data_3KEU
# 
_entry.id   3KEU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KEU         
RCSB  RCSB055903   
WWPDB D_1000055903 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2YXT 
_pdbx_database_related.details        'Crystal Structure of human pyridoxal kinase' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3KEU 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Safo, M.K.'    1 
'Gandhi, A.K.'  2 
'Musayev, F.N.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of PL kinase in complex with MgATP and PLP: Structural basis of severe induced MgATP substrate inhibition of the enzyme
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gandhi, A.K.'  1 
primary 'Musayev, F.N.' 2 
primary 'Safo, M.K.'    3 
# 
_cell.entry_id           3KEU 
_cell.length_a           91.202 
_cell.length_b           114.585 
_cell.length_c           169.414 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3KEU 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Pyridoxal kinase'              35143.266 2   2.7.1.35 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                 24.305    4   ?        ? ? ? 
3 non-polymer syn 'SODIUM ION'                    22.990    2   ?        ? ? ? 
4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"     507.181   2   ?        ? ? ? 
5 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"        247.142   2   ?        ? ? ? 
6 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   9   ?        ? ? ? 
7 non-polymer syn 'SULFATE ION'                   96.063    8   ?        ? ? ? 
8 water       nat water                           18.015    323 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pyridoxine kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
KIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
KIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   GLU n 
1 4   GLU n 
1 5   CYS n 
1 6   ARG n 
1 7   VAL n 
1 8   LEU n 
1 9   SER n 
1 10  ILE n 
1 11  GLN n 
1 12  SER n 
1 13  HIS n 
1 14  VAL n 
1 15  ILE n 
1 16  ARG n 
1 17  GLY n 
1 18  TYR n 
1 19  VAL n 
1 20  GLY n 
1 21  ASN n 
1 22  ARG n 
1 23  ALA n 
1 24  ALA n 
1 25  THR n 
1 26  PHE n 
1 27  PRO n 
1 28  LEU n 
1 29  GLN n 
1 30  VAL n 
1 31  LEU n 
1 32  GLY n 
1 33  PHE n 
1 34  GLU n 
1 35  ILE n 
1 36  ASP n 
1 37  ALA n 
1 38  VAL n 
1 39  ASN n 
1 40  SER n 
1 41  VAL n 
1 42  GLN n 
1 43  PHE n 
1 44  SER n 
1 45  ASN n 
1 46  HIS n 
1 47  THR n 
1 48  GLY n 
1 49  TYR n 
1 50  ALA n 
1 51  HIS n 
1 52  TRP n 
1 53  LYS n 
1 54  GLY n 
1 55  GLN n 
1 56  VAL n 
1 57  LEU n 
1 58  ASN n 
1 59  SER n 
1 60  ASP n 
1 61  GLU n 
1 62  LEU n 
1 63  GLN n 
1 64  GLU n 
1 65  LEU n 
1 66  TYR n 
1 67  GLU n 
1 68  GLY n 
1 69  LEU n 
1 70  ARG n 
1 71  LEU n 
1 72  ASN n 
1 73  ASN n 
1 74  MET n 
1 75  ASN n 
1 76  LYS n 
1 77  TYR n 
1 78  ASP n 
1 79  TYR n 
1 80  VAL n 
1 81  LEU n 
1 82  THR n 
1 83  GLY n 
1 84  TYR n 
1 85  THR n 
1 86  ARG n 
1 87  ASP n 
1 88  LYS n 
1 89  SER n 
1 90  PHE n 
1 91  LEU n 
1 92  ALA n 
1 93  MET n 
1 94  VAL n 
1 95  VAL n 
1 96  ASP n 
1 97  ILE n 
1 98  VAL n 
1 99  GLN n 
1 100 GLU n 
1 101 LEU n 
1 102 LYS n 
1 103 GLN n 
1 104 GLN n 
1 105 ASN n 
1 106 PRO n 
1 107 ARG n 
1 108 LEU n 
1 109 VAL n 
1 110 TYR n 
1 111 VAL n 
1 112 CYS n 
1 113 ASP n 
1 114 PRO n 
1 115 VAL n 
1 116 LEU n 
1 117 GLY n 
1 118 ASP n 
1 119 LYS n 
1 120 TRP n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 GLY n 
1 125 SER n 
1 126 MET n 
1 127 TYR n 
1 128 VAL n 
1 129 PRO n 
1 130 GLU n 
1 131 ASP n 
1 132 LEU n 
1 133 LEU n 
1 134 PRO n 
1 135 VAL n 
1 136 TYR n 
1 137 LYS n 
1 138 GLU n 
1 139 LYS n 
1 140 VAL n 
1 141 VAL n 
1 142 PRO n 
1 143 LEU n 
1 144 ALA n 
1 145 ASP n 
1 146 ILE n 
1 147 ILE n 
1 148 THR n 
1 149 PRO n 
1 150 ASN n 
1 151 GLN n 
1 152 PHE n 
1 153 GLU n 
1 154 ALA n 
1 155 GLU n 
1 156 LEU n 
1 157 LEU n 
1 158 SER n 
1 159 GLY n 
1 160 ARG n 
1 161 LYS n 
1 162 ILE n 
1 163 HIS n 
1 164 SER n 
1 165 GLN n 
1 166 GLU n 
1 167 GLU n 
1 168 ALA n 
1 169 LEU n 
1 170 ARG n 
1 171 VAL n 
1 172 MET n 
1 173 ASP n 
1 174 MET n 
1 175 LEU n 
1 176 HIS n 
1 177 SER n 
1 178 MET n 
1 179 GLY n 
1 180 PRO n 
1 181 ASP n 
1 182 THR n 
1 183 VAL n 
1 184 VAL n 
1 185 ILE n 
1 186 THR n 
1 187 SER n 
1 188 SER n 
1 189 ASP n 
1 190 LEU n 
1 191 PRO n 
1 192 SER n 
1 193 PRO n 
1 194 GLN n 
1 195 GLY n 
1 196 SER n 
1 197 ASN n 
1 198 TYR n 
1 199 LEU n 
1 200 ILE n 
1 201 VAL n 
1 202 LEU n 
1 203 GLY n 
1 204 SER n 
1 205 GLN n 
1 206 ARG n 
1 207 ARG n 
1 208 ARG n 
1 209 ASN n 
1 210 PRO n 
1 211 ALA n 
1 212 GLY n 
1 213 SER n 
1 214 VAL n 
1 215 VAL n 
1 216 MET n 
1 217 GLU n 
1 218 ARG n 
1 219 ILE n 
1 220 ARG n 
1 221 MET n 
1 222 ASP n 
1 223 ILE n 
1 224 ARG n 
1 225 LYS n 
1 226 VAL n 
1 227 ASP n 
1 228 ALA n 
1 229 VAL n 
1 230 PHE n 
1 231 VAL n 
1 232 GLY n 
1 233 THR n 
1 234 GLY n 
1 235 ASP n 
1 236 LEU n 
1 237 PHE n 
1 238 ALA n 
1 239 ALA n 
1 240 MET n 
1 241 LEU n 
1 242 LEU n 
1 243 ALA n 
1 244 TRP n 
1 245 THR n 
1 246 HIS n 
1 247 LYS n 
1 248 HIS n 
1 249 PRO n 
1 250 ASN n 
1 251 ASN n 
1 252 LEU n 
1 253 LYS n 
1 254 VAL n 
1 255 ALA n 
1 256 CYS n 
1 257 GLU n 
1 258 LYS n 
1 259 THR n 
1 260 VAL n 
1 261 SER n 
1 262 THR n 
1 263 LEU n 
1 264 HIS n 
1 265 HIS n 
1 266 VAL n 
1 267 LEU n 
1 268 GLN n 
1 269 ARG n 
1 270 THR n 
1 271 ILE n 
1 272 GLN n 
1 273 CYS n 
1 274 ALA n 
1 275 LYS n 
1 276 ALA n 
1 277 GLN n 
1 278 ALA n 
1 279 GLY n 
1 280 GLU n 
1 281 GLY n 
1 282 VAL n 
1 283 ARG n 
1 284 PRO n 
1 285 SER n 
1 286 PRO n 
1 287 MET n 
1 288 GLN n 
1 289 LEU n 
1 290 GLU n 
1 291 LEU n 
1 292 ARG n 
1 293 MET n 
1 294 VAL n 
1 295 GLN n 
1 296 SER n 
1 297 LYS n 
1 298 ARG n 
1 299 ASP n 
1 300 ILE n 
1 301 GLU n 
1 302 ASP n 
1 303 PRO n 
1 304 GLU n 
1 305 ILE n 
1 306 VAL n 
1 307 VAL n 
1 308 GLN n 
1 309 ALA n 
1 310 THR n 
1 311 VAL n 
1 312 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'C21orf124, C21orf97, PDXK, PKH, PNK' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosetta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDXK_HUMAN 
_struct_ref.pdbx_db_accession          O00764 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
KIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KEU A 1 ? 312 ? O00764 1 ? 312 ? 1 312 
2 1 3KEU B 1 ? 312 ? O00764 1 ? 312 ? 1 312 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ?                      'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                        ?                      'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ?                      'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ?                      'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"     ?                      'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                        ?                      'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ?                      'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ?                      'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                         ?                      'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                       ?                      'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                           ?                      'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ?                      'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                         ?                      'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                          ?                      'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                      ?                      'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                 ?                      'Mg 2'              24.305  
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ?                      'C6 H14 O2'         118.174 
NA  non-polymer         . 'SODIUM ION'                    ?                      'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                   ?                      'C9 H11 N O2'       165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"        'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'     247.142 
PRO 'L-peptide linking' y PROLINE                         ?                      'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                          ?                      'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                   ?                      'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                       ?                      'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ?                      'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                        ?                      'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                          ?                      'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3KEU 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.15 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'hanging drop' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    'Saturated MgATP and PLP, 50-60% MPD precipitant, pH 8.0, hanging drop, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   2009-08-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3KEU 
_reflns.d_resolution_high            2.000 
_reflns.d_resolution_low             26.980 
_reflns.number_obs                   59477 
_reflns.pdbx_scaling_rejects         19926 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_netI_over_sigmaI        13.300 
_reflns.pdbx_chi_squared             0.880 
_reflns.pdbx_redundancy              3.100 
_reflns.percent_possible_obs         98.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.00 2.07  ? 18558 ? 0.300 3.4  ? 0.980 2.81 ? 5891 99.00 1  1 
2.07 2.15  ? 18855 ? 0.272 3.8  ? 0.980 2.83 ? 5870 98.80 2  1 
2.15 2.25  ? 19167 ? 0.252 4.1  ? 0.980 2.88 ? 5889 99.10 3  1 
2.25 2.37  ? 19646 ? 0.224 4.6  ? 0.970 2.95 ? 5929 99.20 4  1 
2.37 2.52  ? 20174 ? 0.181 5.5  ? 0.950 3.02 ? 5933 99.40 5  1 
2.52 2.71  ? 20757 ? 0.133 7.0  ? 0.920 3.11 ? 5940 99.10 6  1 
2.71 2.99  ? 21349 ? 0.095 9.4  ? 0.870 3.22 ? 5948 99.30 7  1 
2.99 3.42  ? 21733 ? 0.055 15.4 ? 0.790 3.37 ? 6000 99.30 8  1 
3.42 4.30  ? 21962 ? 0.030 27.1 ? 0.740 3.42 ? 6034 99.40 9  1 
4.30 26.98 ? 22160 ? 0.019 44.0 ? 0.720 3.37 ? 6043 96.50 10 1 
# 
_refine.entry_id                                 3KEU 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             26.980 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               3564144.000 
_refine.pdbx_data_cutoff_low_absF                0.000 
_refine.ls_percent_reflns_obs                    98.900 
_refine.ls_number_reflns_obs                     51485 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2606 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.B_iso_mean                               44.453 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.aniso_B[1][1]                            12.560 
_refine.aniso_B[2][2]                            -8.760 
_refine.aniso_B[3][3]                            -3.790 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'isomorphous refinement' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                100.00 
_refine.B_iso_min                                15.31 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3KEU 
_refine_analyze.Luzzati_coordinate_error_obs    0.270 
_refine_analyze.Luzzati_sigma_a_obs             0.490 
_refine_analyze.Luzzati_d_res_low_obs           5.000 
_refine_analyze.Luzzati_coordinate_error_free   0.350 
_refine_analyze.Luzzati_sigma_a_free            0.600 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4822 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         212 
_refine_hist.number_atoms_solvent             323 
_refine_hist.number_atoms_total               5357 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        26.980 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.010  ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        ? 1.600  ?     ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 23.500 ?     ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 2.280  ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        ? 5.610  1.500 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       ? 6.720  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        ? 8.510  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       ? 10.000 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.180 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.percent_reflns_obs               98.700 
_refine_ls_shell.number_reflns_R_work             4801 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.403 
_refine_ls_shell.R_factor_R_free                  0.445 
_refine_ls_shell.percent_reflns_R_free            5.600 
_refine_ls_shell.number_reflns_R_free             283 
_refine_ls_shell.R_factor_R_free_error            0.026 
_refine_ls_shell.number_reflns_all                5084 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 atp.par           ion.top     'X-RAY DIFFRACTION' 
3 ion.param         water.top   'X-RAY DIFFRACTION' 
4 mpd.par           atp.top     'X-RAY DIFFRACTION' 
5 water.param       plp.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KEU 
_struct.title                     'Crystal Structure of Human PL Kinase with bound PLP and ATP' 
_struct.pdbx_descriptor           'Pyridoxal kinase (E.C.2.7.1.35)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KEU 
_struct_keywords.text            
;Pyridoxal 5'-phosphate, Pyridoxal kinase, Vitamin B6, PLP, ATP-binding, Kinase, Metal-binding, Nucleotide-binding, Phosphoprotein, Transferase
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 5 ? 
H  N N 6 ? 
I  N N 6 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 7 ? 
M  N N 7 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 6 ? 
S  N N 5 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 6 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 8 ? 
EA N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 20  ? LEU A 31  ? GLY A 20  LEU A 31  1 ? 12 
HELX_P HELX_P2  2  ASN A 58  ? ASN A 72  ? ASN A 58  ASN A 72  1 ? 15 
HELX_P HELX_P3  3  ASP A 87  ? ASN A 105 ? ASP A 87  ASN A 105 1 ? 19 
HELX_P HELX_P4  4  ASP A 131 ? LYS A 139 ? ASP A 131 LYS A 139 1 ? 9  
HELX_P HELX_P5  5  LYS A 139 ? ALA A 144 ? LYS A 139 ALA A 144 1 ? 6  
HELX_P HELX_P6  6  ASN A 150 ? GLY A 159 ? ASN A 150 GLY A 159 1 ? 10 
HELX_P HELX_P7  7  SER A 164 ? MET A 178 ? SER A 164 MET A 178 1 ? 15 
HELX_P HELX_P8  8  GLY A 232 ? HIS A 248 ? GLY A 232 HIS A 248 1 ? 17 
HELX_P HELX_P9  9  ASN A 251 ? GLY A 279 ? ASN A 251 GLY A 279 1 ? 29 
HELX_P HELX_P10 10 MET A 293 ? GLN A 295 ? MET A 293 GLN A 295 5 ? 3  
HELX_P HELX_P11 11 SER A 296 ? ASP A 302 ? SER A 296 ASP A 302 1 ? 7  
HELX_P HELX_P12 12 GLY B 20  ? LEU B 31  ? GLY B 20  LEU B 31  1 ? 12 
HELX_P HELX_P13 13 ASN B 58  ? ASN B 72  ? ASN B 58  ASN B 72  1 ? 15 
HELX_P HELX_P14 14 ASP B 87  ? ASN B 105 ? ASP B 87  ASN B 105 1 ? 19 
HELX_P HELX_P15 15 PRO B 129 ? ASP B 131 ? PRO B 129 ASP B 131 5 ? 3  
HELX_P HELX_P16 16 LEU B 132 ? LYS B 139 ? LEU B 132 LYS B 139 1 ? 8  
HELX_P HELX_P17 17 VAL B 140 ? ALA B 144 ? VAL B 140 ALA B 144 5 ? 5  
HELX_P HELX_P18 18 ASN B 150 ? GLY B 159 ? ASN B 150 GLY B 159 1 ? 10 
HELX_P HELX_P19 19 SER B 164 ? GLY B 179 ? SER B 164 GLY B 179 1 ? 16 
HELX_P HELX_P20 20 GLY B 232 ? HIS B 248 ? GLY B 232 HIS B 248 1 ? 17 
HELX_P HELX_P21 21 ASN B 251 ? ALA B 276 ? ASN B 251 ALA B 276 1 ? 26 
HELX_P HELX_P22 22 SER B 285 ? GLU B 290 ? SER B 285 GLU B 290 5 ? 6  
HELX_P HELX_P23 23 MET B 293 ? GLN B 295 ? MET B 293 GLN B 295 5 ? 3  
HELX_P HELX_P24 24 SER B 296 ? ASP B 302 ? SER B 296 ASP B 302 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 118 OD2 ? ? ? 1_555 C  MG  . MG  ? ? A ASP 118 A MG  400 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc2  metalc ? ? A THR 148 O   ? ? ? 1_555 E  NA  . NA  ? ? A THR 148 A NA  402 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc3  metalc ? ? A THR 186 OG1 ? ? ? 1_555 E  NA  . NA  ? ? A THR 186 A NA  402 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc4  metalc ? ? B ASP 118 OD2 ? ? ? 1_555 N  MG  . MG  ? ? B ASP 118 B MG  404 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc5  metalc ? ? B THR 148 O   ? ? ? 1_555 P  NA  . NA  ? ? B THR 148 B NA  406 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc6  metalc ? ? B THR 186 OG1 ? ? ? 1_555 P  NA  . NA  ? ? B THR 186 B NA  406 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc7  metalc ? ? C MG  .   MG  ? ? ? 1_555 F  ATP . O1B ? ? A MG  400 A ATP 407 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc8  metalc ? ? C MG  .   MG  ? ? ? 1_555 F  ATP . O2A ? ? A MG  400 A ATP 407 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc9  metalc ? ? C MG  .   MG  ? ? ? 1_555 DA HOH . O   ? ? A MG  400 A HOH 792 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc10 metalc ? ? C MG  .   MG  ? ? ? 1_555 I  MPD . O4  ? ? A MG  400 A MPD 512 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc11 metalc ? ? C MG  .   MG  ? ? ? 1_555 DA HOH . O   ? ? A MG  400 A HOH 806 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc12 metalc ? ? E NA  .   NA  ? ? ? 1_555 F  ATP . O3B ? ? A NA  402 A ATP 407 1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc13 metalc ? ? E NA  .   NA  ? ? ? 1_555 F  ATP . O2G ? ? A NA  402 A ATP 407 1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc14 metalc ? ? E NA  .   NA  ? ? ? 1_555 DA HOH . O   ? ? A NA  402 A HOH 656 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc15 metalc ? ? N MG  .   MG  ? ? ? 1_555 Q  ATP . O1B ? ? B MG  404 B ATP 409 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc16 metalc ? ? N MG  .   MG  ? ? ? 1_555 EA HOH . O   ? ? B MG  404 B HOH 798 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc17 metalc ? ? N MG  .   MG  ? ? ? 1_555 Q  ATP . O2A ? ? B MG  404 B ATP 409 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc18 metalc ? ? N MG  .   MG  ? ? ? 1_555 U  MPD . O4  ? ? B MG  404 B MPD 514 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc19 metalc ? ? N MG  .   MG  ? ? ? 1_555 EA HOH . O   ? ? B MG  404 B HOH 797 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc20 metalc ? ? P NA  .   NA  ? ? ? 1_555 Q  ATP . O1G ? ? B NA  406 B ATP 409 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc21 metalc ? ? P NA  .   NA  ? ? ? 1_555 Q  ATP . O3B ? ? B NA  406 B ATP 409 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc22 metalc ? ? P NA  .   NA  ? ? ? 1_555 EA HOH . O   ? ? B NA  406 B HOH 796 1_555 ? ? ? ? ? ? ? 2.588 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 2  ? 
C ? 10 ? 
D ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? parallel      
C 3 4  ? parallel      
C 4 5  ? parallel      
C 5 6  ? parallel      
C 6 7  ? parallel      
C 7 8  ? anti-parallel 
C 8 9  ? anti-parallel 
C 9 10 ? anti-parallel 
D 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLY A 54  ? VAL A 56  ? GLY A 54  VAL A 56  
A 2  GLU A 34  ? PHE A 43  ? GLU A 34  PHE A 43  
A 3  ARG A 6   ? VAL A 14  ? ARG A 6   VAL A 14  
A 4  TYR A 79  ? THR A 82  ? TYR A 79  THR A 82  
A 5  VAL A 109 ? CYS A 112 ? VAL A 109 CYS A 112 
A 6  ILE A 146 ? ILE A 147 ? ILE A 146 ILE A 147 
A 7  THR A 182 ? ILE A 185 ? THR A 182 ILE A 185 
A 8  TYR A 198 ? ARG A 206 ? TYR A 198 ARG A 206 
A 9  MET A 216 ? ARG A 224 ? MET A 216 ARG A 224 
A 10 THR A 310 ? LEU A 312 ? THR A 310 LEU A 312 
B 1  GLY A 117 ? LYS A 119 ? GLY A 117 LYS A 119 
B 2  GLY A 124 ? MET A 126 ? GLY A 124 MET A 126 
C 1  GLY B 54  ? VAL B 56  ? GLY B 54  VAL B 56  
C 2  GLU B 34  ? PHE B 43  ? GLU B 34  PHE B 43  
C 3  ARG B 6   ? VAL B 14  ? ARG B 6   VAL B 14  
C 4  TYR B 79  ? THR B 82  ? TYR B 79  THR B 82  
C 5  VAL B 109 ? CYS B 112 ? VAL B 109 CYS B 112 
C 6  ILE B 146 ? ILE B 147 ? ILE B 146 ILE B 147 
C 7  THR B 182 ? ILE B 185 ? THR B 182 ILE B 185 
C 8  TYR B 198 ? ARG B 208 ? TYR B 198 ARG B 208 
C 9  VAL B 214 ? ARG B 224 ? VAL B 214 ARG B 224 
C 10 THR B 310 ? LEU B 312 ? THR B 310 LEU B 312 
D 1  GLY B 117 ? TRP B 120 ? GLY B 117 TRP B 120 
D 2  GLU B 123 ? MET B 126 ? GLU B 123 MET B 126 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O GLN A 55  ? O GLN A 55  N GLN A 42  ? N GLN A 42  
A 2 3  O ASP A 36  ? O ASP A 36  N VAL A 7   ? N VAL A 7   
A 3 4  N LEU A 8   ? N LEU A 8   O LEU A 81  ? O LEU A 81  
A 4 5  N VAL A 80  ? N VAL A 80  O VAL A 111 ? O VAL A 111 
A 5 6  N CYS A 112 ? N CYS A 112 O ILE A 146 ? O ILE A 146 
A 6 7  N ILE A 147 ? N ILE A 147 O THR A 182 ? O THR A 182 
A 7 8  N VAL A 183 ? N VAL A 183 O SER A 204 ? O SER A 204 
A 8 9  N LEU A 199 ? N LEU A 199 O ILE A 223 ? O ILE A 223 
A 9 10 N ARG A 220 ? N ARG A 220 O THR A 310 ? O THR A 310 
B 1 2  N ASP A 118 ? N ASP A 118 O SER A 125 ? O SER A 125 
C 1 2  O GLN B 55  ? O GLN B 55  N GLN B 42  ? N GLN B 42  
C 2 3  O ASP B 36  ? O ASP B 36  N VAL B 7   ? N VAL B 7   
C 3 4  N LEU B 8   ? N LEU B 8   O LEU B 81  ? O LEU B 81  
C 4 5  N VAL B 80  ? N VAL B 80  O VAL B 111 ? O VAL B 111 
C 5 6  N CYS B 112 ? N CYS B 112 O ILE B 146 ? O ILE B 146 
C 6 7  N ILE B 147 ? N ILE B 147 O THR B 182 ? O THR B 182 
C 7 8  N ILE B 185 ? N ILE B 185 O LEU B 202 ? O LEU B 202 
C 8 9  N GLY B 203 ? N GLY B 203 O ILE B 219 ? O ILE B 219 
C 9 10 N ARG B 220 ? N ARG B 220 O THR B 310 ? O THR B 310 
D 1 2  N TRP B 120 ? N TRP B 120 O GLU B 123 ? O GLU B 123 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 400'  
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 401'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 402'  
AC4 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE ATP A 407' 
AC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PLP A 500' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MPD A 508' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MPD A 512' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MPD A 516' 
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SO4 A 524' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 528' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 538' 
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 404'  
BC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG B 405'  
BC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA B 406'  
BC6 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE ATP B 409' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MPD B 508' 
BC8 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP B 500' 
BC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MPD B 510' 
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MPD B 514' 
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MPD B 518' 
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MPD B 520' 
CC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MPD B 522' 
CC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 B 526' 
CC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 530' 
CC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 B 532' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 534' 
CC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 B 536' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ASP A  118 ? ASP A 118 . ? 1_555 ? 
2   AC1 5  ATP F  .   ? ATP A 407 . ? 1_555 ? 
3   AC1 5  MPD I  .   ? MPD A 512 . ? 1_555 ? 
4   AC1 5  HOH DA .   ? HOH A 792 . ? 1_555 ? 
5   AC1 5  HOH DA .   ? HOH A 806 . ? 1_555 ? 
6   AC2 3  ASP A  235 ? ASP A 235 . ? 1_555 ? 
7   AC2 3  ATP F  .   ? ATP A 407 . ? 1_555 ? 
8   AC2 3  PLP G  .   ? PLP A 500 . ? 1_555 ? 
9   AC3 5  ASP A  113 ? ASP A 113 . ? 1_555 ? 
10  AC3 5  THR A  148 ? THR A 148 . ? 1_555 ? 
11  AC3 5  THR A  186 ? THR A 186 . ? 1_555 ? 
12  AC3 5  ATP F  .   ? ATP A 407 . ? 1_555 ? 
13  AC3 5  HOH DA .   ? HOH A 656 . ? 1_555 ? 
14  AC4 24 ASP A  113 ? ASP A 113 . ? 1_555 ? 
15  AC4 24 ASP A  118 ? ASP A 118 . ? 1_555 ? 
16  AC4 24 ASN A  150 ? ASN A 150 . ? 1_555 ? 
17  AC4 24 GLU A  153 ? GLU A 153 . ? 1_555 ? 
18  AC4 24 THR A  186 ? THR A 186 . ? 1_555 ? 
19  AC4 24 SER A  187 ? SER A 187 . ? 1_555 ? 
20  AC4 24 VAL A  201 ? VAL A 201 . ? 1_555 ? 
21  AC4 24 ARG A  224 ? ARG A 224 . ? 1_555 ? 
22  AC4 24 LYS A  225 ? LYS A 225 . ? 1_555 ? 
23  AC4 24 VAL A  226 ? VAL A 226 . ? 1_555 ? 
24  AC4 24 ALA A  228 ? ALA A 228 . ? 1_555 ? 
25  AC4 24 THR A  233 ? THR A 233 . ? 1_555 ? 
26  AC4 24 GLY A  234 ? GLY A 234 . ? 1_555 ? 
27  AC4 24 LEU A  267 ? LEU A 267 . ? 1_555 ? 
28  AC4 24 MG  C  .   ? MG  A 400 . ? 1_555 ? 
29  AC4 24 MG  D  .   ? MG  A 401 . ? 1_555 ? 
30  AC4 24 NA  E  .   ? NA  A 402 . ? 1_555 ? 
31  AC4 24 PLP G  .   ? PLP A 500 . ? 1_555 ? 
32  AC4 24 MPD I  .   ? MPD A 512 . ? 1_555 ? 
33  AC4 24 HOH DA .   ? HOH A 792 . ? 1_555 ? 
34  AC4 24 HOH DA .   ? HOH A 805 . ? 1_555 ? 
35  AC4 24 HOH DA .   ? HOH A 806 . ? 1_555 ? 
36  AC4 24 HOH DA .   ? HOH A 824 . ? 1_555 ? 
37  AC4 24 HOH DA .   ? HOH A 849 . ? 1_555 ? 
38  AC5 11 SER A  12  ? SER A 12  . ? 1_555 ? 
39  AC5 11 VAL A  19  ? VAL A 19  . ? 1_555 ? 
40  AC5 11 GLY A  20  ? GLY A 20  . ? 1_555 ? 
41  AC5 11 THR A  47  ? THR A 47  . ? 1_555 ? 
42  AC5 11 VAL A  231 ? VAL A 231 . ? 1_555 ? 
43  AC5 11 GLY A  232 ? GLY A 232 . ? 1_555 ? 
44  AC5 11 THR A  233 ? THR A 233 . ? 1_555 ? 
45  AC5 11 GLY A  234 ? GLY A 234 . ? 1_555 ? 
46  AC5 11 ASP A  235 ? ASP A 235 . ? 1_555 ? 
47  AC5 11 MG  D  .   ? MG  A 401 . ? 1_555 ? 
48  AC5 11 ATP F  .   ? ATP A 407 . ? 1_555 ? 
49  AC6 3  SER A  12  ? SER A 12  . ? 1_555 ? 
50  AC6 3  THR A  47  ? THR A 47  . ? 1_555 ? 
51  AC6 3  TYR A  84  ? TYR A 84  . ? 1_555 ? 
52  AC7 5  ASP A  118 ? ASP A 118 . ? 1_555 ? 
53  AC7 5  LEU A  199 ? LEU A 199 . ? 1_555 ? 
54  AC7 5  MG  C  .   ? MG  A 400 . ? 1_555 ? 
55  AC7 5  ATP F  .   ? ATP A 407 . ? 1_555 ? 
56  AC7 5  HOH DA .   ? HOH A 822 . ? 1_555 ? 
57  AC8 4  LYS A  76  ? LYS A 76  . ? 1_555 ? 
58  AC8 4  ASP A  78  ? ASP A 78  . ? 1_555 ? 
59  AC8 4  ASN A  105 ? ASN A 105 . ? 1_555 ? 
60  AC8 4  HOH DA .   ? HOH A 907 . ? 1_555 ? 
61  AC9 1  GLU A  155 ? GLU A 155 . ? 1_555 ? 
62  BC1 4  GLN A  63  ? GLN A 63  . ? 1_555 ? 
63  BC1 4  ARG A  70  ? ARG A 70  . ? 1_555 ? 
64  BC1 4  MET A  93  ? MET A 93  . ? 1_555 ? 
65  BC1 4  GLU A  100 ? GLU A 100 . ? 1_555 ? 
66  BC2 4  CYS A  5   ? CYS A 5   . ? 1_555 ? 
67  BC2 4  LEU A  31  ? LEU A 31  . ? 1_555 ? 
68  BC2 4  GLY A  32  ? GLY A 32  . ? 1_555 ? 
69  BC2 4  LYS A  247 ? LYS A 247 . ? 1_555 ? 
70  BC3 5  ASP B  118 ? ASP B 118 . ? 1_555 ? 
71  BC3 5  ATP Q  .   ? ATP B 409 . ? 1_555 ? 
72  BC3 5  MPD U  .   ? MPD B 514 . ? 1_555 ? 
73  BC3 5  HOH EA .   ? HOH B 797 . ? 1_555 ? 
74  BC3 5  HOH EA .   ? HOH B 798 . ? 1_555 ? 
75  BC4 4  VAL B  115 ? VAL B 115 . ? 1_555 ? 
76  BC4 4  ASP B  235 ? ASP B 235 . ? 1_555 ? 
77  BC4 4  ATP Q  .   ? ATP B 409 . ? 1_555 ? 
78  BC4 4  PLP S  .   ? PLP B 500 . ? 1_555 ? 
79  BC5 7  ASP B  113 ? ASP B 113 . ? 1_555 ? 
80  BC5 7  THR B  148 ? THR B 148 . ? 1_555 ? 
81  BC5 7  PRO B  149 ? PRO B 149 . ? 1_555 ? 
82  BC5 7  ASN B  150 ? ASN B 150 . ? 1_555 ? 
83  BC5 7  THR B  186 ? THR B 186 . ? 1_555 ? 
84  BC5 7  ATP Q  .   ? ATP B 409 . ? 1_555 ? 
85  BC5 7  HOH EA .   ? HOH B 796 . ? 1_555 ? 
86  BC6 24 ASP B  113 ? ASP B 113 . ? 1_555 ? 
87  BC6 24 ASP B  118 ? ASP B 118 . ? 1_555 ? 
88  BC6 24 TYR B  127 ? TYR B 127 . ? 1_555 ? 
89  BC6 24 ASN B  150 ? ASN B 150 . ? 1_555 ? 
90  BC6 24 GLU B  153 ? GLU B 153 . ? 1_555 ? 
91  BC6 24 THR B  186 ? THR B 186 . ? 1_555 ? 
92  BC6 24 SER B  187 ? SER B 187 . ? 1_555 ? 
93  BC6 24 VAL B  201 ? VAL B 201 . ? 1_555 ? 
94  BC6 24 ARG B  224 ? ARG B 224 . ? 1_555 ? 
95  BC6 24 LYS B  225 ? LYS B 225 . ? 1_555 ? 
96  BC6 24 VAL B  226 ? VAL B 226 . ? 1_555 ? 
97  BC6 24 ALA B  228 ? ALA B 228 . ? 1_555 ? 
98  BC6 24 THR B  233 ? THR B 233 . ? 1_555 ? 
99  BC6 24 GLY B  234 ? GLY B 234 . ? 1_555 ? 
100 BC6 24 LEU B  263 ? LEU B 263 . ? 1_555 ? 
101 BC6 24 LEU B  267 ? LEU B 267 . ? 1_555 ? 
102 BC6 24 MG  N  .   ? MG  B 404 . ? 1_555 ? 
103 BC6 24 MG  O  .   ? MG  B 405 . ? 1_555 ? 
104 BC6 24 NA  P  .   ? NA  B 406 . ? 1_555 ? 
105 BC6 24 PLP S  .   ? PLP B 500 . ? 1_555 ? 
106 BC6 24 MPD U  .   ? MPD B 514 . ? 1_555 ? 
107 BC6 24 HOH EA .   ? HOH B 766 . ? 1_555 ? 
108 BC6 24 HOH EA .   ? HOH B 797 . ? 1_555 ? 
109 BC6 24 HOH EA .   ? HOH B 846 . ? 1_555 ? 
110 BC7 5  SER B  12  ? SER B 12  . ? 1_555 ? 
111 BC7 5  VAL B  19  ? VAL B 19  . ? 1_555 ? 
112 BC7 5  HIS B  46  ? HIS B 46  . ? 1_555 ? 
113 BC7 5  THR B  47  ? THR B 47  . ? 1_555 ? 
114 BC7 5  VAL B  231 ? VAL B 231 . ? 1_555 ? 
115 BC8 12 SER B  12  ? SER B 12  . ? 1_555 ? 
116 BC8 12 VAL B  19  ? VAL B 19  . ? 1_555 ? 
117 BC8 12 GLY B  20  ? GLY B 20  . ? 1_555 ? 
118 BC8 12 THR B  47  ? THR B 47  . ? 1_555 ? 
119 BC8 12 PHE B  230 ? PHE B 230 . ? 1_555 ? 
120 BC8 12 VAL B  231 ? VAL B 231 . ? 1_555 ? 
121 BC8 12 GLY B  232 ? GLY B 232 . ? 1_555 ? 
122 BC8 12 THR B  233 ? THR B 233 . ? 1_555 ? 
123 BC8 12 GLY B  234 ? GLY B 234 . ? 1_555 ? 
124 BC8 12 ASP B  235 ? ASP B 235 . ? 1_555 ? 
125 BC8 12 MG  O  .   ? MG  B 405 . ? 1_555 ? 
126 BC8 12 ATP Q  .   ? ATP B 409 . ? 1_555 ? 
127 BC9 5  ASP B  181 ? ASP B 181 . ? 1_555 ? 
128 BC9 5  ARG B  206 ? ARG B 206 . ? 1_555 ? 
129 BC9 5  ARG B  207 ? ARG B 207 . ? 1_555 ? 
130 BC9 5  ARG B  208 ? ARG B 208 . ? 1_555 ? 
131 BC9 5  HOH EA .   ? HOH B 842 . ? 1_555 ? 
132 CC1 6  ASP B  118 ? ASP B 118 . ? 1_555 ? 
133 CC1 6  LYS B  225 ? LYS B 225 . ? 1_555 ? 
134 CC1 6  MG  N  .   ? MG  B 404 . ? 1_555 ? 
135 CC1 6  ATP Q  .   ? ATP B 409 . ? 1_555 ? 
136 CC1 6  HOH EA .   ? HOH B 798 . ? 1_555 ? 
137 CC1 6  HOH EA .   ? HOH B 884 . ? 1_555 ? 
138 CC2 4  SER B  177 ? SER B 177 . ? 3_555 ? 
139 CC2 4  LEU B  312 ? LEU B 312 . ? 1_555 ? 
140 CC2 4  MPD W  .   ? MPD B 520 . ? 3_555 ? 
141 CC2 4  HOH EA .   ? HOH B 785 . ? 3_555 ? 
142 CC3 6  ASP B  173 ? ASP B 173 . ? 1_555 ? 
143 CC3 6  SER B  177 ? SER B 177 . ? 1_555 ? 
144 CC3 6  ARG B  206 ? ARG B 206 . ? 1_555 ? 
145 CC3 6  LEU B  312 ? LEU B 312 . ? 3_555 ? 
146 CC3 6  MPD V  .   ? MPD B 518 . ? 3_555 ? 
147 CC3 6  HOH EA .   ? HOH B 785 . ? 1_555 ? 
148 CC4 1  GLN B  165 ? GLN B 165 . ? 1_555 ? 
149 CC5 2  GLN B  63  ? GLN B 63  . ? 1_555 ? 
150 CC5 2  GLU B  100 ? GLU B 100 . ? 1_555 ? 
151 CC6 5  GLU B  4   ? GLU B 4   . ? 1_555 ? 
152 CC6 5  CYS B  5   ? CYS B 5   . ? 1_555 ? 
153 CC6 5  ASP B  78  ? ASP B 78  . ? 1_555 ? 
154 CC6 5  HIS B  246 ? HIS B 246 . ? 1_555 ? 
155 CC6 5  HOH EA .   ? HOH B 869 . ? 1_555 ? 
156 CC7 2  GLU B  155 ? GLU B 155 . ? 1_555 ? 
157 CC7 2  ARG B  160 ? ARG B 160 . ? 1_555 ? 
158 CC8 3  LEU B  31  ? LEU B 31  . ? 1_555 ? 
159 CC8 3  GLY B  32  ? GLY B 32  . ? 1_555 ? 
160 CC8 3  HIS B  246 ? HIS B 246 . ? 1_555 ? 
161 CC9 2  TYR B  84  ? TYR B 84  . ? 1_555 ? 
162 CC9 2  HOH EA .   ? HOH B 896 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KEU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    3KEU 
_atom_sites.fract_transf_matrix[1][1]   0.010965 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008727 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005903 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A  1 3   ? -0.701  15.572  48.843 1.00 100.00 ? 3   GLU A N     1 
ATOM   2    C  CA    . GLU A  1 3   ? -0.676  16.245  47.510 1.00 100.00 ? 3   GLU A CA    1 
ATOM   3    C  C     . GLU A  1 3   ? 0.627   15.952  46.764 1.00 98.55  ? 3   GLU A C     1 
ATOM   4    O  O     . GLU A  1 3   ? 0.609   15.479  45.618 1.00 97.25  ? 3   GLU A O     1 
ATOM   5    C  CB    . GLU A  1 3   ? -0.845  17.761  47.685 1.00 100.00 ? 3   GLU A CB    1 
ATOM   6    C  CG    . GLU A  1 3   ? -2.166  18.179  48.320 1.00 100.00 ? 3   GLU A CG    1 
ATOM   7    C  CD    . GLU A  1 3   ? -3.357  17.987  47.397 1.00 100.00 ? 3   GLU A CD    1 
ATOM   8    O  OE1   . GLU A  1 3   ? -4.507  18.141  47.875 1.00 99.06  ? 3   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A  1 3   ? -3.138  17.689  46.197 1.00 100.00 ? 3   GLU A OE2   1 
ATOM   10   N  N     . GLU A  1 4   ? 1.757   16.241  47.407 1.00 89.20  ? 4   GLU A N     1 
ATOM   11   C  CA    . GLU A  1 4   ? 3.049   15.991  46.779 1.00 80.61  ? 4   GLU A CA    1 
ATOM   12   C  C     . GLU A  1 4   ? 4.152   15.594  47.734 1.00 72.69  ? 4   GLU A C     1 
ATOM   13   O  O     . GLU A  1 4   ? 4.338   16.209  48.785 1.00 74.98  ? 4   GLU A O     1 
ATOM   14   C  CB    . GLU A  1 4   ? 3.536   17.211  46.001 1.00 85.01  ? 4   GLU A CB    1 
ATOM   15   C  CG    . GLU A  1 4   ? 2.633   17.674  44.886 1.00 91.54  ? 4   GLU A CG    1 
ATOM   16   C  CD    . GLU A  1 4   ? 1.758   18.837  45.310 1.00 100.00 ? 4   GLU A CD    1 
ATOM   17   O  OE1   . GLU A  1 4   ? 0.520   18.667  45.331 1.00 100.00 ? 4   GLU A OE1   1 
ATOM   18   O  OE2   . GLU A  1 4   ? 2.311   19.917  45.623 1.00 100.00 ? 4   GLU A OE2   1 
ATOM   19   N  N     . CYS A  1 5   ? 4.892   14.564  47.338 1.00 61.42  ? 5   CYS A N     1 
ATOM   20   C  CA    . CYS A  1 5   ? 6.021   14.082  48.108 1.00 43.76  ? 5   CYS A CA    1 
ATOM   21   C  C     . CYS A  1 5   ? 7.243   14.524  47.300 1.00 33.85  ? 5   CYS A C     1 
ATOM   22   O  O     . CYS A  1 5   ? 7.579   13.934  46.280 1.00 40.89  ? 5   CYS A O     1 
ATOM   23   C  CB    . CYS A  1 5   ? 5.969   12.569  48.218 1.00 50.68  ? 5   CYS A CB    1 
ATOM   24   S  SG    . CYS A  1 5   ? 7.173   11.956  49.374 1.00 70.43  ? 5   CYS A SG    1 
ATOM   25   N  N     . ARG A  1 6   ? 7.895   15.585  47.750 1.00 31.89  ? 6   ARG A N     1 
ATOM   26   C  CA    . ARG A  1 6   ? 9.024   16.126  47.018 1.00 34.74  ? 6   ARG A CA    1 
ATOM   27   C  C     . ARG A  1 6   ? 10.340  15.571  47.497 1.00 29.78  ? 6   ARG A C     1 
ATOM   28   O  O     . ARG A  1 6   ? 10.562  15.427  48.693 1.00 35.96  ? 6   ARG A O     1 
ATOM   29   C  CB    . ARG A  1 6   ? 9.031   17.646  47.149 1.00 39.47  ? 6   ARG A CB    1 
ATOM   30   C  CG    . ARG A  1 6   ? 7.679   18.243  46.907 1.00 28.16  ? 6   ARG A CG    1 
ATOM   31   C  CD    . ARG A  1 6   ? 7.736   19.751  46.856 1.00 38.70  ? 6   ARG A CD    1 
ATOM   32   N  NE    . ARG A  1 6   ? 6.577   20.253  46.131 1.00 47.44  ? 6   ARG A NE    1 
ATOM   33   C  CZ    . ARG A  1 6   ? 6.531   20.472  44.819 1.00 47.66  ? 6   ARG A CZ    1 
ATOM   34   N  NH1   . ARG A  1 6   ? 7.599   20.260  44.057 1.00 37.39  ? 6   ARG A NH1   1 
ATOM   35   N  NH2   . ARG A  1 6   ? 5.393   20.861  44.260 1.00 28.41  ? 6   ARG A NH2   1 
ATOM   36   N  N     . VAL A  1 7   ? 11.219  15.289  46.551 1.00 25.79  ? 7   VAL A N     1 
ATOM   37   C  CA    . VAL A  1 7   ? 12.518  14.750  46.862 1.00 28.67  ? 7   VAL A CA    1 
ATOM   38   C  C     . VAL A  1 7   ? 13.592  15.629  46.235 1.00 33.44  ? 7   VAL A C     1 
ATOM   39   O  O     . VAL A  1 7   ? 13.497  15.986  45.070 1.00 33.89  ? 7   VAL A O     1 
ATOM   40   C  CB    . VAL A  1 7   ? 12.672  13.331  46.272 1.00 33.27  ? 7   VAL A CB    1 
ATOM   41   C  CG1   . VAL A  1 7   ? 14.074  12.805  46.522 1.00 23.18  ? 7   VAL A CG1   1 
ATOM   42   C  CG2   . VAL A  1 7   ? 11.620  12.417  46.847 1.00 33.57  ? 7   VAL A CG2   1 
ATOM   43   N  N     . LEU A  1 8   ? 14.602  15.994  47.018 1.00 31.93  ? 8   LEU A N     1 
ATOM   44   C  CA    . LEU A  1 8   ? 15.717  16.780  46.489 1.00 37.84  ? 8   LEU A CA    1 
ATOM   45   C  C     . LEU A  1 8   ? 16.812  15.739  46.389 1.00 25.26  ? 8   LEU A C     1 
ATOM   46   O  O     . LEU A  1 8   ? 17.291  15.254  47.405 1.00 32.29  ? 8   LEU A O     1 
ATOM   47   C  CB    . LEU A  1 8   ? 16.147  17.883  47.456 1.00 36.19  ? 8   LEU A CB    1 
ATOM   48   C  CG    . LEU A  1 8   ? 17.368  18.648  46.940 1.00 36.48  ? 8   LEU A CG    1 
ATOM   49   C  CD1   . LEU A  1 8   ? 16.959  19.389  45.688 1.00 34.73  ? 8   LEU A CD1   1 
ATOM   50   C  CD2   . LEU A  1 8   ? 17.892  19.615  47.992 1.00 36.60  ? 8   LEU A CD2   1 
ATOM   51   N  N     . SER A  1 9   ? 17.184  15.380  45.167 1.00 31.26  ? 9   SER A N     1 
ATOM   52   C  CA    . SER A  1 9   ? 18.195  14.362  44.925 1.00 24.88  ? 9   SER A CA    1 
ATOM   53   C  C     . SER A  1 9   ? 19.447  14.995  44.311 1.00 31.06  ? 9   SER A C     1 
ATOM   54   O  O     . SER A  1 9   ? 19.418  15.488  43.190 1.00 29.31  ? 9   SER A O     1 
ATOM   55   C  CB    . SER A  1 9   ? 17.605  13.294  43.988 1.00 30.54  ? 9   SER A CB    1 
ATOM   56   O  OG    . SER A  1 9   ? 18.557  12.309  43.621 1.00 29.68  ? 9   SER A OG    1 
ATOM   57   N  N     . ILE A  1 10  ? 20.547  14.956  45.049 1.00 31.93  ? 10  ILE A N     1 
ATOM   58   C  CA    . ILE A  1 10  ? 21.809  15.556  44.621 1.00 31.98  ? 10  ILE A CA    1 
ATOM   59   C  C     . ILE A  1 10  ? 22.798  14.448  44.286 1.00 27.79  ? 10  ILE A C     1 
ATOM   60   O  O     . ILE A  1 10  ? 23.422  13.872  45.166 1.00 35.82  ? 10  ILE A O     1 
ATOM   61   C  CB    . ILE A  1 10  ? 22.369  16.437  45.753 1.00 30.98  ? 10  ILE A CB    1 
ATOM   62   C  CG1   . ILE A  1 10  ? 21.278  17.390  46.235 1.00 28.31  ? 10  ILE A CG1   1 
ATOM   63   C  CG2   . ILE A  1 10  ? 23.576  17.193  45.272 1.00 30.11  ? 10  ILE A CG2   1 
ATOM   64   C  CD1   . ILE A  1 10  ? 21.566  18.124  47.572 1.00 37.64  ? 10  ILE A CD1   1 
ATOM   65   N  N     . GLN A  1 11  ? 22.915  14.162  42.998 1.00 29.19  ? 11  GLN A N     1 
ATOM   66   C  CA    . GLN A  1 11  ? 23.766  13.093  42.490 1.00 36.64  ? 11  GLN A CA    1 
ATOM   67   C  C     . GLN A  1 11  ? 24.245  13.443  41.097 1.00 36.49  ? 11  GLN A C     1 
ATOM   68   O  O     . GLN A  1 11  ? 23.787  14.405  40.475 1.00 36.76  ? 11  GLN A O     1 
ATOM   69   C  CB    . GLN A  1 11  ? 22.980  11.767  42.373 1.00 32.06  ? 11  GLN A CB    1 
ATOM   70   C  CG    . GLN A  1 11  ? 22.172  11.370  43.583 1.00 35.08  ? 11  GLN A CG    1 
ATOM   71   C  CD    . GLN A  1 11  ? 21.578  9.980   43.461 1.00 34.51  ? 11  GLN A CD    1 
ATOM   72   O  OE1   . GLN A  1 11  ? 20.400  9.765   43.749 1.00 34.83  ? 11  GLN A OE1   1 
ATOM   73   N  NE2   . GLN A  1 11  ? 22.393  9.034   43.052 1.00 23.38  ? 11  GLN A NE2   1 
ATOM   74   N  N     . SER A  1 12  ? 25.142  12.614  40.594 1.00 30.61  ? 12  SER A N     1 
ATOM   75   C  CA    . SER A  1 12  ? 25.683  12.793  39.264 1.00 30.32  ? 12  SER A CA    1 
ATOM   76   C  C     . SER A  1 12  ? 24.634  12.705  38.158 1.00 35.27  ? 12  SER A C     1 
ATOM   77   O  O     . SER A  1 12  ? 23.551  12.110  38.329 1.00 24.38  ? 12  SER A O     1 
ATOM   78   C  CB    . SER A  1 12  ? 26.724  11.708  38.989 1.00 29.56  ? 12  SER A CB    1 
ATOM   79   O  OG    . SER A  1 12  ? 27.768  11.777  39.937 1.00 52.47  ? 12  SER A OG    1 
ATOM   80   N  N     . HIS A  1 13  ? 24.982  13.309  37.025 1.00 28.12  ? 13  HIS A N     1 
ATOM   81   C  CA    . HIS A  1 13  ? 24.171  13.236  35.840 1.00 35.24  ? 13  HIS A CA    1 
ATOM   82   C  C     . HIS A  1 13  ? 25.102  12.823  34.720 1.00 31.80  ? 13  HIS A C     1 
ATOM   83   O  O     . HIS A  1 13  ? 26.233  13.319  34.642 1.00 33.10  ? 13  HIS A O     1 
ATOM   84   C  CB    . HIS A  1 13  ? 23.542  14.578  35.478 1.00 35.11  ? 13  HIS A CB    1 
ATOM   85   C  CG    . HIS A  1 13  ? 22.800  14.547  34.177 1.00 32.06  ? 13  HIS A CG    1 
ATOM   86   N  ND1   . HIS A  1 13  ? 21.567  13.944  34.035 1.00 32.28  ? 13  HIS A ND1   1 
ATOM   87   C  CD2   . HIS A  1 13  ? 23.123  15.037  32.957 1.00 27.88  ? 13  HIS A CD2   1 
ATOM   88   C  CE1   . HIS A  1 13  ? 21.159  14.070  32.783 1.00 19.72  ? 13  HIS A CE1   1 
ATOM   89   N  NE2   . HIS A  1 13  ? 22.084  14.732  32.110 1.00 33.28  ? 13  HIS A NE2   1 
ATOM   90   N  N     . VAL A  1 14  ? 24.658  11.899  33.873 1.00 23.46  ? 14  VAL A N     1 
ATOM   91   C  CA    . VAL A  1 14  ? 25.462  11.502  32.699 1.00 25.98  ? 14  VAL A CA    1 
ATOM   92   C  C     . VAL A  1 14  ? 24.525  11.712  31.521 1.00 34.12  ? 14  VAL A C     1 
ATOM   93   O  O     . VAL A  1 14  ? 23.305  11.662  31.702 1.00 25.98  ? 14  VAL A O     1 
ATOM   94   C  CB    . VAL A  1 14  ? 25.900  9.994   32.703 1.00 34.99  ? 14  VAL A CB    1 
ATOM   95   C  CG1   . VAL A  1 14  ? 26.962  9.787   33.755 1.00 25.07  ? 14  VAL A CG1   1 
ATOM   96   C  CG2   . VAL A  1 14  ? 24.688  9.063   32.958 1.00 17.76  ? 14  VAL A CG2   1 
ATOM   97   N  N     . ILE A  1 15  ? 25.082  11.944  30.333 1.00 26.54  ? 15  ILE A N     1 
ATOM   98   C  CA    . ILE A  1 15  ? 24.282  12.157  29.133 1.00 26.18  ? 15  ILE A CA    1 
ATOM   99   C  C     . ILE A  1 15  ? 23.843  10.802  28.621 1.00 31.06  ? 15  ILE A C     1 
ATOM   100  O  O     . ILE A  1 15  ? 22.654  10.538  28.428 1.00 29.64  ? 15  ILE A O     1 
ATOM   101  C  CB    . ILE A  1 15  ? 25.084  12.905  28.051 1.00 34.16  ? 15  ILE A CB    1 
ATOM   102  C  CG1   . ILE A  1 15  ? 25.317  14.359  28.498 1.00 31.52  ? 15  ILE A CG1   1 
ATOM   103  C  CG2   . ILE A  1 15  ? 24.342  12.869  26.734 1.00 28.35  ? 15  ILE A CG2   1 
ATOM   104  C  CD1   . ILE A  1 15  ? 26.564  14.996  27.945 1.00 41.46  ? 15  ILE A CD1   1 
ATOM   105  N  N     . ARG A  1 16  ? 24.806  9.915   28.440 1.00 26.79  ? 16  ARG A N     1 
ATOM   106  C  CA    . ARG A  1 16  ? 24.476  8.585   28.005 1.00 25.11  ? 16  ARG A CA    1 
ATOM   107  C  C     . ARG A  1 16  ? 24.539  7.666   29.216 1.00 35.31  ? 16  ARG A C     1 
ATOM   108  O  O     . ARG A  1 16  ? 25.551  7.656   29.917 1.00 32.81  ? 16  ARG A O     1 
ATOM   109  C  CB    . ARG A  1 16  ? 25.473  8.079   26.957 1.00 26.98  ? 16  ARG A CB    1 
ATOM   110  C  CG    . ARG A  1 16  ? 25.359  6.561   26.715 1.00 33.87  ? 16  ARG A CG    1 
ATOM   111  C  CD    . ARG A  1 16  ? 23.995  6.201   26.117 1.00 44.04  ? 16  ARG A CD    1 
ATOM   112  N  NE    . ARG A  1 16  ? 23.826  6.911   24.853 1.00 46.02  ? 16  ARG A NE    1 
ATOM   113  C  CZ    . ARG A  1 16  ? 24.200  6.444   23.665 1.00 52.28  ? 16  ARG A CZ    1 
ATOM   114  N  NH1   . ARG A  1 16  ? 24.749  5.237   23.543 1.00 32.05  ? 16  ARG A NH1   1 
ATOM   115  N  NH2   . ARG A  1 16  ? 24.096  7.231   22.606 1.00 41.90  ? 16  ARG A NH2   1 
ATOM   116  N  N     . GLY A  1 17  ? 23.464  6.909   29.460 1.00 24.37  ? 17  GLY A N     1 
ATOM   117  C  CA    . GLY A  1 17  ? 23.465  5.955   30.544 1.00 19.27  ? 17  GLY A CA    1 
ATOM   118  C  C     . GLY A  1 17  ? 22.605  6.217   31.761 1.00 28.18  ? 17  GLY A C     1 
ATOM   119  O  O     . GLY A  1 17  ? 21.887  7.215   31.826 1.00 33.03  ? 17  GLY A O     1 
ATOM   120  N  N     . TYR A  1 18  ? 22.692  5.311   32.736 1.00 25.50  ? 18  TYR A N     1 
ATOM   121  C  CA    . TYR A  1 18  ? 21.924  5.432   33.961 1.00 30.76  ? 18  TYR A CA    1 
ATOM   122  C  C     . TYR A  1 18  ? 22.673  5.246   35.288 1.00 28.38  ? 18  TYR A C     1 
ATOM   123  O  O     . TYR A  1 18  ? 22.754  4.141   35.812 1.00 36.48  ? 18  TYR A O     1 
ATOM   124  C  CB    . TYR A  1 18  ? 20.741  4.463   33.914 1.00 28.71  ? 18  TYR A CB    1 
ATOM   125  C  CG    . TYR A  1 18  ? 19.845  4.731   32.745 1.00 38.11  ? 18  TYR A CG    1 
ATOM   126  C  CD1   . TYR A  1 18  ? 20.052  4.099   31.524 1.00 35.09  ? 18  TYR A CD1   1 
ATOM   127  C  CD2   . TYR A  1 18  ? 18.870  5.725   32.816 1.00 30.79  ? 18  TYR A CD2   1 
ATOM   128  C  CE1   . TYR A  1 18  ? 19.312  4.460   30.387 1.00 34.36  ? 18  TYR A CE1   1 
ATOM   129  C  CE2   . TYR A  1 18  ? 18.134  6.089   31.694 1.00 33.40  ? 18  TYR A CE2   1 
ATOM   130  C  CZ    . TYR A  1 18  ? 18.363  5.458   30.481 1.00 29.48  ? 18  TYR A CZ    1 
ATOM   131  O  OH    . TYR A  1 18  ? 17.659  5.854   29.358 1.00 40.79  ? 18  TYR A OH    1 
ATOM   132  N  N     . VAL A  1 19  ? 23.201  6.337   35.833 1.00 31.62  ? 19  VAL A N     1 
ATOM   133  C  CA    . VAL A  1 19  ? 23.872  6.313   37.135 1.00 30.20  ? 19  VAL A CA    1 
ATOM   134  C  C     . VAL A  1 19  ? 23.421  7.566   37.900 1.00 33.15  ? 19  VAL A C     1 
ATOM   135  O  O     . VAL A  1 19  ? 22.945  8.551   37.310 1.00 32.67  ? 19  VAL A O     1 
ATOM   136  C  CB    . VAL A  1 19  ? 25.390  6.312   36.983 1.00 34.39  ? 19  VAL A CB    1 
ATOM   137  C  CG1   . VAL A  1 19  ? 25.807  5.093   36.194 1.00 32.89  ? 19  VAL A CG1   1 
ATOM   138  C  CG2   . VAL A  1 19  ? 25.853  7.590   36.285 1.00 30.87  ? 19  VAL A CG2   1 
ATOM   139  N  N     . GLY A  1 20  ? 23.555  7.528   39.213 1.00 30.06  ? 20  GLY A N     1 
ATOM   140  C  CA    . GLY A  1 20  ? 23.145  8.662   40.021 1.00 21.69  ? 20  GLY A CA    1 
ATOM   141  C  C     . GLY A  1 20  ? 21.740  9.165   39.715 1.00 40.41  ? 20  GLY A C     1 
ATOM   142  O  O     . GLY A  1 20  ? 20.782  8.393   39.740 1.00 26.08  ? 20  GLY A O     1 
ATOM   143  N  N     . ASN A  1 21  ? 21.614  10.463  39.439 1.00 33.96  ? 21  ASN A N     1 
ATOM   144  C  CA    . ASN A  1 21  ? 20.326  11.046  39.147 1.00 34.52  ? 21  ASN A CA    1 
ATOM   145  C  C     . ASN A  1 21  ? 19.626  10.442  37.934 1.00 34.69  ? 21  ASN A C     1 
ATOM   146  O  O     . ASN A  1 21  ? 18.389  10.453  37.857 1.00 21.95  ? 21  ASN A O     1 
ATOM   147  C  CB    . ASN A  1 21  ? 20.466  12.560  38.999 1.00 36.78  ? 21  ASN A CB    1 
ATOM   148  C  CG    . ASN A  1 21  ? 20.219  13.277  40.293 1.00 32.41  ? 21  ASN A CG    1 
ATOM   149  O  OD1   . ASN A  1 21  ? 20.772  14.352  40.550 1.00 39.27  ? 21  ASN A OD1   1 
ATOM   150  N  ND2   . ASN A  1 21  ? 19.379  12.687  41.133 1.00 23.93  ? 21  ASN A ND2   1 
ATOM   151  N  N     . ARG A  1 22  ? 20.405  9.918   36.990 1.00 28.07  ? 22  ARG A N     1 
ATOM   152  C  CA    . ARG A  1 22  ? 19.813  9.259   35.821 1.00 34.41  ? 22  ARG A CA    1 
ATOM   153  C  C     . ARG A  1 22  ? 19.164  7.939   36.218 1.00 38.21  ? 22  ARG A C     1 
ATOM   154  O  O     . ARG A  1 22  ? 18.145  7.552   35.643 1.00 28.14  ? 22  ARG A O     1 
ATOM   155  C  CB    . ARG A  1 22  ? 20.866  9.006   34.734 1.00 29.31  ? 22  ARG A CB    1 
ATOM   156  C  CG    . ARG A  1 22  ? 21.184  10.272  33.918 1.00 26.40  ? 22  ARG A CG    1 
ATOM   157  C  CD    . ARG A  1 22  ? 20.063  10.558  32.923 1.00 22.45  ? 22  ARG A CD    1 
ATOM   158  N  NE    . ARG A  1 22  ? 20.110  9.608   31.817 1.00 28.75  ? 22  ARG A NE    1 
ATOM   159  C  CZ    . ARG A  1 22  ? 19.381  9.680   30.709 1.00 32.66  ? 22  ARG A CZ    1 
ATOM   160  N  NH1   . ARG A  1 22  ? 18.506  10.657  30.533 1.00 30.85  ? 22  ARG A NH1   1 
ATOM   161  N  NH2   . ARG A  1 22  ? 19.601  8.813   29.737 1.00 29.15  ? 22  ARG A NH2   1 
ATOM   162  N  N     . ALA A  1 23  ? 19.752  7.239   37.192 1.00 27.92  ? 23  ALA A N     1 
ATOM   163  C  CA    . ALA A  1 23  ? 19.176  5.971   37.646 1.00 23.13  ? 23  ALA A CA    1 
ATOM   164  C  C     . ALA A  1 23  ? 18.040  6.207   38.635 1.00 27.01  ? 23  ALA A C     1 
ATOM   165  O  O     . ALA A  1 23  ? 17.111  5.406   38.743 1.00 33.44  ? 23  ALA A O     1 
ATOM   166  C  CB    . ALA A  1 23  ? 20.261  5.094   38.304 1.00 36.97  ? 23  ALA A CB    1 
ATOM   167  N  N     . ALA A  1 24  ? 18.099  7.328   39.339 1.00 26.18  ? 24  ALA A N     1 
ATOM   168  C  CA    . ALA A  1 24  ? 17.096  7.645   40.355 1.00 29.53  ? 24  ALA A CA    1 
ATOM   169  C  C     . ALA A  1 24  ? 15.837  8.410   39.932 1.00 23.20  ? 24  ALA A C     1 
ATOM   170  O  O     . ALA A  1 24  ? 14.772  8.217   40.523 1.00 31.41  ? 24  ALA A O     1 
ATOM   171  C  CB    . ALA A  1 24  ? 17.771  8.439   41.487 1.00 27.86  ? 24  ALA A CB    1 
ATOM   172  N  N     . THR A  1 25  ? 15.969  9.286   38.940 1.00 27.85  ? 25  THR A N     1 
ATOM   173  C  CA    . THR A  1 25  ? 14.864  10.157  38.558 1.00 28.80  ? 25  THR A CA    1 
ATOM   174  C  C     . THR A  1 25  ? 13.666  9.510   37.890 1.00 30.47  ? 25  THR A C     1 
ATOM   175  O  O     . THR A  1 25  ? 12.549  9.553   38.440 1.00 33.93  ? 25  THR A O     1 
ATOM   176  C  CB    . THR A  1 25  ? 15.383  11.364  37.722 1.00 23.29  ? 25  THR A CB    1 
ATOM   177  O  OG1   . THR A  1 25  ? 16.372  12.061  38.490 1.00 27.94  ? 25  THR A OG1   1 
ATOM   178  C  CG2   . THR A  1 25  ? 14.260  12.359  37.437 1.00 17.77  ? 25  THR A CG2   1 
ATOM   179  N  N     . PHE A  1 26  ? 13.879  8.916   36.722 1.00 28.54  ? 26  PHE A N     1 
ATOM   180  C  CA    . PHE A  1 26  ? 12.785  8.274   36.008 1.00 31.93  ? 26  PHE A CA    1 
ATOM   181  C  C     . PHE A  1 26  ? 11.976  7.356   36.938 1.00 34.44  ? 26  PHE A C     1 
ATOM   182  O  O     . PHE A  1 26  ? 10.743  7.452   37.008 1.00 30.67  ? 26  PHE A O     1 
ATOM   183  C  CB    . PHE A  1 26  ? 13.327  7.488   34.808 1.00 36.46  ? 26  PHE A CB    1 
ATOM   184  C  CG    . PHE A  1 26  ? 12.266  6.785   34.009 1.00 31.28  ? 26  PHE A CG    1 
ATOM   185  C  CD1   . PHE A  1 26  ? 11.292  7.517   33.313 1.00 33.08  ? 26  PHE A CD1   1 
ATOM   186  C  CD2   . PHE A  1 26  ? 12.208  5.386   33.995 1.00 24.84  ? 26  PHE A CD2   1 
ATOM   187  C  CE1   . PHE A  1 26  ? 10.260  6.872   32.606 1.00 27.88  ? 26  PHE A CE1   1 
ATOM   188  C  CE2   . PHE A  1 26  ? 11.174  4.720   33.293 1.00 37.62  ? 26  PHE A CE2   1 
