATOM   5477 N NE    . ARG B 1 357 ? 35.241  -24.008 -6.661  1.00 28.21 ? 568 ARG B NE    1 
ATOM   5478 C CZ    . ARG B 1 357 ? 35.605  -24.264 -7.909  1.00 31.63 ? 568 ARG B CZ    1 
ATOM   5479 N NH1   . ARG B 1 357 ? 36.882  -24.453 -8.239  1.00 33.73 ? 568 ARG B NH1   1 
ATOM   5480 N NH2   . ARG B 1 357 ? 34.675  -24.311 -8.837  1.00 34.27 ? 568 ARG B NH2   1 
ATOM   5481 N N     . MET B 1 358 ? 33.698  -26.301 -1.668  1.00 13.14 ? 569 MET B N     1 
ATOM   5482 C CA    . MET B 1 358 ? 33.025  -27.589 -1.768  1.00 14.38 ? 569 MET B CA    1 
ATOM   5483 C C     . MET B 1 358 ? 33.035  -27.975 -3.258  1.00 15.26 ? 569 MET B C     1 
ATOM   5484 O O     . MET B 1 358 ? 32.864  -27.102 -4.108  1.00 15.61 ? 569 MET B O     1 
ATOM   5485 C CB    . MET B 1 358 ? 31.583  -27.504 -1.249  1.00 14.13 ? 569 MET B CB    1 
ATOM   5486 C CG    . MET B 1 358 ? 31.467  -27.066 0.193   1.00 14.25 ? 569 MET B CG    1 
ATOM   5487 S SD    . MET B 1 358 ? 29.817  -27.194 0.927   1.00 13.54 ? 569 MET B SD    1 
ATOM   5488 C CE    . MET B 1 358 ? 28.997  -25.771 0.152   1.00 10.87 ? 569 MET B CE    1 
ATOM   5489 N N     . ARG B 1 359 ? 33.280  -29.248 -3.573  1.00 15.11 ? 570 ARG B N     1 
ATOM   5490 C CA    . ARG B 1 359 ? 33.368  -29.670 -4.958  1.00 15.24 ? 570 ARG B CA    1 
ATOM   5491 C C     . ARG B 1 359 ? 32.551  -30.894 -5.312  1.00 14.91 ? 570 ARG B C     1 
ATOM   5492 O O     . ARG B 1 359 ? 32.020  -30.950 -6.422  1.00 14.06 ? 570 ARG B O     1 
ATOM   5493 C CB    . ARG B 1 359 ? 34.824  -29.929 -5.360  1.00 16.56 ? 570 ARG B CB    1 
ATOM   5494 C CG    . ARG B 1 359 ? 35.666  -28.753 -5.666  1.00 19.60 ? 570 ARG B CG    1 
ATOM   5495 C CD    . ARG B 1 359 ? 35.048  -27.780 -6.664  1.00 23.95 ? 570 ARG B CD    1 
ATOM   5496 N NE    . ARG B 1 359 ? 34.948  -28.301 -8.021  1.00 27.97 ? 570 ARG B NE    1 
ATOM   5497 C CZ    . ARG B 1 359 ? 34.056  -27.873 -8.919  1.00 32.05 ? 570 ARG B CZ    1 
ATOM   5498 N NH1   . ARG B 1 359 ? 33.144  -26.926 -8.606  1.00 32.72 ? 570 ARG B NH1   1 
ATOM   5499 N NH2   . ARG B 1 359 ? 34.043  -28.427 -10.127 1.00 35.01 ? 570 ARG B NH2   1 
ATOM   5500 N N     . TYR B 1 360 ? 32.482  -31.888 -4.406  1.00 13.56 ? 571 TYR B N     1 
ATOM   5501 C CA    . TYR B 1 360 ? 31.727  -33.109 -4.665  1.00 12.67 ? 571 TYR B CA    1 
ATOM   5502 C C     . TYR B 1 360 ? 30.907  -33.593 -3.470  1.00 12.00 ? 571 TYR B C     1 
ATOM   5503 O O     . TYR B 1 360 ? 31.333  -33.519 -2.312  1.00 11.87 ? 571 TYR B O     1 
ATOM   5504 C CB    . TYR B 1 360 ? 32.663  -34.244 -5.077  1.00 12.24 ? 571 TYR B CB    1 
ATOM   5505 C CG    . TYR B 1 360 ? 33.544  -33.938 -6.267  1.00 12.26 ? 571 TYR B CG    1 
ATOM   5506 C CD1   . TYR B 1 360 ? 33.035  -33.946 -7.568  1.00 13.63 ? 571 TYR B CD1   1 
ATOM   5507 C CD2   . TYR B 1 360 ? 34.879  -33.623 -6.092  1.00 13.79 ? 571 TYR B CD2   1 
ATOM   5508 C CE1   . TYR B 1 360 ? 33.883  -33.652 -8.674  1.00 16.24 ? 571 TYR B CE1   1 
ATOM   5509 C CE2   . TYR B 1 360 ? 35.703  -33.312 -7.166  1.00 15.04 ? 571 TYR B CE2   1 
ATOM   5510 C CZ    . TYR B 1 360 ? 35.206  -33.330 -8.445  1.00 15.55 ? 571 TYR B CZ    1 
ATOM   5511 O OH    . TYR B 1 360 ? 36.069  -33.032 -9.482  1.00 17.65 ? 571 TYR B OH    1 
ATOM   5512 N N     . LEU B 1 361 ? 29.734  -34.116 -3.764  1.00 11.12 ? 572 LEU B N     1 
ATOM   5513 C CA    . LEU B 1 361 ? 28.918  -34.733 -2.733  1.00 11.81 ? 572 LEU B CA    1 
ATOM   5514 C C     . LEU B 1 361 ? 28.610  -36.177 -3.163  1.00 12.19 ? 572 LEU B C     1 
ATOM   5515 O O     . LEU B 1 361 ? 28.114  -36.417 -4.279  1.00 11.94 ? 572 LEU B O     1 
ATOM   5516 C CB    . LEU B 1 361 ? 27.649  -33.932 -2.561  1.00 11.71 ? 572 LEU B CB    1 
ATOM   5517 C CG    . LEU B 1 361 ? 26.714  -34.341 -1.411  1.00 12.73 ? 572 LEU B CG    1 
ATOM   5518 C CD1   . LEU B 1 361 ? 27.354  -34.007 -0.063  1.00 10.01 ? 572 LEU B CD1   1 
ATOM   5519 C CD2   . LEU B 1 361 ? 25.357  -33.657 -1.606  1.00 11.61 ? 572 LEU B CD2   1 
ATOM   5520 N N     . LEU B 1 362 ? 28.960  -37.120 -2.290  1.00 12.42 ? 573 LEU B N     1 
ATOM   5521 C CA    . LEU B 1 362 ? 28.805  -38.554 -2.547  1.00 11.92 ? 573 LEU B CA    1 
ATOM   5522 C C     . LEU B 1 362 ? 27.592  -39.031 -1.795  1.00 12.98 ? 573 LEU B C     1 
ATOM   5523 O O     . LEU B 1 362 ? 27.506  -38.856 -0.552  1.00 12.00 ? 573 LEU B O     1 
ATOM   5524 C CB    . LEU B 1 362 ? 30.029  -39.322 -2.043  1.00 11.22 ? 573 LEU B CB    1 
ATOM   5525 C CG    . LEU B 1 362 ? 31.346  -39.211 -2.840  1.00 11.12 ? 573 LEU B CG    1 
ATOM   5526 C CD1   . LEU B 1 362 ? 31.971  -37.776 -2.747  1.00 8.67  ? 573 LEU B CD1   1 
ATOM   5527 C CD2   . LEU B 1 362 ? 32.330  -40.228 -2.377  1.00 12.19 ? 573 LEU B CD2   1 
ATOM   5528 N N     . LYS B 1 363 ? 26.676  -39.686 -2.497  1.00 12.59 ? 574 LYS B N     1 
ATOM   5529 C CA    . LYS B 1 363 ? 25.612  -40.378 -1.804  1.00 12.90 ? 574 LYS B CA    1 
ATOM   5530 C C     . LYS B 1 363 ? 26.086  -41.808 -1.595  1.00 13.02 ? 574 LYS B C     1 
ATOM   5531 O O     . LYS B 1 363 ? 26.359  -42.536 -2.567  1.00 13.42 ? 574 LYS B O     1 
ATOM   5532 C CB    . LYS B 1 363 ? 24.324  -40.307 -2.602  1.00 12.99 ? 574 LYS B CB    1 
ATOM   5533 C CG    . LYS B 1 363 ? 23.172  -41.036 -1.992  1.00 14.76 ? 574 LYS B CG    1 
ATOM   5534 C CD    . LYS B 1 363 ? 22.009  -41.064 -2.977  1.00 18.00 ? 574 LYS B CD    1 
ATOM   5535 C CE    . LYS B 1 363 ? 20.786  -41.736 -2.441  1.00 21.63 ? 574 LYS B CE    1 
ATOM   5536 N NZ    . LYS B 1 363 ? 19.575  -41.350 -3.260  1.00 24.36 ? 574 LYS B NZ    1 
ATOM   5537 N N     . VAL B 1 364 ? 26.217  -42.217 -0.337  1.00 11.91 ? 575 VAL B N     1 
ATOM   5538 C CA    . VAL B 1 364 ? 26.907  -43.457 -0.026  1.00 12.53 ? 575 VAL B CA    1 
ATOM   5539 C C     . VAL B 1 364 ? 25.981  -44.472 0.624   1.00 13.00 ? 575 VAL B C     1 
ATOM   5540 O O     . VAL B 1 364 ? 25.190  -44.121 1.504   1.00 12.30 ? 575 VAL B O     1 
ATOM   5541 C CB    . VAL B 1 364 ? 28.060  -43.194 0.942   1.00 13.07 ? 575 VAL B CB    1 
ATOM   5542 C CG1   . VAL B 1 364 ? 28.690  -44.478 1.375   1.00 14.22 ? 575 VAL B CG1   1 
ATOM   5543 C CG2   . VAL B 1 364 ? 29.102  -42.217 0.291   1.00 14.49 ? 575 VAL B CG2   1 
ATOM   5544 N N     . GLN B 1 365 ? 26.135  -45.735 0.243   1.00 13.84 ? 576 GLN B N     1 
ATOM   5545 C CA    . GLN B 1 365 ? 25.436  -46.806 0.923   1.00 14.45 ? 576 GLN B CA    1 
ATOM   5546 C C     . GLN B 1 365 ? 26.404  -47.421 1.881   1.00 14.37 ? 576 GLN B C     1 
ATOM   5547 O O     . GLN B 1 365 ? 27.485  -47.839 1.476   1.00 14.23 ? 576 GLN B O     1 
ATOM   5548 C CB    . GLN B 1 365 ? 24.859  -47.827 -0.075  1.00 15.25 ? 576 GLN B CB    1 
ATOM   5549 C CG    . GLN B 1 365 ? 24.378  -49.177 0.515   1.00 16.92 ? 576 GLN B CG    1 
ATOM   5550 C CD    . GLN B 1 365 ? 24.053  -50.154 -0.617  1.00 19.82 ? 576 GLN B CD    1 
ATOM   5551 O OE1   . GLN B 1 365 ? 23.231  -49.850 -1.462  1.00 21.21 ? 576 GLN B OE1   1 
ATOM   5552 N NE2   . GLN B 1 365 ? 24.787  -51.269 -0.694  1.00 19.72 ? 576 GLN B NE2   1 
ATOM   5553 N N     . PHE B 1 366 ? 26.035  -47.461 3.162   1.00 13.52 ? 577 PHE B N     1 
ATOM   5554 C CA    . PHE B 1 366 ? 26.910  -48.057 4.165   1.00 13.75 ? 577 PHE B CA    1 
ATOM   5555 C C     . PHE B 1 366 ? 26.529  -49.525 4.305   1.00 13.85 ? 577 PHE B C     1 
ATOM   5556 O O     . PHE B 1 366 ? 25.360  -49.846 4.520   1.00 13.16 ? 577 PHE B O     1 
ATOM   5557 C CB    . PHE B 1 366 ? 26.762  -47.380 5.541   1.00 13.71 ? 577 PHE B CB    1 
ATOM   5558 C CG    . PHE B 1 366 ? 27.412  -46.024 5.631   1.00 12.07 ? 577 PHE B CG    1 
ATOM   5559 C CD1   . PHE B 1 366 ? 28.536  -45.836 6.401   1.00 12.77 ? 577 PHE B CD1   1 
ATOM   5560 C CD2   . PHE B 1 366 ? 26.890  -44.942 4.933   1.00 12.60 ? 577 PHE B CD2   1 
ATOM   5561 C CE1   . PHE B 1 366 ? 29.147  -44.575 6.482   1.00 15.19 ? 577 PHE B CE1   1 
ATOM   5562 C CE2   . PHE B 1 366 ? 27.470  -43.701 5.006   1.00 12.66 ? 577 PHE B CE2   1 
ATOM   5563 C CZ    . PHE B 1 366 ? 28.610  -43.515 5.794   1.00 14.22 ? 577 PHE B CZ    1 
ATOM   5564 N N     . ASN B 1 367 ? 27.515  -50.411 4.210   1.00 14.90 ? 578 ASN B N     1 
ATOM   5565 C CA    . ASN B 1 367 ? 27.240  -51.852 4.279   1.00 15.48 ? 578 ASN B CA    1 
ATOM   5566 C C     . ASN B 1 367 ? 27.682  -52.415 5.613   1.00 15.93 ? 578 ASN B C     1 
ATOM   5567 O O     . ASN B 1 367 ? 28.876  -52.669 5.839   1.00 17.37 ? 578 ASN B O     1 
ATOM   5568 C CB    . ASN B 1 367 ? 27.898  -52.585 3.108   1.00 16.10 ? 578 ASN B CB    1 
ATOM   5569 C CG    . ASN B 1 367 ? 27.578  -51.942 1.775   1.00 14.66 ? 578 ASN B CG    1 
ATOM   5570 O OD1   . ASN B 1 367 ? 26.419  -51.738 1.432   1.00 17.95 ? 578 ASN B OD1   1 
ATOM   5571 N ND2   . ASN B 1 367 ? 28.610  -51.604 1.025   1.00 15.95 ? 578 ASN B ND2   1 
ATOM   5572 N N     . PHE B 1 368 ? 26.725  -52.588 6.517   1.00 16.39 ? 579 PHE B N     1 
ATOM   5573 C CA    . PHE B 1 368 ? 27.022  -53.067 7.858   1.00 17.44 ? 579 PHE B CA    1 
ATOM   5574 C C     . PHE B 1 368 ? 26.925  -54.576 7.972   1.00 17.93 ? 579 PHE B C     1 
ATOM   5575 O O     . PHE B 1 368 ? 27.402  -55.153 8.968   1.00 18.40 ? 579 PHE B O     1 
ATOM   5576 C CB    . PHE B 1 368 ? 26.093  -52.429 8.880   1.00 17.82 ? 579 PHE B CB    1 
ATOM   5577 C CG    . PHE B 1 368 ? 26.343  -50.985 9.075   1.00 17.99 ? 579 PHE B CG    1 
ATOM   5578 C CD1   . PHE B 1 368 ? 25.579  -50.041 8.399   1.00 18.31 ? 579 PHE B CD1   1 
ATOM   5579 C CD2   . PHE B 1 368 ? 27.364  -50.552 9.903   1.00 16.22 ? 579 PHE B CD2   1 
ATOM   5580 C CE1   . PHE B 1 368 ? 25.819  -48.699 8.577   1.00 17.97 ? 579 PHE B CE1   1 
ATOM   5581 C CE2   . PHE B 1 368 ? 27.607  -49.207 10.071  1.00 19.04 ? 579 PHE B CE2   1 
ATOM   5582 C CZ    . PHE B 1 368 ? 26.839  -48.278 9.413   1.00 17.66 ? 579 PHE B CZ    1 
ATOM   5583 O OXT   . PHE B 1 368 ? 26.381  -55.223 7.070   1.00 19.54 ? 579 PHE B OXT   1 
HETATM 5584 N N3    . 3AB C 2 .   ? 22.196  3.171   19.023  1.00 13.58 ? 1   3AB A N3    1 
HETATM 5585 C C3    . 3AB C 2 .   ? 21.207  3.211   19.924  1.00 11.60 ? 1   3AB A C3    1 
HETATM 5586 C C2    . 3AB C 2 .   ? 19.893  3.157   19.463  1.00 9.27  ? 1   3AB A C2    1 
HETATM 5587 C C4    . 3AB C 2 .   ? 21.468  3.269   21.280  1.00 7.85  ? 1   3AB A C4    1 
HETATM 5588 C C5    . 3AB C 2 .   ? 20.389  3.273   22.147  1.00 8.92  ? 1   3AB A C5    1 
HETATM 5589 C C6    . 3AB C 2 .   ? 19.061  3.250   21.704  1.00 8.63  ? 1   3AB A C6    1 
HETATM 5590 C C1    . 3AB C 2 .   ? 18.817  3.204   20.334  1.00 10.19 ? 1   3AB A C1    1 
HETATM 5591 C "C1'" . 3AB C 2 .   ? 17.382  3.191   19.793  1.00 9.23  ? 1   3AB A "C1'" 1 
HETATM 5592 O "O1'" . 3AB C 2 .   ? 16.439  3.667   20.434  1.00 9.86  ? 1   3AB A "O1'" 1 
HETATM 5593 N "N1'" . 3AB C 2 .   ? 17.217  2.623   18.607  1.00 8.98  ? 1   3AB A "N1'" 1 
HETATM 5594 C C1    . GOL D 3 .   ? 16.003  14.909  14.433  1.00 21.63 ? 580 GOL A C1    1 
HETATM 5595 O O1    . GOL D 3 .   ? 17.103  14.915  15.299  1.00 21.99 ? 580 GOL A O1    1 
HETATM 5596 C C2    . GOL D 3 .   ? 15.471  13.478  14.200  1.00 21.51 ? 580 GOL A C2    1 
HETATM 5597 O O2    . GOL D 3 .   ? 16.475  12.490  14.334  1.00 20.92 ? 580 GOL A O2    1 
HETATM 5598 C C3    . GOL D 3 .   ? 14.267  13.136  15.085  1.00 18.43 ? 580 GOL A C3    1 
HETATM 5599 O O3    . GOL D 3 .   ? 13.737  11.858  14.723  1.00 13.84 ? 580 GOL A O3    1 
HETATM 5600 N N3    . 3AB E 2 .   ? 36.625  -34.526 14.092  1.00 15.36 ? 1   3AB B N3    1 
HETATM 5601 C C3    . 3AB E 2 .   ? 36.738  -34.617 12.763  1.00 13.85 ? 1   3AB B C3    1 
HETATM 5602 C C2    . 3AB E 2 .   ? 35.608  -34.669 11.958  1.00 13.66 ? 1   3AB B C2    1 
HETATM 5603 C C4    . 3AB E 2 .   ? 37.998  -34.660 12.174  1.00 12.35 ? 1   3AB B C4    1 
HETATM 5604 C C5    . 3AB E 2 .   ? 38.152  -34.741 10.803  1.00 11.93 ? 1   3AB B C5    1 