ATOM   189  C  CZ    . PHE A  1 26  ? 10.197  5.463   32.594 1.00 25.86  ? 26  PHE A CZ    1 
ATOM   190  N  N     . PRO A  1 27  ? 12.658  6.483   37.703 1.00 29.63  ? 27  PRO A N     1 
ATOM   191  C  CA    . PRO A  1 27  ? 11.947  5.572   38.614 1.00 28.96  ? 27  PRO A CA    1 
ATOM   192  C  C     . PRO A  1 27  ? 11.047  6.266   39.609 1.00 30.87  ? 27  PRO A C     1 
ATOM   193  O  O     . PRO A  1 27  ? 9.892   5.892   39.794 1.00 35.48  ? 27  PRO A O     1 
ATOM   194  C  CB    . PRO A  1 27  ? 13.063  4.822   39.311 1.00 27.94  ? 27  PRO A CB    1 
ATOM   195  C  CG    . PRO A  1 27  ? 14.179  4.832   38.311 1.00 31.65  ? 27  PRO A CG    1 
ATOM   196  C  CD    . PRO A  1 27  ? 14.104  6.203   37.678 1.00 23.78  ? 27  PRO A CD    1 
ATOM   197  N  N     . LEU A  1 28  ? 11.594  7.269   40.279 1.00 31.35  ? 28  LEU A N     1 
ATOM   198  C  CA    . LEU A  1 28  ? 10.825  8.011   41.255 1.00 33.00  ? 28  LEU A CA    1 
ATOM   199  C  C     . LEU A  1 28  ? 9.666   8.787   40.590 1.00 27.50  ? 28  LEU A C     1 
ATOM   200  O  O     . LEU A  1 28  ? 8.577   8.841   41.135 1.00 34.96  ? 28  LEU A O     1 
ATOM   201  C  CB    . LEU A  1 28  ? 11.771  8.941   42.018 1.00 29.07  ? 28  LEU A CB    1 
ATOM   202  C  CG    . LEU A  1 28  ? 12.633  8.161   43.016 1.00 31.51  ? 28  LEU A CG    1 
ATOM   203  C  CD1   . LEU A  1 28  ? 13.863  8.971   43.469 1.00 36.65  ? 28  LEU A CD1   1 
ATOM   204  C  CD2   . LEU A  1 28  ? 11.763  7.807   44.193 1.00 23.44  ? 28  LEU A CD2   1 
ATOM   205  N  N     . GLN A  1 29  ? 9.903   9.377   39.419 1.00 27.08  ? 29  GLN A N     1 
ATOM   206  C  CA    . GLN A  1 29  ? 8.846   10.111  38.720 1.00 31.24  ? 29  GLN A CA    1 
ATOM   207  C  C     . GLN A  1 29  ? 7.726   9.151   38.348 1.00 30.37  ? 29  GLN A C     1 
ATOM   208  O  O     . GLN A  1 29  ? 6.549   9.475   38.483 1.00 32.92  ? 29  GLN A O     1 
ATOM   209  C  CB    . GLN A  1 29  ? 9.386   10.778  37.452 1.00 26.51  ? 29  GLN A CB    1 
ATOM   210  C  CG    . GLN A  1 29  ? 10.444  11.827  37.735 1.00 33.74  ? 29  GLN A CG    1 
ATOM   211  C  CD    . GLN A  1 29  ? 10.970  12.452  36.473 1.00 33.16  ? 29  GLN A CD    1 
ATOM   212  O  OE1   . GLN A  1 29  ? 11.358  11.750  35.545 1.00 27.91  ? 29  GLN A OE1   1 
ATOM   213  N  NE2   . GLN A  1 29  ? 10.988  13.778  36.424 1.00 34.11  ? 29  GLN A NE2   1 
ATOM   214  N  N     . VAL A  1 30  ? 8.109   7.968   37.875 1.00 31.62  ? 30  VAL A N     1 
ATOM   215  C  CA    . VAL A  1 30  ? 7.147   6.947   37.509 1.00 32.60  ? 30  VAL A CA    1 
ATOM   216  C  C     . VAL A  1 30  ? 6.279   6.588   38.727 1.00 40.36  ? 30  VAL A C     1 
ATOM   217  O  O     . VAL A  1 30  ? 5.089   6.303   38.586 1.00 32.98  ? 30  VAL A O     1 
ATOM   218  C  CB    . VAL A  1 30  ? 7.872   5.684   36.952 1.00 28.26  ? 30  VAL A CB    1 
ATOM   219  C  CG1   . VAL A  1 30  ? 6.971   4.462   37.024 1.00 29.91  ? 30  VAL A CG1   1 
ATOM   220  C  CG2   . VAL A  1 30  ? 8.266   5.911   35.498 1.00 28.91  ? 30  VAL A CG2   1 
ATOM   221  N  N     . LEU A  1 31  ? 6.864   6.624   39.924 1.00 35.19  ? 31  LEU A N     1 
ATOM   222  C  CA    . LEU A  1 31  ? 6.101   6.289   41.121 1.00 35.71  ? 31  LEU A CA    1 
ATOM   223  C  C     . LEU A  1 31  ? 5.346   7.474   41.709 1.00 35.80  ? 31  LEU A C     1 
ATOM   224  O  O     . LEU A  1 31  ? 4.809   7.391   42.810 1.00 36.32  ? 31  LEU A O     1 
ATOM   225  C  CB    . LEU A  1 31  ? 7.012   5.618   42.169 1.00 29.61  ? 31  LEU A CB    1 
ATOM   226  C  CG    . LEU A  1 31  ? 7.438   4.205   41.706 1.00 39.62  ? 31  LEU A CG    1 
ATOM   227  C  CD1   . LEU A  1 31  ? 8.487   3.600   42.607 1.00 30.28  ? 31  LEU A CD1   1 
ATOM   228  C  CD2   . LEU A  1 31  ? 6.200   3.312   41.649 1.00 37.68  ? 31  LEU A CD2   1 
ATOM   229  N  N     . GLY A  1 32  ? 5.320   8.582   40.969 1.00 36.59  ? 32  GLY A N     1 
ATOM   230  C  CA    . GLY A  1 32  ? 4.582   9.759   41.403 1.00 31.30  ? 32  GLY A CA    1 
ATOM   231  C  C     . GLY A  1 32  ? 5.242   10.768  42.323 1.00 38.77  ? 32  GLY A C     1 
ATOM   232  O  O     . GLY A  1 32  ? 4.558   11.632  42.882 1.00 33.88  ? 32  GLY A O     1 
ATOM   233  N  N     . PHE A  1 33  ? 6.555   10.686  42.490 1.00 25.46  ? 33  PHE A N     1 
ATOM   234  C  CA    . PHE A  1 33  ? 7.239   11.629  43.365 1.00 32.97  ? 33  PHE A CA    1 
ATOM   235  C  C     . PHE A  1 33  ? 7.692   12.868  42.599 1.00 29.87  ? 33  PHE A C     1 
ATOM   236  O  O     . PHE A  1 33  ? 8.152   12.760  41.456 1.00 30.55  ? 33  PHE A O     1 
ATOM   237  C  CB    . PHE A  1 33  ? 8.493   10.981  44.016 1.00 32.98  ? 33  PHE A CB    1 
ATOM   238  C  CG    . PHE A  1 33  ? 8.185   9.894   45.024 1.00 28.69  ? 33  PHE A CG    1 
ATOM   239  C  CD1   . PHE A  1 33  ? 7.878   8.596   44.604 1.00 24.48  ? 33  PHE A CD1   1 
ATOM   240  C  CD2   . PHE A  1 33  ? 8.206   10.168  46.392 1.00 28.25  ? 33  PHE A CD2   1 
ATOM   241  C  CE1   . PHE A  1 33  ? 7.599   7.584   45.545 1.00 30.95  ? 33  PHE A CE1   1 
ATOM   242  C  CE2   . PHE A  1 33  ? 7.925   9.164   47.336 1.00 32.21  ? 33  PHE A CE2   1 
ATOM   243  C  CZ    . PHE A  1 33  ? 7.620   7.870   46.906 1.00 27.57  ? 33  PHE A CZ    1 
ATOM   244  N  N     . GLU A  1 34  ? 7.560   14.037  43.228 1.00 27.88  ? 34  GLU A N     1 
ATOM   245  C  CA    . GLU A  1 34  ? 8.045   15.272  42.628 1.00 31.22  ? 34  GLU A CA    1 
ATOM   246  C  C     . GLU A  1 34  ? 9.533   15.312  42.983 1.00 30.12  ? 34  GLU A C     1 
ATOM   247  O  O     . GLU A  1 34  ? 9.940   15.957  43.937 1.00 34.39  ? 34  GLU A O     1 
ATOM   248  C  CB    . GLU A  1 34  ? 7.375   16.501  43.240 1.00 23.41  ? 34  GLU A CB    1 
ATOM   249  C  CG    . GLU A  1 34  ? 5.929   16.701  42.891 1.00 35.98  ? 34  GLU A CG    1 
ATOM   250  C  CD    . GLU A  1 34  ? 5.744   17.066  41.446 1.00 35.04  ? 34  GLU A CD    1 
ATOM   251  O  OE1   . GLU A  1 34  ? 6.739   17.431  40.786 1.00 42.26  ? 34  GLU A OE1   1 
ATOM   252  O  OE2   . GLU A  1 34  ? 4.606   16.997  40.968 1.00 47.55  ? 34  GLU A OE2   1 
ATOM   253  N  N     . ILE A  1 35  ? 10.346  14.581  42.243 1.00 31.76  ? 35  ILE A N     1 
ATOM   254  C  CA    . ILE A  1 35  ? 11.761  14.605  42.523 1.00 33.19  ? 35  ILE A CA    1 
ATOM   255  C  C     . ILE A  1 35  ? 12.436  15.681  41.677 1.00 34.48  ? 35  ILE A C     1 
ATOM   256  O  O     . ILE A  1 35  ? 12.196  15.799  40.469 1.00 32.15  ? 35  ILE A O     1 
ATOM   257  C  CB    . ILE A  1 35  ? 12.431  13.221  42.273 1.00 36.86  ? 35  ILE A CB    1 
ATOM   258  C  CG1   . ILE A  1 35  ? 13.963  13.393  42.226 1.00 22.64  ? 35  ILE A CG1   1 
ATOM   259  C  CG2   . ILE A  1 35  ? 11.869  12.578  40.985 1.00 23.57  ? 35  ILE A CG2   1 
ATOM   260  C  CD1   . ILE A  1 35  ? 14.744  12.071  42.164 1.00 31.21  ? 35  ILE A CD1   1 
ATOM   261  N  N     . ASP A  1 36  ? 13.249  16.478  42.365 1.00 36.54  ? 36  ASP A N     1 
ATOM   262  C  CA    . ASP A  1 36  ? 14.015  17.575  41.790 1.00 29.67  ? 36  ASP A CA    1 
ATOM   263  C  C     . ASP A  1 36  ? 15.443  17.057  41.781 1.00 27.35  ? 36  ASP A C     1 
ATOM   264  O  O     . ASP A  1 36  ? 15.944  16.582  42.811 1.00 35.57  ? 36  ASP A O     1 
ATOM   265  C  CB    . ASP A  1 36  ? 13.915  18.831  42.676 1.00 25.67  ? 36  ASP A CB    1 
ATOM   266  C  CG    . ASP A  1 36  ? 12.501  19.437  42.700 1.00 37.05  ? 36  ASP A CG    1 
ATOM   267  O  OD1   . ASP A  1 36  ? 11.653  18.999  41.899 1.00 36.88  ? 36  ASP A OD1   1 
ATOM   268  O  OD2   . ASP A  1 36  ? 12.241  20.367  43.502 1.00 35.12  ? 36  ASP A OD2   1 
ATOM   269  N  N     . ALA A  1 37  ? 16.092  17.161  40.628 1.00 26.25  ? 37  ALA A N     1 
ATOM   270  C  CA    . ALA A  1 37  ? 17.453  16.672  40.442 1.00 22.47  ? 37  ALA A CA    1 
ATOM   271  C  C     . ALA A  1 37  ? 18.530  17.752  40.406 1.00 31.65  ? 37  ALA A C     1 
ATOM   272  O  O     . ALA A  1 37  ? 18.561  18.594  39.514 1.00 44.60  ? 37  ALA A O     1 
ATOM   273  C  CB    . ALA A  1 37  ? 17.523  15.859  39.149 1.00 19.34  ? 37  ALA A CB    1 
ATOM   274  N  N     . VAL A  1 38  ? 19.416  17.724  41.383 1.00 36.18  ? 38  VAL A N     1 
ATOM   275  C  CA    . VAL A  1 38  ? 20.517  18.663  41.412 1.00 29.77  ? 38  VAL A CA    1 
ATOM   276  C  C     . VAL A  1 38  ? 21.637  17.810  40.891 1.00 31.78  ? 38  VAL A C     1 
ATOM   277  O  O     . VAL A  1 38  ? 21.995  16.802  41.512 1.00 38.13  ? 38  VAL A O     1 
ATOM   278  C  CB    . VAL A  1 38  ? 20.832  19.148  42.858 1.00 40.20  ? 38  VAL A CB    1 
ATOM   279  C  CG1   . VAL A  1 38  ? 22.066  20.041  42.865 1.00 25.28  ? 38  VAL A CG1   1 
ATOM   280  C  CG2   . VAL A  1 38  ? 19.640  19.905  43.426 1.00 29.73  ? 38  VAL A CG2   1 
ATOM   281  N  N     . ASN A  1 39  ? 22.205  18.193  39.756 1.00 26.19  ? 39  ASN A N     1 
ATOM   282  C  CA    . ASN A  1 39  ? 23.262  17.379  39.177 1.00 31.86  ? 39  ASN A CA    1 
ATOM   283  C  C     . ASN A  1 39  ? 24.627  17.803  39.664 1.00 32.84  ? 39  ASN A C     1 
ATOM   284  O  O     . ASN A  1 39  ? 25.135  18.838  39.242 1.00 26.61  ? 39  ASN A O     1 
ATOM   285  C  CB    . ASN A  1 39  ? 23.193  17.435  37.650 1.00 33.69  ? 39  ASN A CB    1 
ATOM   286  C  CG    . ASN A  1 39  ? 21.847  16.991  37.127 1.00 34.78  ? 39  ASN A CG    1 
ATOM   287  O  OD1   . ASN A  1 39  ? 21.288  16.003  37.604 1.00 34.70  ? 39  ASN A OD1   1 
ATOM   288  N  ND2   . ASN A  1 39  ? 21.315  17.717  36.150 1.00 28.22  ? 39  ASN A ND2   1 
ATOM   289  N  N     . SER A  1 40  ? 25.202  16.985  40.549 1.00 36.40  ? 40  SER A N     1 
ATOM   290  C  CA    . SER A  1 40  ? 26.524  17.240  41.135 1.00 41.34  ? 40  SER A CA    1 
ATOM   291  C  C     . SER A  1 40  ? 27.662  17.263  40.109 1.00 35.55  ? 40  SER A C     1 
ATOM   292  O  O     . SER A  1 40  ? 28.726  17.803  40.383 1.00 49.18  ? 40  SER A O     1 
ATOM   293  C  CB    . SER A  1 40  ? 26.819  16.211  42.216 1.00 34.71  ? 40  SER A CB    1 
ATOM   294  O  OG    . SER A  1 40  ? 26.805  14.908  41.679 1.00 33.40  ? 40  SER A OG    1 
ATOM   295  N  N     . VAL A  1 41  ? 27.449  16.632  38.956 1.00 35.51  ? 41  VAL A N     1 
ATOM   296  C  CA    . VAL A  1 41  ? 28.412  16.640  37.843 1.00 38.06  ? 41  VAL A CA    1 
ATOM   297  C  C     . VAL A  1 41  ? 27.580  16.356  36.595 1.00 39.06  ? 41  VAL A C     1 
ATOM   298  O  O     . VAL A  1 41  ? 26.426  15.940  36.693 1.00 30.17  ? 41  VAL A O     1 
ATOM   299  C  CB    . VAL A  1 41  ? 29.518  15.526  37.913 1.00 34.11  ? 41  VAL A CB    1 
ATOM   300  C  CG1   . VAL A  1 41  ? 30.161  15.482  39.293 1.00 30.96  ? 41  VAL A CG1   1 
ATOM   301  C  CG2   . VAL A  1 41  ? 28.941  14.182  37.503 1.00 27.79  ? 41  VAL A CG2   1 
ATOM   302  N  N     . GLN A  1 42  ? 28.159  16.616  35.436 1.00 35.91  ? 42  GLN A N     1 
ATOM   303  C  CA    . GLN A  1 42  ? 27.500  16.325  34.175 1.00 39.47  ? 42  GLN A CA    1 
ATOM   304  C  C     . GLN A  1 42  ? 28.579  15.698  33.321 1.00 28.78  ? 42  GLN A C     1 
ATOM   305  O  O     . GLN A  1 42  ? 29.444  16.393  32.787 1.00 41.86  ? 42  GLN A O     1 
ATOM   306  C  CB    . GLN A  1 42  ? 26.945  17.583  33.473 1.00 28.40  ? 42  GLN A CB    1 
ATOM   307  C  CG    . GLN A  1 42  ? 26.529  17.293  32.002 1.00 28.35  ? 42  GLN A CG    1 
ATOM   308  C  CD    . GLN A  1 42  ? 25.527  18.282  31.434 1.00 35.10  ? 42  GLN A CD    1 
ATOM   309  O  OE1   . GLN A  1 42  ? 25.711  19.501  31.503 1.00 42.94  ? 42  GLN A OE1   1 
ATOM   310  N  NE2   . GLN A  1 42  ? 24.458  17.758  30.862 1.00 26.03  ? 42  GLN A NE2   1 
ATOM   311  N  N     . PHE A  1 43  ? 28.528  14.379  33.205 1.00 30.65  ? 43  PHE A N     1 
ATOM   312  C  CA    . PHE A  1 43  ? 29.508  13.654  32.418 1.00 31.83  ? 43  PHE A CA    1 
ATOM   313  C  C     . PHE A  1 43  ? 28.913  13.026  31.182 1.00 37.59  ? 43  PHE A C     1 
ATOM   314  O  O     . PHE A  1 43  ? 27.699  12.769  31.128 1.00 34.70  ? 43  PHE A O     1 
ATOM   315  C  CB    . PHE A  1 43  ? 30.157  12.579  33.283 1.00 41.00  ? 43  PHE A CB    1 
ATOM   316  C  CG    . PHE A  1 43  ? 31.335  13.071  34.063 1.00 47.85  ? 43  PHE A CG    1 
ATOM   317  C  CD1   . PHE A  1 43  ? 31.308  14.317  34.676 1.00 46.14  ? 43  PHE A CD1   1 
ATOM   318  C  CD2   . PHE A  1 43  ? 32.476  12.291  34.186 1.00 66.41  ? 43  PHE A CD2   1 
ATOM   319  C  CE1   . PHE A  1 43  ? 32.394  14.781  35.396 1.00 55.55  ? 43  PHE A CE1   1 
ATOM   320  C  CE2   . PHE A  1 43  ? 33.574  12.747  34.910 1.00 66.88  ? 43  PHE A CE2   1 
ATOM   321  C  CZ    . PHE A  1 43  ? 33.531  13.994  35.515 1.00 62.39  ? 43  PHE A CZ    1 
ATOM   322  N  N     . SER A  1 44  ? 29.760  12.785  30.178 1.00 34.03  ? 44  SER A N     1 
ATOM   323  C  CA    . SER A  1 44  ? 29.285  12.169  28.955 1.00 36.96  ? 44  SER A CA    1 
ATOM   324  C  C     . SER A  1 44  ? 28.689  10.792  29.274 1.00 40.65  ? 44  SER A C     1 
ATOM   325  O  O     . SER A  1 44  ? 27.668  10.383  28.704 1.00 45.82  ? 44  SER A O     1 
ATOM   326  C  CB    . SER A  1 44  ? 30.415  12.049  27.921 1.00 34.65  ? 44  SER A CB    1 
ATOM   327  O  OG    . SER A  1 44  ? 31.477  11.232  28.377 1.00 36.59  ? 44  SER A OG    1 
ATOM   328  N  N     . ASN A  1 45  ? 29.298  10.117  30.240 1.00 38.77  ? 45  ASN A N     1 
ATOM   329  C  CA    . ASN A  1 45  ? 28.891  8.774   30.616 1.00 30.22  ? 45  ASN A CA    1 
ATOM   330  C  C     . ASN A  1 45  ? 29.621  8.419   31.910 1.00 40.07  ? 45  ASN A C     1 
ATOM   331  O  O     . ASN A  1 45  ? 30.505  9.172   32.331 1.00 34.85  ? 45  ASN A O     1 
ATOM   332  C  CB    . ASN A  1 45  ? 29.291  7.832   29.475 1.00 32.28  ? 45  ASN A CB    1 
ATOM   333  C  CG    . ASN A  1 45  ? 30.712  8.096   28.988 1.00 33.43  ? 45  ASN A CG    1 
ATOM   334  O  OD1   . ASN A  1 45  ? 31.672  7.706   29.632 1.00 37.17  ? 45  ASN A OD1   1 
ATOM   335  N  ND2   . ASN A  1 45  ? 30.844  8.790   27.868 1.00 32.87  ? 45  ASN A ND2   1 
ATOM   336  N  N     . HIS A  1 46  ? 29.277  7.287   32.532 1.00 32.55  ? 46  HIS A N     1 
ATOM   337  C  CA    . HIS A  1 46  ? 29.927  6.894   33.779 1.00 41.85  ? 46  HIS A CA    1 
ATOM   338  C  C     . HIS A  1 46  ? 31.386  6.506   33.576 1.00 42.10  ? 46  HIS A C     1 
ATOM   339  O  O     . HIS A  1 46  ? 31.792  6.154   32.470 1.00 38.07  ? 46  HIS A O     1 
ATOM   340  C  CB    . HIS A  1 46  ? 29.147  5.775   34.521 1.00 32.02  ? 46  HIS A CB    1 
ATOM   341  C  CG    . HIS A  1 46  ? 29.192  4.422   33.870 1.00 33.23  ? 46  HIS A CG    1 
ATOM   342  N  ND1   . HIS A  1 46  ? 30.372  3.756   33.609 1.00 32.58  ? 46  HIS A ND1   1 
ATOM   343  C  CD2   . HIS A  1 46  ? 28.194  3.573   33.513 1.00 32.84  ? 46  HIS A CD2   1 
ATOM   344  C  CE1   . HIS A  1 46  ? 30.102  2.558   33.122 1.00 30.03  ? 46  HIS A CE1   1 
ATOM   345  N  NE2   . HIS A  1 46  ? 28.787  2.421   33.056 1.00 37.73  ? 46  HIS A NE2   1 
ATOM   346  N  N     . THR A  1 47  ? 32.162  6.574   34.660 1.00 48.26  ? 47  THR A N     1 
ATOM   347  C  CA    . THR A  1 47  ? 33.599  6.293   34.629 1.00 50.03  ? 47  THR A CA    1 
ATOM   348  C  C     . THR A  1 47  ? 33.996  4.838   34.418 1.00 49.71  ? 47  THR A C     1 
ATOM   349  O  O     . THR A  1 47  ? 35.175  4.494   34.459 1.00 50.99  ? 47  THR A O     1 
ATOM   350  C  CB    . THR A  1 47  ? 34.283  6.815   35.920 1.00 52.23  ? 47  THR A CB    1 
ATOM   351  O  OG1   . THR A  1 47  ? 33.746  6.130   37.053 1.00 62.85  ? 47  THR A OG1   1 
ATOM   352  C  CG2   . THR A  1 47  ? 34.047  8.326   36.085 1.00 39.04  ? 47  THR A CG2   1 
ATOM   353  N  N     . GLY A  1 48  ? 33.013  3.981   34.181 1.00 46.29  ? 48  GLY A N     1 
ATOM   354  C  CA    . GLY A  1 48  ? 33.318  2.587   33.945 1.00 34.70  ? 48  GLY A CA    1 
ATOM   355  C  C     . GLY A  1 48  ? 33.737  2.385   32.499 1.00 52.01  ? 48  GLY A C     1 
ATOM   356  O  O     . GLY A  1 48  ? 34.193  1.304   32.115 1.00 54.66  ? 48  GLY A O     1 
ATOM   357  N  N     . TYR A  1 49  ? 33.577  3.425   31.683 1.00 45.29  ? 49  TYR A N     1 
ATOM   358  C  CA    . TYR A  1 49  ? 33.951  3.347   30.272 1.00 46.84  ? 49  TYR A CA    1 
ATOM   359  C  C     . TYR A  1 49  ? 35.429  3.675   30.033 1.00 46.19  ? 49  TYR A C     1 
ATOM   360  O  O     . TYR A  1 49  ? 36.093  4.268   30.886 1.00 51.08  ? 49  TYR A O     1 
ATOM   361  C  CB    . TYR A  1 49  ? 33.110  4.316   29.431 1.00 46.38  ? 49  TYR A CB    1 
ATOM   362  C  CG    . TYR A  1 49  ? 31.666  3.923   29.248 1.00 38.38  ? 49  TYR A CG    1 
ATOM   363  C  CD1   . TYR A  1 49  ? 30.705  4.236   30.216 1.00 33.29  ? 49  TYR A CD1   1 
ATOM   364  C  CD2   . TYR A  1 49  ? 31.252  3.255   28.092 1.00 44.78  ? 49  TYR A CD2   1 
ATOM   365  C  CE1   . TYR A  1 49  ? 29.349  3.897   30.032 1.00 39.07  ? 49  TYR A CE1   1 
ATOM   366  C  CE2   . TYR A  1 49  ? 29.913  2.912   27.897 1.00 47.26  ? 49  TYR A CE2   1 
ATOM   367  C  CZ    . TYR A  1 49  ? 28.967  3.239   28.871 1.00 46.91  ? 49  TYR A CZ    1 
ATOM   368  O  OH    . TYR A  1 49  ? 27.646  2.929   28.669 1.00 42.31  ? 49  TYR A OH    1 
ATOM   369  N  N     . ALA A  1 50  ? 35.931  3.301   28.860 1.00 39.05  ? 50  ALA A N     1 
ATOM   370  C  CA    . ALA A  1 50  ? 37.312  3.593   28.512 1.00 49.67  ? 50  ALA A CA    1 
ATOM   371  C  C     . ALA A  1 50  ? 37.512  5.097   28.590 1.00 53.83  ? 50  ALA A C     1 
ATOM   372  O  O     . ALA A  1 50  ? 38.562  5.568   29.014 1.00 56.32  ? 50  ALA A O     1 
ATOM   373  C  CB    . ALA A  1 50  ? 37.626  3.104   27.105 1.00 51.70  ? 50  ALA A CB    1 
ATOM   374  N  N     . HIS A  1 51  ? 36.502  5.861   28.186 1.00 57.51  ? 51  HIS A N     1 
ATOM   375  C  CA    . HIS A  1 51  ? 36.623  7.316   28.227 1.00 52.42  ? 51  HIS A CA    1 
ATOM   376  C  C     . HIS A  1 51  ? 35.442  7.988   28.899 1.00 44.62  ? 51  HIS A C     1 
ATOM   377  O  O     . HIS A  1 51  ? 34.395  7.378   29.109 1.00 52.26  ? 51  HIS A O     1 
ATOM   378  C  CB    . HIS A  1 51  ? 36.768  7.880   26.811 1.00 52.66  ? 51  HIS A CB    1 
ATOM   379  C  CG    . HIS A  1 51  ? 37.774  7.153   25.969 1.00 63.18  ? 51  HIS A CG    1 
ATOM   380  N  ND1   . HIS A  1 51  ? 37.483  5.976   25.308 1.00 66.11  ? 51  HIS A ND1   1 
ATOM   381  C  CD2   . HIS A  1 51  ? 39.067  7.435   25.683 1.00 60.70  ? 51  HIS A CD2   1 
ATOM   382  C  CE1   . HIS A  1 51  ? 38.553  5.572   24.646 1.00 63.67  ? 51  HIS A CE1   1 
ATOM   383  N  NE2   . HIS A  1 51  ? 39.527  6.438   24.858 1.00 59.75  ? 51  HIS A NE2   1 
ATOM   384  N  N     . TRP A  1 52  ? 35.638  9.248   29.261 1.00 41.47  ? 52  TRP A N     1 
ATOM   385  C  CA    . TRP A  1 52  ? 34.582  10.047  29.849 1.00 47.32  ? 52  TRP A CA    1 
ATOM   386  C  C     . TRP A  1 52  ? 35.040  11.503  29.992 1.00 49.59  ? 52  TRP A C     1 
ATOM   387  O  O     . TRP A  1 52  ? 36.213  11.782  30.222 1.00 49.61  ? 52  TRP A O     1 
ATOM   388  C  CB    . TRP A  1 52  ? 34.143  9.464   31.187 1.00 44.45  ? 52  TRP A CB    1 
ATOM   389  C  CG    . TRP A  1 52  ? 35.076  9.692   32.288 1.00 59.97  ? 52  TRP A CG    1 
ATOM   390  C  CD1   . TRP A  1 52  ? 35.240  10.841  32.990 1.00 56.48  ? 52  TRP A CD1   1 
ATOM   391  C  CD2   . TRP A  1 52  ? 35.962  8.731   32.863 1.00 51.75  ? 52  TRP A CD2   1 
ATOM   392  N  NE1   . TRP A  1 52  ? 36.170  10.661  33.978 1.00 61.97  ? 52  TRP A NE1   1 
ATOM   393  C  CE2   . TRP A  1 52  ? 36.634  9.374   33.924 1.00 60.01  ? 52  TRP A CE2   1 
ATOM   394  C  CE3   . TRP A  1 52  ? 36.251  7.389   32.587 1.00 53.05  ? 52  TRP A CE3   1 
ATOM   395  C  CZ2   . TRP A  1 52  ? 37.582  8.723   34.719 1.00 69.93  ? 52  TRP A CZ2   1 
ATOM   396  C  CZ3   . TRP A  1 52  ? 37.196  6.733   33.379 1.00 71.76  ? 52  TRP A CZ3   1 
ATOM   397  C  CH2   . TRP A  1 52  ? 37.850  7.405   34.433 1.00 75.39  ? 52  TRP A CH2   1 
ATOM   398  N  N     . LYS A  1 53  ? 34.110  12.437  29.808 1.00 53.55  ? 53  LYS A N     1 
ATOM   399  C  CA    . LYS A  1 53  ? 34.341  13.879  29.901 1.00 42.41  ? 53  LYS A CA    1 
ATOM   400  C  C     . LYS A  1 53  ? 33.249  14.555  30.678 1.00 41.20  ? 53  LYS A C     1 
ATOM   401  O  O     . LYS A  1 53  ? 32.139  14.071  30.730 1.00 48.81  ? 53  LYS A O     1 
ATOM   402  C  CB    . LYS A  1 53  ? 34.272  14.541  28.549 1.00 53.20  ? 53  LYS A CB    1 
ATOM   403  C  CG    . LYS A  1 53  ? 35.178  13.991  27.542 1.00 51.18  ? 53  LYS A CG    1 
ATOM   404  C  CD    . LYS A  1 53  ? 36.545  14.296  27.974 1.00 52.70  ? 53  LYS A CD    1 
ATOM   405  C  CE    . LYS A  1 53  ? 37.526  13.741  27.004 1.00 66.08  ? 53  LYS A CE    1 
ATOM   406  N  NZ    . LYS A  1 53  ? 38.845  14.136  27.537 1.00 82.65  ? 53  LYS A NZ    1 
ATOM   407  N  N     . GLY A  1 54  ? 33.530  15.703  31.238 1.00 37.67  ? 54  GLY A N     1 
ATOM   408  C  CA    . GLY A  1 54  ? 32.521  16.443  31.959 1.00 37.96  ? 54  GLY A CA    1 
ATOM   409  C  C     . GLY A  1 54  ? 33.050  17.533  32.833 1.00 42.09  ? 54  GLY A C     1 
ATOM   410  O  O     . GLY A  1 54  ? 34.251  17.771  32.898 1.00 43.51  ? 54  GLY A O     1 
ATOM   411  N  N     . GLN A  1 55  ? 32.103  18.170  33.508 1.00 31.09  ? 55  GLN A N     1 
ATOM   412  C  CA    . GLN A  1 55  ? 32.382  19.248  34.417 1.00 40.10  ? 55  GLN A CA    1 
ATOM   413  C  C     . GLN A  1 55  ? 31.638  18.918  35.705 1.00 50.81  ? 55  GLN A C     1 
ATOM   414  O  O     . GLN A  1 55  ? 30.639  18.199  35.690 1.00 41.54  ? 55  GLN A O     1 
ATOM   415  C  CB    . GLN A  1 55  ? 31.863  20.578  33.855 1.00 32.90  ? 55  GLN A CB    1 
ATOM   416  C  CG    . GLN A  1 55  ? 32.330  20.935  32.446 1.00 39.44  ? 55  GLN A CG    1 
ATOM   417  C  CD    . GLN A  1 55  ? 31.508  20.273  31.333 1.00 48.49  ? 55  GLN A CD    1 
ATOM   418  O  OE1   . GLN A  1 55  ? 30.304  20.053  31.474 1.00 26.75  ? 55  GLN A OE1   1 
ATOM   419  N  NE2   . GLN A  1 55  ? 32.161  19.977  30.215 1.00 37.37  ? 55  GLN A NE2   1 
ATOM   420  N  N     . VAL A  1 56  ? 32.127  19.463  36.810 1.00 45.54  ? 56  VAL A N     1 
ATOM   421  C  CA    . VAL A  1 56  ? 31.526  19.228  38.102 1.00 38.62  ? 56  VAL A CA    1 
ATOM   422  C  C     . VAL A  1 56  ? 30.842  20.488  38.566 1.00 40.55  ? 56  VAL A C     1 
ATOM   423  O  O     . VAL A  1 56  ? 30.925  21.538  37.932 1.00 47.56  ? 56  VAL A O     1 
ATOM   424  C  CB    . VAL A  1 56  ? 32.588  18.870  39.172 1.00 38.10  ? 56  VAL A CB    1 
ATOM   425  C  CG1   . VAL A  1 56  ? 33.463  17.705  38.683 1.00 38.32  ? 56  VAL A CG1   1 
ATOM   426  C  CG2   . VAL A  1 56  ? 33.432  20.110  39.489 1.00 42.73  ? 56  VAL A CG2   1 
ATOM   427  N  N     . LEU A  1 57  ? 30.170  20.360  39.696 1.00 38.23  ? 57  LEU A N     1 
ATOM   428  C  CA    . LEU A  1 57  ? 29.471  21.455  40.323 1.00 41.53  ? 57  LEU A CA    1 
ATOM   429  C  C     . LEU A  1 57  ? 30.244  21.656  41.628 1.00 50.60  ? 57  LEU A C     1 
ATOM   430  O  O     . LEU A  1 57  ? 30.368  20.714  42.417 1.00 45.70  ? 57  LEU A O     1 
ATOM   431  C  CB    . LEU A  1 57  ? 28.036  21.026  40.619 1.00 39.49  ? 57  LEU A CB    1 
ATOM   432  C  CG    . LEU A  1 57  ? 27.086  22.024  41.276 1.00 38.81  ? 57  LEU A CG    1 
ATOM   433  C  CD1   . LEU A  1 57  ? 26.653  23.027  40.247 1.00 36.44  ? 57  LEU A CD1   1 
ATOM   434  C  CD2   . LEU A  1 57  ? 25.881  21.308  41.837 1.00 27.32  ? 57  LEU A CD2   1 
ATOM   435  N  N     . ASN A  1 58  ? 30.797  22.852  41.844 1.00 44.36  ? 58  ASN A N     1 
ATOM   436  C  CA    . ASN A  1 58  ? 31.524  23.114  43.082 1.00 39.49  ? 58  ASN A CA    1 
ATOM   437  C  C     . ASN A  1 58  ? 30.542  23.501  44.177 1.00 44.21  ? 58  ASN A C     1 
ATOM   438  O  O     . ASN A  1 58  ? 29.363  23.812  43.904 1.00 35.40  ? 58  ASN A O     1 
ATOM   439  C  CB    . ASN A  1 58  ? 32.599  24.210  42.905 1.00 46.98  ? 58  ASN A CB    1 
ATOM   440  C  CG    . ASN A  1 58  ? 32.028  25.561  42.480 1.00 47.73  ? 58  ASN A CG    1 
ATOM   441  O  OD1   . ASN A  1 58  ? 31.098  26.106  43.099 1.00 30.27  ? 58  ASN A OD1   1 
ATOM   442  N  ND2   . ASN A  1 58  ? 32.603  26.117  41.423 1.00 46.42  ? 58  ASN A ND2   1 
ATOM   443  N  N     . SER A  1 59  ? 31.026  23.474  45.416 1.00 35.59  ? 59  SER A N     1 
ATOM   444  C  CA    . SER A  1 59  ? 30.193  23.774  46.572 1.00 32.54  ? 59  SER A CA    1 
ATOM   445  C  C     . SER A  1 59  ? 29.510  25.135  46.533 1.00 32.41  ? 59  SER A C     1 
ATOM   446  O  O     . SER A  1 59  ? 28.405  25.295  47.062 1.00 41.60  ? 59  SER A O     1 
ATOM   447  C  CB    . SER A  1 59  ? 31.011  23.613  47.859 1.00 42.32  ? 59  SER A CB    1 
ATOM   448  O  OG    . SER A  1 59  ? 32.294  24.235  47.769 1.00 46.75  ? 59  SER A OG    1 
ATOM   449  N  N     . ASP A  1 60  ? 30.145  26.114  45.896 1.00 41.74  ? 60  ASP A N     1 
ATOM   450  C  CA    . ASP A  1 60  ? 29.554  27.448  45.807 1.00 35.25  ? 60  ASP A CA    1 
ATOM   451  C  C     . ASP A  1 60  ? 28.348  27.426  44.863 1.00 38.66  ? 60  ASP A C     1 
ATOM   452  O  O     . ASP A  1 60  ? 27.318  28.064  45.126 1.00 34.49  ? 60  ASP A O     1 
ATOM   453  C  CB    . ASP A  1 60  ? 30.578  28.464  45.289 1.00 43.92  ? 60  ASP A CB    1 
ATOM   454  C  CG    . ASP A  1 60  ? 31.881  28.441  46.077 1.00 51.02  ? 60  ASP A CG    1 
ATOM   455  O  OD1   . ASP A  1 60  ? 31.828  28.551  47.323 1.00 50.05  ? 60  ASP A OD1   1 
ATOM   456  O  OD2   . ASP A  1 60  ? 32.957  28.318  45.446 1.00 59.07  ? 60  ASP A OD2   1 
ATOM   457  N  N     . GLU A  1 61  ? 28.481  26.695  43.763 1.00 34.64  ? 61  GLU A N     1 
ATOM   458  C  CA    . GLU A  1 61  ? 27.398  26.580  42.789 1.00 41.88  ? 61  GLU A CA    1 
ATOM   459  C  C     . GLU A  1 61  ? 26.198  25.836  43.389 1.00 39.91  ? 61  GLU A C     1 
ATOM   460  O  O     . GLU A  1 61  ? 25.048  26.180  43.121 1.00 41.84  ? 61  GLU A O     1 
ATOM   461  C  CB    . GLU A  1 61  ? 27.925  25.887  41.542 1.00 43.88  ? 61  GLU A CB    1 
ATOM   462  C  CG    . GLU A  1 61  ? 29.020  26.704  40.904 1.00 39.00  ? 61  GLU A CG    1 
ATOM   463  C  CD    . GLU A  1 61  ? 29.735  25.994  39.775 1.00 51.68  ? 61  GLU A CD    1 
ATOM   464  O  OE1   . GLU A  1 61  ? 29.998  24.780  39.893 1.00 51.07  ? 61  GLU A OE1   1 
ATOM   465  O  OE2   . GLU A  1 61  ? 30.059  26.662  38.770 1.00 60.24  ? 61  GLU A OE2   1 
ATOM   466  N  N     . LEU A  1 62  ? 26.474  24.833  44.224 1.00 33.80  ? 62  LEU A N     1 
ATOM   467  C  CA    . LEU A  1 62  ? 25.427  24.083  44.887 1.00 29.65  ? 62  LEU A CA    1 
ATOM   468  C  C     . LEU A  1 62  ? 24.681  25.023  45.826 1.00 37.73  ? 62  LEU A C     1 
ATOM   469  O  O     . LEU A  1 62  ? 23.443  25.037  45.872 1.00 31.38  ? 62  LEU A O     1 
ATOM   470  C  CB    . LEU A  1 62  ? 26.017  22.895  45.674 1.00 33.68  ? 62  LEU A CB    1 
ATOM   471  C  CG    . LEU A  1 62  ? 25.083  22.236  46.704 1.00 42.46  ? 62  LEU A CG    1 
ATOM   472  C  CD1   . LEU A  1 62  ? 23.798  21.739  46.047 1.00 42.72  ? 62  LEU A CD1   1 
ATOM   473  C  CD2   . LEU A  1 62  ? 25.800  21.092  47.383 1.00 38.06  ? 62  LEU A CD2   1 
ATOM   474  N  N     . GLN A  1 63  ? 25.435  25.816  46.582 1.00 45.59  ? 63  GLN A N     1 
ATOM   475  C  CA    . GLN A  1 63  ? 24.830  26.777  47.502 1.00 42.49  ? 63  GLN A CA    1 
ATOM   476  C  C     . GLN A  1 63  ? 24.038  27.829  46.717 1.00 37.94  ? 63  GLN A C     1 
ATOM   477  O  O     . GLN A  1 63  ? 22.942  28.259  47.108 1.00 36.52  ? 63  GLN A O     1 
ATOM   478  C  CB    . GLN A  1 63  ? 25.912  27.449  48.342 1.00 44.09  ? 63  GLN A CB    1 
ATOM   479  C  CG    . GLN A  1 63  ? 25.379  28.625  49.096 1.00 43.00  ? 63  GLN A CG    1 
ATOM   480  C  CD    . GLN A  1 63  ? 26.393  29.194  50.035 1.00 50.69  ? 63  GLN A CD    1 
ATOM   481  O  OE1   . GLN A  1 63  ? 27.556  29.372  49.681 1.00 49.79  ? 63  GLN A OE1   1 
ATOM   482  N  NE2   . GLN A  1 63  ? 25.961  29.488  51.246 1.00 40.78  ? 63  GLN A NE2   1 
ATOM   483  N  N     . GLU A  1 64  ? 24.607  28.248  45.597 1.00 31.00  ? 64  GLU A N     1 
ATOM   484  C  CA    . GLU A  1 64  ? 23.938  29.195  44.723 1.00 41.56  ? 64  GLU A CA    1 
ATOM   485  C  C     . GLU A  1 64  ? 22.547  28.627  44.363 1.00 41.06  ? 64  GLU A C     1 
ATOM   486  O  O     . GLU A  1 64  ? 21.531  29.314  44.523 1.00 46.02  ? 64  GLU A O     1 
ATOM   487  C  CB    . GLU A  1 64  ? 24.777  29.389  43.472 1.00 36.30  ? 64  GLU A CB    1 
ATOM   488  C  CG    . GLU A  1 64  ? 24.429  30.600  42.651 1.00 66.66  ? 64  GLU A CG    1 
ATOM   489  C  CD    . GLU A  1 64  ? 25.392  30.793  41.494 1.00 68.50  ? 64  GLU A CD    1 
ATOM   490  O  OE1   . GLU A  1 64  ? 25.417  31.900  40.923 1.00 72.46  ? 64  GLU A OE1   1 
ATOM   491  O  OE2   . GLU A  1 64  ? 26.123  29.839  41.150 1.00 75.16  ? 64  GLU A OE2   1 
ATOM   492  N  N     . LEU A  1 65  ? 22.496  27.373  43.897 1.00 31.44  ? 65  LEU A N     1 
ATOM   493  C  CA    . LEU A  1 65  ? 21.217  26.739  43.532 1.00 31.71  ? 65  LEU A CA    1 
ATOM   494  C  C     . LEU A  1 65  ? 20.256  26.646  44.721 1.00 31.59  ? 65  LEU A C     1 
ATOM   495  O  O     . LEU A  1 65  ? 19.045  26.895  44.581 1.00 42.04  ? 65  LEU A O     1 
ATOM   496  C  CB    . LEU A  1 65  ? 21.451  25.325  42.961 1.00 36.25  ? 65  LEU A CB    1 
ATOM   497  C  CG    . LEU A  1 65  ? 22.236  25.239  41.656 1.00 30.17  ? 65  LEU A CG    1 
ATOM   498  C  CD1   . LEU A  1 65  ? 22.716  23.830  41.424 1.00 29.40  ? 65  LEU A CD1   1 
ATOM   499  C  CD2   . LEU A  1 65  ? 21.340  25.725  40.504 1.00 39.17  ? 65  LEU A CD2   1 
ATOM   500  N  N     . TYR A  1 66  ? 20.779  26.272  45.894 1.00 37.12  ? 66  TYR A N     1 
ATOM   501  C  CA    . TYR A  1 66  ? 19.924  26.181  47.077 1.00 35.41  ? 66  TYR A CA    1 
ATOM   502  C  C     . TYR A  1 66  ? 19.341  27.559  47.392 1.00 37.71  ? 66  TYR A C     1 
ATOM   503  O  O     . TYR A  1 66  ? 18.158  27.688  47.794 1.00 33.09  ? 66  TYR A O     1 
ATOM   504  C  CB    . TYR A  1 66  ? 20.703  25.684  48.302 1.00 38.55  ? 66  TYR A CB    1 
ATOM   505  C  CG    . TYR A  1 66  ? 19.844  25.660  49.551 1.00 39.88  ? 66  TYR A CG    1 
ATOM   506  C  CD1   . TYR A  1 66  ? 18.860  24.696  49.729 1.00 47.81  ? 66  TYR A CD1   1 
ATOM   507  C  CD2   . TYR A  1 66  ? 19.930  26.673  50.487 1.00 43.45  ? 66  TYR A CD2   1 
ATOM   508  C  CE1   . TYR A  1 66  ? 17.981  24.755  50.803 1.00 42.55  ? 66  TYR A CE1   1 
ATOM   509  C  CE2   . TYR A  1 66  ? 19.059  26.739  51.545 1.00 38.83  ? 66  TYR A CE2   1 
ATOM   510  C  CZ    . TYR A  1 66  ? 18.082  25.788  51.698 1.00 43.92  ? 66  TYR A CZ    1 
ATOM   511  O  OH    . TYR A  1 66  ? 17.164  25.944  52.704 1.00 53.20  ? 66  TYR A OH    1 
ATOM   512  N  N     . GLU A  1 67  ? 20.173  28.583  47.202 1.00 31.68  ? 67  GLU A N     1 
ATOM   513  C  CA    . GLU A  1 67  ? 19.777  29.968  47.466 1.00 40.93  ? 67  GLU A CA    1 
ATOM   514  C  C     . GLU A  1 67  ? 18.622  30.420  46.590 1.00 38.75  ? 67  GLU A C     1 
ATOM   515  O  O     . GLU A  1 67  ? 17.704  31.106  47.057 1.00 36.50  ? 67  GLU A O     1 
ATOM   516  C  CB    . GLU A  1 67  ? 20.969  30.909  47.301 1.00 50.11  ? 67  GLU A CB    1 
ATOM   517  C  CG    . GLU A  1 67  ? 21.443  31.487  48.622 1.00 61.45  ? 67  GLU A CG    1 
ATOM   518  C  CD    . GLU A  1 67  ? 20.353  32.301  49.324 1.00 84.05  ? 67  GLU A CD    1 
ATOM   519  O  OE1   . GLU A  1 67  ? 20.068  33.444  48.894 1.00 85.02  ? 67  GLU A OE1   1 
ATOM   520  O  OE2   . GLU A  1 67  ? 19.769  31.796  50.304 1.00 90.55  ? 67  GLU A OE2   1 
ATOM   521  N  N     . GLY A  1 68  ? 18.655  30.012  45.325 1.00 36.10  ? 68  GLY A N     1 
ATOM   522  C  CA    . GLY A  1 68  ? 17.581  30.368  44.420 1.00 27.77  ? 68  GLY A CA    1 
ATOM   523  C  C     . GLY A  1 68  ? 16.276  29.751  44.890 1.00 31.80  ? 68  GLY A C     1 
ATOM   524  O  O     . GLY A  1 68  ? 15.216  30.378  44.811 1.00 36.75  ? 68  GLY A O     1 
ATOM   525  N  N     . LEU A  1 69  ? 16.348  28.513  45.373 1.00 33.54  ? 69  LEU A N     1 
ATOM   526  C  CA    . LEU A  1 69  ? 15.156  27.810  45.847 1.00 34.78  ? 69  LEU A CA    1 
ATOM   527  C  C     . LEU A  1 69  ? 14.643  28.476  47.105 1.00 42.27  ? 69  LEU A C     1 
ATOM   528  O  O     . LEU A  1 69  ? 13.434  28.656  47.272 1.00 32.96  ? 69  LEU A O     1 
ATOM   529  C  CB    . LEU A  1 69  ? 15.469  26.338  46.159 1.00 45.17  ? 69  LEU A CB    1 
ATOM   530  C  CG    . LEU A  1 69  ? 15.973  25.391  45.057 1.00 48.19  ? 69  LEU A CG    1 
ATOM   531  C  CD1   . LEU A  1 69  ? 16.276  24.036  45.662 1.00 38.25  ? 69  LEU A CD1   1 
ATOM   532  C  CD2   . LEU A  1 69  ? 14.934  25.251  43.975 1.00 40.02  ? 69  LEU A CD2   1 
ATOM   533  N  N     . ARG A  1 70  ? 15.569  28.830  47.999 1.00 43.19  ? 70  ARG A N     1 
ATOM   534  C  CA    . ARG A  1 70  ? 15.177  29.470  49.253 1.00 50.37  ? 70  ARG A CA    1 
ATOM   535  C  C     . ARG A  1 70  ? 14.500  30.817  49.002 1.00 41.25  ? 70  ARG A C     1 
ATOM   536  O  O     . ARG A  1 70  ? 13.439  31.090  49.561 1.00 40.77  ? 70  ARG A O     1 
ATOM   537  C  CB    . ARG A  1 70  ? 16.385  29.648  50.192 1.00 47.97  ? 70  ARG A CB    1 
ATOM   538  C  CG    . ARG A  1 70  ? 15.997  30.283  51.534 1.00 53.22  ? 70  ARG A CG    1 
ATOM   539  C  CD    . ARG A  1 70  ? 17.063  30.102  52.597 1.00 57.10  ? 70  ARG A CD    1 
ATOM   540  N  NE    . ARG A  1 70  ? 18.376  30.551  52.156 1.00 53.77  ? 70  ARG A NE    1 
ATOM   541  C  CZ    . ARG A  1 70  ? 19.513  30.168  52.728 1.00 75.52  ? 70  ARG A CZ    1 
ATOM   542  N  NH1   . ARG A  1 70  ? 19.481  29.336  53.761 1.00 75.08  ? 70  ARG A NH1   1 
ATOM   543  N  NH2   . ARG A  1 70  ? 20.681  30.588  52.253 1.00 81.42  ? 70  ARG A NH2   1 
ATOM   544  N  N     . LEU A  1 71  ? 15.120  31.647  48.163 1.00 41.71  ? 71  LEU A N     1 
ATOM   545  C  CA    . LEU A  1 71  ? 14.569  32.953  47.815 1.00 43.84  ? 71  LEU A CA    1 
ATOM   546  C  C     . LEU A  1 71  ? 13.123  32.827  47.328 1.00 40.76  ? 71  LEU A C     1 
ATOM   547  O  O     . LEU A  1 71  ? 12.325  33.724  47.558 1.00 51.09  ? 71  LEU A O     1 
ATOM   548  C  CB    . LEU A  1 71  ? 15.423  33.625  46.733 1.00 34.80  ? 71  LEU A CB    1 
ATOM   549  C  CG    . LEU A  1 71  ? 16.819  34.121  47.132 1.00 44.79  ? 71  LEU A CG    1 
ATOM   550  C  CD1   . LEU A  1 71  ? 17.617  34.517  45.897 1.00 42.32  ? 71  LEU A CD1   1 
ATOM   551  C  CD2   . LEU A  1 71  ? 16.685  35.297  48.070 1.00 40.60  ? 71  LEU A CD2   1 
ATOM   552  N  N     . ASN A  1 72  ? 12.777  31.716  46.673 1.00 45.21  ? 72  ASN A N     1 
ATOM   553  C  CA    . ASN A  1 72  ? 11.400  31.528  46.182 1.00 39.43  ? 72  ASN A CA    1 
ATOM   554  C  C     . ASN A  1 72  ? 10.545  30.724  47.147 1.00 45.29  ? 72  ASN A C     1 
ATOM   555  O  O     . ASN A  1 72  ? 9.387   30.401  46.845 1.00 43.43  ? 72  ASN A O     1 
ATOM   556  C  CB    . ASN A  1 72  ? 11.367  30.811  44.813 1.00 39.28  ? 72  ASN A CB    1 
ATOM   557  C  CG    . ASN A  1 72  ? 11.902  31.672  43.664 1.00 46.55  ? 72  ASN A CG    1 
ATOM   558  O  OD1   . ASN A  1 72  ? 11.478  32.809  43.463 1.00 43.05  ? 72  ASN A OD1   1 
ATOM   559  N  ND2   . ASN A  1 72  ? 12.830  31.115  42.897 1.00 38.50  ? 72  ASN A ND2   1 
ATOM   560  N  N     . ASN A  1 73  ? 11.116  30.384  48.301 1.00 48.14  ? 73  ASN A N     1 
ATOM   561  C  CA    . ASN A  1 73  ? 10.414  29.579  49.298 1.00 54.74  ? 73  ASN A CA    1 
ATOM   562  C  C     . ASN A  1 73  ? 10.078  28.204  48.762 1.00 53.52  ? 73  ASN A C     1 
ATOM   563  O  O     . ASN A  1 73  ? 8.993   27.676  49.014 1.00 54.96  ? 73  ASN A O     1 
ATOM   564  C  CB    . ASN A  1 73  ? 9.116   30.249  49.741 1.00 54.69  ? 73  ASN A CB    1 
ATOM   565  C  CG    . ASN A  1 73  ? 9.334   31.235  50.855 1.00 67.73  ? 73  ASN A CG    1 
ATOM   566  O  OD1   . ASN A  1 73  ? 9.761   32.372  50.627 1.00 76.50  ? 73  ASN A OD1   1 
ATOM   567  N  ND2   . ASN A  1 73  ? 9.057   30.800  52.079 1.00 63.62  ? 73  ASN A ND2   1 
ATOM   568  N  N     . MET A  1 74  ? 11.002  27.637  47.998 1.00 49.94  ? 74  MET A N     1 
ATOM   569  C  CA    . MET A  1 74  ? 10.794  26.314  47.425 1.00 53.41  ? 74  MET A CA    1 
ATOM   570  C  C     . MET A  1 74  ? 11.737  25.345  48.130 1.00 47.55  ? 74  MET A C     1 
ATOM   571  O  O     . MET A  1 74  ? 12.028  24.258  47.634 1.00 52.19  ? 74  MET A O     1 
ATOM   572  C  CB    . MET A  1 74  ? 11.065  26.339  45.911 1.00 51.35  ? 74  MET A CB    1 
ATOM   573  C  CG    . MET A  1 74  ? 9.994   27.054  45.103 1.00 47.71  ? 74  MET A CG    1 
ATOM   574  S  SD    . MET A  1 74  ? 10.420  27.341  43.365 1.00 51.72  ? 74  MET A SD    1 
ATOM   575  C  CE    . MET A  1 74  ? 12.226  27.518  43.492 1.00 25.39  ? 74  MET A CE    1 
ATOM   576  N  N     . ASN A  1 75  ? 12.200  25.755  49.303 1.00 45.26  ? 75  ASN A N     1 
ATOM   577  C  CA    . ASN A  1 75  ? 13.114  24.941  50.090 1.00 44.29  ? 75  ASN A CA    1 
ATOM   578  C  C     . ASN A  1 75  ? 12.370  24.086  51.138 1.00 42.31  ? 75  ASN A C     1 
ATOM   579  O  O     . ASN A  1 75  ? 12.737  24.048  52.308 1.00 51.94  ? 75  ASN A O     1 
ATOM   580  C  CB    . ASN A  1 75  ? 14.179  25.842  50.740 1.00 46.79  ? 75  ASN A CB    1 
ATOM   581  C  CG    . ASN A  1 75  ? 13.618  26.739  51.840 1.00 54.37  ? 75  ASN A CG    1 
ATOM   582  O  OD1   . ASN A  1 75  ? 12.546  27.334  51.697 1.00 53.60  ? 75  ASN A OD1   1 
ATOM   583  N  ND2   . ASN A  1 75  ? 14.356  26.844  52.943 1.00 40.16  ? 75  ASN A ND2   1 
ATOM   584  N  N     . LYS A  1 76  ? 11.312  23.412  50.705 1.00 42.59  ? 76  LYS A N     1 
ATOM   585  C  CA    . LYS A  1 76  ? 10.538  22.558  51.588 1.00 46.44  ? 76  LYS A CA    1 
ATOM   586  C  C     . LYS A  1 76  ? 10.408  21.235  50.863 1.00 50.26  ? 76  LYS A C     1 
ATOM   587  O  O     . LYS A  1 76  ? 9.721   21.145  49.849 1.00 56.75  ? 76  LYS A O     1 
ATOM   588  C  CB    . LYS A  1 76  ? 9.166   23.170  51.847 1.00 53.58  ? 76  LYS A CB    1 
ATOM   589  C  CG    . LYS A  1 76  ? 9.272   24.640  52.232 1.00 73.56  ? 76  LYS A CG    1 
ATOM   590  C  CD    . LYS A  1 76  ? 7.945   25.242  52.654 1.00 78.30  ? 76  LYS A CD    1 
ATOM   591  C  CE    . LYS A  1 76  ? 8.038   26.763  52.672 1.00 81.15  ? 76  LYS A CE    1 
ATOM   592  N  NZ    . LYS A  1 76  ? 9.335   27.219  53.255 1.00 78.56  ? 76  LYS A NZ    1 
ATOM   593  N  N     . TYR A  1 77  ? 11.106  20.225  51.373 1.00 50.30  ? 77  TYR A N     1 
ATOM   594  C  CA    . TYR A  1 77  ? 11.117  18.891  50.788 1.00 43.53  ? 77  TYR A CA    1 
ATOM   595  C  C     . TYR A  1 77  ? 10.753  17.860  51.821 1.00 45.01  ? 77  TYR A C     1 
ATOM   596  O  O     . TYR A  1 77  ? 11.037  18.044  53.000 1.00 35.04  ? 77  TYR A O     1 
ATOM   597  C  CB    . TYR A  1 77  ? 12.510  18.549  50.241 1.00 35.00  ? 77  TYR A CB    1 
ATOM   598  C  CG    . TYR A  1 77  ? 12.843  19.276  48.968 1.00 32.24  ? 77  TYR A CG    1 
ATOM   599  C  CD1   . TYR A  1 77  ? 13.444  20.537  48.995 1.00 28.22  ? 77  TYR A CD1   1 
ATOM   600  C  CD2   . TYR A  1 77  ? 12.497  18.736  47.736 1.00 22.34  ? 77  TYR A CD2   1 
ATOM   601  C  CE1   . TYR A  1 77  ? 13.688  21.238  47.826 1.00 32.32  ? 77  TYR A CE1   1 
ATOM   602  C  CE2   . TYR A  1 77  ? 12.729  19.430  46.555 1.00 39.12  ? 77  TYR A CE2   1 
ATOM   603  C  CZ    . TYR A  1 77  ? 13.325  20.684  46.607 1.00 35.77  ? 77  TYR A CZ    1 
ATOM   604  O  OH    . TYR A  1 77  ? 13.521  21.392  45.445 1.00 45.70  ? 77  TYR A OH    1 
ATOM   605  N  N     . ASP A  1 78  ? 10.131  16.777  51.363 1.00 43.94  ? 78  ASP A N     1 
ATOM   606  C  CA    . ASP A  1 78  ? 9.735   15.671  52.227 1.00 40.95  ? 78  ASP A CA    1 
ATOM   607  C  C     . ASP A  1 78  ? 10.900  14.686  52.397 1.00 41.85  ? 78  ASP A C     1 
ATOM   608  O  O     . ASP A  1 78  ? 11.006  13.981  53.415 1.00 37.43  ? 78  ASP A O     1 
ATOM   609  C  CB    . ASP A  1 78  ? 8.529   14.961  51.626 1.00 40.20  ? 78  ASP A CB    1 
ATOM   610  C  CG    . ASP A  1 78  ? 7.310   15.867  51.539 1.00 42.49  ? 78  ASP A CG    1 
ATOM   611  O  OD1   . ASP A  1 78  ? 6.729   16.185  52.595 1.00 36.71  ? 78  ASP A OD1   1 
ATOM   612  O  OD2   . ASP A  1 78  ? 6.945   16.278  50.418 1.00 39.38  ? 78  ASP A OD2   1 
ATOM   613  N  N     . TYR A  1 79  ? 11.773  14.651  51.389 1.00 42.88  ? 79  TYR A N     1 
ATOM   614  C  CA    . TYR A  1 79  ? 12.945  13.772  51.387 1.00 34.27  ? 79  TYR A CA    1 
ATOM   615  C  C     . TYR A  1 79  ? 14.124  14.435  50.739 1.00 36.31  ? 79  TYR A C     1 
ATOM   616  O  O     . TYR A  1 79  ? 13.977  15.341  49.913 1.00 39.26  ? 79  TYR A O     1 
ATOM   617  C  CB    . TYR A  1 79  ? 12.728  12.492  50.563 1.00 36.17  ? 79  TYR A CB    1 
ATOM   618  C  CG    . TYR A  1 79  ? 11.747  11.523  51.125 1.00 32.73  ? 79  TYR A CG    1 
ATOM   619  C  CD1   . TYR A  1 79  ? 10.380  11.694  50.928 1.00 33.85  ? 79  TYR A CD1   1 
ATOM   620  C  CD2   . TYR A  1 79  ? 12.177  10.452  51.895 1.00 27.96  ? 79  TYR A CD2   1 
ATOM   621  C  CE1   . TYR A  1 79  ? 9.470   10.824  51.492 1.00 35.23  ? 79  TYR A CE1   1 
ATOM   622  C  CE2   . TYR A  1 79  ? 11.272  9.576   52.463 1.00 37.68  ? 79  TYR A CE2   1 
ATOM   623  C  CZ    . TYR A  1 79  ? 9.919   9.777   52.254 1.00 33.54  ? 79  TYR A CZ    1 
ATOM   624  O  OH    . TYR A  1 79  ? 9.009   8.922   52.791 1.00 40.74  ? 79  TYR A OH    1 
ATOM   625  N  N     . VAL A  1 80  ? 15.297  13.953  51.106 1.00 32.99  ? 80  VAL A N     1 
ATOM   626  C  CA    . VAL A  1 80  ? 16.525  14.389  50.491 1.00 26.38  ? 80  VAL A CA    1 
ATOM   627  C  C     . VAL A  1 80  ? 17.220  13.076  50.183 1.00 30.88  ? 80  VAL A C     1 
ATOM   628  O  O     . VAL A  1 80  ? 17.171  12.143  50.971 1.00 27.96  ? 80  VAL A O     1 
ATOM   629  C  CB    . VAL A  1 80  ? 17.391  15.263  51.405 1.00 37.58  ? 80  VAL A CB    1 
ATOM   630  C  CG1   . VAL A  1 80  ? 18.828  15.398  50.806 1.00 25.05  ? 80  VAL A CG1   1 
ATOM   631  C  CG2   . VAL A  1 80  ? 16.750  16.644  51.506 1.00 28.66  ? 80  VAL A CG2   1 
ATOM   632  N  N     . LEU A  1 81  ? 17.835  13.008  49.010 1.00 38.43  ? 81  LEU A N     1 
ATOM   633  C  CA    . LEU A  1 81  ? 18.518  11.810  48.567 1.00 31.97  ? 81  LEU A CA    1 
ATOM   634  C  C     . LEU A  1 81  ? 19.903  12.168  48.046 1.00 34.44  ? 81  LEU A C     1 
ATOM   635  O  O     . LEU A  1 81  ? 20.024  12.978  47.135 1.00 34.18  ? 81  LEU A O     1 
ATOM   636  C  CB    . LEU A  1 81  ? 17.706  11.157  47.445 1.00 28.37  ? 81  LEU A CB    1 
ATOM   637  C  CG    . LEU A  1 81  ? 18.279  9.922   46.736 1.00 30.21  ? 81  LEU A CG    1 
ATOM   638  C  CD1   . LEU A  1 81  ? 18.225  8.745   47.697 1.00 28.40  ? 81  LEU A CD1   1 
ATOM   639  C  CD2   . LEU A  1 81  ? 17.470  9.592   45.442 1.00 25.82  ? 81  LEU A CD2   1 
ATOM   640  N  N     . THR A  1 82  ? 20.949  11.572  48.609 1.00 26.98  ? 82  THR A N     1 
ATOM   641  C  CA    . THR A  1 82  ? 22.289  11.855  48.107 1.00 30.30  ? 82  THR A CA    1 
ATOM   642  C  C     . THR A  1 82  ? 23.037  10.561  47.904 1.00 25.54  ? 82  THR A C     1 
ATOM   643  O  O     . THR A  1 82  ? 22.743  9.558   48.537 1.00 32.39  ? 82  THR A O     1 
ATOM   644  C  CB    . THR A  1 82  ? 23.112  12.719  49.080 1.00 23.79  ? 82  THR A CB    1 
ATOM   645  O  OG1   . THR A  1 82  ? 23.274  12.017  50.317 1.00 37.86  ? 82  THR A OG1   1 
ATOM   646  C  CG2   . THR A  1 82  ? 22.431  14.047  49.321 1.00 26.02  ? 82  THR A CG2   1 
ATOM   647  N  N     . GLY A  1 83  ? 24.020  10.588  47.019 1.00 29.43  ? 83  GLY A N     1 
ATOM   648  C  CA    . GLY A  1 83  ? 24.797  9.397   46.771 1.00 26.26  ? 83  GLY A CA    1 
ATOM   649  C  C     . GLY A  1 83  ? 26.276  9.729   46.613 1.00 36.02  ? 83  GLY A C     1 
ATOM   650  O  O     . GLY A  1 83  ? 26.853  10.440  47.431 1.00 38.43  ? 83  GLY A O     1 
ATOM   651  N  N     . TYR A  1 84  ? 26.886  9.232   45.546 1.00 26.54  ? 84  TYR A N     1 
ATOM   652  C  CA    . TYR A  1 84  ? 28.304  9.450   45.328 1.00 33.99  ? 84  TYR A CA    1 
ATOM   653  C  C     . TYR A  1 84  ? 28.759  10.897  45.162 1.00 38.88  ? 84  TYR A C     1 
ATOM   654  O  O     . TYR A  1 84  ? 28.216  11.661  44.373 1.00 37.29  ? 84  TYR A O     1 
ATOM   655  C  CB    . TYR A  1 84  ? 28.772  8.610   44.138 1.00 25.37  ? 84  TYR A CB    1 
ATOM   656  C  CG    . TYR A  1 84  ? 30.204  8.870   43.696 1.00 47.08  ? 84  TYR A CG    1 
ATOM   657  C  CD1   . TYR A  1 84  ? 30.485  9.717   42.617 1.00 47.70  ? 84  TYR A CD1   1 
ATOM   658  C  CD2   . TYR A  1 84  ? 31.279  8.248   44.343 1.00 45.64  ? 84  TYR A CD2   1 
ATOM   659  C  CE1   . TYR A  1 84  ? 31.812  9.935   42.188 1.00 47.27  ? 84  TYR A CE1   1 
ATOM   660  C  CE2   . TYR A  1 84  ? 32.599  8.457   43.926 1.00 58.92  ? 84  TYR A CE2   1 
ATOM   661  C  CZ    . TYR A  1 84  ? 32.860  9.301   42.850 1.00 64.37  ? 84  TYR A CZ    1 
ATOM   662  O  OH    . TYR A  1 84  ? 34.167  9.511   42.454 1.00 69.19  ? 84  TYR A OH    1 
ATOM   663  N  N     . THR A  1 85  ? 29.773  11.256  45.941 1.00 42.84  ? 85  THR A N     1 
ATOM   664  C  CA    . THR A  1 85  ? 30.388  12.575  45.883 1.00 43.96  ? 85  THR A CA    1 
ATOM   665  C  C     . THR A  1 85  ? 31.869  12.314  46.070 1.00 44.56  ? 85  THR A C     1 
ATOM   666  O  O     . THR A  1 85  ? 32.254  11.514  46.909 1.00 41.28  ? 85  THR A O     1 
ATOM   667  C  CB    . THR A  1 85  ? 30.019  13.496  47.041 1.00 43.75  ? 85  THR A CB    1 
ATOM   668  O  OG1   . THR A  1 85  ? 28.624  13.396  47.351 1.00 68.21  ? 85  THR A OG1   1 
ATOM   669  C  CG2   . THR A  1 85  ? 30.376  14.908  46.656 1.00 41.90  ? 85  THR A CG2   1 
ATOM   670  N  N     . ARG A  1 86  ? 32.700  13.014  45.326 1.00 45.88  ? 86  ARG A N     1 
ATOM   671  C  CA    . ARG A  1 86  ? 34.126  12.810  45.439 1.00 54.99  ? 86  ARG A CA    1 
ATOM   672  C  C     . ARG A  1 86  ? 34.745  13.983  46.189 1.00 54.92  ? 86  ARG A C     1 
ATOM   673  O  O     . ARG A  1 86  ? 35.835  13.874  46.743 1.00 55.63  ? 86  ARG A O     1 
ATOM   674  C  CB    . ARG A  1 86  ? 34.721  12.701  44.032 1.00 61.77  ? 86  ARG A CB    1 
ATOM   675  C  CG    . ARG A  1 86  ? 36.192  12.368  43.979 1.00 74.75  ? 86  ARG A CG    1 
ATOM   676  C  CD    . ARG A  1 86  ? 36.663  12.305  42.539 1.00 76.20  ? 86  ARG A CD    1 
ATOM   677  N  NE    . ARG A  1 86  ? 36.737  10.932  42.050 1.00 89.33  ? 86  ARG A NE    1 
ATOM   678  C  CZ    . ARG A  1 86  ? 37.817  10.160  42.147 1.00 96.91  ? 86  ARG A CZ    1 
ATOM   679  N  NH1   . ARG A  1 86  ? 38.925  10.627  42.717 1.00 100.00 ? 86  ARG A NH1   1 
ATOM   680  N  NH2   . ARG A  1 86  ? 37.788  8.921   41.672 1.00 92.16  ? 86  ARG A NH2   1 
ATOM   681  N  N     . ASP A  1 87  ? 34.025  15.096  46.218 1.00 50.02  ? 87  ASP A N     1 
ATOM   682  C  CA    . ASP A  1 87  ? 34.509  16.318  46.847 1.00 49.43  ? 87  ASP A CA    1 
ATOM   683  C  C     . ASP A  1 87  ? 34.023  16.537  48.274 1.00 45.19  ? 87  ASP A C     1 
ATOM   684  O  O     . ASP A  1 87  ? 32.815  16.577  48.520 1.00 41.95  ? 87  ASP A O     1 
ATOM   685  C  CB    . ASP A  1 87  ? 34.108  17.518  45.994 1.00 55.71  ? 87  ASP A CB    1 
ATOM   686  C  CG    . ASP A  1 87  ? 34.459  18.829  46.651 1.00 67.35  ? 87  ASP A CG    1 
ATOM   687  O  OD1   . ASP A  1 87  ? 35.665  19.140  46.742 1.00 88.95  ? 87  ASP A OD1   1 
ATOM   688  O  OD2   . ASP A  1 87  ? 33.538  19.543  47.092 1.00 60.22  ? 87  ASP A OD2   1 
ATOM   689  N  N     . LYS A  1 88  ? 34.978  16.712  49.190 1.00 42.65  ? 88  LYS A N     1 
ATOM   690  C  CA    . LYS A  1 88  ? 34.713  16.934  50.619 1.00 46.94  ? 88  LYS A CA    1 
ATOM   691  C  C     . LYS A  1 88  ? 33.945  18.234  50.889 1.00 34.64  ? 88  LYS A C     1 
ATOM   692  O  O     . LYS A  1 88  ? 33.006  18.285  51.692 1.00 38.06  ? 88  LYS A O     1 
ATOM   693  C  CB    . LYS A  1 88  ? 36.050  16.927  51.360 1.00 62.24  ? 88  LYS A CB    1 
ATOM   694  C  CG    . LYS A  1 88  ? 36.021  17.374  52.808 1.00 65.94  ? 88  LYS A CG    1 
ATOM   695  C  CD    . LYS A  1 88  ? 37.415  17.175  53.405 1.00 73.18  ? 88  LYS A CD    1 
ATOM   696  C  CE    . LYS A  1 88  ? 37.727  18.172  54.512 1.00 77.99  ? 88  LYS A CE    1 
ATOM   697  N  NZ    . LYS A  1 88  ? 37.859  19.560  53.977 1.00 89.11  ? 88  LYS A NZ    1 
ATOM   698  N  N     . SER A  1 89  ? 34.337  19.281  50.182 1.00 38.51  ? 89  SER A N     1 
ATOM   699  C  CA    . SER A  1 89  ? 33.693  20.580  50.297 1.00 41.88  ? 89  SER A CA    1 
ATOM   700  C  C     . SER A  1 89  ? 32.193  20.451  49.928 1.00 42.54  ? 89  SER A C     1 
ATOM   701  O  O     . SER A  1 89  ? 31.306  20.939  50.639 1.00 35.64  ? 89  SER A O     1 
ATOM   702  C  CB    . SER A  1 89  ? 34.406  21.550  49.348 1.00 45.53  ? 89  SER A CB    1 
ATOM   703  O  OG    . SER A  1 89  ? 33.983  22.883  49.548 1.00 76.76  ? 89  SER A OG    1 
ATOM   704  N  N     . PHE A  1 90  ? 31.933  19.767  48.812 1.00 44.51  ? 90  PHE A N     1 
ATOM   705  C  CA    . PHE A  1 90  ? 30.584  19.531  48.307 1.00 28.76  ? 90  PHE A CA    1 
ATOM   706  C  C     . PHE A  1 90  ? 29.742  18.820  49.361 1.00 36.88  ? 90  PHE A C     1 
ATOM   707  O  O     . PHE A  1 90  ? 28.640  19.264  49.685 1.00 33.03  ? 90  PHE A O     1 
ATOM   708  C  CB    . PHE A  1 90  ? 30.654  18.672  47.042 1.00 41.87  ? 90  PHE A CB    1 
ATOM   709  C  CG    . PHE A  1 90  ? 29.408  18.712  46.201 1.00 42.74  ? 90  PHE A CG    1 
ATOM   710  C  CD1   . PHE A  1 90  ? 29.233  19.704  45.238 1.00 39.51  ? 90  PHE A CD1   1 
ATOM   711  C  CD2   . PHE A  1 90  ? 28.402  17.765  46.383 1.00 37.18  ? 90  PHE A CD2   1 
ATOM   712  C  CE1   . PHE A  1 90  ? 28.067  19.757  44.461 1.00 36.39  ? 90  PHE A CE1   1 
ATOM   713  C  CE2   . PHE A  1 90  ? 27.227  17.806  45.611 1.00 54.57  ? 90  PHE A CE2   1 
ATOM   714  C  CZ    . PHE A  1 90  ? 27.061  18.801  44.650 1.00 44.67  ? 90  PHE A CZ    1 
ATOM   715  N  N     . LEU A  1 91  ? 30.276  17.722  49.905 1.00 42.08  ? 91  LEU A N     1 
ATOM   716  C  CA    . LEU A  1 91  ? 29.567  16.941  50.931 1.00 38.30  ? 91  LEU A CA    1 
ATOM   717  C  C     . LEU A  1 91  ? 29.228  17.769  52.168 1.00 41.23  ? 91  LEU A C     1 
ATOM   718  O  O     . LEU A  1 91  ? 28.120  17.654  52.732 1.00 35.10  ? 91  LEU A O     1 
ATOM   719  C  CB    . LEU A  1 91  ? 30.383  15.698  51.334 1.00 34.11  ? 91  LEU A CB    1 
ATOM   720  C  CG    . LEU A  1 91  ? 29.729  14.649  52.253 1.00 42.81  ? 91  LEU A CG    1 
ATOM   721  C  CD1   . LEU A  1 91  ? 28.505  14.010  51.592 1.00 32.52  ? 91  LEU A CD1   1 
ATOM   722  C  CD2   . LEU A  1 91  ? 30.759  13.580  52.587 1.00 39.98  ? 91  LEU A CD2   1 
ATOM   723  N  N     . ALA A  1 92  ? 30.175  18.603  52.593 1.00 44.07  ? 92  ALA A N     1 
ATOM   724  C  CA    . ALA A  1 92  ? 29.953  19.475  53.754 1.00 43.25  ? 92  ALA A CA    1 
ATOM   725  C  C     . ALA A  1 92  ? 28.813  20.453  53.428 1.00 38.51  ? 92  ALA A C     1 
ATOM   726  O  O     . ALA A  1 92  ? 27.909  20.674  54.247 1.00 44.06  ? 92  ALA A O     1 
ATOM   727  C  CB    . ALA A  1 92  ? 31.238  20.229  54.091 1.00 36.79  ? 92  ALA A CB    1 
ATOM   728  N  N     . MET A  1 93  ? 28.849  21.022  52.222 1.00 36.22  ? 93  MET A N     1 
ATOM   729  C  CA    . MET A  1 93  ? 27.792  21.931  51.778 1.00 36.06  ? 93  MET A CA    1 
ATOM   730  C  C     . MET A  1 93  ? 26.461  21.168  51.756 1.00 34.89  ? 93  MET A C     1 
ATOM   731  O  O     . MET A  1 93  ? 25.428  21.705  52.151 1.00 39.08  ? 93  MET A O     1 
ATOM   732  C  CB    . MET A  1 93  ? 28.112  22.474  50.382 1.00 35.17  ? 93  MET A CB    1 
ATOM   733  C  CG    . MET A  1 93  ? 27.137  23.517  49.888 1.00 27.57  ? 93  MET A CG    1 
ATOM   734  S  SD    . MET A  1 93  ? 27.126  25.009  50.856 1.00 47.26  ? 93  MET A SD    1 
ATOM   735  C  CE    . MET A  1 93  ? 25.444  24.943  51.505 1.00 38.32  ? 93  MET A CE    1 
ATOM   736  N  N     . VAL A  1 94  ? 26.483  19.913  51.304 1.00 35.86  ? 94  VAL A N     1 
ATOM   737  C  CA    . VAL A  1 94  ? 25.259  19.105  51.288 1.00 38.74  ? 94  VAL A CA    1 
ATOM   738  C  C     . VAL A  1 94  ? 24.699  18.999  52.704 1.00 32.82  ? 94  VAL A C     1 
ATOM   739  O  O     . VAL A  1 94  ? 23.485  19.116  52.927 1.00 32.07  ? 94  VAL A O     1 
ATOM   740  C  CB    . VAL A  1 94  ? 25.517  17.652  50.738 1.00 42.54  ? 94  VAL A CB    1 
ATOM   741  C  CG1   . VAL A  1 94  ? 24.344  16.715  51.083 1.00 34.77  ? 94  VAL A CG1   1 
ATOM   742  C  CG2   . VAL A  1 94  ? 25.692  17.690  49.243 1.00 32.82  ? 94  VAL A CG2   1 
ATOM   743  N  N     . VAL A  1 95  ? 25.595  18.755  53.660 1.00 38.17  ? 95  VAL A N     1 
ATOM   744  C  CA    . VAL A  1 95  ? 25.220  18.627  55.070 1.00 35.45  ? 95  VAL A CA    1 
ATOM   745  C  C     . VAL A  1 95  ? 24.524  19.876  55.593 1.00 38.46  ? 95  VAL A C     1 
ATOM   746  O  O     . VAL A  1 95  ? 23.485  19.791  56.285 1.00 36.07  ? 95  VAL A O     1 
ATOM   747  C  CB    . VAL A  1 95  ? 26.459  18.308  55.960 1.00 38.91  ? 95  VAL A CB    1 
ATOM   748  C  CG1   . VAL A  1 95  ? 26.102  18.494  57.446 1.00 27.59  ? 95  VAL A CG1   1 
ATOM   749  C  CG2   . VAL A  1 95  ? 26.903  16.865  55.715 1.00 32.02  ? 95  VAL A CG2   1 
ATOM   750  N  N     . ASP A  1 96  ? 25.079  21.041  55.266 1.00 35.70  ? 96  ASP A N     1 
ATOM   751  C  CA    . ASP A  1 96  ? 24.455  22.284  55.716 1.00 41.04  ? 96  ASP A CA    1 
ATOM   752  C  C     . ASP A  1 96  ? 23.056  22.414  55.159 1.00 39.94  ? 96  ASP A C     1 
ATOM   753  O  O     . ASP A  1 96  ? 22.143  22.845  55.862 1.00 33.43  ? 96  ASP A O     1 
ATOM   754  C  CB    . ASP A  1 96  ? 25.283  23.493  55.301 1.00 53.95  ? 96  ASP A CB    1 
ATOM   755  C  CG    . ASP A  1 96  ? 26.559  23.600  56.094 1.00 52.55  ? 96  ASP A CG    1 
ATOM   756  O  OD1   . ASP A  1 96  ? 26.529  23.211  57.282 1.00 58.17  ? 96  ASP A OD1   1 
ATOM   757  O  OD2   . ASP A  1 96  ? 27.579  24.063  55.540 1.00 58.61  ? 96  ASP A OD2   1 
ATOM   758  N  N     . ILE A  1 97  ? 22.899  22.029  53.893 1.00 45.99  ? 97  ILE A N     1 
ATOM   759  C  CA    . ILE A  1 97  ? 21.609  22.087  53.226 1.00 41.12  ? 97  ILE A CA    1 
ATOM   760  C  C     . ILE A  1 97  ? 20.581  21.175  53.892 1.00 37.67  ? 97  ILE A C     1 
ATOM   761  O  O     . ILE A  1 97  ? 19.464  21.609  54.170 1.00 38.74  ? 97  ILE A O     1 
ATOM   762  C  CB    . ILE A  1 97  ? 21.770  21.779  51.713 1.00 46.89  ? 97  ILE A CB    1 
ATOM   763  C  CG1   . ILE A  1 97  ? 22.499  22.958  51.046 1.00 36.00  ? 97  ILE A CG1   1 
ATOM   764  C  CG2   . ILE A  1 97  ? 20.406  21.545  51.058 1.00 36.88  ? 97  ILE A CG2   1 
ATOM   765  C  CD1   . ILE A  1 97  ? 23.026  22.694  49.643 1.00 28.60  ? 97  ILE A CD1   1 
ATOM   766  N  N     . VAL A  1 98  ? 20.946  19.928  54.182 1.00 45.13  ? 98  VAL A N     1 
ATOM   767  C  CA    . VAL A  1 98  ? 19.993  19.021  54.839 1.00 38.29  ? 98  VAL A CA    1 
ATOM   768  C  C     . VAL A  1 98  ? 19.606  19.568  56.215 1.00 43.68  ? 98  VAL A C     1 
ATOM   769  O  O     . VAL A  1 98  ? 18.415  19.584  56.587 1.00 33.87  ? 98  VAL A O     1 
ATOM   770  C  CB    . VAL A  1 98  ? 20.578  17.600  55.002 1.00 36.88  ? 98  VAL A CB    1 
ATOM   771  C  CG1   . VAL A  1 98  ? 19.557  16.689  55.650 1.00 38.40  ? 98  VAL A CG1   1 
ATOM   772  C  CG2   . VAL A  1 98  ? 20.964  17.045  53.648 1.00 31.56  ? 98  VAL A CG2   1 
ATOM   773  N  N     . GLN A  1 99  ? 20.608  20.016  56.975 1.00 38.27  ? 99  GLN A N     1 
ATOM   774  C  CA    . GLN A  1 99  ? 20.351  20.590  58.301 1.00 42.23  ? 99  GLN A CA    1 
ATOM   775  C  C     . GLN A  1 99  ? 19.296  21.686  58.153 1.00 38.33  ? 99  GLN A C     1 
ATOM   776  O  O     . GLN A  1 99  ? 18.296  21.718  58.866 1.00 43.44  ? 99  GLN A O     1 
ATOM   777  C  CB    . GLN A  1 99  ? 21.636  21.176  58.889 1.00 38.99  ? 99  GLN A CB    1 
ATOM   778  C  CG    . GLN A  1 99  ? 22.463  20.163  59.665 1.00 60.94  ? 99  GLN A CG    1 
ATOM   779  C  CD    . GLN A  1 99  ? 23.842  20.667  60.054 1.00 64.48  ? 99  GLN A CD    1 
ATOM   780  O  OE1   . GLN A  1 99  ? 24.532  20.035  60.848 1.00 73.72  ? 99  GLN A OE1   1 
ATOM   781  N  NE2   . GLN A  1 99  ? 24.255  21.799  59.486 1.00 62.53  ? 99  GLN A NE2   1 
ATOM   782  N  N     . GLU A  1 100 ? 19.522  22.568  57.186 1.00 41.95  ? 100 GLU A N     1 
ATOM   783  C  CA    . GLU A  1 100 ? 18.607  23.661  56.900 1.00 50.95  ? 100 GLU A CA    1 
ATOM   784  C  C     . GLU A  1 100 ? 17.223  23.129  56.482 1.00 53.43  ? 100 GLU A C     1 
ATOM   785  O  O     . GLU A  1 100 ? 16.193  23.545  57.043 1.00 47.74  ? 100 GLU A O     1 
ATOM   786  C  CB    . GLU A  1 100 ? 19.210  24.536  55.793 1.00 59.50  ? 100 GLU A CB    1 
ATOM   787  C  CG    . GLU A  1 100 ? 18.364  25.715  55.347 1.00 70.81  ? 100 GLU A CG    1 
ATOM   788  C  CD    . GLU A  1 100 ? 18.325  26.821  56.361 1.00 74.80  ? 100 GLU A CD    1 
ATOM   789  O  OE1   . GLU A  1 100 ? 17.479  26.754  57.277 1.00 84.15  ? 100 GLU A OE1   1 
ATOM   790  O  OE2   . GLU A  1 100 ? 19.152  27.751  56.247 1.00 77.21  ? 100 GLU A OE2   1 
ATOM   791  N  N     . LEU A  1 101 ? 17.188  22.205  55.516 1.00 40.70  ? 101 LEU A N     1 
ATOM   792  C  CA    . LEU A  1 101 ? 15.908  21.672  55.071 1.00 37.44  ? 101 LEU A CA    1 
ATOM   793  C  C     . LEU A  1 101 ? 15.178  20.985  56.217 1.00 36.63  ? 101 LEU A C     1 
ATOM   794  O  O     . LEU A  1 101 ? 13.942  21.001  56.278 1.00 35.35  ? 101 LEU A O     1 
ATOM   795  C  CB    . LEU A  1 101 ? 16.095  20.715  53.887 1.00 41.35  ? 101 LEU A CB    1 
ATOM   796  C  CG    . LEU A  1 101 ? 16.522  21.383  52.574 1.00 42.35  ? 101 LEU A CG    1 
ATOM   797  C  CD1   . LEU A  1 101 ? 16.811  20.317  51.554 1.00 41.63  ? 101 LEU A CD1   1 
ATOM   798  C  CD2   . LEU A  1 101 ? 15.440  22.343  52.066 1.00 43.28  ? 101 LEU A CD2   1 
ATOM   799  N  N     . LYS A  1 102 ? 15.940  20.386  57.136 1.00 37.38  ? 102 LYS A N     1 
ATOM   800  C  CA    . LYS A  1 102 ? 15.347  19.737  58.302 1.00 48.63  ? 102 LYS A CA    1 
ATOM   801  C  C     . LYS A  1 102 ? 14.743  20.750  59.292 1.00 46.32  ? 102 LYS A C     1 
ATOM   802  O  O     . LYS A  1 102 ? 13.696  20.491  59.892 1.00 45.58  ? 102 LYS A O     1 
ATOM   803  C  CB    . LYS A  1 102 ? 16.377  18.846  58.989 1.00 47.38  ? 102 LYS A CB    1 
ATOM   804  C  CG    . LYS A  1 102 ? 16.404  17.442  58.414 1.00 48.88  ? 102 LYS A CG    1 
ATOM   805  C  CD    . LYS A  1 102 ? 17.649  16.679  58.834 1.00 60.83  ? 102 LYS A CD    1 
ATOM   806  C  CE    . LYS A  1 102 ? 17.619  15.229  58.349 1.00 56.41  ? 102 LYS A CE    1 
ATOM   807  N  NZ    . LYS A  1 102 ? 16.695  14.357  59.128 1.00 37.67  ? 102 LYS A NZ    1 
ATOM   808  N  N     . GLN A  1 103 ? 15.384  21.906  59.456 1.00 39.98  ? 103 GLN A N     1 
ATOM   809  C  CA    . GLN A  1 103 ? 14.832  22.937  60.335 1.00 40.77  ? 103 GLN A CA    1 
ATOM   810  C  C     . GLN A  1 103 ? 13.605  23.490  59.636 1.00 44.76  ? 103 GLN A C     1 
ATOM   811  O  O     . GLN A  1 103 ? 12.638  23.901  60.271 1.00 45.20  ? 103 GLN A O     1 
ATOM   812  C  CB    . GLN A  1 103 ? 15.860  24.043  60.589 1.00 40.75  ? 103 GLN A CB    1 
ATOM   813  C  CG    . GLN A  1 103 ? 17.056  23.530  61.385 1.00 68.79  ? 103 GLN A CG    1 
ATOM   814  C  CD    . GLN A  1 103 ? 18.258  24.459  61.355 1.00 78.72  ? 103 GLN A CD    1 
ATOM   815  O  OE1   . GLN A  1 103 ? 18.748  24.840  60.285 1.00 70.52  ? 103 GLN A OE1   1 
ATOM   816  N  NE2   . GLN A  1 103 ? 18.753  24.814  62.536 1.00 82.06  ? 103 GLN A NE2   1 
ATOM   817  N  N     . GLN A  1 104 ? 13.628  23.476  58.308 1.00 51.61  ? 104 GLN A N     1 
ATOM   818  C  CA    . GLN A  1 104 ? 12.479  23.948  57.550 1.00 47.33  ? 104 GLN A CA    1 
ATOM   819  C  C     . GLN A  1 104 ? 11.315  22.952  57.646 1.00 55.06  ? 104 GLN A C     1 
ATOM   820  O  O     . GLN A  1 104 ? 10.147  23.346  57.627 1.00 54.34  ? 104 GLN A O     1 
ATOM   821  C  CB    . GLN A  1 104 ? 12.841  24.145  56.086 1.00 52.55  ? 104 GLN A CB    1 
ATOM   822  C  CG    . GLN A  1 104 ? 11.710  24.772  55.318 1.00 63.95  ? 104 GLN A CG    1 
ATOM   823  C  CD    . GLN A  1 104 ? 11.420  26.167  55.837 1.00 76.37  ? 104 GLN A CD    1 
ATOM   824  O  OE1   . GLN A  1 104 ? 10.269  26.625  55.829 1.00 59.88  ? 104 GLN A OE1   1 
ATOM   825  N  NE2   . GLN A  1 104 ? 12.475  26.858  56.292 1.00 56.83  ? 104 GLN A NE2   1 
ATOM   826  N  N     . ASN A  1 105 ? 11.640  21.660  57.724 1.00 52.25  ? 105 ASN A N     1 
ATOM   827  C  CA    . ASN A  1 105 ? 10.626  20.619  57.842 1.00 50.79  ? 105 ASN A CA    1 
ATOM   828  C  C     . ASN A  1 105 ? 11.110  19.419  58.645 1.00 50.39  ? 105 ASN A C     1 
ATOM   829  O  O     . ASN A  1 105 ? 11.603  18.439  58.099 1.00 47.03  ? 105 ASN A O     1 
ATOM   830  C  CB    . ASN A  1 105 ? 10.162  20.124  56.474 1.00 54.21  ? 105 ASN A CB    1 
ATOM   831  C  CG    . ASN A  1 105 ? 9.341   18.859  56.585 1.00 37.64  ? 105 ASN A CG    1 
ATOM   832  O  OD1   . ASN A  1 105 ? 8.709   18.623  57.617 1.00 42.95  ? 105 ASN A OD1   1 
ATOM   833  N  ND2   . ASN A  1 105 ? 9.341   18.038  55.536 1.00 41.78  ? 105 ASN A ND2   1 
ATOM   834  N  N     . PRO A  1 106 ? 10.914  19.468  59.961 1.00 58.31  ? 106 PRO A N     1 
ATOM   835  C  CA    . PRO A  1 106 ? 11.317  18.423  60.902 1.00 55.13  ? 106 PRO A CA    1 
ATOM   836  C  C     . PRO A  1 106 ? 11.028  16.992  60.461 1.00 57.77  ? 106 PRO A C     1 
ATOM   837  O  O     . PRO A  1 106 ? 11.764  16.067  60.813 1.00 49.83  ? 106 PRO A O     1 
ATOM   838  C  CB    . PRO A  1 106 ? 10.547  18.795  62.158 1.00 59.13  ? 106 PRO A CB    1 
ATOM   839  C  CG    . PRO A  1 106 ? 10.431  20.277  62.049 1.00 59.88  ? 106 PRO A CG    1 
ATOM   840  C  CD    . PRO A  1 106 ? 10.042  20.452  60.621 1.00 54.56  ? 106 PRO A CD    1 
ATOM   841  N  N     . ARG A  1 107 ? 9.958   16.801  59.698 1.00 55.56  ? 107 ARG A N     1 
ATOM   842  C  CA    . ARG A  1 107 ? 9.601   15.465  59.242 1.00 43.58  ? 107 ARG A CA    1 
ATOM   843  C  C     . ARG A  1 107 ? 10.346  14.987  57.987 1.00 44.99  ? 107 ARG A C     1 
ATOM   844  O  O     . ARG A  1 107 ? 10.080  13.901  57.481 1.00 50.38  ? 107 ARG A O     1 
ATOM   845  C  CB    . ARG A  1 107 ? 8.089   15.378  59.050 1.00 51.18  ? 107 ARG A CB    1 
ATOM   846  C  CG    . ARG A  1 107 ? 7.320   15.584  60.356 1.00 49.86  ? 107 ARG A CG    1 
ATOM   847  C  CD    . ARG A  1 107 ? 5.836   15.753  60.125 1.00 58.73  ? 107 ARG A CD    1 
ATOM   848  N  NE    . ARG A  1 107 ? 5.228   14.553  59.564 1.00 81.00  ? 107 ARG A NE    1 
ATOM   849  C  CZ    . ARG A  1 107 ? 5.050   13.414  60.231 1.00 86.84  ? 107 ARG A CZ    1 
ATOM   850  N  NH1   . ARG A  1 107 ? 5.438   13.308  61.497 1.00 91.89  ? 107 ARG A NH1   1 
ATOM   851  N  NH2   . ARG A  1 107 ? 4.487   12.377  59.624 1.00 88.69  ? 107 ARG A NH2   1 
ATOM   852  N  N     . LEU A  1 108 ? 11.297  15.779  57.505 1.00 32.06  ? 108 LEU A N     1 
ATOM   853  C  CA    . LEU A  1 108 ? 12.071  15.391  56.332 1.00 34.75  ? 108 LEU A CA    1 
ATOM   854  C  C     . LEU A  1 108 ? 12.876  14.107  56.562 1.00 32.51  ? 108 LEU A C     1 
ATOM   855  O  O     . LEU A  1 108 ? 13.544  13.949  57.588 1.00 37.45  ? 108 LEU A O     1 
ATOM   856  C  CB    . LEU A  1 108 ? 13.021  16.520  55.927 1.00 34.26  ? 108 LEU A CB    1 
ATOM   857  C  CG    . LEU A  1 108 ? 13.890  16.336  54.678 1.00 41.04  ? 108 LEU A CG    1 
ATOM   858  C  CD1   . LEU A  1 108 ? 14.148  17.676  54.013 1.00 40.05  ? 108 LEU A CD1   1 
ATOM   859  C  CD2   . LEU A  1 108 ? 15.200  15.685  55.067 1.00 31.71  ? 108 LEU A CD2   1 
ATOM   860  N  N     . VAL A  1 109 ? 12.816  13.194  55.596 1.00 37.45  ? 109 VAL A N     1 
ATOM   861  C  CA    . VAL A  1 109 ? 13.556  11.940  55.678 1.00 35.01  ? 109 VAL A CA    1 
ATOM   862  C  C     . VAL A  1 109 ? 14.767  12.030  54.769 1.00 36.32  ? 109 VAL A C     1 
ATOM   863  O  O     . VAL A  1 109 ? 14.637  12.147  53.551 1.00 51.69  ? 109 VAL A O     1 
ATOM   864  C  CB    . VAL A  1 109 ? 12.709  10.749  55.212 1.00 37.50  ? 109 VAL A CB    1 
ATOM   865  C  CG1   . VAL A  1 109 ? 13.579  9.514   55.103 1.00 26.24  ? 109 VAL A CG1   1 
ATOM   866  C  CG2   . VAL A  1 109 ? 11.569  10.510  56.174 1.00 30.65  ? 109 VAL A CG2   1 
ATOM   867  N  N     . TYR A  1 110 ? 15.951  11.948  55.349 1.00 39.60  ? 110 TYR A N     1 
ATOM   868  C  CA    . TYR A  1 110 ? 17.168  12.026  54.555 1.00 30.43  ? 110 TYR A CA    1 
ATOM   869  C  C     . TYR A  1 110 ? 17.658  10.615  54.227 1.00 32.39  ? 110 TYR A C     1 
ATOM   870  O  O     . TYR A  1 110 ? 18.018  9.858   55.135 1.00 32.04  ? 110 TYR A O     1 
ATOM   871  C  CB    . TYR A  1 110 ? 18.247  12.818  55.335 1.00 33.79  ? 110 TYR A CB    1 
ATOM   872  C  CG    . TYR A  1 110 ? 19.643  12.846  54.712 1.00 28.09  ? 110 TYR A CG    1 
ATOM   873  C  CD1   . TYR A  1 110 ? 19.820  12.668  53.331 1.00 24.67  ? 110 TYR A CD1   1 
ATOM   874  C  CD2   . TYR A  1 110 ? 20.786  13.033  55.505 1.00 31.65  ? 110 TYR A CD2   1 
ATOM   875  C  CE1   . TYR A  1 110 ? 21.108  12.671  52.743 1.00 29.88  ? 110 TYR A CE1   1 
ATOM   876  C  CE2   . TYR A  1 110 ? 22.087  13.040  54.927 1.00 28.11  ? 110 TYR A CE2   1 
ATOM   877  C  CZ    . TYR A  1 110 ? 22.229  12.859  53.543 1.00 32.91  ? 110 TYR A CZ    1 
ATOM   878  O  OH    . TYR A  1 110 ? 23.466  12.865  52.941 1.00 36.33  ? 110 TYR A OH    1 
ATOM   879  N  N     . VAL A  1 111 ? 17.651  10.270  52.936 1.00 31.38  ? 111 VAL A N     1 
ATOM   880  C  CA    . VAL A  1 111 ? 18.136  8.977   52.455 1.00 26.61  ? 111 VAL A CA    1 
ATOM   881  C  C     . VAL A  1 111 ? 19.569  9.172   51.930 1.00 34.79  ? 111 VAL A C     1 
ATOM   882  O  O     . VAL A  1 111 ? 19.783  9.735   50.857 1.00 34.73  ? 111 VAL A O     1 
ATOM   883  C  CB    . VAL A  1 111 ? 17.296  8.409   51.300 1.00 32.06  ? 111 VAL A CB    1 
ATOM   884  C  CG1   . VAL A  1 111 ? 17.901  7.072   50.866 1.00 21.43  ? 111 VAL A CG1   1 
ATOM   885  C  CG2   . VAL A  1 111 ? 15.804  8.260   51.721 1.00 31.81  ? 111 VAL A CG2   1 
ATOM   886  N  N     . CYS A  1 112 ? 20.534  8.692   52.702 1.00 37.42  ? 112 CYS A N     1 
ATOM   887  C  CA    . CYS A  1 112 ? 21.949  8.808   52.380 1.00 27.31  ? 112 CYS A CA    1 
ATOM   888  C  C     . CYS A  1 112 ? 22.565  7.489   51.926 1.00 30.81  ? 112 CYS A C     1 
ATOM   889  O  O     . CYS A  1 112 ? 22.490  6.484   52.644 1.00 27.44  ? 112 CYS A O     1 
ATOM   890  C  CB    . CYS A  1 112 ? 22.740  9.284   53.619 1.00 16.85  ? 112 CYS A CB    1 
ATOM   891  S  SG    . CYS A  1 112 ? 24.528  9.158   53.367 1.00 37.95  ? 112 CYS A SG    1 
ATOM   892  N  N     . ASP A  1 113 ? 23.142  7.489   50.726 1.00 28.28  ? 113 ASP A N     1 
ATOM   893  C  CA    . ASP A  1 113 ? 23.850  6.325   50.231 1.00 31.89  ? 113 ASP A CA    1 
ATOM   894  C  C     . ASP A  1 113 ? 25.290  6.772   50.445 1.00 30.82  ? 113 ASP A C     1 
ATOM   895  O  O     . ASP A  1 113 ? 25.809  7.584   49.684 1.00 28.21  ? 113 ASP A O     1 
ATOM   896  C  CB    . ASP A  1 113 ? 23.577  6.079   48.742 1.00 28.73  ? 113 ASP A CB    1 
ATOM   897  C  CG    . ASP A  1 113 ? 24.255  4.809   48.220 1.00 36.38  ? 113 ASP A CG    1 
ATOM   898  O  OD1   . ASP A  1 113 ? 24.876  4.092   49.033 1.00 32.89  ? 113 ASP A OD1   1 
ATOM   899  O  OD2   . ASP A  1 113 ? 24.177  4.522   47.000 1.00 37.04  ? 113 ASP A OD2   1 
ATOM   900  N  N     . PRO A  1 114 ? 25.944  6.270   51.504 1.00 41.37  ? 114 PRO A N     1 
ATOM   901  C  CA    . PRO A  1 114 ? 27.331  6.588   51.884 1.00 40.08  ? 114 PRO A CA    1 
ATOM   902  C  C     . PRO A  1 114 ? 28.331  5.920   50.959 1.00 45.20  ? 114 PRO A C     1 
ATOM   903  O  O     . PRO A  1 114 ? 29.068  5.023   51.370 1.00 48.82  ? 114 PRO A O     1 
ATOM   904  C  CB    . PRO A  1 114 ? 27.419  6.037   53.298 1.00 31.97  ? 114 PRO A CB    1 
ATOM   905  C  CG    . PRO A  1 114 ? 26.637  4.746   53.149 1.00 43.61  ? 114 PRO A CG    1 
ATOM   906  C  CD    . PRO A  1 114 ? 25.396  5.218   52.379 1.00 39.10  ? 114 PRO A CD    1 
ATOM   907  N  N     . VAL A  1 115 ? 28.370  6.369   49.712 1.00 40.31  ? 115 VAL A N     1 
ATOM   908  C  CA    . VAL A  1 115 ? 29.251  5.756   48.737 1.00 41.46  ? 115 VAL A CA    1 
ATOM   909  C  C     . VAL A  1 115 ? 30.724  6.038   49.016 1.00 42.18  ? 115 VAL A C     1 
ATOM   910  O  O     . VAL A  1 115 ? 31.162  7.187   48.943 1.00 47.28  ? 115 VAL A O     1 
ATOM   911  C  CB    . VAL A  1 115 ? 28.850  6.217   47.327 1.00 43.04  ? 115 VAL A CB    1 
ATOM   912  C  CG1   . VAL A  1 115 ? 29.675  5.509   46.283 1.00 32.45  ? 115 VAL A CG1   1 
ATOM   913  C  CG2   . VAL A  1 115 ? 27.353  5.927   47.109 1.00 36.01  ? 115 VAL A CG2   1 
ATOM   914  N  N     . LEU A  1 116 ? 31.485  4.982   49.325 1.00 43.83  ? 116 LEU A N     1 
ATOM   915  C  CA    . LEU A  1 116 ? 32.921  5.117   49.639 1.00 41.24  ? 116 LEU A CA    1 
ATOM   916  C  C     . LEU A  1 116 ? 33.812  4.169   48.848 1.00 38.82  ? 116 LEU A C     1 
ATOM   917  O  O     . LEU A  1 116 ? 34.981  4.465   48.572 1.00 48.42  ? 116 LEU A O     1 
ATOM   918  C  CB    . LEU A  1 116 ? 33.160  4.877   51.137 1.00 33.66  ? 116 LEU A CB    1 
ATOM   919  C  CG    . LEU A  1 116 ? 32.270  5.671   52.101 1.00 37.78  ? 116 LEU A CG    1 
ATOM   920  C  CD1   . LEU A  1 116 ? 32.178  5.001   53.458 1.00 34.77  ? 116 LEU A CD1   1 
ATOM   921  C  CD2   . LEU A  1 116 ? 32.798  7.063   52.216 1.00 34.48  ? 116 LEU A CD2   1 
ATOM   922  N  N     . GLY A  1 117 ? 33.280  3.021   48.471 1.00 40.24  ? 117 GLY A N     1 
ATOM   923  C  CA    . GLY A  1 117 ? 34.107  2.078   47.740 1.00 39.99  ? 117 GLY A CA    1 
ATOM   924  C  C     . GLY A  1 117 ? 33.403  0.745   47.691 1.00 35.92  ? 117 GLY A C     1 
ATOM   925  O  O     . GLY A  1 117 ? 32.209  0.662   47.979 1.00 40.78  ? 117 GLY A O     1 
ATOM   926  N  N     . ASP A  1 118 ? 34.134  -0.307  47.359 1.00 41.17  ? 118 ASP A N     1 
ATOM   927  C  CA    . ASP A  1 118 ? 33.521  -1.626  47.267 1.00 48.34  ? 118 ASP A CA    1 
ATOM   928  C  C     . ASP A  1 118 ? 34.557  -2.722  47.409 1.00 38.36  ? 118 ASP A C     1 
ATOM   929  O  O     . ASP A  1 118 ? 35.748  -2.454  47.381 1.00 43.87  ? 118 ASP A O     1 
ATOM   930  C  CB    . ASP A  1 118 ? 32.850  -1.777  45.903 1.00 49.39  ? 118 ASP A CB    1 
ATOM   931  C  CG    . ASP A  1 118 ? 31.557  -2.556  45.963 1.00 40.13  ? 118 ASP A CG    1 
ATOM   932  O  OD1   . ASP A  1 118 ? 31.453  -3.552  46.724 1.00 37.52  ? 118 ASP A OD1   1 
ATOM   933  O  OD2   . ASP A  1 118 ? 30.641  -2.161  45.220 1.00 42.64  ? 118 ASP A OD2   1 
ATOM   934  N  N     . LYS A  1 119 ? 34.088  -3.957  47.540 1.00 43.88  ? 119 LYS A N     1 
ATOM   935  C  CA    . LYS A  1 119 ? 34.975  -5.114  47.643 1.00 57.18  ? 119 LYS A CA    1 
ATOM   936  C  C     . LYS A  1 119 ? 34.950  -5.778  46.283 1.00 62.59  ? 119 LYS A C     1 
ATOM   937  O  O     . LYS A  1 119 ? 33.890  -5.897  45.685 1.00 64.10  ? 119 LYS A O     1 
ATOM   938  C  CB    . LYS A  1 119 ? 34.465  -6.119  48.670 1.00 47.38  ? 119 LYS A CB    1 
ATOM   939  C  CG    . LYS A  1 119 ? 34.585  -5.708  50.112 1.00 46.77  ? 119 LYS A CG    1 
ATOM   940  C  CD    . LYS A  1 119 ? 33.956  -6.778  50.992 1.00 64.64  ? 119 LYS A CD    1 
ATOM   941  C  CE    . LYS A  1 119 ? 33.981  -6.404  52.466 1.00 66.95  ? 119 LYS A CE    1 
ATOM   942  N  NZ    . LYS A  1 119 ? 35.352  -6.414  53.008 1.00 66.42  ? 119 LYS A NZ    1 
ATOM   943  N  N     . TRP A  1 120 ? 36.098  -6.224  45.786 1.00 70.95  ? 120 TRP A N     1 
ATOM   944  C  CA    . TRP A  1 120 ? 36.099  -6.872  44.487 1.00 79.27  ? 120 TRP A CA    1 
ATOM   945  C  C     . TRP A  1 120 ? 36.065  -8.392  44.561 1.00 86.81  ? 120 TRP A C     1 
ATOM   946  O  O     . TRP A  1 120 ? 34.993  -8.997  44.655 1.00 96.17  ? 120 TRP A O     1 
ATOM   947  C  CB    . TRP A  1 120 ? 37.301  -6.431  43.663 1.00 82.91  ? 120 TRP A CB    1 
ATOM   948  C  CG    . TRP A  1 120 ? 36.907  -6.160  42.261 1.00 98.05  ? 120 TRP A CG    1 
ATOM   949  C  CD1   . TRP A  1 120 ? 36.754  -4.934  41.675 1.00 100.00 ? 120 TRP A CD1   1 
ATOM   950  C  CD2   . TRP A  1 120 ? 36.497  -7.128  41.285 1.00 100.00 ? 120 TRP A CD2   1 
ATOM   951  N  NE1   . TRP A  1 120 ? 36.272  -5.078  40.391 1.00 100.00 ? 120 TRP A NE1   1 
ATOM   952  C  CE2   . TRP A  1 120 ? 36.104  -6.413  40.126 1.00 100.00 ? 120 TRP A CE2   1 
ATOM   953  C  CE3   . TRP A  1 120 ? 36.421  -8.529  41.277 1.00 96.41  ? 120 TRP A CE3   1 
ATOM   954  C  CZ2   . TRP A  1 120 ? 35.640  -7.052  38.970 1.00 100.00 ? 120 TRP A CZ2   1 
ATOM   955  C  CZ3   . TRP A  1 120 ? 35.958  -9.166  40.126 1.00 100.00 ? 120 TRP A CZ3   1 
ATOM   956  C  CH2   . TRP A  1 120 ? 35.575  -8.424  38.988 1.00 100.00 ? 120 TRP A CH2   1 
ATOM   957  N  N     . ASP A  1 121 ? 37.235  -9.013  44.510 1.00 91.16  ? 121 ASP A N     1 
ATOM   958  C  CA    . ASP A  1 121 ? 37.309  -10.467 44.563 1.00 94.77  ? 121 ASP A CA    1 
ATOM   959  C  C     . ASP A  1 121 ? 37.099  -10.936 45.990 1.00 94.47  ? 121 ASP A C     1 
ATOM   960  O  O     . ASP A  1 121 ? 36.325  -11.851 46.258 1.00 100.00 ? 121 ASP A O     1 
ATOM   961  C  CB    . ASP A  1 121 ? 38.666  -10.951 44.043 1.00 100.00 ? 121 ASP A CB    1 
ATOM   962  C  CG    . ASP A  1 121 ? 38.529  -12.005 42.951 1.00 100.00 ? 121 ASP A CG    1 
ATOM   963  O  OD1   . ASP A  1 121 ? 37.988  -13.098 43.233 1.00 100.00 ? 121 ASP A OD1   1 
ATOM   964  O  OD2   . ASP A  1 121 ? 38.959  -11.737 41.809 1.00 100.00 ? 121 ASP A OD2   1 
ATOM   965  N  N     . GLY A  1 122 ? 37.797  -10.299 46.913 1.00 93.78  ? 122 GLY A N     1 
ATOM   966  C  CA    . GLY A  1 122 ? 37.648  -10.656 48.308 1.00 94.15  ? 122 GLY A CA    1 
ATOM   967  C  C     . GLY A  1 122 ? 37.497  -9.414  49.155 1.00 91.70  ? 122 GLY A C     1 
ATOM   968  O  O     . GLY A  1 122 ? 36.409  -9.070  49.605 1.00 88.88  ? 122 GLY A O     1 
ATOM   969  N  N     . GLU A  1 123 ? 38.610  -8.730  49.361 1.00 90.76  ? 123 GLU A N     1 
ATOM   970  C  CA    . GLU A  1 123 ? 38.617  -7.506  50.135 1.00 91.56  ? 123 GLU A CA    1 
ATOM   971  C  C     . GLU A  1 123 ? 38.558  -6.371  49.122 1.00 86.70  ? 123 GLU A C     1 
ATOM   972  O  O     . GLU A  1 123 ? 39.040  -6.518  47.998 1.00 85.86  ? 123 GLU A O     1 
ATOM   973  C  CB    . GLU A  1 123 ? 39.887  -7.428  50.984 1.00 99.00  ? 123 GLU A CB    1 
ATOM   974  C  CG    . GLU A  1 123 ? 39.624  -7.396  52.477 1.00 95.69  ? 123 GLU A CG    1 
ATOM   975  C  CD    . GLU A  1 123 ? 38.931  -6.117  52.908 1.00 97.13  ? 123 GLU A CD    1 
ATOM   976  O  OE1   . GLU A  1 123 ? 39.470  -5.023  52.637 1.00 91.52  ? 123 GLU A OE1   1 
ATOM   977  O  OE2   . GLU A  1 123 ? 37.848  -6.199  53.518 1.00 100.00 ? 123 GLU A OE2   1 
ATOM   978  N  N     . GLY A  1 124 ? 37.963  -5.247  49.514 1.00 78.86  ? 124 GLY A N     1 
ATOM   979  C  CA    . GLY A  1 124 ? 37.822  -4.150  48.578 1.00 74.30  ? 124 GLY A CA    1 
ATOM   980  C  C     . GLY A  1 124 ? 38.639  -2.904  48.813 1.00 66.43  ? 124 GLY A C     1 
ATOM   981  O  O     . GLY A  1 124 ? 39.454  -2.841  49.724 1.00 76.10  ? 124 GLY A O     1 
ATOM   982  N  N     . SER A  1 125 ? 38.409  -1.907  47.964 1.00 58.06  ? 125 SER A N     1 
ATOM   983  C  CA    . SER A  1 125 ? 39.111  -0.641  48.034 1.00 51.72  ? 125 SER A CA    1 
ATOM   984  C  C     . SER A  1 125 ? 38.160  0.535   47.892 1.00 57.54  ? 125 SER A C     1 
ATOM   985  O  O     . SER A  1 125 ? 37.069  0.410   47.338 1.00 48.92  ? 125 SER A O     1 
ATOM   986  C  CB    . SER A  1 125 ? 40.175  -0.569  46.943 1.00 61.96  ? 125 SER A CB    1 
ATOM   987  O  OG    . SER A  1 125 ? 39.620  -0.819  45.665 1.00 68.05  ? 125 SER A OG    1 
ATOM   988  N  N     . MET A  1 126 ? 38.589  1.680   48.407 1.00 55.48  ? 126 MET A N     1 
ATOM   989  C  CA    . MET A  1 126 ? 37.806  2.899   48.353 1.00 51.66  ? 126 MET A CA    1 
ATOM   990  C  C     . MET A  1 126 ? 38.010  3.540   46.996 1.00 52.00  ? 126 MET A C     1 
ATOM   991  O  O     . MET A  1 126 ? 39.024  3.304   46.347 1.00 55.79  ? 126 MET A O     1 
ATOM   992  C  CB    . MET A  1 126 ? 38.298  3.895   49.417 1.00 53.60  ? 126 MET A CB    1 
ATOM   993  C  CG    . MET A  1 126 ? 37.984  3.545   50.861 1.00 51.98  ? 126 MET A CG    1 
ATOM   994  S  SD    . MET A  1 126 ? 38.360  4.939   51.959 1.00 72.52  ? 126 MET A SD    1 
ATOM   995  C  CE    . MET A  1 126 ? 37.054  6.071   51.582 1.00 57.08  ? 126 MET A CE    1 
ATOM   996  N  N     . TYR A  1 127 ? 37.039  4.322   46.545 1.00 53.68  ? 127 TYR A N     1 
ATOM   997  C  CA    . TYR A  1 127 ? 37.223  5.040   45.294 1.00 60.58  ? 127 TYR A CA    1 
ATOM   998  C  C     . TYR A  1 127 ? 36.717  6.456   45.465 1.00 54.55  ? 127 TYR A C     1 
ATOM   999  O  O     . TYR A  1 127 ? 36.138  7.078   44.577 1.00 57.06  ? 127 TYR A O     1 
ATOM   1000 C  CB    . TYR A  1 127 ? 36.595  4.336   44.079 1.00 63.86  ? 127 TYR A CB    1 
ATOM   1001 C  CG    . TYR A  1 127 ? 35.352  3.534   44.307 1.00 57.35  ? 127 TYR A CG    1 
ATOM   1002 C  CD1   . TYR A  1 127 ? 34.195  4.133   44.806 1.00 63.69  ? 127 TYR A CD1   1 
ATOM   1003 C  CD2   . TYR A  1 127 ? 35.298  2.183   43.922 1.00 54.59  ? 127 TYR A CD2   1 
ATOM   1004 C  CE1   . TYR A  1 127 ? 33.003  3.412   44.912 1.00 64.00  ? 127 TYR A CE1   1 
ATOM   1005 C  CE2   . TYR A  1 127 ? 34.111  1.448   44.021 1.00 54.02  ? 127 TYR A CE2   1 
ATOM   1006 C  CZ    . TYR A  1 127 ? 32.962  2.075   44.515 1.00 65.01  ? 127 TYR A CZ    1 
ATOM   1007 O  OH    . TYR A  1 127 ? 31.760  1.392   44.597 1.00 75.30  ? 127 TYR A OH    1 
ATOM   1008 N  N     . VAL A  1 128 ? 37.006  6.947   46.660 1.00 57.35  ? 128 VAL A N     1 
ATOM   1009 C  CA    . VAL A  1 128 ? 36.684  8.279   47.099 1.00 54.17  ? 128 VAL A CA    1 
ATOM   1010 C  C     . VAL A  1 128 ? 37.869  8.682   47.971 1.00 57.47  ? 128 VAL A C     1 
ATOM   1011 O  O     . VAL A  1 128 ? 38.476  7.841   48.625 1.00 59.10  ? 128 VAL A O     1 
ATOM   1012 C  CB    . VAL A  1 128 ? 35.385  8.277   47.920 1.00 49.11  ? 128 VAL A CB    1 
ATOM   1013 C  CG1   . VAL A  1 128 ? 35.432  9.339   48.968 1.00 60.80  ? 128 VAL A CG1   1 
ATOM   1014 C  CG2   . VAL A  1 128 ? 34.199  8.513   47.001 1.00 58.46  ? 128 VAL A CG2   1 
ATOM   1015 N  N     . PRO A  1 129 ? 38.240  9.967   47.956 1.00 59.98  ? 129 PRO A N     1 
ATOM   1016 C  CA    . PRO A  1 129 ? 39.364  10.411  48.780 1.00 57.06  ? 129 PRO A CA    1 
ATOM   1017 C  C     . PRO A  1 129 ? 39.071  10.020  50.223 1.00 53.96  ? 129 PRO A C     1 
ATOM   1018 O  O     . PRO A  1 129 ? 37.931  10.098  50.662 1.00 51.43  ? 129 PRO A O     1 
ATOM   1019 C  CB    . PRO A  1 129 ? 39.351  11.915  48.573 1.00 57.26  ? 129 PRO A CB    1 
ATOM   1020 C  CG    . PRO A  1 129 ? 38.865  12.037  47.162 1.00 62.05  ? 129 PRO A CG    1 
ATOM   1021 C  CD    . PRO A  1 129 ? 37.717  11.071  47.136 1.00 57.40  ? 129 PRO A CD    1 
ATOM   1022 N  N     . GLU A  1 130 ? 40.089  9.597   50.961 1.00 55.45  ? 130 GLU A N     1 
ATOM   1023 C  CA    . GLU A  1 130 ? 39.895  9.182   52.344 1.00 52.54  ? 130 GLU A CA    1 
ATOM   1024 C  C     . GLU A  1 130 ? 39.347  10.247  53.294 1.00 61.12  ? 130 GLU A C     1 
ATOM   1025 O  O     . GLU A  1 130 ? 38.593  9.918   54.215 1.00 61.46  ? 130 GLU A O     1 
ATOM   1026 C  CB    . GLU A  1 130 ? 41.193  8.633   52.911 1.00 52.90  ? 130 GLU A CB    1 
ATOM   1027 C  CG    . GLU A  1 130 ? 41.624  7.293   52.336 1.00 71.69  ? 130 GLU A CG    1 
ATOM   1028 C  CD    . GLU A  1 130 ? 43.020  6.887   52.807 1.00 79.34  ? 130 GLU A CD    1 
ATOM   1029 O  OE1   . GLU A  1 130 ? 43.276  6.924   54.032 1.00 89.59  ? 130 GLU A OE1   1 
ATOM   1030 O  OE2   . GLU A  1 130 ? 43.863  6.531   51.957 1.00 78.42  ? 130 GLU A OE2   1 
ATOM   1031 N  N     . ASP A  1 131 ? 39.728  11.511  53.098 1.00 59.10  ? 131 ASP A N     1 
ATOM   1032 C  CA    . ASP A  1 131 ? 39.251  12.590  53.973 1.00 56.46  ? 131 ASP A CA    1 
ATOM   1033 C  C     . ASP A  1 131 ? 37.727  12.678  54.044 1.00 50.03  ? 131 ASP A C     1 
ATOM   1034 O  O     . ASP A  1 131 ? 37.172  13.397  54.877 1.00 57.65  ? 131 ASP A O     1 
ATOM   1035 C  CB    . ASP A  1 131 ? 39.822  13.945  53.533 1.00 53.02  ? 131 ASP A CB    1 
ATOM   1036 C  CG    . ASP A  1 131 ? 39.826  14.123  52.026 1.00 73.03  ? 131 ASP A CG    1 
ATOM   1037 O  OD1   . ASP A  1 131 ? 40.517  13.333  51.341 1.00 87.77  ? 131 ASP A OD1   1 
ATOM   1038 O  OD2   . ASP A  1 131 ? 39.146  15.051  51.524 1.00 70.92  ? 131 ASP A OD2   1 
ATOM   1039 N  N     . LEU A  1 132 ? 37.053  11.927  53.181 1.00 49.79  ? 132 LEU A N     1 
ATOM   1040 C  CA    . LEU A  1 132 ? 35.600  11.927  53.141 1.00 45.55  ? 132 LEU A CA    1 
ATOM   1041 C  C     . LEU A  1 132 ? 34.974  11.094  54.245 1.00 38.72  ? 132 LEU A C     1 
ATOM   1042 O  O     . LEU A  1 132 ? 33.936  11.457  54.798 1.00 47.15  ? 132 LEU A O     1 
ATOM   1043 C  CB    . LEU A  1 132 ? 35.124  11.417  51.783 1.00 51.46  ? 132 LEU A CB    1 
ATOM   1044 C  CG    . LEU A  1 132 ? 34.224  12.395  51.030 1.00 55.90  ? 132 LEU A CG    1 
ATOM   1045 C  CD1   . LEU A  1 132 ? 34.996  13.652  50.717 1.00 61.78  ? 132 LEU A CD1   1 
ATOM   1046 C  CD2   . LEU A  1 132 ? 33.739  11.771  49.755 1.00 54.46  ? 132 LEU A CD2   1 
ATOM   1047 N  N     . LEU A  1 133 ? 35.611  9.970   54.563 1.00 37.34  ? 133 LEU A N     1 
ATOM   1048 C  CA    . LEU A  1 133 ? 35.104  9.059   55.582 1.00 43.41  ? 133 LEU A CA    1 
ATOM   1049 C  C     . LEU A  1 133 ? 34.773  9.751   56.901 1.00 44.31  ? 133 LEU A C     1 
ATOM   1050 O  O     . LEU A  1 133 ? 33.701  9.529   57.475 1.00 46.82  ? 133 LEU A O     1 
ATOM   1051 C  CB    . LEU A  1 133 ? 36.095  7.904   55.811 1.00 37.41  ? 133 LEU A CB    1 
ATOM   1052 C  CG    . LEU A  1 133 ? 35.678  6.836   56.828 1.00 46.60  ? 133 LEU A CG    1 
ATOM   1053 C  CD1   . LEU A  1 133 ? 34.380  6.162   56.397 1.00 44.93  ? 133 LEU A CD1   1 
ATOM   1054 C  CD2   . LEU A  1 133 ? 36.792  5.814   56.966 1.00 43.93  ? 133 LEU A CD2   1 
ATOM   1055 N  N     . PRO A  1 134 ? 35.687  10.594  57.407 1.00 48.81  ? 134 PRO A N     1 
ATOM   1056 C  CA    . PRO A  1 134 ? 35.402  11.280  58.669 1.00 39.40  ? 134 PRO A CA    1 
ATOM   1057 C  C     . PRO A  1 134 ? 34.132  12.138  58.589 1.00 38.46  ? 134 PRO A C     1 
ATOM   1058 O  O     . PRO A  1 134 ? 33.342  12.203  59.539 1.00 42.19  ? 134 PRO A O     1 
ATOM   1059 C  CB    . PRO A  1 134 ? 36.663  12.115  58.892 1.00 39.86  ? 134 PRO A CB    1 
ATOM   1060 C  CG    . PRO A  1 134 ? 37.718  11.293  58.271 1.00 33.64  ? 134 PRO A CG    1 
ATOM   1061 C  CD    . PRO A  1 134 ? 37.079  10.842  56.985 1.00 38.92  ? 134 PRO A CD    1 
ATOM   1062 N  N     . VAL A  1 135 ? 33.927  12.800  57.457 1.00 46.22  ? 135 VAL A N     1 
ATOM   1063 C  CA    . VAL A  1 135 ? 32.735  13.640  57.312 1.00 45.57  ? 135 VAL A CA    1 
ATOM   1064 C  C     . VAL A  1 135 ? 31.479  12.777  57.301 1.00 43.03  ? 135 VAL A C     1 
ATOM   1065 O  O     . VAL A  1 135 ? 30.452  13.141  57.889 1.00 40.76  ? 135 VAL A O     1 
ATOM   1066 C  CB    . VAL A  1 135 ? 32.773  14.461  56.014 1.00 45.25  ? 135 VAL A CB    1 
ATOM   1067 C  CG1   . VAL A  1 135 ? 31.495  15.290  55.878 1.00 47.90  ? 135 VAL A CG1   1 
ATOM   1068 C  CG2   . VAL A  1 135 ? 33.975  15.348  56.010 1.00 42.06  ? 135 VAL A CG2   1 
ATOM   1069 N  N     . TYR A  1 136 ? 31.555  11.637  56.625 1.00 44.00  ? 136 TYR A N     1 
ATOM   1070 C  CA    . TYR A  1 136 ? 30.403  10.744  56.590 1.00 44.69  ? 136 TYR A CA    1 
ATOM   1071 C  C     . TYR A  1 136 ? 30.088  10.254  57.994 1.00 42.27  ? 136 TYR A C     1 
ATOM   1072 O  O     . TYR A  1 136 ? 28.918  10.260  58.419 1.00 38.84  ? 136 TYR A O     1 
ATOM   1073 C  CB    . TYR A  1 136 ? 30.663  9.544   55.681 1.00 34.95  ? 136 TYR A CB    1 
ATOM   1074 C  CG    . TYR A  1 136 ? 30.166  9.729   54.264 1.00 39.08  ? 136 TYR A CG    1 
ATOM   1075 C  CD1   . TYR A  1 136 ? 28.808  9.901   53.986 1.00 33.68  ? 136 TYR A CD1   1 
ATOM   1076 C  CD2   . TYR A  1 136 ? 31.056  9.732   53.201 1.00 27.12  ? 136 TYR A CD2   1 
ATOM   1077 C  CE1   . TYR A  1 136 ? 28.360  10.070  52.671 1.00 28.87  ? 136 TYR A CE1   1 
ATOM   1078 C  CE2   . TYR A  1 136 ? 30.630  9.902   51.905 1.00 32.85  ? 136 TYR A CE2   1 
ATOM   1079 C  CZ    . TYR A  1 136 ? 29.285  10.074  51.635 1.00 35.58  ? 136 TYR A CZ    1 
ATOM   1080 O  OH    . TYR A  1 136 ? 28.903  10.278  50.321 1.00 34.32  ? 136 TYR A OH    1 
ATOM   1081 N  N     . LYS A  1 137 ? 31.125  9.837   58.722 1.00 36.23  ? 137 LYS A N     1 
ATOM   1082 C  CA    . LYS A  1 137 ? 30.923  9.335   60.091 1.00 44.27  ? 137 LYS A CA    1 
ATOM   1083 C  C     . LYS A  1 137 ? 30.478  10.415  61.063 1.00 39.04  ? 137 LYS A C     1 
ATOM   1084 O  O     . LYS A  1 137 ? 29.540  10.231  61.848 1.00 38.51  ? 137 LYS A O     1 
ATOM   1085 C  CB    . LYS A  1 137 ? 32.205  8.666   60.620 1.00 40.13  ? 137 LYS A CB    1 
ATOM   1086 C  CG    . LYS A  1 137 ? 32.735  7.602   59.682 1.00 45.72  ? 137 LYS A CG    1 
ATOM   1087 C  CD    . LYS A  1 137 ? 33.481  6.496   60.404 1.00 57.88  ? 137 LYS A CD    1 
ATOM   1088 C  CE    . LYS A  1 137 ? 34.829  6.950   60.929 1.00 58.29  ? 137 LYS A CE    1 
ATOM   1089 N  NZ    . LYS A  1 137 ? 35.760  5.786   61.096 1.00 58.88  ? 137 LYS A NZ    1 
ATOM   1090 N  N     . GLU A  1 138 ? 31.134  11.565  60.976 1.00 44.93  ? 138 GLU A N     1 
ATOM   1091 C  CA    . GLU A  1 138 ? 30.853  12.657  61.890 1.00 50.88  ? 138 GLU A CA    1 
ATOM   1092 C  C     . GLU A  1 138 ? 29.717  13.579  61.498 1.00 47.89  ? 138 GLU A C     1 
ATOM   1093 O  O     . GLU A  1 138 ? 28.947  13.999  62.348 1.00 49.51  ? 138 GLU A O     1 
ATOM   1094 C  CB    . GLU A  1 138 ? 32.132  13.474  62.097 1.00 52.18  ? 138 GLU A CB    1 
ATOM   1095 C  CG    . GLU A  1 138 ? 33.290  12.683  62.724 1.00 48.75  ? 138 GLU A CG    1 
ATOM   1096 C  CD    . GLU A  1 138 ? 34.621  13.430  62.664 1.00 62.04  ? 138 GLU A CD    1 
ATOM   1097 O  OE1   . GLU A  1 138 ? 34.614  14.674  62.734 1.00 71.84  ? 138 GLU A OE1   1 
ATOM   1098 O  OE2   . GLU A  1 138 ? 35.682  12.779  62.550 1.00 65.08  ? 138 GLU A OE2   1 
ATOM   1099 N  N     . LYS A  1 139 ? 29.590  13.876  60.214 1.00 51.99  ? 139 LYS A N     1 
ATOM   1100 C  CA    . LYS A  1 139 ? 28.559  14.803  59.781 1.00 53.39  ? 139 LYS A CA    1 
ATOM   1101 C  C     . LYS A  1 139 ? 27.346  14.226  59.060 1.00 47.77  ? 139 LYS A C     1 
ATOM   1102 O  O     . LYS A  1 139 ? 26.201  14.482  59.437 1.00 49.86  ? 139 LYS A O     1 
ATOM   1103 C  CB    . LYS A  1 139 ? 29.193  15.878  58.888 1.00 50.84  ? 139 LYS A CB    1 
ATOM   1104 C  CG    . LYS A  1 139 ? 30.324  16.664  59.531 1.00 44.11  ? 139 LYS A CG    1 
ATOM   1105 C  CD    . LYS A  1 139 ? 29.859  17.323  60.817 1.00 62.18  ? 139 LYS A CD    1 
ATOM   1106 C  CE    . LYS A  1 139 ? 30.994  18.074  61.499 1.00 69.92  ? 139 LYS A CE    1 
ATOM   1107 N  NZ    . LYS A  1 139 ? 30.743  18.306  62.959 1.00 73.10  ? 139 LYS A NZ    1 
ATOM   1108 N  N     . VAL A  1 140 ? 27.604  13.451  58.015 1.00 43.87  ? 140 VAL A N     1 
ATOM   1109 C  CA    . VAL A  1 140 ? 26.539  12.891  57.190 1.00 34.76  ? 140 VAL A CA    1 
ATOM   1110 C  C     . VAL A  1 140 ? 25.623  11.869  57.835 1.00 38.59  ? 140 VAL A C     1 
ATOM   1111 O  O     . VAL A  1 140 ? 24.419  12.115  57.981 1.00 32.01  ? 140 VAL A O     1 
ATOM   1112 C  CB    . VAL A  1 140 ? 27.141  12.300  55.919 1.00 43.00  ? 140 VAL A CB    1 
ATOM   1113 C  CG1   . VAL A  1 140 ? 26.026  11.925  54.918 1.00 35.46  ? 140 VAL A CG1   1 
ATOM   1114 C  CG2   . VAL A  1 140 ? 28.121  13.315  55.336 1.00 38.90  ? 140 VAL A CG2   1 
ATOM   1115 N  N     . VAL A  1 141 ? 26.187  10.726  58.235 1.00 43.75  ? 141 VAL A N     1 
ATOM   1116 C  CA    . VAL A  1 141 ? 25.385  9.664   58.840 1.00 42.88  ? 141 VAL A CA    1 
ATOM   1117 C  C     . VAL A  1 141 ? 24.568  10.075  60.070 1.00 42.00  ? 141 VAL A C     1 
ATOM   1118 O  O     . VAL A  1 141 ? 23.418  9.654   60.215 1.00 42.44  ? 141 VAL A O     1 
ATOM   1119 C  CB    . VAL A  1 141 ? 26.250  8.426   59.129 1.00 42.19  ? 141 VAL A CB    1 
ATOM   1120 C  CG1   . VAL A  1 141 ? 25.431  7.345   59.794 1.00 40.01  ? 141 VAL A CG1   1 
ATOM   1121 C  CG2   . VAL A  1 141 ? 26.809  7.895   57.813 1.00 37.03  ? 141 VAL A CG2   1 
ATOM   1122 N  N     . PRO A  1 142 ? 25.134  10.902  60.972 1.00 39.29  ? 142 PRO A N     1 
ATOM   1123 C  CA    . PRO A  1 142 ? 24.292  11.261  62.118 1.00 34.47  ? 142 PRO A CA    1 
ATOM   1124 C  C     . PRO A  1 142 ? 23.032  12.015  61.672 1.00 40.82  ? 142 PRO A C     1 
ATOM   1125 O  O     . PRO A  1 142 ? 22.011  11.980  62.354 1.00 30.32  ? 142 PRO A O     1 
ATOM   1126 C  CB    . PRO A  1 142 ? 25.213  12.117  62.976 1.00 35.73  ? 142 PRO A CB    1 
ATOM   1127 C  CG    . PRO A  1 142 ? 26.597  11.581  62.645 1.00 39.11  ? 142 PRO A CG    1 
ATOM   1128 C  CD    . PRO A  1 142 ? 26.520  11.369  61.156 1.00 46.83  ? 142 PRO A CD    1 
ATOM   1129 N  N     . LEU A  1 143 ? 23.097  12.688  60.524 1.00 41.37  ? 143 LEU A N     1 
ATOM   1130 C  CA    . LEU A  1 143 ? 21.937  13.426  60.020 1.00 46.05  ? 143 LEU A CA    1 
ATOM   1131 C  C     . LEU A  1 143 ? 20.947  12.535  59.265 1.00 46.64  ? 143 LEU A C     1 
ATOM   1132 O  O     . LEU A  1 143 ? 19.741  12.811  59.221 1.00 40.23  ? 143 LEU A O     1 
ATOM   1133 C  CB    . LEU A  1 143 ? 22.384  14.560  59.091 1.00 47.35  ? 143 LEU A CB    1 
ATOM   1134 C  CG    . LEU A  1 143 ? 22.252  15.990  59.614 1.00 51.56  ? 143 LEU A CG    1 
ATOM   1135 C  CD1   . LEU A  1 143 ? 22.567  16.923  58.463 1.00 50.65  ? 143 LEU A CD1   1 
ATOM   1136 C  CD2   . LEU A  1 143 ? 20.841  16.254  60.151 1.00 45.73  ? 143 LEU A CD2   1 
ATOM   1137 N  N     . ALA A  1 144 ? 21.473  11.468  58.674 1.00 38.51  ? 144 ALA A N     1 
ATOM   1138 C  CA    . ALA A  1 144 ? 20.686  10.532  57.887 1.00 37.28  ? 144 ALA A CA    1 
ATOM   1139 C  C     . ALA A  1 144 ? 19.637  9.733   58.621 1.00 37.24  ? 144 ALA A C     1 
ATOM   1140 O  O     . ALA A  1 144 ? 19.839  9.302   59.750 1.00 42.14  ? 144 ALA A O     1 
ATOM   1141 C  CB    . ALA A  1 144 ? 21.587  9.597   57.194 1.00 34.44  ? 144 ALA A CB    1 
ATOM   1142 N  N     . ASP A  1 145 ? 18.507  9.526   57.962 1.00 35.03  ? 145 ASP A N     1 
ATOM   1143 C  CA    . ASP A  1 145 ? 17.443  8.727   58.551 1.00 33.60  ? 145 ASP A CA    1 
ATOM   1144 C  C     . ASP A  1 145 ? 17.461  7.310   57.978 1.00 41.11  ? 145 ASP A C     1 
ATOM   1145 O  O     . ASP A  1 145 ? 17.030  6.364   58.632 1.00 36.55  ? 145 ASP A O     1 
ATOM   1146 C  CB    . ASP A  1 145 ? 16.098  9.366   58.279 1.00 42.14  ? 145 ASP A CB    1 
ATOM   1147 C  CG    . ASP A  1 145 ? 16.015  10.760  58.832 1.00 47.36  ? 145 ASP A CG    1 
ATOM   1148 O  OD1   . ASP A  1 145 ? 16.361  11.718  58.102 1.00 42.13  ? 145 ASP A OD1   1 
ATOM   1149 O  OD2   . ASP A  1 145 ? 15.624  10.891  60.008 1.00 60.38  ? 145 ASP A OD2   1 
ATOM   1150 N  N     . ILE A  1 146 ? 17.963  7.181   56.752 1.00 37.92  ? 146 ILE A N     1 
ATOM   1151 C  CA    . ILE A  1 146 ? 18.050  5.894   56.073 1.00 31.90  ? 146 ILE A CA    1 
ATOM   1152 C  C     . ILE A  1 146 ? 19.399  5.837   55.375 1.00 36.80  ? 146 ILE A C     1 
ATOM   1153 O  O     . ILE A  1 146 ? 19.757  6.770   54.659 1.00 31.39  ? 146 ILE A O     1 
ATOM   1154 C  CB    . ILE A  1 146 ? 16.926  5.752   55.006 1.00 33.99  ? 146 ILE A CB    1 
ATOM   1155 C  CG1   . ILE A  1 146 ? 15.559  5.687   55.701 1.00 35.60  ? 146 ILE A CG1   1 
ATOM   1156 C  CG2   . ILE A  1 146 ? 17.155  4.501   54.154 1.00 31.56  ? 146 ILE A CG2   1 
ATOM   1157 C  CD1   . ILE A  1 146 ? 14.365  5.447   54.772 1.00 31.43  ? 146 ILE A CD1   1 
ATOM   1158 N  N     . ILE A  1 147 ? 20.171  4.774   55.599 1.00 35.93  ? 147 ILE A N     1 
ATOM   1159 C  CA    . ILE A  1 147 ? 21.443  4.663   54.902 1.00 32.82  ? 147 ILE A CA    1 
ATOM   1160 C  C     . ILE A  1 147 ? 21.477  3.329   54.200 1.00 26.47  ? 147 ILE A C     1 
ATOM   1161 O  O     . ILE A  1 147 ? 20.904  2.358   54.663 1.00 30.89  ? 147 ILE A O     1 
ATOM   1162 C  CB    . ILE A  1 147 ? 22.698  4.832   55.825 1.00 27.61  ? 147 ILE A CB    1 
ATOM   1163 C  CG1   . ILE A  1 147 ? 22.708  3.803   56.941 1.00 28.52  ? 147 ILE A CG1   1 
ATOM   1164 C  CG2   . ILE A  1 147 ? 22.737  6.251   56.354 1.00 28.11  ? 147 ILE A CG2   1 
ATOM   1165 C  CD1   . ILE A  1 147 ? 24.096  3.568   57.489 1.00 30.56  ? 147 ILE A CD1   1 
ATOM   1166 N  N     . THR A  1 148 ? 22.166  3.305   53.073 1.00 32.65  ? 148 THR A N     1 
ATOM   1167 C  CA    . THR A  1 148 ? 22.247  2.131   52.213 1.00 33.21  ? 148 THR A CA    1 
ATOM   1168 C  C     . THR A  1 148 ? 23.685  1.706   51.903 1.00 30.84  ? 148 THR A C     1 
ATOM   1169 O  O     . THR A  1 148 ? 24.066  1.601   50.751 1.00 28.24  ? 148 THR A O     1 
ATOM   1170 C  CB    . THR A  1 148 ? 21.531  2.440   50.882 1.00 30.33  ? 148 THR A CB    1 
ATOM   1171 O  OG1   . THR A  1 148 ? 22.158  3.576   50.258 1.00 27.82  ? 148 THR A OG1   1 
ATOM   1172 C  CG2   . THR A  1 148 ? 20.066  2.794   51.135 1.00 28.14  ? 148 THR A CG2   1 
ATOM   1173 N  N     . PRO A  1 149 ? 24.500  1.441   52.923 1.00 37.47  ? 149 PRO A N     1 
ATOM   1174 C  CA    . PRO A  1 149 ? 25.854  1.045   52.524 1.00 30.61  ? 149 PRO A CA    1 
ATOM   1175 C  C     . PRO A  1 149 ? 25.913  -0.421  52.092 1.00 37.39  ? 149 PRO A C     1 
ATOM   1176 O  O     . PRO A  1 149 ? 25.020  -1.213  52.410 1.00 41.53  ? 149 PRO A O     1 
ATOM   1177 C  CB    . PRO A  1 149 ? 26.657  1.266   53.797 1.00 26.17  ? 149 PRO A CB    1 
ATOM   1178 C  CG    . PRO A  1 149 ? 25.665  0.781   54.860 1.00 28.48  ? 149 PRO A CG    1 
ATOM   1179 C  CD    . PRO A  1 149 ? 24.349  1.443   54.394 1.00 37.98  ? 149 PRO A CD    1 
ATOM   1180 N  N     . ASN A  1 150 ? 26.951  -0.755  51.335 1.00 32.97  ? 150 ASN A N     1 
ATOM   1181 C  CA    . ASN A  1 150 ? 27.194  -2.117  50.936 1.00 28.68  ? 150 ASN A CA    1 
ATOM   1182 C  C     . ASN A  1 150 ? 28.105  -2.609  52.101 1.00 40.43  ? 150 ASN A C     1 
ATOM   1183 O  O     . ASN A  1 150 ? 28.458  -1.817  52.979 1.00 34.65  ? 150 ASN A O     1 
ATOM   1184 C  CB    . ASN A  1 150 ? 27.917  -2.173  49.568 1.00 29.21  ? 150 ASN A CB    1 
ATOM   1185 C  CG    . ASN A  1 150 ? 29.255  -1.427  49.553 1.00 34.43  ? 150 ASN A CG    1 
ATOM   1186 O  OD1   . ASN A  1 150 ? 29.863  -1.158  50.596 1.00 36.51  ? 150 ASN A OD1   1 
ATOM   1187 N  ND2   . ASN A  1 150 ? 29.729  -1.114  48.351 1.00 29.26  ? 150 ASN A ND2   1 
ATOM   1188 N  N     . GLN A  1 151 ? 28.487  -3.882  52.114 1.00 30.38  ? 151 GLN A N     1 
ATOM   1189 C  CA    . GLN A  1 151 ? 29.300  -4.414  53.209 1.00 38.42  ? 151 GLN A CA    1 
ATOM   1190 C  C     . GLN A  1 151 ? 30.536  -3.571  53.539 1.00 42.11  ? 151 GLN A C     1 
ATOM   1191 O  O     . GLN A  1 151 ? 30.745  -3.184  54.696 1.00 37.04  ? 151 GLN A O     1 
ATOM   1192 C  CB    . GLN A  1 151 ? 29.742  -5.847  52.903 1.00 32.87  ? 151 GLN A CB    1 
ATOM   1193 C  CG    . GLN A  1 151 ? 30.300  -6.591  54.111 1.00 39.19  ? 151 GLN A CG    1 
ATOM   1194 C  CD    . GLN A  1 151 ? 30.844  -7.963  53.746 1.00 52.21  ? 151 GLN A CD    1 
ATOM   1195 O  OE1   . GLN A  1 151 ? 30.148  -8.773  53.142 1.00 62.48  ? 151 GLN A OE1   1 
ATOM   1196 N  NE2   . GLN A  1 151 ? 32.096  -8.226  54.111 1.00 55.50  ? 151 GLN A NE2   1 
ATOM   1197 N  N     . PHE A  1 152 ? 31.347  -3.319  52.520 1.00 35.34  ? 152 PHE A N     1 
ATOM   1198 C  CA    . PHE A  1 152 ? 32.552  -2.521  52.641 1.00 37.73  ? 152 PHE A CA    1 
ATOM   1199 C  C     . PHE A  1 152 ? 32.290  -1.164  53.315 1.00 42.95  ? 152 PHE A C     1 
ATOM   1200 O  O     . PHE A  1 152 ? 32.971  -0.784  54.266 1.00 46.20  ? 152 PHE A O     1 
ATOM   1201 C  CB    . PHE A  1 152 ? 33.132  -2.293  51.248 1.00 48.53  ? 152 PHE A CB    1 
ATOM   1202 C  CG    . PHE A  1 152 ? 34.463  -1.611  51.256 1.00 49.35  ? 152 PHE A CG    1 
ATOM   1203 C  CD1   . PHE A  1 152 ? 35.567  -2.240  51.810 1.00 54.39  ? 152 PHE A CD1   1 
ATOM   1204 C  CD2   . PHE A  1 152 ? 34.610  -0.327  50.740 1.00 55.20  ? 152 PHE A CD2   1 
ATOM   1205 C  CE1   . PHE A  1 152 ? 36.805  -1.603  51.857 1.00 58.27  ? 152 PHE A CE1   1 
ATOM   1206 C  CE2   . PHE A  1 152 ? 35.848  0.325   50.780 1.00 60.27  ? 152 PHE A CE2   1 
ATOM   1207 C  CZ    . PHE A  1 152 ? 36.945  -0.318  51.342 1.00 53.67  ? 152 PHE A CZ    1 
ATOM   1208 N  N     . GLU A  1 153 ? 31.304  -0.429  52.820 1.00 37.89  ? 153 GLU A N     1 
ATOM   1209 C  CA    . GLU A  1 153 ? 30.984  0.861   53.409 1.00 39.83  ? 153 GLU A CA    1 
ATOM   1210 C  C     . GLU A  1 153 ? 30.520  0.723   54.860 1.00 43.58  ? 153 GLU A C     1 
ATOM   1211 O  O     . GLU A  1 153 ? 30.877  1.548   55.700 1.00 47.46  ? 153 GLU A O     1 
ATOM   1212 C  CB    . GLU A  1 153 ? 29.950  1.598   52.524 1.00 28.91  ? 153 GLU A CB    1 
ATOM   1213 C  CG    . GLU A  1 153 ? 30.555  1.880   51.142 1.00 38.70  ? 153 GLU A CG    1 
ATOM   1214 C  CD    . GLU A  1 153 ? 29.549  2.046   49.997 1.00 33.85  ? 153 GLU A CD    1 
ATOM   1215 O  OE1   . GLU A  1 153 ? 28.351  1.739   50.172 1.00 29.42  ? 153 GLU A OE1   1 
ATOM   1216 O  OE2   . GLU A  1 153 ? 29.990  2.467   48.906 1.00 35.70  ? 153 GLU A OE2   1 
ATOM   1217 N  N     . ALA A  1 154 ? 29.745  -0.316  55.172 1.00 41.21  ? 154 ALA A N     1 
ATOM   1218 C  CA    . ALA A  1 154 ? 29.298  -0.518  56.558 1.00 42.97  ? 154 ALA A CA    1 
ATOM   1219 C  C     . ALA A  1 154 ? 30.483  -0.783  57.515 1.00 46.72  ? 154 ALA A C     1 
ATOM   1220 O  O     . ALA A  1 154 ? 30.438  -0.445  58.705 1.00 39.82  ? 154 ALA A O     1 
ATOM   1221 C  CB    . ALA A  1 154 ? 28.334  -1.678  56.628 1.00 37.03  ? 154 ALA A CB    1 
ATOM   1222 N  N     . GLU A  1 155 ? 31.530  -1.397  56.974 1.00 29.22  ? 155 GLU A N     1 
ATOM   1223 C  CA    . GLU A  1 155 ? 32.701  -1.751  57.739 1.00 43.11  ? 155 GLU A CA    1 
ATOM   1224 C  C     . GLU A  1 155 ? 33.498  -0.489  57.988 1.00 47.24  ? 155 GLU A C     1 
ATOM   1225 O  O     . GLU A  1 155 ? 33.937  -0.234  59.108 1.00 57.00  ? 155 GLU A O     1 
ATOM   1226 C  CB    . GLU A  1 155 ? 33.544  -2.795  56.971 1.00 46.26  ? 155 GLU A CB    1 
ATOM   1227 C  CG    . GLU A  1 155 ? 32.798  -4.105  56.686 1.00 42.17  ? 155 GLU A CG    1 
ATOM   1228 C  CD    . GLU A  1 155 ? 33.668  -5.197  56.076 1.00 36.69  ? 155 GLU A CD    1 