HETATM 5605 C C6    . 3AB E 2 .   ? 37.025  -34.790 10.005  1.00 12.46 ? 1   3AB B C6    1 
HETATM 5606 C C1    . 3AB E 2 .   ? 35.762  -34.749 10.581  1.00 13.46 ? 1   3AB B C1    1 
HETATM 5607 C "C1'" . 3AB E 2 .   ? 34.534  -34.791 9.681   1.00 14.17 ? 1   3AB B "C1'" 1 
HETATM 5608 O "O1'" . 3AB E 2 .   ? 34.583  -35.303 8.573   1.00 11.74 ? 1   3AB B "O1'" 1 
HETATM 5609 N "N1'" . 3AB E 2 .   ? 33.419  -34.232 10.156  1.00 14.04 ? 1   3AB B "N1'" 1 
HETATM 5610 C C1    . GOL F 3 .   ? 29.524  -46.591 12.012  1.00 23.66 ? 580 GOL B C1    1 
HETATM 5611 O O1    . GOL F 3 .   ? 30.772  -46.711 12.664  1.00 23.32 ? 580 GOL B O1    1 
HETATM 5612 C C2    . GOL F 3 .   ? 29.065  -45.139 11.797  1.00 23.17 ? 580 GOL B C2    1 
HETATM 5613 O O2    . GOL F 3 .   ? 29.795  -44.226 12.595  1.00 25.47 ? 580 GOL B O2    1 
HETATM 5614 C C3    . GOL F 3 .   ? 29.095  -44.759 10.304  1.00 20.91 ? 580 GOL B C3    1 
HETATM 5615 O O3    . GOL F 3 .   ? 28.473  -43.508 10.007  1.00 13.20 ? 580 GOL B O3    1 
HETATM 5616 O O     . HOH G 4 .   ? 18.609  -2.641  18.626  1.00 8.40  ? 5   HOH A O     1 
HETATM 5617 O O     . HOH G 4 .   ? 12.326  -11.093 18.634  1.00 13.75 ? 6   HOH A O     1 
HETATM 5618 O O     . HOH G 4 .   ? 24.798  9.311   23.415  1.00 8.99  ? 7   HOH A O     1 
HETATM 5619 O O     . HOH G 4 .   ? 31.519  -10.632 20.608  1.00 28.02 ? 8   HOH A O     1 
HETATM 5620 O O     . HOH G 4 .   ? 42.393  -1.429  -2.959  1.00 23.83 ? 10  HOH A O     1 
HETATM 5621 O O     . HOH G 4 .   ? 7.198   -8.542  33.261  1.00 30.81 ? 11  HOH A O     1 
HETATM 5622 O O     . HOH G 4 .   ? 6.215   -1.490  33.251  1.00 18.98 ? 12  HOH A O     1 
HETATM 5623 O O     . HOH G 4 .   ? 4.258   9.130   10.021  1.00 16.41 ? 19  HOH A O     1 
HETATM 5624 O O     . HOH G 4 .   ? 30.088  10.560  -5.385  1.00 18.04 ? 23  HOH A O     1 
HETATM 5625 O O     . HOH G 4 .   ? 5.866   -0.115  9.907   1.00 9.06  ? 25  HOH A O     1 
HETATM 5626 O O     . HOH G 4 .   ? 11.724  -0.134  24.205  1.00 9.14  ? 26  HOH A O     1 
HETATM 5627 O O     . HOH G 4 .   ? 22.819  5.210   -9.032  1.00 27.56 ? 27  HOH A O     1 
HETATM 5628 O O     . HOH G 4 .   ? 9.679   8.477   12.606  1.00 11.77 ? 28  HOH A O     1 
HETATM 5629 O O     . HOH G 4 .   ? 25.142  2.577   19.808  1.00 14.07 ? 30  HOH A O     1 
HETATM 5630 O O     . HOH G 4 .   ? -12.300 -8.006  3.338   1.00 19.91 ? 31  HOH A O     1 
HETATM 5631 O O     . HOH G 4 .   ? 22.807  0.889   -7.607  1.00 17.19 ? 33  HOH A O     1 
HETATM 5632 O O     . HOH G 4 .   ? 10.295  -11.840 26.578  1.00 13.91 ? 34  HOH A O     1 
HETATM 5633 O O     . HOH G 4 .   ? 9.077   6.150   14.108  1.00 10.89 ? 36  HOH A O     1 
HETATM 5634 O O     . HOH G 4 .   ? 12.815  6.438   7.467   1.00 20.53 ? 38  HOH A O     1 
HETATM 5635 O O     . HOH G 4 .   ? 18.671  -14.368 28.810  1.00 19.60 ? 39  HOH A O     1 
HETATM 5636 O O     . HOH G 4 .   ? 17.764  -18.017 28.406  1.00 21.28 ? 40  HOH A O     1 
HETATM 5637 O O     . HOH G 4 .   ? 25.223  5.609   20.497  1.00 22.30 ? 41  HOH A O     1 
HETATM 5638 O O     . HOH G 4 .   ? 15.263  -0.245  15.364  1.00 23.36 ? 43  HOH A O     1 
HETATM 5639 O O     . HOH G 4 .   ? 14.552  -3.615  12.543  1.00 28.36 ? 45  HOH A O     1 
HETATM 5640 O O     . HOH G 4 .   ? -8.318  9.139   26.567  1.00 19.12 ? 46  HOH A O     1 
HETATM 5641 O O     . HOH G 4 .   ? 16.613  0.857   9.887   1.00 15.32 ? 48  HOH A O     1 
HETATM 5642 O O     . HOH G 4 .   ? -3.310  10.482  17.209  1.00 24.79 ? 49  HOH A O     1 
HETATM 5643 O O     . HOH G 4 .   ? -1.201  6.730   7.118   1.00 33.47 ? 50  HOH A O     1 
HETATM 5644 O O     . HOH G 4 .   ? 9.632   -12.629 6.181   1.00 28.80 ? 51  HOH A O     1 
HETATM 5645 O O     . HOH G 4 .   ? 7.424   -9.222  0.961   1.00 18.44 ? 52  HOH A O     1 
HETATM 5646 O O     . HOH G 4 .   ? 27.492  10.309  22.245  1.00 17.34 ? 53  HOH A O     1 
HETATM 5647 O O     . HOH G 4 .   ? 7.759   -3.184  9.080   1.00 8.42  ? 54  HOH A O     1 
HETATM 5648 O O     . HOH G 4 .   ? 5.049   -7.654  25.176  1.00 10.09 ? 56  HOH A O     1 
HETATM 5649 O O     . HOH G 4 .   ? 22.831  10.429  21.836  1.00 17.80 ? 57  HOH A O     1 
HETATM 5650 O O     . HOH G 4 .   ? 21.953  8.563   29.870  1.00 10.03 ? 59  HOH A O     1 
HETATM 5651 O O     . HOH G 4 .   ? 25.693  0.941   17.570  1.00 13.27 ? 62  HOH A O     1 
HETATM 5652 O O     . HOH G 4 .   ? -13.228 3.722   18.916  1.00 14.96 ? 63  HOH A O     1 
HETATM 5653 O O     . HOH G 4 .   ? 24.441  -11.571 19.330  1.00 18.90 ? 64  HOH A O     1 
HETATM 5654 O O     . HOH G 4 .   ? 14.212  -5.377  15.700  1.00 11.02 ? 65  HOH A O     1 
HETATM 5655 O O     . HOH G 4 .   ? 10.634  -7.406  21.649  1.00 14.56 ? 66  HOH A O     1 
HETATM 5656 O O     . HOH G 4 .   ? 3.032   -11.748 26.172  1.00 16.86 ? 67  HOH A O     1 
HETATM 5657 O O     . HOH G 4 .   ? 23.422  -12.385 14.632  1.00 15.61 ? 68  HOH A O     1 
HETATM 5658 O O     . HOH G 4 .   ? 20.582  9.726   19.633  1.00 19.10 ? 71  HOH A O     1 
HETATM 5659 O O     . HOH G 4 .   ? 28.256  -13.822 25.773  1.00 17.07 ? 72  HOH A O     1 
HETATM 5660 O O     . HOH G 4 .   ? 30.515  -11.873 3.213   1.00 24.08 ? 75  HOH A O     1 
HETATM 5661 O O     . HOH G 4 .   ? -3.704  6.132   16.341  1.00 15.63 ? 77  HOH A O     1 
HETATM 5662 O O     . HOH G 4 .   ? 4.826   7.437   8.025   1.00 15.89 ? 78  HOH A O     1 
HETATM 5663 O O     . HOH G 4 .   ? 11.184  -10.508 23.070  1.00 15.30 ? 80  HOH A O     1 
HETATM 5664 O O     . HOH G 4 .   ? 25.251  7.140   -10.418 1.00 13.61 ? 82  HOH A O     1 
HETATM 5665 O O     . HOH G 4 .   ? -3.204  -8.532  6.423   1.00 18.96 ? 83  HOH A O     1 
HETATM 5666 O O     . HOH G 4 .   ? -2.225  2.546   5.418   1.00 24.90 ? 84  HOH A O     1 
HETATM 5667 O O     . HOH G 4 .   ? 20.373  6.981   27.316  1.00 19.09 ? 87  HOH A O     1 
HETATM 5668 O O     . HOH G 4 .   ? 18.606  15.465  18.288  1.00 19.12 ? 88  HOH A O     1 
HETATM 5669 O O     . HOH G 4 .   ? 19.348  -12.911 39.272  1.00 34.55 ? 91  HOH A O     1 
HETATM 5670 O O     . HOH G 4 .   ? 22.127  -10.539 27.034  1.00 16.54 ? 92  HOH A O     1 
HETATM 5671 O O     . HOH G 4 .   ? -9.997  -2.576  18.904  1.00 27.94 ? 93  HOH A O     1 
HETATM 5672 O O     . HOH G 4 .   ? 16.725  -4.842  40.910  1.00 25.31 ? 94  HOH A O     1 
HETATM 5673 O O     . HOH G 4 .   ? 25.535  -13.398 24.895  1.00 19.29 ? 95  HOH A O     1 
HETATM 5674 O O     . HOH G 4 .   ? 3.690   -9.030  27.070  1.00 14.39 ? 97  HOH A O     1 
HETATM 5675 O O     . HOH G 4 .   ? 4.759   2.547   6.851   1.00 19.14 ? 99  HOH A O     1 
HETATM 5676 O O     . HOH G 4 .   ? 15.679  -6.032  13.534  1.00 28.21 ? 100 HOH A O     1 
HETATM 5677 O O     . HOH G 4 .   ? 9.937   17.280  24.430  1.00 16.98 ? 101 HOH A O     1 
HETATM 5678 O O     . HOH G 4 .   ? 17.442  15.574  31.275  1.00 23.01 ? 102 HOH A O     1 
HETATM 5679 O O     . HOH G 4 .   ? 21.715  -0.738  13.117  1.00 25.93 ? 103 HOH A O     1 
HETATM 5680 O O     . HOH G 4 .   ? 27.537  -9.531  19.153  1.00 13.26 ? 105 HOH A O     1 
HETATM 5681 O O     . HOH G 4 .   ? 12.915  -17.745 27.371  1.00 22.31 ? 108 HOH A O     1 
HETATM 5682 O O     . HOH G 4 .   ? 8.686   -11.218 20.447  1.00 18.51 ? 111 HOH A O     1 
HETATM 5683 O O     . HOH G 4 .   ? 31.044  -3.552  34.956  1.00 18.96 ? 116 HOH A O     1 
HETATM 5684 O O     . HOH G 4 .   ? 23.350  5.847   34.719  1.00 21.75 ? 117 HOH A O     1 
HETATM 5685 O O     . HOH G 4 .   ? 10.118  -13.640 16.184  1.00 32.24 ? 118 HOH A O     1 
HETATM 5686 O O     . HOH G 4 .   ? 22.028  -6.272  16.927  1.00 14.68 ? 122 HOH A O     1 
HETATM 5687 O O     . HOH G 4 .   ? 23.288  10.970  37.122  1.00 35.51 ? 123 HOH A O     1 
HETATM 5688 O O     . HOH G 4 .   ? 1.359   -6.706  -0.001  1.00 21.68 ? 125 HOH A O     1 
HETATM 5689 O O     . HOH G 4 .   ? 28.878  5.863   1.131   1.00 30.23 ? 128 HOH A O     1 
HETATM 5690 O O     . HOH G 4 .   ? 7.300   8.329   4.304   1.00 23.69 ? 129 HOH A O     1 
HETATM 5691 O O     . HOH G 4 .   ? -3.319  -12.366 16.325  1.00 23.25 ? 132 HOH A O     1 
HETATM 5692 O O     . HOH G 4 .   ? 16.595  19.618  24.238  1.00 14.45 ? 133 HOH A O     1 
HETATM 5693 O O     . HOH G 4 .   ? 17.628  3.675   10.805  1.00 21.60 ? 135 HOH A O     1 
HETATM 5694 O O     . HOH G 4 .   ? 22.921  0.251   17.677  1.00 30.87 ? 137 HOH A O     1 
HETATM 5695 O O     . HOH G 4 .   ? -7.819  9.976   23.926  1.00 31.31 ? 138 HOH A O     1 
HETATM 5696 O O     . HOH G 4 .   ? 10.886  -12.924 23.929  1.00 15.61 ? 140 HOH A O     1 
HETATM 5697 O O     . HOH G 4 .   ? 32.034  -8.728  10.912  1.00 15.86 ? 141 HOH A O     1 
HETATM 5698 O O     . HOH G 4 .   ? 17.856  -11.382 4.725   1.00 19.42 ? 142 HOH A O     1 
HETATM 5699 O O     . HOH G 4 .   ? -3.503  -8.123  -0.836  1.00 26.15 ? 143 HOH A O     1 
HETATM 5700 O O     . HOH G 4 .   ? 20.961  6.643   35.319  1.00 26.80 ? 146 HOH A O     1 
HETATM 5701 O O     . HOH G 4 .   ? 28.490  -11.416 14.116  1.00 29.48 ? 151 HOH A O     1 
HETATM 5702 O O     . HOH G 4 .   ? 13.628  -9.045  35.162  1.00 14.81 ? 152 HOH A O     1 
HETATM 5703 O O     . HOH G 4 .   ? 12.713  -9.722  6.025   1.00 17.96 ? 153 HOH A O     1 
HETATM 5704 O O     . HOH G 4 .   ? 7.104   8.047   6.874   1.00 15.07 ? 156 HOH A O     1 
HETATM 5705 O O     . HOH G 4 .   ? 11.008  10.084  -0.623  1.00 30.17 ? 158 HOH A O     1 
HETATM 5706 O O     . HOH G 4 .   ? 33.607  8.126   -2.776  1.00 25.57 ? 159 HOH A O     1 
HETATM 5707 O O     . HOH G 4 .   ? 16.624  -11.860 17.571  1.00 15.76 ? 161 HOH A O     1 
HETATM 5708 O O     . HOH G 4 .   ? 14.617  21.988  14.119  1.00 25.86 ? 162 HOH A O     1 
HETATM 5709 O O     . HOH G 4 .   ? 33.551  -3.912  32.206  1.00 27.37 ? 164 HOH A O     1 
HETATM 5710 O O     . HOH G 4 .   ? -6.119  3.150   30.315  1.00 33.33 ? 165 HOH A O     1 
HETATM 5711 O O     . HOH G 4 .   ? 19.794  9.480   2.478   1.00 31.78 ? 169 HOH A O     1 
HETATM 5712 O O     . HOH G 4 .   ? 23.374  -13.104 26.403  1.00 19.61 ? 172 HOH A O     1 
HETATM 5713 O O     . HOH G 4 .   ? 28.227  -14.904 28.317  1.00 26.43 ? 174 HOH A O     1 
HETATM 5714 O O     . HOH G 4 .   ? 0.219   -14.494 28.809  1.00 27.02 ? 175 HOH A O     1 
HETATM 5715 O O     . HOH G 4 .   ? 14.415  -15.355 -0.266  1.00 20.95 ? 176 HOH A O     1 
HETATM 5716 O O     . HOH G 4 .   ? 8.089   -4.965  35.415  1.00 19.06 ? 178 HOH A O     1 
HETATM 5717 O O     . HOH G 4 .   ? 21.416  5.316   2.279   1.00 33.42 ? 179 HOH A O     1 
HETATM 5718 O O     . HOH G 4 .   ? 36.285  -3.077  25.642  1.00 27.12 ? 180 HOH A O     1 
HETATM 5719 O O     . HOH G 4 .   ? 30.132  -6.281  27.548  1.00 14.82 ? 182 HOH A O     1 
HETATM 5720 O O     . HOH G 4 .   ? 20.190  -4.203  15.006  1.00 28.93 ? 183 HOH A O     1 
HETATM 5721 O O     . HOH G 4 .   ? 4.816   12.013  9.864   1.00 21.45 ? 184 HOH A O     1 
HETATM 5722 O O     . HOH G 4 .   ? 13.536  -10.478 10.985  1.00 26.12 ? 185 HOH A O     1 
HETATM 5723 O O     . HOH G 4 .   ? 4.101   4.891   7.929   1.00 18.99 ? 186 HOH A O     1 
HETATM 5724 O O     . HOH G 4 .   ? 21.877  -14.535 14.970  1.00 24.19 ? 187 HOH A O     1 
HETATM 5725 O O     . HOH G 4 .   ? 4.762   -5.428  34.453  1.00 31.83 ? 189 HOH A O     1 
HETATM 5726 O O     . HOH G 4 .   ? -13.975 -5.618  16.971  1.00 36.40 ? 190 HOH A O     1 
HETATM 5727 O O     . HOH G 4 .   ? 18.358  -13.721 5.712   1.00 23.05 ? 191 HOH A O     1 
HETATM 5728 O O     . HOH G 4 .   ? 20.565  -6.473  10.726  1.00 22.34 ? 193 HOH A O     1 
HETATM 5729 O O     . HOH G 4 .   ? -3.486  6.659   10.395  1.00 20.37 ? 194 HOH A O     1 
HETATM 5730 O O     . HOH G 4 .   ? -9.934  -5.330  17.865  1.00 31.24 ? 195 HOH A O     1 
HETATM 5731 O O     . HOH G 4 .   ? 15.997  3.645   13.061  1.00 17.55 ? 196 HOH A O     1 
HETATM 5732 O O     . HOH G 4 .   ? 7.369   -12.461 7.964   1.00 30.57 ? 202 HOH A O     1 
HETATM 5733 O O     . HOH G 4 .   ? 3.096   15.749  25.466  1.00 25.02 ? 204 HOH A O     1 
HETATM 5734 O O     . HOH G 4 .   ? 14.265  19.999  23.014  1.00 12.49 ? 206 HOH A O     1 
HETATM 5735 O O     . HOH G 4 .   ? 10.967  10.480  7.643   1.00 26.01 ? 208 HOH A O     1 
HETATM 5736 O O     . HOH G 4 .   ? -4.980  6.096   36.618  1.00 34.34 ? 209 HOH A O     1 
HETATM 5737 O O     . HOH G 4 .   ? 26.736  6.663   33.000  1.00 21.27 ? 211 HOH A O     1 
HETATM 5738 O O     . HOH G 4 .   ? 11.070  7.176   9.688   1.00 13.66 ? 581 HOH A O     1 
HETATM 5739 O O     . HOH G 4 .   ? 5.126   -10.178 -0.454  1.00 26.66 ? 582 HOH A O     1 
HETATM 5740 O O     . HOH G 4 .   ? 7.424   -7.586  39.225  1.00 29.90 ? 583 HOH A O     1 
HETATM 5741 O O     . HOH G 4 .   ? 11.678  -13.331 0.753   1.00 21.86 ? 584 HOH A O     1 
HETATM 5742 O O     . HOH G 4 .   ? 15.349  -10.235 6.129   1.00 34.08 ? 585 HOH A O     1 
HETATM 5743 O O     . HOH G 4 .   ? 31.824  9.054   -12.258 1.00 22.27 ? 586 HOH A O     1 
HETATM 5744 O O     . HOH G 4 .   ? 15.149  -16.333 23.635  1.00 22.86 ? 587 HOH A O     1 
HETATM 5745 O O     . HOH G 4 .   ? 23.838  -14.969 -0.491  1.00 29.31 ? 588 HOH A O     1 
HETATM 5746 O O     . HOH G 4 .   ? -2.819  -5.004  1.304   1.00 26.92 ? 589 HOH A O     1 
HETATM 5747 O O     . HOH G 4 .   ? 35.795  -8.128  8.606   1.00 21.38 ? 590 HOH A O     1 
HETATM 5748 O O     . HOH G 4 .   ? 36.019  -10.803 1.956   1.00 27.87 ? 591 HOH A O     1 
HETATM 5749 O O     . HOH G 4 .   ? 28.959  10.700  -0.870  1.00 32.14 ? 592 HOH A O     1 
HETATM 5750 O O     . HOH G 4 .   ? 5.369   -10.956 7.270   1.00 21.29 ? 593 HOH A O     1 
HETATM 5751 O O     . HOH G 4 .   ? 24.824  0.016   12.214  1.00 21.84 ? 594 HOH A O     1 
HETATM 5752 O O     . HOH G 4 .   ? -11.674 -15.774 5.340   1.00 28.41 ? 595 HOH A O     1 
HETATM 5753 O O     . HOH G 4 .   ? -8.024  -8.911  14.288  1.00 21.12 ? 596 HOH A O     1 
HETATM 5754 O O     . HOH G 4 .   ? 9.286   8.845   8.706   1.00 13.90 ? 597 HOH A O     1 
HETATM 5755 O O     . HOH G 4 .   ? 16.710  -4.545  17.941  1.00 23.08 ? 598 HOH A O     1 
HETATM 5756 O O     . HOH G 4 .   ? 14.143  -12.927 17.795  1.00 13.32 ? 599 HOH A O     1 
HETATM 5757 O O     . HOH G 4 .   ? 13.569  7.644   5.130   1.00 27.12 ? 600 HOH A O     1 
HETATM 5758 O O     . HOH G 4 .   ? 15.836  9.128   6.084   1.00 28.49 ? 601 HOH A O     1 
HETATM 5759 O O     . HOH G 4 .   ? 9.105   -8.033  -0.524  1.00 23.45 ? 602 HOH A O     1 
HETATM 5760 O O     . HOH G 4 .   ? 8.380   -11.561 0.928   1.00 37.07 ? 603 HOH A O     1 
HETATM 5761 O O     . HOH G 4 .   ? 20.586  -8.706  -3.388  1.00 27.46 ? 604 HOH A O     1 
HETATM 5762 O O     . HOH G 4 .   ? 17.526  -6.749  7.479   1.00 19.51 ? 605 HOH A O     1 
HETATM 5763 O O     . HOH G 4 .   ? 17.739  -0.342  11.861  1.00 25.70 ? 606 HOH A O     1 
HETATM 5764 O O     . HOH G 4 .   ? -2.509  -8.847  17.217  1.00 20.07 ? 607 HOH A O     1 
HETATM 5765 O O     . HOH G 4 .   ? -2.822  11.503  32.799  1.00 21.51 ? 608 HOH A O     1 
HETATM 5766 O O     . HOH G 4 .   ? 4.445   4.377   40.552  1.00 24.79 ? 609 HOH A O     1 
HETATM 5767 O O     . HOH G 4 .   ? 14.505  22.797  21.979  1.00 16.43 ? 610 HOH A O     1 
HETATM 5768 O O     . HOH G 4 .   ? 16.395  18.662  13.103  1.00 22.03 ? 611 HOH A O     1 
HETATM 5769 O O     . HOH G 4 .   ? -4.500  7.990   17.902  1.00 20.28 ? 612 HOH A O     1 
HETATM 5770 O O     . HOH G 4 .   ? 2.091   -6.130  28.094  1.00 23.12 ? 613 HOH A O     1 
HETATM 5771 O O     . HOH G 4 .   ? 14.654  -2.710  15.784  1.00 24.44 ? 614 HOH A O     1 
HETATM 5772 O O     . HOH G 4 .   ? 15.789  -1.688  13.009  1.00 35.51 ? 615 HOH A O     1 
HETATM 5773 O O     . HOH G 4 .   ? 9.797   9.766   3.873   1.00 23.24 ? 616 HOH A O     1 
HETATM 5774 O O     . HOH G 4 .   ? 18.284  -14.203 17.682  1.00 16.26 ? 617 HOH A O     1 
HETATM 5775 O O     . HOH G 4 .   ? 19.310  -14.121 14.977  1.00 21.45 ? 618 HOH A O     1 
HETATM 5776 O O     . HOH G 4 .   ? 25.215  -12.388 16.793  1.00 22.21 ? 619 HOH A O     1 
HETATM 5777 O O     . HOH G 4 .   ? 28.036  -11.267 17.027  1.00 22.07 ? 620 HOH A O     1 
HETATM 5778 O O     . HOH G 4 .   ? 30.045  -8.453  20.339  1.00 13.73 ? 621 HOH A O     1 
HETATM 5779 O O     . HOH G 4 .   ? 3.739   -1.407  33.284  1.00 18.10 ? 622 HOH A O     1 
HETATM 5780 O O     . HOH G 4 .   ? 25.174  -3.978  37.058  1.00 33.03 ? 623 HOH A O     1 
HETATM 5781 O O     . HOH G 4 .   ? 26.232  2.908   36.047  1.00 19.65 ? 624 HOH A O     1 
HETATM 5782 O O     . HOH G 4 .   ? 25.017  -0.877  35.722  1.00 38.72 ? 625 HOH A O     1 
HETATM 5783 O O     . HOH G 4 .   ? 16.979  12.191  37.319  1.00 26.12 ? 626 HOH A O     1 
HETATM 5784 O O     . HOH G 4 .   ? 12.869  -8.954  21.961  1.00 23.51 ? 627 HOH A O     1 
HETATM 5785 O O     . HOH G 4 .   ? 17.121  -18.232 24.924  1.00 31.91 ? 628 HOH A O     1 
HETATM 5786 O O     . HOH G 4 .   ? 8.327   10.309  10.860  1.00 22.18 ? 629 HOH A O     1 
HETATM 5787 O O     . HOH G 4 .   ? -10.487 4.479   22.612  1.00 29.95 ? 630 HOH A O     1 
HETATM 5788 O O     . HOH G 4 .   ? 7.449   20.200  13.197  1.00 25.24 ? 631 HOH A O     1 
HETATM 5789 O O     . HOH G 4 .   ? 6.456   -2.715  -5.156  1.00 27.00 ? 632 HOH A O     1 
HETATM 5790 O O     . HOH G 4 .   ? 0.761   7.820   1.794   1.00 33.78 ? 633 HOH A O     1 
HETATM 5791 O O     . HOH G 4 .   ? 6.218   -13.753 14.138  1.00 33.09 ? 634 HOH A O     1 
HETATM 5792 O O     . HOH G 4 .   ? 6.818   -17.693 25.056  1.00 27.80 ? 635 HOH A O     1 
HETATM 5793 O O     . HOH G 4 .   ? 8.285   -14.582 22.998  1.00 27.35 ? 636 HOH A O     1 
HETATM 5794 O O     . HOH G 4 .   ? -16.015 -9.384  1.342   1.00 31.73 ? 637 HOH A O     1 
HETATM 5795 O O     . HOH G 4 .   ? 19.133  1.843   16.234  1.00 29.15 ? 638 HOH A O     1 
HETATM 5796 O O     . HOH G 4 .   ? 15.018  6.959   -6.320  1.00 32.39 ? 639 HOH A O     1 
HETATM 5797 O O     . HOH G 4 .   ? -0.940  4.903   0.480   1.00 27.76 ? 640 HOH A O     1 
HETATM 5798 O O     . HOH G 4 .   ? -3.768  13.528  21.047  1.00 27.05 ? 641 HOH A O     1 
HETATM 5799 O O     . HOH G 4 .   ? 19.960  -16.817 27.869  1.00 22.33 ? 642 HOH A O     1 
HETATM 5800 O O     . HOH G 4 .   ? -3.177  14.209  26.244  1.00 28.06 ? 643 HOH A O     1 
HETATM 5801 O O     . HOH G 4 .   ? -7.264  -2.966  20.782  1.00 26.57 ? 644 HOH A O     1 
HETATM 5802 O O     . HOH G 4 .   ? 33.337  -12.213 3.738   1.00 30.06 ? 645 HOH A O     1 
HETATM 5803 O O     . HOH G 4 .   ? -0.301  14.324  25.739  1.00 31.24 ? 646 HOH A O     1 
HETATM 5804 O O     . HOH G 4 .   ? -18.072 -9.419  3.121   1.00 15.96 ? 647 HOH A O     1 
HETATM 5805 O O     . HOH G 4 .   ? 8.679   -0.208  -4.613  1.00 24.27 ? 648 HOH A O     1 
HETATM 5806 O O     . HOH G 4 .   ? 19.849  17.538  31.903  1.00 38.50 ? 649 HOH A O     1 
HETATM 5807 O O     . HOH G 4 .   ? -9.959  -8.507  2.290   1.00 24.35 ? 650 HOH A O     1 
HETATM 5808 O O     . HOH G 4 .   ? 5.128   10.430  37.093  1.00 27.14 ? 651 HOH A O     1 
HETATM 5809 O O     . HOH G 4 .   ? 21.020  -14.783 -0.738  1.00 30.19 ? 652 HOH A O     1 
HETATM 5810 O O     . HOH G 4 .   ? 6.919   22.402  22.876  1.00 35.26 ? 653 HOH A O     1 
HETATM 5811 O O     . HOH G 4 .   ? 26.211  14.445  27.887  1.00 19.85 ? 654 HOH A O     1 
HETATM 5812 O O     . HOH G 4 .   ? -9.804  -13.149 6.716   1.00 29.09 ? 655 HOH A O     1 
HETATM 5813 O O     . HOH G 4 .   ? 14.875  16.840  29.880  1.00 36.67 ? 656 HOH A O     1 
HETATM 5814 O O     . HOH G 4 .   ? -0.790  0.625   2.075   1.00 24.82 ? 657 HOH A O     1 
HETATM 5815 O O     . HOH G 4 .   ? 34.957  -5.320  30.034  1.00 29.07 ? 658 HOH A O     1 
HETATM 5816 O O     . HOH G 4 .   ? 0.606   16.074  14.611  1.00 32.58 ? 659 HOH A O     1 
HETATM 5817 O O     . HOH G 4 .   ? -5.918  -12.430 5.897   1.00 40.08 ? 660 HOH A O     1 
HETATM 5818 O O     . HOH G 4 .   ? 35.575  0.750   28.215  1.00 29.92 ? 661 HOH A O     1 
HETATM 5819 O O     . HOH G 4 .   ? 31.209  6.367   26.951  1.00 32.34 ? 662 HOH A O     1 
HETATM 5820 O O     . HOH G 4 .   ? 11.772  13.044  6.417   1.00 29.97 ? 663 HOH A O     1 
HETATM 5821 O O     . HOH G 4 .   ? 12.685  4.104   6.496   1.00 31.32 ? 664 HOH A O     1 
HETATM 5822 O O     . HOH G 4 .   ? 15.656  -18.157 -0.144  1.00 45.22 ? 665 HOH A O     1 
HETATM 5823 O O     . HOH H 4 .   ? 24.280  -40.587 7.652   1.00 13.93 ? 2   HOH B O     1 
HETATM 5824 O O     . HOH H 4 .   ? 16.765  -35.018 6.672   1.00 15.94 ? 3   HOH B O     1 
HETATM 5825 O O     . HOH H 4 .   ? 38.923  -33.816 16.141  1.00 15.12 ? 4   HOH B O     1 
HETATM 5826 O O     . HOH H 4 .   ? 19.432  -44.006 5.543   1.00 24.14 ? 9   HOH B O     1 
HETATM 5827 O O     . HOH H 4 .   ? 15.296  -32.261 29.844  1.00 15.28 ? 13  HOH B O     1 
HETATM 5828 O O     . HOH H 4 .   ? 26.081  -32.374 14.444  1.00 9.80  ? 14  HOH B O     1 
HETATM 5829 O O     . HOH H 4 .   ? 37.981  -17.958 12.880  1.00 32.26 ? 15  HOH B O     1 
HETATM 5830 O O     . HOH H 4 .   ? 25.257  -38.312 6.259   1.00 9.01  ? 16  HOH B O     1 
HETATM 5831 O O     . HOH H 4 .   ? 19.733  -32.013 5.710   1.00 11.23 ? 17  HOH B O     1 
HETATM 5832 O O     . HOH H 4 .   ? 34.941  -31.870 2.441   1.00 7.83  ? 18  HOH B O     1 
HETATM 5833 O O     . HOH H 4 .   ? 20.178  -29.005 7.680   1.00 10.11 ? 20  HOH B O     1 
HETATM 5834 O O     . HOH H 4 .   ? 28.581  -53.779 11.254  1.00 12.27 ? 21  HOH B O     1 
HETATM 5835 O O     . HOH H 4 .   ? 35.472  -19.101 21.250  1.00 25.87 ? 22  HOH B O     1 
HETATM 5836 O O     . HOH H 4 .   ? 38.306  -19.743 19.260  1.00 21.36 ? 24  HOH B O     1 
HETATM 5837 O O     . HOH H 4 .   ? 34.099  -28.912 11.112  1.00 9.01  ? 29  HOH B O     1 
HETATM 5838 O O     . HOH H 4 .   ? 13.315  -22.839 11.900  1.00 12.28 ? 32  HOH B O     1 
HETATM 5839 O O     . HOH H 4 .   ? 41.985  -40.507 14.059  1.00 13.94 ? 35  HOH B O     1 
HETATM 5840 O O     . HOH H 4 .   ? 35.377  -22.121 26.183  1.00 16.04 ? 37  HOH B O     1 
HETATM 5841 O O     . HOH H 4 .   ? 34.292  -49.208 1.720   1.00 20.00 ? 42  HOH B O     1 
HETATM 5842 O O     . HOH H 4 .   ? 36.219  -40.996 12.827  1.00 17.68 ? 44  HOH B O     1 
HETATM 5843 O O     . HOH H 4 .   ? 29.842  -36.643 -15.910 1.00 27.54 ? 47  HOH B O     1 
HETATM 5844 O O     . HOH H 4 .   ? 50.914  -37.922 10.007  1.00 18.30 ? 55  HOH B O     1 
HETATM 5845 O O     . HOH H 4 .   ? 21.852  -32.260 37.235  1.00 39.34 ? 58  HOH B O     1 
HETATM 5846 O O     . HOH H 4 .   ? 29.728  -19.094 26.193  1.00 29.60 ? 60  HOH B O     1 
HETATM 5847 O O     . HOH H 4 .   ? 39.487  -42.090 13.210  1.00 19.37 ? 61  HOH B O     1 
HETATM 5848 O O     . HOH H 4 .   ? 38.049  -14.162 0.341   1.00 26.84 ? 69  HOH B O     1 
HETATM 5849 O O     . HOH H 4 .   ? 28.215  -35.397 12.364  1.00 15.07 ? 70  HOH B O     1 
HETATM 5850 O O     . HOH H 4 .   ? 8.989   -25.809 7.388   1.00 23.75 ? 73  HOH B O     1 
HETATM 5851 O O     . HOH H 4 .   ? 31.266  -20.604 -6.379  1.00 19.64 ? 74  HOH B O     1 
HETATM 5852 O O     . HOH H 4 .   ? 43.204  -17.768 12.788  1.00 21.60 ? 76  HOH B O     1 
HETATM 5853 O O     . HOH H 4 .   ? 12.093  -38.056 22.689  1.00 35.66 ? 79  HOH B O     1 
HETATM 5854 O O     . HOH H 4 .   ? 20.453  -22.122 12.877  1.00 15.01 ? 81  HOH B O     1 
HETATM 5855 O O     . HOH H 4 .   ? 42.614  -38.704 7.865   1.00 12.98 ? 85  HOH B O     1 
HETATM 5856 O O     . HOH H 4 .   ? 28.051  -19.343 30.088  1.00 20.44 ? 86  HOH B O     1 
HETATM 5857 O O     . HOH H 4 .   ? 39.785  -21.502 17.807  1.00 12.41 ? 89  HOH B O     1 
HETATM 5858 O O     . HOH H 4 .   ? 43.109  -20.929 8.916   1.00 14.44 ? 90  HOH B O     1 
HETATM 5859 O O     . HOH H 4 .   ? 31.557  -24.810 -4.050  1.00 17.44 ? 96  HOH B O     1 
HETATM 5860 O O     . HOH H 4 .   ? 23.640  -35.931 28.243  1.00 24.42 ? 98  HOH B O     1 