ATOM   1229 O  OE1   . GLU A  1 155 ? 34.489  -4.900  55.190 1.00 53.45  ? 155 GLU A OE1   1 
ATOM   1230 O  OE2   . GLU A  1 155 ? 33.514  -6.371  56.475 1.00 55.20  ? 155 GLU A OE2   1 
ATOM   1231 N  N     . LEU A  1 156 ? 33.662  0.306   56.935 1.00 50.05  ? 156 LEU A N     1 
ATOM   1232 C  CA    . LEU A  1 156 ? 34.394  1.557   57.026 1.00 41.29  ? 156 LEU A CA    1 
ATOM   1233 C  C     . LEU A  1 156 ? 33.744  2.525   57.997 1.00 44.64  ? 156 LEU A C     1 
ATOM   1234 O  O     . LEU A  1 156 ? 34.435  3.162   58.786 1.00 42.28  ? 156 LEU A O     1 
ATOM   1235 C  CB    . LEU A  1 156 ? 34.481  2.234   55.659 1.00 40.85  ? 156 LEU A CB    1 
ATOM   1236 C  CG    . LEU A  1 156 ? 35.381  1.627   54.586 1.00 56.54  ? 156 LEU A CG    1 
ATOM   1237 C  CD1   . LEU A  1 156 ? 35.230  2.419   53.298 1.00 51.11  ? 156 LEU A CD1   1 
ATOM   1238 C  CD2   . LEU A  1 156 ? 36.823  1.659   55.049 1.00 52.61  ? 156 LEU A CD2   1 
ATOM   1239 N  N     . LEU A  1 157 ? 32.419  2.634   57.931 1.00 39.78  ? 157 LEU A N     1 
ATOM   1240 C  CA    . LEU A  1 157 ? 31.684  3.555   58.784 1.00 36.21  ? 157 LEU A CA    1 
ATOM   1241 C  C     . LEU A  1 157 ? 31.611  3.088   60.232 1.00 52.15  ? 157 LEU A C     1 
ATOM   1242 O  O     . LEU A  1 157 ? 31.280  3.871   61.127 1.00 52.77  ? 157 LEU A O     1 
ATOM   1243 C  CB    . LEU A  1 157 ? 30.266  3.742   58.256 1.00 43.15  ? 157 LEU A CB    1 
ATOM   1244 C  CG    . LEU A  1 157 ? 30.055  4.321   56.857 1.00 39.55  ? 157 LEU A CG    1 
ATOM   1245 C  CD1   . LEU A  1 157 ? 28.579  4.284   56.535 1.00 28.48  ? 157 LEU A CD1   1 
ATOM   1246 C  CD2   . LEU A  1 157 ? 30.561  5.741   56.797 1.00 39.25  ? 157 LEU A CD2   1 
ATOM   1247 N  N     . SER A  1 158 ? 31.928  1.819   60.473 1.00 47.02  ? 158 SER A N     1 
ATOM   1248 C  CA    . SER A  1 158 ? 31.851  1.276   61.830 1.00 52.36  ? 158 SER A CA    1 
ATOM   1249 C  C     . SER A  1 158 ? 33.207  0.931   62.413 1.00 44.72  ? 158 SER A C     1 
ATOM   1250 O  O     . SER A  1 158 ? 33.356  0.849   63.625 1.00 58.31  ? 158 SER A O     1 
ATOM   1251 C  CB    . SER A  1 158 ? 31.010  0.007   61.846 1.00 49.12  ? 158 SER A CB    1 
ATOM   1252 O  OG    . SER A  1 158 ? 31.738  -1.023  61.204 1.00 40.40  ? 158 SER A OG    1 
ATOM   1253 N  N     . GLY A  1 159 ? 34.182  0.710   61.545 1.00 55.94  ? 159 GLY A N     1 
ATOM   1254 C  CA    . GLY A  1 159 ? 35.503  0.347   62.012 1.00 54.14  ? 159 GLY A CA    1 
ATOM   1255 C  C     . GLY A  1 159 ? 35.589  -1.139  62.312 1.00 54.84  ? 159 GLY A C     1 
ATOM   1256 O  O     . GLY A  1 159 ? 36.619  -1.619  62.777 1.00 56.09  ? 159 GLY A O     1 
ATOM   1257 N  N     . ARG A  1 160 ? 34.506  -1.870  62.063 1.00 45.68  ? 160 ARG A N     1 
ATOM   1258 C  CA    . ARG A  1 160 ? 34.499  -3.312  62.301 1.00 49.59  ? 160 ARG A CA    1 
ATOM   1259 C  C     . ARG A  1 160 ? 34.369  -4.117  61.012 1.00 55.16  ? 160 ARG A C     1 
ATOM   1260 O  O     . ARG A  1 160 ? 33.629  -3.749  60.099 1.00 58.99  ? 160 ARG A O     1 
ATOM   1261 C  CB    . ARG A  1 160 ? 33.368  -3.720  63.238 1.00 46.71  ? 160 ARG A CB    1 
ATOM   1262 C  CG    . ARG A  1 160 ? 33.435  -3.066  64.580 1.00 61.52  ? 160 ARG A CG    1 
ATOM   1263 C  CD    . ARG A  1 160 ? 32.770  -3.909  65.666 1.00 75.24  ? 160 ARG A CD    1 
ATOM   1264 N  NE    . ARG A  1 160 ? 32.897  -3.242  66.959 1.00 94.16  ? 160 ARG A NE    1 
ATOM   1265 C  CZ    . ARG A  1 160 ? 34.054  -2.829  67.477 1.00 100.00 ? 160 ARG A CZ    1 
ATOM   1266 N  NH1   . ARG A  1 160 ? 35.192  -3.022  66.817 1.00 100.00 ? 160 ARG A NH1   1 
ATOM   1267 N  NH2   . ARG A  1 160 ? 34.076  -2.196  68.644 1.00 100.00 ? 160 ARG A NH2   1 
ATOM   1268 N  N     . LYS A  1 161 ? 35.094  -5.222  60.953 1.00 51.39  ? 161 LYS A N     1 
ATOM   1269 C  CA    . LYS A  1 161 ? 35.075  -6.106  59.801 1.00 46.50  ? 161 LYS A CA    1 
ATOM   1270 C  C     . LYS A  1 161 ? 33.845  -6.975  59.957 1.00 43.60  ? 161 LYS A C     1 
ATOM   1271 O  O     . LYS A  1 161 ? 33.446  -7.273  61.073 1.00 48.47  ? 161 LYS A O     1 
ATOM   1272 C  CB    . LYS A  1 161 ? 36.314  -6.981  59.823 1.00 51.00  ? 161 LYS A CB    1 
ATOM   1273 C  CG    . LYS A  1 161 ? 36.742  -7.517  58.498 1.00 62.24  ? 161 LYS A CG    1 
ATOM   1274 C  CD    . LYS A  1 161 ? 38.098  -8.159  58.662 1.00 71.18  ? 161 LYS A CD    1 
ATOM   1275 C  CE    . LYS A  1 161 ? 38.887  -8.135  57.368 1.00 82.22  ? 161 LYS A CE    1 
ATOM   1276 N  NZ    . LYS A  1 161 ? 40.311  -8.524  57.596 1.00 86.36  ? 161 LYS A NZ    1 
ATOM   1277 N  N     . ILE A  1 162 ? 33.243  -7.374  58.847 1.00 42.36  ? 162 ILE A N     1 
ATOM   1278 C  CA    . ILE A  1 162 ? 32.052  -8.218  58.892 1.00 49.39  ? 162 ILE A CA    1 
ATOM   1279 C  C     . ILE A  1 162 ? 32.358  -9.572  58.237 1.00 49.78  ? 162 ILE A C     1 
ATOM   1280 O  O     . ILE A  1 162 ? 32.611  -9.636  57.033 1.00 64.56  ? 162 ILE A O     1 
ATOM   1281 C  CB    . ILE A  1 162 ? 30.874  -7.531  58.156 1.00 40.00  ? 162 ILE A CB    1 
ATOM   1282 C  CG1   . ILE A  1 162 ? 30.543  -6.204  58.846 1.00 44.12  ? 162 ILE A CG1   1 
ATOM   1283 C  CG2   . ILE A  1 162 ? 29.653  -8.447  58.124 1.00 44.69  ? 162 ILE A CG2   1 
ATOM   1284 C  CD1   . ILE A  1 162 ? 29.364  -5.431  58.235 1.00 32.72  ? 162 ILE A CD1   1 
ATOM   1285 N  N     . HIS A  1 163 ? 32.354  -10.643 59.024 1.00 49.57  ? 163 HIS A N     1 
ATOM   1286 C  CA    . HIS A  1 163 ? 32.631  -11.985 58.495 1.00 53.74  ? 163 HIS A CA    1 
ATOM   1287 C  C     . HIS A  1 163 ? 31.392  -12.877 58.518 1.00 54.23  ? 163 HIS A C     1 
ATOM   1288 O  O     . HIS A  1 163 ? 31.380  -13.927 57.889 1.00 53.49  ? 163 HIS A O     1 
ATOM   1289 C  CB    . HIS A  1 163 ? 33.692  -12.743 59.306 1.00 62.39  ? 163 HIS A CB    1 
ATOM   1290 C  CG    . HIS A  1 163 ? 34.915  -11.953 59.651 1.00 65.96  ? 163 HIS A CG    1 
ATOM   1291 N  ND1   . HIS A  1 163 ? 35.009  -11.193 60.799 1.00 67.33  ? 163 HIS A ND1   1 
ATOM   1292 C  CD2   . HIS A  1 163 ? 36.122  -11.876 59.048 1.00 64.99  ? 163 HIS A CD2   1 
ATOM   1293 C  CE1   . HIS A  1 163 ? 36.227  -10.689 60.890 1.00 74.32  ? 163 HIS A CE1   1 
ATOM   1294 N  NE2   . HIS A  1 163 ? 36.922  -11.089 59.841 1.00 64.81  ? 163 HIS A NE2   1 
ATOM   1295 N  N     . SER A  1 164 ? 30.366  -12.487 59.263 1.00 42.68  ? 164 SER A N     1 
ATOM   1296 C  CA    . SER A  1 164 ? 29.168  -13.311 59.348 1.00 46.74  ? 164 SER A CA    1 
ATOM   1297 C  C     . SER A  1 164 ? 27.918  -12.459 59.353 1.00 37.61  ? 164 SER A C     1 
ATOM   1298 O  O     . SER A  1 164 ? 27.993  -11.239 59.401 1.00 36.46  ? 164 SER A O     1 
ATOM   1299 C  CB    . SER A  1 164 ? 29.186  -14.114 60.639 1.00 46.66  ? 164 SER A CB    1 
ATOM   1300 O  OG    . SER A  1 164 ? 28.981  -13.248 61.745 1.00 44.49  ? 164 SER A OG    1 
ATOM   1301 N  N     . GLN A  1 165 ? 26.768  -13.124 59.322 1.00 44.33  ? 165 GLN A N     1 
ATOM   1302 C  CA    . GLN A  1 165 ? 25.490  -12.441 59.372 1.00 33.96  ? 165 GLN A CA    1 
ATOM   1303 C  C     . GLN A  1 165 ? 25.365  -11.718 60.717 1.00 42.88  ? 165 GLN A C     1 
ATOM   1304 O  O     . GLN A  1 165 ? 24.934  -10.565 60.769 1.00 48.77  ? 165 GLN A O     1 
ATOM   1305 C  CB    . GLN A  1 165 ? 24.321  -13.435 59.225 1.00 32.91  ? 165 GLN A CB    1 
ATOM   1306 C  CG    . GLN A  1 165 ? 22.987  -12.803 59.648 1.00 42.33  ? 165 GLN A CG    1 
ATOM   1307 C  CD    . GLN A  1 165 ? 21.766  -13.644 59.333 1.00 35.71  ? 165 GLN A CD    1 
ATOM   1308 O  OE1   . GLN A  1 165 ? 21.554  -14.037 58.194 1.00 39.60  ? 165 GLN A OE1   1 
ATOM   1309 N  NE2   . GLN A  1 165 ? 20.944  -13.905 60.346 1.00 38.59  ? 165 GLN A NE2   1 
ATOM   1310 N  N     . GLU A  1 166 ? 25.742  -12.398 61.796 1.00 36.93  ? 166 GLU A N     1 
ATOM   1311 C  CA    . GLU A  1 166 ? 25.639  -11.843 63.141 1.00 29.25  ? 166 GLU A CA    1 
ATOM   1312 C  C     . GLU A  1 166 ? 26.456  -10.578 63.346 1.00 29.06  ? 166 GLU A C     1 
ATOM   1313 O  O     . GLU A  1 166 ? 26.001  -9.627  63.999 1.00 37.04  ? 166 GLU A O     1 
ATOM   1314 C  CB    . GLU A  1 166 ? 26.048  -12.893 64.194 1.00 38.96  ? 166 GLU A CB    1 
ATOM   1315 C  CG    . GLU A  1 166 ? 25.144  -14.120 64.256 1.00 31.41  ? 166 GLU A CG    1 
ATOM   1316 C  CD    . GLU A  1 166 ? 25.514  -15.182 63.236 1.00 32.89  ? 166 GLU A CD    1 
ATOM   1317 O  OE1   . GLU A  1 166 ? 26.336  -14.914 62.333 1.00 40.72  ? 166 GLU A OE1   1 
ATOM   1318 O  OE2   . GLU A  1 166 ? 24.969  -16.290 63.334 1.00 45.10  ? 166 GLU A OE2   1 
ATOM   1319 N  N     . GLU A  1 167 ? 27.675  -10.587 62.817 1.00 34.86  ? 167 GLU A N     1 
ATOM   1320 C  CA    . GLU A  1 167 ? 28.557  -9.436  62.889 1.00 39.54  ? 167 GLU A CA    1 
ATOM   1321 C  C     . GLU A  1 167 ? 27.977  -8.287  62.061 1.00 45.50  ? 167 GLU A C     1 
ATOM   1322 O  O     . GLU A  1 167 ? 28.124  -7.121  62.423 1.00 42.16  ? 167 GLU A O     1 
ATOM   1323 C  CB    . GLU A  1 167 ? 29.949  -9.799  62.354 1.00 31.37  ? 167 GLU A CB    1 
ATOM   1324 C  CG    . GLU A  1 167 ? 30.769  -10.638 63.341 1.00 59.97  ? 167 GLU A CG    1 
ATOM   1325 C  CD    . GLU A  1 167 ? 32.229  -10.839 62.931 1.00 56.62  ? 167 GLU A CD    1 
ATOM   1326 O  OE1   . GLU A  1 167 ? 33.033  -11.280 63.785 1.00 67.44  ? 167 GLU A OE1   1 
ATOM   1327 O  OE2   . GLU A  1 167 ? 32.575  -10.568 61.766 1.00 57.51  ? 167 GLU A OE2   1 
ATOM   1328 N  N     . ALA A  1 168 ? 27.318  -8.620  60.950 1.00 41.11  ? 168 ALA A N     1 
ATOM   1329 C  CA    . ALA A  1 168 ? 26.729  -7.608  60.086 1.00 35.54  ? 168 ALA A CA    1 
ATOM   1330 C  C     . ALA A  1 168 ? 25.615  -6.896  60.846 1.00 38.88  ? 168 ALA A C     1 
ATOM   1331 O  O     . ALA A  1 168 ? 25.519  -5.666  60.811 1.00 36.33  ? 168 ALA A O     1 
ATOM   1332 C  CB    . ALA A  1 168 ? 26.187  -8.249  58.808 1.00 29.74  ? 168 ALA A CB    1 
ATOM   1333 N  N     . LEU A  1 169 ? 24.800  -7.667  61.563 1.00 36.75  ? 169 LEU A N     1 
ATOM   1334 C  CA    . LEU A  1 169 ? 23.697  -7.099  62.328 1.00 40.49  ? 169 LEU A CA    1 
ATOM   1335 C  C     . LEU A  1 169 ? 24.215  -6.291  63.506 1.00 47.83  ? 169 LEU A C     1 
ATOM   1336 O  O     . LEU A  1 169 ? 23.557  -5.360  63.959 1.00 42.97  ? 169 LEU A O     1 
ATOM   1337 C  CB    . LEU A  1 169 ? 22.756  -8.200  62.819 1.00 39.22  ? 169 LEU A CB    1 
ATOM   1338 C  CG    . LEU A  1 169 ? 22.159  -9.045  61.694 1.00 46.96  ? 169 LEU A CG    1 
ATOM   1339 C  CD1   . LEU A  1 169 ? 21.487  -10.275 62.286 1.00 52.05  ? 169 LEU A CD1   1 
ATOM   1340 C  CD2   . LEU A  1 169 ? 21.178  -8.209  60.884 1.00 39.97  ? 169 LEU A CD2   1 
ATOM   1341 N  N     . ARG A  1 170 ? 25.394  -6.641  64.012 1.00 51.65  ? 170 ARG A N     1 
ATOM   1342 C  CA    . ARG A  1 170 ? 25.960  -5.877  65.126 1.00 48.96  ? 170 ARG A CA    1 
ATOM   1343 C  C     . ARG A  1 170 ? 26.474  -4.538  64.587 1.00 45.00  ? 170 ARG A C     1 
ATOM   1344 O  O     . ARG A  1 170 ? 26.271  -3.493  65.206 1.00 42.63  ? 170 ARG A O     1 
ATOM   1345 C  CB    . ARG A  1 170 ? 27.100  -6.657  65.827 1.00 39.62  ? 170 ARG A CB    1 
ATOM   1346 C  CG    . ARG A  1 170 ? 26.585  -7.705  66.838 1.00 53.31  ? 170 ARG A CG    1 
ATOM   1347 C  CD    . ARG A  1 170 ? 27.676  -8.238  67.782 1.00 48.15  ? 170 ARG A CD    1 
ATOM   1348 N  NE    . ARG A  1 170 ? 28.608  -9.164  67.141 1.00 47.23  ? 170 ARG A NE    1 
ATOM   1349 C  CZ    . ARG A  1 170 ? 28.381  -10.462 66.955 1.00 39.25  ? 170 ARG A CZ    1 
ATOM   1350 N  NH1   . ARG A  1 170 ? 27.247  -11.028 67.367 1.00 28.03  ? 170 ARG A NH1   1 
ATOM   1351 N  NH2   . ARG A  1 170 ? 29.290  -11.190 66.329 1.00 33.54  ? 170 ARG A NH2   1 
ATOM   1352 N  N     . VAL A  1 171 ? 27.141  -4.588  63.436 1.00 43.80  ? 171 VAL A N     1 
ATOM   1353 C  CA    . VAL A  1 171 ? 27.664  -3.399  62.790 1.00 38.42  ? 171 VAL A CA    1 
ATOM   1354 C  C     . VAL A  1 171 ? 26.486  -2.494  62.439 1.00 47.43  ? 171 VAL A C     1 
ATOM   1355 O  O     . VAL A  1 171 ? 26.589  -1.268  62.489 1.00 45.62  ? 171 VAL A O     1 
ATOM   1356 C  CB    . VAL A  1 171 ? 28.466  -3.762  61.503 1.00 36.61  ? 171 VAL A CB    1 
ATOM   1357 C  CG1   . VAL A  1 171 ? 28.514  -2.586  60.561 1.00 28.72  ? 171 VAL A CG1   1 
ATOM   1358 C  CG2   . VAL A  1 171 ? 29.908  -4.134  61.869 1.00 32.02  ? 171 VAL A CG2   1 
ATOM   1359 N  N     . MET A  1 172 ? 25.355  -3.100  62.099 1.00 39.73  ? 172 MET A N     1 
ATOM   1360 C  CA    . MET A  1 172 ? 24.186  -2.309  61.758 1.00 36.37  ? 172 MET A CA    1 
ATOM   1361 C  C     . MET A  1 172 ? 23.621  -1.620  62.984 1.00 36.97  ? 172 MET A C     1 
ATOM   1362 O  O     . MET A  1 172 ? 23.049  -0.525  62.889 1.00 41.31  ? 172 MET A O     1 
ATOM   1363 C  CB    . MET A  1 172 ? 23.146  -3.185  61.068 1.00 30.18  ? 172 MET A CB    1 
ATOM   1364 C  CG    . MET A  1 172 ? 23.595  -3.603  59.654 1.00 30.07  ? 172 MET A CG    1 
ATOM   1365 S  SD    . MET A  1 172 ? 22.604  -4.937  58.942 1.00 45.77  ? 172 MET A SD    1 
ATOM   1366 C  CE    . MET A  1 172 ? 21.165  -4.116  58.653 1.00 26.84  ? 172 MET A CE    1 
ATOM   1367 N  N     . ASP A  1 173 ? 23.794  -2.258  64.139 1.00 41.56  ? 173 ASP A N     1 
ATOM   1368 C  CA    . ASP A  1 173 ? 23.339  -1.692  65.407 1.00 37.43  ? 173 ASP A CA    1 
ATOM   1369 C  C     . ASP A  1 173 ? 24.184  -0.459  65.735 1.00 41.60  ? 173 ASP A C     1 
ATOM   1370 O  O     . ASP A  1 173 ? 23.669  0.538   66.237 1.00 38.56  ? 173 ASP A O     1 
ATOM   1371 C  CB    . ASP A  1 173 ? 23.427  -2.730  66.521 1.00 39.71  ? 173 ASP A CB    1 
ATOM   1372 C  CG    . ASP A  1 173 ? 22.232  -3.656  66.531 1.00 55.43  ? 173 ASP A CG    1 
ATOM   1373 O  OD1   . ASP A  1 173 ? 21.234  -3.350  65.841 1.00 49.91  ? 173 ASP A OD1   1 
ATOM   1374 O  OD2   . ASP A  1 173 ? 22.287  -4.680  67.234 1.00 62.20  ? 173 ASP A OD2   1 
ATOM   1375 N  N     . MET A  1 174 ? 25.477  -0.541  65.421 1.00 32.94  ? 174 MET A N     1 
ATOM   1376 C  CA    . MET A  1 174 ? 26.399  0.563   65.611 1.00 39.84  ? 174 MET A CA    1 
ATOM   1377 C  C     . MET A  1 174 ? 25.996  1.750   64.718 1.00 46.27  ? 174 MET A C     1 
ATOM   1378 O  O     . MET A  1 174 ? 25.900  2.888   65.185 1.00 42.28  ? 174 MET A O     1 
ATOM   1379 C  CB    . MET A  1 174 ? 27.813  0.117   65.254 1.00 44.62  ? 174 MET A CB    1 
ATOM   1380 C  CG    . MET A  1 174 ? 28.339  -1.023  66.134 1.00 49.11  ? 174 MET A CG    1 
ATOM   1381 S  SD    . MET A  1 174 ? 30.019  -1.562  65.666 1.00 56.03  ? 174 MET A SD    1 
ATOM   1382 C  CE    . MET A  1 174 ? 30.913  -0.036  65.909 1.00 44.11  ? 174 MET A CE    1 
ATOM   1383 N  N     . LEU A  1 175 ? 25.770  1.486   63.434 1.00 44.52  ? 175 LEU A N     1 
ATOM   1384 C  CA    . LEU A  1 175 ? 25.357  2.534   62.510 1.00 34.83  ? 175 LEU A CA    1 
ATOM   1385 C  C     . LEU A  1 175 ? 24.035  3.134   63.000 1.00 41.68  ? 175 LEU A C     1 
ATOM   1386 O  O     . LEU A  1 175 ? 23.809  4.346   62.888 1.00 39.24  ? 175 LEU A O     1 
ATOM   1387 C  CB    . LEU A  1 175 ? 25.204  1.962   61.101 1.00 30.34  ? 175 LEU A CB    1 
ATOM   1388 C  CG    . LEU A  1 175 ? 26.493  1.282   60.644 1.00 30.97  ? 175 LEU A CG    1 
ATOM   1389 C  CD1   . LEU A  1 175 ? 26.273  0.557   59.341 1.00 31.76  ? 175 LEU A CD1   1 
ATOM   1390 C  CD2   . LEU A  1 175 ? 27.582  2.320   60.523 1.00 24.59  ? 175 LEU A CD2   1 
ATOM   1391 N  N     . HIS A  1 176 ? 23.160  2.301   63.554 1.00 36.33  ? 176 HIS A N     1 
ATOM   1392 C  CA    . HIS A  1 176 ? 21.884  2.820   64.077 1.00 39.91  ? 176 HIS A CA    1 
ATOM   1393 C  C     . HIS A  1 176 ? 22.151  3.844   65.188 1.00 54.40  ? 176 HIS A C     1 
ATOM   1394 O  O     . HIS A  1 176 ? 21.540  4.917   65.235 1.00 48.25  ? 176 HIS A O     1 
ATOM   1395 C  CB    . HIS A  1 176 ? 21.053  1.711   64.706 1.00 30.44  ? 176 HIS A CB    1 
ATOM   1396 C  CG    . HIS A  1 176 ? 20.215  0.941   63.741 1.00 48.57  ? 176 HIS A CG    1 
ATOM   1397 N  ND1   . HIS A  1 176 ? 19.212  1.524   62.994 1.00 43.00  ? 176 HIS A ND1   1 
ATOM   1398 C  CD2   . HIS A  1 176 ? 20.191  -0.379  63.443 1.00 41.19  ? 176 HIS A CD2   1 
ATOM   1399 C  CE1   . HIS A  1 176 ? 18.606  0.593   62.279 1.00 47.30  ? 176 HIS A CE1   1 
ATOM   1400 N  NE2   . HIS A  1 176 ? 19.180  -0.569  62.533 1.00 41.00  ? 176 HIS A NE2   1 
ATOM   1401 N  N     . SER A  1 177 ? 23.054  3.484   66.100 1.00 46.17  ? 177 SER A N     1 
ATOM   1402 C  CA    . SER A  1 177 ? 23.382  4.341   67.216 1.00 38.37  ? 177 SER A CA    1 
ATOM   1403 C  C     . SER A  1 177 ? 24.017  5.626   66.735 1.00 46.42  ? 177 SER A C     1 
ATOM   1404 O  O     . SER A  1 177 ? 24.052  6.621   67.469 1.00 46.43  ? 177 SER A O     1 
ATOM   1405 C  CB    . SER A  1 177 ? 24.310  3.621   68.197 1.00 31.49  ? 177 SER A CB    1 
ATOM   1406 O  OG    . SER A  1 177 ? 25.648  3.629   67.726 1.00 51.11  ? 177 SER A OG    1 
ATOM   1407 N  N     . MET A  1 178 ? 24.540  5.610   65.511 1.00 39.31  ? 178 MET A N     1 
ATOM   1408 C  CA    . MET A  1 178 ? 25.136  6.807   64.943 1.00 35.47  ? 178 MET A CA    1 
ATOM   1409 C  C     . MET A  1 178 ? 24.050  7.770   64.468 1.00 43.74  ? 178 MET A C     1 
ATOM   1410 O  O     . MET A  1 178 ? 24.323  8.914   64.103 1.00 35.71  ? 178 MET A O     1 
ATOM   1411 C  CB    . MET A  1 178 ? 26.061  6.442   63.784 1.00 43.10  ? 178 MET A CB    1 
ATOM   1412 C  CG    . MET A  1 178 ? 27.376  5.863   64.215 1.00 42.36  ? 178 MET A CG    1 
ATOM   1413 S  SD    . MET A  1 178 ? 28.207  4.960   62.925 1.00 56.86  ? 178 MET A SD    1 
ATOM   1414 C  CE    . MET A  1 178 ? 29.003  6.209   62.124 1.00 42.32  ? 178 MET A CE    1 
ATOM   1415 N  N     . GLY A  1 179 ? 22.818  7.279   64.437 1.00 40.86  ? 179 GLY A N     1 
ATOM   1416 C  CA    . GLY A  1 179 ? 21.712  8.107   64.000 1.00 31.61  ? 179 GLY A CA    1 
ATOM   1417 C  C     . GLY A  1 179 ? 20.645  7.472   63.113 1.00 38.40  ? 179 GLY A C     1 
ATOM   1418 O  O     . GLY A  1 179 ? 19.464  7.471   63.482 1.00 43.49  ? 179 GLY A O     1 
ATOM   1419 N  N     . PRO A  1 180 ? 21.010  6.895   61.956 1.00 35.99  ? 180 PRO A N     1 
ATOM   1420 C  CA    . PRO A  1 180 ? 19.963  6.315   61.104 1.00 37.34  ? 180 PRO A CA    1 
ATOM   1421 C  C     . PRO A  1 180 ? 19.098  5.229   61.734 1.00 43.77  ? 180 PRO A C     1 
ATOM   1422 O  O     . PRO A  1 180 ? 19.605  4.283   62.342 1.00 45.37  ? 180 PRO A O     1 
ATOM   1423 C  CB    . PRO A  1 180 ? 20.734  5.785   59.891 1.00 25.78  ? 180 PRO A CB    1 
ATOM   1424 C  CG    . PRO A  1 180 ? 22.014  6.576   59.896 1.00 43.74  ? 180 PRO A CG    1 
ATOM   1425 C  CD    . PRO A  1 180 ? 22.345  6.730   61.355 1.00 39.13  ? 180 PRO A CD    1 
ATOM   1426 N  N     . ASP A  1 181 ? 17.784  5.383   61.561 1.00 31.77  ? 181 ASP A N     1 
ATOM   1427 C  CA    . ASP A  1 181 ? 16.796  4.437   62.046 1.00 40.19  ? 181 ASP A CA    1 
ATOM   1428 C  C     . ASP A  1 181 ? 16.649  3.263   61.068 1.00 42.26  ? 181 ASP A C     1 
ATOM   1429 O  O     . ASP A  1 181 ? 16.199  2.184   61.443 1.00 53.01  ? 181 ASP A O     1 
ATOM   1430 C  CB    . ASP A  1 181 ? 15.443  5.137   62.228 1.00 30.84  ? 181 ASP A CB    1 
ATOM   1431 C  CG    . ASP A  1 181 ? 15.433  6.081   63.436 1.00 57.89  ? 181 ASP A CG    1 
ATOM   1432 O  OD1   . ASP A  1 181 ? 14.550  6.965   63.521 1.00 67.89  ? 181 ASP A OD1   1 
ATOM   1433 O  OD2   . ASP A  1 181 ? 16.312  5.927   64.309 1.00 50.43  ? 181 ASP A OD2   1 
ATOM   1434 N  N     . THR A  1 182 ? 17.003  3.480   59.808 1.00 38.76  ? 182 THR A N     1 
ATOM   1435 C  CA    . THR A  1 182 ? 16.910  2.412   58.827 1.00 32.60  ? 182 THR A CA    1 
ATOM   1436 C  C     . THR A  1 182 ? 18.270  2.184   58.195 1.00 39.54  ? 182 THR A C     1 
ATOM   1437 O  O     . THR A  1 182 ? 18.865  3.104   57.620 1.00 39.54  ? 182 THR A O     1 
ATOM   1438 C  CB    . THR A  1 182 ? 15.903  2.724   57.711 1.00 24.87  ? 182 THR A CB    1 
ATOM   1439 O  OG1   . THR A  1 182 ? 14.582  2.854   58.268 1.00 41.13  ? 182 THR A OG1   1 
ATOM   1440 C  CG2   . THR A  1 182 ? 15.863  1.593   56.709 1.00 26.55  ? 182 THR A CG2   1 
ATOM   1441 N  N     . VAL A  1 183 ? 18.772  0.963   58.334 1.00 31.86  ? 183 VAL A N     1 
ATOM   1442 C  CA    . VAL A  1 183 ? 20.048  0.603   57.748 1.00 37.01  ? 183 VAL A CA    1 
ATOM   1443 C  C     . VAL A  1 183 ? 19.824  -0.623  56.884 1.00 34.46  ? 183 VAL A C     1 
ATOM   1444 O  O     . VAL A  1 183 ? 19.244  -1.608  57.322 1.00 40.12  ? 183 VAL A O     1 
ATOM   1445 C  CB    . VAL A  1 183 ? 21.115  0.247   58.812 1.00 35.72  ? 183 VAL A CB    1 
ATOM   1446 C  CG1   . VAL A  1 183 ? 22.370  -0.263  58.122 1.00 35.44  ? 183 VAL A CG1   1 
ATOM   1447 C  CG2   . VAL A  1 183 ? 21.455  1.473   59.661 1.00 34.33  ? 183 VAL A CG2   1 
ATOM   1448 N  N     . VAL A  1 184 ? 20.273  -0.541  55.646 1.00 39.65  ? 184 VAL A N     1 
ATOM   1449 C  CA    . VAL A  1 184 ? 20.146  -1.650  54.732 1.00 31.01  ? 184 VAL A CA    1 
ATOM   1450 C  C     . VAL A  1 184 ? 21.482  -1.865  54.056 1.00 38.81  ? 184 VAL A C     1 
ATOM   1451 O  O     . VAL A  1 184 ? 21.994  -0.973  53.369 1.00 38.58  ? 184 VAL A O     1 
ATOM   1452 C  CB    . VAL A  1 184 ? 19.050  -1.391  53.677 1.00 29.96  ? 184 VAL A CB    1 
ATOM   1453 C  CG1   . VAL A  1 184 ? 19.095  -2.445  52.570 1.00 29.53  ? 184 VAL A CG1   1 
ATOM   1454 C  CG2   . VAL A  1 184 ? 17.674  -1.406  54.369 1.00 25.58  ? 184 VAL A CG2   1 
ATOM   1455 N  N     . ILE A  1 185 ? 22.080  -3.025  54.294 1.00 35.13  ? 185 ILE A N     1 
ATOM   1456 C  CA    . ILE A  1 185 ? 23.351  -3.336  53.640 1.00 41.99  ? 185 ILE A CA    1 
ATOM   1457 C  C     . ILE A  1 185 ? 22.894  -3.925  52.311 1.00 35.98  ? 185 ILE A C     1 
ATOM   1458 O  O     . ILE A  1 185 ? 22.304  -4.997  52.260 1.00 40.73  ? 185 ILE A O     1 
ATOM   1459 C  CB    . ILE A  1 185 ? 24.171  -4.355  54.446 1.00 32.30  ? 185 ILE A CB    1 
ATOM   1460 C  CG1   . ILE A  1 185 ? 24.542  -3.737  55.800 1.00 29.91  ? 185 ILE A CG1   1 
ATOM   1461 C  CG2   . ILE A  1 185 ? 25.407  -4.792  53.637 1.00 23.51  ? 185 ILE A CG2   1 
ATOM   1462 C  CD1   . ILE A  1 185 ? 25.362  -4.684  56.752 1.00 34.70  ? 185 ILE A CD1   1 
ATOM   1463 N  N     . THR A  1 186 ? 23.167  -3.198  51.239 1.00 38.28  ? 186 THR A N     1 
ATOM   1464 C  CA    . THR A  1 186 ? 22.709  -3.570  49.908 1.00 35.26  ? 186 THR A CA    1 
ATOM   1465 C  C     . THR A  1 186 ? 23.469  -4.685  49.182 1.00 37.23  ? 186 THR A C     1 
ATOM   1466 O  O     . THR A  1 186 ? 23.074  -5.129  48.125 1.00 29.20  ? 186 THR A O     1 
ATOM   1467 C  CB    . THR A  1 186 ? 22.672  -2.315  49.040 1.00 43.85  ? 186 THR A CB    1 
ATOM   1468 O  OG1   . THR A  1 186 ? 23.987  -1.763  48.996 1.00 30.61  ? 186 THR A OG1   1 
ATOM   1469 C  CG2   . THR A  1 186 ? 21.715  -1.260  49.651 1.00 29.66  ? 186 THR A CG2   1 
ATOM   1470 N  N     . SER A  1 187 ? 24.584  -5.120  49.734 1.00 32.53  ? 187 SER A N     1 
ATOM   1471 C  CA    . SER A  1 187 ? 25.310  -6.218  49.135 1.00 39.22  ? 187 SER A CA    1 
ATOM   1472 C  C     . SER A  1 187 ? 26.424  -6.618  50.083 1.00 40.05  ? 187 SER A C     1 
ATOM   1473 O  O     . SER A  1 187 ? 26.917  -5.787  50.849 1.00 32.31  ? 187 SER A O     1 
ATOM   1474 C  CB    . SER A  1 187 ? 25.847  -5.844  47.748 1.00 26.69  ? 187 SER A CB    1 
ATOM   1475 O  OG    . SER A  1 187 ? 26.563  -4.636  47.766 1.00 37.35  ? 187 SER A OG    1 
ATOM   1476 N  N     . SER A  1 188 ? 26.776  -7.902  50.048 1.00 43.29  ? 188 SER A N     1 
ATOM   1477 C  CA    . SER A  1 188 ? 27.823  -8.447  50.901 1.00 43.84  ? 188 SER A CA    1 
ATOM   1478 C  C     . SER A  1 188 ? 28.321  -9.801  50.411 1.00 45.04  ? 188 SER A C     1 
ATOM   1479 O  O     . SER A  1 188 ? 27.709  -10.423 49.551 1.00 47.33  ? 188 SER A O     1 
ATOM   1480 C  CB    . SER A  1 188 ? 27.317  -8.574  52.340 1.00 45.34  ? 188 SER A CB    1 
ATOM   1481 O  OG    . SER A  1 188 ? 26.250  -9.487  52.427 1.00 42.68  ? 188 SER A OG    1 
ATOM   1482 N  N     . ASP A  1 189 ? 29.451  -10.233 50.958 1.00 53.32  ? 189 ASP A N     1 
ATOM   1483 C  CA    . ASP A  1 189 ? 30.066  -11.498 50.610 1.00 40.83  ? 189 ASP A CA    1 
ATOM   1484 C  C     . ASP A  1 189 ? 29.501  -12.611 51.472 1.00 50.97  ? 189 ASP A C     1 
ATOM   1485 O  O     . ASP A  1 189 ? 29.957  -13.746 51.381 1.00 54.70  ? 189 ASP A O     1 
ATOM   1486 C  CB    . ASP A  1 189 ? 31.568  -11.457 50.869 1.00 48.14  ? 189 ASP A CB    1 
ATOM   1487 C  CG    . ASP A  1 189 ? 32.268  -10.356 50.118 1.00 64.02  ? 189 ASP A CG    1 
ATOM   1488 O  OD1   . ASP A  1 189 ? 32.021  -10.205 48.903 1.00 80.96  ? 189 ASP A OD1   1 
ATOM   1489 O  OD2   . ASP A  1 189 ? 33.083  -9.648  50.743 1.00 73.32  ? 189 ASP A OD2   1 
ATOM   1490 N  N     . LEU A  1 190 ? 28.534  -12.299 52.331 1.00 40.78  ? 190 LEU A N     1 
ATOM   1491 C  CA    . LEU A  1 190 ? 27.989  -13.335 53.194 1.00 44.97  ? 190 LEU A CA    1 
ATOM   1492 C  C     . LEU A  1 190 ? 27.585  -14.611 52.430 1.00 46.91  ? 190 LEU A C     1 
ATOM   1493 O  O     . LEU A  1 190 ? 27.141  -14.559 51.287 1.00 44.23  ? 190 LEU A O     1 
ATOM   1494 C  CB    . LEU A  1 190 ? 26.817  -12.775 54.017 1.00 41.43  ? 190 LEU A CB    1 
ATOM   1495 C  CG    . LEU A  1 190 ? 27.275  -11.694 55.007 1.00 51.69  ? 190 LEU A CG    1 
ATOM   1496 C  CD1   . LEU A  1 190 ? 26.098  -11.107 55.751 1.00 48.93  ? 190 LEU A CD1   1 
ATOM   1497 C  CD2   . LEU A  1 190 ? 28.263  -12.307 55.981 1.00 51.28  ? 190 LEU A CD2   1 
ATOM   1498 N  N     . PRO A  1 191 ? 27.771  -15.783 53.052 1.00 48.99  ? 191 PRO A N     1 
ATOM   1499 C  CA    . PRO A  1 191 ? 27.407  -17.027 52.370 1.00 45.28  ? 191 PRO A CA    1 
ATOM   1500 C  C     . PRO A  1 191 ? 25.909  -17.310 52.394 1.00 39.03  ? 191 PRO A C     1 
ATOM   1501 O  O     . PRO A  1 191 ? 25.213  -16.925 53.329 1.00 46.51  ? 191 PRO A O     1 
ATOM   1502 C  CB    . PRO A  1 191 ? 28.214  -18.074 53.135 1.00 45.05  ? 191 PRO A CB    1 
ATOM   1503 C  CG    . PRO A  1 191 ? 28.179  -17.537 54.531 1.00 42.50  ? 191 PRO A CG    1 
ATOM   1504 C  CD    . PRO A  1 191 ? 28.500  -16.064 54.302 1.00 41.87  ? 191 PRO A CD    1 
ATOM   1505 N  N     . SER A  1 192 ? 25.408  -17.978 51.359 1.00 41.51  ? 192 SER A N     1 
ATOM   1506 C  CA    . SER A  1 192 ? 23.986  -18.317 51.288 1.00 45.35  ? 192 SER A CA    1 
ATOM   1507 C  C     . SER A  1 192 ? 23.822  -19.823 51.211 1.00 43.63  ? 192 SER A C     1 
ATOM   1508 O  O     . SER A  1 192 ? 24.637  -20.503 50.611 1.00 46.97  ? 192 SER A O     1 
ATOM   1509 C  CB    . SER A  1 192 ? 23.335  -17.698 50.046 1.00 30.79  ? 192 SER A CB    1 
ATOM   1510 O  OG    . SER A  1 192 ? 21.979  -18.106 49.942 1.00 35.47  ? 192 SER A OG    1 
ATOM   1511 N  N     . PRO A  1 193 ? 22.763  -20.362 51.820 1.00 56.98  ? 193 PRO A N     1 
ATOM   1512 C  CA    . PRO A  1 193 ? 22.517  -21.807 51.791 1.00 57.39  ? 193 PRO A CA    1 
ATOM   1513 C  C     . PRO A  1 193 ? 22.078  -22.201 50.383 1.00 58.09  ? 193 PRO A C     1 
ATOM   1514 O  O     . PRO A  1 193 ? 22.168  -23.362 49.987 1.00 63.28  ? 193 PRO A O     1 
ATOM   1515 C  CB    . PRO A  1 193 ? 21.380  -21.988 52.801 1.00 55.52  ? 193 PRO A CB    1 
ATOM   1516 C  CG    . PRO A  1 193 ? 21.509  -20.813 53.697 1.00 54.52  ? 193 PRO A CG    1 
ATOM   1517 C  CD    . PRO A  1 193 ? 21.834  -19.699 52.749 1.00 56.64  ? 193 PRO A CD    1 
ATOM   1518 N  N     . GLN A  1 194 ? 21.601  -21.205 49.643 1.00 53.81  ? 194 GLN A N     1 
ATOM   1519 C  CA    . GLN A  1 194 ? 21.108  -21.364 48.277 1.00 44.17  ? 194 GLN A CA    1 
ATOM   1520 C  C     . GLN A  1 194 ? 22.186  -21.729 47.284 1.00 39.85  ? 194 GLN A C     1 
ATOM   1521 O  O     . GLN A  1 194 ? 21.901  -22.267 46.222 1.00 54.94  ? 194 GLN A O     1 
ATOM   1522 C  CB    . GLN A  1 194 ? 20.470  -20.063 47.822 1.00 56.04  ? 194 GLN A CB    1 
ATOM   1523 C  CG    . GLN A  1 194 ? 19.496  -19.498 48.815 1.00 69.66  ? 194 GLN A CG    1 
ATOM   1524 C  CD    . GLN A  1 194 ? 18.138  -20.098 48.645 1.00 71.52  ? 194 GLN A CD    1 
ATOM   1525 O  OE1   . GLN A  1 194 ? 18.012  -21.296 48.412 1.00 71.04  ? 194 GLN A OE1   1 
ATOM   1526 N  NE2   . GLN A  1 194 ? 17.102  -19.272 48.759 1.00 76.25  ? 194 GLN A NE2   1 
ATOM   1527 N  N     . GLY A  1 195 ? 23.425  -21.413 47.610 1.00 41.24  ? 195 GLY A N     1 
ATOM   1528 C  CA    . GLY A  1 195 ? 24.504  -21.718 46.697 1.00 45.26  ? 195 GLY A CA    1 
ATOM   1529 C  C     . GLY A  1 195 ? 25.511  -20.597 46.710 1.00 42.62  ? 195 GLY A C     1 
ATOM   1530 O  O     . GLY A  1 195 ? 25.286  -19.552 47.324 1.00 43.18  ? 195 GLY A O     1 
ATOM   1531 N  N     . SER A  1 196 ? 26.624  -20.811 46.024 1.00 37.46  ? 196 SER A N     1 
ATOM   1532 C  CA    . SER A  1 196 ? 27.670  -19.814 45.959 1.00 40.22  ? 196 SER A CA    1 
ATOM   1533 C  C     . SER A  1 196 ? 27.264  -18.616 45.086 1.00 47.76  ? 196 SER A C     1 
ATOM   1534 O  O     . SER A  1 196 ? 27.764  -17.514 45.274 1.00 41.71  ? 196 SER A O     1 
ATOM   1535 C  CB    . SER A  1 196 ? 28.923  -20.449 45.378 1.00 37.52  ? 196 SER A CB    1 
ATOM   1536 O  OG    . SER A  1 196 ? 28.640  -20.912 44.070 1.00 46.72  ? 196 SER A OG    1 
ATOM   1537 N  N     . ASN A  1 197 ? 26.365  -18.840 44.132 1.00 51.40  ? 197 ASN A N     1 
ATOM   1538 C  CA    . ASN A  1 197 ? 25.931  -17.784 43.220 1.00 49.24  ? 197 ASN A CA    1 
ATOM   1539 C  C     . ASN A  1 197 ? 24.874  -16.852 43.814 1.00 50.47  ? 197 ASN A C     1 
ATOM   1540 O  O     . ASN A  1 197 ? 23.844  -16.568 43.182 1.00 39.63  ? 197 ASN A O     1 
ATOM   1541 C  CB    . ASN A  1 197 ? 25.423  -18.411 41.913 1.00 41.49  ? 197 ASN A CB    1 
ATOM   1542 C  CG    . ASN A  1 197 ? 24.270  -19.393 42.130 1.00 56.71  ? 197 ASN A CG    1 
ATOM   1543 O  OD1   . ASN A  1 197 ? 24.319  -20.242 43.024 1.00 58.88  ? 197 ASN A OD1   1 
ATOM   1544 N  ND2   . ASN A  1 197 ? 23.233  -19.290 41.288 1.00 55.77  ? 197 ASN A ND2   1 
ATOM   1545 N  N     . TYR A  1 198 ? 25.128  -16.382 45.036 1.00 48.46  ? 198 TYR A N     1 
ATOM   1546 C  CA    . TYR A  1 198 ? 24.211  -15.465 45.720 1.00 51.43  ? 198 TYR A CA    1 
ATOM   1547 C  C     . TYR A  1 198 ? 24.908  -14.373 46.490 1.00 48.37  ? 198 TYR A C     1 
ATOM   1548 O  O     . TYR A  1 198 ? 26.051  -14.532 46.911 1.00 54.34  ? 198 TYR A O     1 
ATOM   1549 C  CB    . TYR A  1 198 ? 23.290  -16.200 46.693 1.00 31.16  ? 198 TYR A CB    1 
ATOM   1550 C  CG    . TYR A  1 198 ? 22.251  -17.047 46.013 1.00 47.34  ? 198 TYR A CG    1 
ATOM   1551 C  CD1   . TYR A  1 198 ? 22.583  -18.284 45.489 1.00 42.05  ? 198 TYR A CD1   1 
ATOM   1552 C  CD2   . TYR A  1 198 ? 20.943  -16.583 45.843 1.00 42.17  ? 198 TYR A CD2   1 
ATOM   1553 C  CE1   . TYR A  1 198 ? 21.655  -19.041 44.802 1.00 55.35  ? 198 TYR A CE1   1 
ATOM   1554 C  CE2   . TYR A  1 198 ? 20.007  -17.332 45.159 1.00 46.96  ? 198 TYR A CE2   1 
ATOM   1555 C  CZ    . TYR A  1 198 ? 20.370  -18.564 44.639 1.00 44.58  ? 198 TYR A CZ    1 
ATOM   1556 O  OH    . TYR A  1 198 ? 19.456  -19.312 43.931 1.00 63.57  ? 198 TYR A OH    1 
ATOM   1557 N  N     . LEU A  1 199 ? 24.211  -13.249 46.641 1.00 52.06  ? 199 LEU A N     1 
ATOM   1558 C  CA    . LEU A  1 199 ? 24.717  -12.115 47.399 1.00 53.46  ? 199 LEU A CA    1 
ATOM   1559 C  C     . LEU A  1 199 ? 23.652  -11.846 48.437 1.00 48.78  ? 199 LEU A C     1 
ATOM   1560 O  O     . LEU A  1 199 ? 22.466  -12.040 48.175 1.00 53.30  ? 199 LEU A O     1 
ATOM   1561 C  CB    . LEU A  1 199 ? 24.963  -10.897 46.500 1.00 47.46  ? 199 LEU A CB    1 
ATOM   1562 C  CG    . LEU A  1 199 ? 23.860  -10.114 45.821 1.00 45.39  ? 199 LEU A CG    1 
ATOM   1563 C  CD1   . LEU A  1 199 ? 23.270  -9.099  46.772 1.00 32.38  ? 199 LEU A CD1   1 
ATOM   1564 C  CD2   . LEU A  1 199 ? 24.474  -9.393  44.647 1.00 55.35  ? 199 LEU A CD2   1 
ATOM   1565 N  N     . ILE A  1 200 ? 24.062  -11.424 49.628 1.00 53.69  ? 200 ILE A N     1 
ATOM   1566 C  CA    . ILE A  1 200 ? 23.092  -11.205 50.694 1.00 42.54  ? 200 ILE A CA    1 
ATOM   1567 C  C     . ILE A  1 200 ? 22.829  -9.752  51.019 1.00 38.79  ? 200 ILE A C     1 
ATOM   1568 O  O     . ILE A  1 200 ? 23.739  -8.939  51.063 1.00 44.40  ? 200 ILE A O     1 
ATOM   1569 C  CB    . ILE A  1 200 ? 23.521  -11.958 51.978 1.00 42.20  ? 200 ILE A CB    1 
ATOM   1570 C  CG1   . ILE A  1 200 ? 23.214  -13.445 51.825 1.00 36.10  ? 200 ILE A CG1   1 
ATOM   1571 C  CG2   . ILE A  1 200 ? 22.788  -11.437 53.192 1.00 35.85  ? 200 ILE A CG2   1 
ATOM   1572 C  CD1   . ILE A  1 200 ? 24.056  -14.133 50.804 1.00 42.75  ? 200 ILE A CD1   1 
ATOM   1573 N  N     . VAL A  1 201 ? 21.555  -9.443  51.228 1.00 34.19  ? 201 VAL A N     1 
ATOM   1574 C  CA    . VAL A  1 201 ? 21.110  -8.112  51.581 1.00 33.96  ? 201 VAL A CA    1 
ATOM   1575 C  C     . VAL A  1 201 ? 20.544  -8.256  52.984 1.00 30.25  ? 201 VAL A C     1 
ATOM   1576 O  O     . VAL A  1 201 ? 19.809  -9.202  53.276 1.00 37.95  ? 201 VAL A O     1 
ATOM   1577 C  CB    . VAL A  1 201 ? 19.991  -7.595  50.603 1.00 31.82  ? 201 VAL A CB    1 
ATOM   1578 C  CG1   . VAL A  1 201 ? 19.301  -6.369  51.163 1.00 24.50  ? 201 VAL A CG1   1 
ATOM   1579 C  CG2   . VAL A  1 201 ? 20.593  -7.240  49.284 1.00 32.59  ? 201 VAL A CG2   1 
ATOM   1580 N  N     . LEU A  1 202 ? 20.902  -7.330  53.860 1.00 33.33  ? 202 LEU A N     1 
ATOM   1581 C  CA    . LEU A  1 202 ? 20.409  -7.358  55.219 1.00 32.68  ? 202 LEU A CA    1 
ATOM   1582 C  C     . LEU A  1 202 ? 19.780  -6.009  55.482 1.00 42.78  ? 202 LEU A C     1 
ATOM   1583 O  O     . LEU A  1 202 ? 20.281  -4.989  55.002 1.00 37.05  ? 202 LEU A O     1 
ATOM   1584 C  CB    . LEU A  1 202 ? 21.560  -7.583  56.200 1.00 37.28  ? 202 LEU A CB    1 
ATOM   1585 C  CG    . LEU A  1 202 ? 22.208  -8.970  56.219 1.00 40.06  ? 202 LEU A CG    1 
ATOM   1586 C  CD1   . LEU A  1 202 ? 23.401  -8.930  57.146 1.00 44.97  ? 202 LEU A CD1   1 
ATOM   1587 C  CD2   . LEU A  1 202 ? 21.196  -10.036 56.681 1.00 33.54  ? 202 LEU A CD2   1 
ATOM   1588 N  N     . GLY A  1 203 ? 18.678  -6.011  56.227 1.00 39.89  ? 203 GLY A N     1 
ATOM   1589 C  CA    . GLY A  1 203 ? 18.009  -4.770  56.541 1.00 38.47  ? 203 GLY A CA    1 
ATOM   1590 C  C     . GLY A  1 203 ? 17.585  -4.663  57.993 1.00 46.95  ? 203 GLY A C     1 
ATOM   1591 O  O     . GLY A  1 203 ? 17.064  -5.615  58.579 1.00 41.12  ? 203 GLY A O     1 
ATOM   1592 N  N     . SER A  1 204 ? 17.801  -3.491  58.582 1.00 46.37  ? 204 SER A N     1 
ATOM   1593 C  CA    . SER A  1 204 ? 17.441  -3.271  59.970 1.00 43.37  ? 204 SER A CA    1 
ATOM   1594 C  C     . SER A  1 204 ? 16.695  -1.951  60.143 1.00 44.54  ? 204 SER A C     1 
ATOM   1595 O  O     . SER A  1 204 ? 17.120  -0.902  59.659 1.00 37.56  ? 204 SER A O     1 
ATOM   1596 C  CB    . SER A  1 204 ? 18.696  -3.275  60.825 1.00 34.09  ? 204 SER A CB    1 
ATOM   1597 O  OG    . SER A  1 204 ? 18.331  -3.230  62.182 1.00 46.24  ? 204 SER A OG    1 
ATOM   1598 N  N     . GLN A  1 205 ? 15.584  -1.995  60.858 1.00 38.61  ? 205 GLN A N     1 
ATOM   1599 C  CA    . GLN A  1 205 ? 14.809  -0.792  61.037 1.00 43.62  ? 205 GLN A CA    1 
ATOM   1600 C  C     . GLN A  1 205 ? 14.323  -0.651  62.478 1.00 50.57  ? 205 GLN A C     1 
ATOM   1601 O  O     . GLN A  1 205 ? 13.654  -1.536  63.017 1.00 48.62  ? 205 GLN A O     1 
ATOM   1602 C  CB    . GLN A  1 205 ? 13.645  -0.801  60.038 1.00 36.77  ? 205 GLN A CB    1 
ATOM   1603 C  CG    . GLN A  1 205 ? 12.663  0.367   60.124 1.00 41.15  ? 205 GLN A CG    1 
ATOM   1604 C  CD    . GLN A  1 205 ? 11.834  0.529   58.843 1.00 46.13  ? 205 GLN A CD    1 
ATOM   1605 O  OE1   . GLN A  1 205 ? 12.321  1.056   57.837 1.00 53.27  ? 205 GLN A OE1   1 
ATOM   1606 N  NE2   . GLN A  1 205 ? 10.592  0.062   58.872 1.00 43.76  ? 205 GLN A NE2   1 
ATOM   1607 N  N     . ARG A  1 206 ? 14.686  0.473   63.088 1.00 48.18  ? 206 ARG A N     1 
ATOM   1608 C  CA    . ARG A  1 206 ? 14.319  0.809   64.457 1.00 51.02  ? 206 ARG A CA    1 
ATOM   1609 C  C     . ARG A  1 206 ? 13.078  1.696   64.409 1.00 50.62  ? 206 ARG A C     1 
ATOM   1610 O  O     . ARG A  1 206 ? 12.996  2.595   63.580 1.00 49.94  ? 206 ARG A O     1 
ATOM   1611 C  CB    . ARG A  1 206 ? 15.482  1.561   65.112 1.00 52.56  ? 206 ARG A CB    1 
ATOM   1612 C  CG    . ARG A  1 206 ? 15.208  2.153   66.486 1.00 56.46  ? 206 ARG A CG    1 
ATOM   1613 C  CD    . ARG A  1 206 ? 16.468  2.847   67.012 1.00 61.99  ? 206 ARG A CD    1 
ATOM   1614 N  NE    . ARG A  1 206 ? 16.964  3.916   66.129 1.00 59.11  ? 206 ARG A NE    1 
ATOM   1615 C  CZ    . ARG A  1 206 ? 18.120  4.558   66.307 1.00 58.53  ? 206 ARG A CZ    1 
ATOM   1616 N  NH1   . ARG A  1 206 ? 18.903  4.244   67.329 1.00 68.60  ? 206 ARG A NH1   1 
ATOM   1617 N  NH2   . ARG A  1 206 ? 18.506  5.505   65.463 1.00 48.22  ? 206 ARG A NH2   1 
ATOM   1618 N  N     . ARG A  1 207 ? 12.113  1.444   65.285 1.00 50.46  ? 207 ARG A N     1 
ATOM   1619 C  CA    . ARG A  1 207 ? 10.894  2.254   65.304 1.00 64.34  ? 207 ARG A CA    1 
ATOM   1620 C  C     . ARG A  1 207 ? 10.033  2.025   66.545 1.00 66.58  ? 207 ARG A C     1 
ATOM   1621 O  O     . ARG A  1 207 ? 8.926   2.612   66.619 1.00 73.91  ? 207 ARG A O     1 
ATOM   1622 C  CB    . ARG A  1 207 ? 10.063  1.992   64.043 1.00 50.41  ? 207 ARG A CB    1 
ATOM   1623 C  CG    . ARG A  1 207 ? 9.645   0.563   63.873 1.00 59.40  ? 207 ARG A CG    1 
ATOM   1624 C  CD    . ARG A  1 207 ? 8.830   0.398   62.609 1.00 64.46  ? 207 ARG A CD    1 
ATOM   1625 N  NE    . ARG A  1 207 ? 8.265   -0.945  62.504 1.00 62.59  ? 207 ARG A NE    1 
ATOM   1626 C  CZ    . ARG A  1 207 ? 8.719   -1.892  61.688 1.00 63.89  ? 207 ARG A CZ    1 
ATOM   1627 N  NH1   . ARG A  1 207 ? 9.748   -1.650  60.888 1.00 52.30  ? 207 ARG A NH1   1 
ATOM   1628 N  NH2   . ARG A  1 207 ? 8.137   -3.086  61.677 1.00 74.67  ? 207 ARG A NH2   1 
ATOM   1629 N  N     . SER A  1 213 ? 6.628   2.232   72.125 1.00 94.42  ? 213 SER A N     1 
ATOM   1630 C  CA    . SER A  1 213 ? 7.180   0.866   71.867 1.00 96.78  ? 213 SER A CA    1 
ATOM   1631 C  C     . SER A  1 213 ? 8.299   0.878   70.819 1.00 94.55  ? 213 SER A C     1 
ATOM   1632 O  O     . SER A  1 213 ? 8.039   0.927   69.613 1.00 94.17  ? 213 SER A O     1 
ATOM   1633 C  CB    . SER A  1 213 ? 6.054   -0.079  71.419 1.00 93.01  ? 213 SER A CB    1 
ATOM   1634 O  OG    . SER A  1 213 ? 5.352   0.435   70.295 1.00 93.37  ? 213 SER A OG    1 
ATOM   1635 N  N     . VAL A  1 214 ? 9.545   0.842   71.293 1.00 90.78  ? 214 VAL A N     1 
ATOM   1636 C  CA    . VAL A  1 214 ? 10.724  0.839   70.423 1.00 78.19  ? 214 VAL A CA    1 
ATOM   1637 C  C     . VAL A  1 214 ? 11.039  -0.581  69.977 1.00 74.43  ? 214 VAL A C     1 
ATOM   1638 O  O     . VAL A  1 214 ? 11.618  -1.375  70.722 1.00 71.70  ? 214 VAL A O     1 
ATOM   1639 C  CB    . VAL A  1 214 ? 11.939  1.416   71.146 1.00 73.52  ? 214 VAL A CB    1 
ATOM   1640 C  CG1   . VAL A  1 214 ? 12.003  0.858   72.556 1.00 81.73  ? 214 VAL A CG1   1 
ATOM   1641 C  CG2   . VAL A  1 214 ? 13.205  1.090   70.372 1.00 62.87  ? 214 VAL A CG2   1 
ATOM   1642 N  N     . VAL A  1 215 ? 10.675  -0.877  68.736 1.00 66.14  ? 215 VAL A N     1 
ATOM   1643 C  CA    . VAL A  1 215 ? 10.846  -2.204  68.177 1.00 60.81  ? 215 VAL A CA    1 
ATOM   1644 C  C     . VAL A  1 215 ? 11.810  -2.279  67.001 1.00 55.38  ? 215 VAL A C     1 
ATOM   1645 O  O     . VAL A  1 215 ? 11.948  -1.334  66.230 1.00 52.58  ? 215 VAL A O     1 
ATOM   1646 C  CB    . VAL A  1 215 ? 9.486   -2.728  67.713 1.00 68.06  ? 215 VAL A CB    1 
ATOM   1647 C  CG1   . VAL A  1 215 ? 8.387   -2.063  68.531 1.00 59.11  ? 215 VAL A CG1   1 
ATOM   1648 C  CG2   . VAL A  1 215 ? 9.280   -2.432  66.235 1.00 75.40  ? 215 VAL A CG2   1 
ATOM   1649 N  N     . MET A  1 216 ? 12.466  -3.420  66.864 1.00 51.77  ? 216 MET A N     1 
ATOM   1650 C  CA    . MET A  1 216 ? 13.391  -3.634  65.767 1.00 50.39  ? 216 MET A CA    1 
ATOM   1651 C  C     . MET A  1 216 ? 12.780  -4.631  64.785 1.00 52.60  ? 216 MET A C     1 
ATOM   1652 O  O     . MET A  1 216 ? 12.032  -5.523  65.172 1.00 58.42  ? 216 MET A O     1 
ATOM   1653 C  CB    . MET A  1 216 ? 14.732  -4.197  66.267 1.00 49.07  ? 216 MET A CB    1 
ATOM   1654 C  CG    . MET A  1 216 ? 15.581  -3.234  67.093 1.00 50.65  ? 216 MET A CG    1 
ATOM   1655 S  SD    . MET A  1 216 ? 16.066  -1.733  66.206 1.00 66.84  ? 216 MET A SD    1 
ATOM   1656 C  CE    . MET A  1 216 ? 17.687  -2.198  65.557 1.00 49.75  ? 216 MET A CE    1 
ATOM   1657 N  N     . GLU A  1 217 ? 13.078  -4.451  63.508 1.00 54.03  ? 217 GLU A N     1 
ATOM   1658 C  CA    . GLU A  1 217 ? 12.612  -5.359  62.478 1.00 50.95  ? 217 GLU A CA    1 
ATOM   1659 C  C     . GLU A  1 217 ? 13.841  -5.632  61.629 1.00 48.79  ? 217 GLU A C     1 
ATOM   1660 O  O     . GLU A  1 217 ? 14.469  -4.698  61.132 1.00 52.56  ? 217 GLU A O     1 
ATOM   1661 C  CB    . GLU A  1 217 ? 11.526  -4.731  61.625 1.00 39.48  ? 217 GLU A CB    1 
ATOM   1662 C  CG    . GLU A  1 217 ? 11.421  -5.414  60.287 1.00 45.88  ? 217 GLU A CG    1 
ATOM   1663 C  CD    . GLU A  1 217 ? 10.210  -4.996  59.508 1.00 51.79  ? 217 GLU A CD    1 
ATOM   1664 O  OE1   . GLU A  1 217 ? 9.830   -3.810  59.583 1.00 62.69  ? 217 GLU A OE1   1 
ATOM   1665 O  OE2   . GLU A  1 217 ? 9.646   -5.856  58.804 1.00 56.38  ? 217 GLU A OE2   1 
ATOM   1666 N  N     . ARG A  1 218 ? 14.199  -6.903  61.484 1.00 43.04  ? 218 ARG A N     1 
ATOM   1667 C  CA    . ARG A  1 218 ? 15.384  -7.271  60.722 1.00 37.97  ? 218 ARG A CA    1 
ATOM   1668 C  C     . ARG A  1 218 ? 15.075  -8.316  59.683 1.00 36.28  ? 218 ARG A C     1 
ATOM   1669 O  O     . ARG A  1 218 ? 14.409  -9.313  59.973 1.00 37.10  ? 218 ARG A O     1 
ATOM   1670 C  CB    . ARG A  1 218 ? 16.463  -7.803  61.645 1.00 44.34  ? 218 ARG A CB    1 
ATOM   1671 C  CG    . ARG A  1 218 ? 17.020  -6.772  62.583 1.00 40.34  ? 218 ARG A CG    1 
ATOM   1672 C  CD    . ARG A  1 218 ? 18.122  -7.392  63.380 1.00 56.57  ? 218 ARG A CD    1 
ATOM   1673 N  NE    . ARG A  1 218 ? 18.893  -6.407  64.120 1.00 59.32  ? 218 ARG A NE    1 
ATOM   1674 C  CZ    . ARG A  1 218 ? 18.597  -5.976  65.340 1.00 72.39  ? 218 ARG A CZ    1 
ATOM   1675 N  NH1   . ARG A  1 218 ? 17.531  -6.444  65.984 1.00 56.76  ? 218 ARG A NH1   1 
ATOM   1676 N  NH2   . ARG A  1 218 ? 19.384  -5.082  65.923 1.00 76.85  ? 218 ARG A NH2   1 
ATOM   1677 N  N     . ILE A  1 219 ? 15.603  -8.093  58.485 1.00 33.04  ? 219 ILE A N     1 
ATOM   1678 C  CA    . ILE A  1 219 ? 15.345  -8.976  57.376 1.00 31.69  ? 219 ILE A CA    1 
ATOM   1679 C  C     . ILE A  1 219 ? 16.597  -9.363  56.625 1.00 34.74  ? 219 ILE A C     1 
ATOM   1680 O  O     . ILE A  1 219 ? 17.643  -8.711  56.730 1.00 36.63  ? 219 ILE A O     1 
ATOM   1681 C  CB    . ILE A  1 219 ? 14.291  -8.336  56.386 1.00 38.26  ? 219 ILE A CB    1 
ATOM   1682 C  CG1   . ILE A  1 219 ? 14.832  -7.056  55.742 1.00 30.31  ? 219 ILE A CG1   1 
ATOM   1683 C  CG2   . ILE A  1 219 ? 13.027  -8.002  57.128 1.00 22.78  ? 219 ILE A CG2   1 
ATOM   1684 C  CD1   . ILE A  1 219 ? 15.692  -7.316  54.558 1.00 31.99  ? 219 ILE A CD1   1 
ATOM   1685 N  N     . ARG A  1 220 ? 16.470  -10.448 55.867 1.00 34.47  ? 220 ARG A N     1 
ATOM   1686 C  CA    . ARG A  1 220 ? 17.557  -10.964 55.056 1.00 40.10  ? 220 ARG A CA    1 
ATOM   1687 C  C     . ARG A  1 220 ? 16.984  -11.383 53.694 1.00 40.97  ? 220 ARG A C     1 
ATOM   1688 O  O     . ARG A  1 220 ? 15.827  -11.807 53.591 1.00 35.66  ? 220 ARG A O     1 
ATOM   1689 C  CB    . ARG A  1 220 ? 18.189  -12.179 55.744 1.00 39.97  ? 220 ARG A CB    1 
ATOM   1690 C  CG    . ARG A  1 220 ? 19.291  -12.826 54.954 1.00 40.56  ? 220 ARG A CG    1 
ATOM   1691 C  CD    . ARG A  1 220 ? 19.810  -14.112 55.613 1.00 50.78  ? 220 ARG A CD    1 
ATOM   1692 N  NE    . ARG A  1 220 ? 20.651  -14.832 54.668 1.00 33.22  ? 220 ARG A NE    1 
ATOM   1693 C  CZ    . ARG A  1 220 ? 21.934  -15.109 54.848 1.00 43.16  ? 220 ARG A CZ    1 
ATOM   1694 N  NH1   . ARG A  1 220 ? 22.545  -14.738 55.963 1.00 47.59  ? 220 ARG A NH1   1 
ATOM   1695 N  NH2   . ARG A  1 220 ? 22.619  -15.714 53.883 1.00 44.60  ? 220 ARG A NH2   1 
ATOM   1696 N  N     . MET A  1 221 ? 17.782  -11.225 52.648 1.00 34.48  ? 221 MET A N     1 
ATOM   1697 C  CA    . MET A  1 221 ? 17.367  -11.641 51.327 1.00 36.40  ? 221 MET A CA    1 
ATOM   1698 C  C     . MET A  1 221 ? 18.579  -12.238 50.647 1.00 34.22  ? 221 MET A C     1 
ATOM   1699 O  O     . MET A  1 221 ? 19.692  -11.734 50.780 1.00 41.15  ? 221 MET A O     1 
ATOM   1700 C  CB    . MET A  1 221 ? 16.811  -10.463 50.529 1.00 31.30  ? 221 MET A CB    1 
ATOM   1701 C  CG    . MET A  1 221 ? 15.463  -10.002 51.048 1.00 44.19  ? 221 MET A CG    1 
ATOM   1702 S  SD    . MET A  1 221 ? 14.775  -8.666  50.054 1.00 44.71  ? 221 MET A SD    1 
ATOM   1703 C  CE    . MET A  1 221 ? 16.035  -7.504  50.294 1.00 46.84  ? 221 MET A CE    1 
ATOM   1704 N  N     . ASP A  1 222 ? 18.351  -13.337 49.942 1.00 40.45  ? 222 ASP A N     1 
ATOM   1705 C  CA    . ASP A  1 222 ? 19.409  -14.046 49.239 1.00 41.72  ? 222 ASP A CA    1 
ATOM   1706 C  C     . ASP A  1 222 ? 19.127  -13.852 47.763 1.00 42.53  ? 222 ASP A C     1 
ATOM   1707 O  O     . ASP A  1 222 ? 18.137  -14.334 47.228 1.00 47.94  ? 222 ASP A O     1 
ATOM   1708 C  CB    . ASP A  1 222 ? 19.390  -15.518 49.653 1.00 40.73  ? 222 ASP A CB    1 
ATOM   1709 C  CG    . ASP A  1 222 ? 19.882  -15.720 51.094 1.00 45.26  ? 222 ASP A CG    1 
ATOM   1710 O  OD1   . ASP A  1 222 ? 19.140  -15.412 52.051 1.00 49.60  ? 222 ASP A OD1   1 
ATOM   1711 O  OD2   . ASP A  1 222 ? 21.027  -16.179 51.273 1.00 55.86  ? 222 ASP A OD2   1 
ATOM   1712 N  N     . ILE A  1 223 ? 20.008  -13.120 47.111 1.00 41.96  ? 223 ILE A N     1 
ATOM   1713 C  CA    . ILE A  1 223 ? 19.812  -12.771 45.729 1.00 40.17  ? 223 ILE A CA    1 
ATOM   1714 C  C     . ILE A  1 223 ? 20.748  -13.472 44.769 1.00 44.09  ? 223 ILE A C     1 
ATOM   1715 O  O     . ILE A  1 223 ? 21.965  -13.525 44.981 1.00 43.12  ? 223 ILE A O     1 
ATOM   1716 C  CB    . ILE A  1 223 ? 19.938  -11.246 45.592 1.00 48.36  ? 223 ILE A CB    1 
ATOM   1717 C  CG1   . ILE A  1 223 ? 18.890  -10.589 46.495 1.00 48.42  ? 223 ILE A CG1   1 
ATOM   1718 C  CG2   . ILE A  1 223 ? 19.760  -10.810 44.143 1.00 46.90  ? 223 ILE A CG2   1 
ATOM   1719 C  CD1   . ILE A  1 223 ? 19.255  -9.190  46.927 1.00 56.35  ? 223 ILE A CD1   1 
ATOM   1720 N  N     . ARG A  1 224 ? 20.169  -14.002 43.700 1.00 32.33  ? 224 ARG A N     1 
ATOM   1721 C  CA    . ARG A  1 224 ? 20.950  -14.710 42.712 1.00 45.13  ? 224 ARG A CA    1 
ATOM   1722 C  C     . ARG A  1 224 ? 21.789  -13.742 41.915 1.00 47.59  ? 224 ARG A C     1 
ATOM   1723 O  O     . ARG A  1 224 ? 21.292  -12.787 41.330 1.00 53.28  ? 224 ARG A O     1 
ATOM   1724 C  CB    . ARG A  1 224 ? 20.059  -15.528 41.777 1.00 52.36  ? 224 ARG A CB    1 
ATOM   1725 C  CG    . ARG A  1 224 ? 20.870  -16.494 40.912 1.00 68.41  ? 224 ARG A CG    1 
ATOM   1726 C  CD    . ARG A  1 224 ? 20.080  -17.744 40.532 1.00 80.82  ? 224 ARG A CD    1 
ATOM   1727 N  NE    . ARG A  1 224 ? 19.540  -17.686 39.178 1.00 90.47  ? 224 ARG A NE    1 
ATOM   1728 C  CZ    . ARG A  1 224 ? 18.814  -18.652 38.618 1.00 100.00 ? 224 ARG A CZ    1 
ATOM   1729 N  NH1   . ARG A  1 224 ? 18.365  -18.513 37.376 1.00 100.00 ? 224 ARG A NH1   1 
ATOM   1730 N  NH2   . ARG A  1 224 ? 18.534  -19.757 39.300 1.00 100.00 ? 224 ARG A NH2   1 
ATOM   1731 N  N     . LYS A  1 225 ? 23.081  -14.003 41.909 1.00 47.12  ? 225 LYS A N     1 
ATOM   1732 C  CA    . LYS A  1 225 ? 24.020  -13.180 41.185 1.00 54.61  ? 225 LYS A CA    1 
ATOM   1733 C  C     . LYS A  1 225 ? 23.962  -13.314 39.670 1.00 61.65  ? 225 LYS A C     1 
ATOM   1734 O  O     . LYS A  1 225 ? 23.889  -14.424 39.145 1.00 69.69  ? 225 LYS A O     1 
ATOM   1735 C  CB    . LYS A  1 225 ? 25.416  -13.506 41.659 1.00 41.40  ? 225 LYS A CB    1 
ATOM   1736 C  CG    . LYS A  1 225 ? 25.638  -13.031 43.042 1.00 41.98  ? 225 LYS A CG    1 
ATOM   1737 C  CD    . LYS A  1 225 ? 27.053  -12.577 43.185 1.00 60.02  ? 225 LYS A CD    1 
ATOM   1738 C  CE    . LYS A  1 225 ? 27.989  -13.761 43.185 1.00 63.75  ? 225 LYS A CE    1 
ATOM   1739 N  NZ    . LYS A  1 225 ? 27.705  -14.658 44.339 1.00 64.38  ? 225 LYS A NZ    1 
ATOM   1740 N  N     . VAL A  1 226 ? 23.982  -12.172 38.978 1.00 58.58  ? 226 VAL A N     1 
ATOM   1741 C  CA    . VAL A  1 226 ? 23.985  -12.141 37.514 1.00 46.15  ? 226 VAL A CA    1 
ATOM   1742 C  C     . VAL A  1 226 ? 25.467  -12.001 37.145 1.00 56.48  ? 226 VAL A C     1 
ATOM   1743 O  O     . VAL A  1 226 ? 26.219  -11.268 37.803 1.00 53.26  ? 226 VAL A O     1 
ATOM   1744 C  CB    . VAL A  1 226 ? 23.177  -10.938 36.966 1.00 44.94  ? 226 VAL A CB    1 
ATOM   1745 C  CG1   . VAL A  1 226 ? 23.409  -10.789 35.475 1.00 42.89  ? 226 VAL A CG1   1 
ATOM   1746 C  CG2   . VAL A  1 226 ? 21.696  -11.141 37.223 1.00 35.77  ? 226 VAL A CG2   1 
ATOM   1747 N  N     . ASP A  1 227 ? 25.885  -12.709 36.104 1.00 57.88  ? 227 ASP A N     1 
ATOM   1748 C  CA    . ASP A  1 227 ? 27.282  -12.702 35.694 1.00 64.10  ? 227 ASP A CA    1 
ATOM   1749 C  C     . ASP A  1 227 ? 27.756  -11.451 34.960 1.00 62.88  ? 227 ASP A C     1 