HETATM 5861 O O     . HOH H 4 .   ? 34.230  -47.234 12.157  1.00 18.81 ? 104 HOH B O     1 
HETATM 5862 O O     . HOH H 4 .   ? 31.995  -24.807 2.545   1.00 17.04 ? 106 HOH B O     1 
HETATM 5863 O O     . HOH H 4 .   ? 20.519  -23.968 -5.866  1.00 25.10 ? 107 HOH B O     1 
HETATM 5864 O O     . HOH H 4 .   ? 31.955  -19.769 9.435   1.00 16.21 ? 109 HOH B O     1 
HETATM 5865 O O     . HOH H 4 .   ? 15.642  -18.646 15.019  1.00 19.60 ? 110 HOH B O     1 
HETATM 5866 O O     . HOH H 4 .   ? 33.781  -17.670 10.018  1.00 20.06 ? 112 HOH B O     1 
HETATM 5867 O O     . HOH H 4 .   ? 16.293  -16.276 17.736  1.00 13.79 ? 113 HOH B O     1 
HETATM 5868 O O     . HOH H 4 .   ? 24.578  -24.616 16.400  1.00 17.74 ? 114 HOH B O     1 
HETATM 5869 O O     . HOH H 4 .   ? 35.819  -20.299 -0.488  1.00 14.52 ? 115 HOH B O     1 
HETATM 5870 O O     . HOH H 4 .   ? 40.136  -45.942 14.506  1.00 36.70 ? 119 HOH B O     1 
HETATM 5871 O O     . HOH H 4 .   ? 47.938  -24.813 15.266  1.00 18.64 ? 120 HOH B O     1 
HETATM 5872 O O     . HOH H 4 .   ? 12.394  -26.992 29.427  1.00 27.10 ? 121 HOH B O     1 
HETATM 5873 O O     . HOH H 4 .   ? 21.817  -15.501 25.321  1.00 24.93 ? 124 HOH B O     1 
HETATM 5874 O O     . HOH H 4 .   ? 30.394  -21.236 5.446   1.00 21.93 ? 126 HOH B O     1 
HETATM 5875 O O     . HOH H 4 .   ? 38.214  -51.409 7.187   1.00 15.68 ? 127 HOH B O     1 
HETATM 5876 O O     . HOH H 4 .   ? 22.694  -39.096 10.447  1.00 16.36 ? 130 HOH B O     1 
HETATM 5877 O O     . HOH H 4 .   ? 34.974  -50.491 14.101  1.00 33.48 ? 131 HOH B O     1 
HETATM 5878 O O     . HOH H 4 .   ? 20.822  -40.893 9.593   1.00 14.81 ? 134 HOH B O     1 
HETATM 5879 O O     . HOH H 4 .   ? 26.208  -37.101 30.009  1.00 23.43 ? 136 HOH B O     1 
HETATM 5880 O O     . HOH H 4 .   ? 34.601  -25.004 14.661  1.00 10.28 ? 139 HOH B O     1 
HETATM 5881 O O     . HOH H 4 .   ? 16.684  -20.234 26.615  1.00 29.91 ? 144 HOH B O     1 
HETATM 5882 O O     . HOH H 4 .   ? 39.628  -37.032 15.953  1.00 25.51 ? 145 HOH B O     1 
HETATM 5883 O O     . HOH H 4 .   ? 34.253  -44.070 -13.900 1.00 23.45 ? 147 HOH B O     1 
HETATM 5884 O O     . HOH H 4 .   ? 42.172  -16.577 4.439   1.00 20.82 ? 148 HOH B O     1 
HETATM 5885 O O     . HOH H 4 .   ? 36.835  -23.202 35.795  1.00 19.93 ? 149 HOH B O     1 
HETATM 5886 O O     . HOH H 4 .   ? 22.875  -40.940 16.631  1.00 31.27 ? 150 HOH B O     1 
HETATM 5887 O O     . HOH H 4 .   ? 16.914  -21.286 6.308   1.00 24.58 ? 154 HOH B O     1 
HETATM 5888 O O     . HOH H 4 .   ? 9.583   -31.540 16.322  1.00 22.30 ? 155 HOH B O     1 
HETATM 5889 O O     . HOH H 4 .   ? 38.454  -13.247 5.845   1.00 25.94 ? 157 HOH B O     1 
HETATM 5890 O O     . HOH H 4 .   ? 32.405  -31.199 19.556  1.00 29.23 ? 160 HOH B O     1 
HETATM 5891 O O     . HOH H 4 .   ? 10.756  -26.593 -25.044 1.00 30.13 ? 163 HOH B O     1 
HETATM 5892 O O     . HOH H 4 .   ? 33.380  -21.612 2.122   1.00 16.56 ? 166 HOH B O     1 
HETATM 5893 O O     . HOH H 4 .   ? 23.423  -43.392 14.492  1.00 30.46 ? 167 HOH B O     1 
HETATM 5894 O O     . HOH H 4 .   ? 37.834  -31.073 -9.374  1.00 24.64 ? 168 HOH B O     1 
HETATM 5895 O O     . HOH H 4 .   ? 14.090  -37.112 30.886  1.00 16.94 ? 170 HOH B O     1 
HETATM 5896 O O     . HOH H 4 .   ? 36.223  -33.080 19.805  1.00 28.16 ? 171 HOH B O     1 
HETATM 5897 O O     . HOH H 4 .   ? 13.994  -16.792 21.063  1.00 28.72 ? 173 HOH B O     1 
HETATM 5898 O O     . HOH H 4 .   ? 21.848  -41.968 34.622  1.00 30.83 ? 177 HOH B O     1 
HETATM 5899 O O     . HOH H 4 .   ? 14.172  -15.442 18.926  1.00 18.37 ? 181 HOH B O     1 
HETATM 5900 O O     . HOH H 4 .   ? 24.779  -21.402 10.691  1.00 23.36 ? 188 HOH B O     1 
HETATM 5901 O O     . HOH H 4 .   ? 50.378  -37.367 6.243   1.00 21.25 ? 192 HOH B O     1 
HETATM 5902 O O     . HOH H 4 .   ? 29.134  -26.326 9.064   1.00 14.68 ? 197 HOH B O     1 
HETATM 5903 O O     . HOH H 4 .   ? 19.401  -20.132 1.963   1.00 36.30 ? 198 HOH B O     1 
HETATM 5904 O O     . HOH H 4 .   ? 21.724  -51.993 6.776   1.00 33.63 ? 199 HOH B O     1 
HETATM 5905 O O     . HOH H 4 .   ? 22.775  -17.670 28.920  1.00 17.22 ? 200 HOH B O     1 
HETATM 5906 O O     . HOH H 4 .   ? 11.040  -38.587 31.893  1.00 26.19 ? 201 HOH B O     1 
HETATM 5907 O O     . HOH H 4 .   ? 27.531  -34.952 14.902  1.00 21.13 ? 203 HOH B O     1 
HETATM 5908 O O     . HOH H 4 .   ? 13.579  -27.134 34.049  1.00 44.94 ? 205 HOH B O     1 
HETATM 5909 O O     . HOH H 4 .   ? 39.470  -30.815 -7.162  1.00 31.87 ? 210 HOH B O     1 
HETATM 5910 O O     . HOH H 4 .   ? 32.241  -26.951 9.785   1.00 25.08 ? 581 HOH B O     1 
HETATM 5911 O O     . HOH H 4 .   ? 46.553  -17.693 9.436   1.00 27.70 ? 582 HOH B O     1 
HETATM 5912 O O     . HOH H 4 .   ? 52.860  -34.246 8.017   1.00 25.40 ? 583 HOH B O     1 
HETATM 5913 O O     . HOH H 4 .   ? 44.993  -23.043 -2.710  1.00 26.33 ? 584 HOH B O     1 
HETATM 5914 O O     . HOH H 4 .   ? 43.123  -20.233 20.179  1.00 28.86 ? 585 HOH B O     1 
HETATM 5915 O O     . HOH H 4 .   ? 17.220  -18.943 31.762  1.00 40.92 ? 586 HOH B O     1 
HETATM 5916 O O     . HOH H 4 .   ? 23.887  -52.303 5.670   1.00 23.34 ? 587 HOH B O     1 
HETATM 5917 O O     . HOH H 4 .   ? 22.683  -15.373 30.902  1.00 30.40 ? 588 HOH B O     1 
HETATM 5918 O O     . HOH H 4 .   ? 28.864  -24.602 16.966  1.00 22.14 ? 589 HOH B O     1 
HETATM 5919 O O     . HOH H 4 .   ? 10.665  -25.860 20.641  1.00 22.05 ? 590 HOH B O     1 
HETATM 5920 O O     . HOH H 4 .   ? 40.878  -49.154 2.344   1.00 27.25 ? 591 HOH B O     1 
HETATM 5921 O O     . HOH H 4 .   ? 24.106  -52.442 2.506   1.00 30.85 ? 592 HOH B O     1 
HETATM 5922 O O     . HOH H 4 .   ? 11.894  -24.075 0.006   1.00 25.04 ? 593 HOH B O     1 
HETATM 5923 O O     . HOH H 4 .   ? 22.108  -42.288 7.560   1.00 13.13 ? 594 HOH B O     1 
HETATM 5924 O O     . HOH H 4 .   ? 17.197  -37.367 5.587   1.00 26.77 ? 595 HOH B O     1 
HETATM 5925 O O     . HOH H 4 .   ? 17.766  -39.691 6.388   1.00 20.50 ? 596 HOH B O     1 
HETATM 5926 O O     . HOH H 4 .   ? 18.210  -40.236 8.882   1.00 16.50 ? 597 HOH B O     1 
HETATM 5927 O O     . HOH H 4 .   ? 37.461  -31.995 17.529  1.00 14.07 ? 598 HOH B O     1 
HETATM 5928 O O     . HOH H 4 .   ? 36.601  -18.688 17.096  1.00 14.07 ? 599 HOH B O     1 
HETATM 5929 O O     . HOH H 4 .   ? 37.874  -19.651 15.014  1.00 17.43 ? 600 HOH B O     1 
HETATM 5930 O O     . HOH H 4 .   ? 16.158  -40.376 10.707  1.00 24.31 ? 601 HOH B O     1 
HETATM 5931 O O     . HOH H 4 .   ? 17.568  -22.189 25.277  1.00 25.32 ? 602 HOH B O     1 
HETATM 5932 O O     . HOH H 4 .   ? 20.902  -16.457 23.182  1.00 26.40 ? 603 HOH B O     1 
HETATM 5933 O O     . HOH H 4 .   ? 13.243  -24.034 14.179  1.00 21.63 ? 604 HOH B O     1 
HETATM 5934 O O     . HOH H 4 .   ? 19.685  -24.913 37.307  1.00 22.99 ? 605 HOH B O     1 
HETATM 5935 O O     . HOH H 4 .   ? 16.543  -29.783 34.523  1.00 20.32 ? 606 HOH B O     1 
HETATM 5936 O O     . HOH H 4 .   ? 16.440  -34.081 31.500  1.00 22.28 ? 607 HOH B O     1 
HETATM 5937 O O     . HOH H 4 .   ? 14.372  -38.899 33.149  1.00 12.88 ? 608 HOH B O     1 
HETATM 5938 O O     . HOH H 4 .   ? 26.717  -36.168 26.959  1.00 27.37 ? 609 HOH B O     1 
HETATM 5939 O O     . HOH H 4 .   ? 35.932  -51.866 6.018   1.00 18.29 ? 610 HOH B O     1 
HETATM 5940 O O     . HOH H 4 .   ? 33.797  -19.038 1.168   1.00 17.61 ? 611 HOH B O     1 
HETATM 5941 O O     . HOH H 4 .   ? 32.044  -17.748 -0.170  1.00 19.64 ? 612 HOH B O     1 
HETATM 5942 O O     . HOH H 4 .   ? 34.038  -16.831 2.578   1.00 20.87 ? 613 HOH B O     1 
HETATM 5943 O O     . HOH H 4 .   ? 35.795  -15.913 4.621   1.00 26.19 ? 614 HOH B O     1 
HETATM 5944 O O     . HOH H 4 .   ? 32.001  -15.016 -0.249  1.00 28.00 ? 615 HOH B O     1 
HETATM 5945 O O     . HOH H 4 .   ? 32.408  -14.481 -2.878  1.00 22.08 ? 616 HOH B O     1 
HETATM 5946 O O     . HOH H 4 .   ? 33.606  -23.298 4.237   1.00 27.20 ? 617 HOH B O     1 
HETATM 5947 O O     . HOH H 4 .   ? 30.537  -19.139 7.283   1.00 24.92 ? 618 HOH B O     1 
HETATM 5948 O O     . HOH H 4 .   ? 51.435  -26.967 -3.168  1.00 21.34 ? 619 HOH B O     1 
HETATM 5949 O O     . HOH H 4 .   ? 45.664  -40.281 7.898   1.00 18.95 ? 620 HOH B O     1 
HETATM 5950 O O     . HOH H 4 .   ? 53.048  -27.680 5.920   1.00 24.25 ? 621 HOH B O     1 
HETATM 5951 O O     . HOH H 4 .   ? 49.592  -30.551 23.963  1.00 44.83 ? 622 HOH B O     1 
HETATM 5952 O O     . HOH H 4 .   ? 51.859  -31.688 19.894  1.00 31.75 ? 623 HOH B O     1 
HETATM 5953 O O     . HOH H 4 .   ? 49.584  -30.672 20.964  1.00 31.61 ? 624 HOH B O     1 
HETATM 5954 O O     . HOH H 4 .   ? 50.109  -27.595 21.360  1.00 31.66 ? 625 HOH B O     1 
HETATM 5955 O O     . HOH H 4 .   ? 42.008  -22.495 19.017  1.00 19.23 ? 626 HOH B O     1 
HETATM 5956 O O     . HOH H 4 .   ? 48.888  -44.019 -0.081  1.00 31.24 ? 627 HOH B O     1 
HETATM 5957 O O     . HOH H 4 .   ? 48.597  -29.967 -3.480  1.00 21.23 ? 628 HOH B O     1 
HETATM 5958 O O     . HOH H 4 .   ? 43.677  -18.567 10.166  1.00 23.35 ? 629 HOH B O     1 
HETATM 5959 O O     . HOH H 4 .   ? 14.887  -40.885 23.903  1.00 33.50 ? 630 HOH B O     1 
HETATM 5960 O O     . HOH H 4 .   ? 10.094  -36.788 21.568  1.00 22.74 ? 631 HOH B O     1 
HETATM 5961 O O     . HOH H 4 .   ? 28.843  -17.666 28.368  1.00 28.46 ? 632 HOH B O     1 
HETATM 5962 O O     . HOH H 4 .   ? 25.647  -17.409 30.885  1.00 30.47 ? 633 HOH B O     1 
HETATM 5963 O O     . HOH H 4 .   ? 42.788  -29.610 -14.901 1.00 26.67 ? 634 HOH B O     1 
HETATM 5964 O O     . HOH H 4 .   ? 35.189  -54.327 6.801   1.00 25.68 ? 635 HOH B O     1 
HETATM 5965 O O     . HOH H 4 .   ? 17.226  -21.697 31.726  1.00 20.93 ? 636 HOH B O     1 
HETATM 5966 O O     . HOH H 4 .   ? 24.828  -50.052 12.757  1.00 20.70 ? 637 HOH B O     1 
HETATM 5967 O O     . HOH H 4 .   ? 44.175  -36.171 -12.804 1.00 23.45 ? 638 HOH B O     1 
HETATM 5968 O O     . HOH H 4 .   ? 18.967  -26.450 39.767  1.00 19.87 ? 639 HOH B O     1 
HETATM 5969 O O     . HOH H 4 .   ? 28.868  -50.268 13.545  1.00 22.73 ? 640 HOH B O     1 
HETATM 5970 O O     . HOH H 4 .   ? 42.807  -41.359 16.847  1.00 26.06 ? 641 HOH B O     1 
HETATM 5971 O O     . HOH H 4 .   ? 19.272  -41.635 4.769   1.00 25.36 ? 642 HOH B O     1 
HETATM 5972 O O     . HOH H 4 .   ? 9.608   -28.554 -12.943 1.00 43.89 ? 643 HOH B O     1 
HETATM 5973 O O     . HOH H 4 .   ? 33.250  -18.753 16.636  1.00 22.95 ? 644 HOH B O     1 
HETATM 5974 O O     . HOH H 4 .   ? 8.696   -26.434 -10.678 1.00 26.74 ? 645 HOH B O     1 
HETATM 5975 O O     . HOH H 4 .   ? 14.314  -42.013 16.595  1.00 27.07 ? 647 HOH B O     1 
HETATM 5976 O O     . HOH H 4 .   ? 9.868   -39.659 29.242  1.00 38.04 ? 648 HOH B O     1 
HETATM 5977 O O     . HOH H 4 .   ? 43.589  -31.717 -13.368 1.00 31.70 ? 649 HOH B O     1 
HETATM 5978 O O     . HOH H 4 .   ? 31.542  -30.573 17.021  1.00 25.85 ? 650 HOH B O     1 
HETATM 5979 O O     . HOH H 4 .   ? 19.550  -20.529 -6.489  1.00 22.50 ? 651 HOH B O     1 
HETATM 5980 O O     . HOH H 4 .   ? 22.705  -36.679 23.247  1.00 31.82 ? 652 HOH B O     1 
HETATM 5981 O O     . HOH H 4 .   ? 21.721  -16.955 32.524  1.00 30.19 ? 653 HOH B O     1 
HETATM 5982 O O     . HOH H 4 .   ? 15.050  -39.400 -2.090  1.00 26.65 ? 654 HOH B O     1 
HETATM 5983 O O     . HOH H 4 .   ? 43.597  -46.828 -11.639 1.00 30.17 ? 655 HOH B O     1 
HETATM 5984 O O     . HOH H 4 .   ? 23.432  -18.019 17.515  1.00 24.18 ? 656 HOH B O     1 
HETATM 5985 O O     . HOH H 4 .   ? 21.372  -42.806 11.560  1.00 28.97 ? 657 HOH B O     1 
HETATM 5986 O O     . HOH H 4 .   ? 33.417  -20.334 25.138  1.00 40.66 ? 658 HOH B O     1 
HETATM 5987 O O     . HOH H 4 .   ? 22.123  -38.106 12.984  1.00 33.00 ? 659 HOH B O     1 
HETATM 5988 O O     . HOH H 4 .   ? 29.747  -21.036 1.567   1.00 27.43 ? 660 HOH B O     1 