ATOM   1750 O  O     . ASP A  1 227 ? 28.025  -11.491 33.753 1.00 52.67  ? 227 ASP A O     1 
ATOM   1751 C  CB    . ASP A  1 227 ? 27.577  -13.938 34.841 1.00 68.12  ? 227 ASP A CB    1 
ATOM   1752 C  CG    . ASP A  1 227 ? 29.069  -14.160 34.635 1.00 85.32  ? 227 ASP A CG    1 
ATOM   1753 O  OD1   . ASP A  1 227 ? 29.426  -15.062 33.847 1.00 86.88  ? 227 ASP A OD1   1 
ATOM   1754 O  OD2   . ASP A  1 227 ? 29.883  -13.436 35.262 1.00 83.36  ? 227 ASP A OD2   1 
ATOM   1755 N  N     . ALA A  1 228 ? 27.869  -10.349 35.696 1.00 53.85  ? 228 ALA A N     1 
ATOM   1756 C  CA    . ALA A  1 228 ? 28.340  -9.095  35.119 1.00 47.28  ? 228 ALA A CA    1 
ATOM   1757 C  C     . ALA A  1 228 ? 28.334  -7.964  36.116 1.00 40.01  ? 228 ALA A C     1 
ATOM   1758 O  O     . ALA A  1 228 ? 27.651  -8.004  37.140 1.00 40.95  ? 228 ALA A O     1 
ATOM   1759 C  CB    . ALA A  1 228 ? 27.506  -8.703  33.914 1.00 38.03  ? 228 ALA A CB    1 
ATOM   1760 N  N     . VAL A  1 229 ? 29.103  -6.939  35.791 1.00 33.76  ? 229 VAL A N     1 
ATOM   1761 C  CA    . VAL A  1 229 ? 29.192  -5.771  36.632 1.00 39.75  ? 229 VAL A CA    1 
ATOM   1762 C  C     . VAL A  1 229 ? 28.277  -4.675  36.114 1.00 45.34  ? 229 VAL A C     1 
ATOM   1763 O  O     . VAL A  1 229 ? 28.413  -4.237  34.974 1.00 41.44  ? 229 VAL A O     1 
ATOM   1764 C  CB    . VAL A  1 229 ? 30.631  -5.269  36.681 1.00 41.93  ? 229 VAL A CB    1 
ATOM   1765 C  CG1   . VAL A  1 229 ? 30.697  -3.905  37.342 1.00 45.35  ? 229 VAL A CG1   1 
ATOM   1766 C  CG2   . VAL A  1 229 ? 31.475  -6.271  37.453 1.00 37.90  ? 229 VAL A CG2   1 
ATOM   1767 N  N     . PHE A  1 230 ? 27.342  -4.243  36.953 1.00 40.87  ? 230 PHE A N     1 
ATOM   1768 C  CA    . PHE A  1 230 ? 26.419  -3.173  36.589 1.00 43.44  ? 230 PHE A CA    1 
ATOM   1769 C  C     . PHE A  1 230 ? 26.791  -1.866  37.281 1.00 43.22  ? 230 PHE A C     1 
ATOM   1770 O  O     . PHE A  1 230 ? 27.418  -1.869  38.339 1.00 42.38  ? 230 PHE A O     1 
ATOM   1771 C  CB    . PHE A  1 230 ? 25.005  -3.553  36.996 1.00 28.95  ? 230 PHE A CB    1 
ATOM   1772 C  CG    . PHE A  1 230 ? 24.507  -4.778  36.329 1.00 35.29  ? 230 PHE A CG    1 
ATOM   1773 C  CD1   . PHE A  1 230 ? 24.127  -4.748  34.994 1.00 31.56  ? 230 PHE A CD1   1 
ATOM   1774 C  CD2   . PHE A  1 230 ? 24.396  -5.968  37.038 1.00 27.71  ? 230 PHE A CD2   1 
ATOM   1775 C  CE1   . PHE A  1 230 ? 23.631  -5.903  34.371 1.00 35.47  ? 230 PHE A CE1   1 
ATOM   1776 C  CE2   . PHE A  1 230 ? 23.905  -7.111  36.434 1.00 30.90  ? 230 PHE A CE2   1 
ATOM   1777 C  CZ    . PHE A  1 230 ? 23.519  -7.083  35.091 1.00 33.10  ? 230 PHE A CZ    1 
ATOM   1778 N  N     . VAL A  1 231 ? 26.383  -0.751  36.688 1.00 42.52  ? 231 VAL A N     1 
ATOM   1779 C  CA    . VAL A  1 231 ? 26.652  0.560   37.252 1.00 37.33  ? 231 VAL A CA    1 
ATOM   1780 C  C     . VAL A  1 231 ? 25.320  1.276   37.376 1.00 39.02  ? 231 VAL A C     1 
ATOM   1781 O  O     . VAL A  1 231 ? 24.536  1.309   36.430 1.00 39.21  ? 231 VAL A O     1 
ATOM   1782 C  CB    . VAL A  1 231 ? 27.573  1.383   36.333 1.00 42.51  ? 231 VAL A CB    1 
ATOM   1783 C  CG1   . VAL A  1 231 ? 28.021  2.657   37.052 1.00 44.13  ? 231 VAL A CG1   1 
ATOM   1784 C  CG2   . VAL A  1 231 ? 28.770  0.533   35.912 1.00 41.09  ? 231 VAL A CG2   1 
ATOM   1785 N  N     . GLY A  1 232 ? 25.057  1.841   38.546 1.00 29.58  ? 232 GLY A N     1 
ATOM   1786 C  CA    . GLY A  1 232 ? 23.803  2.551   38.755 1.00 24.41  ? 232 GLY A CA    1 
ATOM   1787 C  C     . GLY A  1 232 ? 22.854  1.781   39.647 1.00 23.55  ? 232 GLY A C     1 
ATOM   1788 O  O     . GLY A  1 232 ? 21.917  2.335   40.216 1.00 24.81  ? 232 GLY A O     1 
ATOM   1789 N  N     . THR A  1 233 ? 23.098  0.488   39.780 1.00 27.65  ? 233 THR A N     1 
ATOM   1790 C  CA    . THR A  1 233 ? 22.253  -0.341  40.627 1.00 33.12  ? 233 THR A CA    1 
ATOM   1791 C  C     . THR A  1 233 ? 22.195  0.070   42.096 1.00 30.89  ? 233 THR A C     1 
ATOM   1792 O  O     . THR A  1 233 ? 21.125  0.016   42.714 1.00 30.46  ? 233 THR A O     1 
ATOM   1793 C  CB    . THR A  1 233 ? 22.660  -1.813  40.497 1.00 41.80  ? 233 THR A CB    1 
ATOM   1794 O  OG1   . THR A  1 233 ? 24.081  -1.909  40.286 1.00 34.02  ? 233 THR A OG1   1 
ATOM   1795 C  CG2   . THR A  1 233 ? 21.907  -2.444  39.319 1.00 28.34  ? 233 THR A CG2   1 
ATOM   1796 N  N     . GLY A  1 234 ? 23.330  0.484   42.666 1.00 29.22  ? 234 GLY A N     1 
ATOM   1797 C  CA    . GLY A  1 234 ? 23.335  0.935   44.061 1.00 20.16  ? 234 GLY A CA    1 
ATOM   1798 C  C     . GLY A  1 234 ? 22.455  2.185   44.168 1.00 30.42  ? 234 GLY A C     1 
ATOM   1799 O  O     . GLY A  1 234 ? 21.647  2.339   45.087 1.00 30.00  ? 234 GLY A O     1 
ATOM   1800 N  N     . ASP A  1 235 ? 22.606  3.087   43.204 1.00 24.59  ? 235 ASP A N     1 
ATOM   1801 C  CA    . ASP A  1 235 ? 21.807  4.300   43.163 1.00 23.35  ? 235 ASP A CA    1 
ATOM   1802 C  C     . ASP A  1 235 ? 20.305  3.951   43.059 1.00 25.64  ? 235 ASP A C     1 
ATOM   1803 O  O     . ASP A  1 235 ? 19.473  4.515   43.779 1.00 21.85  ? 235 ASP A O     1 
ATOM   1804 C  CB    . ASP A  1 235 ? 22.227  5.152   41.955 1.00 29.57  ? 235 ASP A CB    1 
ATOM   1805 C  CG    . ASP A  1 235 ? 23.701  5.503   41.963 1.00 24.07  ? 235 ASP A CG    1 
ATOM   1806 O  OD1   . ASP A  1 235 ? 24.228  5.891   43.038 1.00 26.67  ? 235 ASP A OD1   1 
ATOM   1807 O  OD2   . ASP A  1 235 ? 24.324  5.410   40.887 1.00 28.16  ? 235 ASP A OD2   1 
ATOM   1808 N  N     . LEU A  1 236 ? 19.988  3.011   42.163 1.00 31.38  ? 236 LEU A N     1 
ATOM   1809 C  CA    . LEU A  1 236 ? 18.618  2.554   41.933 1.00 27.87  ? 236 LEU A CA    1 
ATOM   1810 C  C     . LEU A  1 236 ? 18.071  1.942   43.209 1.00 31.74  ? 236 LEU A C     1 
ATOM   1811 O  O     . LEU A  1 236 ? 16.918  2.200   43.587 1.00 36.25  ? 236 LEU A O     1 
ATOM   1812 C  CB    . LEU A  1 236 ? 18.567  1.523   40.796 1.00 28.05  ? 236 LEU A CB    1 
ATOM   1813 C  CG    . LEU A  1 236 ? 17.167  1.027   40.419 1.00 20.09  ? 236 LEU A CG    1 
ATOM   1814 C  CD1   . LEU A  1 236 ? 16.331  2.243   40.014 1.00 28.89  ? 236 LEU A CD1   1 
ATOM   1815 C  CD2   . LEU A  1 236 ? 17.226  0.032   39.243 1.00 20.99  ? 236 LEU A CD2   1 
ATOM   1816 N  N     . PHE A  1 237 ? 18.899  1.141   43.879 1.00 31.53  ? 237 PHE A N     1 
ATOM   1817 C  CA    . PHE A  1 237 ? 18.500  0.520   45.140 1.00 28.93  ? 237 PHE A CA    1 
ATOM   1818 C  C     . PHE A  1 237 ? 18.093  1.603   46.137 1.00 33.30  ? 237 PHE A C     1 
ATOM   1819 O  O     . PHE A  1 237 ? 16.985  1.562   46.681 1.00 30.21  ? 237 PHE A O     1 
ATOM   1820 C  CB    . PHE A  1 237 ? 19.641  -0.320  45.733 1.00 30.09  ? 237 PHE A CB    1 
ATOM   1821 C  CG    . PHE A  1 237 ? 19.203  -1.235  46.858 1.00 27.05  ? 237 PHE A CG    1 
ATOM   1822 C  CD1   . PHE A  1 237 ? 19.190  -2.613  46.680 1.00 34.10  ? 237 PHE A CD1   1 
ATOM   1823 C  CD2   . PHE A  1 237 ? 18.788  -0.724  48.084 1.00 29.06  ? 237 PHE A CD2   1 
ATOM   1824 C  CE1   . PHE A  1 237 ? 18.766  -3.462  47.707 1.00 30.02  ? 237 PHE A CE1   1 
ATOM   1825 C  CE2   . PHE A  1 237 ? 18.369  -1.567  49.103 1.00 31.29  ? 237 PHE A CE2   1 
ATOM   1826 C  CZ    . PHE A  1 237 ? 18.360  -2.939  48.909 1.00 27.11  ? 237 PHE A CZ    1 
ATOM   1827 N  N     . ALA A  1 238 ? 18.969  2.581   46.381 1.00 31.13  ? 238 ALA A N     1 
ATOM   1828 C  CA    . ALA A  1 238 ? 18.612  3.655   47.325 1.00 32.09  ? 238 ALA A CA    1 
ATOM   1829 C  C     . ALA A  1 238 ? 17.309  4.390   46.960 1.00 32.67  ? 238 ALA A C     1 
ATOM   1830 O  O     . ALA A  1 238 ? 16.460  4.626   47.822 1.00 28.15  ? 238 ALA A O     1 
ATOM   1831 C  CB    . ALA A  1 238 ? 19.746  4.646   47.445 1.00 25.83  ? 238 ALA A CB    1 
ATOM   1832 N  N     . ALA A  1 239 ? 17.154  4.753   45.689 1.00 31.77  ? 239 ALA A N     1 
ATOM   1833 C  CA    . ALA A  1 239 ? 15.948  5.476   45.247 1.00 28.46  ? 239 ALA A CA    1 
ATOM   1834 C  C     . ALA A  1 239 ? 14.668  4.646   45.434 1.00 25.82  ? 239 ALA A C     1 
ATOM   1835 O  O     . ALA A  1 239 ? 13.658  5.159   45.920 1.00 34.95  ? 239 ALA A O     1 
ATOM   1836 C  CB    . ALA A  1 239 ? 16.101  5.891   43.804 1.00 25.35  ? 239 ALA A CB    1 
ATOM   1837 N  N     . MET A  1 240 ? 14.720  3.362   45.055 1.00 33.01  ? 240 MET A N     1 
ATOM   1838 C  CA    . MET A  1 240 ? 13.568  2.487   45.211 1.00 27.18  ? 240 MET A CA    1 
ATOM   1839 C  C     . MET A  1 240 ? 13.264  2.219   46.687 1.00 34.76  ? 240 MET A C     1 
ATOM   1840 O  O     . MET A  1 240 ? 12.101  2.136   47.079 1.00 29.91  ? 240 MET A O     1 
ATOM   1841 C  CB    . MET A  1 240 ? 13.760  1.174   44.449 1.00 32.40  ? 240 MET A CB    1 
ATOM   1842 C  CG    . MET A  1 240 ? 13.719  1.309   42.927 1.00 33.72  ? 240 MET A CG    1 
ATOM   1843 S  SD    . MET A  1 240 ? 12.451  2.463   42.285 1.00 37.86  ? 240 MET A SD    1 
ATOM   1844 C  CE    . MET A  1 240 ? 11.130  2.039   43.220 1.00 57.95  ? 240 MET A CE    1 
ATOM   1845 N  N     . LEU A  1 241 ? 14.300  2.090   47.511 1.00 24.34  ? 241 LEU A N     1 
ATOM   1846 C  CA    . LEU A  1 241 ? 14.095  1.900   48.951 1.00 26.27  ? 241 LEU A CA    1 
ATOM   1847 C  C     . LEU A  1 241 ? 13.399  3.149   49.483 1.00 34.58  ? 241 LEU A C     1 
ATOM   1848 O  O     . LEU A  1 241 ? 12.510  3.073   50.349 1.00 34.38  ? 241 LEU A O     1 
ATOM   1849 C  CB    . LEU A  1 241 ? 15.431  1.715   49.672 1.00 36.72  ? 241 LEU A CB    1 
ATOM   1850 C  CG    . LEU A  1 241 ? 15.328  1.481   51.173 1.00 36.45  ? 241 LEU A CG    1 
ATOM   1851 C  CD1   . LEU A  1 241 ? 14.574  0.176   51.435 1.00 26.49  ? 241 LEU A CD1   1 
ATOM   1852 C  CD2   . LEU A  1 241 ? 16.754  1.438   51.758 1.00 31.41  ? 241 LEU A CD2   1 
ATOM   1853 N  N     . LEU A  1 242 ? 13.810  4.306   48.963 1.00 30.55  ? 242 LEU A N     1 
ATOM   1854 C  CA    . LEU A  1 242 ? 13.182  5.547   49.368 1.00 27.45  ? 242 LEU A CA    1 
ATOM   1855 C  C     . LEU A  1 242 ? 11.685  5.458   49.020 1.00 24.75  ? 242 LEU A C     1 
ATOM   1856 O  O     . LEU A  1 242 ? 10.826  5.726   49.861 1.00 36.50  ? 242 LEU A O     1 
ATOM   1857 C  CB    . LEU A  1 242 ? 13.822  6.756   48.646 1.00 20.86  ? 242 LEU A CB    1 
ATOM   1858 C  CG    . LEU A  1 242 ? 13.326  8.165   49.042 1.00 28.65  ? 242 LEU A CG    1 
ATOM   1859 C  CD1   . LEU A  1 242 ? 14.150  9.202   48.338 1.00 25.09  ? 242 LEU A CD1   1 
ATOM   1860 C  CD2   . LEU A  1 242 ? 11.853  8.377   48.665 1.00 24.87  ? 242 LEU A CD2   1 
ATOM   1861 N  N     . ALA A  1 243 ? 11.373  5.074   47.790 1.00 24.97  ? 243 ALA A N     1 
ATOM   1862 C  CA    . ALA A  1 243 ? 9.964   5.007   47.386 1.00 27.19  ? 243 ALA A CA    1 
ATOM   1863 C  C     . ALA A  1 243 ? 9.136   3.972   48.129 1.00 28.30  ? 243 ALA A C     1 
ATOM   1864 O  O     . ALA A  1 243 ? 7.997   4.243   48.527 1.00 36.55  ? 243 ALA A O     1 
ATOM   1865 C  CB    . ALA A  1 243 ? 9.854   4.765   45.890 1.00 25.62  ? 243 ALA A CB    1 
ATOM   1866 N  N     . TRP A  1 244 ? 9.691   2.780   48.318 1.00 29.33  ? 244 TRP A N     1 
ATOM   1867 C  CA    . TRP A  1 244 ? 8.933   1.743   48.990 1.00 36.31  ? 244 TRP A CA    1 
ATOM   1868 C  C     . TRP A  1 244 ? 8.839   1.885   50.514 1.00 35.29  ? 244 TRP A C     1 
ATOM   1869 O  O     . TRP A  1 244 ? 7.828   1.499   51.116 1.00 32.03  ? 244 TRP A O     1 
ATOM   1870 C  CB    . TRP A  1 244 ? 9.442   0.375   48.533 1.00 28.16  ? 244 TRP A CB    1 
ATOM   1871 C  CG    . TRP A  1 244 ? 9.195   0.183   47.054 1.00 33.18  ? 244 TRP A CG    1 
ATOM   1872 C  CD1   . TRP A  1 244 ? 10.130  -0.029  46.076 1.00 29.19  ? 244 TRP A CD1   1 
ATOM   1873 C  CD2   . TRP A  1 244 ? 7.924   0.277   46.374 1.00 31.61  ? 244 TRP A CD2   1 
ATOM   1874 N  NE1   . TRP A  1 244 ? 9.525   -0.060  44.835 1.00 36.05  ? 244 TRP A NE1   1 
ATOM   1875 C  CE2   . TRP A  1 244 ? 8.175   0.122   44.988 1.00 23.49  ? 244 TRP A CE2   1 
ATOM   1876 C  CE3   . TRP A  1 244 ? 6.604   0.476   46.803 1.00 37.87  ? 244 TRP A CE3   1 
ATOM   1877 C  CZ2   . TRP A  1 244 ? 7.161   0.160   44.028 1.00 27.68  ? 244 TRP A CZ2   1 
ATOM   1878 C  CZ3   . TRP A  1 244 ? 5.584   0.512   45.841 1.00 34.56  ? 244 TRP A CZ3   1 
ATOM   1879 C  CH2   . TRP A  1 244 ? 5.875   0.357   44.469 1.00 38.70  ? 244 TRP A CH2   1 
ATOM   1880 N  N     . THR A  1 245 ? 9.853   2.452   51.163 1.00 36.94  ? 245 THR A N     1 
ATOM   1881 C  CA    . THR A  1 245 ? 9.695   2.639   52.608 1.00 40.14  ? 245 THR A CA    1 
ATOM   1882 C  C     . THR A  1 245 ? 8.642   3.732   52.750 1.00 45.51  ? 245 THR A C     1 
ATOM   1883 O  O     . THR A  1 245 ? 7.910   3.782   53.740 1.00 47.53  ? 245 THR A O     1 
ATOM   1884 C  CB    . THR A  1 245 ? 11.016  3.058   53.351 1.00 40.83  ? 245 THR A CB    1 
ATOM   1885 O  OG1   . THR A  1 245 ? 11.631  4.161   52.689 1.00 43.85  ? 245 THR A OG1   1 
ATOM   1886 C  CG2   . THR A  1 245 ? 12.003  1.901   53.392 1.00 31.83  ? 245 THR A CG2   1 
ATOM   1887 N  N     . HIS A  1 246 ? 8.541   4.601   51.741 1.00 42.23  ? 246 HIS A N     1 
ATOM   1888 C  CA    . HIS A  1 246 ? 7.536   5.656   51.790 1.00 43.91  ? 246 HIS A CA    1 
ATOM   1889 C  C     . HIS A  1 246 ? 6.110   5.086   51.761 1.00 39.31  ? 246 HIS A C     1 
ATOM   1890 O  O     . HIS A  1 246 ? 5.264   5.494   52.548 1.00 49.72  ? 246 HIS A O     1 
ATOM   1891 C  CB    . HIS A  1 246 ? 7.708   6.651   50.637 1.00 36.38  ? 246 HIS A CB    1 
ATOM   1892 C  CG    . HIS A  1 246 ? 6.689   7.747   50.642 1.00 48.30  ? 246 HIS A CG    1 
ATOM   1893 N  ND1   . HIS A  1 246 ? 6.780   8.848   51.470 1.00 43.71  ? 246 HIS A ND1   1 
ATOM   1894 C  CD2   . HIS A  1 246 ? 5.517   7.876   49.970 1.00 43.05  ? 246 HIS A CD2   1 
ATOM   1895 C  CE1   . HIS A  1 246 ? 5.711   9.607   51.306 1.00 41.85  ? 246 HIS A CE1   1 
ATOM   1896 N  NE2   . HIS A  1 246 ? 4.929   9.039   50.402 1.00 36.27  ? 246 HIS A NE2   1 
ATOM   1897 N  N     . LYS A  1 247 ? 5.846   4.150   50.853 1.00 39.50  ? 247 LYS A N     1 
ATOM   1898 C  CA    . LYS A  1 247 ? 4.514   3.545   50.750 1.00 51.95  ? 247 LYS A CA    1 
ATOM   1899 C  C     . LYS A  1 247 ? 4.234   2.488   51.822 1.00 54.95  ? 247 LYS A C     1 
ATOM   1900 O  O     . LYS A  1 247 ? 3.075   2.173   52.101 1.00 49.17  ? 247 LYS A O     1 
ATOM   1901 C  CB    . LYS A  1 247 ? 4.320   2.926   49.359 1.00 44.08  ? 247 LYS A CB    1 
ATOM   1902 C  CG    . LYS A  1 247 ? 4.185   3.974   48.248 1.00 68.85  ? 247 LYS A CG    1 
ATOM   1903 C  CD    . LYS A  1 247 ? 5.092   3.665   47.055 1.00 78.52  ? 247 LYS A CD    1 
ATOM   1904 C  CE    . LYS A  1 247 ? 5.043   4.755   45.990 1.00 77.16  ? 247 LYS A CE    1 
ATOM   1905 N  NZ    . LYS A  1 247 ? 3.707   4.903   45.341 1.00 80.01  ? 247 LYS A NZ    1 
ATOM   1906 N  N     . HIS A  1 248 ? 5.302   1.960   52.418 1.00 49.30  ? 248 HIS A N     1 
ATOM   1907 C  CA    . HIS A  1 248 ? 5.214   0.933   53.448 1.00 38.81  ? 248 HIS A CA    1 
ATOM   1908 C  C     . HIS A  1 248 ? 6.081   1.285   54.648 1.00 47.07  ? 248 HIS A C     1 
ATOM   1909 O  O     . HIS A  1 248 ? 7.142   0.678   54.873 1.00 38.47  ? 248 HIS A O     1 
ATOM   1910 C  CB    . HIS A  1 248 ? 5.687   -0.404  52.891 1.00 44.65  ? 248 HIS A CB    1 
ATOM   1911 C  CG    . HIS A  1 248 ? 4.947   -0.843  51.669 1.00 41.72  ? 248 HIS A CG    1 
ATOM   1912 N  ND1   . HIS A  1 248 ? 3.662   -1.343  51.715 1.00 39.08  ? 248 HIS A ND1   1 
ATOM   1913 C  CD2   . HIS A  1 248 ? 5.316   -0.874  50.366 1.00 43.57  ? 248 HIS A CD2   1 
ATOM   1914 C  CE1   . HIS A  1 248 ? 3.275   -1.670  50.494 1.00 36.59  ? 248 HIS A CE1   1 
ATOM   1915 N  NE2   . HIS A  1 248 ? 4.259   -1.395  49.656 1.00 46.54  ? 248 HIS A NE2   1 
ATOM   1916 N  N     . PRO A  1 249 ? 5.665   2.297   55.423 1.00 44.35  ? 249 PRO A N     1 
ATOM   1917 C  CA    . PRO A  1 249 ? 6.449   2.675   56.599 1.00 48.83  ? 249 PRO A CA    1 
ATOM   1918 C  C     . PRO A  1 249 ? 6.171   1.557   57.599 1.00 52.04  ? 249 PRO A C     1 
ATOM   1919 O  O     . PRO A  1 249 ? 5.095   0.956   57.567 1.00 55.76  ? 249 PRO A O     1 
ATOM   1920 C  CB    . PRO A  1 249 ? 5.808   3.994   57.040 1.00 45.89  ? 249 PRO A CB    1 
ATOM   1921 C  CG    . PRO A  1 249 ? 4.956   4.423   55.867 1.00 52.18  ? 249 PRO A CG    1 
ATOM   1922 C  CD    . PRO A  1 249 ? 4.472   3.140   55.291 1.00 50.42  ? 249 PRO A CD    1 
ATOM   1923 N  N     . ASN A  1 250 ? 7.109   1.252   58.481 1.00 55.91  ? 250 ASN A N     1 
ATOM   1924 C  CA    . ASN A  1 250 ? 6.861   0.179   59.448 1.00 63.25  ? 250 ASN A CA    1 
ATOM   1925 C  C     . ASN A  1 250 ? 6.661   -1.201  58.788 1.00 64.21  ? 250 ASN A C     1 
ATOM   1926 O  O     . ASN A  1 250 ? 5.967   -2.066  59.329 1.00 61.70  ? 250 ASN A O     1 
ATOM   1927 C  CB    . ASN A  1 250 ? 5.624   0.487   60.315 1.00 59.34  ? 250 ASN A CB    1 
ATOM   1928 C  CG    . ASN A  1 250 ? 5.535   1.949   60.727 1.00 59.55  ? 250 ASN A CG    1 
ATOM   1929 O  OD1   . ASN A  1 250 ? 6.533   2.578   61.100 1.00 53.96  ? 250 ASN A OD1   1 
ATOM   1930 N  ND2   . ASN A  1 250 ? 4.326   2.495   60.669 1.00 51.50  ? 250 ASN A ND2   1 
ATOM   1931 N  N     . ASN A  1 251 ? 7.229   -1.391  57.601 1.00 55.93  ? 251 ASN A N     1 
ATOM   1932 C  CA    . ASN A  1 251 ? 7.169   -2.690  56.939 1.00 46.26  ? 251 ASN A CA    1 
ATOM   1933 C  C     . ASN A  1 251 ? 8.397   -2.828  56.043 1.00 41.14  ? 251 ASN A C     1 
ATOM   1934 O  O     . ASN A  1 251 ? 8.333   -2.852  54.803 1.00 39.98  ? 251 ASN A O     1 
ATOM   1935 C  CB    . ASN A  1 251 ? 5.885   -2.880  56.141 1.00 44.60  ? 251 ASN A CB    1 
ATOM   1936 C  CG    . ASN A  1 251 ? 5.586   -4.344  55.901 1.00 46.97  ? 251 ASN A CG    1 
ATOM   1937 O  OD1   . ASN A  1 251 ? 6.503   -5.158  55.784 1.00 40.84  ? 251 ASN A OD1   1 
ATOM   1938 N  ND2   . ASN A  1 251 ? 4.310   -4.690  55.822 1.00 46.57  ? 251 ASN A ND2   1 
ATOM   1939 N  N     . LEU A  1 252 ? 9.530   -2.922  56.717 1.00 36.56  ? 252 LEU A N     1 
ATOM   1940 C  CA    . LEU A  1 252 ? 10.815  -3.041  56.070 1.00 37.58  ? 252 LEU A CA    1 
ATOM   1941 C  C     . LEU A  1 252 ? 10.846  -4.232  55.136 1.00 43.50  ? 252 LEU A C     1 
ATOM   1942 O  O     . LEU A  1 252 ? 11.498  -4.194  54.085 1.00 41.07  ? 252 LEU A O     1 
ATOM   1943 C  CB    . LEU A  1 252 ? 11.902  -3.215  57.132 1.00 36.38  ? 252 LEU A CB    1 
ATOM   1944 C  CG    . LEU A  1 252 ? 13.291  -3.170  56.521 1.00 27.62  ? 252 LEU A CG    1 
ATOM   1945 C  CD1   . LEU A  1 252 ? 13.481  -1.750  56.021 1.00 29.36  ? 252 LEU A CD1   1 
ATOM   1946 C  CD2   . LEU A  1 252 ? 14.369  -3.550  57.544 1.00 43.23  ? 252 LEU A CD2   1 
ATOM   1947 N  N     . LYS A  1 253 ? 10.143  -5.290  55.541 1.00 43.32  ? 253 LYS A N     1 
ATOM   1948 C  CA    . LYS A  1 253 ? 10.089  -6.522  54.773 1.00 43.49  ? 253 LYS A CA    1 
ATOM   1949 C  C     . LYS A  1 253 ? 9.617   -6.271  53.351 1.00 43.96  ? 253 LYS A C     1 
ATOM   1950 O  O     . LYS A  1 253 ? 10.360  -6.517  52.397 1.00 35.88  ? 253 LYS A O     1 
ATOM   1951 C  CB    . LYS A  1 253 ? 9.165   -7.543  55.459 1.00 42.64  ? 253 LYS A CB    1 
ATOM   1952 C  CG    . LYS A  1 253 ? 9.114   -8.897  54.731 1.00 30.64  ? 253 LYS A CG    1 
ATOM   1953 C  CD    . LYS A  1 253 ? 8.524   -10.020 55.576 1.00 35.66  ? 253 LYS A CD    1 
ATOM   1954 C  CE    . LYS A  1 253 ? 8.510   -11.347 54.806 1.00 43.65  ? 253 LYS A CE    1 
ATOM   1955 N  NZ    . LYS A  1 253 ? 7.568   -11.297 53.628 1.00 43.51  ? 253 LYS A NZ    1 
ATOM   1956 N  N     . VAL A  1 254 ? 8.387   -5.773  53.214 1.00 40.45  ? 254 VAL A N     1 
ATOM   1957 C  CA    . VAL A  1 254 ? 7.817   -5.496  51.899 1.00 41.78  ? 254 VAL A CA    1 
ATOM   1958 C  C     . VAL A  1 254 ? 8.616   -4.445  51.115 1.00 34.18  ? 254 VAL A C     1 
ATOM   1959 O  O     . VAL A  1 254 ? 8.877   -4.605  49.920 1.00 35.39  ? 254 VAL A O     1 
ATOM   1960 C  CB    . VAL A  1 254 ? 6.359   -5.018  52.027 1.00 40.25  ? 254 VAL A CB    1 
ATOM   1961 C  CG1   . VAL A  1 254 ? 5.838   -4.586  50.689 1.00 34.40  ? 254 VAL A CG1   1 
ATOM   1962 C  CG2   . VAL A  1 254 ? 5.502   -6.132  52.573 1.00 41.31  ? 254 VAL A CG2   1 
ATOM   1963 N  N     . ALA A  1 255 ? 9.000   -3.378  51.798 1.00 29.95  ? 255 ALA A N     1 
ATOM   1964 C  CA    . ALA A  1 255 ? 9.755   -2.322  51.155 1.00 34.25  ? 255 ALA A CA    1 
ATOM   1965 C  C     . ALA A  1 255 ? 10.995  -2.921  50.502 1.00 27.19  ? 255 ALA A C     1 
ATOM   1966 O  O     . ALA A  1 255 ? 11.315  -2.606  49.354 1.00 40.47  ? 255 ALA A O     1 
ATOM   1967 C  CB    . ALA A  1 255 ? 10.139  -1.249  52.182 1.00 20.60  ? 255 ALA A CB    1 
ATOM   1968 N  N     . CYS A  1 256 ? 11.661  -3.823  51.214 1.00 35.37  ? 256 CYS A N     1 
ATOM   1969 C  CA    . CYS A  1 256 ? 12.862  -4.438  50.666 1.00 38.44  ? 256 CYS A CA    1 
ATOM   1970 C  C     . CYS A  1 256 ? 12.564  -5.429  49.568 1.00 37.74  ? 256 CYS A C     1 
ATOM   1971 O  O     . CYS A  1 256 ? 13.363  -5.591  48.642 1.00 31.35  ? 256 CYS A O     1 
ATOM   1972 C  CB    . CYS A  1 256 ? 13.696  -5.093  51.771 1.00 37.04  ? 256 CYS A CB    1 
ATOM   1973 S  SG    . CYS A  1 256 ? 14.568  -3.847  52.772 1.00 37.03  ? 256 CYS A SG    1 
ATOM   1974 N  N     . GLU A  1 257 ? 11.407  -6.075  49.636 1.00 33.44  ? 257 GLU A N     1 
ATOM   1975 C  CA    . GLU A  1 257 ? 11.070  -7.041  48.599 1.00 35.96  ? 257 GLU A CA    1 
ATOM   1976 C  C     . GLU A  1 257 ? 10.743  -6.357  47.277 1.00 38.00  ? 257 GLU A C     1 
ATOM   1977 O  O     . GLU A  1 257 ? 11.123  -6.837  46.212 1.00 38.67  ? 257 GLU A O     1 
ATOM   1978 C  CB    . GLU A  1 257 ? 9.928   -7.938  49.066 1.00 37.92  ? 257 GLU A CB    1 
ATOM   1979 C  CG    . GLU A  1 257 ? 10.328  -8.700  50.309 1.00 41.66  ? 257 GLU A CG    1 
ATOM   1980 C  CD    . GLU A  1 257 ? 9.278   -9.651  50.815 1.00 48.15  ? 257 GLU A CD    1 
ATOM   1981 O  OE1   . GLU A  1 257 ? 8.077   -9.312  50.779 1.00 40.64  ? 257 GLU A OE1   1 
ATOM   1982 O  OE2   . GLU A  1 257 ? 9.669   -10.741 51.274 1.00 51.90  ? 257 GLU A OE2   1 
ATOM   1983 N  N     . LYS A  1 258 ? 10.060  -5.221  47.342 1.00 44.59  ? 258 LYS A N     1 
ATOM   1984 C  CA    . LYS A  1 258 ? 9.732   -4.496  46.124 1.00 39.80  ? 258 LYS A CA    1 
ATOM   1985 C  C     . LYS A  1 258 ? 10.986  -3.876  45.508 1.00 36.65  ? 258 LYS A C     1 
ATOM   1986 O  O     . LYS A  1 258 ? 11.139  -3.857  44.292 1.00 37.63  ? 258 LYS A O     1 
ATOM   1987 C  CB    . LYS A  1 258 ? 8.699   -3.412  46.421 1.00 29.20  ? 258 LYS A CB    1 
ATOM   1988 C  CG    . LYS A  1 258 ? 7.318   -3.996  46.713 1.00 41.74  ? 258 LYS A CG    1 
ATOM   1989 C  CD    . LYS A  1 258 ? 6.276   -2.938  46.909 1.00 42.42  ? 258 LYS A CD    1 
ATOM   1990 C  CE    . LYS A  1 258 ? 4.909   -3.578  47.021 1.00 41.37  ? 258 LYS A CE    1 
ATOM   1991 N  NZ    . LYS A  1 258 ? 3.891   -2.549  47.361 1.00 52.09  ? 258 LYS A NZ    1 
ATOM   1992 N  N     . THR A  1 259 ? 11.881  -3.394  46.363 1.00 33.98  ? 259 THR A N     1 
ATOM   1993 C  CA    . THR A  1 259 ? 13.117  -2.760  45.917 1.00 34.51  ? 259 THR A CA    1 
ATOM   1994 C  C     . THR A  1 259 ? 14.002  -3.759  45.199 1.00 33.74  ? 259 THR A C     1 
ATOM   1995 O  O     . THR A  1 259 ? 14.440  -3.522  44.068 1.00 43.37  ? 259 THR A O     1 
ATOM   1996 C  CB    . THR A  1 259 ? 13.869  -2.148  47.109 1.00 26.29  ? 259 THR A CB    1 
ATOM   1997 O  OG1   . THR A  1 259 ? 13.093  -1.078  47.645 1.00 32.04  ? 259 THR A OG1   1 
ATOM   1998 C  CG2   . THR A  1 259 ? 15.241  -1.643  46.704 1.00 31.84  ? 259 THR A CG2   1 
ATOM   1999 N  N     . VAL A  1 260 ? 14.271  -4.875  45.861 1.00 32.73  ? 260 VAL A N     1 
ATOM   2000 C  CA    . VAL A  1 260 ? 15.085  -5.930  45.278 1.00 28.55  ? 260 VAL A CA    1 
ATOM   2001 C  C     . VAL A  1 260 ? 14.401  -6.548  44.043 1.00 35.64  ? 260 VAL A C     1 
ATOM   2002 O  O     . VAL A  1 260 ? 15.053  -6.824  43.031 1.00 25.77  ? 260 VAL A O     1 
ATOM   2003 C  CB    . VAL A  1 260 ? 15.368  -7.018  46.348 1.00 38.79  ? 260 VAL A CB    1 
ATOM   2004 C  CG1   . VAL A  1 260 ? 15.960  -8.268  45.725 1.00 35.90  ? 260 VAL A CG1   1 
ATOM   2005 C  CG2   . VAL A  1 260 ? 16.302  -6.443  47.399 1.00 33.83  ? 260 VAL A CG2   1 
ATOM   2006 N  N     . SER A  1 261 ? 13.087  -6.765  44.104 1.00 20.94  ? 261 SER A N     1 
ATOM   2007 C  CA    . SER A  1 261 ? 12.404  -7.321  42.935 1.00 29.10  ? 261 SER A CA    1 
ATOM   2008 C  C     . SER A  1 261 ? 12.505  -6.366  41.771 1.00 26.69  ? 261 SER A C     1 
ATOM   2009 O  O     . SER A  1 261 ? 12.709  -6.787  40.643 1.00 34.44  ? 261 SER A O     1 
ATOM   2010 C  CB    . SER A  1 261 ? 10.933  -7.626  43.224 1.00 27.84  ? 261 SER A CB    1 
ATOM   2011 O  OG    . SER A  1 261 ? 10.822  -8.790  44.010 1.00 36.96  ? 261 SER A OG    1 
ATOM   2012 N  N     . THR A  1 262 ? 12.379  -5.071  42.037 1.00 29.92  ? 262 THR A N     1 
ATOM   2013 C  CA    . THR A  1 262 ? 12.489  -4.101  40.957 1.00 31.47  ? 262 THR A CA    1 
ATOM   2014 C  C     . THR A  1 262 ? 13.887  -4.222  40.332 1.00 27.45  ? 262 THR A C     1 
ATOM   2015 O  O     . THR A  1 262 ? 14.031  -4.211  39.108 1.00 30.33  ? 262 THR A O     1 
ATOM   2016 C  CB    . THR A  1 262 ? 12.218  -2.650  41.466 1.00 38.53  ? 262 THR A CB    1 
ATOM   2017 O  OG1   . THR A  1 262 ? 10.851  -2.538  41.891 1.00 41.48  ? 262 THR A OG1   1 
ATOM   2018 C  CG2   . THR A  1 262 ? 12.440  -1.643  40.360 1.00 29.91  ? 262 THR A CG2   1 
ATOM   2019 N  N     . LEU A  1 263 ? 14.916  -4.341  41.167 1.00 34.39  ? 263 LEU A N     1 
ATOM   2020 C  CA    . LEU A  1 263 ? 16.277  -4.494  40.664 1.00 30.05  ? 263 LEU A CA    1 
ATOM   2021 C  C     . LEU A  1 263 ? 16.335  -5.778  39.819 1.00 30.88  ? 263 LEU A C     1 
ATOM   2022 O  O     . LEU A  1 263 ? 16.890  -5.773  38.723 1.00 36.94  ? 263 LEU A O     1 
ATOM   2023 C  CB    . LEU A  1 263 ? 17.293  -4.584  41.819 1.00 34.78  ? 263 LEU A CB    1 
ATOM   2024 C  CG    . LEU A  1 263 ? 18.142  -3.360  42.206 1.00 31.95  ? 263 LEU A CG    1 
ATOM   2025 C  CD1   . LEU A  1 263 ? 18.950  -2.872  41.025 1.00 28.95  ? 263 LEU A CD1   1 
ATOM   2026 C  CD2   . LEU A  1 263 ? 17.237  -2.262  42.697 1.00 52.84  ? 263 LEU A CD2   1 
ATOM   2027 N  N     . HIS A  1 264 ? 15.752  -6.867  40.324 1.00 34.92  ? 264 HIS A N     1 
ATOM   2028 C  CA    . HIS A  1 264 ? 15.728  -8.137  39.586 1.00 31.29  ? 264 HIS A CA    1 
ATOM   2029 C  C     . HIS A  1 264 ? 15.212  -7.943  38.132 1.00 35.88  ? 264 HIS A C     1 
ATOM   2030 O  O     . HIS A  1 264 ? 15.905  -8.252  37.148 1.00 35.28  ? 264 HIS A O     1 
ATOM   2031 C  CB    . HIS A  1 264 ? 14.842  -9.156  40.328 1.00 25.22  ? 264 HIS A CB    1 
ATOM   2032 C  CG    . HIS A  1 264 ? 14.732  -10.474 39.635 1.00 36.70  ? 264 HIS A CG    1 
ATOM   2033 N  ND1   . HIS A  1 264 ? 15.746  -11.410 39.657 1.00 49.46  ? 264 HIS A ND1   1 
ATOM   2034 C  CD2   . HIS A  1 264 ? 13.781  -10.971 38.810 1.00 37.44  ? 264 HIS A CD2   1 
ATOM   2035 C  CE1   . HIS A  1 264 ? 15.430  -12.423 38.872 1.00 36.91  ? 264 HIS A CE1   1 
ATOM   2036 N  NE2   . HIS A  1 264 ? 14.243  -12.183 38.344 1.00 47.65  ? 264 HIS A NE2   1 
ATOM   2037 N  N     . HIS A  1 265 ? 13.999  -7.423  37.985 1.00 33.58  ? 265 HIS A N     1 
ATOM   2038 C  CA    . HIS A  1 265 ? 13.448  -7.208  36.653 1.00 27.40  ? 265 HIS A CA    1 
ATOM   2039 C  C     . HIS A  1 265 ? 14.329  -6.330  35.758 1.00 28.11  ? 265 HIS A C     1 
ATOM   2040 O  O     . HIS A  1 265 ? 14.564  -6.650  34.594 1.00 30.40  ? 265 HIS A O     1 
ATOM   2041 C  CB    . HIS A  1 265 ? 12.045  -6.624  36.786 1.00 26.03  ? 265 HIS A CB    1 
ATOM   2042 C  CG    . HIS A  1 265 ? 11.129  -7.493  37.586 1.00 29.91  ? 265 HIS A CG    1 
ATOM   2043 N  ND1   . HIS A  1 265 ? 10.908  -8.818  37.274 1.00 30.62  ? 265 HIS A ND1   1 
ATOM   2044 C  CD2   . HIS A  1 265 ? 10.432  -7.253  38.721 1.00 33.45  ? 265 HIS A CD2   1 
ATOM   2045 C  CE1   . HIS A  1 265 ? 10.114  -9.356  38.181 1.00 28.47  ? 265 HIS A CE1   1 
ATOM   2046 N  NE2   . HIS A  1 265 ? 9.809   -8.428  39.071 1.00 31.19  ? 265 HIS A NE2   1 
ATOM   2047 N  N     . VAL A  1 266 ? 14.817  -5.223  36.296 1.00 31.53  ? 266 VAL A N     1 
ATOM   2048 C  CA    . VAL A  1 266 ? 15.682  -4.359  35.523 1.00 31.02  ? 266 VAL A CA    1 
ATOM   2049 C  C     . VAL A  1 266 ? 16.939  -5.115  35.059 1.00 29.13  ? 266 VAL A C     1 
ATOM   2050 O  O     . VAL A  1 266 ? 17.295  -5.102  33.881 1.00 36.16  ? 266 VAL A O     1 
ATOM   2051 C  CB    . VAL A  1 266 ? 16.115  -3.140  36.350 1.00 30.85  ? 266 VAL A CB    1 
ATOM   2052 C  CG1   . VAL A  1 266 ? 17.149  -2.341  35.573 1.00 21.47  ? 266 VAL A CG1   1 
ATOM   2053 C  CG2   . VAL A  1 266 ? 14.882  -2.277  36.682 1.00 27.64  ? 266 VAL A CG2   1 
ATOM   2054 N  N     . LEU A  1 267 ? 17.616  -5.778  35.982 1.00 35.67  ? 267 LEU A N     1 
ATOM   2055 C  CA    . LEU A  1 267 ? 18.829  -6.498  35.603 1.00 36.27  ? 267 LEU A CA    1 
ATOM   2056 C  C     . LEU A  1 267 ? 18.522  -7.682  34.700 1.00 31.69  ? 267 LEU A C     1 
ATOM   2057 O  O     . LEU A  1 267 ? 19.269  -7.967  33.774 1.00 32.96  ? 267 LEU A O     1 
ATOM   2058 C  CB    . LEU A  1 267 ? 19.600  -6.953  36.850 1.00 37.29  ? 267 LEU A CB    1 
ATOM   2059 C  CG    . LEU A  1 267 ? 20.293  -5.829  37.636 1.00 48.43  ? 267 LEU A CG    1 
ATOM   2060 C  CD1   . LEU A  1 267 ? 21.120  -6.435  38.764 1.00 41.37  ? 267 LEU A CD1   1 
ATOM   2061 C  CD2   . LEU A  1 267 ? 21.193  -5.006  36.693 1.00 37.97  ? 267 LEU A CD2   1 
ATOM   2062 N  N     . GLN A  1 268 ? 17.417  -8.368  34.955 1.00 33.57  ? 268 GLN A N     1 
ATOM   2063 C  CA    . GLN A  1 268 ? 17.057  -9.501  34.124 1.00 34.18  ? 268 GLN A CA    1 
ATOM   2064 C  C     . GLN A  1 268 ? 16.893  -9.003  32.690 1.00 35.61  ? 268 GLN A C     1 
ATOM   2065 O  O     . GLN A  1 268 ? 17.451  -9.576  31.747 1.00 38.30  ? 268 GLN A O     1 
ATOM   2066 C  CB    . GLN A  1 268 ? 15.770  -10.150 34.637 1.00 40.18  ? 268 GLN A CB    1 
ATOM   2067 C  CG    . GLN A  1 268 ? 15.596  -11.567 34.138 1.00 71.31  ? 268 GLN A CG    1 
ATOM   2068 C  CD    . GLN A  1 268 ? 16.833  -12.425 34.408 1.00 78.07  ? 268 GLN A CD    1 
ATOM   2069 O  OE1   . GLN A  1 268 ? 17.220  -13.260 33.585 1.00 86.23  ? 268 GLN A OE1   1 
ATOM   2070 N  NE2   . GLN A  1 268 ? 17.452  -12.221 35.562 1.00 68.27  ? 268 GLN A NE2   1 
ATOM   2071 N  N     . ARG A  1 269 ? 16.160  -7.906  32.537 1.00 36.26  ? 269 ARG A N     1 
ATOM   2072 C  CA    . ARG A  1 269 ? 15.936  -7.323  31.222 1.00 34.77  ? 269 ARG A CA    1 
ATOM   2073 C  C     . ARG A  1 269 ? 17.233  -6.811  30.630 1.00 31.66  ? 269 ARG A C     1 
ATOM   2074 O  O     . ARG A  1 269 ? 17.446  -6.915  29.435 1.00 40.20  ? 269 ARG A O     1 
ATOM   2075 C  CB    . ARG A  1 269 ? 14.923  -6.170  31.298 1.00 30.91  ? 269 ARG A CB    1 
ATOM   2076 C  CG    . ARG A  1 269 ? 14.729  -5.469  29.966 1.00 32.93  ? 269 ARG A CG    1 
ATOM   2077 C  CD    . ARG A  1 269 ? 13.580  -4.489  29.975 1.00 41.83  ? 269 ARG A CD    1 
ATOM   2078 N  NE    . ARG A  1 269 ? 12.276  -5.140  30.095 1.00 34.24  ? 269 ARG A NE    1 
ATOM   2079 C  CZ    . ARG A  1 269 ? 11.665  -5.368  31.246 1.00 40.78  ? 269 ARG A CZ    1 
ATOM   2080 N  NH1   . ARG A  1 269 ? 12.227  -4.996  32.385 1.00 39.12  ? 269 ARG A NH1   1 
ATOM   2081 N  NH2   . ARG A  1 269 ? 10.491  -5.974  31.258 1.00 43.29  ? 269 ARG A NH2   1 
ATOM   2082 N  N     . THR A  1 270 ? 18.105  -6.269  31.476 1.00 38.63  ? 270 THR A N     1 
ATOM   2083 C  CA    . THR A  1 270 ? 19.385  -5.731  31.021 1.00 32.06  ? 270 THR A CA    1 
ATOM   2084 C  C     . THR A  1 270 ? 20.392  -6.786  30.565 1.00 28.32  ? 270 THR A C     1 
ATOM   2085 O  O     . THR A  1 270 ? 21.090  -6.606  29.569 1.00 36.39  ? 270 THR A O     1 
ATOM   2086 C  CB    . THR A  1 270 ? 20.051  -4.872  32.130 1.00 28.45  ? 270 THR A CB    1 
ATOM   2087 O  OG1   . THR A  1 270 ? 19.182  -3.797  32.490 1.00 30.74  ? 270 THR A OG1   1 
ATOM   2088 C  CG2   . THR A  1 270 ? 21.381  -4.278  31.649 1.00 16.44  ? 270 THR A CG2   1 
ATOM   2089 N  N     . ILE A  1 271 ? 20.505  -7.880  31.297 1.00 37.21  ? 271 ILE A N     1 
ATOM   2090 C  CA    . ILE A  1 271 ? 21.490  -8.871  30.892 1.00 32.14  ? 271 ILE A CA    1 
ATOM   2091 C  C     . ILE A  1 271 ? 21.041  -9.546  29.595 1.00 37.20  ? 271 ILE A C     1 
ATOM   2092 O  O     . ILE A  1 271 ? 21.867  -9.871  28.747 1.00 35.14  ? 271 ILE A O     1 
ATOM   2093 C  CB    . ILE A  1 271 ? 21.752  -9.909  32.024 1.00 29.59  ? 271 ILE A CB    1 
ATOM   2094 C  CG1   . ILE A  1 271 ? 23.007  -10.720 31.696 1.00 44.30  ? 271 ILE A CG1   1 
ATOM   2095 C  CG2   . ILE A  1 271 ? 20.564  -10.818 32.204 1.00 37.49  ? 271 ILE A CG2   1 
ATOM   2096 C  CD1   . ILE A  1 271 ? 24.275  -9.880  31.574 1.00 27.97  ? 271 ILE A CD1   1 
ATOM   2097 N  N     . GLN A  1 272 ? 19.735  -9.735  29.413 1.00 38.38  ? 272 GLN A N     1 
ATOM   2098 C  CA    . GLN A  1 272 ? 19.270  -10.356 28.170 1.00 38.05  ? 272 GLN A CA    1 
ATOM   2099 C  C     . GLN A  1 272 ? 19.691  -9.497  26.977 1.00 48.13  ? 272 GLN A C     1 
ATOM   2100 O  O     . GLN A  1 272 ? 20.406  -9.958  26.083 1.00 40.94  ? 272 GLN A O     1 
ATOM   2101 C  CB    . GLN A  1 272 ? 17.752  -10.539 28.184 1.00 45.51  ? 272 GLN A CB    1 
ATOM   2102 C  CG    . GLN A  1 272 ? 17.282  -11.654 29.114 1.00 60.20  ? 272 GLN A CG    1 
ATOM   2103 C  CD    . GLN A  1 272 ? 15.799  -11.946 28.978 1.00 77.02  ? 272 GLN A CD    1 
ATOM   2104 O  OE1   . GLN A  1 272 ? 15.304  -12.216 27.877 1.00 84.32  ? 272 GLN A OE1   1 
ATOM   2105 N  NE2   . GLN A  1 272 ? 15.081  -11.899 30.098 1.00 78.41  ? 272 GLN A NE2   1 
ATOM   2106 N  N     . CYS A  1 273 ? 19.275  -8.236  26.971 1.00 48.41  ? 273 CYS A N     1 
ATOM   2107 C  CA    . CYS A  1 273 ? 19.643  -7.377  25.869 1.00 46.25  ? 273 CYS A CA    1 
ATOM   2108 C  C     . CYS A  1 273 ? 21.160  -7.316  25.691 1.00 45.41  ? 273 CYS A C     1 
ATOM   2109 O  O     . CYS A  1 273 ? 21.663  -7.411  24.571 1.00 48.02  ? 273 CYS A O     1 
ATOM   2110 C  CB    . CYS A  1 273 ? 19.050  -5.975  26.052 1.00 47.20  ? 273 CYS A CB    1 
ATOM   2111 S  SG    . CYS A  1 273 ? 17.479  -5.736  25.143 1.00 87.97  ? 273 CYS A SG    1 
ATOM   2112 N  N     . ALA A  1 274 ? 21.895  -7.187  26.789 1.00 43.12  ? 274 ALA A N     1 
ATOM   2113 C  CA    . ALA A  1 274 ? 23.351  -7.109  26.705 1.00 42.99  ? 274 ALA A CA    1 
ATOM   2114 C  C     . ALA A  1 274 ? 23.912  -8.274  25.889 1.00 51.87  ? 274 ALA A C     1 
ATOM   2115 O  O     . ALA A  1 274 ? 24.761  -8.072  25.018 1.00 60.32  ? 274 ALA A O     1 
ATOM   2116 C  CB    . ALA A  1 274 ? 23.956  -7.097  28.098 1.00 35.78  ? 274 ALA A CB    1 
ATOM   2117 N  N     . LYS A  1 275 ? 23.426  -9.485  26.164 1.00 44.70  ? 275 LYS A N     1 
ATOM   2118 C  CA    . LYS A  1 275 ? 23.866  -10.689 25.455 1.00 54.47  ? 275 LYS A CA    1 
ATOM   2119 C  C     . LYS A  1 275 ? 23.514  -10.671 23.977 1.00 55.07  ? 275 LYS A C     1 
ATOM   2120 O  O     . LYS A  1 275 ? 24.386  -10.809 23.132 1.00 52.42  ? 275 LYS A O     1 
ATOM   2121 C  CB    . LYS A  1 275 ? 23.229  -11.927 26.045 1.00 48.43  ? 275 LYS A CB    1 
ATOM   2122 C  CG    . LYS A  1 275 ? 23.631  -12.254 27.427 1.00 55.89  ? 275 LYS A CG    1 
ATOM   2123 C  CD    . LYS A  1 275 ? 22.632  -13.259 27.890 1.00 64.20  ? 275 LYS A CD    1 
ATOM   2124 C  CE    . LYS A  1 275 ? 23.060  -13.944 29.138 1.00 68.28  ? 275 LYS A CE    1 
ATOM   2125 N  NZ    . LYS A  1 275 ? 22.261  -15.191 29.235 1.00 80.91  ? 275 LYS A NZ    1 
ATOM   2126 N  N     . ALA A  1 276 ? 22.222  -10.553 23.681 1.00 55.82  ? 276 ALA A N     1 
ATOM   2127 C  CA    . ALA A  1 276 ? 21.762  -10.499 22.304 1.00 55.94  ? 276 ALA A CA    1 
ATOM   2128 C  C     . ALA A  1 276 ? 22.705  -9.590  21.502 1.00 54.65  ? 276 ALA A C     1 
ATOM   2129 O  O     . ALA A  1 276 ? 23.112  -9.927  20.392 1.00 62.35  ? 276 ALA A O     1 
ATOM   2130 C  CB    . ALA A  1 276 ? 20.345  -9.960  22.259 1.00 37.76  ? 276 ALA A CB    1 
ATOM   2131 N  N     . GLN A  1 277 ? 23.065  -8.452  22.084 1.00 50.38  ? 277 GLN A N     1 
ATOM   2132 C  CA    . GLN A  1 277 ? 23.955  -7.503  21.424 1.00 56.98  ? 277 GLN A CA    1 
ATOM   2133 C  C     . GLN A  1 277 ? 25.391  -8.006  21.342 1.00 64.32  ? 277 GLN A C     1 
ATOM   2134 O  O     . GLN A  1 277 ? 26.030  -7.916  20.291 1.00 66.82  ? 277 GLN A O     1 
ATOM   2135 C  CB    . GLN A  1 277 ? 23.975  -6.164  22.161 1.00 61.82  ? 277 GLN A CB    1 
ATOM   2136 C  CG    . GLN A  1 277 ? 22.690  -5.367  22.151 1.00 57.55  ? 277 GLN A CG    1 
ATOM   2137 C  CD    . GLN A  1 277 ? 22.843  -4.088  22.947 1.00 72.90  ? 277 GLN A CD    1 
ATOM   2138 O  OE1   . GLN A  1 277 ? 23.007  -4.117  24.172 1.00 69.11  ? 277 GLN A OE1   1 
ATOM   2139 N  NE2   . GLN A  1 277 ? 22.809  -2.955  22.255 1.00 82.87  ? 277 GLN A NE2   1 
ATOM   2140 N  N     . ALA A  1 278 ? 25.904  -8.516  22.457 1.00 57.44  ? 278 ALA A N     1 
ATOM   2141 C  CA    . ALA A  1 278 ? 27.273  -9.001  22.503 1.00 60.61  ? 278 ALA A CA    1 
ATOM   2142 C  C     . ALA A  1 278 ? 27.455  -10.240 21.650 1.00 66.86  ? 278 ALA A C     1 
ATOM   2143 O  O     . ALA A  1 278 ? 28.469  -10.391 20.960 1.00 65.33  ? 278 ALA A O     1 
ATOM   2144 C  CB    . ALA A  1 278 ? 27.673  -9.300  23.932 1.00 49.09  ? 278 ALA A CB    1 
ATOM   2145 N  N     . GLY A  1 279 ? 26.456  -11.114 21.694 1.00 64.56  ? 279 GLY A N     1 
ATOM   2146 C  CA    . GLY A  1 279 ? 26.513  -12.357 20.955 1.00 67.33  ? 279 GLY A CA    1 
ATOM   2147 C  C     . GLY A  1 279 ? 26.923  -13.459 21.913 1.00 76.79  ? 279 GLY A C     1 
ATOM   2148 O  O     . GLY A  1 279 ? 27.599  -13.198 22.914 1.00 79.08  ? 279 GLY A O     1 
ATOM   2149 N  N     . GLU A  1 280 ? 26.518  -14.689 21.613 1.00 80.47  ? 280 GLU A N     1 
ATOM   2150 C  CA    . GLU A  1 280 ? 26.841  -15.830 22.456 1.00 83.17  ? 280 GLU A CA    1 
ATOM   2151 C  C     . GLU A  1 280 ? 28.311  -15.937 22.861 1.00 82.59  ? 280 GLU A C     1 
ATOM   2152 O  O     . GLU A  1 280 ? 29.217  -15.792 22.036 1.00 82.83  ? 280 GLU A O     1 
ATOM   2153 C  CB    . GLU A  1 280 ? 26.426  -17.129 21.767 1.00 81.69  ? 280 GLU A CB    1 
ATOM   2154 C  CG    . GLU A  1 280 ? 26.958  -18.378 22.458 1.00 91.66  ? 280 GLU A CG    1 
ATOM   2155 C  CD    . GLU A  1 280 ? 26.542  -19.670 21.762 1.00 100.00 ? 280 GLU A CD    1 
ATOM   2156 O  OE1   . GLU A  1 280 ? 25.326  -19.979 21.760 1.00 100.00 ? 280 GLU A OE1   1 
ATOM   2157 O  OE2   . GLU A  1 280 ? 27.430  -20.376 21.220 1.00 100.00 ? 280 GLU A OE2   1 
ATOM   2158 N  N     . GLY A  1 281 ? 28.527  -16.190 24.146 1.00 80.24  ? 281 GLY A N     1 
ATOM   2159 C  CA    . GLY A  1 281 ? 29.868  -16.353 24.666 1.00 83.38  ? 281 GLY A CA    1 
ATOM   2160 C  C     . GLY A  1 281 ? 30.717  -15.104 24.785 1.00 86.96  ? 281 GLY A C     1 
ATOM   2161 O  O     . GLY A  1 281 ? 31.860  -15.177 25.243 1.00 94.06  ? 281 GLY A O     1 
ATOM   2162 N  N     . VAL A  1 282 ? 30.192  -13.953 24.383 1.00 83.57  ? 282 VAL A N     1 
ATOM   2163 C  CA    . VAL A  1 282 ? 30.971  -12.728 24.481 1.00 77.51  ? 282 VAL A CA    1 
ATOM   2164 C  C     . VAL A  1 282 ? 30.463  -11.905 25.654 1.00 76.58  ? 282 VAL A C     1 
ATOM   2165 O  O     . VAL A  1 282 ? 29.255  -11.671 25.771 1.00 72.33  ? 282 VAL A O     1 
ATOM   2166 C  CB    . VAL A  1 282 ? 30.837  -11.865 23.209 1.00 76.35  ? 282 VAL A CB    1 
ATOM   2167 C  CG1   . VAL A  1 282 ? 31.886  -10.774 23.215 1.00 69.42  ? 282 VAL A CG1   1 
ATOM   2168 C  CG2   . VAL A  1 282 ? 30.956  -12.741 21.982 1.00 77.23  ? 282 VAL A CG2   1 
ATOM   2169 N  N     . ARG A  1 283 ? 31.374  -11.461 26.523 1.00 72.46  ? 283 ARG A N     1 
ATOM   2170 C  CA    . ARG A  1 283 ? 30.972  -10.621 27.647 1.00 66.71  ? 283 ARG A CA    1 
ATOM   2171 C  C     . ARG A  1 283 ? 30.581  -9.226  27.170 1.00 60.52  ? 283 ARG A C     1 
ATOM   2172 O  O     . ARG A  1 283 ? 31.350  -8.569  26.472 1.00 62.19  ? 283 ARG A O     1 
ATOM   2173 C  CB    . ARG A  1 283 ? 32.061  -10.539 28.721 1.00 62.14  ? 283 ARG A CB    1 
ATOM   2174 C  CG    . ARG A  1 283 ? 32.068  -11.743 29.619 1.00 77.48  ? 283 ARG A CG    1 
ATOM   2175 C  CD    . ARG A  1 283 ? 32.996  -11.599 30.822 1.00 82.12  ? 283 ARG A CD    1 
ATOM   2176 N  NE    . ARG A  1 283 ? 33.104  -12.861 31.558 1.00 94.77  ? 283 ARG A NE    1 
ATOM   2177 C  CZ    . ARG A  1 283 ? 32.235  -13.290 32.470 1.00 92.68  ? 283 ARG A CZ    1 
ATOM   2178 N  NH1   . ARG A  1 283 ? 31.183  -12.556 32.797 1.00 93.62  ? 283 ARG A NH1   1 
ATOM   2179 N  NH2   . ARG A  1 283 ? 32.400  -14.479 33.036 1.00 89.04  ? 283 ARG A NH2   1 
ATOM   2180 N  N     . PRO A  1 284 ? 29.354  -8.816  27.536 1.00 54.12  ? 284 PRO A N     1 
ATOM   2181 C  CA    . PRO A  1 284 ? 28.791  -7.530  27.186 1.00 46.27  ? 284 PRO A CA    1 
ATOM   2182 C  C     . PRO A  1 284 ? 29.694  -6.432  27.698 1.00 48.67  ? 284 PRO A C     1 
ATOM   2183 O  O     . PRO A  1 284 ? 30.276  -6.554  28.779 1.00 50.04  ? 284 PRO A O     1 
ATOM   2184 C  CB    . PRO A  1 284 ? 27.418  -7.522  27.841 1.00 49.10  ? 284 PRO A CB    1 
ATOM   2185 C  CG    . PRO A  1 284 ? 27.020  -8.957  27.837 1.00 53.19  ? 284 PRO A CG    1 
ATOM   2186 C  CD    . PRO A  1 284 ? 28.338  -9.600  28.299 1.00 45.64  ? 284 PRO A CD    1 
ATOM   2187 N  N     . SER A  1 285 ? 29.811  -5.375  26.910 1.00 47.30  ? 285 SER A N     1 
ATOM   2188 C  CA    . SER A  1 285 ? 30.619  -4.225  27.276 1.00 48.60  ? 285 SER A CA    1 
ATOM   2189 C  C     . SER A  1 285 ? 29.817  -3.358  28.252 1.00 46.78  ? 285 SER A C     1 
ATOM   2190 O  O     . SER A  1 285 ? 28.631  -3.616  28.492 1.00 48.00  ? 285 SER A O     1 
ATOM   2191 C  CB    . SER A  1 285 ? 30.933  -3.417  26.027 1.00 41.46  ? 285 SER A CB    1 
ATOM   2192 O  OG    . SER A  1 285 ? 29.724  -3.014  25.408 1.00 53.31  ? 285 SER A OG    1 
ATOM   2193 N  N     . PRO A  1 286 ? 30.453  -2.330  28.836 1.00 45.10  ? 286 PRO A N     1 
ATOM   2194 C  CA    . PRO A  1 286 ? 29.732  -1.456  29.768 1.00 49.01  ? 286 PRO A CA    1 
ATOM   2195 C  C     . PRO A  1 286 ? 28.539  -0.830  29.060 1.00 49.45  ? 286 PRO A C     1 
ATOM   2196 O  O     . PRO A  1 286 ? 27.459  -0.691  29.642 1.00 50.61  ? 286 PRO A O     1 
ATOM   2197 C  CB    . PRO A  1 286 ? 30.778  -0.414  30.155 1.00 47.43  ? 286 PRO A CB    1 
ATOM   2198 C  CG    . PRO A  1 286 ? 32.056  -1.194  30.099 1.00 43.50  ? 286 PRO A CG    1 
ATOM   2199 C  CD    . PRO A  1 286 ? 31.892  -1.999  28.818 1.00 48.23  ? 286 PRO A CD    1 
ATOM   2200 N  N     . MET A  1 287 ? 28.733  -0.471  27.792 1.00 48.28  ? 287 MET A N     1 
ATOM   2201 C  CA    . MET A  1 287 ? 27.665  0.154   27.014 1.00 44.57  ? 287 MET A CA    1 
ATOM   2202 C  C     . MET A  1 287 ? 26.456  -0.769  26.911 1.00 40.00  ? 287 MET A C     1 
ATOM   2203 O  O     . MET A  1 287 ? 25.306  -0.358  27.112 1.00 45.41  ? 287 MET A O     1 
ATOM   2204 C  CB    . MET A  1 287 ? 28.161  0.503   25.612 1.00 43.84  ? 287 MET A CB    1 
ATOM   2205 C  CG    . MET A  1 287 ? 27.179  1.331   24.798 1.00 55.34  ? 287 MET A CG    1 
ATOM   2206 S  SD    . MET A  1 287 ? 27.665  1.454   23.064 1.00 72.02  ? 287 MET A SD    1 
ATOM   2207 C  CE    . MET A  1 287 ? 29.157  2.386   23.191 1.00 58.33  ? 287 MET A CE    1 
ATOM   2208 N  N     . GLN A  1 288 ? 26.719  -2.029  26.610 1.00 41.76  ? 288 GLN A N     1 
ATOM   2209 C  CA    . GLN A  1 288 ? 25.647  -2.993  26.465 1.00 43.70  ? 288 GLN A CA    1 
ATOM   2210 C  C     . GLN A  1 288 ? 24.989  -3.321  27.788 1.00 40.06  ? 288 GLN A C     1 
ATOM   2211 O  O     . GLN A  1 288 ? 23.847  -3.787  27.812 1.00 35.55  ? 288 GLN A O     1 
ATOM   2212 C  CB    . GLN A  1 288 ? 26.199  -4.244  25.794 1.00 44.70  ? 288 GLN A CB    1 
ATOM   2213 C  CG    . GLN A  1 288 ? 26.944  -3.885  24.525 1.00 55.11  ? 288 GLN A CG    1 
ATOM   2214 C  CD    . GLN A  1 288 ? 27.459  -5.078  23.767 1.00 60.11  ? 288 GLN A CD    1 
ATOM   2215 O  OE1   . GLN A  1 288 ? 28.001  -6.012  24.355 1.00 69.84  ? 288 GLN A OE1   1 
ATOM   2216 N  NE2   . GLN A  1 288 ? 27.315  -5.045  22.442 1.00 56.62  ? 288 GLN A NE2   1 
ATOM   2217 N  N     . LEU A  1 289 ? 25.709  -3.048  28.884 1.00 40.31  ? 289 LEU A N     1 
ATOM   2218 C  CA    . LEU A  1 289 ? 25.231  -3.310  30.247 1.00 44.67  ? 289 LEU A CA    1 
ATOM   2219 C  C     . LEU A  1 289 ? 24.492  -2.152  30.953 1.00 34.63  ? 289 LEU A C     1 
ATOM   2220 O  O     . LEU A  1 289 ? 24.146  -2.262  32.126 1.00 38.24  ? 289 LEU A O     1 
ATOM   2221 C  CB    . LEU A  1 289 ? 26.409  -3.799  31.112 1.00 34.96  ? 289 LEU A CB    1 
ATOM   2222 C  CG    . LEU A  1 289 ? 26.853  -5.236  30.758 1.00 40.56  ? 289 LEU A CG    1 
ATOM   2223 C  CD1   . LEU A  1 289 ? 28.142  -5.609  31.487 1.00 34.78  ? 289 LEU A CD1   1 
ATOM   2224 C  CD2   . LEU A  1 289 ? 25.746  -6.219  31.154 1.00 27.54  ? 289 LEU A CD2   1 
ATOM   2225 N  N     . GLU A  1 290 ? 24.258  -1.054  30.237 1.00 30.59  ? 290 GLU A N     1 
ATOM   2226 C  CA    . GLU A  1 290 ? 23.548  0.088   30.793 1.00 35.45  ? 290 GLU A CA    1 
ATOM   2227 C  C     . GLU A  1 290 ? 22.146  -0.385  31.134 1.00 27.81  ? 290 GLU A C     1 
ATOM   2228 O  O     . GLU A  1 290 ? 21.534  -1.125  30.381 1.00 33.56  ? 290 GLU A O     1 
ATOM   2229 C  CB    . GLU A  1 290 ? 23.466  1.227   29.775 1.00 39.07  ? 290 GLU A CB    1 
ATOM   2230 C  CG    . GLU A  1 290 ? 24.766  1.960   29.563 1.00 34.41  ? 290 GLU A CG    1 
ATOM   2231 C  CD    . GLU A  1 290 ? 25.116  2.903   30.694 1.00 34.60  ? 290 GLU A CD    1 
ATOM   2232 O  OE1   . GLU A  1 290 ? 24.381  2.972   31.704 1.00 36.23  ? 290 GLU A OE1   1 
ATOM   2233 O  OE2   . GLU A  1 290 ? 26.139  3.589   30.564 1.00 36.24  ? 290 GLU A OE2   1 
ATOM   2234 N  N     . LEU A  1 291 ? 21.648  0.035   32.279 1.00 25.38  ? 291 LEU A N     1 
ATOM   2235 C  CA    . LEU A  1 291 ? 20.327  -0.381  32.710 1.00 32.45  ? 291 LEU A CA    1 
ATOM   2236 C  C     . LEU A  1 291 ? 19.241  -0.117  31.667 1.00 31.76  ? 291 LEU A C     1 
ATOM   2237 O  O     . LEU A  1 291 ? 19.192  0.947   31.039 1.00 30.79  ? 291 LEU A O     1 
ATOM   2238 C  CB    . LEU A  1 291 ? 19.970  0.321   34.035 1.00 28.17  ? 291 LEU A CB    1 
ATOM   2239 C  CG    . LEU A  1 291 ? 20.912  0.073   35.234 1.00 39.03  ? 291 LEU A CG    1 
ATOM   2240 C  CD1   . LEU A  1 291 ? 20.265  0.617   36.473 1.00 34.00  ? 291 LEU A CD1   1 
ATOM   2241 C  CD2   . LEU A  1 291 ? 21.187  -1.412  35.439 1.00 35.65  ? 291 LEU A CD2   1 
ATOM   2242 N  N     . ARG A  1 292 ? 18.375  -1.099  31.471 1.00 39.75  ? 292 ARG A N     1 
ATOM   2243 C  CA    . ARG A  1 292 ? 17.267  -0.923  30.549 1.00 31.18  ? 292 ARG A CA    1 
ATOM   2244 C  C     . ARG A  1 292 ? 16.187  -0.275  31.391 1.00 36.31  ? 292 ARG A C     1 
ATOM   2245 O  O     . ARG A  1 292 ? 15.161  -0.899  31.742 1.00 38.32  ? 292 ARG A O     1 
ATOM   2246 C  CB    . ARG A  1 292 ? 16.804  -2.281  30.015 1.00 29.68  ? 292 ARG A CB    1 
ATOM   2247 C  CG    . ARG A  1 292 ? 17.774  -2.871  29.016 1.00 38.37  ? 292 ARG A CG    1 
ATOM   2248 C  CD    . ARG A  1 292 ? 18.026  -1.877  27.888 1.00 37.14  ? 292 ARG A CD    1 
ATOM   2249 N  NE    . ARG A  1 292 ? 18.727  -2.466  26.757 1.00 59.37  ? 292 ARG A NE    1 
ATOM   2250 C  CZ    . ARG A  1 292 ? 20.000  -2.870  26.772 1.00 85.84  ? 292 ARG A CZ    1 
ATOM   2251 N  NH1   . ARG A  1 292 ? 20.748  -2.745  27.869 1.00 68.57  ? 292 ARG A NH1   1 
ATOM   2252 N  NH2   . ARG A  1 292 ? 20.526  -3.415  25.680 1.00 89.22  ? 292 ARG A NH2   1 
ATOM   2253 N  N     . MET A  1 293 ? 16.428  0.994   31.711 1.00 28.01  ? 293 MET A N     1 
ATOM   2254 C  CA    . MET A  1 293 ? 15.526  1.757   32.559 1.00 34.05  ? 293 MET A CA    1 
ATOM   2255 C  C     . MET A  1 293 ? 14.138  2.085   31.995 1.00 36.73  ? 293 MET A C     1 
ATOM   2256 O  O     . MET A  1 293 ? 13.134  1.750   32.612 1.00 29.63  ? 293 MET A O     1 
ATOM   2257 C  CB    . MET A  1 293 ? 16.207  3.059   33.011 1.00 39.82  ? 293 MET A CB    1 
ATOM   2258 C  CG    . MET A  1 293 ? 15.470  3.791   34.153 1.00 33.42  ? 293 MET A CG    1 
ATOM   2259 S  SD    . MET A  1 293 ? 15.691  3.022   35.796 1.00 53.60  ? 293 MET A SD    1 
ATOM   2260 C  CE    . MET A  1 293 ? 16.954  1.770   35.485 1.00 26.74  ? 293 MET A CE    1 
ATOM   2261 N  N     . VAL A  1 294 ? 14.069  2.740   30.844 1.00 35.38  ? 294 VAL A N     1 
ATOM   2262 C  CA    . VAL A  1 294 ? 12.766  3.102   30.303 1.00 40.79  ? 294 VAL A CA    1 
ATOM   2263 C  C     . VAL A  1 294 ? 11.947  1.869   29.953 1.00 38.09  ? 294 VAL A C     1 
ATOM   2264 O  O     . VAL A  1 294 ? 10.730  1.878   30.114 1.00 32.07  ? 294 VAL A O     1 
ATOM   2265 C  CB    . VAL A  1 294 ? 12.888  4.088   29.074 1.00 48.12  ? 294 VAL A CB    1 
ATOM   2266 C  CG1   . VAL A  1 294 ? 13.743  5.298   29.467 1.00 32.84  ? 294 VAL A CG1   1 
ATOM   2267 C  CG2   . VAL A  1 294 ? 13.485  3.401   27.874 1.00 37.03  ? 294 VAL A CG2   1 
ATOM   2268 N  N     . GLN A  1 295 ? 12.604  0.804   29.500 1.00 28.82  ? 295 GLN A N     1 
ATOM   2269 C  CA    . GLN A  1 295 ? 11.900  -0.434  29.172 1.00 25.91  ? 295 GLN A CA    1 