HETATM 5989 O O     . HOH H 4 .   ? 20.015  -39.112 -5.287  1.00 24.27 ? 661 HOH B O     1 
HETATM 5990 O O     . HOH H 4 .   ? 8.066   -29.171 15.002  1.00 25.50 ? 662 HOH B O     1 
HETATM 5991 O O     . HOH H 4 .   ? 25.924  -42.246 -14.720 1.00 29.58 ? 663 HOH B O     1 
HETATM 5992 O O     . HOH H 4 .   ? 18.448  -31.020 -12.189 1.00 29.87 ? 664 HOH B O     1 
HETATM 5993 O O     . HOH H 4 .   ? 28.276  -31.396 14.346  1.00 22.51 ? 665 HOH B O     1 
HETATM 5994 O O     . HOH H 4 .   ? 32.737  -26.038 -11.188 1.00 35.58 ? 666 HOH B O     1 
HETATM 5995 O O     . HOH H 4 .   ? 17.994  -38.867 -14.016 1.00 42.01 ? 667 HOH B O     1 
HETATM 5996 O O     . HOH H 4 .   ? 26.045  -22.446 -10.978 1.00 30.52 ? 668 HOH B O     1 
HETATM 5997 O O     . HOH H 4 .   ? 20.693  -40.968 -6.998  1.00 33.22 ? 669 HOH B O     1 
HETATM 5998 O O     . HOH H 4 .   ? 20.556  -43.387 -5.293  1.00 32.35 ? 670 HOH B O     1 
HETATM 5999 O O     . HOH H 4 .   ? 35.754  -22.950 30.574  1.00 23.89 ? 671 HOH B O     1 
HETATM 6000 O O     . HOH H 4 .   ? 12.414  -17.904 24.610  1.00 23.45 ? 672 HOH B O     1 
HETATM 6001 O O     . HOH H 4 .   ? 32.717  -23.439 -6.261  1.00 28.03 ? 673 HOH B O     1 
HETATM 6002 O O     . HOH H 4 .   ? 46.213  -45.891 12.483  1.00 31.34 ? 674 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   212 ?   ?   ?   A . n 
A 1 2   HIS 2   213 ?   ?   ?   A . n 
A 1 3   HIS 3   214 ?   ?   ?   A . n 
A 1 4   HIS 4   215 ?   ?   ?   A . n 
A 1 5   HIS 5   216 ?   ?   ?   A . n 
A 1 6   HIS 6   217 ?   ?   ?   A . n 
A 1 7   HIS 7   218 ?   ?   ?   A . n 
A 1 8   SER 8   219 ?   ?   ?   A . n 
A 1 9   SER 9   220 ?   ?   ?   A . n 
A 1 10  GLY 10  221 ?   ?   ?   A . n 
A 1 11  VAL 11  222 ?   ?   ?   A . n 
A 1 12  ASP 12  223 ?   ?   ?   A . n 
A 1 13  LEU 13  224 224 LEU LEU A . n 
A 1 14  GLY 14  225 225 GLY GLY A . n 
A 1 15  THR 15  226 226 THR THR A . n 
A 1 16  GLU 16  227 227 GLU GLU A . n 
A 1 17  ASN 17  228 228 ASN ASN A . n 
A 1 18  LEU 18  229 229 LEU LEU A . n 
A 1 19  TYR 19  230 230 TYR TYR A . n 
A 1 20  PHE 20  231 231 PHE PHE A . n 
A 1 21  GLN 21  232 232 GLN GLN A . n 
A 1 22  SER 22  233 233 SER SER A . n 
A 1 23  MET 23  234 234 MET MET A . n 
A 1 24  ASP 24  235 235 ASP ASP A . n 
A 1 25  LEU 25  236 236 LEU LEU A . n 
A 1 26  ARG 26  237 237 ARG ARG A . n 
A 1 27  VAL 27  238 238 VAL VAL A . n 
A 1 28  GLN 28  239 239 GLN GLN A . n 
A 1 29  GLU 29  240 240 GLU GLU A . n 
A 1 30  LEU 30  241 241 LEU LEU A . n 
A 1 31  ILE 31  242 242 ILE ILE A . n 
A 1 32  LYS 32  243 243 LYS LYS A . n 
A 1 33  LEU 33  244 244 LEU LEU A . n 
A 1 34  ILE 34  245 245 ILE ILE A . n 
A 1 35  CYS 35  246 246 CYS CYS A . n 
A 1 36  ASN 36  247 247 ASN ASN A . n 
A 1 37  VAL 37  248 248 VAL VAL A . n 
A 1 38  GLN 38  249 249 GLN GLN A . n 
A 1 39  ALA 39  250 250 ALA ALA A . n 
A 1 40  MET 40  251 251 MET MET A . n 
A 1 41  GLU 41  252 252 GLU GLU A . n 
A 1 42  GLU 42  253 253 GLU GLU A . n 
A 1 43  MET 43  254 254 MET MET A . n 
A 1 44  MET 44  255 255 MET MET A . n 
A 1 45  MET 45  256 256 MET MET A . n 
A 1 46  GLU 46  257 257 GLU GLU A . n 
A 1 47  MET 47  258 258 MET MET A . n 
A 1 48  LYS 48  259 259 LYS LYS A . n 
A 1 49  TYR 49  260 260 TYR TYR A . n 
A 1 50  ASN 50  261 261 ASN ASN A . n 
A 1 51  THR 51  262 262 THR THR A . n 
A 1 52  LYS 52  263 263 LYS LYS A . n 
A 1 53  LYS 53  264 264 LYS LYS A . n 
A 1 54  ALA 54  265 265 ALA ALA A . n 
A 1 55  PRO 55  266 266 PRO PRO A . n 
A 1 56  LEU 56  267 267 LEU LEU A . n 
A 1 57  GLY 57  268 268 GLY GLY A . n 
A 1 58  LYS 58  269 269 LYS LYS A . n 
A 1 59  LEU 59  270 270 LEU LEU A . n 
A 1 60  THR 60  271 271 THR THR A . n 
A 1 61  VAL 61  272 272 VAL VAL A . n 
A 1 62  ALA 62  273 273 ALA ALA A . n 
A 1 63  GLN 63  274 274 GLN GLN A . n 
A 1 64  ILE 64  275 275 ILE ILE A . n 
A 1 65  LYS 65  276 276 LYS LYS A . n 
A 1 66  ALA 66  277 277 ALA ALA A . n 
A 1 67  GLY 67  278 278 GLY GLY A . n 
A 1 68  TYR 68  279 279 TYR TYR A . n 
A 1 69  GLN 69  280 280 GLN GLN A . n 
A 1 70  SER 70  281 281 SER SER A . n 
A 1 71  LEU 71  282 282 LEU LEU A . n 
A 1 72  LYS 72  283 283 LYS LYS A . n 
A 1 73  LYS 73  284 284 LYS LYS A . n 
A 1 74  ILE 74  285 285 ILE ILE A . n 
A 1 75  GLU 75  286 286 GLU GLU A . n 
A 1 76  ASP 76  287 287 ASP ASP A . n 
A 1 77  CYS 77  288 288 CYS CYS A . n 
A 1 78  ILE 78  289 289 ILE ILE A . n 
A 1 79  ARG 79  290 290 ARG ARG A . n 
A 1 80  ALA 80  291 291 ALA ALA A . n 
A 1 81  GLY 81  292 292 GLY GLY A . n 
A 1 82  GLN 82  293 293 GLN GLN A . n 
A 1 83  HIS 83  294 294 HIS HIS A . n 
A 1 84  GLY 84  295 295 GLY GLY A . n 
A 1 85  ARG 85  296 296 ARG ARG A . n 
A 1 86  ALA 86  297 297 ALA ALA A . n 
A 1 87  LEU 87  298 298 LEU LEU A . n 
A 1 88  MET 88  299 299 MET MET A . n 
A 1 89  GLU 89  300 300 GLU GLU A . n 
A 1 90  ALA 90  301 301 ALA ALA A . n 
A 1 91  CYS 91  302 302 CYS CYS A . n 
A 1 92  ASN 92  303 303 ASN ASN A . n 
A 1 93  GLU 93  304 304 GLU GLU A . n 
A 1 94  PHE 94  305 305 PHE PHE A . n 
A 1 95  TYR 95  306 306 TYR TYR A . n 
A 1 96  THR 96  307 307 THR THR A . n 
A 1 97  ARG 97  308 308 ARG ARG A . n 
A 1 98  ILE 98  309 309 ILE ILE A . n 
A 1 99  PRO 99  310 310 PRO PRO A . n 
A 1 100 HIS 100 311 311 HIS HIS A . n 
A 1 101 ASP 101 312 312 ASP ASP A . n 
A 1 102 PHE 102 313 313 PHE PHE A . n 
A 1 103 GLY 103 314 314 GLY GLY A . n 
A 1 104 LEU 104 315 315 LEU LEU A . n 
A 1 105 ARG 105 316 316 ARG ARG A . n 
A 1 106 THR 106 317 317 THR THR A . n 
A 1 107 PRO 107 318 318 PRO PRO A . n 
A 1 108 PRO 108 319 319 PRO PRO A . n 
A 1 109 LEU 109 320 320 LEU LEU A . n 
A 1 110 ILE 110 321 321 ILE ILE A . n 
A 1 111 ARG 111 322 322 ARG ARG A . n 
A 1 112 THR 112 323 323 THR THR A . n 
A 1 113 GLN 113 324 324 GLN GLN A . n 
A 1 114 LYS 114 325 325 LYS LYS A . n 
A 1 115 GLU 115 326 326 GLU GLU A . n 
A 1 116 LEU 116 327 327 LEU LEU A . n 
A 1 117 SER 117 328 328 SER SER A . n 
A 1 118 GLU 118 329 329 GLU GLU A . n 
A 1 119 LYS 119 330 330 LYS LYS A . n 
A 1 120 ILE 120 331 331 ILE ILE A . n 
A 1 121 GLN 121 332 332 GLN GLN A . n 
A 1 122 LEU 122 333 333 LEU LEU A . n 
A 1 123 LEU 123 334 334 LEU LEU A . n 
A 1 124 GLU 124 335 335 GLU GLU A . n 
A 1 125 ALA 125 336 336 ALA ALA A . n 
A 1 126 LEU 126 337 337 LEU LEU A . n 
A 1 127 GLY 127 338 338 GLY GLY A . n 
A 1 128 ASP 128 339 339 ASP ASP A . n 
A 1 129 ILE 129 340 340 ILE ILE A . n 
A 1 130 GLU 130 341 341 GLU GLU A . n 
A 1 131 ILE 131 342 342 ILE ILE A . n 
A 1 132 ALA 132 343 343 ALA ALA A . n 
A 1 133 ILE 133 344 344 ILE ILE A . n 
A 1 134 LYS 134 345 345 LYS LYS A . n 
A 1 135 LEU 135 346 346 LEU LEU A . n 
A 1 136 VAL 136 347 347 VAL VAL A . n 
A 1 137 LYS 137 348 348 LYS LYS A . n 
A 1 138 THR 138 349 349 THR THR A . n 
A 1 139 GLU 139 350 350 GLU GLU A . n 
A 1 140 LEU 140 351 351 LEU LEU A . n 
A 1 141 GLN 141 352 352 GLN GLN A . n 
A 1 142 SER 142 353 353 SER SER A . n 
A 1 143 PRO 143 354 354 PRO PRO A . n 
A 1 144 GLU 144 355 355 GLU GLU A . n 
A 1 145 HIS 145 356 356 HIS HIS A . n 
A 1 146 PRO 146 357 357 PRO PRO A . n 
A 1 147 LEU 147 358 358 LEU LEU A . n 
A 1 148 ASP 148 359 359 ASP ASP A . n 
A 1 149 GLN 149 360 360 GLN GLN A . n 
A 1 150 HIS 150 361 361 HIS HIS A . n 
A 1 151 TYR 151 362 362 TYR TYR A . n 
A 1 152 ARG 152 363 363 ARG ARG A . n 
A 1 153 ASN 153 364 364 ASN ASN A . n 
A 1 154 LEU 154 365 365 LEU LEU A . n 
A 1 155 HIS 155 366 366 HIS HIS A . n 
A 1 156 CYS 156 367 367 CYS CYS A . n 
A 1 157 ALA 157 368 368 ALA ALA A . n 
A 1 158 LEU 158 369 369 LEU LEU A . n 
A 1 159 ARG 159 370 370 ARG ARG A . n 
A 1 160 PRO 160 371 371 PRO PRO A . n 
A 1 161 LEU 161 372 372 LEU LEU A . n 
A 1 162 ASP 162 373 373 ASP ASP A . n 
A 1 163 HIS 163 374 374 HIS HIS A . n 
A 1 164 GLU 164 375 375 GLU GLU A . n 
A 1 165 SER 165 376 376 SER SER A . n 
A 1 166 TYR 166 377 377 TYR TYR A . n 
A 1 167 GLU 167 378 378 GLU GLU A . n 
A 1 168 PHE 168 379 379 PHE PHE A . n 
A 1 169 LYS 169 380 380 LYS LYS A . n 
A 1 170 VAL 170 381 381 VAL VAL A . n 
A 1 171 ILE 171 382 382 ILE ILE A . n 
A 1 172 SER 172 383 383 SER SER A . n 
A 1 173 GLN 173 384 384 GLN GLN A . n 
A 1 174 TYR 174 385 385 TYR TYR A . n 
A 1 175 LEU 175 386 386 LEU LEU A . n 
A 1 176 GLN 176 387 387 GLN GLN A . n 
A 1 177 SER 177 388 388 SER SER A . n 
A 1 178 THR 178 389 389 THR THR A . n 
A 1 179 HIS 179 390 390 HIS HIS A . n 
A 1 180 ALA 180 391 391 ALA ALA A . n 
A 1 181 PRO 181 392 392 PRO PRO A . n 
A 1 182 THR 182 393 393 THR THR A . n 
A 1 183 HIS 183 394 394 HIS HIS A . n 
A 1 184 SER 184 395 395 SER SER A . n 
A 1 185 ASP 185 396 396 ASP ASP A . n 
A 1 186 TYR 186 397 397 TYR TYR A . n 
A 1 187 THR 187 398 398 THR THR A . n 
A 1 188 MET 188 399 399 MET MET A . n 
A 1 189 THR 189 400 400 THR THR A . n 
A 1 190 LEU 190 401 401 LEU LEU A . n 
A 1 191 LEU 191 402 402 LEU LEU A . n 
A 1 192 ASP 192 403 403 ASP ASP A . n 
A 1 193 LEU 193 404 404 LEU LEU A . n 
A 1 194 PHE 194 405 405 PHE PHE A . n 
A 1 195 GLU 195 406 406 GLU GLU A . n 
A 1 196 VAL 196 407 407 VAL VAL A . n 
A 1 197 GLU 197 408 408 GLU GLU A . n 
A 1 198 LYS 198 409 409 LYS LYS A . n 
A 1 199 ASP 199 410 410 ASP ASP A . n 
A 1 200 GLY 200 411 411 GLY GLY A . n 
A 1 201 GLU 201 412 412 GLU GLU A . n 
A 1 202 LYS 202 413 413 LYS LYS A . n 
A 1 203 GLU 203 414 414 GLU GLU A . n 
A 1 204 ALA 204 415 415 ALA ALA A . n 
A 1 205 PHE 205 416 416 PHE PHE A . n 
A 1 206 ARG 206 417 417 ARG ARG A . n 
A 1 207 GLU 207 418 418 GLU GLU A . n 
A 1 208 ASP 208 419 419 ASP ASP A . n 
A 1 209 LEU 209 420 420 LEU LEU A . n 
A 1 210 HIS 210 421 421 HIS HIS A . n 
A 1 211 ASN 211 422 422 ASN ASN A . n 
A 1 212 ARG 212 423 423 ARG ARG A . n 
A 1 213 MET 213 424 424 MET MET A . n 
A 1 214 LEU 214 425 425 LEU LEU A . n 
A 1 215 LEU 215 426 426 LEU LEU A . n 
A 1 216 TRP 216 427 427 TRP TRP A . n 
A 1 217 HIS 217 428 428 HIS HIS A . n 
A 1 218 GLY 218 429 429 GLY GLY A . n 
A 1 219 SER 219 430 430 SER SER A . n 
A 1 220 ARG 220 431 431 ARG ARG A . n 
A 1 221 MET 221 432 432 MET MET A . n 
A 1 222 SER 222 433 433 SER SER A . n 
A 1 223 ASN 223 434 434 ASN ASN A . n 
A 1 224 TRP 224 435 435 TRP TRP A . n 
A 1 225 VAL 225 436 436 VAL VAL A . n 
A 1 226 GLY 226 437 437 GLY GLY A . n 
A 1 227 ILE 227 438 438 ILE ILE A . n 
A 1 228 LEU 228 439 439 LEU LEU A . n 
A 1 229 SER 229 440 440 SER SER A . n 
A 1 230 HIS 230 441 441 HIS HIS A . n 
A 1 231 GLY 231 442 442 GLY GLY A . n 
A 1 232 LEU 232 443 443 LEU LEU A . n 
A 1 233 ARG 233 444 444 ARG ARG A . n 
A 1 234 ILE 234 445 445 ILE ILE A . n 
A 1 235 ALA 235 446 446 ALA ALA A . n 
A 1 236 HIS 236 447 447 HIS HIS A . n 
A 1 237 PRO 237 448 448 PRO PRO A . n 
A 1 238 GLU 238 449 449 GLU GLU A . n 
A 1 239 ALA 239 450 450 ALA ALA A . n 
A 1 240 PRO 240 451 451 PRO PRO A . n 
A 1 241 ILE 241 452 452 ILE ILE A . n 
A 1 242 THR 242 453 453 THR THR A . n 
A 1 243 GLY 243 454 454 GLY GLY A . n 
A 1 244 TYR 244 455 455 TYR TYR A . n 
A 1 245 MET 245 456 456 MET MET A . n 
A 1 246 PHE 246 457 457 PHE PHE A . n 
A 1 247 GLY 247 458 458 GLY GLY A . n 
A 1 248 LYS 248 459 459 LYS LYS A . n 
A 1 249 GLY 249 460 460 GLY GLY A . n 
A 1 250 ILE 250 461 461 ILE ILE A . n 
A 1 251 TYR 251 462 462 TYR TYR A . n 
A 1 252 PHE 252 463 463 PHE PHE A . n 
A 1 253 ALA 253 464 464 ALA ALA A . n 
A 1 254 ASP 254 465 465 ASP ASP A . n 
A 1 255 MET 255 466 466 MET MET A . n 
A 1 256 SER 256 467 467 SER SER A . n 
A 1 257 SER 257 468 468 SER SER A . n 
A 1 258 LYS 258 469 469 LYS LYS A . n 
A 1 259 SER 259 470 470 SER SER A . n 
A 1 260 ALA 260 471 471 ALA ALA A . n 
A 1 261 ASN 261 472 472 ASN ASN A . n 
A 1 262 TYR 262 473 473 TYR TYR A . n 
A 1 263 CYS 263 474 474 CYS CYS A . n 
A 1 264 PHE 264 475 475 PHE PHE A . n 
A 1 265 ALA 265 476 476 ALA ALA A . n 
A 1 266 SER 266 477 477 SER SER A . n 
A 1 267 ARG 267 478 478 ARG ARG A . n 
A 1 268 LEU 268 479 479 LEU LEU A . n 
A 1 269 LYS 269 480 480 LYS LYS A . n 
A 1 270 ASN 270 481 481 ASN ASN A . n 