ATOM   2270 C  C     . GLN A  1 295 ? 11.358  -1.170  30.416 1.00 29.12  ? 295 GLN A C     1 
ATOM   2271 O  O     . GLN A  1 295 ? 10.554  -2.093  30.303 1.00 34.50  ? 295 GLN A O     1 
ATOM   2272 C  CB    . GLN A  1 295 ? 12.823  -1.365  28.379 1.00 25.32  ? 295 GLN A CB    1 
ATOM   2273 C  CG    . GLN A  1 295 ? 13.404  -0.758  27.075 1.00 22.69  ? 295 GLN A CG    1 
ATOM   2274 C  CD    . GLN A  1 295 ? 14.626  0.127   27.314 1.00 49.33  ? 295 GLN A CD    1 
ATOM   2275 O  OE1   . GLN A  1 295 ? 15.059  0.313   28.451 1.00 37.01  ? 295 GLN A OE1   1 
ATOM   2276 N  NE2   . GLN A  1 295 ? 15.185  0.677   26.238 1.00 39.38  ? 295 GLN A NE2   1 
ATOM   2277 N  N     . SER A  1 296 ? 11.780  -0.758  31.606 1.00 22.63  ? 296 SER A N     1 
ATOM   2278 C  CA    . SER A  1 296 ? 11.330  -1.398  32.847 1.00 22.73  ? 296 SER A CA    1 
ATOM   2279 C  C     . SER A  1 296 ? 10.252  -0.642  33.582 1.00 29.10  ? 296 SER A C     1 
ATOM   2280 O  O     . SER A  1 296 ? 9.972   -0.947  34.739 1.00 28.90  ? 296 SER A O     1 
ATOM   2281 C  CB    . SER A  1 296 ? 12.494  -1.573  33.818 1.00 23.52  ? 296 SER A CB    1 
ATOM   2282 O  OG    . SER A  1 296 ? 13.520  -2.380  33.245 1.00 38.22  ? 296 SER A OG    1 
ATOM   2283 N  N     . LYS A  1 297 ? 9.653   0.340   32.913 1.00 29.27  ? 297 LYS A N     1 
ATOM   2284 C  CA    . LYS A  1 297 ? 8.620   1.166   33.514 1.00 25.91  ? 297 LYS A CA    1 
ATOM   2285 C  C     . LYS A  1 297 ? 7.544   0.375   34.262 1.00 26.04  ? 297 LYS A C     1 
ATOM   2286 O  O     . LYS A  1 297 ? 7.235   0.683   35.420 1.00 34.44  ? 297 LYS A O     1 
ATOM   2287 C  CB    . LYS A  1 297 ? 7.987   2.070   32.433 1.00 22.01  ? 297 LYS A CB    1 
ATOM   2288 C  CG    . LYS A  1 297 ? 6.813   2.921   32.945 1.00 34.10  ? 297 LYS A CG    1 
ATOM   2289 C  CD    . LYS A  1 297 ? 6.190   3.786   31.853 1.00 38.90  ? 297 LYS A CD    1 
ATOM   2290 C  CE    . LYS A  1 297 ? 5.571   2.940   30.734 1.00 22.38  ? 297 LYS A CE    1 
ATOM   2291 N  NZ    . LYS A  1 297 ? 4.905   3.780   29.710 1.00 32.23  ? 297 LYS A NZ    1 
ATOM   2292 N  N     . ARG A  1 298 ? 6.974   -0.645  33.628 1.00 31.04  ? 298 ARG A N     1 
ATOM   2293 C  CA    . ARG A  1 298 ? 5.919   -1.412  34.293 1.00 40.08  ? 298 ARG A CA    1 
ATOM   2294 C  C     . ARG A  1 298 ? 6.427   -2.157  35.517 1.00 38.08  ? 298 ARG A C     1 
ATOM   2295 O  O     . ARG A  1 298 ? 5.679   -2.336  36.480 1.00 38.27  ? 298 ARG A O     1 
ATOM   2296 C  CB    . ARG A  1 298 ? 5.275   -2.404  33.329 1.00 35.09  ? 298 ARG A CB    1 
ATOM   2297 C  CG    . ARG A  1 298 ? 4.667   -1.753  32.104 1.00 43.87  ? 298 ARG A CG    1 
ATOM   2298 C  CD    . ARG A  1 298 ? 3.349   -1.033  32.393 1.00 63.48  ? 298 ARG A CD    1 
ATOM   2299 N  NE    . ARG A  1 298 ? 2.180   -1.913  32.305 1.00 79.43  ? 298 ARG A NE    1 
ATOM   2300 C  CZ    . ARG A  1 298 ? 1.869   -2.668  31.248 1.00 82.24  ? 298 ARG A CZ    1 
ATOM   2301 N  NH1   . ARG A  1 298 ? 2.637   -2.676  30.166 1.00 81.90  ? 298 ARG A NH1   1 
ATOM   2302 N  NH2   . ARG A  1 298 ? 0.781   -3.420  31.270 1.00 79.34  ? 298 ARG A NH2   1 
ATOM   2303 N  N     . ASP A  1 299 ? 7.689   -2.583  35.489 1.00 30.90  ? 299 ASP A N     1 
ATOM   2304 C  CA    . ASP A  1 299 ? 8.281   -3.295  36.621 1.00 36.84  ? 299 ASP A CA    1 
ATOM   2305 C  C     . ASP A  1 299 ? 8.511   -2.341  37.791 1.00 39.00  ? 299 ASP A C     1 
ATOM   2306 O  O     . ASP A  1 299 ? 8.393   -2.729  38.961 1.00 41.16  ? 299 ASP A O     1 
ATOM   2307 C  CB    . ASP A  1 299 ? 9.596   -3.961  36.203 1.00 35.50  ? 299 ASP A CB    1 
ATOM   2308 C  CG    . ASP A  1 299 ? 9.406   -4.948  35.076 1.00 35.87  ? 299 ASP A CG    1 
ATOM   2309 O  OD1   . ASP A  1 299 ? 8.584   -5.869  35.255 1.00 36.36  ? 299 ASP A OD1   1 
ATOM   2310 O  OD2   . ASP A  1 299 ? 10.066  -4.809  34.018 1.00 35.86  ? 299 ASP A OD2   1 
ATOM   2311 N  N     . ILE A  1 300 ? 8.823   -1.085  37.483 1.00 29.60  ? 300 ILE A N     1 
ATOM   2312 C  CA    . ILE A  1 300 ? 9.026   -0.098  38.543 1.00 31.68  ? 300 ILE A CA    1 
ATOM   2313 C  C     . ILE A  1 300 ? 7.668   0.288   39.203 1.00 34.65  ? 300 ILE A C     1 
ATOM   2314 O  O     . ILE A  1 300 ? 7.574   0.448   40.411 1.00 31.41  ? 300 ILE A O     1 
ATOM   2315 C  CB    . ILE A  1 300 ? 9.742   1.143   37.963 1.00 34.17  ? 300 ILE A CB    1 
ATOM   2316 C  CG1   . ILE A  1 300 ? 11.153  0.748   37.504 1.00 31.94  ? 300 ILE A CG1   1 
ATOM   2317 C  CG2   . ILE A  1 300 ? 9.784   2.241   38.977 1.00 29.73  ? 300 ILE A CG2   1 
ATOM   2318 C  CD1   . ILE A  1 300 ? 11.764  1.743   36.563 1.00 25.83  ? 300 ILE A CD1   1 
ATOM   2319 N  N     . GLU A  1 301 ? 6.624   0.414   38.400 1.00 30.83  ? 301 GLU A N     1 
ATOM   2320 C  CA    . GLU A  1 301 ? 5.292   0.768   38.897 1.00 33.19  ? 301 GLU A CA    1 
ATOM   2321 C  C     . GLU A  1 301 ? 4.709   -0.272  39.836 1.00 39.89  ? 301 GLU A C     1 
ATOM   2322 O  O     . GLU A  1 301 ? 4.141   0.063   40.866 1.00 54.76  ? 301 GLU A O     1 
ATOM   2323 C  CB    . GLU A  1 301 ? 4.329   0.958   37.722 1.00 29.42  ? 301 GLU A CB    1 
ATOM   2324 C  CG    . GLU A  1 301 ? 4.496   2.273   37.020 1.00 37.88  ? 301 GLU A CG    1 
ATOM   2325 C  CD    . GLU A  1 301 ? 3.736   2.367   35.708 1.00 35.48  ? 301 GLU A CD    1 
ATOM   2326 O  OE1   . GLU A  1 301 ? 3.475   3.507   35.289 1.00 43.27  ? 301 GLU A OE1   1 
ATOM   2327 O  OE2   . GLU A  1 301 ? 3.419   1.327   35.093 1.00 46.80  ? 301 GLU A OE2   1 
ATOM   2328 N  N     . ASP A  1 302 ? 4.833   -1.540  39.467 1.00 42.74  ? 302 ASP A N     1 
ATOM   2329 C  CA    . ASP A  1 302 ? 4.283   -2.618  40.273 1.00 44.18  ? 302 ASP A CA    1 
ATOM   2330 C  C     . ASP A  1 302 ? 5.165   -3.829  40.048 1.00 42.26  ? 302 ASP A C     1 
ATOM   2331 O  O     . ASP A  1 302 ? 4.921   -4.638  39.156 1.00 43.50  ? 302 ASP A O     1 
ATOM   2332 C  CB    . ASP A  1 302 ? 2.848   -2.905  39.825 1.00 51.39  ? 302 ASP A CB    1 
ATOM   2333 C  CG    . ASP A  1 302 ? 2.184   -3.978  40.659 1.00 62.92  ? 302 ASP A CG    1 
ATOM   2334 O  OD1   . ASP A  1 302 ? 2.176   -3.835  41.899 1.00 59.50  ? 302 ASP A OD1   1 
ATOM   2335 O  OD2   . ASP A  1 302 ? 1.674   -4.958  40.076 1.00 67.89  ? 302 ASP A OD2   1 
ATOM   2336 N  N     . PRO A  1 303 ? 6.220   -3.969  40.846 1.00 38.31  ? 303 PRO A N     1 
ATOM   2337 C  CA    . PRO A  1 303 ? 7.083   -5.131  40.623 1.00 38.42  ? 303 PRO A CA    1 
ATOM   2338 C  C     . PRO A  1 303 ? 6.506   -6.453  41.118 1.00 35.61  ? 303 PRO A C     1 
ATOM   2339 O  O     . PRO A  1 303 ? 5.880   -6.522  42.190 1.00 35.60  ? 303 PRO A O     1 
ATOM   2340 C  CB    . PRO A  1 303 ? 8.371   -4.747  41.344 1.00 35.29  ? 303 PRO A CB    1 
ATOM   2341 C  CG    . PRO A  1 303 ? 7.848   -3.943  42.518 1.00 28.01  ? 303 PRO A CG    1 
ATOM   2342 C  CD    . PRO A  1 303 ? 6.731   -3.106  41.927 1.00 30.70  ? 303 PRO A CD    1 
ATOM   2343 N  N     . GLU A  1 304 ? 6.678   -7.493  40.311 1.00 36.48  ? 304 GLU A N     1 
ATOM   2344 C  CA    . GLU A  1 304 ? 6.211   -8.806  40.706 1.00 41.50  ? 304 GLU A CA    1 
ATOM   2345 C  C     . GLU A  1 304 ? 7.253   -9.241  41.728 1.00 37.82  ? 304 GLU A C     1 
ATOM   2346 O  O     . GLU A  1 304 ? 8.455   -9.279  41.427 1.00 38.93  ? 304 GLU A O     1 
ATOM   2347 C  CB    . GLU A  1 304 ? 6.186   -9.756  39.500 1.00 30.41  ? 304 GLU A CB    1 
ATOM   2348 C  CG    . GLU A  1 304 ? 5.881   -11.226 39.839 1.00 33.19  ? 304 GLU A CG    1 
ATOM   2349 C  CD    . GLU A  1 304 ? 5.715   -12.088 38.592 1.00 47.86  ? 304 GLU A CD    1 
ATOM   2350 O  OE1   . GLU A  1 304 ? 6.011   -11.606 37.473 1.00 54.25  ? 304 GLU A OE1   1 
ATOM   2351 O  OE2   . GLU A  1 304 ? 5.287   -13.251 38.728 1.00 52.67  ? 304 GLU A OE2   1 
ATOM   2352 N  N     . ILE A  1 305 ? 6.816   -9.525  42.948 1.00 33.77  ? 305 ILE A N     1 
ATOM   2353 C  CA    . ILE A  1 305 ? 7.761   -9.945  43.984 1.00 42.65  ? 305 ILE A CA    1 
ATOM   2354 C  C     . ILE A  1 305 ? 8.354   -11.297 43.636 1.00 40.46  ? 305 ILE A C     1 
ATOM   2355 O  O     . ILE A  1 305 ? 7.643   -12.290 43.586 1.00 46.49  ? 305 ILE A O     1 
ATOM   2356 C  CB    . ILE A  1 305 ? 7.089   -10.073 45.352 1.00 44.91  ? 305 ILE A CB    1 
ATOM   2357 C  CG1   . ILE A  1 305 ? 6.345   -8.784  45.682 1.00 42.16  ? 305 ILE A CG1   1 
ATOM   2358 C  CG2   . ILE A  1 305 ? 8.140   -10.369 46.408 1.00 40.84  ? 305 ILE A CG2   1 
ATOM   2359 C  CD1   . ILE A  1 305 ? 7.196   -7.549  45.517 1.00 39.90  ? 305 ILE A CD1   1 
ATOM   2360 N  N     . VAL A  1 306 ? 9.651   -11.345 43.384 1.00 40.01  ? 306 VAL A N     1 
ATOM   2361 C  CA    . VAL A  1 306 ? 10.262  -12.614 43.038 1.00 42.36  ? 306 VAL A CA    1 
ATOM   2362 C  C     . VAL A  1 306 ? 11.283  -13.050 44.087 1.00 47.56  ? 306 VAL A C     1 
ATOM   2363 O  O     . VAL A  1 306 ? 12.086  -13.952 43.866 1.00 48.12  ? 306 VAL A O     1 
ATOM   2364 C  CB    . VAL A  1 306 ? 10.905  -12.534 41.648 1.00 39.80  ? 306 VAL A CB    1 
ATOM   2365 C  CG1   . VAL A  1 306 ? 9.832   -12.193 40.624 1.00 43.12  ? 306 VAL A CG1   1 
ATOM   2366 C  CG2   . VAL A  1 306 ? 12.015  -11.506 41.637 1.00 42.38  ? 306 VAL A CG2   1 
ATOM   2367 N  N     . VAL A  1 307 ? 11.234  -12.398 45.239 1.00 46.49  ? 307 VAL A N     1 
ATOM   2368 C  CA    . VAL A  1 307 ? 12.120  -12.718 46.349 1.00 56.47  ? 307 VAL A CA    1 
ATOM   2369 C  C     . VAL A  1 307 ? 11.410  -12.454 47.673 1.00 52.97  ? 307 VAL A C     1 
ATOM   2370 O  O     . VAL A  1 307 ? 10.955  -11.344 47.927 1.00 66.38  ? 307 VAL A O     1 
ATOM   2371 C  CB    . VAL A  1 307 ? 13.414  -11.861 46.348 1.00 60.44  ? 307 VAL A CB    1 
ATOM   2372 C  CG1   . VAL A  1 307 ? 14.394  -12.418 47.379 1.00 62.24  ? 307 VAL A CG1   1 
ATOM   2373 C  CG2   . VAL A  1 307 ? 14.049  -11.840 44.972 1.00 68.58  ? 307 VAL A CG2   1 
ATOM   2374 N  N     . GLN A  1 308 ? 11.291  -13.476 48.506 1.00 52.38  ? 308 GLN A N     1 
ATOM   2375 C  CA    . GLN A  1 308 ? 10.680  -13.284 49.807 1.00 50.26  ? 308 GLN A CA    1 
ATOM   2376 C  C     . GLN A  1 308 ? 11.877  -12.989 50.699 1.00 52.84  ? 308 GLN A C     1 
ATOM   2377 O  O     . GLN A  1 308 ? 12.945  -13.566 50.519 1.00 52.55  ? 308 GLN A O     1 
ATOM   2378 C  CB    . GLN A  1 308 ? 9.984   -14.556 50.276 1.00 44.12  ? 308 GLN A CB    1 
ATOM   2379 C  CG    . GLN A  1 308 ? 8.835   -15.010 49.382 1.00 74.31  ? 308 GLN A CG    1 
ATOM   2380 C  CD    . GLN A  1 308 ? 7.497   -14.451 49.821 1.00 82.33  ? 308 GLN A CD    1 
ATOM   2381 O  OE1   . GLN A  1 308 ? 7.360   -13.252 50.076 1.00 89.29  ? 308 GLN A OE1   1 
ATOM   2382 N  NE2   . GLN A  1 308 ? 6.494   -15.319 49.906 1.00 90.85  ? 308 GLN A NE2   1 
ATOM   2383 N  N     . ALA A  1 309 ? 11.704  -12.074 51.640 1.00 45.61  ? 309 ALA A N     1 
ATOM   2384 C  CA    . ALA A  1 309 ? 12.768  -11.724 52.556 1.00 45.28  ? 309 ALA A CA    1 
ATOM   2385 C  C     . ALA A  1 309 ? 12.509  -12.488 53.851 1.00 51.95  ? 309 ALA A C     1 
ATOM   2386 O  O     . ALA A  1 309 ? 11.344  -12.637 54.269 1.00 45.06  ? 309 ALA A O     1 
ATOM   2387 C  CB    . ALA A  1 309 ? 12.764  -10.214 52.820 1.00 30.80  ? 309 ALA A CB    1 
ATOM   2388 N  N     . THR A  1 310 ? 13.578  -12.987 54.476 1.00 43.35  ? 310 THR A N     1 
ATOM   2389 C  CA    . THR A  1 310 ? 13.411  -13.707 55.737 1.00 52.20  ? 310 THR A CA    1 
ATOM   2390 C  C     . THR A  1 310 ? 13.529  -12.750 56.931 1.00 51.23  ? 310 THR A C     1 
ATOM   2391 O  O     . THR A  1 310 ? 14.377  -11.851 56.970 1.00 44.67  ? 310 THR A O     1 
ATOM   2392 C  CB    . THR A  1 310 ? 14.433  -14.884 55.913 1.00 46.36  ? 310 THR A CB    1 
ATOM   2393 O  OG1   . THR A  1 310 ? 15.767  -14.378 55.955 1.00 75.66  ? 310 THR A OG1   1 
ATOM   2394 C  CG2   . THR A  1 310 ? 14.318  -15.868 54.770 1.00 45.54  ? 310 THR A CG2   1 
ATOM   2395 N  N     . VAL A  1 311 ? 12.639  -12.950 57.892 1.00 53.10  ? 311 VAL A N     1 
ATOM   2396 C  CA    . VAL A  1 311 ? 12.588  -12.152 59.103 1.00 48.60  ? 311 VAL A CA    1 
ATOM   2397 C  C     . VAL A  1 311 ? 13.524  -12.697 60.157 1.00 41.45  ? 311 VAL A C     1 
ATOM   2398 O  O     . VAL A  1 311 ? 13.253  -13.741 60.726 1.00 57.73  ? 311 VAL A O     1 
ATOM   2399 C  CB    . VAL A  1 311 ? 11.188  -12.164 59.673 1.00 46.08  ? 311 VAL A CB    1 
ATOM   2400 C  CG1   . VAL A  1 311 ? 11.167  -11.447 60.996 1.00 64.63  ? 311 VAL A CG1   1 
ATOM   2401 C  CG2   . VAL A  1 311 ? 10.237  -11.513 58.691 1.00 58.03  ? 311 VAL A CG2   1 
ATOM   2402 N  N     . LEU A  1 312 ? 14.621  -11.992 60.412 1.00 50.33  ? 312 LEU A N     1 
ATOM   2403 C  CA    . LEU A  1 312 ? 15.593  -12.418 61.413 1.00 49.43  ? 312 LEU A CA    1 
ATOM   2404 C  C     . LEU A  1 312 ? 15.089  -12.009 62.785 1.00 55.31  ? 312 LEU A C     1 
ATOM   2405 O  O     . LEU A  1 312 ? 14.260  -11.074 62.835 1.00 62.48  ? 312 LEU A O     1 
ATOM   2406 C  CB    . LEU A  1 312 ? 16.953  -11.770 61.153 1.00 43.37  ? 312 LEU A CB    1 
ATOM   2407 C  CG    . LEU A  1 312 ? 17.426  -11.888 59.704 1.00 52.39  ? 312 LEU A CG    1 
ATOM   2408 C  CD1   . LEU A  1 312 ? 18.794  -11.245 59.552 1.00 37.56  ? 312 LEU A CD1   1 
ATOM   2409 C  CD2   . LEU A  1 312 ? 17.469  -13.353 59.303 1.00 53.62  ? 312 LEU A CD2   1 
ATOM   2410 O  OXT   . LEU A  1 312 ? 15.534  -12.614 63.787 1.00 63.14  ? 312 LEU A OXT   1 
ATOM   2411 N  N     . GLU B  1 4   ? 15.249  0.197   19.458 1.00 59.72  ? 4   GLU B N     1 
ATOM   2412 C  CA    . GLU B  1 4   ? 15.437  1.321   20.408 1.00 69.27  ? 4   GLU B CA    1 
ATOM   2413 C  C     . GLU B  1 4   ? 15.604  2.652   19.667 1.00 62.90  ? 4   GLU B C     1 
ATOM   2414 O  O     . GLU B  1 4   ? 16.271  2.735   18.638 1.00 63.29  ? 4   GLU B O     1 
ATOM   2415 C  CB    . GLU B  1 4   ? 16.645  1.039   21.307 1.00 74.35  ? 4   GLU B CB    1 
ATOM   2416 C  CG    . GLU B  1 4   ? 16.287  0.294   22.609 1.00 85.34  ? 4   GLU B CG    1 
ATOM   2417 C  CD    . GLU B  1 4   ? 15.092  -0.667  22.474 1.00 94.47  ? 4   GLU B CD    1 
ATOM   2418 O  OE1   . GLU B  1 4   ? 15.155  -1.566  21.606 1.00 100.00 ? 4   GLU B OE1   1 
ATOM   2419 O  OE2   . GLU B  1 4   ? 14.096  -0.520  23.233 1.00 84.69  ? 4   GLU B OE2   1 
ATOM   2420 N  N     . CYS B  1 5   ? 14.984  3.693   20.199 1.00 53.01  ? 5   CYS B N     1 
ATOM   2421 C  CA    . CYS B  1 5   ? 15.043  5.004   19.573 1.00 45.81  ? 5   CYS B CA    1 
ATOM   2422 C  C     . CYS B  1 5   ? 15.785  6.003   20.450 1.00 34.07  ? 5   CYS B C     1 
ATOM   2423 O  O     . CYS B  1 5   ? 15.280  6.395   21.496 1.00 33.63  ? 5   CYS B O     1 
ATOM   2424 C  CB    . CYS B  1 5   ? 13.618  5.479   19.308 1.00 48.86  ? 5   CYS B CB    1 
ATOM   2425 S  SG    . CYS B  1 5   ? 13.533  6.967   18.340 1.00 59.18  ? 5   CYS B SG    1 
ATOM   2426 N  N     . ARG B  1 6   ? 16.974  6.412   20.019 1.00 28.60  ? 6   ARG B N     1 
ATOM   2427 C  CA    . ARG B  1 6   ? 17.798  7.353   20.784 1.00 31.48  ? 6   ARG B CA    1 
ATOM   2428 C  C     . ARG B  1 6   ? 17.658  8.827   20.455 1.00 33.52  ? 6   ARG B C     1 
ATOM   2429 O  O     . ARG B  1 6   ? 17.823  9.241   19.308 1.00 31.75  ? 6   ARG B O     1 
ATOM   2430 C  CB    . ARG B  1 6   ? 19.264  6.974   20.648 1.00 25.30  ? 6   ARG B CB    1 
ATOM   2431 C  CG    . ARG B  1 6   ? 19.571  5.700   21.354 1.00 41.35  ? 6   ARG B CG    1 
ATOM   2432 C  CD    . ARG B  1 6   ? 21.036  5.348   21.299 1.00 27.51  ? 6   ARG B CD    1 
ATOM   2433 N  NE    . ARG B  1 6   ? 21.201  4.054   21.930 1.00 35.44  ? 6   ARG B NE    1 
ATOM   2434 C  CZ    . ARG B  1 6   ? 21.191  3.864   23.245 1.00 40.73  ? 6   ARG B CZ    1 
ATOM   2435 N  NH1   . ARG B  1 6   ? 21.044  4.891   24.074 1.00 40.15  ? 6   ARG B NH1   1 
ATOM   2436 N  NH2   . ARG B  1 6   ? 21.271  2.639   23.726 1.00 45.51  ? 6   ARG B NH2   1 
ATOM   2437 N  N     . VAL B  1 7   ? 17.409  9.629   21.487 1.00 31.41  ? 7   VAL B N     1 
ATOM   2438 C  CA    . VAL B  1 7   ? 17.236  11.066  21.314 1.00 26.41  ? 7   VAL B CA    1 
ATOM   2439 C  C     . VAL B  1 7   ? 18.285  11.832  22.108 1.00 31.86  ? 7   VAL B C     1 
ATOM   2440 O  O     . VAL B  1 7   ? 18.521  11.528  23.267 1.00 31.08  ? 7   VAL B O     1 
ATOM   2441 C  CB    . VAL B  1 7   ? 15.825  11.506  21.814 1.00 26.97  ? 7   VAL B CB    1 
ATOM   2442 C  CG1   . VAL B  1 7   ? 15.641  13.022  21.652 1.00 24.46  ? 7   VAL B CG1   1 
ATOM   2443 C  CG2   . VAL B  1 7   ? 14.746  10.742  21.042 1.00 28.01  ? 7   VAL B CG2   1 
ATOM   2444 N  N     . LEU B  1 8   ? 18.937  12.805  21.482 1.00 37.87  ? 8   LEU B N     1 
ATOM   2445 C  CA    . LEU B  1 8   ? 19.907  13.626  22.201 1.00 31.91  ? 8   LEU B CA    1 
ATOM   2446 C  C     . LEU B  1 8   ? 19.216  14.974  22.382 1.00 30.05  ? 8   LEU B C     1 
ATOM   2447 O  O     . LEU B  1 8   ? 18.992  15.696  21.405 1.00 30.82  ? 8   LEU B O     1 
ATOM   2448 C  CB    . LEU B  1 8   ? 21.203  13.797  21.395 1.00 26.65  ? 8   LEU B CB    1 
ATOM   2449 C  CG    . LEU B  1 8   ? 22.310  14.583  22.133 1.00 30.20  ? 8   LEU B CG    1 
ATOM   2450 C  CD1   . LEU B  1 8   ? 22.742  13.818  23.377 1.00 28.59  ? 8   LEU B CD1   1 
ATOM   2451 C  CD2   . LEU B  1 8   ? 23.497  14.805  21.228 1.00 27.47  ? 8   LEU B CD2   1 
ATOM   2452 N  N     . SER B  1 9   ? 18.856  15.313  23.616 1.00 31.45  ? 9   SER B N     1 
ATOM   2453 C  CA    . SER B  1 9   ? 18.156  16.573  23.844 1.00 25.65  ? 9   SER B CA    1 
ATOM   2454 C  C     . SER B  1 9   ? 19.004  17.562  24.590 1.00 27.98  ? 9   SER B C     1 
ATOM   2455 O  O     . SER B  1 9   ? 19.341  17.360  25.752 1.00 31.61  ? 9   SER B O     1 
ATOM   2456 C  CB    . SER B  1 9   ? 16.849  16.338  24.596 1.00 24.79  ? 9   SER B CB    1 
ATOM   2457 O  OG    . SER B  1 9   ? 16.192  17.565  24.856 1.00 29.05  ? 9   SER B OG    1 
ATOM   2458 N  N     . ILE B  1 10  ? 19.326  18.652  23.908 1.00 34.37  ? 10  ILE B N     1 
ATOM   2459 C  CA    . ILE B  1 10  ? 20.160  19.707  24.457 1.00 30.56  ? 10  ILE B CA    1 
ATOM   2460 C  C     . ILE B  1 10  ? 19.278  20.895  24.812 1.00 27.16  ? 10  ILE B C     1 
ATOM   2461 O  O     . ILE B  1 10  ? 18.866  21.668  23.938 1.00 31.04  ? 10  ILE B O     1 
ATOM   2462 C  CB    . ILE B  1 10  ? 21.235  20.131  23.424 1.00 28.34  ? 10  ILE B CB    1 
ATOM   2463 C  CG1   . ILE B  1 10  ? 22.080  18.914  23.028 1.00 28.55  ? 10  ILE B CG1   1 
ATOM   2464 C  CG2   . ILE B  1 10  ? 22.120  21.225  23.997 1.00 30.28  ? 10  ILE B CG2   1 
ATOM   2465 C  CD1   . ILE B  1 10  ? 22.865  19.114  21.738 1.00 23.42  ? 10  ILE B CD1   1 
ATOM   2466 N  N     . GLN B  1 11  ? 18.991  21.028  26.102 1.00 26.13  ? 11  GLN B N     1 
ATOM   2467 C  CA    . GLN B  1 11  ? 18.122  22.095  26.586 1.00 33.12  ? 11  GLN B CA    1 
ATOM   2468 C  C     . GLN B  1 11  ? 18.425  22.391  28.029 1.00 35.98  ? 11  GLN B C     1 
ATOM   2469 O  O     . GLN B  1 11  ? 19.246  21.708  28.658 1.00 32.36  ? 11  GLN B O     1 
ATOM   2470 C  CB    . GLN B  1 11  ? 16.657  21.675  26.520 1.00 27.10  ? 11  GLN B CB    1 
ATOM   2471 C  CG    . GLN B  1 11  ? 16.181  21.126  25.218 1.00 23.92  ? 11  GLN B CG    1 
ATOM   2472 C  CD    . GLN B  1 11  ? 14.670  20.999  25.245 1.00 28.58  ? 11  GLN B CD    1 
ATOM   2473 O  OE1   . GLN B  1 11  ? 13.981  21.978  25.515 1.00 23.15  ? 11  GLN B OE1   1 
ATOM   2474 N  NE2   . GLN B  1 11  ? 14.154  19.802  24.988 1.00 19.54  ? 11  GLN B NE2   1 
ATOM   2475 N  N     . SER B  1 12  ? 17.715  23.368  28.580 1.00 26.90  ? 12  SER B N     1 
ATOM   2476 C  CA    . SER B  1 12  ? 17.974  23.730  29.959 1.00 32.11  ? 12  SER B CA    1 
ATOM   2477 C  C     . SER B  1 12  ? 17.415  22.797  31.028 1.00 36.24  ? 12  SER B C     1 
ATOM   2478 O  O     . SER B  1 12  ? 16.467  22.045  30.807 1.00 34.38  ? 12  SER B O     1 
ATOM   2479 C  CB    . SER B  1 12  ? 17.540  25.180  30.224 1.00 30.04  ? 12  SER B CB    1 
ATOM   2480 O  OG    . SER B  1 12  ? 16.478  25.589  29.409 1.00 52.39  ? 12  SER B OG    1 
ATOM   2481 N  N     . HIS B  1 13  ? 18.068  22.812  32.184 1.00 36.46  ? 13  HIS B N     1 
ATOM   2482 C  CA    . HIS B  1 13  ? 17.635  22.017  33.323 1.00 28.41  ? 13  HIS B CA    1 
ATOM   2483 C  C     . HIS B  1 13  ? 17.379  22.962  34.493 1.00 28.69  ? 13  HIS B C     1 
ATOM   2484 O  O     . HIS B  1 13  ? 18.110  23.938  34.684 1.00 31.98  ? 13  HIS B O     1 
ATOM   2485 C  CB    . HIS B  1 13  ? 18.712  21.002  33.724 1.00 30.37  ? 13  HIS B CB    1 
ATOM   2486 C  CG    . HIS B  1 13  ? 18.338  20.145  34.897 1.00 29.71  ? 13  HIS B CG    1 
ATOM   2487 N  ND1   . HIS B  1 13  ? 17.285  19.252  34.867 1.00 28.81  ? 13  HIS B ND1   1 
ATOM   2488 C  CD2   . HIS B  1 13  ? 18.889  20.034  36.130 1.00 23.45  ? 13  HIS B CD2   1 
ATOM   2489 C  CE1   . HIS B  1 13  ? 17.208  18.630  36.030 1.00 34.56  ? 13  HIS B CE1   1 
ATOM   2490 N  NE2   . HIS B  1 13  ? 18.171  19.085  36.814 1.00 26.11  ? 13  HIS B NE2   1 
ATOM   2491 N  N     . VAL B  1 14  ? 16.326  22.679  35.249 1.00 24.23  ? 14  VAL B N     1 
ATOM   2492 C  CA    . VAL B  1 14  ? 15.996  23.435  36.434 1.00 33.59  ? 14  VAL B CA    1 
ATOM   2493 C  C     . VAL B  1 14  ? 15.843  22.419  37.549 1.00 36.43  ? 14  VAL B C     1 
ATOM   2494 O  O     . VAL B  1 14  ? 15.462  21.287  37.289 1.00 33.96  ? 14  VAL B O     1 
ATOM   2495 C  CB    . VAL B  1 14  ? 14.662  24.171  36.308 1.00 36.25  ? 14  VAL B CB    1 
ATOM   2496 C  CG1   . VAL B  1 14  ? 14.800  25.296  35.287 1.00 29.12  ? 14  VAL B CG1   1 
ATOM   2497 C  CG2   . VAL B  1 14  ? 13.551  23.164  35.943 1.00 29.22  ? 14  VAL B CG2   1 
ATOM   2498 N  N     . ILE B  1 15  ? 16.124  22.840  38.783 1.00 33.46  ? 15  ILE B N     1 
ATOM   2499 C  CA    . ILE B  1 15  ? 16.005  21.979  39.948 1.00 27.57  ? 15  ILE B CA    1 
ATOM   2500 C  C     . ILE B  1 15  ? 14.515  21.743  40.217 1.00 28.79  ? 15  ILE B C     1 
ATOM   2501 O  O     . ILE B  1 15  ? 14.047  20.604  40.246 1.00 27.37  ? 15  ILE B O     1 
ATOM   2502 C  CB    . ILE B  1 15  ? 16.654  22.626  41.194 1.00 35.31  ? 15  ILE B CB    1 
ATOM   2503 C  CG1   . ILE B  1 15  ? 18.092  23.044  40.876 1.00 35.50  ? 15  ILE B CG1   1 
ATOM   2504 C  CG2   . ILE B  1 15  ? 16.665  21.634  42.351 1.00 27.51  ? 15  ILE B CG2   1 
ATOM   2505 C  CD1   . ILE B  1 15  ? 18.918  21.952  40.284 1.00 27.24  ? 15  ILE B CD1   1 
ATOM   2506 N  N     . ARG B  1 16  ? 13.793  22.836  40.414 1.00 28.83  ? 16  ARG B N     1 
ATOM   2507 C  CA    . ARG B  1 16  ? 12.355  22.815  40.645 1.00 26.51  ? 16  ARG B CA    1 
ATOM   2508 C  C     . ARG B  1 16  ? 11.602  23.189  39.343 1.00 33.05  ? 16  ARG B C     1 
ATOM   2509 O  O     . ARG B  1 16  ? 12.005  24.121  38.619 1.00 25.16  ? 16  ARG B O     1 
ATOM   2510 C  CB    . ARG B  1 16  ? 11.985  23.843  41.725 1.00 23.44  ? 16  ARG B CB    1 
ATOM   2511 C  CG    . ARG B  1 16  ? 10.447  24.068  41.908 1.00 25.15  ? 16  ARG B CG    1 
ATOM   2512 C  CD    . ARG B  1 16  ? 9.753   22.775  42.316 1.00 29.80  ? 16  ARG B CD    1 
ATOM   2513 N  NE    . ARG B  1 16  ? 10.200  22.349  43.635 1.00 42.12  ? 16  ARG B NE    1 
ATOM   2514 C  CZ    . ARG B  1 16  ? 9.658   22.771  44.770 1.00 41.45  ? 16  ARG B CZ    1 
ATOM   2515 N  NH1   . ARG B  1 16  ? 8.637   23.615  44.734 1.00 51.07  ? 16  ARG B NH1   1 
ATOM   2516 N  NH2   . ARG B  1 16  ? 10.157  22.380  45.934 1.00 40.32  ? 16  ARG B NH2   1 
ATOM   2517 N  N     . GLY B  1 17  ? 10.506  22.479  39.074 1.00 31.08  ? 17  GLY B N     1 
ATOM   2518 C  CA    . GLY B  1 17  ? 9.677   22.781  37.923 1.00 30.57  ? 17  GLY B CA    1 
ATOM   2519 C  C     . GLY B  1 17  ? 9.926   22.013  36.641 1.00 40.28  ? 17  GLY B C     1 
ATOM   2520 O  O     . GLY B  1 17  ? 10.833  21.175  36.558 1.00 37.02  ? 17  GLY B O     1 
ATOM   2521 N  N     . TYR B  1 18  ? 9.134   22.321  35.616 1.00 27.53  ? 18  TYR B N     1 
ATOM   2522 C  CA    . TYR B  1 18  ? 9.267   21.614  34.343 1.00 25.88  ? 18  TYR B CA    1 
ATOM   2523 C  C     . TYR B  1 18  ? 9.374   22.469  33.078 1.00 30.66  ? 18  TYR B C     1 
ATOM   2524 O  O     . TYR B  1 18  ? 8.363   22.882  32.512 1.00 29.14  ? 18  TYR B O     1 
ATOM   2525 C  CB    . TYR B  1 18  ? 8.105   20.623  34.195 1.00 24.74  ? 18  TYR B CB    1 
ATOM   2526 C  CG    . TYR B  1 18  ? 8.002   19.676  35.362 1.00 31.83  ? 18  TYR B CG    1 
ATOM   2527 C  CD1   . TYR B  1 18  ? 7.355   20.052  36.541 1.00 31.48  ? 18  TYR B CD1   1 
ATOM   2528 C  CD2   . TYR B  1 18  ? 8.640   18.443  35.327 1.00 31.62  ? 18  TYR B CD2   1 
ATOM   2529 C  CE1   . TYR B  1 18  ? 7.358   19.222  37.654 1.00 31.08  ? 18  TYR B CE1   1 
ATOM   2530 C  CE2   . TYR B  1 18  ? 8.648   17.604  36.429 1.00 40.61  ? 18  TYR B CE2   1 
ATOM   2531 C  CZ    . TYR B  1 18  ? 8.009   17.994  37.592 1.00 39.50  ? 18  TYR B CZ    1 
ATOM   2532 O  OH    . TYR B  1 18  ? 8.022   17.145  38.682 1.00 34.76  ? 18  TYR B OH    1 
ATOM   2533 N  N     . VAL B  1 19  ? 10.604  22.725  32.638 1.00 24.33  ? 19  VAL B N     1 
ATOM   2534 C  CA    . VAL B  1 19  ? 10.848  23.493  31.411 1.00 27.63  ? 19  VAL B CA    1 
ATOM   2535 C  C     . VAL B  1 19  ? 12.099  22.871  30.798 1.00 35.64  ? 19  VAL B C     1 
ATOM   2536 O  O     . VAL B  1 19  ? 12.791  22.102  31.462 1.00 35.14  ? 19  VAL B O     1 
ATOM   2537 C  CB    . VAL B  1 19  ? 11.105  25.038  31.696 1.00 25.41  ? 19  VAL B CB    1 
ATOM   2538 C  CG1   . VAL B  1 19  ? 9.971   25.605  32.580 1.00 30.72  ? 19  VAL B CG1   1 
ATOM   2539 C  CG2   . VAL B  1 19  ? 12.467  25.240  32.372 1.00 31.27  ? 19  VAL B CG2   1 
ATOM   2540 N  N     . GLY B  1 20  ? 12.392  23.183  29.543 1.00 26.34  ? 20  GLY B N     1 
ATOM   2541 C  CA    . GLY B  1 20  ? 13.568  22.605  28.944 1.00 25.97  ? 20  GLY B CA    1 
ATOM   2542 C  C     . GLY B  1 20  ? 13.559  21.099  29.064 1.00 32.49  ? 20  GLY B C     1 
ATOM   2543 O  O     . GLY B  1 20  ? 12.511  20.449  28.920 1.00 27.97  ? 20  GLY B O     1 
ATOM   2544 N  N     . ASN B  1 21  ? 14.736  20.542  29.321 1.00 25.85  ? 21  ASN B N     1 
ATOM   2545 C  CA    . ASN B  1 21  ? 14.891  19.105  29.461 1.00 27.84  ? 21  ASN B CA    1 
ATOM   2546 C  C     . ASN B  1 21  ? 14.005  18.467  30.528 1.00 21.69  ? 21  ASN B C     1 
ATOM   2547 O  O     . ASN B  1 21  ? 13.792  17.268  30.485 1.00 27.58  ? 21  ASN B O     1 
ATOM   2548 C  CB    . ASN B  1 21  ? 16.362  18.749  29.719 1.00 25.70  ? 21  ASN B CB    1 
ATOM   2549 C  CG    . ASN B  1 21  ? 17.059  18.331  28.453 1.00 28.78  ? 21  ASN B CG    1 
ATOM   2550 O  OD1   . ASN B  1 21  ? 16.419  17.771  27.566 1.00 34.29  ? 21  ASN B OD1   1 
ATOM   2551 N  ND2   . ASN B  1 21  ? 18.363  18.584  28.353 1.00 24.09  ? 21  ASN B ND2   1 
ATOM   2552 N  N     . ARG B  1 22  ? 13.500  19.264  31.470 1.00 26.94  ? 22  ARG B N     1 
ATOM   2553 C  CA    . ARG B  1 22  ? 12.615  18.763  32.525 1.00 23.45  ? 22  ARG B CA    1 
ATOM   2554 C  C     . ARG B  1 22  ? 11.192  18.552  31.986 1.00 29.54  ? 22  ARG B C     1 
ATOM   2555 O  O     . ARG B  1 22  ? 10.478  17.661  32.435 1.00 27.76  ? 22  ARG B O     1 
ATOM   2556 C  CB    . ARG B  1 22  ? 12.580  19.736  33.710 1.00 23.68  ? 22  ARG B CB    1 
ATOM   2557 C  CG    . ARG B  1 22  ? 13.773  19.574  34.702 1.00 31.01  ? 22  ARG B CG    1 
ATOM   2558 C  CD    . ARG B  1 22  ? 13.662  18.299  35.563 1.00 19.44  ? 22  ARG B CD    1 
ATOM   2559 N  NE    . ARG B  1 22  ? 12.793  18.553  36.710 1.00 29.04  ? 22  ARG B NE    1 
ATOM   2560 C  CZ    . ARG B  1 22  ? 12.564  17.697  37.699 1.00 22.86  ? 22  ARG B CZ    1 
ATOM   2561 N  NH1   . ARG B  1 22  ? 13.133  16.508  37.698 1.00 30.46  ? 22  ARG B NH1   1 
ATOM   2562 N  NH2   . ARG B  1 22  ? 11.767  18.036  38.703 1.00 32.20  ? 22  ARG B NH2   1 
ATOM   2563 N  N     . ALA B  1 23  ? 10.786  19.377  31.026 1.00 29.80  ? 23  ALA B N     1 
ATOM   2564 C  CA    . ALA B  1 23  ? 9.469   19.224  30.402 1.00 31.68  ? 23  ALA B CA    1 
ATOM   2565 C  C     . ALA B  1 23  ? 9.491   18.121  29.323 1.00 29.65  ? 23  ALA B C     1 
ATOM   2566 O  O     . ALA B  1 23  ? 8.497   17.441  29.111 1.00 38.90  ? 23  ALA B O     1 
ATOM   2567 C  CB    . ALA B  1 23  ? 9.040   20.531  29.773 1.00 22.19  ? 23  ALA B CB    1 
ATOM   2568 N  N     . ALA B  1 24  ? 10.634  17.944  28.666 1.00 26.59  ? 24  ALA B N     1 
ATOM   2569 C  CA    . ALA B  1 24  ? 10.787  16.985  27.584 1.00 27.46  ? 24  ALA B CA    1 
ATOM   2570 C  C     . ALA B  1 24  ? 11.201  15.557  27.948 1.00 38.97  ? 24  ALA B C     1 
ATOM   2571 O  O     . ALA B  1 24  ? 10.776  14.603  27.291 1.00 23.24  ? 24  ALA B O     1 
ATOM   2572 C  CB    . ALA B  1 24  ? 11.800  17.540  26.556 1.00 26.69  ? 24  ALA B CB    1 
ATOM   2573 N  N     . THR B  1 25  ? 12.023  15.406  28.986 1.00 29.57  ? 25  THR B N     1 
ATOM   2574 C  CA    . THR B  1 25  ? 12.558  14.096  29.332 1.00 29.15  ? 25  THR B CA    1 
ATOM   2575 C  C     . THR B  1 25  ? 11.615  13.068  29.914 1.00 24.35  ? 25  THR B C     1 
ATOM   2576 O  O     . THR B  1 25  ? 11.492  11.981  29.361 1.00 30.32  ? 25  THR B O     1 
ATOM   2577 C  CB    . THR B  1 25  ? 13.807  14.225  30.260 1.00 36.08  ? 25  THR B CB    1 
ATOM   2578 O  OG1   . THR B  1 25  ? 14.816  14.984  29.582 1.00 23.75  ? 25  THR B OG1   1 
ATOM   2579 C  CG2   . THR B  1 25  ? 14.380  12.845  30.621 1.00 19.26  ? 25  THR B CG2   1 
ATOM   2580 N  N     . PHE B  1 26  ? 10.943  13.383  31.011 1.00 28.72  ? 26  PHE B N     1 
ATOM   2581 C  CA    . PHE B  1 26  ? 10.034  12.406  31.595 1.00 22.74  ? 26  PHE B CA    1 
ATOM   2582 C  C     . PHE B  1 26  ? 8.973   11.872  30.619 1.00 27.37  ? 26  PHE B C     1 
ATOM   2583 O  O     . PHE B  1 26  ? 8.734   10.668  30.568 1.00 25.59  ? 26  PHE B O     1 
ATOM   2584 C  CB    . PHE B  1 26  ? 9.334   12.984  32.832 1.00 33.62  ? 26  PHE B CB    1 
ATOM   2585 C  CG    . PHE B  1 26  ? 8.317   12.046  33.445 1.00 29.56  ? 26  PHE B CG    1 
ATOM   2586 C  CD1   . PHE B  1 26  ? 8.720   10.844  34.024 1.00 22.48  ? 26  PHE B CD1   1 
ATOM   2587 C  CD2   . PHE B  1 26  ? 6.952   12.358  33.419 1.00 32.84  ? 26  PHE B CD2   1 
ATOM   2588 C  CE1   . PHE B  1 26  ? 7.794   9.959   34.575 1.00 31.33  ? 26  PHE B CE1   1 
ATOM   2589 C  CE2   . PHE B  1 26  ? 6.015   11.486  33.968 1.00 22.24  ? 26  PHE B CE2   1 
ATOM   2590 C  CZ    . PHE B  1 26  ? 6.436   10.282  34.550 1.00 20.89  ? 26  PHE B CZ    1 
ATOM   2591 N  N     . PRO B  1 27  ? 8.323   12.761  29.842 1.00 30.20  ? 27  PRO B N     1 
ATOM   2592 C  CA    . PRO B  1 27  ? 7.287   12.295  28.895 1.00 20.80  ? 27  PRO B CA    1 
ATOM   2593 C  C     . PRO B  1 27  ? 7.900   11.410  27.824 1.00 24.87  ? 27  PRO B C     1 
ATOM   2594 O  O     . PRO B  1 27  ? 7.360   10.371  27.515 1.00 23.16  ? 27  PRO B O     1 
ATOM   2595 C  CB    . PRO B  1 27  ? 6.723   13.599  28.308 1.00 26.07  ? 27  PRO B CB    1 
ATOM   2596 C  CG    . PRO B  1 27  ? 7.134   14.657  29.288 1.00 38.84  ? 27  PRO B CG    1 
ATOM   2597 C  CD    . PRO B  1 27  ? 8.492   14.219  29.762 1.00 28.29  ? 27  PRO B CD    1 
ATOM   2598 N  N     . LEU B  1 28  ? 9.034   11.803  27.254 1.00 22.02  ? 28  LEU B N     1 
ATOM   2599 C  CA    . LEU B  1 28  ? 9.632   10.931  26.249 1.00 22.89  ? 28  LEU B CA    1 
ATOM   2600 C  C     . LEU B  1 28  ? 10.051  9.559   26.813 1.00 28.22  ? 28  LEU B C     1 
ATOM   2601 O  O     . LEU B  1 28  ? 9.944   8.536   26.124 1.00 28.29  ? 28  LEU B O     1 
ATOM   2602 C  CB    . LEU B  1 28  ? 10.814  11.619  25.578 1.00 17.48  ? 28  LEU B CB    1 
ATOM   2603 C  CG    . LEU B  1 28  ? 10.368  12.684  24.566 1.00 29.03  ? 28  LEU B CG    1 
ATOM   2604 C  CD1   . LEU B  1 28  ? 11.578  13.506  24.109 1.00 30.65  ? 28  LEU B CD1   1 
ATOM   2605 C  CD2   . LEU B  1 28  ? 9.662   12.007  23.401 1.00 26.32  ? 28  LEU B CD2   1 
ATOM   2606 N  N     . GLN B  1 29  ? 10.517  9.539   28.063 1.00 30.78  ? 29  GLN B N     1 
ATOM   2607 C  CA    . GLN B  1 29  ? 10.949  8.296   28.688 1.00 30.39  ? 29  GLN B CA    1 
ATOM   2608 C  C     . GLN B  1 29  ? 9.715   7.426   28.931 1.00 16.22  ? 29  GLN B C     1 
ATOM   2609 O  O     . GLN B  1 29  ? 9.744   6.197   28.801 1.00 23.09  ? 29  GLN B O     1 
ATOM   2610 C  CB    . GLN B  1 29  ? 11.671  8.596   30.015 1.00 27.56  ? 29  GLN B CB    1 
ATOM   2611 C  CG    . GLN B  1 29  ? 13.024  9.309   29.872 1.00 23.40  ? 29  GLN B CG    1 
ATOM   2612 C  CD    . GLN B  1 29  ? 13.709  9.521   31.210 1.00 15.70  ? 29  GLN B CD    1 
ATOM   2613 O  OE1   . GLN B  1 29  ? 14.861  9.125   31.408 1.00 33.40  ? 29  GLN B OE1   1 
ATOM   2614 N  NE2   . GLN B  1 29  ? 13.010  10.134  32.130 1.00 20.54  ? 29  GLN B NE2   1 
ATOM   2615 N  N     . VAL B  1 30  ? 8.632   8.070   29.316 1.00 29.04  ? 30  VAL B N     1 
ATOM   2616 C  CA    . VAL B  1 30  ? 7.415   7.347   29.551 1.00 26.61  ? 30  VAL B CA    1 
ATOM   2617 C  C     . VAL B  1 30  ? 7.017   6.654   28.242 1.00 34.29  ? 30  VAL B C     1 
ATOM   2618 O  O     . VAL B  1 30  ? 6.537   5.521   28.259 1.00 33.00  ? 30  VAL B O     1 
ATOM   2619 C  CB    . VAL B  1 30  ? 6.307   8.308   30.068 1.00 33.49  ? 30  VAL B CB    1 
ATOM   2620 C  CG1   . VAL B  1 30  ? 4.940   7.674   29.936 1.00 31.02  ? 30  VAL B CG1   1 
ATOM   2621 C  CG2   . VAL B  1 30  ? 6.556   8.606   31.522 1.00 22.23  ? 30  VAL B CG2   1 
ATOM   2622 N  N     . LEU B  1 31  ? 7.276   7.318   27.114 1.00 35.73  ? 31  LEU B N     1 
ATOM   2623 C  CA    . LEU B  1 31  ? 6.927   6.770   25.804 1.00 33.35  ? 31  LEU B CA    1 
ATOM   2624 C  C     . LEU B  1 31  ? 7.923   5.775   25.213 1.00 39.73  ? 31  LEU B C     1 
ATOM   2625 O  O     . LEU B  1 31  ? 7.766   5.341   24.064 1.00 35.18  ? 31  LEU B O     1 
ATOM   2626 C  CB    . LEU B  1 31  ? 6.650   7.909   24.813 1.00 25.15  ? 31  LEU B CB    1 
ATOM   2627 C  CG    . LEU B  1 31  ? 5.418   8.729   25.226 1.00 30.15  ? 31  LEU B CG    1 
ATOM   2628 C  CD1   . LEU B  1 31  ? 5.312   9.950   24.348 1.00 24.64  ? 31  LEU B CD1   1 
ATOM   2629 C  CD2   . LEU B  1 31  ? 4.148   7.856   25.135 1.00 28.32  ? 31  LEU B CD2   1 
ATOM   2630 N  N     . GLY B  1 32  ? 8.954   5.429   25.976 1.00 29.18  ? 32  GLY B N     1 
ATOM   2631 C  CA    . GLY B  1 32  ? 9.893   4.442   25.486 1.00 24.76  ? 32  GLY B CA    1 
ATOM   2632 C  C     . GLY B  1 32  ? 11.124  4.938   24.770 1.00 35.75  ? 32  GLY B C     1 
ATOM   2633 O  O     . GLY B  1 32  ? 11.908  4.132   24.261 1.00 35.32  ? 32  GLY B O     1 
ATOM   2634 N  N     . PHE B  1 33  ? 11.330  6.246   24.745 1.00 31.63  ? 33  PHE B N     1 
ATOM   2635 C  CA    . PHE B  1 33  ? 12.493  6.777   24.040 1.00 27.40  ? 33  PHE B CA    1 
ATOM   2636 C  C     . PHE B  1 33  ? 13.733  6.789   24.931 1.00 27.97  ? 33  PHE B C     1 
ATOM   2637 O  O     . PHE B  1 33  ? 13.651  7.102   26.127 1.00 25.88  ? 33  PHE B O     1 
ATOM   2638 C  CB    . PHE B  1 33  ? 12.211  8.215   23.538 1.00 22.83  ? 33  PHE B CB    1 
ATOM   2639 C  CG    . PHE B  1 33  ? 11.213  8.285   22.420 1.00 26.13  ? 33  PHE B CG    1 
ATOM   2640 C  CD1   . PHE B  1 33  ? 9.840   8.247   22.682 1.00 24.49  ? 33  PHE B CD1   1 
ATOM   2641 C  CD2   . PHE B  1 33  ? 11.645  8.354   21.100 1.00 26.50  ? 33  PHE B CD2   1 
ATOM   2642 C  CE1   . PHE B  1 33  ? 8.913   8.274   21.648 1.00 26.57  ? 33  PHE B CE1   1 
ATOM   2643 C  CE2   . PHE B  1 33  ? 10.726  8.377   20.044 1.00 26.06  ? 33  PHE B CE2   1 
ATOM   2644 C  CZ    . PHE B  1 33  ? 9.356   8.335   20.320 1.00 26.30  ? 33  PHE B CZ    1 
ATOM   2645 N  N     . GLU B  1 34  ? 14.875  6.424   24.353 1.00 33.63  ? 34  GLU B N     1 
ATOM   2646 C  CA    . GLU B  1 34  ? 16.146  6.450   25.081 1.00 26.23  ? 34  GLU B CA    1 
ATOM   2647 C  C     . GLU B  1 34  ? 16.624  7.880   24.874 1.00 26.27  ? 34  GLU B C     1 
ATOM   2648 O  O     . GLU B  1 34  ? 17.382  8.172   23.942 1.00 31.93  ? 34  GLU B O     1 
ATOM   2649 C  CB    . GLU B  1 34  ? 17.153  5.495   24.453 1.00 27.52  ? 34  GLU B CB    1 
ATOM   2650 C  CG    . GLU B  1 34  ? 17.016  4.053   24.892 1.00 40.21  ? 34  GLU B CG    1 
ATOM   2651 C  CD    . GLU B  1 34  ? 17.471  3.841   26.311 1.00 32.88  ? 34  GLU B CD    1 
ATOM   2652 O  OE1   . GLU B  1 34  ? 18.048  4.778   26.909 1.00 38.53  ? 34  GLU B OE1   1 
ATOM   2653 O  OE2   . GLU B  1 34  ? 17.263  2.730   26.828 1.00 48.49  ? 34  GLU B OE2   1 
ATOM   2654 N  N     . ILE B  1 35  ? 16.165  8.776   25.732 1.00 24.27  ? 35  ILE B N     1 
ATOM   2655 C  CA    . ILE B  1 35  ? 16.543  10.172  25.588 1.00 22.45  ? 35  ILE B CA    1 
ATOM   2656 C  C     . ILE B  1 35  ? 17.679  10.560  26.519 1.00 29.64  ? 35  ILE B C     1 
ATOM   2657 O  O     . ILE B  1 35  ? 17.594  10.366  27.717 1.00 33.36  ? 35  ILE B O     1 
ATOM   2658 C  CB    . ILE B  1 35  ? 15.331  11.126  25.829 1.00 35.63  ? 35  ILE B CB    1 
ATOM   2659 C  CG1   . ILE B  1 35  ? 15.847  12.561  25.978 1.00 32.58  ? 35  ILE B CG1   1 
ATOM   2660 C  CG2   . ILE B  1 35  ? 14.534  10.682  27.057 1.00 18.23  ? 35  ILE B CG2   1 
ATOM   2661 C  CD1   . ILE B  1 35  ? 14.796  13.640  25.875 1.00 24.68  ? 35  ILE B CD1   1 
ATOM   2662 N  N     . ASP B  1 36  ? 18.749  11.076  25.922 1.00 30.61  ? 36  ASP B N     1 
ATOM   2663 C  CA    . ASP B  1 36  ? 19.923  11.517  26.645 1.00 32.80  ? 36  ASP B CA    1 
ATOM   2664 C  C     . ASP B  1 36  ? 19.792  13.032  26.733 1.00 28.17  ? 36  ASP B C     1 
ATOM   2665 O  O     . ASP B  1 36  ? 19.633  13.725  25.719 1.00 27.47  ? 36  ASP B O     1 
ATOM   2666 C  CB    . ASP B  1 36  ? 21.201  11.116  25.890 1.00 25.32  ? 36  ASP B CB    1 
ATOM   2667 C  CG    . ASP B  1 36  ? 21.401  9.593   25.832 1.00 28.85  ? 36  ASP B CG    1 
ATOM   2668 O  OD1   . ASP B  1 36  ? 20.646  8.866   26.495 1.00 36.48  ? 36  ASP B OD1   1 
ATOM   2669 O  OD2   . ASP B  1 36  ? 22.320  9.114   25.130 1.00 36.97  ? 36  ASP B OD2   1 
ATOM   2670 N  N     . ALA B  1 37  ? 19.834  13.539  27.960 1.00 30.53  ? 37  ALA B N     1 
ATOM   2671 C  CA    . ALA B  1 37  ? 19.695  14.960  28.199 1.00 27.65  ? 37  ALA B CA    1 
ATOM   2672 C  C     . ALA B  1 37  ? 21.014  15.700  28.417 1.00 35.69  ? 37  ALA B C     1 
ATOM   2673 O  O     . ALA B  1 37  ? 21.762  15.404  29.350 1.00 33.80  ? 37  ALA B O     1 
ATOM   2674 C  CB    . ALA B  1 37  ? 18.786  15.186  29.395 1.00 23.16  ? 37  ALA B CB    1 
ATOM   2675 N  N     . VAL B  1 38  ? 21.313  16.645  27.540 1.00 35.26  ? 38  VAL B N     1 
ATOM   2676 C  CA    . VAL B  1 38  ? 22.490  17.465  27.715 1.00 36.80  ? 38  VAL B CA    1 
ATOM   2677 C  C     . VAL B  1 38  ? 21.906  18.757  28.300 1.00 36.00  ? 38  VAL B C     1 
ATOM   2678 O  O     . VAL B  1 38  ? 21.172  19.475  27.612 1.00 31.51  ? 38  VAL B O     1 
ATOM   2679 C  CB    . VAL B  1 38  ? 23.188  17.794  26.386 1.00 40.41  ? 38  VAL B CB    1 
ATOM   2680 C  CG1   . VAL B  1 38  ? 24.285  18.803  26.626 1.00 38.37  ? 38  VAL B CG1   1 
ATOM   2681 C  CG2   . VAL B  1 38  ? 23.782  16.530  25.774 1.00 33.61  ? 38  VAL B CG2   1 
ATOM   2682 N  N     . ASN B  1 39  ? 22.207  19.044  29.565 1.00 30.32  ? 39  ASN B N     1 
ATOM   2683 C  CA    . ASN B  1 39  ? 21.690  20.254  30.206 1.00 33.32  ? 39  ASN B CA    1 
ATOM   2684 C  C     . ASN B  1 39  ? 22.510  21.496  29.855 1.00 37.96  ? 39  ASN B C     1 
ATOM   2685 O  O     . ASN B  1 39  ? 23.663  21.647  30.265 1.00 33.94  ? 39  ASN B O     1 
ATOM   2686 C  CB    . ASN B  1 39  ? 21.608  20.030  31.705 1.00 27.13  ? 39  ASN B CB    1 
ATOM   2687 C  CG    . ASN B  1 39  ? 20.819  18.787  32.040 1.00 41.87  ? 39  ASN B CG    1 
ATOM   2688 O  OD1   . ASN B  1 39  ? 19.778  18.527  31.415 1.00 25.36  ? 39  ASN B OD1   1 
ATOM   2689 N  ND2   . ASN B  1 39  ? 21.292  18.009  33.022 1.00 32.59  ? 39  ASN B ND2   1 
ATOM   2690 N  N     . SER B  1 40  ? 21.896  22.388  29.083 1.00 36.58  ? 40  SER B N     1 
ATOM   2691 C  CA    . SER B  1 40  ? 22.586  23.584  28.617 1.00 41.57  ? 40  SER B CA    1 
ATOM   2692 C  C     . SER B  1 40  ? 22.737  24.642  29.705 1.00 39.70  ? 40  SER B C     1 
ATOM   2693 O  O     . SER B  1 40  ? 23.547  25.559  29.577 1.00 34.80  ? 40  SER B O     1 
ATOM   2694 C  CB    . SER B  1 40  ? 21.880  24.137  27.377 1.00 34.36  ? 40  SER B CB    1 
ATOM   2695 O  OG    . SER B  1 40  ? 20.559  24.528  27.692 1.00 40.54  ? 40  SER B OG    1 
ATOM   2696 N  N     . VAL B  1 41  ? 21.927  24.518  30.754 1.00 26.10  ? 41  VAL B N     1 
ATOM   2697 C  CA    . VAL B  1 41  ? 22.009  25.380  31.931 1.00 34.98  ? 41  VAL B CA    1 
ATOM   2698 C  C     . VAL B  1 41  ? 21.450  24.590  33.123 1.00 38.22  ? 41  VAL B C     1 
ATOM   2699 O  O     . VAL B  1 41  ? 20.752  23.586  32.944 1.00 33.42  ? 41  VAL B O     1 
ATOM   2700 C  CB    . VAL B  1 41  ? 21.204  26.731  31.797 1.00 38.95  ? 41  VAL B CB    1 
ATOM   2701 C  CG1   . VAL B  1 41  ? 21.430  27.355  30.437 1.00 39.54  ? 41  VAL B CG1   1 
ATOM   2702 C  CG2   . VAL B  1 41  ? 19.745  26.521  32.059 1.00 30.74  ? 41  VAL B CG2   1 
ATOM   2703 N  N     . GLN B  1 42  ? 21.790  25.007  34.334 1.00 33.38  ? 42  GLN B N     1 
ATOM   2704 C  CA    . GLN B  1 42  ? 21.256  24.359  35.515 1.00 28.86  ? 42  GLN B CA    1 
ATOM   2705 C  C     . GLN B  1 42  ? 20.872  25.506  36.425 1.00 31.35  ? 42  GLN B C     1 
ATOM   2706 O  O     . GLN B  1 42  ? 21.717  26.179  36.993 1.00 36.22  ? 42  GLN B O     1 
ATOM   2707 C  CB    . GLN B  1 42  ? 22.278  23.413  36.201 1.00 26.54  ? 42  GLN B CB    1 
ATOM   2708 C  CG    . GLN B  1 42  ? 21.750  22.885  37.563 1.00 25.03  ? 42  GLN B CG    1 
ATOM   2709 C  CD    . GLN B  1 42  ? 22.370  21.577  38.051 1.00 28.77  ? 42  GLN B CD    1 
ATOM   2710 O  OE1   . GLN B  1 42  ? 21.645  20.661  38.462 1.00 32.94  ? 42  GLN B OE1   1 
ATOM   2711 N  NE2   . GLN B  1 42  ? 23.691  21.488  38.042 1.00 29.61  ? 42  GLN B NE2   1 
ATOM   2712 N  N     . PHE B  1 43  ? 19.572  25.736  36.530 1.00 32.97  ? 43  PHE B N     1 
ATOM   2713 C  CA    . PHE B  1 43  ? 19.028  26.818  37.329 1.00 28.59  ? 43  PHE B CA    1 
ATOM   2714 C  C     . PHE B  1 43  ? 18.134  26.272  38.431 1.00 29.55  ? 43  PHE B C     1 
ATOM   2715 O  O     . PHE B  1 43  ? 17.687  25.131  38.367 1.00 29.57  ? 43  PHE B O     1 
ATOM   2716 C  CB    . PHE B  1 43  ? 18.203  27.770  36.442 1.00 37.46  ? 43  PHE B CB    1 
ATOM   2717 C  CG    . PHE B  1 43  ? 19.024  28.692  35.591 1.00 31.10  ? 43  PHE B CG    1 
ATOM   2718 C  CD1   . PHE B  1 43  ? 20.406  28.581  35.533 1.00 44.73  ? 43  PHE B CD1   1 
ATOM   2719 C  CD2   . PHE B  1 43  ? 18.400  29.666  34.812 1.00 64.16  ? 43  PHE B CD2   1 
ATOM   2720 C  CE1   . PHE B  1 43  ? 21.158  29.414  34.723 1.00 49.05  ? 43  PHE B CE1   1 
ATOM   2721 C  CE2   . PHE B  1 43  ? 19.147  30.515  33.985 1.00 53.73  ? 43  PHE B CE2   1 
ATOM   2722 C  CZ    . PHE B  1 43  ? 20.528  30.384  33.944 1.00 59.44  ? 43  PHE B CZ    1 
ATOM   2723 N  N     . SER B  1 44  ? 17.859  27.100  39.428 1.00 31.16  ? 44  SER B N     1 
ATOM   2724 C  CA    . SER B  1 44  ? 17.032  26.682  40.557 1.00 40.21  ? 44  SER B CA    1 
ATOM   2725 C  C     . SER B  1 44  ? 15.591  26.502  40.097 1.00 29.31  ? 44  SER B C     1 
ATOM   2726 O  O     . SER B  1 44  ? 14.869  25.636  40.583 1.00 37.33  ? 44  SER B O     1 
ATOM   2727 C  CB    . SER B  1 44  ? 17.108  27.730  41.692 1.00 25.60  ? 44  SER B CB    1 
ATOM   2728 O  OG    . SER B  1 44  ? 16.650  29.005  41.283 1.00 27.77  ? 44  SER B OG    1 
ATOM   2729 N  N     . ASN B  1 45  ? 15.212  27.308  39.122 1.00 27.80  ? 45  ASN B N     1 
ATOM   2730 C  CA    . ASN B  1 45  ? 13.867  27.274  38.587 1.00 37.22  ? 45  ASN B CA    1 
ATOM   2731 C  C     . ASN B  1 45  ? 13.859  28.084  37.304 1.00 36.29  ? 45  ASN B C     1 
ATOM   2732 O  O     . ASN B  1 45  ? 14.887  28.643  36.921 1.00 28.68  ? 45  ASN B O     1 
ATOM   2733 C  CB    . ASN B  1 45  ? 12.925  27.876  39.616 1.00 33.08  ? 45  ASN B CB    1 
ATOM   2734 C  CG    . ASN B  1 45  ? 13.466  29.172  40.187 1.00 34.23  ? 45  ASN B CG    1 
ATOM   2735 O  OD1   . ASN B  1 45  ? 13.304  30.234  39.598 1.00 38.32  ? 45  ASN B OD1   1 
ATOM   2736 N  ND2   . ASN B  1 45  ? 14.130  29.087  41.330 1.00 23.07  ? 45  ASN B ND2   1 
ATOM   2737 N  N     . HIS B  1 46  ? 12.719  28.152  36.626 1.00 36.47  ? 46  HIS B N     1 
ATOM   2738 C  CA    . HIS B  1 46  ? 12.705  28.919  35.394 1.00 36.58  ? 46  HIS B CA    1 
ATOM   2739 C  C     . HIS B  1 46  ? 12.737  30.432  35.684 1.00 46.56  ? 46  HIS B C     1 
ATOM   2740 O  O     . HIS B  1 46  ? 12.311  30.891  36.753 1.00 45.25  ? 46  HIS B O     1 
ATOM   2741 C  CB    . HIS B  1 46  ? 11.519  28.499  34.494 1.00 33.11  ? 46  HIS B CB    1 
ATOM   2742 C  CG    . HIS B  1 46  ? 10.186  29.011  34.942 1.00 19.27  ? 46  HIS B CG    1 
ATOM   2743 N  ND1   . HIS B  1 46  ? 9.151   28.169  35.294 1.00 38.24  ? 46  HIS B ND1   1 
ATOM   2744 C  CD2   . HIS B  1 46  ? 9.708   30.271  35.073 1.00 24.99  ? 46  HIS B CD2   1 
ATOM   2745 C  CE1   . HIS B  1 46  ? 8.095   28.888  35.626 1.00 24.01  ? 46  HIS B CE1   1 
ATOM   2746 N  NE2   . HIS B  1 46  ? 8.406   30.168  35.497 1.00 29.95  ? 46  HIS B NE2   1 
ATOM   2747 N  N     . THR B  1 47  ? 13.261  31.203  34.737 1.00 39.13  ? 47  THR B N     1 
ATOM   2748 C  CA    . THR B  1 47  ? 13.423  32.639  34.913 1.00 36.74  ? 47  THR B CA    1 
ATOM   2749 C  C     . THR B  1 47  ? 12.173  33.491  35.014 1.00 37.91  ? 47  THR B C     1 
ATOM   2750 O  O     . THR B  1 47  ? 12.261  34.707  35.078 1.00 39.37  ? 47  THR B O     1 
ATOM   2751 C  CB    . THR B  1 47  ? 14.308  33.194  33.819 1.00 24.55  ? 47  THR B CB    1 
ATOM   2752 O  OG1   . THR B  1 47  ? 13.751  32.866  32.550 1.00 42.70  ? 47  THR B OG1   1 
ATOM   2753 C  CG2   . THR B  1 47  ? 15.682  32.565  33.895 1.00 32.10  ? 47  THR B CG2   1 
ATOM   2754 N  N     . GLY B  1 48  ? 11.009  32.855  35.058 1.00 43.33  ? 48  GLY B N     1 
ATOM   2755 C  CA    . GLY B  1 48  ? 9.776   33.610  35.162 1.00 35.44  ? 48  GLY B CA    1 
ATOM   2756 C  C     . GLY B  1 48  ? 9.380   33.821  36.610 1.00 48.06  ? 48  GLY B C     1 
ATOM   2757 O  O     . GLY B  1 48  ? 8.355   34.439  36.887 1.00 52.10  ? 48  GLY B O     1 
ATOM   2758 N  N     . TYR B  1 49  ? 10.174  33.276  37.534 1.00 39.29  ? 49  TYR B N     1 
ATOM   2759 C  CA    . TYR B  1 49  ? 9.917   33.429  38.966 1.00 40.10  ? 49  TYR B CA    1 
ATOM   2760 C  C     . TYR B  1 49  ? 10.556  34.733  39.418 1.00 37.33  ? 49  TYR B C     1 
ATOM   2761 O  O     . TYR B  1 49  ? 11.365  35.305  38.700 1.00 37.51  ? 49  TYR B O     1 
ATOM   2762 C  CB    . TYR B  1 49  ? 10.547  32.296  39.782 1.00 35.79  ? 49  TYR B CB    1 
ATOM   2763 C  CG    . TYR B  1 49  ? 9.798   30.993  39.787 1.00 44.15  ? 49  TYR B CG    1 
ATOM   2764 C  CD1   . TYR B  1 49  ? 9.932   30.082  38.735 1.00 31.86  ? 49  TYR B CD1   1 
ATOM   2765 C  CD2   . TYR B  1 49  ? 8.990   30.642  40.870 1.00 33.42  ? 49  TYR B CD2   1 
ATOM   2766 C  CE1   . TYR B  1 49  ? 9.292   28.859  38.769 1.00 26.76  ? 49  TYR B CE1   1 
ATOM   2767 C  CE2   . TYR B  1 49  ? 8.344   29.414  40.912 1.00 39.39  ? 49  TYR B CE2   1 
ATOM   2768 C  CZ    . TYR B  1 49  ? 8.500   28.524  39.859 1.00 36.68  ? 49  TYR B CZ    1 
ATOM   2769 O  OH    . TYR B  1 49  ? 7.865   27.309  39.897 1.00 43.57  ? 49  TYR B OH    1 
ATOM   2770 N  N     . ALA B  1 50  ? 10.218  35.185  40.623 1.00 40.61  ? 50  ALA B N     1 
ATOM   2771 C  CA    . ALA B  1 50  ? 10.781  36.427  41.137 1.00 39.70  ? 50  ALA B CA    1 
ATOM   2772 C  C     . ALA B  1 50  ? 12.289  36.310  41.182 1.00 39.82  ? 50  ALA B C     1 
ATOM   2773 O  O     . ALA B  1 50  ? 12.993  37.256  40.840 1.00 42.01  ? 50  ALA B O     1 
ATOM   2774 C  CB    . ALA B  1 50  ? 10.242  36.722  42.538 1.00 42.98  ? 50  ALA B CB    1 
ATOM   2775 N  N     . HIS B  1 51  ? 12.783  35.151  41.618 1.00 35.15  ? 51  HIS B N     1 
ATOM   2776 C  CA    . HIS B  1 51  ? 14.220  34.926  41.696 1.00 34.84  ? 51  HIS B CA    1 
ATOM   2777 C  C     . HIS B  1 51  ? 14.534  33.634  41.016 1.00 43.33  ? 51  HIS B C     1 
ATOM   2778 O  O     . HIS B  1 51  ? 13.668  32.773  40.828 1.00 39.63  ? 51  HIS B O     1 
ATOM   2779 C  CB    . HIS B  1 51  ? 14.709  34.805  43.153 1.00 31.58  ? 51  HIS B CB    1 
ATOM   2780 C  CG    . HIS B  1 51  ? 14.043  35.756  44.096 1.00 41.18  ? 51  HIS B CG    1 
ATOM   2781 N  ND1   . HIS B  1 51  ? 12.790  35.521  44.619 1.00 44.42  ? 51  HIS B ND1   1 
ATOM   2782 C  CD2   . HIS B  1 51  ? 14.417  36.976  44.549 1.00 29.46  ? 51  HIS B CD2   1 
ATOM   2783 C  CE1   . HIS B  1 51  ? 12.419  36.554  45.352 1.00 39.05  ? 51  HIS B CE1   1 
ATOM   2784 N  NE2   . HIS B  1 51  ? 13.387  37.450  45.323 1.00 50.38  ? 51  HIS B NE2   1 
ATOM   2785 N  N     . TRP B  1 52  ? 15.800  33.515  40.660 1.00 27.00  ? 52  TRP B N     1 
ATOM   2786 C  CA    . TRP B  1 52  ? 16.334  32.340  40.044 1.00 36.65  ? 52  TRP B CA    1 
ATOM   2787 C  C     . TRP B  1 52  ? 17.870  32.464  40.001 1.00 23.49  ? 52  TRP B C     1 
ATOM   2788 O  O     . TRP B  1 52  ? 18.404  33.535  39.733 1.00 35.51  ? 52  TRP B O     1 
ATOM   2789 C  CB    . TRP B  1 52  ? 15.747  32.182  38.647 1.00 31.82  ? 52  TRP B CB    1 
ATOM   2790 C  CG    . TRP B  1 52  ? 15.995  33.331  37.749 1.00 43.52  ? 52  TRP B CG    1 
ATOM   2791 C  CD1   . TRP B  1 52  ? 15.155  34.390  37.491 1.00 46.99  ? 52  TRP B CD1   1 
ATOM   2792 C  CD2   . TRP B  1 52  ? 17.191  33.573  37.010 1.00 38.56  ? 52  TRP B CD2   1 
ATOM   2793 N  NE1   . TRP B  1 52  ? 15.769  35.274  36.632 1.00 44.36  ? 52  TRP B NE1   1 
ATOM   2794 C  CE2   . TRP B  1 52  ? 17.020  34.793  36.325 1.00 33.79  ? 52  TRP B CE2   1 
ATOM   2795 C  CE3   . TRP B  1 52  ? 18.400  32.875  36.867 1.00 43.84  ? 52  TRP B CE3   1 
ATOM   2796 C  CZ2   . TRP B  1 52  ? 18.015  35.330  35.507 1.00 46.01  ? 52  TRP B CZ2   1 
ATOM   2797 C  CZ3   . TRP B  1 52  ? 19.385  33.407  36.056 1.00 49.99  ? 52  TRP B CZ3   1 
ATOM   2798 C  CH2   . TRP B  1 52  ? 19.185  34.624  35.389 1.00 38.17  ? 52  TRP B CH2   1 
ATOM   2799 N  N     . LYS B  1 53  ? 18.574  31.373  40.296 1.00 30.86  ? 53  LYS B N     1 
ATOM   2800 C  CA    . LYS B  1 53  ? 20.035  31.386  40.241 1.00 25.61  ? 53  LYS B CA    1 
ATOM   2801 C  C     . LYS B  1 53  ? 20.493  30.124  39.562 1.00 32.99  ? 53  LYS B C     1 
ATOM   2802 O  O     . LYS B  1 53  ? 19.723  29.185  39.441 1.00 39.84  ? 53  LYS B O     1 
ATOM   2803 C  CB    . LYS B  1 53  ? 20.643  31.462  41.638 1.00 35.67  ? 53  LYS B CB    1 
ATOM   2804 C  CG    . LYS B  1 53  ? 20.193  32.669  42.437 1.00 38.34  ? 53  LYS B CG    1 
ATOM   2805 C  CD    . LYS B  1 53  ? 21.182  32.997  43.550 1.00 54.32  ? 53  LYS B CD    1 
ATOM   2806 C  CE    . LYS B  1 53  ? 21.807  34.395  43.374 1.00 68.21  ? 53  LYS B CE    1 
ATOM   2807 N  NZ    . LYS B  1 53  ? 22.595  34.607  42.107 1.00 54.00  ? 53  LYS B NZ    1 
ATOM   2808 N  N     . GLY B  1 54  ? 21.745  30.098  39.105 1.00 26.76  ? 54  GLY B N     1 
ATOM   2809 C  CA    . GLY B  1 54  ? 22.240  28.905  38.457 1.00 24.40  ? 54  GLY B CA    1 
ATOM   2810 C  C     . GLY B  1 54  ? 23.455  29.181  37.591 1.00 31.14  ? 54  GLY B C     1 
ATOM   2811 O  O     . GLY B  1 54  ? 23.957  30.289  37.579 1.00 38.72  ? 54  GLY B O     1 
ATOM   2812 N  N     . GLN B  1 55  ? 23.919  28.164  36.875 1.00 33.40  ? 55  GLN B N     1 
ATOM   2813 C  CA    . GLN B  1 55  ? 25.086  28.256  35.997 1.00 36.61  ? 55  GLN B CA    1 
ATOM   2814 C  C     . GLN B  1 55  ? 24.725  27.841  34.564 1.00 34.43  ? 55  GLN B C     1 
ATOM   2815 O  O     . GLN B  1 55  ? 23.717  27.197  34.344 1.00 37.32  ? 55  GLN B O     1 
ATOM   2816 C  CB    . GLN B  1 55  ? 26.207  27.337  36.518 1.00 36.98  ? 55  GLN B CB    1 
ATOM   2817 C  CG    . GLN B  1 55  ? 26.586  27.536  37.987 1.00 31.95  ? 55  GLN B CG    1 
ATOM   2818 C  CD    . GLN B  1 55  ? 25.675  26.794  38.939 1.00 31.40  ? 55  GLN B CD    1 
ATOM   2819 O  OE1   . GLN B  1 55  ? 25.397  25.603  38.746 1.00 38.88  ? 55  GLN B OE1   1 
ATOM   2820 N  NE2   . GLN B  1 55  ? 25.214  27.482  39.988 1.00 30.86  ? 55  GLN B NE2   1 
ATOM   2821 N  N     . VAL B  1 56  ? 25.548  28.206  33.586 1.00 34.54  ? 56  VAL B N     1 
ATOM   2822 C  CA    . VAL B  1 56  ? 25.253  27.842  32.209 1.00 40.08  ? 56  VAL B CA    1 
ATOM   2823 C  C     . VAL B  1 56  ? 26.386  27.013  31.646 1.00 42.46  ? 56  VAL B C     1 
ATOM   2824 O  O     . VAL B  1 56  ? 27.494  27.036  32.161 1.00 49.24  ? 56  VAL B O     1 
ATOM   2825 C  CB    . VAL B  1 56  ? 25.069  29.091  31.274 1.00 38.42  ? 56  VAL B CB    1 
ATOM   2826 C  CG1   . VAL B  1 56  ? 24.050  30.052  31.851 1.00 37.72  ? 56  VAL B CG1   1 
ATOM   2827 C  CG2   . VAL B  1 56  ? 26.387  29.774  31.051 1.00 43.82  ? 56  VAL B CG2   1 
ATOM   2828 N  N     . LEU B  1 57  ? 26.093  26.279  30.580 1.00 39.05  ? 57  LEU B N     1 
ATOM   2829 C  CA    . LEU B  1 57  ? 27.092  25.460  29.911 1.00 40.08  ? 57  LEU B CA    1 
ATOM   2830 C  C     . LEU B  1 57  ? 27.638  26.297  28.750 1.00 44.21  ? 57  LEU B C     1 
ATOM   2831 O  O     . LEU B  1 57  ? 26.866  26.913  28.024 1.00 46.19  ? 57  LEU B O     1 
ATOM   2832 C  CB    . LEU B  1 57  ? 26.432  24.201  29.371 1.00 24.62  ? 57  LEU B CB    1 
ATOM   2833 C  CG    . LEU B  1 57  ? 27.279  23.074  28.795 1.00 38.98  ? 57  LEU B CG    1 
ATOM   2834 C  CD1   . LEU B  1 57  ? 28.226  22.534  29.858 1.00 34.58  ? 57  LEU B CD1   1 
ATOM   2835 C  CD2   . LEU B  1 57  ? 26.348  21.958  28.317 1.00 37.26  ? 57  LEU B CD2   1 
ATOM   2836 N  N     . ASN B  1 58  ? 28.954  26.347  28.571 1.00 43.89  ? 58  ASN B N     1 
ATOM   2837 C  CA    . ASN B  1 58  ? 29.471  27.127  27.461 1.00 46.77  ? 58  ASN B CA    1 
ATOM   2838 C  C     . ASN B  1 58  ? 29.780  26.166  26.344 1.00 43.29  ? 58  ASN B C     1 
ATOM   2839 O  O     . ASN B  1 58  ? 29.888  24.952  26.577 1.00 42.76  ? 58  ASN B O     1 
ATOM   2840 C  CB    . ASN B  1 58  ? 30.719  27.941  27.859 1.00 46.24  ? 58  ASN B CB    1 
ATOM   2841 C  CG    . ASN B  1 58  ? 31.931  27.074  28.164 1.00 58.64  ? 58  ASN B CG    1 
ATOM   2842 O  OD1   . ASN B  1 58  ? 32.351  26.231  27.356 1.00 56.10  ? 58  ASN B OD1   1 
ATOM   2843 N  ND2   . ASN B  1 58  ? 32.519  27.299  29.330 1.00 66.14  ? 58  ASN B ND2   1 
ATOM   2844 N  N     . SER B  1 59  ? 29.911  26.708  25.135 1.00 43.11  ? 59  SER B N     1 
ATOM   2845 C  CA    . SER B  1 59  ? 30.197  25.913  23.933 1.00 44.40  ? 59  SER B CA    1 
ATOM   2846 C  C     . SER B  1 59  ? 31.381  24.949  24.046 1.00 37.90  ? 59  SER B C     1 
ATOM   2847 O  O     . SER B  1 59  ? 31.388  23.896  23.424 1.00 43.84  ? 59  SER B O     1 
ATOM   2848 C  CB    . SER B  1 59  ? 30.392  26.844  22.722 1.00 32.69  ? 59  SER B CB    1 
ATOM   2849 O  OG    . SER B  1 59  ? 31.094  28.024  23.073 1.00 50.59  ? 59  SER B OG    1 
ATOM   2850 N  N     . ASP B  1 60  ? 32.378  25.311  24.842 1.00 49.36  ? 60  ASP B N     1 
ATOM   2851 C  CA    . ASP B  1 60  ? 33.553  24.470  25.032 1.00 43.38  ? 60  ASP B CA    1 
ATOM   2852 C  C     . ASP B  1 60  ? 33.215  23.235  25.830 1.00 42.70  ? 60  ASP B C     1 
ATOM   2853 O  O     . ASP B  1 60  ? 33.632  22.134  25.480 1.00 43.67  ? 60  ASP B O     1 
ATOM   2854 C  CB    . ASP B  1 60  ? 34.629  25.259  25.757 1.00 48.16  ? 60  ASP B CB    1 
ATOM   2855 C  CG    . ASP B  1 60  ? 35.196  26.343  24.901 1.00 64.58  ? 60  ASP B CG    1 
ATOM   2856 O  OD1   . ASP B  1 60  ? 35.812  25.982  23.874 1.00 62.13  ? 60  ASP B OD1   1 
ATOM   2857 O  OD2   . ASP B  1 60  ? 35.012  27.541  25.239 1.00 64.80  ? 60  ASP B OD2   1 
ATOM   2858 N  N     . GLU B  1 61  ? 32.457  23.425  26.909 1.00 46.90  ? 61  GLU B N     1 
ATOM   2859 C  CA    . GLU B  1 61  ? 32.059  22.305  27.754 1.00 43.60  ? 61  GLU B CA    1 
ATOM   2860 C  C     . GLU B  1 61  ? 31.123  21.377  26.971 1.00 44.57  ? 61  GLU B C     1 
ATOM   2861 O  O     . GLU B  1 61  ? 31.177  20.147  27.123 1.00 37.75  ? 61  GLU B O     1 
ATOM   2862 C  CB    . GLU B  1 61  ? 31.407  22.833  29.029 1.00 39.49  ? 61  GLU B CB    1 
ATOM   2863 C  CG    . GLU B  1 61  ? 32.351  23.692  29.850 1.00 39.09  ? 61  GLU B CG    1 
ATOM   2864 C  CD    . GLU B  1 61  ? 31.645  24.565  30.852 1.00 41.18  ? 61  GLU B CD    1 
ATOM   2865 O  OE1   . GLU B  1 61  ? 30.546  25.071  30.532 1.00 54.37  ? 61  GLU B OE1   1 
ATOM   2866 O  OE2   . GLU B  1 61  ? 32.194  24.764  31.953 1.00 48.08  ? 61  GLU B OE2   1 
ATOM   2867 N  N     . LEU B  1 62  ? 30.289  21.966  26.114 1.00 41.64  ? 62  LEU B N     1 
ATOM   2868 C  CA    . LEU B  1 62  ? 29.376  21.176  25.296 1.00 39.79  ? 62  LEU B CA    1 
ATOM   2869 C  C     . LEU B  1 62  ? 30.227  20.340  24.366 1.00 36.92  ? 62  LEU B C     1 
ATOM   2870 O  O     . LEU B  1 62  ? 29.992  19.146  24.190 1.00 40.60  ? 62  LEU B O     1 
ATOM   2871 C  CB    . LEU B  1 62  ? 28.455  22.070  24.460 1.00 30.98  ? 62  LEU B CB    1 
ATOM   2872 C  CG    . LEU B  1 62  ? 27.650  21.285  23.425 1.00 37.91  ? 62  LEU B CG    1 
ATOM   2873 C  CD1   . LEU B  1 62  ? 26.664  20.398  24.152 1.00 38.65  ? 62  LEU B CD1   1 
ATOM   2874 C  CD2   . LEU B  1 62  ? 26.907  22.234  22.483 1.00 45.71  ? 62  LEU B CD2   1 
ATOM   2875 N  N     . GLN B  1 63  ? 31.230  20.974  23.771 1.00 42.08  ? 63  GLN B N     1 
ATOM   2876 C  CA    . GLN B  1 63  ? 32.109  20.266  22.861 1.00 39.00  ? 63  GLN B CA    1 
ATOM   2877 C  C     . GLN B  1 63  ? 32.799  19.128  23.588 1.00 38.40  ? 63  GLN B C     1 
ATOM   2878 O  O     . GLN B  1 63  ? 32.911  18.028  23.056 1.00 42.28  ? 63  GLN B O     1 
ATOM   2879 C  CB    . GLN B  1 63  ? 33.150  21.212  22.261 1.00 41.76  ? 63  GLN B CB    1 
ATOM   2880 C  CG    . GLN B  1 63  ? 34.153  20.495  21.381 1.00 37.13  ? 63  GLN B CG    1 
ATOM   2881 C  CD    . GLN B  1 63  ? 35.124  21.440  20.681 1.00 47.96  ? 63  GLN B CD    1 
ATOM   2882 O  OE1   . GLN B  1 63  ? 35.321  22.585  21.095 1.00 41.82  ? 63  GLN B OE1   1 
ATOM   2883 N  NE2   . GLN B  1 63  ? 35.751  20.948  19.622 1.00 56.86  ? 63  GLN B NE2   1 
ATOM   2884 N  N     . GLU B  1 64  ? 33.258  19.397  24.806 1.00 46.98  ? 64  GLU B N     1 
ATOM   2885 C  CA    . GLU B  1 64  ? 33.933  18.391  25.622 1.00 44.07  ? 64  GLU B CA    1 
ATOM   2886 C  C     . GLU B  1 64  ? 32.996  17.226  25.939 1.00 39.70  ? 64  GLU B C     1 
ATOM   2887 O  O     . GLU B  1 64  ? 33.374  16.060  25.795 1.00 38.65  ? 64  GLU B O     1 
ATOM   2888 C  CB    . GLU B  1 64  ? 34.453  19.038  26.915 1.00 45.83  ? 64  GLU B CB    1 
ATOM   2889 C  CG    . GLU B  1 64  ? 34.948  18.066  27.978 1.00 63.42  ? 64  GLU B CG    1 
ATOM   2890 C  CD    . GLU B  1 64  ? 35.761  18.744  29.079 1.00 70.39  ? 64  GLU B CD    1 
ATOM   2891 O  OE1   . GLU B  1 64  ? 35.252  19.671  29.758 1.00 63.84  ? 64  GLU B OE1   1 
ATOM   2892 O  OE2   . GLU B  1 64  ? 36.924  18.339  29.265 1.00 77.26  ? 64  GLU B OE2   1 
ATOM   2893 N  N     . LEU B  1 65  ? 31.771  17.535  26.367 1.00 43.87  ? 65  LEU B N     1 
ATOM   2894 C  CA    . LEU B  1 65  ? 30.802  16.487  26.692 1.00 34.28  ? 65  LEU B CA    1 
ATOM   2895 C  C     . LEU B  1 65  ? 30.561  15.638  25.455 1.00 36.27  ? 65  LEU B C     1 
ATOM   2896 O  O     . LEU B  1 65  ? 30.393  14.426  25.551 1.00 47.72  ? 65  LEU B O     1 
ATOM   2897 C  CB    . LEU B  1 65  ? 29.479  17.097  27.182 1.00 39.33  ? 65  LEU B CB    1 
ATOM   2898 C  CG    . LEU B  1 65  ? 29.394  17.647  28.618 1.00 42.42  ? 65  LEU B CG    1 
ATOM   2899 C  CD1   . LEU B  1 65  ? 28.151  18.523  28.732 1.00 31.71  ? 65  LEU B CD1   1 
ATOM   2900 C  CD2   . LEU B  1 65  ? 29.352  16.503  29.665 1.00 20.35  ? 65  LEU B CD2   1 
ATOM   2901 N  N     . TYR B  1 66  ? 30.540  16.270  24.289 1.00 39.79  ? 66  TYR B N     1 
ATOM   2902 C  CA    . TYR B  1 66  ? 30.339  15.543  23.051 1.00 35.15  ? 66  TYR B CA    1 
ATOM   2903 C  C     . TYR B  1 66  ? 31.562  14.682  22.688 1.00 44.69  ? 66  TYR B C     1 
ATOM   2904 O  O     . TYR B  1 66  ? 31.425  13.572  22.129 1.00 40.45  ? 66  TYR B O     1 
ATOM   2905 C  CB    . TYR B  1 66  ? 30.041  16.512  21.899 1.00 43.96  ? 66  TYR B CB    1 
ATOM   2906 C  CG    . TYR B  1 66  ? 29.803  15.792  20.585 1.00 42.90  ? 66  TYR B CG    1 
ATOM   2907 C  CD1   . TYR B  1 66  ? 28.650  15.042  20.379 1.00 42.43  ? 66  TYR B CD1   1 
ATOM   2908 C  CD2   . TYR B  1 66  ? 30.768  15.792  19.588 1.00 36.97  ? 66  TYR B CD2   1 
ATOM   2909 C  CE1   . TYR B  1 66  ? 28.469  14.307  19.215 1.00 36.64  ? 66  TYR B CE1   1 
ATOM   2910 C  CE2   . TYR B  1 66  ? 30.603  15.060  18.424 1.00 46.13  ? 66  TYR B CE2   1 
ATOM   2911 C  CZ    . TYR B  1 66  ? 29.454  14.316  18.241 1.00 52.04  ? 66  TYR B CZ    1 
ATOM   2912 O  OH    . TYR B  1 66  ? 29.316  13.563  17.092 1.00 57.10  ? 66  TYR B OH    1 
ATOM   2913 N  N     . GLU B  1 67  ? 32.753  15.201  22.990 1.00 41.28  ? 67  GLU B N     1 
ATOM   2914 C  CA    . GLU B  1 67  ? 33.995  14.483  22.716 1.00 43.74  ? 67  GLU B CA    1 
ATOM   2915 C  C     . GLU B  1 67  ? 33.977  13.161  23.484 1.00 37.05  ? 67  GLU B C     1 
ATOM   2916 O  O     . GLU B  1 67  ? 34.408  12.130  22.980 1.00 33.66  ? 67  GLU B O     1 
ATOM   2917 C  CB    . GLU B  1 67  ? 35.198  15.329  23.141 1.00 54.44  ? 67  GLU B CB    1 
ATOM   2918 C  CG    . GLU B  1 67  ? 36.550  14.671  22.885 1.00 65.47  ? 67  GLU B CG    1 
ATOM   2919 C  CD    . GLU B  1 67  ? 36.865  14.501  21.398 1.00 77.61  ? 67  GLU B CD    1 
ATOM   2920 O  OE1   . GLU B  1 67  ? 37.963  13.991  21.076 1.00 72.12  ? 67  GLU B OE1   1 
ATOM   2921 O  OE2   . GLU B  1 67  ? 36.025  14.880  20.551 1.00 79.22  ? 67  GLU B OE2   1 
ATOM   2922 N  N     . GLY B  1 68  ? 33.468  13.203  24.712 1.00 36.35  ? 68  GLY B N     1 
ATOM   2923 C  CA    . GLY B  1 68  ? 33.357  12.000  25.517 1.00 40.64  ? 68  GLY B CA    1 
ATOM   2924 C  C     . GLY B  1 68  ? 32.455  10.962  24.864 1.00 39.82  ? 68  GLY B C     1 
ATOM   2925 O  O     . GLY B  1 68  ? 32.792  9.785   24.806 1.00 35.65  ? 68  GLY B O     1 
ATOM   2926 N  N     . LEU B  1 69  ? 31.301  11.383  24.358 1.00 40.72  ? 69  LEU B N     1 
ATOM   2927 C  CA    . LEU B  1 69  ? 30.394  10.426  23.707 1.00 37.56  ? 69  LEU B CA    1 
ATOM   2928 C  C     . LEU B  1 69  ? 31.119  9.826   22.505 1.00 42.05  ? 69  LEU B C     1 
ATOM   2929 O  O     . LEU B  1 69  ? 31.105  8.607   22.284 1.00 44.62  ? 69  LEU B O     1 
ATOM   2930 C  CB    . LEU B  1 69  ? 29.104  11.120  23.229 1.00 30.22  ? 69  LEU B CB    1 
ATOM   2931 C  CG    . LEU B  1 69  ? 28.143  11.639  24.313 1.00 37.02  ? 69  LEU B CG    1 
ATOM   2932 C  CD1   . LEU B  1 69  ? 27.041  12.502  23.701 1.00 33.26  ? 69  LEU B CD1   1 
ATOM   2933 C  CD2   . LEU B  1 69  ? 27.549  10.462  25.034 1.00 25.82  ? 69  LEU B CD2   1 
ATOM   2934 N  N     . ARG B  1 70  ? 31.765  10.697  21.738 1.00 35.36  ? 70  ARG B N     1 
ATOM   2935 C  CA    . ARG B  1 70  ? 32.491  10.290  20.547 1.00 40.31  ? 70  ARG B CA    1 
ATOM   2936 C  C     . ARG B  1 70  ? 33.657  9.363   20.847 1.00 44.69  ? 70  ARG B C     1 
ATOM   2937 O  O     . ARG B  1 70  ? 33.868  8.376   20.138 1.00 44.49  ? 70  ARG B O     1 
ATOM   2938 C  CB    . ARG B  1 70  ? 32.998  11.516  19.802 1.00 37.79  ? 70  ARG B CB    1 
ATOM   2939 C  CG    . ARG B  1 70  ? 32.942  11.364  18.309 1.00 61.17  ? 70  ARG B CG    1 
ATOM   2940 C  CD    . ARG B  1 70  ? 33.956  12.269  17.693 1.00 74.00  ? 70  ARG B CD    1 
ATOM   2941 N  NE    . ARG B  1 70  ? 35.271  11.925  18.211 1.00 88.68  ? 70  ARG B NE    1 
ATOM   2942 C  CZ    . ARG B  1 70  ? 36.324  12.728  18.155 1.00 95.78  ? 70  ARG B CZ    1 
ATOM   2943 N  NH1   . ARG B  1 70  ? 37.488  12.332  18.653 1.00 92.66  ? 70  ARG B NH1   1 
ATOM   2944 N  NH2   . ARG B  1 70  ? 36.202  13.930  17.609 1.00 100.00 ? 70  ARG B NH2   1 
ATOM   2945 N  N     . LEU B  1 71  ? 34.413  9.671   21.894 1.00 44.90  ? 71  LEU B N     1 
ATOM   2946 C  CA    . LEU B  1 71  ? 35.549  8.828   22.249 1.00 48.66  ? 71  LEU B CA    1 
ATOM   2947 C  C     . LEU B  1 71  ? 35.081  7.406   22.544 1.00 52.10  ? 71  LEU B C     1 
ATOM   2948 O  O     . LEU B  1 71  ? 35.823  6.449   22.347 1.00 47.90  ? 71  LEU B O     1 
ATOM   2949 C  CB    . LEU B  1 71  ? 36.311  9.419   23.450 1.00 48.74  ? 71  LEU B CB    1 
ATOM   2950 C  CG    . LEU B  1 71  ? 37.128  10.689  23.146 1.00 50.53  ? 71  LEU B CG    1 
ATOM   2951 C  CD1   . LEU B  1 71  ? 37.728  11.243  24.413 1.00 50.25  ? 71  LEU B CD1   1 
ATOM   2952 C  CD2   . LEU B  1 71  ? 38.232  10.371  22.143 1.00 46.87  ? 71  LEU B CD2   1 
ATOM   2953 N  N     . ASN B  1 72  ? 33.837  7.264   22.988 1.00 47.14  ? 72  ASN B N     1 
ATOM   2954 C  CA    . ASN B  1 72  ? 33.302  5.942   23.292 1.00 46.40  ? 72  ASN B CA    1 
ATOM   2955 C  C     . ASN B  1 72  ? 32.402  5.430   22.184 1.00 41.86  ? 72  ASN B C     1 
ATOM   2956 O  O     . ASN B  1 72  ? 31.736  4.421   22.343 1.00 40.79  ? 72  ASN B O     1 
ATOM   2957 C  CB    . ASN B  1 72  ? 32.518  5.966   24.611 1.00 44.37  ? 72  ASN B CB    1 
ATOM   2958 C  CG    . ASN B  1 72  ? 33.407  6.190   25.817 1.00 42.32  ? 72  ASN B CG    1 
ATOM   2959 O  OD1   . ASN B  1 72  ? 34.333  5.423   26.071 1.00 45.03  ? 72  ASN B OD1   1 
ATOM   2960 N  ND2   . ASN B  1 72  ? 33.120  7.236   26.575 1.00 45.56  ? 72  ASN B ND2   1 
ATOM   2961 N  N     . ASN B  1 73  ? 32.362  6.135   21.065 1.00 49.01  ? 73  ASN B N     1 
ATOM   2962 C  CA    . ASN B  1 73  ? 31.523  5.701   19.961 1.00 47.50  ? 73  ASN B CA    1 
ATOM   2963 C  C     . ASN B  1 73  ? 30.027  5.687   20.315 1.00 44.20  ? 73  ASN B C     1 
ATOM   2964 O  O     . ASN B  1 73  ? 29.282  4.834   19.836 1.00 44.97  ? 73  ASN B O     1 
ATOM   2965 C  CB    . ASN B  1 73  ? 31.953  4.303   19.530 1.00 62.64  ? 73  ASN B CB    1 
ATOM   2966 C  CG    . ASN B  1 73  ? 31.938  4.136   18.044 1.00 74.24  ? 73  ASN B CG    1 
ATOM   2967 O  OD1   . ASN B  1 73  ? 32.705  4.784   17.334 1.00 87.50  ? 73  ASN B OD1   1 
ATOM   2968 N  ND2   . ASN B  1 73  ? 31.061  3.270   17.555 1.00 83.74  ? 73  ASN B ND2   1 
ATOM   2969 N  N     . MET B  1 74  ? 29.598  6.626   21.159 1.00 45.25  ? 74  MET B N     1 
ATOM   2970 C  CA    . MET B  1 74  ? 28.191  6.732   21.559 1.00 44.91  ? 74  MET B CA    1 
ATOM   2971 C  C     . MET B  1 74  ? 27.505  7.908   20.858 1.00 48.23  ? 74  MET B C     1 
ATOM   2972 O  O     . MET B  1 74  ? 26.496  8.414   21.341 1.00 46.42  ? 74  MET B O     1 
ATOM   2973 C  CB    . MET B  1 74  ? 28.068  6.916   23.076 1.00 43.36  ? 74  MET B CB    1 
ATOM   2974 C  CG    . MET B  1 74  ? 28.570  5.737   23.903 1.00 43.95  ? 74  MET B CG    1 
ATOM   2975 S  SD    . MET B  1 74  ? 28.775  6.184   25.632 1.00 54.92  ? 74  MET B SD    1 
ATOM   2976 C  CE    . MET B  1 74  ? 29.625  7.653   25.471 1.00 45.29  ? 74  MET B CE    1 
ATOM   2977 N  N     . ASN B  1 75  ? 28.071  8.355   19.736 1.00 50.49  ? 75  ASN B N     1 
ATOM   2978 C  CA    . ASN B  1 75  ? 27.497  9.461   18.974 1.00 46.52  ? 75  ASN B CA    1 
ATOM   2979 C  C     . ASN B  1 75  ? 26.693  8.896   17.794 1.00 48.54  ? 75  ASN B C     1 
ATOM   2980 O  O     . ASN B  1 75  ? 26.975  9.138   16.624 1.00 44.29  ? 75  ASN B O     1 
ATOM   2981 C  CB    . ASN B  1 75  ? 28.604  10.419  18.501 1.00 47.97  ? 75  ASN B CB    1 
ATOM   2982 C  CG    . ASN B  1 75  ? 29.545  9.786   17.504 1.00 53.73  ? 75  ASN B CG    1 
ATOM   2983 O  OD1   . ASN B  1 75  ? 29.646  8.563   17.416 1.00 58.47  ? 75  ASN B OD1   1 
ATOM   2984 N  ND2   . ASN B  1 75  ? 30.251  10.623  16.750 1.00 50.88  ? 75  ASN B ND2   1 
ATOM   2985 N  N     . LYS B  1 76  ? 25.685  8.110   18.135 1.00 43.74  ? 76  LYS B N     1 
ATOM   2986 C  CA    . LYS B  1 76  ? 24.818  7.497   17.149 1.00 44.30  ? 76  LYS B CA    1 
ATOM   2987 C  C     . LYS B  1 76  ? 23.415  7.739   17.687 1.00 39.64  ? 76  LYS B C     1 
ATOM   2988 O  O     . LYS B  1 76  ? 22.995  7.119   18.658 1.00 49.21  ? 76  LYS B O     1 
ATOM   2989 C  CB    . LYS B  1 76  ? 25.137  5.999   17.026 1.00 45.53  ? 76  LYS B CB    1 
ATOM   2990 C  CG    . LYS B  1 76  ? 26.554  5.734   16.507 1.00 56.78  ? 76  LYS B CG    1 
ATOM   2991 C  CD    . LYS B  1 76  ? 26.912  4.251   16.490 1.00 75.67  ? 76  LYS B CD    1 
ATOM   2992 C  CE    . LYS B  1 76  ? 28.379  4.051   16.080 1.00 82.89  ? 76  LYS B CE    1 
ATOM   2993 N  NZ    . LYS B  1 76  ? 28.846  2.632   16.187 1.00 74.20  ? 76  LYS B NZ    1 
ATOM   2994 N  N     . TYR B  1 77  ? 22.708  8.672   17.067 1.00 39.43  ? 77  TYR B N     1 
ATOM   2995 C  CA    . TYR B  1 77  ? 21.376  9.027   17.501 1.00 29.99  ? 77  TYR B CA    1 
ATOM   2996 C  C     . TYR B  1 77  ? 20.372  8.985   16.373 1.00 39.97  ? 77  TYR B C     1 
ATOM   2997 O  O     . TYR B  1 77  ? 20.722  9.174   15.211 1.00 40.91  ? 77  TYR B O     1 
ATOM   2998 C  CB    . TYR B  1 77  ? 21.389  10.432  18.119 1.00 27.03  ? 77  TYR B CB    1 
ATOM   2999 C  CG    . TYR B  1 77  ? 22.020  10.471  19.497 1.00 32.36  ? 77  TYR B CG    1 
ATOM   3000 C  CD1   . TYR B  1 77  ? 23.391  10.695  19.658 1.00 34.76  ? 77  TYR B CD1   1 
ATOM   3001 C  CD2   . TYR B  1 77  ? 21.251  10.200  20.637 1.00 31.07  ? 77  TYR B CD2   1 
ATOM   3002 C  CE1   . TYR B  1 77  ? 23.980  10.645  20.928 1.00 36.77  ? 77  TYR B CE1   1 
ATOM   3003 C  CE2   . TYR B  1 77  ? 21.823  10.139  21.901 1.00 27.06  ? 77  TYR B CE2   1 
ATOM   3004 C  CZ    . TYR B  1 77  ? 23.189  10.364  22.041 1.00 39.71  ? 77  TYR B CZ    1 
ATOM   3005 O  OH    . TYR B  1 77  ? 23.758  10.300  23.288 1.00 39.91  ? 77  TYR B OH    1 
ATOM   3006 N  N     . ASP B  1 78  ? 19.119  8.740   16.735 1.00 23.22  ? 78  ASP B N     1 
ATOM   3007 C  CA    . ASP B  1 78  ? 18.022  8.705   15.785 1.00 35.12  ? 78  ASP B CA    1 
ATOM   3008 C  C     . ASP B  1 78  ? 17.384  10.079  15.700 1.00 37.36  ? 78  ASP B C     1 
ATOM   3009 O  O     . ASP B  1 78  ? 16.890  10.467  14.643 1.00 38.18  ? 78  ASP B O     1 
ATOM   3010 C  CB    . ASP B  1 78  ? 16.992  7.677   16.238 1.00 31.06  ? 78  ASP B CB    1 
ATOM   3011 C  CG    . ASP B  1 78  ? 17.570  6.303   16.293 1.00 36.87  ? 78  ASP B CG    1 
ATOM   3012 O  OD1   . ASP B  1 78  ? 17.993  5.807   15.222 1.00 33.36  ? 78  ASP B OD1   1 
ATOM   3013 O  OD2   . ASP B  1 78  ? 17.623  5.734   17.403 1.00 33.26  ? 78  ASP B OD2   1 
ATOM   3014 N  N     . TYR B  1 79  ? 17.408  10.802  16.825 1.00 33.43  ? 79  TYR B N     1 
ATOM   3015 C  CA    . TYR B  1 79  ? 16.850  12.142  16.915 1.00 26.61  ? 79  TYR B CA    1 
ATOM   3016 C  C     . TYR B  1 79  ? 17.722  13.075  17.724 1.00 36.89  ? 79  TYR B C     1 
ATOM   3017 O  O     . TYR B  1 79  ? 18.468  12.649  18.617 1.00 43.76  ? 79  TYR B O     1 
ATOM   3018 C  CB    . TYR B  1 79  ? 15.493  12.142  17.632 1.00 30.40  ? 79  TYR B CB    1 
ATOM   3019 C  CG    . TYR B  1 79  ? 14.342  11.570  16.876 1.00 36.92  ? 79  TYR B CG    1 
ATOM   3020 C  CD1   . TYR B  1 79  ? 14.126  10.195  16.851 1.00 29.93  ? 79  TYR B CD1   1 
ATOM   3021 C  CD2   . TYR B  1 79  ? 13.466  12.405  16.162 1.00 29.63  ? 79  TYR B CD2   1 
ATOM   3022 C  CE1   . TYR B  1 79  ? 13.073  9.644   16.128 1.00 35.67  ? 79  TYR B CE1   1 
ATOM   3023 C  CE2   . TYR B  1 79  ? 12.406  11.871  15.439 1.00 18.06  ? 79  TYR B CE2   1 
ATOM   3024 C  CZ    . TYR B  1 79  ? 12.218  10.485  15.422 1.00 28.95  ? 79  TYR B CZ    1 
ATOM   3025 O  OH    . TYR B  1 79  ? 11.196  9.919   14.710 1.00 40.47  ? 79  TYR B OH    1 
ATOM   3026 N  N     . VAL B  1 80  ? 17.601  14.357  17.400 1.00 30.58  ? 80  VAL B N     1 
ATOM   3027 C  CA    . VAL B  1 80  ? 18.254  15.422  18.138 1.00 30.63  ? 80  VAL B CA    1 
ATOM   3028 C  C     . VAL B  1 80  ? 17.121  16.416  18.368 1.00 30.11  ? 80  VAL B C     1 
ATOM   3029 O  O     . VAL B  1 80  ? 16.300  16.690  17.475 1.00 30.33  ? 80  VAL B O     1 
ATOM   3030 C  CB    . VAL B  1 80  ? 19.394  16.148  17.386 1.00 28.99  ? 80  VAL B CB    1 
ATOM   3031 C  CG1   . VAL B  1 80  ? 19.803  17.388  18.207 1.00 27.74  ? 80  VAL B CG1   1 
ATOM   3032 C  CG2   . VAL B  1 80  ? 20.611  15.233  17.224 1.00 24.21  ? 80  VAL B CG2   1 
ATOM   3033 N  N     . LEU B  1 81  ? 17.082  16.941  19.582 1.00 31.61  ? 81  LEU B N     1 
ATOM   3034 C  CA    . LEU B  1 81  ? 16.052  17.881  19.983 1.00 31.25  ? 81  LEU B CA    1 
ATOM   3035 C  C     . LEU B  1 81  ? 16.748  19.059  20.682 1.00 38.47  ? 81  LEU B C     1 
ATOM   3036 O  O     . LEU B  1 81  ? 17.542  18.849  21.613 1.00 25.24  ? 81  LEU B O     1 
ATOM   3037 C  CB    . LEU B  1 81  ? 15.099  17.169  20.954 1.00 23.88  ? 81  LEU B CB    1 
ATOM   3038 C  CG    . LEU B  1 81  ? 13.940  17.938  21.602 1.00 37.32  ? 81  LEU B CG    1 
ATOM   3039 C  CD1   . LEU B  1 81  ? 12.925  18.424  20.579 1.00 21.59  ? 81  LEU B CD1   1 
ATOM   3040 C  CD2   . LEU B  1 81  ? 13.281  17.019  22.584 1.00 21.97  ? 81  LEU B CD2   1 
ATOM   3041 N  N     . THR B  1 82  ? 16.485  20.275  20.192 1.00 32.38  ? 82  THR B N     1 
ATOM   3042 C  CA    . THR B  1 82  ? 17.029  21.507  20.773 1.00 31.19  ? 82  THR B CA    1 
ATOM   3043 C  C     . THR B  1 82  ? 15.892  22.498  20.976 1.00 31.12  ? 82  THR B C     1 
ATOM   3044 O  O     . THR B  1 82  ? 14.877  22.459  20.286 1.00 32.58  ? 82  THR B O     1 
ATOM   3045 C  CB    . THR B  1 82  ? 18.129  22.206  19.905 1.00 27.88  ? 82  THR B CB    1 
ATOM   3046 O  OG1   . THR B  1 82  ? 17.574  22.650  18.662 1.00 36.99  ? 82  THR B OG1   1 
ATOM   3047 C  CG2   . THR B  1 82  ? 19.298  21.256  19.640 1.00 26.91  ? 82  THR B CG2   1 
ATOM   3048 N  N     . GLY B  1 83  ? 16.063  23.383  21.939 1.00 35.94  ? 83  GLY B N     1 
ATOM   3049 C  CA    . GLY B  1 83  ? 15.037  24.371  22.205 1.00 25.83  ? 83  GLY B CA    1 
ATOM   3050 C  C     . GLY B  1 83  ? 15.701  25.676  22.570 1.00 39.76  ? 83  GLY B C     1 
ATOM   3051 O  O     . GLY B  1 83  ? 16.685  26.092  21.927 1.00 38.59  ? 83  GLY B O     1 
ATOM   3052 N  N     . TYR B  1 84  ? 15.189  26.314  23.619 1.00 32.27  ? 84  TYR B N     1 
ATOM   3053 C  CA    . TYR B  1 84  ? 15.715  27.588  24.063 1.00 33.35  ? 84  TYR B CA    1 
ATOM   3054 C  C     . TYR B  1 84  ? 17.233  27.567  24.233 1.00 34.01  ? 84  TYR B C     1 
ATOM   3055 O  O     . TYR B  1 84  ? 17.763  26.892  25.111 1.00 40.52  ? 84  TYR B O     1 
ATOM   3056 C  CB    . TYR B  1 84  ? 15.042  28.014  25.365 1.00 28.75  ? 84  TYR B CB    1 
ATOM   3057 C  CG    . TYR B  1 84  ? 15.729  29.190  25.992 1.00 45.73  ? 84  TYR B CG    1 
ATOM   3058 C  CD1   . TYR B  1 84  ? 15.407  30.493  25.627 1.00 45.33  ? 84  TYR B CD1   1 
ATOM   3059 C  CD2   . TYR B  1 84  ? 16.747  28.995  26.925 1.00 50.35  ? 84  TYR B CD2   1 
ATOM   3060 C  CE1   . TYR B  1 84  ? 16.082  31.573  26.182 1.00 54.36  ? 84  TYR B CE1   1 
ATOM   3061 C  CE2   . TYR B  1 84  ? 17.423  30.054  27.477 1.00 51.04  ? 84  TYR B CE2   1 
ATOM   3062 C  CZ    . TYR B  1 84  ? 17.091  31.339  27.109 1.00 49.61  ? 84  TYR B CZ    1 
ATOM   3063 O  OH    . TYR B  1 84  ? 17.775  32.383  27.676 1.00 69.11  ? 84  TYR B OH    1 
ATOM   3064 N  N     . THR B  1 85  ? 17.916  28.310  23.377 1.00 32.13  ? 85  THR B N     1 
ATOM   3065 C  CA    . THR B  1 85  ? 19.384  28.413  23.409 1.00 40.35  ? 85  THR B CA    1 
ATOM   3066 C  C     . THR B  1 85  ? 19.668  29.894  23.572 1.00 37.80  ? 85  THR B C     1 
ATOM   3067 O  O     . THR B  1 85  ? 19.109  30.716  22.859 1.00 50.54  ? 85  THR B O     1 
ATOM   3068 C  CB    . THR B  1 85  ? 20.015  27.937  22.102 1.00 36.34  ? 85  THR B CB    1 
ATOM   3069 O  OG1   . THR B  1 85  ? 19.579  26.599  21.813 1.00 44.36  ? 85  THR B OG1   1 
ATOM   3070 C  CG2   . THR B  1 85  ? 21.525  27.969  22.215 1.00 43.73  ? 85  THR B CG2   1 
ATOM   3071 N  N     . ARG B  1 86  ? 20.539  30.239  24.500 1.00 50.63  ? 86  ARG B N     1 
ATOM   3072 C  CA    . ARG B  1 86  ? 20.794  31.644  24.783 1.00 54.27  ? 86  ARG B CA    1 
ATOM   3073 C  C     . ARG B  1 86  ? 22.030  32.240  24.163 1.00 47.06  ? 86  ARG B C     1 
ATOM   3074 O  O     . ARG B  1 86  ? 22.133  33.448  24.000 1.00 49.27  ? 86  ARG B O     1 
ATOM   3075 C  CB    . ARG B  1 86  ? 20.859  31.832  26.297 1.00 62.51  ? 86  ARG B CB    1 
ATOM   3076 C  CG    . ARG B  1 86  ? 21.728  30.793  26.990 1.00 66.13  ? 86  ARG B CG    1 
ATOM   3077 C  CD    . ARG B  1 86  ? 21.962  31.157  28.440 1.00 84.21  ? 86  ARG B CD    1 
ATOM   3078 N  NE    . ARG B  1 86  ? 22.867  32.298  28.578 1.00 92.54  ? 86  ARG B NE    1 
ATOM   3079 C  CZ    . ARG B  1 86  ? 24.183  32.244  28.373 1.00 83.93  ? 86  ARG B CZ    1 
ATOM   3080 N  NH1   . ARG B  1 86  ? 24.917  33.336  28.523 1.00 70.47  ? 86  ARG B NH1   1 
ATOM   3081 N  NH2   . ARG B  1 86  ? 24.765  31.099  28.031 1.00 74.88  ? 86  ARG B NH2   1 
ATOM   3082 N  N     . ASP B  1 87  ? 22.964  31.389  23.793 1.00 50.44  ? 87  ASP B N     1 
ATOM   3083 C  CA    . ASP B  1 87  ? 24.203  31.892  23.256 1.00 47.78  ? 87  ASP B CA    1 
ATOM   3084 C  C     . ASP B  1 87  ? 24.558  31.422  21.842 1.00 41.25  ? 87  ASP B C     1 
ATOM   3085 O  O     . ASP B  1 87  ? 24.471  30.241  21.507 1.00 35.90  ? 87  ASP B O     1 
ATOM   3086 C  CB    . ASP B  1 87  ? 25.302  31.556  24.269 1.00 43.38  ? 87  ASP B CB    1 
ATOM   3087 C  CG    . ASP B  1 87  ? 26.670  31.802  23.739 1.00 48.61  ? 87  ASP B CG    1 
ATOM   3088 O  OD1   . ASP B  1 87  ? 27.250  30.844  23.193 1.00 44.15  ? 87  ASP B OD1   1 
ATOM   3089 O  OD2   . ASP B  1 87  ? 27.155  32.950  23.865 1.00 67.84  ? 87  ASP B OD2   1 
ATOM   3090 N  N     . LYS B  1 88  ? 24.957  32.389  21.021 1.00 45.24  ? 88  LYS B N     1 
ATOM   3091 C  CA    . LYS B  1 88  ? 25.334  32.171  19.638 1.00 41.65  ? 88  LYS B CA    1 
ATOM   3092 C  C     . LYS B  1 88  ? 26.474  31.159  19.450 1.00 40.70  ? 88  LYS B C     1 
ATOM   3093 O  O     . LYS B  1 88  ? 26.371  30.277  18.601 1.00 41.17  ? 88  LYS B O     1 
ATOM   3094 C  CB    . LYS B  1 88  ? 25.689  33.514  19.017 1.00 32.93  ? 88  LYS B CB    1 
ATOM   3095 C  CG    . LYS B  1 88  ? 26.252  33.435  17.628 1.00 47.43  ? 88  LYS B CG    1 
ATOM   3096 C  CD    . LYS B  1 88  ? 26.738  34.800  17.177 1.00 50.57  ? 88  LYS B CD    1 
ATOM   3097 C  CE    . LYS B  1 88  ? 27.383  34.740  15.797 1.00 63.79  ? 88  LYS B CE    1 
ATOM   3098 N  NZ    . LYS B  1 88  ? 27.836  36.090  15.327 1.00 69.60  ? 88  LYS B NZ    1 
ATOM   3099 N  N     . SER B  1 89  ? 27.559  31.262  20.216 1.00 42.21  ? 89  SER B N     1 
ATOM   3100 C  CA    . SER B  1 89  ? 28.647  30.273  20.060 1.00 46.38  ? 89  SER B CA    1 
ATOM   3101 C  C     . SER B  1 89  ? 28.165  28.881  20.474 1.00 41.52  ? 89  SER B C     1 
ATOM   3102 O  O     . SER B  1 89  ? 28.696  27.867  20.024 1.00 39.52  ? 89  SER B O     1 
ATOM   3103 C  CB    . SER B  1 89  ? 29.893  30.639  20.889 1.00 39.04  ? 89  SER B CB    1 
ATOM   3104 O  OG    . SER B  1 89  ? 29.657  30.578  22.283 1.00 47.83  ? 89  SER B OG    1 
ATOM   3105 N  N     . PHE B  1 90  ? 27.161  28.844  21.344 1.00 38.57  ? 90  PHE B N     1 
ATOM   3106 C  CA    . PHE B  1 90  ? 26.606  27.581  21.805 1.00 39.51  ? 90  PHE B CA    1 
ATOM   3107 C  C     . PHE B  1 90  ? 25.820  26.999  20.628 1.00 35.77  ? 90  PHE B C     1 
ATOM   3108 O  O     . PHE B  1 90  ? 26.032  25.857  20.221 1.00 34.24  ? 90  PHE B O     1 
ATOM   3109 C  CB    . PHE B  1 90  ? 25.680  27.808  23.016 1.00 36.50  ? 90  PHE B CB    1 
ATOM   3110 C  CG    . PHE B  1 90  ? 25.333  26.538  23.750 1.00 44.75  ? 90  PHE B CG    1 
ATOM   3111 C  CD1   . PHE B  1 90  ? 26.103  26.103  24.833 1.00 38.43  ? 90  PHE B CD1   1 
ATOM   3112 C  CD2   . PHE B  1 90  ? 24.254  25.762  23.346 1.00 31.77  ? 90  PHE B CD2   1 
ATOM   3113 C  CE1   . PHE B  1 90  ? 25.798  24.925  25.496 1.00 41.34  ? 90  PHE B CE1   1 
ATOM   3114 C  CE2   . PHE B  1 90  ? 23.937  24.578  24.003 1.00 35.77  ? 90  PHE B CE2   1 
ATOM   3115 C  CZ    . PHE B  1 90  ? 24.707  24.156  25.081 1.00 44.21  ? 90  PHE B CZ    1 
ATOM   3116 N  N     . LEU B  1 91  ? 24.914  27.805  20.089 1.00 36.89  ? 91  LEU B N     1 
ATOM   3117 C  CA    . LEU B  1 91  ? 24.098  27.414  18.945 1.00 36.35  ? 91  LEU B CA    1 
ATOM   3118 C  C     . LEU B  1 91  ? 24.976  26.944  17.774 1.00 40.71  ? 91  LEU B C     1 
ATOM   3119 O  O     . LEU B  1 91  ? 24.654  25.979  17.089 1.00 41.83  ? 91  LEU B O     1 
ATOM   3120 C  CB    . LEU B  1 91  ? 23.251  28.600  18.513 1.00 39.26  ? 91  LEU B CB    1 
ATOM   3121 C  CG    . LEU B  1 91  ? 22.101  28.338  17.552 1.00 38.88  ? 91  LEU B CG    1 
ATOM   3122 C  CD1   . LEU B  1 91  ? 21.179  27.266  18.129 1.00 42.45  ? 91  LEU B CD1   1 
ATOM   3123 C  CD2   . LEU B  1 91  ? 21.345  29.631  17.334 1.00 28.93  ? 91  LEU B CD2   1 
ATOM   3124 N  N     . ALA B  1 92  ? 26.088  27.624  17.533 1.00 43.88  ? 92  ALA B N     1 
ATOM   3125 C  CA    . ALA B  1 92  ? 26.978  27.206  16.456 1.00 36.28  ? 92  ALA B CA    1 
ATOM   3126 C  C     . ALA B  1 92  ? 27.587  25.848  16.799 1.00 36.30  ? 92  ALA B C     1 
ATOM   3127 O  O     . ALA B  1 92  ? 27.810  25.017  15.912 1.00 41.32  ? 92  ALA B O     1 
ATOM   3128 C  CB    . ALA B  1 92  ? 28.078  28.226  16.257 1.00 37.99  ? 92  ALA B CB    1 
ATOM   3129 N  N     . MET B  1 93  ? 27.870  25.623  18.082 1.00 34.12  ? 93  MET B N     1 
ATOM   3130 C  CA    . MET B  1 93  ? 28.445  24.340  18.510 1.00 34.32  ? 93  MET B CA    1 
ATOM   3131 C  C     . MET B  1 93  ? 27.388  23.237  18.332 1.00 37.00  ? 93  MET B C     1 
ATOM   3132 O  O     . MET B  1 93  ? 27.703  22.115  17.910 1.00 32.19  ? 93  MET B O     1 
ATOM   3133 C  CB    . MET B  1 93  ? 28.914  24.414  19.973 1.00 35.09  ? 93  MET B CB    1 
ATOM   3134 C  CG    . MET B  1 93  ? 29.556  23.128  20.469 1.00 32.97  ? 93  MET B CG    1 
ATOM   3135 S  SD    . MET B  1 93  ? 30.750  22.438  19.274 1.00 43.59  ? 93  MET B SD    1 
ATOM   3136 C  CE    . MET B  1 93  ? 32.152  23.577  19.491 1.00 36.68  ? 93  MET B CE    1 
ATOM   3137 N  N     . VAL B  1 94  ? 26.131  23.578  18.629 1.00 38.33  ? 94  VAL B N     1 
ATOM   3138 C  CA    . VAL B  1 94  ? 25.022  22.644  18.481 1.00 32.50  ? 94  VAL B CA    1 
ATOM   3139 C  C     . VAL B  1 94  ? 24.912  22.289  17.004 1.00 37.65  ? 94  VAL B C     1 
ATOM   3140 O  O     . VAL B  1 94  ? 24.700  21.123  16.654 1.00 36.57  ? 94  VAL B O     1 
ATOM   3141 C  CB    . VAL B  1 94  ? 23.666  23.257  18.932 1.00 33.67  ? 94  VAL B CB    1 
ATOM   3142 C  CG1   . VAL B  1 94  ? 22.528  22.422  18.370 1.00 29.40  ? 94  VAL B CG1   1 
ATOM   3143 C  CG2   . VAL B  1 94  ? 23.583  23.320  20.457 1.00 20.23  ? 94  VAL B CG2   1 
ATOM   3144 N  N     . VAL B  1 95  ? 25.075  23.290  16.140 1.00 40.79  ? 95  VAL B N     1 
ATOM   3145 C  CA    . VAL B  1 95  ? 24.994  23.053  14.703 1.00 37.79  ? 95  VAL B CA    1 
ATOM   3146 C  C     . VAL B  1 95  ? 26.070  22.074  14.251 1.00 40.19  ? 95  VAL B C     1 
ATOM   3147 O  O     . VAL B  1 95  ? 25.778  21.142  13.503 1.00 43.85  ? 95  VAL B O     1 
ATOM   3148 C  CB    . VAL B  1 95  ? 25.113  24.371  13.878 1.00 36.30  ? 95  VAL B CB    1 
ATOM   3149 C  CG1   . VAL B  1 95  ? 25.397  24.051  12.422 1.00 27.13  ? 95  VAL B CG1   1 
ATOM   3150 C  CG2   . VAL B  1 95  ? 23.820  25.164  13.975 1.00 33.13  ? 95  VAL B CG2   1 
ATOM   3151 N  N     . ASP B  1 96  ? 27.312  22.276  14.689 1.00 38.25  ? 96  ASP B N     1 
ATOM   3152 C  CA    . ASP B  1 96  ? 28.391  21.368  14.301 1.00 40.32  ? 96  ASP B CA    1 
ATOM   3153 C  C     . ASP B  1 96  ? 28.125  19.953  14.803 1.00 46.51  ? 96  ASP B C     1 
ATOM   3154 O  O     . ASP B  1 96  ? 28.453  18.964  14.141 1.00 46.44  ? 96  ASP B O     1 
ATOM   3155 C  CB    . ASP B  1 96  ? 29.736  21.841  14.861 1.00 41.85  ? 96  ASP B CB    1 
ATOM   3156 C  CG    . ASP B  1 96  ? 30.163  23.181  14.296 1.00 57.62  ? 96  ASP B CG    1 
ATOM   3157 O  OD1   . ASP B  1 96  ? 29.990  23.402  13.075 1.00 58.77  ? 96  ASP B OD1   1 
ATOM   3158 O  OD2   . ASP B  1 96  ? 30.678  24.010  15.072 1.00 60.81  ? 96  ASP B OD2   1 
ATOM   3159 N  N     . ILE B  1 97  ? 27.519  19.855  15.981 1.00 40.73  ? 97  ILE B N     1 
ATOM   3160 C  CA    . ILE B  1 97  ? 27.243  18.550  16.536 1.00 37.44  ? 97  ILE B CA    1 
ATOM   3161 C  C     . ILE B  1 97  ? 26.192  17.830  15.701 1.00 35.66  ? 97  ILE B C     1 
ATOM   3162 O  O     . ILE B  1 97  ? 26.380  16.673  15.337 1.00 34.14  ? 97  ILE B O     1 
ATOM   3163 C  CB    . ILE B  1 97  ? 26.829  18.672  18.039 1.00 34.93  ? 97  ILE B CB    1 
ATOM   3164 C  CG1   . ILE B  1 97  ? 28.064  19.114  18.853 1.00 45.85  ? 97  ILE B CG1   1 
ATOM   3165 C  CG2   . ILE B  1 97  ? 26.297  17.340  18.564 1.00 23.63  ? 97  ILE B CG2   1 
ATOM   3166 C  CD1   . ILE B  1 97  ? 27.831  19.380  20.339 1.00 34.61  ? 97  ILE B CD1   1 
ATOM   3167 N  N     . VAL B  1 98  ? 25.092  18.511  15.396 1.00 36.91  ? 98  VAL B N     1 
ATOM   3168 C  CA    . VAL B  1 98  ? 24.039  17.908  14.590 1.00 31.77  ? 98  VAL B CA    1 
ATOM   3169 C  C     . VAL B  1 98  ? 24.574  17.479  13.219 1.00 36.89  ? 98  VAL B C     1 
ATOM   3170 O  O     . VAL B  1 98  ? 24.132  16.480  12.666 1.00 33.64  ? 98  VAL B O     1 
ATOM   3171 C  CB    . VAL B  1 98  ? 22.858  18.892  14.382 1.00 35.73  ? 98  VAL B CB    1 
ATOM   3172 C  CG1   . VAL B  1 98  ? 21.906  18.358  13.305 1.00 29.97  ? 98  VAL B CG1   1 
ATOM   3173 C  CG2   . VAL B  1 98  ? 22.107  19.096  15.712 1.00 30.62  ? 98  VAL B CG2   1 
ATOM   3174 N  N     . GLN B  1 99  ? 25.533  18.226  12.665 1.00 42.45  ? 99  GLN B N     1 
ATOM   3175 C  CA    . GLN B  1 99  ? 26.062  17.853  11.360 1.00 41.80  ? 99  GLN B CA    1 
ATOM   3176 C  C     . GLN B  1 99  ? 26.791  16.533  11.448 1.00 32.49  ? 99  GLN B C     1 
ATOM   3177 O  O     . GLN B  1 99  ? 26.540  15.620  10.665 1.00 44.89  ? 99  GLN B O     1 
ATOM   3178 C  CB    . GLN B  1 99  ? 26.997  18.933  10.799 1.00 39.56  ? 99  GLN B CB    1 
ATOM   3179 C  CG    . GLN B  1 99  ? 26.295  20.245  10.523 1.00 53.88  ? 99  GLN B CG    1 
ATOM   3180 C  CD    . GLN B  1 99  ? 27.186  21.283  9.863  1.00 65.08  ? 99  GLN B CD    1 
ATOM   3181 O  OE1   . GLN B  1 99  ? 28.334  21.487  10.265 1.00 80.43  ? 99  GLN B OE1   1 
ATOM   3182 N  NE2   . GLN B  1 99  ? 26.651  21.964  8.856  1.00 69.07  ? 99  GLN B NE2   1 
ATOM   3183 N  N     . GLU B  1 100 ? 27.689  16.411  12.414 1.00 49.27  ? 100 GLU B N     1 
ATOM   3184 C  CA    . GLU B  1 100 ? 28.435  15.176  12.555 1.00 44.33  ? 100 GLU B CA    1 
ATOM   3185 C  C     . GLU B  1 100 ? 27.508  14.002  12.853 1.00 46.28  ? 100 GLU B C     1 
ATOM   3186 O  O     . GLU B  1 100 ? 27.697  12.911  12.322 1.00 46.24  ? 100 GLU B O     1 
ATOM   3187 C  CB    . GLU B  1 100 ? 29.496  15.314  13.636 1.00 51.53  ? 100 GLU B CB    1 
ATOM   3188 C  CG    . GLU B  1 100 ? 30.747  14.513  13.302 1.00 72.05  ? 100 GLU B CG    1 
ATOM   3189 C  CD    . GLU B  1 100 ? 31.822  14.640  14.351 1.00 82.68  ? 100 GLU B CD    1 
ATOM   3190 O  OE1   . GLU B  1 100 ? 32.616  15.606  14.268 1.00 93.37  ? 100 GLU B OE1   1 
ATOM   3191 O  OE2   . GLU B  1 100 ? 31.861  13.777  15.262 1.00 75.00  ? 100 GLU B OE2   1 
ATOM   3192 N  N     . LEU B  1 101 ? 26.493  14.223  13.684 1.00 43.04  ? 101 LEU B N     1 
ATOM   3193 C  CA    . LEU B  1 101 ? 25.554  13.156  13.998 1.00 30.39  ? 101 LEU B CA    1 
ATOM   3194 C  C     . LEU B  1 101 ? 24.815  12.735  12.732 1.00 32.02  ? 101 LEU B C     1 
ATOM   3195 O  O     . LEU B  1 101 ? 24.601  11.551  12.496 1.00 42.75  ? 101 LEU B O     1 
ATOM   3196 C  CB    . LEU B  1 101 ? 24.565  13.604  15.090 1.00 36.08  ? 101 LEU B CB    1 
ATOM   3197 C  CG    . LEU B  1 101 ? 25.158  13.786  16.507 1.00 45.10  ? 101 LEU B CG    1 
ATOM   3198 C  CD1   . LEU B  1 101 ? 24.116  14.362  17.500 1.00 34.48  ? 101 LEU B CD1   1 
ATOM   3199 C  CD2   . LEU B  1 101 ? 25.669  12.436  17.000 1.00 36.64  ? 101 LEU B CD2   1 
ATOM   3200 N  N     . LYS B  1 102 ? 24.429  13.701  11.908 1.00 37.50  ? 102 LYS B N     1 
ATOM   3201 C  CA    . LYS B  1 102 ? 23.729  13.380  10.677 1.00 41.66  ? 102 LYS B CA    1 
ATOM   3202 C  C     . LYS B  1 102 ? 24.647  12.599  9.735  1.00 48.35  ? 102 LYS B C     1 
ATOM   3203 O  O     . LYS B  1 102 ? 24.188  11.797  8.920  1.00 45.76  ? 102 LYS B O     1 
ATOM   3204 C  CB    . LYS B  1 102 ? 23.238  14.656  9.990  1.00 38.69  ? 102 LYS B CB    1 
ATOM   3205 C  CG    . LYS B  1 102 ? 21.864  15.121  10.456 1.00 47.27  ? 102 LYS B CG    1 
ATOM   3206 C  CD    . LYS B  1 102 ? 21.428  16.380  9.707  1.00 56.26  ? 102 LYS B CD    1 
ATOM   3207 C  CE    . LYS B  1 102 ? 20.018  16.852  10.106 1.00 55.45  ? 102 LYS B CE    1 
ATOM   3208 N  NZ    . LYS B  1 102 ? 18.913  16.045  9.507  1.00 35.13  ? 102 LYS B NZ    1 
ATOM   3209 N  N     . GLN B  1 103 ? 25.944  12.839  9.850  1.00 49.80  ? 103 GLN B N     1 
ATOM   3210 C  CA    . GLN B  1 103 ? 26.914  12.151  9.018  1.00 44.23  ? 103 GLN B CA    1 
ATOM   3211 C  C     . GLN B  1 103 ? 27.057  10.736  9.538  1.00 49.43  ? 103 GLN B C     1 
ATOM   3212 O  O     . GLN B  1 103 ? 27.212  9.789   8.774  1.00 54.61  ? 103 GLN B O     1 
ATOM   3213 C  CB    . GLN B  1 103 ? 28.237  12.892  9.078  1.00 61.78  ? 103 GLN B CB    1 
ATOM   3214 C  CG    . GLN B  1 103 ? 29.435  12.077  8.684  1.00 81.96  ? 103 GLN B CG    1 
ATOM   3215 C  CD    . GLN B  1 103 ? 30.662  12.948  8.530  1.00 96.57  ? 103 GLN B CD    1 
ATOM   3216 O  OE1   . GLN B  1 103 ? 31.746  12.610  9.005  1.00 100.00 ? 103 GLN B OE1   1 
ATOM   3217 N  NE2   . GLN B  1 103 ? 30.496  14.088  7.859  1.00 96.01  ? 103 GLN B NE2   1 
ATOM   3218 N  N     . GLN B  1 104 ? 27.009  10.598  10.854 1.00 46.97  ? 104 GLN B N     1 
ATOM   3219 C  CA    . GLN B  1 104 ? 27.081  9.289   11.475 1.00 42.81  ? 104 GLN B CA    1 
ATOM   3220 C  C     . GLN B  1 104 ? 25.817  8.511   11.149 1.00 49.93  ? 104 GLN B C     1 
ATOM   3221 O  O     . GLN B  1 104 ? 25.856  7.289   11.045 1.00 55.64  ? 104 GLN B O     1 
ATOM   3222 C  CB    . GLN B  1 104 ? 27.199  9.425   12.994 1.00 48.65  ? 104 GLN B CB    1 
ATOM   3223 C  CG    . GLN B  1 104 ? 28.595  9.712   13.459 1.00 65.85  ? 104 GLN B CG    1 
ATOM   3224 C  CD    . GLN B  1 104 ? 29.518  8.532   13.235 1.00 75.95  ? 104 GLN B CD    1 
ATOM   3225 O  OE1   . GLN B  1 104 ? 30.735  8.651   13.357 1.00 89.47  ? 104 GLN B OE1   1 
ATOM   3226 N  NE2   . GLN B  1 104 ? 28.937  7.378   12.915 1.00 79.17  ? 104 GLN B NE2   1 
ATOM   3227 N  N     . ASN B  1 105 ? 24.698  9.225   11.007 1.00 42.29  ? 105 ASN B N     1 
ATOM   3228 C  CA    . ASN B  1 105 ? 23.412  8.606   10.702 1.00 42.51  ? 105 ASN B CA    1 
ATOM   3229 C  C     . ASN B  1 105 ? 22.541  9.522   9.865  1.00 44.54  ? 105 ASN B C     1 
ATOM   3230 O  O     . ASN B  1 105 ? 21.861  10.411  10.379 1.00 49.98  ? 105 ASN B O     1 
ATOM   3231 C  CB    . ASN B  1 105 ? 22.669  8.220   11.988 1.00 32.72  ? 105 ASN B CB    1 
ATOM   3232 C  CG    . ASN B  1 105 ? 21.254  7.755   11.711 1.00 42.38  ? 105 ASN B CG    1 
ATOM   3233 O  OD1   . ASN B  1 105 ? 20.959  7.296   10.617 1.00 49.68  ? 105 ASN B OD1   1 
ATOM   3234 N  ND2   . ASN B  1 105 ? 20.375  7.866   12.703 1.00 33.98  ? 105 ASN B ND2   1 
ATOM   3235 N  N     . PRO B  1 106 ? 22.529  9.293   8.548  1.00 46.55  ? 106 PRO B N     1 
ATOM   3236 C  CA    . PRO B  1 106 ? 21.749  10.102  7.616  1.00 47.38  ? 106 PRO B CA    1 
ATOM   3237 C  C     . PRO B  1 106 ? 20.238  10.079  7.853  1.00 38.55  ? 106 PRO B C     1 
ATOM   3238 O  O     . PRO B  1 106 ? 19.513  10.916  7.321  1.00 47.35  ? 106 PRO B O     1 
ATOM   3239 C  CB    . PRO B  1 106 ? 22.140  9.523   6.253  1.00 53.25  ? 106 PRO B CB    1 
ATOM   3240 C  CG    . PRO B  1 106 ? 23.514  8.952   6.498  1.00 38.37  ? 106 PRO B CG    1 
ATOM   3241 C  CD    . PRO B  1 106 ? 23.305  8.279   7.820  1.00 49.89  ? 106 PRO B CD    1 
ATOM   3242 N  N     . ARG B  1 107 ? 19.759  9.148   8.663  1.00 32.71  ? 107 ARG B N     1 
ATOM   3243 C  CA    . ARG B  1 107 ? 18.322  9.081   8.905  1.00 36.55  ? 107 ARG B CA    1 
ATOM   3244 C  C     . ARG B  1 107 ? 17.958  9.857   10.153 1.00 32.33  ? 107 ARG B C     1 
ATOM   3245 O  O     . ARG B  1 107 ? 16.791  9.933   10.541 1.00 39.73  ? 107 ARG B O     1 
ATOM   3246 C  CB    . ARG B  1 107 ? 17.867  7.616   9.020  1.00 34.84  ? 107 ARG B CB    1 
ATOM   3247 C  CG    . ARG B  1 107 ? 17.880  6.882   7.676  1.00 53.36  ? 107 ARG B CG    1 
ATOM   3248 C  CD    . ARG B  1 107 ? 17.660  5.383   7.804  1.00 60.43  ? 107 ARG B CD    1 
ATOM   3249 N  NE    . ARG B  1 107 ? 18.806  4.708   8.414  1.00 95.49  ? 107 ARG B NE    1 
ATOM   3250 C  CZ    . ARG B  1 107 ? 19.020  4.617   9.727  1.00 100.00 ? 107 ARG B CZ    1 
ATOM   3251 N  NH1   . ARG B  1 107 ? 18.158  5.155   10.582 1.00 100.00 ? 107 ARG B NH1   1 
ATOM   3252 N  NH2   . ARG B  1 107 ? 20.103  3.995   10.184 1.00 100.00 ? 107 ARG B NH2   1 
ATOM   3253 N  N     . LEU B  1 108 ? 18.964  10.445  10.780 1.00 26.28  ? 108 LEU B N     1 
ATOM   3254 C  CA    . LEU B  1 108 ? 18.723  11.220  11.981 1.00 33.17  ? 108 LEU B CA    1 
ATOM   3255 C  C     . LEU B  1 108 ? 17.737  12.352  11.724 1.00 37.09  ? 108 LEU B C     1 
ATOM   3256 O  O     . LEU B  1 108 ? 17.832  13.088  10.742 1.00 36.92  ? 108 LEU B O     1 
ATOM   3257 C  CB    . LEU B  1 108 ? 20.038  11.795  12.527 1.00 33.44  ? 108 LEU B CB    1 
ATOM   3258 C  CG    . LEU B  1 108 ? 19.875  12.645  13.783 1.00 32.22  ? 108 LEU B CG    1 
ATOM   3259 C  CD1   . LEU B  1 108 ? 21.039  12.414  14.732 1.00 41.29  ? 108 LEU B CD1   1 
ATOM   3260 C  CD2   . LEU B  1 108 ? 19.757  14.107  13.380 1.00 34.08  ? 108 LEU B CD2   1 
ATOM   3261 N  N     . VAL B  1 109 ? 16.780  12.485  12.625 1.00 32.67  ? 109 VAL B N     1 
ATOM   3262 C  CA    . VAL B  1 109 ? 15.784  13.530  12.495 1.00 37.50  ? 109 VAL B CA    1 
ATOM   3263 C  C     . VAL B  1 109 ? 16.108  14.636  13.505 1.00 33.14  ? 109 VAL B C     1 
ATOM   3264 O  O     . VAL B  1 109 ? 16.186  14.373  14.709 1.00 31.78  ? 109 VAL B O     1 
ATOM   3265 C  CB    . VAL B  1 109 ? 14.385  12.960  12.780 1.00 37.32  ? 109 VAL B CB    1 
ATOM   3266 C  CG1   . VAL B  1 109 ? 13.375  14.078  12.830 1.00 23.51  ? 109 VAL B CG1   1 
ATOM   3267 C  CG2   . VAL B  1 109 ? 14.014  11.908  11.715 1.00 28.93  ? 109 VAL B CG2   1 
ATOM   3268 N  N     . TYR B  1 110 ? 16.313  15.857  13.023 1.00 32.03  ? 110 TYR B N     1 
ATOM   3269 C  CA    . TYR B  1 110 ? 16.607  16.984  13.915 1.00 26.79  ? 110 TYR B CA    1 
ATOM   3270 C  C     . TYR B  1 110 ? 15.321  17.759  14.170 1.00 26.17  ? 110 TYR B C     1 
ATOM   3271 O  O     . TYR B  1 110 ? 14.779  18.371  13.261 1.00 29.44  ? 110 TYR B O     1 
ATOM   3272 C  CB    . TYR B  1 110 ? 17.658  17.915  13.296 1.00 26.79  ? 110 TYR B CB    1 
ATOM   3273 C  CG    . TYR B  1 110 ? 18.038  19.115  14.155 1.00 26.63  ? 110 TYR B CG    1 
ATOM   3274 C  CD1   . TYR B  1 110 ? 18.577  20.272  13.574 1.00 25.65  ? 110 TYR B CD1   1 
ATOM   3275 C  CD2   . TYR B  1 110 ? 17.780  19.132  15.526 1.00 42.40  ? 110 TYR B CD2   1 
ATOM   3276 C  CE1   . TYR B  1 110 ? 18.832  21.430  14.338 1.00 27.09  ? 110 TYR B CE1   1 
ATOM   3277 C  CE2   . TYR B  1 110 ? 18.035  20.277  16.306 1.00 32.99  ? 110 TYR B CE2   1 
ATOM   3278 C  CZ    . TYR B  1 110 ? 18.549  21.422  15.705 1.00 28.57  ? 110 TYR B CZ    1 
ATOM   3279 O  OH    . TYR B  1 110 ? 18.708  22.553  16.459 1.00 27.69  ? 110 TYR B OH    1 
ATOM   3280 N  N     . VAL B  1 111 ? 14.833  17.706  15.411 1.00 31.28  ? 111 VAL B N     1 
ATOM   3281 C  CA    . VAL B  1 111 ? 13.622  18.418  15.806 1.00 27.70  ? 111 VAL B CA    1 
ATOM   3282 C  C     . VAL B  1 111 ? 14.115  19.695  16.472 1.00 33.87  ? 111 VAL B C     1 
ATOM   3283 O  O     . VAL B  1 111 ? 14.738  19.661  17.545 1.00 31.55  ? 111 VAL B O     1 
ATOM   3284 C  CB    . VAL B  1 111 ? 12.783  17.590  16.817 1.00 28.82  ? 111 VAL B CB    1 
ATOM   3285 C  CG1   . VAL B  1 111 ? 11.591  18.394  17.305 1.00 21.53  ? 111 VAL B CG1   1 
ATOM   3286 C  CG2   . VAL B  1 111 ? 12.341  16.262  16.170 1.00 22.25  ? 111 VAL B CG2   1 
ATOM   3287 N  N     . CYS B  1 112 ? 13.860  20.824  15.821 1.00 27.92  ? 112 CYS B N     1 
ATOM   3288 C  CA    . CYS B  1 112 ? 14.308  22.104  16.343 1.00 29.75  ? 112 CYS B CA    1 
ATOM   3289 C  C     . CYS B  1 112 ? 13.234  23.081  16.731 1.00 26.11  ? 112 CYS B C     1 
ATOM   3290 O  O     . CYS B  1 112 ? 12.409  23.486  15.908 1.00 33.29  ? 112 CYS B O     1 
ATOM   3291 C  CB    . CYS B  1 112 ? 15.252  22.787  15.336 1.00 28.76  ? 112 CYS B CB    1 
ATOM   3292 S  SG    . CYS B  1 112 ? 15.476  24.597  15.537 1.00 33.08  ? 112 CYS B SG    1 
ATOM   3293 N  N     . ASP B  1 113 ? 13.238  23.465  17.999 1.00 30.72  ? 113 ASP B N     1 
ATOM   3294 C  CA    . ASP B  1 113 ? 12.322  24.492  18.441 1.00 34.52  ? 113 ASP B CA    1 
ATOM   3295 C  C     . ASP B  1 113 ? 13.201  25.747  18.371 1.00 30.30  ? 113 ASP B C     1 
ATOM   3296 O  O     . ASP B  1 113 ? 14.126  25.908  19.176 1.00 33.51  ? 113 ASP B O     1 
ATOM   3297 C  CB    . ASP B  1 113 ? 11.852  24.244  19.861 1.00 38.47  ? 113 ASP B CB    1 
ATOM   3298 C  CG    . ASP B  1 113 ? 10.795  25.238  20.297 1.00 41.14  ? 113 ASP B CG    1 
ATOM   3299 O  OD1   . ASP B  1 113 ? 10.309  25.105  21.434 1.00 30.98  ? 113 ASP B OD1   1 
ATOM   3300 O  OD2   . ASP B  1 113 ? 10.456  26.153  19.515 1.00 42.44  ? 113 ASP B OD2   1 
ATOM   3301 N  N     . PRO B  1 114 ? 12.954  26.633  17.373 1.00 30.11  ? 114 PRO B N     1 
ATOM   3302 C  CA    . PRO B  1 114 ? 13.718  27.870  17.168 1.00 35.02  ? 114 PRO B CA    1 
ATOM   3303 C  C     . PRO B  1 114 ? 13.221  28.975  18.122 1.00 37.19  ? 114 PRO B C     1 
ATOM   3304 O  O     . PRO B  1 114 ? 12.563  29.926  17.702 1.00 34.94  ? 114 PRO B O     1 
ATOM   3305 C  CB    . PRO B  1 114 ? 13.445  28.189  15.688 1.00 21.33  ? 114 PRO B CB    1 
ATOM   3306 C  CG    . PRO B  1 114 ? 11.998  27.817  15.568 1.00 37.13  ? 114 PRO B CG    1 
ATOM   3307 C  CD    . PRO B  1 114 ? 11.873  26.516  16.369 1.00 33.80  ? 114 PRO B CD    1 
ATOM   3308 N  N     . VAL B  1 115 ? 13.558  28.839  19.399 1.00 29.34  ? 115 VAL B N     1 
ATOM   3309 C  CA    . VAL B  1 115 ? 13.110  29.780  20.410 1.00 32.63  ? 115 VAL B CA    1 