A 1 271 THR 271 482 482 THR THR A . n 
A 1 272 GLY 272 483 483 GLY GLY A . n 
A 1 273 LEU 273 484 484 LEU LEU A . n 
A 1 274 LEU 274 485 485 LEU LEU A . n 
A 1 275 LEU 275 486 486 LEU LEU A . n 
A 1 276 LEU 276 487 487 LEU LEU A . n 
A 1 277 SER 277 488 488 SER SER A . n 
A 1 278 GLU 278 489 489 GLU GLU A . n 
A 1 279 VAL 279 490 490 VAL VAL A . n 
A 1 280 ALA 280 491 491 ALA ALA A . n 
A 1 281 LEU 281 492 492 LEU LEU A . n 
A 1 282 GLY 282 493 493 GLY GLY A . n 
A 1 283 GLN 283 494 494 GLN GLN A . n 
A 1 284 CYS 284 495 495 CYS CYS A . n 
A 1 285 ASN 285 496 496 ASN ASN A . n 
A 1 286 GLU 286 497 497 GLU GLU A . n 
A 1 287 LEU 287 498 498 LEU LEU A . n 
A 1 288 LEU 288 499 499 LEU LEU A . n 
A 1 289 GLU 289 500 500 GLU GLU A . n 
A 1 290 ALA 290 501 501 ALA ALA A . n 
A 1 291 ASN 291 502 502 ASN ASN A . n 
A 1 292 PRO 292 503 503 PRO PRO A . n 
A 1 293 LYS 293 504 504 LYS LYS A . n 
A 1 294 ALA 294 505 505 ALA ALA A . n 
A 1 295 GLU 295 506 506 GLU GLU A . n 
A 1 296 GLY 296 507 507 GLY GLY A . n 
A 1 297 LEU 297 508 508 LEU LEU A . n 
A 1 298 LEU 298 509 509 LEU LEU A . n 
A 1 299 GLN 299 510 510 GLN GLN A . n 
A 1 300 GLY 300 511 511 GLY GLY A . n 
A 1 301 LYS 301 512 512 LYS LYS A . n 
A 1 302 HIS 302 513 513 HIS HIS A . n 
A 1 303 SER 303 514 514 SER SER A . n 
A 1 304 THR 304 515 515 THR THR A . n 
A 1 305 LYS 305 516 516 LYS LYS A . n 
A 1 306 GLY 306 517 517 GLY GLY A . n 
A 1 307 LEU 307 518 518 LEU LEU A . n 
A 1 308 GLY 308 519 519 GLY GLY A . n 
A 1 309 LYS 309 520 520 LYS LYS A . n 
A 1 310 MET 310 521 521 MET MET A . n 
A 1 311 ALA 311 522 522 ALA ALA A . n 
A 1 312 PRO 312 523 523 PRO PRO A . n 
A 1 313 SER 313 524 524 SER SER A . n 
A 1 314 SER 314 525 525 SER SER A . n 
A 1 315 ALA 315 526 526 ALA ALA A . n 
A 1 316 HIS 316 527 527 HIS HIS A . n 
A 1 317 PHE 317 528 528 PHE PHE A . n 
A 1 318 VAL 318 529 529 VAL VAL A . n 
A 1 319 THR 319 530 530 THR THR A . n 
A 1 320 LEU 320 531 531 LEU LEU A . n 
A 1 321 ASN 321 532 532 ASN ASN A . n 
A 1 322 GLY 322 533 533 GLY GLY A . n 
A 1 323 SER 323 534 534 SER SER A . n 
A 1 324 THR 324 535 535 THR THR A . n 
A 1 325 VAL 325 536 536 VAL VAL A . n 
A 1 326 PRO 326 537 537 PRO PRO A . n 
A 1 327 LEU 327 538 538 LEU LEU A . n 
A 1 328 GLY 328 539 539 GLY GLY A . n 
A 1 329 PRO 329 540 540 PRO PRO A . n 
A 1 330 ALA 330 541 541 ALA ALA A . n 
A 1 331 SER 331 542 542 SER SER A . n 
A 1 332 ASP 332 543 543 ASP ASP A . n 
A 1 333 THR 333 544 544 THR THR A . n 
A 1 334 GLY 334 545 545 GLY GLY A . n 
A 1 335 ILE 335 546 546 ILE ILE A . n 
A 1 336 LEU 336 547 547 LEU LEU A . n 
A 1 337 ASN 337 548 ?   ?   ?   A . n 
A 1 338 PRO 338 549 ?   ?   ?   A . n 
A 1 339 ASP 339 550 ?   ?   ?   A . n 
A 1 340 GLY 340 551 551 GLY GLY A . n 
A 1 341 TYR 341 552 552 TYR TYR A . n 
A 1 342 THR 342 553 553 THR THR A . n 
A 1 343 LEU 343 554 554 LEU LEU A . n 
A 1 344 ASN 344 555 555 ASN ASN A . n 
A 1 345 TYR 345 556 556 TYR TYR A . n 
A 1 346 ASN 346 557 557 ASN ASN A . n 
A 1 347 GLU 347 558 558 GLU GLU A . n 
A 1 348 TYR 348 559 559 TYR TYR A . n 
A 1 349 ILE 349 560 560 ILE ILE A . n 
A 1 350 VAL 350 561 561 VAL VAL A . n 
A 1 351 TYR 351 562 562 TYR TYR A . n 
A 1 352 ASN 352 563 563 ASN ASN A . n 
A 1 353 PRO 353 564 564 PRO PRO A . n 
A 1 354 ASN 354 565 565 ASN ASN A . n 
A 1 355 GLN 355 566 566 GLN GLN A . n 
A 1 356 VAL 356 567 567 VAL VAL A . n 
A 1 357 ARG 357 568 568 ARG ARG A . n 
A 1 358 MET 358 569 569 MET MET A . n 
A 1 359 ARG 359 570 570 ARG ARG A . n 
A 1 360 TYR 360 571 571 TYR TYR A . n 
A 1 361 LEU 361 572 572 LEU LEU A . n 
A 1 362 LEU 362 573 573 LEU LEU A . n 
A 1 363 LYS 363 574 574 LYS LYS A . n 
A 1 364 VAL 364 575 575 VAL VAL A . n 
A 1 365 GLN 365 576 576 GLN GLN A . n 
A 1 366 PHE 366 577 577 PHE PHE A . n 
A 1 367 ASN 367 578 578 ASN ASN A . n 
A 1 368 PHE 368 579 579 PHE PHE A . n 
B 1 1   MET 1   212 ?   ?   ?   B . n 
B 1 2   HIS 2   213 ?   ?   ?   B . n 
B 1 3   HIS 3   214 ?   ?   ?   B . n 
B 1 4   HIS 4   215 ?   ?   ?   B . n 
B 1 5   HIS 5   216 ?   ?   ?   B . n 
B 1 6   HIS 6   217 ?   ?   ?   B . n 
B 1 7   HIS 7   218 ?   ?   ?   B . n 
B 1 8   SER 8   219 ?   ?   ?   B . n 
B 1 9   SER 9   220 ?   ?   ?   B . n 
B 1 10  GLY 10  221 ?   ?   ?   B . n 
B 1 11  VAL 11  222 ?   ?   ?   B . n 
B 1 12  ASP 12  223 ?   ?   ?   B . n 
B 1 13  LEU 13  224 ?   ?   ?   B . n 
B 1 14  GLY 14  225 ?   ?   ?   B . n 
B 1 15  THR 15  226 226 THR THR B . n 
B 1 16  GLU 16  227 227 GLU GLU B . n 
B 1 17  ASN 17  228 228 ASN ASN B . n 
B 1 18  LEU 18  229 229 LEU LEU B . n 
B 1 19  TYR 19  230 230 TYR TYR B . n 
B 1 20  PHE 20  231 231 PHE PHE B . n 
B 1 21  GLN 21  232 232 GLN GLN B . n 
B 1 22  SER 22  233 233 SER SER B . n 
B 1 23  MET 23  234 234 MET MET B . n 
B 1 24  ASP 24  235 235 ASP ASP B . n 
B 1 25  LEU 25  236 236 LEU LEU B . n 
B 1 26  ARG 26  237 237 ARG ARG B . n 
B 1 27  VAL 27  238 238 VAL VAL B . n 
B 1 28  GLN 28  239 239 GLN GLN B . n 
B 1 29  GLU 29  240 240 GLU GLU B . n 
B 1 30  LEU 30  241 241 LEU LEU B . n 
B 1 31  ILE 31  242 242 ILE ILE B . n 
B 1 32  LYS 32  243 243 LYS LYS B . n 
B 1 33  LEU 33  244 244 LEU LEU B . n 
B 1 34  ILE 34  245 245 ILE ILE B . n 
B 1 35  CYS 35  246 246 CYS CYS B . n 
B 1 36  ASN 36  247 247 ASN ASN B . n 
B 1 37  VAL 37  248 248 VAL VAL B . n 
B 1 38  GLN 38  249 249 GLN GLN B . n 
B 1 39  ALA 39  250 250 ALA ALA B . n 
B 1 40  MET 40  251 251 MET MET B . n 
B 1 41  GLU 41  252 252 GLU GLU B . n 
B 1 42  GLU 42  253 253 GLU GLU B . n 
B 1 43  MET 43  254 254 MET MET B . n 
B 1 44  MET 44  255 255 MET MET B . n 
B 1 45  MET 45  256 256 MET MET B . n 
B 1 46  GLU 46  257 257 GLU GLU B . n 
B 1 47  MET 47  258 258 MET MET B . n 
B 1 48  LYS 48  259 259 LYS LYS B . n 
B 1 49  TYR 49  260 260 TYR TYR B . n 
B 1 50  ASN 50  261 261 ASN ASN B . n 
B 1 51  THR 51  262 262 THR THR B . n 
B 1 52  LYS 52  263 263 LYS LYS B . n 
B 1 53  LYS 53  264 264 LYS LYS B . n 
B 1 54  ALA 54  265 265 ALA ALA B . n 
B 1 55  PRO 55  266 266 PRO PRO B . n 
B 1 56  LEU 56  267 267 LEU LEU B . n 
B 1 57  GLY 57  268 268 GLY GLY B . n 
B 1 58  LYS 58  269 269 LYS LYS B . n 
B 1 59  LEU 59  270 270 LEU LEU B . n 
B 1 60  THR 60  271 271 THR THR B . n 
B 1 61  VAL 61  272 272 VAL VAL B . n 
B 1 62  ALA 62  273 273 ALA ALA B . n 
B 1 63  GLN 63  274 274 GLN GLN B . n 
B 1 64  ILE 64  275 275 ILE ILE B . n 
B 1 65  LYS 65  276 276 LYS LYS B . n 
B 1 66  ALA 66  277 277 ALA ALA B . n 
B 1 67  GLY 67  278 278 GLY GLY B . n 
B 1 68  TYR 68  279 279 TYR TYR B . n 
B 1 69  GLN 69  280 280 GLN GLN B . n 
B 1 70  SER 70  281 281 SER SER B . n 
B 1 71  LEU 71  282 282 LEU LEU B . n 
B 1 72  LYS 72  283 283 LYS LYS B . n 
B 1 73  LYS 73  284 284 LYS LYS B . n 
B 1 74  ILE 74  285 285 ILE ILE B . n 
B 1 75  GLU 75  286 286 GLU GLU B . n 
B 1 76  ASP 76  287 287 ASP ASP B . n 
B 1 77  CYS 77  288 288 CYS CYS B . n 
B 1 78  ILE 78  289 289 ILE ILE B . n 
B 1 79  ARG 79  290 290 ARG ARG B . n 
B 1 80  ALA 80  291 291 ALA ALA B . n 
B 1 81  GLY 81  292 292 GLY GLY B . n 
B 1 82  GLN 82  293 293 GLN GLN B . n 
B 1 83  HIS 83  294 294 HIS HIS B . n 
B 1 84  GLY 84  295 295 GLY GLY B . n 
B 1 85  ARG 85  296 296 ARG ARG B . n 
B 1 86  ALA 86  297 297 ALA ALA B . n 
B 1 87  LEU 87  298 298 LEU LEU B . n 
B 1 88  MET 88  299 299 MET MET B . n 
B 1 89  GLU 89  300 300 GLU GLU B . n 
B 1 90  ALA 90  301 301 ALA ALA B . n 
B 1 91  CYS 91  302 302 CYS CYS B . n 
B 1 92  ASN 92  303 303 ASN ASN B . n 
B 1 93  GLU 93  304 304 GLU GLU B . n 
B 1 94  PHE 94  305 305 PHE PHE B . n 
B 1 95  TYR 95  306 306 TYR TYR B . n 
B 1 96  THR 96  307 307 THR THR B . n 
B 1 97  ARG 97  308 308 ARG ARG B . n 
B 1 98  ILE 98  309 309 ILE ILE B . n 
B 1 99  PRO 99  310 310 PRO PRO B . n 
B 1 100 HIS 100 311 311 HIS HIS B . n 
B 1 101 ASP 101 312 312 ASP ASP B . n 
B 1 102 PHE 102 313 313 PHE PHE B . n 
B 1 103 GLY 103 314 314 GLY GLY B . n 
B 1 104 LEU 104 315 315 LEU LEU B . n 
B 1 105 ARG 105 316 316 ARG ARG B . n 
B 1 106 THR 106 317 317 THR THR B . n 
B 1 107 PRO 107 318 318 PRO PRO B . n 
B 1 108 PRO 108 319 319 PRO PRO B . n 
B 1 109 LEU 109 320 320 LEU LEU B . n 
B 1 110 ILE 110 321 321 ILE ILE B . n 
B 1 111 ARG 111 322 322 ARG ARG B . n 
B 1 112 THR 112 323 323 THR THR B . n 
B 1 113 GLN 113 324 324 GLN GLN B . n 
B 1 114 LYS 114 325 325 LYS LYS B . n 
B 1 115 GLU 115 326 326 GLU GLU B . n 
B 1 116 LEU 116 327 327 LEU LEU B . n 
B 1 117 SER 117 328 328 SER SER B . n 
B 1 118 GLU 118 329 329 GLU GLU B . n 
B 1 119 LYS 119 330 330 LYS LYS B . n 
B 1 120 ILE 120 331 331 ILE ILE B . n 
B 1 121 GLN 121 332 332 GLN GLN B . n 
B 1 122 LEU 122 333 333 LEU LEU B . n 
B 1 123 LEU 123 334 334 LEU LEU B . n 
B 1 124 GLU 124 335 335 GLU GLU B . n 
B 1 125 ALA 125 336 336 ALA ALA B . n 
B 1 126 LEU 126 337 337 LEU LEU B . n 
B 1 127 GLY 127 338 338 GLY GLY B . n 
B 1 128 ASP 128 339 339 ASP ASP B . n 
B 1 129 ILE 129 340 340 ILE ILE B . n 
B 1 130 GLU 130 341 341 GLU GLU B . n 
B 1 131 ILE 131 342 342 ILE ILE B . n 
B 1 132 ALA 132 343 343 ALA ALA B . n 
B 1 133 ILE 133 344 344 ILE ILE B . n 
B 1 134 LYS 134 345 345 LYS LYS B . n 
B 1 135 LEU 135 346 346 LEU LEU B . n 
B 1 136 VAL 136 347 347 VAL VAL B . n 
B 1 137 LYS 137 348 348 LYS LYS B . n 
B 1 138 THR 138 349 349 THR THR B . n 
B 1 139 GLU 139 350 350 GLU GLU B . n 
B 1 140 LEU 140 351 351 LEU LEU B . n 
B 1 141 GLN 141 352 352 GLN GLN B . n 
B 1 142 SER 142 353 353 SER SER B . n 
B 1 143 PRO 143 354 354 PRO PRO B . n 
B 1 144 GLU 144 355 355 GLU GLU B . n 
B 1 145 HIS 145 356 356 HIS HIS B . n 
B 1 146 PRO 146 357 357 PRO PRO B . n 
B 1 147 LEU 147 358 358 LEU LEU B . n 
B 1 148 ASP 148 359 359 ASP ASP B . n 
B 1 149 GLN 149 360 360 GLN GLN B . n 
B 1 150 HIS 150 361 361 HIS HIS B . n 
B 1 151 TYR 151 362 362 TYR TYR B . n 
B 1 152 ARG 152 363 363 ARG ARG B . n 
B 1 153 ASN 153 364 364 ASN ASN B . n 
B 1 154 LEU 154 365 365 LEU LEU B . n 
B 1 155 HIS 155 366 366 HIS HIS B . n 
B 1 156 CYS 156 367 367 CYS CYS B . n 
B 1 157 ALA 157 368 368 ALA ALA B . n 
B 1 158 LEU 158 369 369 LEU LEU B . n 
B 1 159 ARG 159 370 370 ARG ARG B . n 
B 1 160 PRO 160 371 371 PRO PRO B . n 
B 1 161 LEU 161 372 372 LEU LEU B . n 
B 1 162 ASP 162 373 373 ASP ASP B . n 
B 1 163 HIS 163 374 374 HIS HIS B . n 
B 1 164 GLU 164 375 375 GLU GLU B . n 
B 1 165 SER 165 376 376 SER SER B . n 
B 1 166 TYR 166 377 377 TYR TYR B . n 
B 1 167 GLU 167 378 378 GLU GLU B . n 
B 1 168 PHE 168 379 379 PHE PHE B . n 
B 1 169 LYS 169 380 380 LYS LYS B . n 
B 1 170 VAL 170 381 381 VAL VAL B . n 
B 1 171 ILE 171 382 382 ILE ILE B . n 
B 1 172 SER 172 383 383 SER SER B . n 
B 1 173 GLN 173 384 384 GLN GLN B . n 
B 1 174 TYR 174 385 385 TYR TYR B . n 
B 1 175 LEU 175 386 386 LEU LEU B . n 
B 1 176 GLN 176 387 387 GLN GLN B . n 
B 1 177 SER 177 388 388 SER SER B . n 
B 1 178 THR 178 389 389 THR THR B . n 
B 1 179 HIS 179 390 390 HIS HIS B . n 
B 1 180 ALA 180 391 391 ALA ALA B . n 
B 1 181 PRO 181 392 392 PRO PRO B . n 
B 1 182 THR 182 393 393 THR THR B . n 
B 1 183 HIS 183 394 394 HIS HIS B . n 
B 1 184 SER 184 395 395 SER SER B . n 
B 1 185 ASP 185 396 396 ASP ASP B . n 
B 1 186 TYR 186 397 397 TYR TYR B . n 
B 1 187 THR 187 398 398 THR THR B . n 
B 1 188 MET 188 399 399 MET MET B . n 
B 1 189 THR 189 400 400 THR THR B . n 
B 1 190 LEU 190 401 401 LEU LEU B . n 
B 1 191 LEU 191 402 402 LEU LEU B . n 
B 1 192 ASP 192 403 403 ASP ASP B . n 
B 1 193 LEU 193 404 404 LEU LEU B . n 
B 1 194 PHE 194 405 405 PHE PHE B . n 
B 1 195 GLU 195 406 406 GLU GLU B . n 
B 1 196 VAL 196 407 407 VAL VAL B . n 
B 1 197 GLU 197 408 408 GLU GLU B . n 
B 1 198 LYS 198 409 409 LYS LYS B . n 
B 1 199 ASP 199 410 410 ASP ASP B . n 
B 1 200 GLY 200 411 411 GLY GLY B . n 
B 1 201 GLU 201 412 412 GLU GLU B . n 
B 1 202 LYS 202 413 413 LYS LYS B . n 
B 1 203 GLU 203 414 414 GLU GLU B . n 
B 1 204 ALA 204 415 415 ALA ALA B . n 
B 1 205 PHE 205 416 416 PHE PHE B . n 
B 1 206 ARG 206 417 417 ARG ARG B . n 
B 1 207 GLU 207 418 418 GLU GLU B . n 
B 1 208 ASP 208 419 419 ASP ASP B . n 
B 1 209 LEU 209 420 420 LEU LEU B . n 
B 1 210 HIS 210 421 421 HIS HIS B . n 
B 1 211 ASN 211 422 422 ASN ASN B . n 
B 1 212 ARG 212 423 423 ARG ARG B . n 
B 1 213 MET 213 424 424 MET MET B . n 
B 1 214 LEU 214 425 425 LEU LEU B . n 
B 1 215 LEU 215 426 426 LEU LEU B . n 
B 1 216 TRP 216 427 427 TRP TRP B . n 
B 1 217 HIS 217 428 428 HIS HIS B . n 
B 1 218 GLY 218 429 429 GLY GLY B . n 
B 1 219 SER 219 430 430 SER SER B . n 
B 1 220 ARG 220 431 431 ARG ARG B . n 
B 1 221 MET 221 432 432 MET MET B . n 
B 1 222 SER 222 433 433 SER SER B . n 
B 1 223 ASN 223 434 434 ASN ASN B . n 
B 1 224 TRP 224 435 435 TRP TRP B . n 
B 1 225 VAL 225 436 436 VAL VAL B . n 
B 1 226 GLY 226 437 437 GLY GLY B . n 
B 1 227 ILE 227 438 438 ILE ILE B . n 
B 1 228 LEU 228 439 439 LEU LEU B . n 
B 1 229 SER 229 440 440 SER SER B . n 
B 1 230 HIS 230 441 441 HIS HIS B . n 
B 1 231 GLY 231 442 442 GLY GLY B . n 
B 1 232 LEU 232 443 443 LEU LEU B . n 
B 1 233 ARG 233 444 444 ARG ARG B . n 
B 1 234 ILE 234 445 445 ILE ILE B . n 
B 1 235 ALA 235 446 446 ALA ALA B . n 
B 1 236 HIS 236 447 447 HIS HIS B . n 
B 1 237 PRO 237 448 448 PRO PRO B . n 
B 1 238 GLU 238 449 449 GLU GLU B . n 
B 1 239 ALA 239 450 450 ALA ALA B . n 
B 1 240 PRO 240 451 451 PRO PRO B . n 
B 1 241 ILE 241 452 452 ILE ILE B . n 
B 1 242 THR 242 453 453 THR THR B . n 
B 1 243 GLY 243 454 454 GLY GLY B . n 
B 1 244 TYR 244 455 455 TYR TYR B . n 
B 1 245 MET 245 456 456 MET MET B . n 
B 1 246 PHE 246 457 457 PHE PHE B . n 
B 1 247 GLY 247 458 458 GLY GLY B . n 
B 1 248 LYS 248 459 459 LYS LYS B . n 
B 1 249 GLY 249 460 460 GLY GLY B . n 
B 1 250 ILE 250 461 461 ILE ILE B . n 
B 1 251 TYR 251 462 462 TYR TYR B . n 
B 1 252 PHE 252 463 463 PHE PHE B . n 
B 1 253 ALA 253 464 464 ALA ALA B . n 
B 1 254 ASP 254 465 465 ASP ASP B . n 
B 1 255 MET 255 466 466 MET MET B . n 
B 1 256 SER 256 467 467 SER SER B . n 
B 1 257 SER 257 468 468 SER SER B . n 
B 1 258 LYS 258 469 469 LYS LYS B . n 
B 1 259 SER 259 470 470 SER SER B . n 
B 1 260 ALA 260 471 471 ALA ALA B . n 
B 1 261 ASN 261 472 472 ASN ASN B . n 
B 1 262 TYR 262 473 473 TYR TYR B . n 
B 1 263 CYS 263 474 474 CYS CYS B . n 
B 1 264 PHE 264 475 475 PHE PHE B . n 
B 1 265 ALA 265 476 476 ALA ALA B . n 
B 1 266 SER 266 477 477 SER SER B . n 
B 1 267 ARG 267 478 478 ARG ARG B . n 
B 1 268 LEU 268 479 479 LEU LEU B . n 
B 1 269 LYS 269 480 480 LYS LYS B . n 
B 1 270 ASN 270 481 481 ASN ASN B . n 
B 1 271 THR 271 482 482 THR THR B . n 
B 1 272 GLY 272 483 483 GLY GLY B . n 
B 1 273 LEU 273 484 484 LEU LEU B . n 
B 1 274 LEU 274 485 485 LEU LEU B . n 
B 1 275 LEU 275 486 486 LEU LEU B . n 
B 1 276 LEU 276 487 487 LEU LEU B . n 
B 1 277 SER 277 488 488 SER SER B . n 
B 1 278 GLU 278 489 489 GLU GLU B . n 
B 1 279 VAL 279 490 490 VAL VAL B . n 
B 1 280 ALA 280 491 491 ALA ALA B . n 
B 1 281 LEU 281 492 492 LEU LEU B . n 
B 1 282 GLY 282 493 493 GLY GLY B . n 
B 1 283 GLN 283 494 494 GLN GLN B . n 
B 1 284 CYS 284 495 495 CYS CYS B . n 
B 1 285 ASN 285 496 496 ASN ASN B . n 
B 1 286 GLU 286 497 497 GLU GLU B . n 
B 1 287 LEU 287 498 498 LEU LEU B . n 
B 1 288 LEU 288 499 499 LEU LEU B . n 
B 1 289 GLU 289 500 500 GLU GLU B . n 
B 1 290 ALA 290 501 501 ALA ALA B . n 
B 1 291 ASN 291 502 502 ASN ASN B . n 
B 1 292 PRO 292 503 503 PRO PRO B . n 
B 1 293 LYS 293 504 504 LYS LYS B . n 
B 1 294 ALA 294 505 505 ALA ALA B . n 
B 1 295 GLU 295 506 506 GLU GLU B . n 
B 1 296 GLY 296 507 507 GLY GLY B . n 
B 1 297 LEU 297 508 508 LEU LEU B . n 
B 1 298 LEU 298 509 509 LEU LEU B . n 
B 1 299 GLN 299 510 510 GLN GLN B . n 
B 1 300 GLY 300 511 511 GLY GLY B . n 
B 1 301 LYS 301 512 512 LYS LYS B . n 
B 1 302 HIS 302 513 513 HIS HIS B . n 
B 1 303 SER 303 514 514 SER SER B . n 
B 1 304 THR 304 515 515 THR THR B . n 
B 1 305 LYS 305 516 516 LYS LYS B . n 
B 1 306 GLY 306 517 517 GLY GLY B . n 
B 1 307 LEU 307 518 518 LEU LEU B . n 
B 1 308 GLY 308 519 519 GLY GLY B . n 
B 1 309 LYS 309 520 520 LYS LYS B . n 
B 1 310 MET 310 521 521 MET MET B . n 
B 1 311 ALA 311 522 522 ALA ALA B . n 
B 1 312 PRO 312 523 523 PRO PRO B . n 
B 1 313 SER 313 524 524 SER SER B . n 
B 1 314 SER 314 525 525 SER SER B . n 
B 1 315 ALA 315 526 526 ALA ALA B . n 
B 1 316 HIS 316 527 527 HIS HIS B . n 
B 1 317 PHE 317 528 528 PHE PHE B . n 
B 1 318 VAL 318 529 529 VAL VAL B . n 
B 1 319 THR 319 530 530 THR THR B . n 
B 1 320 LEU 320 531 531 LEU LEU B . n 
B 1 321 ASN 321 532 532 ASN ASN B . n 
B 1 322 GLY 322 533 533 GLY GLY B . n 
B 1 323 SER 323 534 534 SER SER B . n 
B 1 324 THR 324 535 535 THR THR B . n 
B 1 325 VAL 325 536 536 VAL VAL B . n 
B 1 326 PRO 326 537 537 PRO PRO B . n 
B 1 327 LEU 327 538 538 LEU LEU B . n 
B 1 328 GLY 328 539 539 GLY GLY B . n 
B 1 329 PRO 329 540 540 PRO PRO B . n 
B 1 330 ALA 330 541 541 ALA ALA B . n 
B 1 331 SER 331 542 542 SER SER B . n 
B 1 332 ASP 332 543 543 ASP ASP B . n 
B 1 333 THR 333 544 544 THR THR B . n 
B 1 334 GLY 334 545 545 GLY GLY B . n 
B 1 335 ILE 335 546 ?   ?   ?   B . n 
B 1 336 LEU 336 547 ?   ?   ?   B . n 
B 1 337 ASN 337 548 ?   ?   ?   B . n 
B 1 338 PRO 338 549 ?   ?   ?   B . n 
B 1 339 ASP 339 550 ?   ?   ?   B . n 
B 1 340 GLY 340 551 ?   ?   ?   B . n 
B 1 341 TYR 341 552 552 TYR TYR B . n 
B 1 342 THR 342 553 553 THR THR B . n 
B 1 343 LEU 343 554 554 LEU LEU B . n 
B 1 344 ASN 344 555 555 ASN ASN B . n 
B 1 345 TYR 345 556 556 TYR TYR B . n 
B 1 346 ASN 346 557 557 ASN ASN B . n 
B 1 347 GLU 347 558 558 GLU GLU B . n 
B 1 348 TYR 348 559 559 TYR TYR B . n 
B 1 349 ILE 349 560 560 ILE ILE B . n 
B 1 350 VAL 350 561 561 VAL VAL B . n 
B 1 351 TYR 351 562 562 TYR TYR B . n 
B 1 352 ASN 352 563 563 ASN ASN B . n 
B 1 353 PRO 353 564 564 PRO PRO B . n 
B 1 354 ASN 354 565 565 ASN ASN B . n 
B 1 355 GLN 355 566 566 GLN GLN B . n 
B 1 356 VAL 356 567 567 VAL VAL B . n 
B 1 357 ARG 357 568 568 ARG ARG B . n 
B 1 358 MET 358 569 569 MET MET B . n 
B 1 359 ARG 359 570 570 ARG ARG B . n 
B 1 360 TYR 360 571 571 TYR TYR B . n 
B 1 361 LEU 361 572 572 LEU LEU B . n 
B 1 362 LEU 362 573 573 LEU LEU B . n 
B 1 363 LYS 363 574 574 LYS LYS B . n 
B 1 364 VAL 364 575 575 VAL VAL B . n 
B 1 365 GLN 365 576 576 GLN GLN B . n 
B 1 366 PHE 366 577 577 PHE PHE B . n 
B 1 367 ASN 367 578 578 ASN ASN B . n 
B 1 368 PHE 368 579 579 PHE PHE B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-10 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum  ? 1 
MOLREP phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
XDS    'data reduction'  .        ? 4 
XSCALE 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.sequence_details     
'THE EXPERIMENTAL INFO OF UNIPROT (Q9UGN5, PARP2_HUMAN) SHOWS CONFLICT P -> H (IN REF. 2; AAD29857) AT THIS POSITION' 
_pdbx_entry_details.entry_id             3KCZ 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 259 ? ? 81.98   10.84  
2 1 HIS A 394 ? ? -101.94 55.32  
3 1 ARG A 570 ? ? -133.98 -40.74 
4 1 HIS B 294 ? ? -143.20 26.37  
5 1 HIS B 394 ? ? -113.04 50.12  
6 1 ARG B 570 ? ? -130.97 -38.08 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 552 ? CD1 ? A TYR 341 CD1 
2  1 Y 1 A TYR 552 ? CD2 ? A TYR 341 CD2 
3  1 Y 1 A TYR 552 ? CE1 ? A TYR 341 CE1 
4  1 Y 1 A TYR 552 ? CE2 ? A TYR 341 CE2 
5  1 Y 1 A TYR 552 ? CZ  ? A TYR 341 CZ  
6  1 Y 1 A TYR 552 ? OH  ? A TYR 341 OH  
7  1 Y 1 B GLU 257 ? CG  ? B GLU 46  CG  
8  1 Y 1 B GLU 257 ? CD  ? B GLU 46  CD  
9  1 Y 1 B GLU 257 ? OE1 ? B GLU 46  OE1 
10 1 Y 1 B GLU 257 ? OE2 ? B GLU 46  OE2 
11 1 Y 1 B GLN 293 ? CG  ? B GLN 82  CG  
12 1 Y 1 B GLN 293 ? CD  ? B GLN 82  CD  
13 1 Y 1 B GLN 293 ? OE1 ? B GLN 82  OE1 
14 1 Y 1 B GLN 293 ? NE2 ? B GLN 82  NE2 
15 1 Y 1 B LEU 351 ? CG  ? B LEU 140 CG  
16 1 Y 1 B LEU 351 ? CD1 ? B LEU 140 CD1 
17 1 Y 1 B LEU 351 ? CD2 ? B LEU 140 CD2 
18 1 Y 1 B GLN 352 ? CG  ? B GLN 141 CG  
19 1 Y 1 B GLN 352 ? CD  ? B GLN 141 CD  
20 1 Y 1 B GLN 352 ? OE1 ? B GLN 141 OE1 
21 1 Y 1 B GLN 352 ? NE2 ? B GLN 141 NE2 
22 1 Y 1 B TYR 552 ? CD1 ? B TYR 341 CD1 
23 1 Y 1 B TYR 552 ? CD2 ? B TYR 341 CD2 
24 1 Y 1 B TYR 552 ? CE1 ? B TYR 341 CE1 
25 1 Y 1 B TYR 552 ? CE2 ? B TYR 341 CE2 
26 1 Y 1 B TYR 552 ? CZ  ? B TYR 341 CZ  
27 1 Y 1 B TYR 552 ? OH  ? B TYR 341 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 212 ? A MET 1   
2  1 Y 1 A HIS 213 ? A HIS 2   
3  1 Y 1 A HIS 214 ? A HIS 3   
4  1 Y 1 A HIS 215 ? A HIS 4   
5  1 Y 1 A HIS 216 ? A HIS 5   
6  1 Y 1 A HIS 217 ? A HIS 6   
7  1 Y 1 A HIS 218 ? A HIS 7   
8  1 Y 1 A SER 219 ? A SER 8   
9  1 Y 1 A SER 220 ? A SER 9   
10 1 Y 1 A GLY 221 ? A GLY 10  
11 1 Y 1 A VAL 222 ? A VAL 11  
12 1 Y 1 A ASP 223 ? A ASP 12  
13 1 Y 1 A ASN 548 ? A ASN 337 
14 1 Y 1 A PRO 549 ? A PRO 338 
15 1 Y 1 A ASP 550 ? A ASP 339 
16 1 Y 1 B MET 212 ? B MET 1   
17 1 Y 1 B HIS 213 ? B HIS 2   
18 1 Y 1 B HIS 214 ? B HIS 3   
19 1 Y 1 B HIS 215 ? B HIS 4   
20 1 Y 1 B HIS 216 ? B HIS 5   
21 1 Y 1 B HIS 217 ? B HIS 6   
22 1 Y 1 B HIS 218 ? B HIS 7   
23 1 Y 1 B SER 219 ? B SER 8   
24 1 Y 1 B SER 220 ? B SER 9   
25 1 Y 1 B GLY 221 ? B GLY 10  
26 1 Y 1 B VAL 222 ? B VAL 11  
27 1 Y 1 B ASP 223 ? B ASP 12  
28 1 Y 1 B LEU 224 ? B LEU 13  
29 1 Y 1 B GLY 225 ? B GLY 14  
30 1 Y 1 B ILE 546 ? B ILE 335 
31 1 Y 1 B LEU 547 ? B LEU 336 
32 1 Y 1 B ASN 548 ? B ASN 337 
33 1 Y 1 B PRO 549 ? B PRO 338 
34 1 Y 1 B ASP 550 ? B ASP 339 
35 1 Y 1 B GLY 551 ? B GLY 340 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 3-aminobenzamide 3AB 
3 GLYCEROL         GOL 
4 water            HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 3AB 1   1   1   3AB 3AB A . 
D 3 GOL 1   580 1   GOL GOL A . 
E 2 3AB 1   1   1   3AB 3AB B . 
F 3 GOL 1   580 1   GOL GOL B . 
G 4 HOH 1   5   5   HOH HOH A . 
G 4 HOH 2   6   6   HOH HOH A . 
G 4 HOH 3   7   7   HOH HOH A . 
G 4 HOH 4   8   8   HOH HOH A . 
G 4 HOH 5   10  10  HOH HOH A . 
G 4 HOH 6   11  11  HOH HOH A . 
G 4 HOH 7   12  12  HOH HOH A . 
G 4 HOH 8   19  19  HOH HOH A . 
G 4 HOH 9   23  23  HOH HOH A . 
G 4 HOH 10  25  25  HOH HOH A . 
G 4 HOH 11  26  26  HOH HOH A . 
G 4 HOH 12  27  27  HOH HOH A . 
G 4 HOH 13  28  28  HOH HOH A . 
G 4 HOH 14  30  30  HOH HOH A . 
G 4 HOH 15  31  31  HOH HOH A . 
G 4 HOH 16  33  33  HOH HOH A . 
G 4 HOH 17  34  34  HOH HOH A . 
G 4 HOH 18  36  36  HOH HOH A . 
G 4 HOH 19  38  38  HOH HOH A . 
G 4 HOH 20  39  39  HOH HOH A . 
G 4 HOH 21  40  40  HOH HOH A . 
G 4 HOH 22  41  41  HOH HOH A . 
G 4 HOH 23  43  43  HOH HOH A . 
G 4 HOH 24  45  45  HOH HOH A . 
G 4 HOH 25  46  46  HOH HOH A . 
G 4 HOH 26  48  48  HOH HOH A . 
G 4 HOH 27  49  49  HOH HOH A . 
G 4 HOH 28  50  50  HOH HOH A . 
G 4 HOH 29  51  51  HOH HOH A . 
G 4 HOH 30  52  52  HOH HOH A . 
G 4 HOH 31  53  53  HOH HOH A . 
G 4 HOH 32  54  54  HOH HOH A . 
G 4 HOH 33  56  56  HOH HOH A . 
G 4 HOH 34  57  57  HOH HOH A . 
G 4 HOH 35  59  59  HOH HOH A . 
G 4 HOH 36  62  62  HOH HOH A . 
G 4 HOH 37  63  63  HOH HOH A . 
G 4 HOH 38  64  64  HOH HOH A . 
G 4 HOH 39  65  65  HOH HOH A . 
G 4 HOH 40  66  66  HOH HOH A . 
G 4 HOH 41  67  67  HOH HOH A . 
G 4 HOH 42  68  68  HOH HOH A . 
G 4 HOH 43  71  71  HOH HOH A . 
G 4 HOH 44  72  72  HOH HOH A . 
G 4 HOH 45  75  75  HOH HOH A . 
G 4 HOH 46  77  77  HOH HOH A . 
G 4 HOH 47  78  78  HOH HOH A . 
G 4 HOH 48  80  80  HOH HOH A . 
G 4 HOH 49  82  82  HOH HOH A . 
G 4 HOH 50  83  83  HOH HOH A . 
G 4 HOH 51  84  84  HOH HOH A . 
G 4 HOH 52  87  87  HOH HOH A . 
G 4 HOH 53  88  88  HOH HOH A . 
G 4 HOH 54  91  91  HOH HOH A . 
G 4 HOH 55  92  92  HOH HOH A . 
G 4 HOH 56  93  93  HOH HOH A . 
G 4 HOH 57  94  94  HOH HOH A . 
G 4 HOH 58  95  95  HOH HOH A . 
G 4 HOH 59  97  97  HOH HOH A . 
G 4 HOH 60  99  99  HOH HOH A . 
G 4 HOH 61  100 100 HOH HOH A . 
G 4 HOH 62  101 101 HOH HOH A . 
G 4 HOH 63  102 102 HOH HOH A . 
G 4 HOH 64  103 103 HOH HOH A . 
G 4 HOH 65  105 105 HOH HOH A . 
G 4 HOH 66  108 108 HOH HOH A . 
G 4 HOH 67  111 111 HOH HOH A . 
G 4 HOH 68  116 116 HOH HOH A . 
G 4 HOH 69  117 117 HOH HOH A . 
G 4 HOH 70  118 118 HOH HOH A . 
G 4 HOH 71  122 122 HOH HOH A . 
G 4 HOH 72  123 123 HOH HOH A . 
G 4 HOH 73  125 125 HOH HOH A . 
G 4 HOH 74  128 128 HOH HOH A . 
G 4 HOH 75  129 129 HOH HOH A . 
G 4 HOH 76  132 132 HOH HOH A . 
G 4 HOH 77  133 133 HOH HOH A . 
G 4 HOH 78  135 135 HOH HOH A . 
G 4 HOH 79  137 137 HOH HOH A . 
G 4 HOH 80  138 138 HOH HOH A . 
G 4 HOH 81  140 140 HOH HOH A . 
G 4 HOH 82  141 141 HOH HOH A . 
G 4 HOH 83  142 142 HOH HOH A . 
G 4 HOH 84  143 143 HOH HOH A . 
G 4 HOH 85  146 146 HOH HOH A . 
G 4 HOH 86  151 151 HOH HOH A . 
G 4 HOH 87  152 152 HOH HOH A . 
G 4 HOH 88  153 153 HOH HOH A . 
G 4 HOH 89  156 156 HOH HOH A . 
G 4 HOH 90  158 158 HOH HOH A . 
G 4 HOH 91  159 159 HOH HOH A . 
G 4 HOH 92  161 161 HOH HOH A . 
G 4 HOH 93  162 162 HOH HOH A . 
G 4 HOH 94  164 164 HOH HOH A . 
G 4 HOH 95  165 165 HOH HOH A . 
G 4 HOH 96  169 169 HOH HOH A . 
G 4 HOH 97  172 172 HOH HOH A . 
G 4 HOH 98  174 174 HOH HOH A . 
G 4 HOH 99  175 175 HOH HOH A . 
G 4 HOH 100 176 176 HOH HOH A . 
G 4 HOH 101 178 178 HOH HOH A . 
G 4 HOH 102 179 179 HOH HOH A . 
G 4 HOH 103 180 180 HOH HOH A . 
G 4 HOH 104 182 182 HOH HOH A . 
G 4 HOH 105 183 183 HOH HOH A . 
G 4 HOH 106 184 184 HOH HOH A . 
G 4 HOH 107 185 185 HOH HOH A . 
G 4 HOH 108 186 186 HOH HOH A . 
G 4 HOH 109 187 187 HOH HOH A . 
G 4 HOH 110 189 189 HOH HOH A . 
G 4 HOH 111 190 190 HOH HOH A . 
G 4 HOH 112 191 191 HOH HOH A . 
G 4 HOH 113 193 193 HOH HOH A . 
G 4 HOH 114 194 194 HOH HOH A . 
G 4 HOH 115 195 195 HOH HOH A . 
G 4 HOH 116 196 196 HOH HOH A . 
G 4 HOH 117 202 202 HOH HOH A . 
G 4 HOH 118 204 204 HOH HOH A . 
G 4 HOH 119 206 206 HOH HOH A . 
G 4 HOH 120 208 208 HOH HOH A . 
G 4 HOH 121 209 209 HOH HOH A . 
G 4 HOH 122 211 211 HOH HOH A . 
G 4 HOH 123 581 1   HOH HOH A . 
G 4 HOH 124 582 212 HOH HOH A . 
G 4 HOH 125 583 214 HOH HOH A . 
G 4 HOH 126 584 215 HOH HOH A . 
G 4 HOH 127 585 217 HOH HOH A . 
G 4 HOH 128 586 218 HOH HOH A . 
G 4 HOH 129 587 224 HOH HOH A . 
G 4 HOH 130 588 225 HOH HOH A . 
G 4 HOH 131 589 226 HOH HOH A . 
G 4 HOH 132 590 229 HOH HOH A . 
G 4 HOH 133 591 230 HOH HOH A . 
G 4 HOH 134 592 232 HOH HOH A . 
G 4 HOH 135 593 235 HOH HOH A . 
G 4 HOH 136 594 236 HOH HOH A . 
G 4 HOH 137 595 237 HOH HOH A . 
G 4 HOH 138 596 238 HOH HOH A . 
G 4 HOH 139 597 240 HOH HOH A . 
G 4 HOH 140 598 246 HOH HOH A . 
G 4 HOH 141 599 247 HOH HOH A . 
G 4 HOH 142 600 250 HOH HOH A . 
G 4 HOH 143 601 251 HOH HOH A . 
G 4 HOH 144 602 252 HOH HOH A . 
G 4 HOH 145 603 253 HOH HOH A . 
G 4 HOH 146 604 254 HOH HOH A . 
G 4 HOH 147 605 255 HOH HOH A . 
G 4 HOH 148 606 256 HOH HOH A . 
G 4 HOH 149 607 257 HOH HOH A . 
G 4 HOH 150 608 258 HOH HOH A . 
G 4 HOH 151 609 259 HOH HOH A . 
G 4 HOH 152 610 260 HOH HOH A . 
G 4 HOH 153 611 261 HOH HOH A . 
G 4 HOH 154 612 262 HOH HOH A . 
G 4 HOH 155 613 263 HOH HOH A . 
G 4 HOH 156 614 264 HOH HOH A . 
G 4 HOH 157 615 265 HOH HOH A . 
G 4 HOH 158 616 266 HOH HOH A . 
G 4 HOH 159 617 267 HOH HOH A . 
G 4 HOH 160 618 268 HOH HOH A . 
G 4 HOH 161 619 269 HOH HOH A . 
G 4 HOH 162 620 270 HOH HOH A . 
G 4 HOH 163 621 271 HOH HOH A . 
G 4 HOH 164 622 272 HOH HOH A . 
G 4 HOH 165 623 273 HOH HOH A . 
G 4 HOH 166 624 274 HOH HOH A . 
G 4 HOH 167 625 275 HOH HOH A . 
G 4 HOH 168 626 276 HOH HOH A . 
G 4 HOH 169 627 277 HOH HOH A . 
G 4 HOH 170 628 280 HOH HOH A . 
G 4 HOH 171 629 308 HOH HOH A . 
G 4 HOH 172 630 309 HOH HOH A . 
G 4 HOH 173 631 316 HOH HOH A . 
G 4 HOH 174 632 318 HOH HOH A . 
G 4 HOH 175 633 320 HOH HOH A . 
G 4 HOH 176 634 322 HOH HOH A . 
G 4 HOH 177 635 323 HOH HOH A . 
G 4 HOH 178 636 324 HOH HOH A . 
G 4 HOH 179 637 326 HOH HOH A . 
G 4 HOH 180 638 329 HOH HOH A . 
G 4 HOH 181 639 331 HOH HOH A . 
G 4 HOH 182 640 334 HOH HOH A . 
G 4 HOH 183 641 338 HOH HOH A . 
G 4 HOH 184 642 341 HOH HOH A . 
G 4 HOH 185 643 342 HOH HOH A . 
G 4 HOH 186 644 346 HOH HOH A . 
G 4 HOH 187 645 349 HOH HOH A . 
G 4 HOH 188 646 350 HOH HOH A . 
G 4 HOH 189 647 351 HOH HOH A . 
G 4 HOH 190 648 354 HOH HOH A . 
G 4 HOH 191 649 355 HOH HOH A . 
G 4 HOH 192 650 357 HOH HOH A . 
G 4 HOH 193 651 360 HOH HOH A . 
G 4 HOH 194 652 361 HOH HOH A . 
G 4 HOH 195 653 363 HOH HOH A . 
G 4 HOH 196 654 364 HOH HOH A . 
G 4 HOH 197 655 365 HOH HOH A . 
G 4 HOH 198 656 366 HOH HOH A . 
G 4 HOH 199 657 369 HOH HOH A . 
G 4 HOH 200 658 374 HOH HOH A . 
G 4 HOH 201 659 375 HOH HOH A . 
G 4 HOH 202 660 376 HOH HOH A . 
G 4 HOH 203 661 379 HOH HOH A . 
G 4 HOH 204 662 380 HOH HOH A . 
G 4 HOH 205 663 384 HOH HOH A . 
G 4 HOH 206 664 387 HOH HOH A . 
G 4 HOH 207 665 336 HOH HOH A . 
H 4 HOH 1   2   2   HOH HOH B . 
H 4 HOH 2   3   3   HOH HOH B . 
H 4 HOH 3   4   4   HOH HOH B . 
H 4 HOH 4   9   9   HOH HOH B . 
H 4 HOH 5   13  13  HOH HOH B . 
H 4 HOH 6   14  14  HOH HOH B . 
H 4 HOH 7   15  15  HOH HOH B . 
H 4 HOH 8   16  16  HOH HOH B . 
H 4 HOH 9   17  17  HOH HOH B . 
H 4 HOH 10  18  18  HOH HOH B . 
H 4 HOH 11  20  20  HOH HOH B . 
H 4 HOH 12  21  21  HOH HOH B . 
H 4 HOH 13  22  22  HOH HOH B . 
H 4 HOH 14  24  24  HOH HOH B . 
H 4 HOH 15  29  29  HOH HOH B . 
H 4 HOH 16  32  32  HOH HOH B . 
H 4 HOH 17  35  35  HOH HOH B . 
H 4 HOH 18  37  37  HOH HOH B . 
H 4 HOH 19  42  42  HOH HOH B . 
H 4 HOH 20  44  44  HOH HOH B . 
H 4 HOH 21  47  47  HOH HOH B . 
H 4 HOH 22  55  55  HOH HOH B . 
H 4 HOH 23  58  58  HOH HOH B . 
H 4 HOH 24  60  60  HOH HOH B . 
H 4 HOH 25  61  61  HOH HOH B . 
H 4 HOH 26  69  69  HOH HOH B . 
H 4 HOH 27  70  70  HOH HOH B . 
H 4 HOH 28  73  73  HOH HOH B . 
H 4 HOH 29  74  74  HOH HOH B . 
H 4 HOH 30  76  76  HOH HOH B . 
H 4 HOH 31  79  79  HOH HOH B . 
H 4 HOH 32  81  81  HOH HOH B . 
H 4 HOH 33  85  85  HOH HOH B . 
H 4 HOH 34  86  86  HOH HOH B . 
H 4 HOH 35  89  89  HOH HOH B . 
H 4 HOH 36  90  90  HOH HOH B . 
H 4 HOH 37  96  96  HOH HOH B . 
H 4 HOH 38  98  98  HOH HOH B . 
H 4 HOH 39  104 104 HOH HOH B . 
H 4 HOH 40  106 106 HOH HOH B . 
H 4 HOH 41  107 107 HOH HOH B . 
H 4 HOH 42  109 109 HOH HOH B . 
H 4 HOH 43  110 110 HOH HOH B . 
H 4 HOH 44  112 112 HOH HOH B . 
H 4 HOH 45  113 113 HOH HOH B . 
H 4 HOH 46  114 114 HOH HOH B . 
H 4 HOH 47  115 115 HOH HOH B . 
H 4 HOH 48  119 119 HOH HOH B . 
H 4 HOH 49  120 120 HOH HOH B . 
H 4 HOH 50  121 121 HOH HOH B . 
H 4 HOH 51  124 124 HOH HOH B . 
H 4 HOH 52  126 126 HOH HOH B . 
H 4 HOH 53  127 127 HOH HOH B . 
H 4 HOH 54  130 130 HOH HOH B . 
H 4 HOH 55  131 131 HOH HOH B . 
H 4 HOH 56  134 134 HOH HOH B . 
H 4 HOH 57  136 136 HOH HOH B . 
H 4 HOH 58  139 139 HOH HOH B . 
H 4 HOH 59  144 144 HOH HOH B . 
H 4 HOH 60  145 145 HOH HOH B . 
H 4 HOH 61  147 147 HOH HOH B . 
H 4 HOH 62  148 148 HOH HOH B . 
H 4 HOH 63  149 149 HOH HOH B . 
H 4 HOH 64  150 150 HOH HOH B . 
H 4 HOH 65  154 154 HOH HOH B . 
H 4 HOH 66  155 155 HOH HOH B . 
H 4 HOH 67  157 157 HOH HOH B . 
H 4 HOH 68  160 160 HOH HOH B . 
H 4 HOH 69  163 163 HOH HOH B . 
H 4 HOH 70  166 166 HOH HOH B . 
H 4 HOH 71  167 167 HOH HOH B . 
H 4 HOH 72  168 168 HOH HOH B . 
H 4 HOH 73  170 170 HOH HOH B . 
H 4 HOH 74  171 171 HOH HOH B . 
H 4 HOH 75  173 173 HOH HOH B . 
H 4 HOH 76  177 177 HOH HOH B . 
H 4 HOH 77  181 181 HOH HOH B . 
H 4 HOH 78  188 188 HOH HOH B . 
H 4 HOH 79  192 192 HOH HOH B . 
H 4 HOH 80  197 197 HOH HOH B . 
H 4 HOH 81  198 198 HOH HOH B . 
H 4 HOH 82  199 199 HOH HOH B . 
H 4 HOH 83  200 200 HOH HOH B . 
H 4 HOH 84  201 201 HOH HOH B . 
H 4 HOH 85  203 203 HOH HOH B . 
H 4 HOH 86  205 205 HOH HOH B . 
H 4 HOH 87  210 210 HOH HOH B . 
H 4 HOH 88  581 213 HOH HOH B . 
H 4 HOH 89  582 216 HOH HOH B . 
H 4 HOH 90  583 219 HOH HOH B . 
H 4 HOH 91  584 220 HOH HOH B . 
H 4 HOH 92  585 221 HOH HOH B . 
H 4 HOH 93  586 222 HOH HOH B . 
H 4 HOH 94  587 223 HOH HOH B . 
H 4 HOH 95  588 227 HOH HOH B . 
H 4 HOH 96  589 228 HOH HOH B . 
H 4 HOH 97  590 231 HOH HOH B . 
H 4 HOH 98  591 233 HOH HOH B . 
H 4 HOH 99  592 234 HOH HOH B . 
H 4 HOH 100 593 239 HOH HOH B . 
H 4 HOH 101 594 241 HOH HOH B . 
H 4 HOH 102 595 242 HOH HOH B . 
H 4 HOH 103 596 243 HOH HOH B . 
H 4 HOH 104 597 244 HOH HOH B . 
H 4 HOH 105 598 245 HOH HOH B . 
H 4 HOH 106 599 248 HOH HOH B . 
H 4 HOH 107 600 249 HOH HOH B . 
H 4 HOH 108 601 278 HOH HOH B . 
H 4 HOH 109 602 279 HOH HOH B . 
H 4 HOH 110 603 281 HOH HOH B . 
H 4 HOH 111 604 282 HOH HOH B . 
H 4 HOH 112 605 283 HOH HOH B . 
H 4 HOH 113 606 284 HOH HOH B . 
H 4 HOH 114 607 285 HOH HOH B . 
H 4 HOH 115 608 286 HOH HOH B . 
H 4 HOH 116 609 287 HOH HOH B . 
H 4 HOH 117 610 288 HOH HOH B . 
H 4 HOH 118 611 289 HOH HOH B . 
H 4 HOH 119 612 290 HOH HOH B . 
H 4 HOH 120 613 291 HOH HOH B . 
H 4 HOH 121 614 292 HOH HOH B . 
H 4 HOH 122 615 293 HOH HOH B . 
H 4 HOH 123 616 294 HOH HOH B . 
H 4 HOH 124 617 295 HOH HOH B . 
H 4 HOH 125 618 296 HOH HOH B . 
H 4 HOH 126 619 297 HOH HOH B . 
H 4 HOH 127 620 298 HOH HOH B . 
H 4 HOH 128 621 299 HOH HOH B . 
H 4 HOH 129 622 300 HOH HOH B . 
H 4 HOH 130 623 301 HOH HOH B . 
H 4 HOH 131 624 302 HOH HOH B . 
H 4 HOH 132 625 303 HOH HOH B . 
H 4 HOH 133 626 304 HOH HOH B . 
H 4 HOH 134 627 305 HOH HOH B . 
H 4 HOH 135 628 306 HOH HOH B . 
H 4 HOH 136 629 307 HOH HOH B . 
H 4 HOH 137 630 310 HOH HOH B . 
H 4 HOH 138 631 311 HOH HOH B . 
H 4 HOH 139 632 312 HOH HOH B . 
H 4 HOH 140 633 313 HOH HOH B . 
H 4 HOH 141 634 314 HOH HOH B . 
H 4 HOH 142 635 315 HOH HOH B . 
H 4 HOH 143 636 317 HOH HOH B . 
H 4 HOH 144 637 319 HOH HOH B . 
H 4 HOH 145 638 321 HOH HOH B . 
H 4 HOH 146 639 325 HOH HOH B . 
H 4 HOH 147 640 327 HOH HOH B . 
H 4 HOH 148 641 328 HOH HOH B . 
H 4 HOH 149 642 330 HOH HOH B . 
H 4 HOH 150 643 332 HOH HOH B . 
H 4 HOH 151 644 333 HOH HOH B . 
H 4 HOH 152 645 335 HOH HOH B . 
H 4 HOH 153 647 337 HOH HOH B . 
H 4 HOH 154 648 339 HOH HOH B . 
H 4 HOH 155 649 340 HOH HOH B . 
H 4 HOH 156 650 343 HOH HOH B . 
H 4 HOH 157 651 344 HOH HOH B . 
H 4 HOH 158 652 345 HOH HOH B . 
H 4 HOH 159 653 347 HOH HOH B . 
H 4 HOH 160 654 348 HOH HOH B . 
H 4 HOH 161 655 352 HOH HOH B . 
H 4 HOH 162 656 353 HOH HOH B . 
H 4 HOH 163 657 356 HOH HOH B . 
H 4 HOH 164 658 358 HOH HOH B . 
H 4 HOH 165 659 359 HOH HOH B . 
H 4 HOH 166 660 362 HOH HOH B . 
H 4 HOH 167 661 367 HOH HOH B . 
H 4 HOH 168 662 368 HOH HOH B . 
H 4 HOH 169 663 370 HOH HOH B . 
H 4 HOH 170 664 371 HOH HOH B . 
H 4 HOH 171 665 372 HOH HOH B . 
H 4 HOH 172 666 373 HOH HOH B . 
H 4 HOH 173 667 377 HOH HOH B . 
H 4 HOH 174 668 378 HOH HOH B . 
H 4 HOH 175 669 381 HOH HOH B . 
H 4 HOH 176 670 382 HOH HOH B . 
H 4 HOH 177 671 383 HOH HOH B . 
H 4 HOH 178 672 385 HOH HOH B . 
H 4 HOH 179 673 386 HOH HOH B . 
H 4 HOH 180 674 388 HOH HOH B . 
#