ATOM   3310 C  C     . VAL B  1 115 ? 13.763  31.147  20.243 1.00 33.50  ? 115 VAL B C     1 
ATOM   3311 O  O     . VAL B  1 115 ? 14.985  31.305  20.390 1.00 34.09  ? 115 VAL B O     1 
ATOM   3312 C  CB    . VAL B  1 115 ? 13.369  29.204  21.817 1.00 39.66  ? 115 VAL B CB    1 
ATOM   3313 C  CG1   . VAL B  1 115 ? 12.982  30.230  22.905 1.00 30.41  ? 115 VAL B CG1   1 
ATOM   3314 C  CG2   . VAL B  1 115 ? 12.568  27.895  21.986 1.00 23.95  ? 115 VAL B CG2   1 
ATOM   3315 N  N     . LEU B  1 116 ? 12.939  32.136  19.907 1.00 30.39  ? 116 LEU B N     1 
ATOM   3316 C  CA    . LEU B  1 116 ? 13.427  33.490  19.687 1.00 31.34  ? 116 LEU B CA    1 
ATOM   3317 C  C     . LEU B  1 116 ? 12.696  34.532  20.513 1.00 32.15  ? 116 LEU B C     1 
ATOM   3318 O  O     . LEU B  1 116 ? 13.292  35.516  20.922 1.00 34.36  ? 116 LEU B O     1 
ATOM   3319 C  CB    . LEU B  1 116 ? 13.322  33.869  18.210 1.00 28.95  ? 116 LEU B CB    1 
ATOM   3320 C  CG    . LEU B  1 116 ? 14.145  33.043  17.232 1.00 41.22  ? 116 LEU B CG    1 
ATOM   3321 C  CD1   . LEU B  1 116 ? 13.613  33.225  15.807 1.00 31.40  ? 116 LEU B CD1   1 
ATOM   3322 C  CD2   . LEU B  1 116 ? 15.598  33.444  17.359 1.00 39.77  ? 116 LEU B CD2   1 
ATOM   3323 N  N     . GLY B  1 117 ? 11.404  34.311  20.767 1.00 32.45  ? 117 GLY B N     1 
ATOM   3324 C  CA    . GLY B  1 117 ? 10.634  35.281  21.516 1.00 24.44  ? 117 GLY B CA    1 
ATOM   3325 C  C     . GLY B  1 117 ? 9.163   34.931  21.440 1.00 32.57  ? 117 GLY B C     1 
ATOM   3326 O  O     . GLY B  1 117 ? 8.828   33.808  21.109 1.00 34.98  ? 117 GLY B O     1 
ATOM   3327 N  N     . ASP B  1 118 ? 8.284   35.878  21.738 1.00 31.01  ? 118 ASP B N     1 
ATOM   3328 C  CA    . ASP B  1 118 ? 6.865   35.592  21.681 1.00 37.07  ? 118 ASP B CA    1 
ATOM   3329 C  C     . ASP B  1 118 ? 6.118   36.924  21.676 1.00 44.43  ? 118 ASP B C     1 
ATOM   3330 O  O     . ASP B  1 118 ? 6.739   37.985  21.688 1.00 50.98  ? 118 ASP B O     1 
ATOM   3331 C  CB    . ASP B  1 118 ? 6.482   34.779  22.903 1.00 38.33  ? 118 ASP B CB    1 
ATOM   3332 C  CG    . ASP B  1 118 ? 5.300   33.879  22.672 1.00 40.51  ? 118 ASP B CG    1 
ATOM   3333 O  OD1   . ASP B  1 118 ? 4.419   34.185  21.833 1.00 38.56  ? 118 ASP B OD1   1 
ATOM   3334 O  OD2   . ASP B  1 118 ? 5.257   32.849  23.376 1.00 39.90  ? 118 ASP B OD2   1 
ATOM   3335 N  N     . LYS B  1 119 ? 4.790   36.849  21.671 1.00 52.48  ? 119 LYS B N     1 
ATOM   3336 C  CA    . LYS B  1 119 ? 3.932   38.020  21.654 1.00 49.28  ? 119 LYS B CA    1 
ATOM   3337 C  C     . LYS B  1 119 ? 3.191   38.117  22.964 1.00 55.69  ? 119 LYS B C     1 
ATOM   3338 O  O     . LYS B  1 119 ? 2.583   37.144  23.404 1.00 55.54  ? 119 LYS B O     1 
ATOM   3339 C  CB    . LYS B  1 119 ? 2.918   37.911  20.513 1.00 47.58  ? 119 LYS B CB    1 
ATOM   3340 C  CG    . LYS B  1 119 ? 3.542   37.703  19.136 1.00 68.60  ? 119 LYS B CG    1 
ATOM   3341 C  CD    . LYS B  1 119 ? 2.515   37.280  18.084 1.00 76.60  ? 119 LYS B CD    1 
ATOM   3342 C  CE    . LYS B  1 119 ? 1.610   38.435  17.677 1.00 90.20  ? 119 LYS B CE    1 
ATOM   3343 N  NZ    . LYS B  1 119 ? 0.759   38.945  18.795 1.00 97.65  ? 119 LYS B NZ    1 
ATOM   3344 N  N     . TRP B  1 120 ? 3.260   39.290  23.588 1.00 69.09  ? 120 TRP B N     1 
ATOM   3345 C  CA    . TRP B  1 120 ? 2.571   39.544  24.850 1.00 74.96  ? 120 TRP B CA    1 
ATOM   3346 C  C     . TRP B  1 120 ? 1.443   40.499  24.513 1.00 85.31  ? 120 TRP B C     1 
ATOM   3347 O  O     . TRP B  1 120 ? 1.637   41.712  24.316 1.00 83.04  ? 120 TRP B O     1 
ATOM   3348 C  CB    . TRP B  1 120 ? 3.545   40.129  25.873 1.00 82.18  ? 120 TRP B CB    1 
ATOM   3349 C  CG    . TRP B  1 120 ? 4.528   39.072  26.339 1.00 96.74  ? 120 TRP B CG    1 
ATOM   3350 C  CD1   . TRP B  1 120 ? 4.317   38.122  27.306 1.00 100.00 ? 120 TRP B CD1   1 
ATOM   3351 C  CD2   . TRP B  1 120 ? 5.810   38.769  25.759 1.00 99.63  ? 120 TRP B CD2   1 
ATOM   3352 N  NE1   . TRP B  1 120 ? 5.382   37.247  27.358 1.00 100.00 ? 120 TRP B NE1   1 
ATOM   3353 C  CE2   . TRP B  1 120 ? 6.311   37.620  26.420 1.00 100.00 ? 120 TRP B CE2   1 
ATOM   3354 C  CE3   . TRP B  1 120 ? 6.582   39.353  24.745 1.00 98.09  ? 120 TRP B CE3   1 
ATOM   3355 C  CZ2   . TRP B  1 120 ? 7.549   37.044  26.095 1.00 97.68  ? 120 TRP B CZ2   1 
ATOM   3356 C  CZ3   . TRP B  1 120 ? 7.813   38.777  24.423 1.00 93.97  ? 120 TRP B CZ3   1 
ATOM   3357 C  CH2   . TRP B  1 120 ? 8.281   37.637  25.099 1.00 82.76  ? 120 TRP B CH2   1 
ATOM   3358 N  N     . ASP B  1 121 ? 0.252   39.919  24.439 1.00 92.75  ? 121 ASP B N     1 
ATOM   3359 C  CA    . ASP B  1 121 ? -0.966  40.600  24.026 1.00 95.14  ? 121 ASP B CA    1 
ATOM   3360 C  C     . ASP B  1 121 ? -0.740  40.898  22.545 1.00 95.99  ? 121 ASP B C     1 
ATOM   3361 O  O     . ASP B  1 121 ? -0.493  39.991  21.748 1.00 99.85  ? 121 ASP B O     1 
ATOM   3362 C  CB    . ASP B  1 121 ? -1.224  41.896  24.824 1.00 97.63  ? 121 ASP B CB    1 
ATOM   3363 C  CG    . ASP B  1 121 ? -2.119  41.673  26.045 1.00 100.00 ? 121 ASP B CG    1 
ATOM   3364 O  OD1   . ASP B  1 121 ? -3.160  40.992  25.911 1.00 100.00 ? 121 ASP B OD1   1 
ATOM   3365 O  OD2   . ASP B  1 121 ? -1.794  42.184  27.140 1.00 100.00 ? 121 ASP B OD2   1 
ATOM   3366 N  N     . GLY B  1 122 ? -0.800  42.164  22.175 1.00 91.74  ? 122 GLY B N     1 
ATOM   3367 C  CA    . GLY B  1 122 ? -0.603  42.513  20.783 1.00 90.04  ? 122 GLY B CA    1 
ATOM   3368 C  C     . GLY B  1 122 ? 0.848   42.516  20.344 1.00 88.88  ? 122 GLY B C     1 
ATOM   3369 O  O     . GLY B  1 122 ? 1.189   41.910  19.328 1.00 86.26  ? 122 GLY B O     1 
ATOM   3370 N  N     . GLU B  1 123 ? 1.712   43.186  21.104 1.00 87.11  ? 123 GLU B N     1 
ATOM   3371 C  CA    . GLU B  1 123 ? 3.127   43.288  20.740 1.00 85.39  ? 123 GLU B CA    1 
ATOM   3372 C  C     . GLU B  1 123 ? 4.035   42.079  21.040 1.00 80.48  ? 123 GLU B C     1 
ATOM   3373 O  O     . GLU B  1 123 ? 3.874   41.382  22.051 1.00 67.65  ? 123 GLU B O     1 
ATOM   3374 C  CB    . GLU B  1 123 ? 3.715   44.537  21.399 1.00 91.77  ? 123 GLU B CB    1 
ATOM   3375 C  CG    . GLU B  1 123 ? 2.738   45.695  21.462 1.00 100.00 ? 123 GLU B CG    1 
ATOM   3376 C  CD    . GLU B  1 123 ? 3.315   46.914  22.161 1.00 100.00 ? 123 GLU B CD    1 
ATOM   3377 O  OE1   . GLU B  1 123 ? 3.804   46.764  23.307 1.00 100.00 ? 123 GLU B OE1   1 
ATOM   3378 O  OE2   . GLU B  1 123 ? 3.267   48.020  21.566 1.00 100.00 ? 123 GLU B OE2   1 
ATOM   3379 N  N     . GLY B  1 124 ? 5.006   41.857  20.155 1.00 69.14  ? 124 GLY B N     1 
ATOM   3380 C  CA    . GLY B  1 124 ? 5.935   40.760  20.325 1.00 56.32  ? 124 GLY B CA    1 
ATOM   3381 C  C     . GLY B  1 124 ? 7.368   41.233  20.439 1.00 58.91  ? 124 GLY B C     1 
ATOM   3382 O  O     . GLY B  1 124 ? 7.738   42.263  19.892 1.00 60.40  ? 124 GLY B O     1 
ATOM   3383 N  N     . SER B  1 125 ? 8.195   40.484  21.154 1.00 56.03  ? 125 SER B N     1 
ATOM   3384 C  CA    . SER B  1 125 ? 9.586   40.880  21.304 1.00 54.12  ? 125 SER B CA    1 
ATOM   3385 C  C     . SER B  1 125 ? 10.462  39.663  21.560 1.00 47.64  ? 125 SER B C     1 
ATOM   3386 O  O     . SER B  1 125 ? 9.984   38.646  22.044 1.00 53.98  ? 125 SER B O     1 
ATOM   3387 C  CB    . SER B  1 125 ? 9.709   41.862  22.459 1.00 57.01  ? 125 SER B CB    1 
ATOM   3388 O  OG    . SER B  1 125 ? 9.274   41.241  23.643 1.00 55.93  ? 125 SER B OG    1 
ATOM   3389 N  N     . MET B  1 126 ? 11.743  39.777  21.242 1.00 42.24  ? 126 MET B N     1 
ATOM   3390 C  CA    . MET B  1 126 ? 12.674  38.682  21.420 1.00 35.99  ? 126 MET B CA    1 
ATOM   3391 C  C     . MET B  1 126 ? 13.166  38.539  22.840 1.00 45.47  ? 126 MET B C     1 
ATOM   3392 O  O     . MET B  1 126 ? 13.159  39.491  23.619 1.00 54.42  ? 126 MET B O     1 
ATOM   3393 C  CB    . MET B  1 126 ? 13.888  38.857  20.506 1.00 34.61  ? 126 MET B CB    1 
ATOM   3394 C  CG    . MET B  1 126 ? 13.605  38.656  19.010 1.00 25.77  ? 126 MET B CG    1 
ATOM   3395 S  SD    . MET B  1 126 ? 15.140  38.560  18.062 1.00 47.28  ? 126 MET B SD    1 
ATOM   3396 C  CE    . MET B  1 126 ? 15.972  37.142  18.853 1.00 52.40  ? 126 MET B CE    1 
ATOM   3397 N  N     . TYR B  1 127 ? 13.555  37.326  23.193 1.00 39.61  ? 127 TYR B N     1 
ATOM   3398 C  CA    . TYR B  1 127 ? 14.123  37.088  24.498 1.00 39.58  ? 127 TYR B CA    1 
ATOM   3399 C  C     . TYR B  1 127 ? 15.327  36.181  24.406 1.00 35.52  ? 127 TYR B C     1 
ATOM   3400 O  O     . TYR B  1 127 ? 15.575  35.337  25.241 1.00 41.64  ? 127 TYR B O     1 
ATOM   3401 C  CB    . TYR B  1 127 ? 13.097  36.577  25.513 1.00 46.38  ? 127 TYR B CB    1 
ATOM   3402 C  CG    . TYR B  1 127 ? 12.169  35.457  25.136 1.00 51.03  ? 127 TYR B CG    1 
ATOM   3403 C  CD1   . TYR B  1 127 ? 10.785  35.635  25.232 1.00 39.56  ? 127 TYR B CD1   1 
ATOM   3404 C  CD2   . TYR B  1 127 ? 12.651  34.197  24.792 1.00 59.69  ? 127 TYR B CD2   1 
ATOM   3405 C  CE1   . TYR B  1 127 ? 9.913   34.609  25.027 1.00 47.21  ? 127 TYR B CE1   1 
ATOM   3406 C  CE2   . TYR B  1 127 ? 11.755  33.115  24.574 1.00 64.88  ? 127 TYR B CE2   1 
ATOM   3407 C  CZ    . TYR B  1 127 ? 10.390  33.340  24.694 1.00 61.11  ? 127 TYR B CZ    1 
ATOM   3408 O  OH    . TYR B  1 127 ? 9.498   32.298  24.538 1.00 58.61  ? 127 TYR B OH    1 
ATOM   3409 N  N     . VAL B  1 128 ? 16.083  36.425  23.361 1.00 24.38  ? 128 VAL B N     1 
ATOM   3410 C  CA    . VAL B  1 128 ? 17.275  35.679  23.053 1.00 32.32  ? 128 VAL B CA    1 
ATOM   3411 C  C     . VAL B  1 128 ? 18.124  36.702  22.310 1.00 33.60  ? 128 VAL B C     1 
ATOM   3412 O  O     . VAL B  1 128 ? 17.588  37.646  21.735 1.00 41.81  ? 128 VAL B O     1 
ATOM   3413 C  CB    . VAL B  1 128 ? 16.900  34.463  22.148 1.00 39.69  ? 128 VAL B CB    1 
ATOM   3414 C  CG1   . VAL B  1 128 ? 18.049  34.049  21.319 1.00 39.34  ? 128 VAL B CG1   1 
ATOM   3415 C  CG2   . VAL B  1 128 ? 16.408  33.299  23.010 1.00 36.81  ? 128 VAL B CG2   1 
ATOM   3416 N  N     . PRO B  1 129 ? 19.450  36.563  22.332 1.00 36.95  ? 129 PRO B N     1 
ATOM   3417 C  CA    . PRO B  1 129 ? 20.227  37.570  21.597 1.00 40.33  ? 129 PRO B CA    1 
ATOM   3418 C  C     . PRO B  1 129 ? 19.841  37.649  20.122 1.00 44.36  ? 129 PRO B C     1 
ATOM   3419 O  O     . PRO B  1 129 ? 19.745  36.627  19.441 1.00 49.51  ? 129 PRO B O     1 
ATOM   3420 C  CB    . PRO B  1 129 ? 21.665  37.111  21.798 1.00 37.26  ? 129 PRO B CB    1 
ATOM   3421 C  CG    . PRO B  1 129 ? 21.627  36.507  23.177 1.00 40.09  ? 129 PRO B CG    1 
ATOM   3422 C  CD    . PRO B  1 129 ? 20.316  35.731  23.187 1.00 45.13  ? 129 PRO B CD    1 
ATOM   3423 N  N     . GLU B  1 130 ? 19.617  38.863  19.635 1.00 49.37  ? 130 GLU B N     1 
ATOM   3424 C  CA    . GLU B  1 130 ? 19.254  39.080  18.238 1.00 39.18  ? 130 GLU B CA    1 
ATOM   3425 C  C     . GLU B  1 130 ? 20.227  38.464  17.246 1.00 44.08  ? 130 GLU B C     1 
ATOM   3426 O  O     . GLU B  1 130 ? 19.829  38.119  16.126 1.00 33.47  ? 130 GLU B O     1 
ATOM   3427 C  CB    . GLU B  1 130 ? 19.144  40.566  17.932 1.00 35.35  ? 130 GLU B CB    1 
ATOM   3428 C  CG    . GLU B  1 130 ? 18.001  41.267  18.630 1.00 32.88  ? 130 GLU B CG    1 
ATOM   3429 C  CD    . GLU B  1 130 ? 17.845  42.687  18.143 1.00 32.96  ? 130 GLU B CD    1 
ATOM   3430 O  OE1   . GLU B  1 130 ? 18.714  43.144  17.366 1.00 43.87  ? 130 GLU B OE1   1 
ATOM   3431 O  OE2   . GLU B  1 130 ? 16.865  43.349  18.545 1.00 39.43  ? 130 GLU B OE2   1 
ATOM   3432 N  N     . ASP B  1 131 ? 21.496  38.328  17.640 1.00 39.26  ? 131 ASP B N     1 
ATOM   3433 C  CA    . ASP B  1 131 ? 22.485  37.768  16.732 1.00 34.87  ? 131 ASP B CA    1 
ATOM   3434 C  C     . ASP B  1 131 ? 22.295  36.268  16.566 1.00 44.12  ? 131 ASP B C     1 
ATOM   3435 O  O     . ASP B  1 131 ? 23.087  35.608  15.892 1.00 36.97  ? 131 ASP B O     1 
ATOM   3436 C  CB    . ASP B  1 131 ? 23.919  38.069  17.206 1.00 45.20  ? 131 ASP B CB    1 
ATOM   3437 C  CG    . ASP B  1 131 ? 24.223  37.488  18.572 1.00 55.34  ? 131 ASP B CG    1 
ATOM   3438 O  OD1   . ASP B  1 131 ? 23.494  36.580  19.026 1.00 55.53  ? 131 ASP B OD1   1 
ATOM   3439 O  OD2   . ASP B  1 131 ? 25.210  37.934  19.193 1.00 75.53  ? 131 ASP B OD2   1 
ATOM   3440 N  N     . LEU B  1 132 ? 21.253  35.723  17.190 1.00 37.34  ? 132 LEU B N     1 
ATOM   3441 C  CA    . LEU B  1 132 ? 20.977  34.302  17.050 1.00 44.02  ? 132 LEU B CA    1 
ATOM   3442 C  C     . LEU B  1 132 ? 20.113  34.086  15.806 1.00 45.04  ? 132 LEU B C     1 
ATOM   3443 O  O     . LEU B  1 132 ? 20.252  33.071  15.123 1.00 41.78  ? 132 LEU B O     1 
ATOM   3444 C  CB    . LEU B  1 132 ? 20.252  33.754  18.288 1.00 36.49  ? 132 LEU B CB    1 
ATOM   3445 C  CG    . LEU B  1 132 ? 21.094  32.894  19.228 1.00 48.88  ? 132 LEU B CG    1 
ATOM   3446 C  CD1   . LEU B  1 132 ? 22.130  33.759  19.908 1.00 44.47  ? 132 LEU B CD1   1 
ATOM   3447 C  CD2   . LEU B  1 132 ? 20.198  32.217  20.261 1.00 39.24  ? 132 LEU B CD2   1 
ATOM   3448 N  N     . LEU B  1 133 ? 19.237  35.048  15.506 1.00 38.19  ? 133 LEU B N     1 
ATOM   3449 C  CA    . LEU B  1 133 ? 18.349  34.942  14.351 1.00 39.72  ? 133 LEU B CA    1 
ATOM   3450 C  C     . LEU B  1 133 ? 19.060  34.624  13.028 1.00 45.58  ? 133 LEU B C     1 
ATOM   3451 O  O     . LEU B  1 133 ? 18.550  33.860  12.217 1.00 45.92  ? 133 LEU B O     1 
ATOM   3452 C  CB    . LEU B  1 133 ? 17.520  36.216  14.197 1.00 42.96  ? 133 LEU B CB    1 
ATOM   3453 C  CG    . LEU B  1 133 ? 16.507  36.169  13.048 1.00 44.03  ? 133 LEU B CG    1 
ATOM   3454 C  CD1   . LEU B  1 133 ? 15.595  34.972  13.250 1.00 33.58  ? 133 LEU B CD1   1 
ATOM   3455 C  CD2   . LEU B  1 133 ? 15.699  37.453  13.003 1.00 33.11  ? 133 LEU B CD2   1 
ATOM   3456 N  N     . PRO B  1 134 ? 20.237  35.218  12.776 1.00 50.89  ? 134 PRO B N     1 
ATOM   3457 C  CA    . PRO B  1 134 ? 20.885  34.873  11.502 1.00 43.36  ? 134 PRO B CA    1 
ATOM   3458 C  C     . PRO B  1 134 ? 21.412  33.442  11.510 1.00 39.08  ? 134 PRO B C     1 
ATOM   3459 O  O     . PRO B  1 134 ? 21.412  32.756  10.485 1.00 37.93  ? 134 PRO B O     1 
ATOM   3460 C  CB    . PRO B  1 134 ? 22.007  35.902  11.397 1.00 39.93  ? 134 PRO B CB    1 
ATOM   3461 C  CG    . PRO B  1 134 ? 21.395  37.100  12.048 1.00 39.83  ? 134 PRO B CG    1 
ATOM   3462 C  CD    . PRO B  1 134 ? 20.760  36.495  13.292 1.00 48.34  ? 134 PRO B CD    1 
ATOM   3463 N  N     . VAL B  1 135 ? 21.880  32.996  12.670 1.00 42.87  ? 135 VAL B N     1 
ATOM   3464 C  CA    . VAL B  1 135 ? 22.403  31.643  12.800 1.00 37.17  ? 135 VAL B CA    1 
ATOM   3465 C  C     . VAL B  1 135 ? 21.262  30.644  12.554 1.00 44.46  ? 135 VAL B C     1 
ATOM   3466 O  O     . VAL B  1 135 ? 21.436  29.651  11.832 1.00 36.40  ? 135 VAL B O     1 
ATOM   3467 C  CB    . VAL B  1 135 ? 23.032  31.447  14.203 1.00 42.42  ? 135 VAL B CB    1 
ATOM   3468 C  CG1   . VAL B  1 135 ? 23.647  30.047  14.341 1.00 33.25  ? 135 VAL B CG1   1 
ATOM   3469 C  CG2   . VAL B  1 135 ? 24.110  32.512  14.416 1.00 42.86  ? 135 VAL B CG2   1 
ATOM   3470 N  N     . TYR B  1 136 ? 20.096  30.909  13.148 1.00 32.48  ? 136 TYR B N     1 
ATOM   3471 C  CA    . TYR B  1 136 ? 18.937  30.048  12.950 1.00 37.99  ? 136 TYR B CA    1 
ATOM   3472 C  C     . TYR B  1 136 ? 18.560  30.026  11.476 1.00 41.61  ? 136 TYR B C     1 
ATOM   3473 O  O     . TYR B  1 136 ? 18.365  28.962  10.899 1.00 42.22  ? 136 TYR B O     1 
ATOM   3474 C  CB    . TYR B  1 136 ? 17.734  30.537  13.763 1.00 27.94  ? 136 TYR B CB    1 
ATOM   3475 C  CG    . TYR B  1 136 ? 17.663  29.944  15.153 1.00 42.87  ? 136 TYR B CG    1 
ATOM   3476 C  CD1   . TYR B  1 136 ? 17.773  30.752  16.284 1.00 35.43  ? 136 TYR B CD1   1 
ATOM   3477 C  CD2   . TYR B  1 136 ? 17.489  28.573  15.336 1.00 44.93  ? 136 TYR B CD2   1 
ATOM   3478 C  CE1   . TYR B  1 136 ? 17.714  30.220  17.553 1.00 31.40  ? 136 TYR B CE1   1 
ATOM   3479 C  CE2   . TYR B  1 136 ? 17.425  28.022  16.605 1.00 31.12  ? 136 TYR B CE2   1 
ATOM   3480 C  CZ    . TYR B  1 136 ? 17.538  28.854  17.714 1.00 41.48  ? 136 TYR B CZ    1 
ATOM   3481 O  OH    . TYR B  1 136 ? 17.459  28.329  18.984 1.00 31.68  ? 136 TYR B OH    1 
ATOM   3482 N  N     . LYS B  1 137 ? 18.476  31.204  10.861 1.00 38.23  ? 137 LYS B N     1 
ATOM   3483 C  CA    . LYS B  1 137 ? 18.109  31.295  9.455  1.00 37.91  ? 137 LYS B CA    1 
ATOM   3484 C  C     . LYS B  1 137 ? 19.003  30.557  8.476  1.00 40.62  ? 137 LYS B C     1 
ATOM   3485 O  O     . LYS B  1 137 ? 18.514  29.872  7.578  1.00 40.85  ? 137 LYS B O     1 
ATOM   3486 C  CB    . LYS B  1 137 ? 18.059  32.751  9.018  1.00 42.32  ? 137 LYS B CB    1 
ATOM   3487 C  CG    . LYS B  1 137 ? 16.859  33.536  9.478  1.00 41.17  ? 137 LYS B CG    1 
ATOM   3488 C  CD    . LYS B  1 137 ? 16.963  34.952  8.936  1.00 43.35  ? 137 LYS B CD    1 
ATOM   3489 C  CE    . LYS B  1 137 ? 15.756  35.790  9.302  1.00 47.80  ? 137 LYS B CE    1 
ATOM   3490 N  NZ    . LYS B  1 137 ? 15.877  37.145  8.718  1.00 43.82  ? 137 LYS B NZ    1 
ATOM   3491 N  N     . GLU B  1 138 ? 20.312  30.693  8.647  1.00 35.82  ? 138 GLU B N     1 
ATOM   3492 C  CA    . GLU B  1 138 ? 21.286  30.104  7.722  1.00 37.00  ? 138 GLU B CA    1 
ATOM   3493 C  C     . GLU B  1 138 ? 21.967  28.817  8.120  1.00 42.43  ? 138 GLU B C     1 
ATOM   3494 O  O     . GLU B  1 138 ? 22.471  28.084  7.265  1.00 42.21  ? 138 GLU B O     1 
ATOM   3495 C  CB    . GLU B  1 138 ? 22.372  31.136  7.405  1.00 35.82  ? 138 GLU B CB    1 
ATOM   3496 C  CG    . GLU B  1 138 ? 21.919  32.572  7.437  1.00 62.06  ? 138 GLU B CG    1 
ATOM   3497 C  CD    . GLU B  1 138 ? 23.075  33.542  7.276  1.00 67.38  ? 138 GLU B CD    1 
ATOM   3498 O  OE1   . GLU B  1 138 ? 22.857  34.764  7.446  1.00 74.28  ? 138 GLU B OE1   1 
ATOM   3499 O  OE2   . GLU B  1 138 ? 24.197  33.077  6.975  1.00 71.72  ? 138 GLU B OE2   1 
ATOM   3500 N  N     . LYS B  1 139 ? 22.005  28.542  9.390  1.00 36.33  ? 139 LYS B N     1 
ATOM   3501 C  CA    . LYS B  1 139 ? 22.659  27.330  9.859  1.00 36.23  ? 139 LYS B CA    1 
ATOM   3502 C  C     . LYS B  1 139 ? 21.752  26.266  10.473 1.00 43.83  ? 139 LYS B C     1 
ATOM   3503 O  O     . LYS B  1 139 ? 21.856  25.084  10.149 1.00 44.11  ? 139 LYS B O     1 
ATOM   3504 C  CB    . LYS B  1 139 ? 23.738  27.703  10.873 1.00 43.77  ? 139 LYS B CB    1 
ATOM   3505 C  CG    . LYS B  1 139 ? 24.759  28.641  10.332 1.00 47.88  ? 139 LYS B CG    1 
ATOM   3506 C  CD    . LYS B  1 139 ? 25.578  27.964  9.284  1.00 57.19  ? 139 LYS B CD    1 
ATOM   3507 C  CE    . LYS B  1 139 ? 26.299  26.759  9.873  1.00 73.66  ? 139 LYS B CE    1 
ATOM   3508 N  NZ    . LYS B  1 139 ? 27.146  26.046  8.875  1.00 86.78  ? 139 LYS B NZ    1 
ATOM   3509 N  N     . VAL B  1 140 ? 20.868  26.655  11.367 1.00 43.45  ? 140 VAL B N     1 
ATOM   3510 C  CA    . VAL B  1 140 ? 20.022  25.693  12.062 1.00 35.16  ? 140 VAL B CA    1 
ATOM   3511 C  C     . VAL B  1 140 ? 18.811  25.161  11.307 1.00 38.26  ? 140 VAL B C     1 
ATOM   3512 O  O     . VAL B  1 140 ? 18.660  23.951  11.120 1.00 39.10  ? 140 VAL B O     1 
ATOM   3513 C  CB    . VAL B  1 140 ? 19.549  26.265  13.432 1.00 38.78  ? 140 VAL B CB    1 
ATOM   3514 C  CG1   . VAL B  1 140 ? 18.918  25.162  14.261 1.00 43.52  ? 140 VAL B CG1   1 
ATOM   3515 C  CG2   . VAL B  1 140 ? 20.709  26.877  14.175 1.00 37.58  ? 140 VAL B CG2   1 
ATOM   3516 N  N     . VAL B  1 141 ? 17.926  26.050  10.889 1.00 34.54  ? 141 VAL B N     1 
ATOM   3517 C  CA    . VAL B  1 141 ? 16.731  25.641  10.195 1.00 31.81  ? 141 VAL B CA    1 
ATOM   3518 C  C     . VAL B  1 141 ? 17.025  24.777  8.960  1.00 35.33  ? 141 VAL B C     1 
ATOM   3519 O  O     . VAL B  1 141 ? 16.295  23.828  8.671  1.00 40.91  ? 141 VAL B O     1 
ATOM   3520 C  CB    . VAL B  1 141 ? 15.853  26.876  9.883  1.00 31.97  ? 141 VAL B CB    1 
ATOM   3521 C  CG1   . VAL B  1 141 ? 14.685  26.515  8.991  1.00 39.49  ? 141 VAL B CG1   1 
ATOM   3522 C  CG2   . VAL B  1 141 ? 15.326  27.441  11.189 1.00 32.07  ? 141 VAL B CG2   1 
ATOM   3523 N  N     . PRO B  1 142 ? 18.097  25.082  8.214  1.00 39.11  ? 142 PRO B N     1 
ATOM   3524 C  CA    . PRO B  1 142 ? 18.428  24.276  7.032  1.00 27.40  ? 142 PRO B CA    1 
ATOM   3525 C  C     . PRO B  1 142 ? 18.773  22.816  7.378  1.00 40.31  ? 142 PRO B C     1 
ATOM   3526 O  O     . PRO B  1 142 ? 18.660  21.910  6.536  1.00 35.87  ? 142 PRO B O     1 
ATOM   3527 C  CB    . PRO B  1 142 ? 19.612  25.030  6.434  1.00 35.16  ? 142 PRO B CB    1 
ATOM   3528 C  CG    . PRO B  1 142 ? 19.269  26.455  6.711  1.00 31.90  ? 142 PRO B CG    1 
ATOM   3529 C  CD    . PRO B  1 142 ? 18.736  26.416  8.133  1.00 41.02  ? 142 PRO B CD    1 
ATOM   3530 N  N     . LEU B  1 143 ? 19.217  22.605  8.615  1.00 34.70  ? 143 LEU B N     1 
ATOM   3531 C  CA    . LEU B  1 143 ? 19.590  21.284  9.121  1.00 32.13  ? 143 LEU B CA    1 
ATOM   3532 C  C     . LEU B  1 143 ? 18.415  20.601  9.789  1.00 33.98  ? 143 LEU B C     1 
ATOM   3533 O  O     . LEU B  1 143 ? 18.458  19.407  10.047 1.00 42.51  ? 143 LEU B O     1 
ATOM   3534 C  CB    . LEU B  1 143 ? 20.677  21.406  10.185 1.00 41.39  ? 143 LEU B CB    1 
ATOM   3535 C  CG    . LEU B  1 143 ? 22.132  21.130  9.878  1.00 53.55  ? 143 LEU B CG    1 
ATOM   3536 C  CD1   . LEU B  1 143 ? 22.917  21.341  11.159 1.00 46.14  ? 143 LEU B CD1   1 
ATOM   3537 C  CD2   . LEU B  1 143 ? 22.306  19.706  9.371  1.00 49.39  ? 143 LEU B CD2   1 
ATOM   3538 N  N     . ALA B  1 144 ? 17.376  21.369  10.096 1.00 28.62  ? 144 ALA B N     1 
ATOM   3539 C  CA    . ALA B  1 144 ? 16.202  20.830  10.780 1.00 35.36  ? 144 ALA B CA    1 
ATOM   3540 C  C     . ALA B  1 144 ? 15.214  20.079  9.879  1.00 36.35  ? 144 ALA B C     1 
ATOM   3541 O  O     . ALA B  1 144 ? 14.980  20.464  8.733  1.00 34.84  ? 144 ALA B O     1 
ATOM   3542 C  CB    . ALA B  1 144 ? 15.479  21.956  11.493 1.00 27.10  ? 144 ALA B CB    1 
ATOM   3543 N  N     . ASP B  1 145 ? 14.631  19.015  10.417 1.00 33.00  ? 145 ASP B N     1 
ATOM   3544 C  CA    . ASP B  1 145 ? 13.659  18.216  9.690  1.00 29.68  ? 145 ASP B CA    1 
ATOM   3545 C  C     . ASP B  1 145 ? 12.281  18.556  10.216 1.00 28.97  ? 145 ASP B C     1 
ATOM   3546 O  O     . ASP B  1 145 ? 11.291  18.456  9.496  1.00 32.66  ? 145 ASP B O     1 
ATOM   3547 C  CB    . ASP B  1 145 ? 13.984  16.734  9.874  1.00 31.68  ? 145 ASP B CB    1 
ATOM   3548 C  CG    . ASP B  1 145 ? 15.418  16.413  9.453  1.00 46.11  ? 145 ASP B CG    1 
ATOM   3549 O  OD1   . ASP B  1 145 ? 15.752  16.599  8.262  1.00 45.45  ? 145 ASP B OD1   1 
ATOM   3550 O  OD2   . ASP B  1 145 ? 16.225  16.001  10.303 1.00 39.05  ? 145 ASP B OD2   1 
ATOM   3551 N  N     . ILE B  1 146 ? 12.223  18.965  11.476 1.00 32.24  ? 146 ILE B N     1 
ATOM   3552 C  CA    . ILE B  1 146 ? 10.963  19.368  12.094 1.00 29.59  ? 146 ILE B CA    1 
ATOM   3553 C  C     . ILE B  1 146 ? 11.185  20.633  12.930 1.00 33.74  ? 146 ILE B C     1 
ATOM   3554 O  O     . ILE B  1 146 ? 12.058  20.648  13.805 1.00 34.13  ? 146 ILE B O     1 
ATOM   3555 C  CB    . ILE B  1 146 ? 10.406  18.284  13.059 1.00 29.56  ? 146 ILE B CB    1 
ATOM   3556 C  CG1   . ILE B  1 146 ? 10.146  16.977  12.322 1.00 38.42  ? 146 ILE B CG1   1 
ATOM   3557 C  CG2   . ILE B  1 146 ? 9.123   18.780  13.686 1.00 24.57  ? 146 ILE B CG2   1 
ATOM   3558 C  CD1   . ILE B  1 146 ? 9.409   15.949  13.151 1.00 22.97  ? 146 ILE B CD1   1 
ATOM   3559 N  N     . ILE B  1 147 ? 10.435  21.700  12.652 1.00 28.87  ? 147 ILE B N     1 
ATOM   3560 C  CA    . ILE B  1 147 ? 10.563  22.910  13.466 1.00 24.39  ? 147 ILE B CA    1 
ATOM   3561 C  C     . ILE B  1 147 ? 9.218   23.242  14.088 1.00 33.39  ? 147 ILE B C     1 
ATOM   3562 O  O     . ILE B  1 147 ? 8.174   22.904  13.533 1.00 33.31  ? 147 ILE B O     1 
ATOM   3563 C  CB    . ILE B  1 147 ? 11.121  24.135  12.688 1.00 25.40  ? 147 ILE B CB    1 
ATOM   3564 C  CG1   . ILE B  1 147 ? 10.274  24.458  11.473 1.00 30.77  ? 147 ILE B CG1   1 
ATOM   3565 C  CG2   . ILE B  1 147 ? 12.584  23.886  12.293 1.00 21.65  ? 147 ILE B CG2   1 
ATOM   3566 C  CD1   . ILE B  1 147 ? 10.553  25.870  10.949 1.00 33.20  ? 147 ILE B CD1   1 
ATOM   3567 N  N     . THR B  1 148 ? 9.241   23.874  15.254 1.00 37.59  ? 148 THR B N     1 
ATOM   3568 C  CA    . THR B  1 148 ? 8.013   24.205  15.970 1.00 28.44  ? 148 THR B CA    1 
ATOM   3569 C  C     . THR B  1 148 ? 7.984   25.674  16.384 1.00 34.88  ? 148 THR B C     1 
ATOM   3570 O  O     . THR B  1 148 ? 7.951   25.976  17.552 1.00 26.62  ? 148 THR B O     1 
ATOM   3571 C  CB    . THR B  1 148 ? 7.879   23.330  17.259 1.00 30.43  ? 148 THR B CB    1 
ATOM   3572 O  OG1   . THR B  1 148 ? 8.980   23.598  18.149 1.00 32.67  ? 148 THR B OG1   1 
ATOM   3573 C  CG2   . THR B  1 148 ? 7.891   21.852  16.895 1.00 24.82  ? 148 THR B CG2   1 
ATOM   3574 N  N     . PRO B  1 149 ? 7.979   26.605  15.430 1.00 36.44  ? 149 PRO B N     1 
ATOM   3575 C  CA    . PRO B  1 149 ? 7.955   27.986  15.919 1.00 25.71  ? 149 PRO B CA    1 
ATOM   3576 C  C     . PRO B  1 149 ? 6.580   28.499  16.358 1.00 33.54  ? 149 PRO B C     1 
ATOM   3577 O  O     . PRO B  1 149 ? 5.559   27.968  15.937 1.00 32.20  ? 149 PRO B O     1 
ATOM   3578 C  CB    . PRO B  1 149 ? 8.472   28.771  14.716 1.00 27.29  ? 149 PRO B CB    1 
ATOM   3579 C  CG    . PRO B  1 149 ? 7.812   28.036  13.577 1.00 27.64  ? 149 PRO B CG    1 
ATOM   3580 C  CD    . PRO B  1 149 ? 8.056   26.564  13.952 1.00 23.88  ? 149 PRO B CD    1 
ATOM   3581 N  N     . ASN B  1 150 ? 6.549   29.517  17.226 1.00 25.80  ? 150 ASN B N     1 
ATOM   3582 C  CA    . ASN B  1 150 ? 5.260   30.122  17.559 1.00 33.76  ? 150 ASN B CA    1 
ATOM   3583 C  C     . ASN B  1 150 ? 5.071   31.156  16.437 1.00 28.06  ? 150 ASN B C     1 
ATOM   3584 O  O     . ASN B  1 150 ? 5.927   31.281  15.548 1.00 25.29  ? 150 ASN B O     1 
ATOM   3585 C  CB    . ASN B  1 150 ? 5.235   30.812  18.936 1.00 36.34  ? 150 ASN B CB    1 
ATOM   3586 C  CG    . ASN B  1 150 ? 6.388   31.769  19.144 1.00 39.23  ? 150 ASN B CG    1 
ATOM   3587 O  OD1   . ASN B  1 150 ? 6.847   32.430  18.210 1.00 42.33  ? 150 ASN B OD1   1 
ATOM   3588 N  ND2   . ASN B  1 150 ? 6.852   31.863  20.383 1.00 37.23  ? 150 ASN B ND2   1 
ATOM   3589 N  N     . GLN B  1 151 ? 3.976   31.902  16.462 1.00 30.46  ? 151 GLN B N     1 
ATOM   3590 C  CA    . GLN B  1 151 ? 3.735   32.868  15.394 1.00 32.29  ? 151 GLN B CA    1 
ATOM   3591 C  C     . GLN B  1 151 ? 4.846   33.899  15.224 1.00 35.37  ? 151 GLN B C     1 
ATOM   3592 O  O     . GLN B  1 151 ? 5.310   34.161  14.105 1.00 33.83  ? 151 GLN B O     1 
ATOM   3593 C  CB    . GLN B  1 151 ? 2.393   33.552  15.610 1.00 32.92  ? 151 GLN B CB    1 
ATOM   3594 C  CG    . GLN B  1 151 ? 2.151   34.724  14.681 1.00 45.65  ? 151 GLN B CG    1 
ATOM   3595 C  CD    . GLN B  1 151 ? 0.727   35.201  14.763 1.00 50.34  ? 151 GLN B CD    1 
ATOM   3596 O  OE1   . GLN B  1 151 ? 0.129   35.227  15.842 1.00 62.80  ? 151 GLN B OE1   1 
ATOM   3597 N  NE2   . GLN B  1 151 ? 0.171   35.586  13.632 1.00 53.33  ? 151 GLN B NE2   1 
ATOM   3598 N  N     . PHE B  1 152 ? 5.291   34.468  16.341 1.00 36.27  ? 152 PHE B N     1 
ATOM   3599 C  CA    . PHE B  1 152 ? 6.347   35.468  16.332 1.00 35.47  ? 152 PHE B CA    1 
ATOM   3600 C  C     . PHE B  1 152 ? 7.652   34.924  15.728 1.00 37.92  ? 152 PHE B C     1 
ATOM   3601 O  O     . PHE B  1 152 ? 8.397   35.641  15.048 1.00 44.04  ? 152 PHE B O     1 
ATOM   3602 C  CB    . PHE B  1 152 ? 6.576   35.951  17.772 1.00 37.33  ? 152 PHE B CB    1 
ATOM   3603 C  CG    . PHE B  1 152 ? 7.721   36.910  17.923 1.00 47.49  ? 152 PHE B CG    1 
ATOM   3604 C  CD1   . PHE B  1 152 ? 7.591   38.236  17.525 1.00 55.54  ? 152 PHE B CD1   1 
ATOM   3605 C  CD2   . PHE B  1 152 ? 8.930   36.490  18.464 1.00 51.13  ? 152 PHE B CD2   1 
ATOM   3606 C  CE1   . PHE B  1 152 ? 8.642   39.131  17.666 1.00 47.86  ? 152 PHE B CE1   1 
ATOM   3607 C  CE2   . PHE B  1 152 ? 9.991   37.378  18.608 1.00 58.74  ? 152 PHE B CE2   1 
ATOM   3608 C  CZ    . PHE B  1 152 ? 9.844   38.702  18.209 1.00 57.65  ? 152 PHE B CZ    1 
ATOM   3609 N  N     . GLU B  1 153 ? 7.936   33.655  15.979 1.00 36.50  ? 153 GLU B N     1 
ATOM   3610 C  CA    . GLU B  1 153 ? 9.157   33.069  15.462 1.00 30.19  ? 153 GLU B CA    1 
ATOM   3611 C  C     . GLU B  1 153 ? 9.086   32.754  13.975 1.00 34.68  ? 153 GLU B C     1 
ATOM   3612 O  O     . GLU B  1 153 ? 10.083  32.897  13.254 1.00 29.32  ? 153 GLU B O     1 
ATOM   3613 C  CB    . GLU B  1 153 ? 9.506   31.831  16.297 1.00 43.90  ? 153 GLU B CB    1 
ATOM   3614 C  CG    . GLU B  1 153 ? 9.722   32.211  17.770 1.00 41.30  ? 153 GLU B CG    1 
ATOM   3615 C  CD    . GLU B  1 153 ? 9.692   31.050  18.757 1.00 40.81  ? 153 GLU B CD    1 
ATOM   3616 O  OE1   . GLU B  1 153 ? 8.931   30.080  18.544 1.00 28.88  ? 153 GLU B OE1   1 
ATOM   3617 O  OE2   . GLU B  1 153 ? 10.420  31.140  19.773 1.00 38.67  ? 153 GLU B OE2   1 
ATOM   3618 N  N     . ALA B  1 154 ? 7.910   32.339  13.506 1.00 36.77  ? 154 ALA B N     1 
ATOM   3619 C  CA    . ALA B  1 154 ? 7.730   32.035  12.084 1.00 32.49  ? 154 ALA B CA    1 
ATOM   3620 C  C     . ALA B  1 154 ? 7.874   33.357  11.317 1.00 28.96  ? 154 ALA B C     1 
ATOM   3621 O  O     . ALA B  1 154 ? 8.389   33.403  10.194 1.00 35.98  ? 154 ALA B O     1 
ATOM   3622 C  CB    . ALA B  1 154 ? 6.340   31.404  11.837 1.00 23.71  ? 154 ALA B CB    1 
ATOM   3623 N  N     . GLU B  1 155 ? 7.437   34.438  11.952 1.00 29.27  ? 155 GLU B N     1 
ATOM   3624 C  CA    . GLU B  1 155 ? 7.533   35.763  11.360 1.00 27.26  ? 155 GLU B CA    1 
ATOM   3625 C  C     . GLU B  1 155 ? 8.992   36.204  11.333 1.00 37.29  ? 155 GLU B C     1 
ATOM   3626 O  O     . GLU B  1 155 ? 9.454   36.740  10.327 1.00 40.68  ? 155 GLU B O     1 
ATOM   3627 C  CB    . GLU B  1 155 ? 6.696   36.760  12.154 1.00 29.30  ? 155 GLU B CB    1 
ATOM   3628 C  CG    . GLU B  1 155 ? 5.191   36.508  12.041 1.00 39.00  ? 155 GLU B CG    1 
ATOM   3629 C  CD    . GLU B  1 155 ? 4.376   37.464  12.907 1.00 40.14  ? 155 GLU B CD    1 
ATOM   3630 O  OE1   . GLU B  1 155 ? 4.858   37.838  13.995 1.00 43.52  ? 155 GLU B OE1   1 
ATOM   3631 O  OE2   . GLU B  1 155 ? 3.251   37.827  12.515 1.00 41.87  ? 155 GLU B OE2   1 
ATOM   3632 N  N     . LEU B  1 156 ? 9.730   35.970  12.418 1.00 32.79  ? 156 LEU B N     1 
ATOM   3633 C  CA    . LEU B  1 156 ? 11.139  36.374  12.440 1.00 39.78  ? 156 LEU B CA    1 
ATOM   3634 C  C     . LEU B  1 156 ? 11.953  35.575  11.436 1.00 28.35  ? 156 LEU B C     1 
ATOM   3635 O  O     . LEU B  1 156 ? 12.787  36.121  10.726 1.00 43.31  ? 156 LEU B O     1 
ATOM   3636 C  CB    . LEU B  1 156 ? 11.752  36.187  13.831 1.00 33.25  ? 156 LEU B CB    1 
ATOM   3637 C  CG    . LEU B  1 156 ? 11.453  37.203  14.918 1.00 38.55  ? 156 LEU B CG    1 
ATOM   3638 C  CD1   . LEU B  1 156 ? 12.172  36.795  16.180 1.00 36.22  ? 156 LEU B CD1   1 
ATOM   3639 C  CD2   . LEU B  1 156 ? 11.913  38.567  14.478 1.00 36.61  ? 156 LEU B CD2   1 
ATOM   3640 N  N     . LEU B  1 157 ? 11.705  34.272  11.387 1.00 32.61  ? 157 LEU B N     1 
ATOM   3641 C  CA    . LEU B  1 157 ? 12.415  33.389  10.474 1.00 28.95  ? 157 LEU B CA    1 
ATOM   3642 C  C     . LEU B  1 157 ? 12.105  33.612  9.000  1.00 36.83  ? 157 LEU B C     1 
ATOM   3643 O  O     . LEU B  1 157 ? 12.994  33.469  8.142  1.00 25.16  ? 157 LEU B O     1 
ATOM   3644 C  CB    . LEU B  1 157 ? 12.114  31.933  10.818 1.00 39.62  ? 157 LEU B CB    1 
ATOM   3645 C  CG    . LEU B  1 157 ? 12.638  31.426  12.155 1.00 34.02  ? 157 LEU B CG    1 
ATOM   3646 C  CD1   . LEU B  1 157 ? 12.132  30.021  12.382 1.00 27.07  ? 157 LEU B CD1   1 
ATOM   3647 C  CD2   . LEU B  1 157 ? 14.166  31.430  12.137 1.00 26.46  ? 157 LEU B CD2   1 
ATOM   3648 N  N     . SER B  1 158 ? 10.845  33.933  8.701  1.00 31.24  ? 158 SER B N     1 
ATOM   3649 C  CA    . SER B  1 158 ? 10.421  34.171  7.322  1.00 29.26  ? 158 SER B CA    1 
ATOM   3650 C  C     . SER B  1 158 ? 10.619  35.612  6.882  1.00 35.78  ? 158 SER B C     1 
ATOM   3651 O  O     . SER B  1 158 ? 10.728  35.896  5.692  1.00 42.99  ? 158 SER B O     1 
ATOM   3652 C  CB    . SER B  1 158 ? 8.938   33.829  7.138  1.00 35.64  ? 158 SER B CB    1 
ATOM   3653 O  OG    . SER B  1 158 ? 8.139   34.666  7.953  1.00 29.90  ? 158 SER B OG    1 
ATOM   3654 N  N     . GLY B  1 159 ? 10.674  36.528  7.836  1.00 36.60  ? 159 GLY B N     1 
ATOM   3655 C  CA    . GLY B  1 159 ? 10.807  37.924  7.467  1.00 39.38  ? 159 GLY B CA    1 
ATOM   3656 C  C     . GLY B  1 159 ? 9.472   38.533  7.036  1.00 45.09  ? 159 GLY B C     1 
ATOM   3657 O  O     . GLY B  1 159 ? 9.449   39.629  6.487  1.00 55.86  ? 159 GLY B O     1 
ATOM   3658 N  N     . ARG B  1 160 ? 8.362   37.832  7.276  1.00 36.78  ? 160 ARG B N     1 
ATOM   3659 C  CA    . ARG B  1 160 ? 7.033   38.322  6.883  1.00 47.54  ? 160 ARG B CA    1 
ATOM   3660 C  C     . ARG B  1 160 ? 6.146   38.326  8.098  1.00 45.48  ? 160 ARG B C     1 
ATOM   3661 O  O     . ARG B  1 160 ? 6.315   37.483  8.971  1.00 52.96  ? 160 ARG B O     1 
ATOM   3662 C  CB    . ARG B  1 160 ? 6.342   37.392  5.865  1.00 42.40  ? 160 ARG B CB    1 
ATOM   3663 C  CG    . ARG B  1 160 ? 7.096   37.087  4.611  1.00 49.28  ? 160 ARG B CG    1 
ATOM   3664 C  CD    . ARG B  1 160 ? 7.271   38.297  3.708  1.00 76.70  ? 160 ARG B CD    1 
ATOM   3665 N  NE    . ARG B  1 160 ? 8.022   37.937  2.507  1.00 86.04  ? 160 ARG B NE    1 
ATOM   3666 C  CZ    . ARG B  1 160 ? 7.556   37.150  1.540  1.00 89.53  ? 160 ARG B CZ    1 
ATOM   3667 N  NH1   . ARG B  1 160 ? 6.325   36.643  1.623  1.00 73.19  ? 160 ARG B NH1   1 
ATOM   3668 N  NH2   . ARG B  1 160 ? 8.334   36.848  0.502  1.00 80.95  ? 160 ARG B NH2   1 
ATOM   3669 N  N     . LYS B  1 161 ? 5.182   39.243  8.144  1.00 51.09  ? 161 LYS B N     1 
ATOM   3670 C  CA    . LYS B  1 161 ? 4.245   39.306  9.262  1.00 45.75  ? 161 LYS B CA    1 
ATOM   3671 C  C     . LYS B  1 161 ? 3.112   38.368  8.927  1.00 39.77  ? 161 LYS B C     1 
ATOM   3672 O  O     . LYS B  1 161 ? 2.830   38.146  7.764  1.00 55.78  ? 161 LYS B O     1 
ATOM   3673 C  CB    . LYS B  1 161 ? 3.687   40.726  9.434  1.00 49.07  ? 161 LYS B CB    1 
ATOM   3674 C  CG    . LYS B  1 161 ? 4.123   41.405  10.702 1.00 53.65  ? 161 LYS B CG    1 
ATOM   3675 C  CD    . LYS B  1 161 ? 2.964   42.100  11.395 1.00 70.10  ? 161 LYS B CD    1 
ATOM   3676 C  CE    . LYS B  1 161 ? 3.328   42.454  12.840 1.00 77.94  ? 161 LYS B CE    1 
ATOM   3677 N  NZ    . LYS B  1 161 ? 2.174   43.035  13.591 1.00 82.50  ? 161 LYS B NZ    1 
ATOM   3678 N  N     . ILE B  1 162 ? 2.453   37.816  9.935  1.00 46.54  ? 162 ILE B N     1 
ATOM   3679 C  CA    . ILE B  1 162 ? 1.340   36.914  9.684  1.00 37.39  ? 162 ILE B CA    1 
ATOM   3680 C  C     . ILE B  1 162 ? 0.062   37.481  10.269 1.00 47.02  ? 162 ILE B C     1 
ATOM   3681 O  O     . ILE B  1 162 ? -0.071  37.596  11.480 1.00 52.05  ? 162 ILE B O     1 
ATOM   3682 C  CB    . ILE B  1 162 ? 1.591   35.536  10.307 1.00 41.55  ? 162 ILE B CB    1 
ATOM   3683 C  CG1   . ILE B  1 162 ? 2.757   34.851  9.593  1.00 31.95  ? 162 ILE B CG1   1 
ATOM   3684 C  CG2   . ILE B  1 162 ? 0.313   34.697  10.233 1.00 27.90  ? 162 ILE B CG2   1 
ATOM   3685 C  CD1   . ILE B  1 162 ? 3.144   33.510  10.207 1.00 24.85  ? 162 ILE B CD1   1 
ATOM   3686 N  N     . HIS B  1 163 ? -0.895  37.813  9.409  1.00 48.34  ? 163 HIS B N     1 
ATOM   3687 C  CA    . HIS B  1 163 ? -2.148  38.386  9.881  1.00 44.31  ? 163 HIS B CA    1 
ATOM   3688 C  C     . HIS B  1 163 ? -3.319  37.486  9.623  1.00 34.98  ? 163 HIS B C     1 
ATOM   3689 O  O     . HIS B  1 163 ? -4.411  37.766  10.089 1.00 44.85  ? 163 HIS B O     1 
ATOM   3690 C  CB    . HIS B  1 163 ? -2.441  39.721  9.182  1.00 53.07  ? 163 HIS B CB    1 
ATOM   3691 C  CG    . HIS B  1 163 ? -1.330  40.719  9.272  1.00 65.84  ? 163 HIS B CG    1 
ATOM   3692 N  ND1   . HIS B  1 163 ? -0.599  41.115  8.173  1.00 64.23  ? 163 HIS B ND1   1 
ATOM   3693 C  CD2   . HIS B  1 163 ? -0.847  41.428  10.320 1.00 64.48  ? 163 HIS B CD2   1 
ATOM   3694 C  CE1   . HIS B  1 163 ? 0.287   42.025  8.539  1.00 66.67  ? 163 HIS B CE1   1 
ATOM   3695 N  NE2   . HIS B  1 163 ? 0.155   42.232  9.837  1.00 67.12  ? 163 HIS B NE2   1 
ATOM   3696 N  N     . SER B  1 164 ? -3.105  36.425  8.851  1.00 46.51  ? 164 SER B N     1 
ATOM   3697 C  CA    . SER B  1 164 ? -4.184  35.509  8.506  1.00 38.95  ? 164 SER B CA    1 
ATOM   3698 C  C     . SER B  1 164 ? -3.715  34.097  8.249  1.00 42.45  ? 164 SER B C     1 
ATOM   3699 O  O     . SER B  1 164 ? -2.499  33.834  8.139  1.00 31.59  ? 164 SER B O     1 
ATOM   3700 C  CB    . SER B  1 164 ? -4.894  36.001  7.254  1.00 37.84  ? 164 SER B CB    1 
ATOM   3701 O  OG    . SER B  1 164 ? -3.970  36.152  6.193  1.00 38.20  ? 164 SER B OG    1 
ATOM   3702 N  N     . GLN B  1 165 ? -4.691  33.192  8.137  1.00 26.80  ? 165 GLN B N     1 
ATOM   3703 C  CA    . GLN B  1 165 ? -4.379  31.797  7.859  1.00 33.30  ? 165 GLN B CA    1 
ATOM   3704 C  C     . GLN B  1 165 ? -3.557  31.736  6.574  1.00 41.32  ? 165 GLN B C     1 
ATOM   3705 O  O     . GLN B  1 165 ? -2.525  31.068  6.528  1.00 40.79  ? 165 GLN B O     1 
ATOM   3706 C  CB    . GLN B  1 165 ? -5.645  30.960  7.697  1.00 43.68  ? 165 GLN B CB    1 
ATOM   3707 C  CG    . GLN B  1 165 ? -5.389  29.460  7.715  1.00 32.15  ? 165 GLN B CG    1 
ATOM   3708 C  CD    . GLN B  1 165 ? -6.654  28.657  7.568  1.00 38.69  ? 165 GLN B CD    1 
ATOM   3709 O  OE1   . GLN B  1 165 ? -7.137  28.446  6.460  1.00 49.11  ? 165 GLN B OE1   1 
ATOM   3710 N  NE2   . GLN B  1 165 ? -7.210  28.213  8.689  1.00 33.76  ? 165 GLN B NE2   1 
ATOM   3711 N  N     . GLU B  1 166 ? -3.998  32.459  5.541  1.00 40.63  ? 166 GLU B N     1 
ATOM   3712 C  CA    . GLU B  1 166 ? -3.281  32.472  4.266  1.00 45.38  ? 166 GLU B CA    1 
ATOM   3713 C  C     . GLU B  1 166 ? -1.831  32.917  4.390  1.00 38.21  ? 166 GLU B C     1 
ATOM   3714 O  O     . GLU B  1 166 ? -0.936  32.319  3.782  1.00 46.35  ? 166 GLU B O     1 
ATOM   3715 C  CB    . GLU B  1 166 ? -3.997  33.359  3.236  1.00 53.73  ? 166 GLU B CB    1 
ATOM   3716 C  CG    . GLU B  1 166 ? -5.215  32.715  2.591  1.00 71.33  ? 166 GLU B CG    1 
ATOM   3717 C  CD    . GLU B  1 166 ? -5.811  33.571  1.479  1.00 89.43  ? 166 GLU B CD    1 
ATOM   3718 O  OE1   . GLU B  1 166 ? -6.804  33.125  0.853  1.00 80.93  ? 166 GLU B OE1   1 
ATOM   3719 O  OE2   . GLU B  1 166 ? -5.286  34.689  1.241  1.00 81.72  ? 166 GLU B OE2   1 
ATOM   3720 N  N     . GLU B  1 167 ? -1.576  33.967  5.157  1.00 38.04  ? 167 GLU B N     1 
ATOM   3721 C  CA    . GLU B  1 167 ? -0.190  34.414  5.309  1.00 48.76  ? 167 GLU B CA    1 
ATOM   3722 C  C     . GLU B  1 167 ? 0.640   33.373  6.077  1.00 40.98  ? 167 GLU B C     1 
ATOM   3723 O  O     . GLU B  1 167 ? 1.829   33.162  5.794  1.00 32.12  ? 167 GLU B O     1 
ATOM   3724 C  CB    . GLU B  1 167 ? -0.142  35.767  6.016  1.00 51.34  ? 167 GLU B CB    1 
ATOM   3725 C  CG    . GLU B  1 167 ? -0.971  36.831  5.323  1.00 58.39  ? 167 GLU B CG    1 
ATOM   3726 C  CD    . GLU B  1 167 ? -0.595  38.221  5.763  1.00 56.27  ? 167 GLU B CD    1 
ATOM   3727 O  OE1   . GLU B  1 167 ? 0.434   38.729  5.278  1.00 74.07  ? 167 GLU B OE1   1 
ATOM   3728 O  OE2   . GLU B  1 167 ? -1.309  38.798  6.602  1.00 54.23  ? 167 GLU B OE2   1 
ATOM   3729 N  N     . ALA B  1 168 ? 0.002   32.717  7.041  1.00 26.54  ? 168 ALA B N     1 
ATOM   3730 C  CA    . ALA B  1 168 ? 0.669   31.686  7.827  1.00 36.01  ? 168 ALA B CA    1 
ATOM   3731 C  C     . ALA B  1 168 ? 1.099   30.541  6.913  1.00 40.41  ? 168 ALA B C     1 
ATOM   3732 O  O     . ALA B  1 168 ? 2.251   30.096  6.970  1.00 32.16  ? 168 ALA B O     1 
ATOM   3733 C  CB    . ALA B  1 168 ? -0.257  31.157  8.926  1.00 32.82  ? 168 ALA B CB    1 
ATOM   3734 N  N     . LEU B  1 169 ? 0.189   30.068  6.058  1.00 40.13  ? 169 LEU B N     1 
ATOM   3735 C  CA    . LEU B  1 169 ? 0.538   28.972  5.141  1.00 38.67  ? 169 LEU B CA    1 
ATOM   3736 C  C     . LEU B  1 169 ? 1.685   29.322  4.189  1.00 37.08  ? 169 LEU B C     1 
ATOM   3737 O  O     . LEU B  1 169 ? 2.498   28.461  3.841  1.00 32.17  ? 169 LEU B O     1 
ATOM   3738 C  CB    . LEU B  1 169 ? -0.678  28.534  4.327  1.00 32.12  ? 169 LEU B CB    1 
ATOM   3739 C  CG    . LEU B  1 169 ? -1.838  27.992  5.160  1.00 37.45  ? 169 LEU B CG    1 
ATOM   3740 C  CD1   . LEU B  1 169 ? -2.951  27.590  4.228  1.00 32.66  ? 169 LEU B CD1   1 
ATOM   3741 C  CD2   . LEU B  1 169 ? -1.389  26.786  6.003  1.00 35.53  ? 169 LEU B CD2   1 
ATOM   3742 N  N     . ARG B  1 170 ? 1.745   30.577  3.757  1.00 36.80  ? 170 ARG B N     1 
ATOM   3743 C  CA    . ARG B  1 170 ? 2.814   31.006  2.865  1.00 32.18  ? 170 ARG B CA    1 
ATOM   3744 C  C     . ARG B  1 170 ? 4.120   31.014  3.646  1.00 34.99  ? 170 ARG B C     1 
ATOM   3745 O  O     . ARG B  1 170 ? 5.167   30.611  3.110  1.00 33.03  ? 170 ARG B O     1 
ATOM   3746 C  CB    . ARG B  1 170 ? 2.547   32.415  2.307  1.00 46.49  ? 170 ARG B CB    1 
ATOM   3747 C  CG    . ARG B  1 170 ? 3.690   32.970  1.422  1.00 60.29  ? 170 ARG B CG    1 
ATOM   3748 C  CD    . ARG B  1 170 ? 3.563   34.492  1.171  1.00 86.10  ? 170 ARG B CD    1 
ATOM   3749 N  NE    . ARG B  1 170 ? 3.022   34.835  -0.150 1.00 89.82  ? 170 ARG B NE    1 
ATOM   3750 C  CZ    . ARG B  1 170 ? 1.847   35.431  -0.363 1.00 95.02  ? 170 ARG B CZ    1 
ATOM   3751 N  NH1   . ARG B  1 170 ? 1.059   35.766  0.654  1.00 85.17  ? 170 ARG B NH1   1 
ATOM   3752 N  NH2   . ARG B  1 170 ? 1.455   35.690  -1.604 1.00 93.64  ? 170 ARG B NH2   1 
ATOM   3753 N  N     . VAL B  1 171 ? 4.090   31.480  4.896  1.00 32.97  ? 171 VAL B N     1 
ATOM   3754 C  CA    . VAL B  1 171 ? 5.343   31.466  5.636  1.00 49.89  ? 171 VAL B CA    1 
ATOM   3755 C  C     . VAL B  1 171 ? 5.676   30.012  5.883  1.00 48.00  ? 171 VAL B C     1 
ATOM   3756 O  O     . VAL B  1 171 ? 6.853   29.639  5.843  1.00 39.30  ? 171 VAL B O     1 
ATOM   3757 C  CB    . VAL B  1 171 ? 5.319   32.257  6.984  1.00 48.64  ? 171 VAL B CB    1 
ATOM   3758 C  CG1   . VAL B  1 171 ? 4.971   33.717  6.725  1.00 34.82  ? 171 VAL B CG1   1 
ATOM   3759 C  CG2   . VAL B  1 171 ? 4.368   31.626  7.952  1.00 69.02  ? 171 VAL B CG2   1 
ATOM   3760 N  N     . MET B  1 172 ? 4.664   29.169  6.099  1.00 31.48  ? 172 MET B N     1 
ATOM   3761 C  CA    . MET B  1 172 ? 5.000   27.759  6.301  1.00 38.98  ? 172 MET B CA    1 
ATOM   3762 C  C     . MET B  1 172 ? 5.724   27.166  5.086  1.00 45.51  ? 172 MET B C     1 
ATOM   3763 O  O     . MET B  1 172 ? 6.708   26.420  5.254  1.00 39.01  ? 172 MET B O     1 
ATOM   3764 C  CB    . MET B  1 172 ? 3.778   26.941  6.676  1.00 25.96  ? 172 MET B CB    1 
ATOM   3765 C  CG    . MET B  1 172 ? 3.452   27.100  8.145  1.00 32.44  ? 172 MET B CG    1 
ATOM   3766 S  SD    . MET B  1 172 ? 1.991   26.229  8.669  1.00 46.70  ? 172 MET B SD    1 
ATOM   3767 C  CE    . MET B  1 172 ? 0.903   27.475  8.531  1.00 46.33  ? 172 MET B CE    1 
ATOM   3768 N  N     . ASP B  1 173 ? 5.274   27.504  3.873  1.00 31.35  ? 173 ASP B N     1 
ATOM   3769 C  CA    . ASP B  1 173 ? 5.970   27.016  2.670  1.00 29.06  ? 173 ASP B CA    1 
ATOM   3770 C  C     . ASP B  1 173 ? 7.377   27.622  2.627  1.00 32.71  ? 173 ASP B C     1 
ATOM   3771 O  O     . ASP B  1 173 ? 8.335   26.972  2.209  1.00 36.83  ? 173 ASP B O     1 
ATOM   3772 C  CB    . ASP B  1 173 ? 5.232   27.416  1.387  1.00 45.20  ? 173 ASP B CB    1 
ATOM   3773 C  CG    . ASP B  1 173 ? 3.904   26.691  1.212  1.00 52.39  ? 173 ASP B CG    1 
ATOM   3774 O  OD1   . ASP B  1 173 ? 3.765   25.548  1.706  1.00 45.41  ? 173 ASP B OD1   1 
ATOM   3775 O  OD2   . ASP B  1 173 ? 3.013   27.272  0.562  1.00 48.91  ? 173 ASP B OD2   1 
ATOM   3776 N  N     . MET B  1 174 ? 7.491   28.882  3.049  1.00 35.58  ? 174 MET B N     1 
ATOM   3777 C  CA    . MET B  1 174 ? 8.782   29.547  3.068  1.00 42.12  ? 174 MET B CA    1 
ATOM   3778 C  C     . MET B  1 174 ? 9.697   28.752  3.982  1.00 34.47  ? 174 MET B C     1 
ATOM   3779 O  O     . MET B  1 174 ? 10.835  28.419  3.624  1.00 34.54  ? 174 MET B O     1 
ATOM   3780 C  CB    . MET B  1 174 ? 8.640   30.985  3.578  1.00 46.17  ? 174 MET B CB    1 
ATOM   3781 C  CG    . MET B  1 174 ? 8.195   31.949  2.505  1.00 47.30  ? 174 MET B CG    1 
ATOM   3782 S  SD    . MET B  1 174 ? 8.261   33.679  2.994  1.00 53.18  ? 174 MET B SD    1 
ATOM   3783 C  CE    . MET B  1 174 ? 6.614   33.796  3.520  1.00 34.23  ? 174 MET B CE    1 
ATOM   3784 N  N     . LEU B  1 175 ? 9.186   28.449  5.169  1.00 30.81  ? 175 LEU B N     1 
ATOM   3785 C  CA    . LEU B  1 175 ? 9.930   27.659  6.137  1.00 31.98  ? 175 LEU B CA    1 
ATOM   3786 C  C     . LEU B  1 175 ? 10.345  26.302  5.535  1.00 39.93  ? 175 LEU B C     1 
ATOM   3787 O  O     . LEU B  1 175 ? 11.501  25.893  5.690  1.00 34.39  ? 175 LEU B O     1 
ATOM   3788 C  CB    . LEU B  1 175 ? 9.091   27.492  7.404  1.00 26.62  ? 175 LEU B CB    1 
ATOM   3789 C  CG    . LEU B  1 175 ? 9.001   28.868  8.087  1.00 33.18  ? 175 LEU B CG    1 
ATOM   3790 C  CD1   . LEU B  1 175 ? 8.084   28.801  9.303  1.00 31.94  ? 175 LEU B CD1   1 
ATOM   3791 C  CD2   . LEU B  1 175 ? 10.417  29.321  8.474  1.00 32.02  ? 175 LEU B CD2   1 
ATOM   3792 N  N     . HIS B  1 176 ? 9.425   25.616  4.841  1.00 33.73  ? 176 HIS B N     1 
ATOM   3793 C  CA    . HIS B  1 176 ? 9.760   24.336  4.187  1.00 33.48  ? 176 HIS B CA    1 
ATOM   3794 C  C     . HIS B  1 176 ? 10.914  24.521  3.230  1.00 36.88  ? 176 HIS B C     1 
ATOM   3795 O  O     . HIS B  1 176 ? 11.844  23.712  3.205  1.00 29.74  ? 176 HIS B O     1 
ATOM   3796 C  CB    . HIS B  1 176 ? 8.603   23.771  3.355  1.00 23.11  ? 176 HIS B CB    1 
ATOM   3797 C  CG    . HIS B  1 176 ? 7.538   23.110  4.169  1.00 28.74  ? 176 HIS B CG    1 
ATOM   3798 N  ND1   . HIS B  1 176 ? 7.810   22.082  5.049  1.00 24.36  ? 176 HIS B ND1   1 
ATOM   3799 C  CD2   . HIS B  1 176 ? 6.215   23.367  4.286  1.00 28.44  ? 176 HIS B CD2   1 
ATOM   3800 C  CE1   . HIS B  1 176 ? 6.699   21.740  5.678  1.00 34.33  ? 176 HIS B CE1   1 
ATOM   3801 N  NE2   . HIS B  1 176 ? 5.717   22.505  5.234  1.00 28.03  ? 176 HIS B NE2   1 
ATOM   3802 N  N     . SER B  1 177 ? 10.854  25.588  2.435  1.00 29.20  ? 177 SER B N     1 
ATOM   3803 C  CA    . SER B  1 177 ? 11.902  25.812  1.449  1.00 35.27  ? 177 SER B CA    1 
ATOM   3804 C  C     . SER B  1 177 ? 13.257  26.048  2.101  1.00 39.21  ? 177 SER B C     1 
ATOM   3805 O  O     . SER B  1 177 ? 14.288  25.792  1.487  1.00 40.61  ? 177 SER B O     1 
ATOM   3806 C  CB    . SER B  1 177 ? 11.532  26.980  0.524  1.00 29.04  ? 177 SER B CB    1 
ATOM   3807 O  OG    . SER B  1 177 ? 11.465  28.192  1.253  1.00 58.42  ? 177 SER B OG    1 
ATOM   3808 N  N     . MET B  1 178 ? 13.255  26.535  3.341  1.00 38.71  ? 178 MET B N     1 
ATOM   3809 C  CA    . MET B  1 178 ? 14.504  26.773  4.062  1.00 39.90  ? 178 MET B CA    1 
ATOM   3810 C  C     . MET B  1 178 ? 15.098  25.455  4.488  1.00 46.29  ? 178 MET B C     1 
ATOM   3811 O  O     . MET B  1 178 ? 16.316  25.343  4.690  1.00 40.47  ? 178 MET B O     1 
ATOM   3812 C  CB    . MET B  1 178 ? 14.265  27.637  5.288  1.00 34.96  ? 178 MET B CB    1 
ATOM   3813 C  CG    . MET B  1 178 ? 13.912  29.051  4.932  1.00 39.53  ? 178 MET B CG    1 
ATOM   3814 S  SD    . MET B  1 178 ? 13.375  29.978  6.347  1.00 48.49  ? 178 MET B SD    1 
ATOM   3815 C  CE    . MET B  1 178 ? 14.967  30.195  7.244  1.00 31.14  ? 178 MET B CE    1 
ATOM   3816 N  N     . GLY B  1 179 ? 14.236  24.451  4.632  1.00 36.59  ? 179 GLY B N     1 
ATOM   3817 C  CA    . GLY B  1 179 ? 14.737  23.150  5.029  1.00 39.85  ? 179 GLY B CA    1 
ATOM   3818 C  C     . GLY B  1 179 ? 13.790  22.091  5.563  1.00 32.34  ? 179 GLY B C     1 
ATOM   3819 O  O     . GLY B  1 179 ? 13.506  21.115  4.885  1.00 41.73  ? 179 GLY B O     1 
ATOM   3820 N  N     . PRO B  1 180 ? 13.267  22.268  6.776  1.00 39.31  ? 180 PRO B N     1 
ATOM   3821 C  CA    . PRO B  1 180 ? 12.364  21.278  7.372  1.00 36.03  ? 180 PRO B CA    1 
ATOM   3822 C  C     . PRO B  1 180 ? 11.115  20.823  6.602  1.00 38.32  ? 180 PRO B C     1 
ATOM   3823 O  O     . PRO B  1 180 ? 10.369  21.640  6.057  1.00 32.60  ? 180 PRO B O     1 
ATOM   3824 C  CB    . PRO B  1 180 ? 12.023  21.905  8.729  1.00 30.44  ? 180 PRO B CB    1 
ATOM   3825 C  CG    . PRO B  1 180 ? 12.094  23.384  8.455  1.00 30.34  ? 180 PRO B CG    1 
ATOM   3826 C  CD    . PRO B  1 180 ? 13.331  23.500  7.582  1.00 31.27  ? 180 PRO B CD    1 
ATOM   3827 N  N     . ASP B  1 181 ? 10.892  19.511  6.591  1.00 30.32  ? 181 ASP B N     1 
ATOM   3828 C  CA    . ASP B  1 181 ? 9.719   18.932  5.950  1.00 30.24  ? 181 ASP B CA    1 
ATOM   3829 C  C     . ASP B  1 181 ? 8.498   19.038  6.839  1.00 35.02  ? 181 ASP B C     1 
ATOM   3830 O  O     . ASP B  1 181 ? 7.374   18.869  6.376  1.00 29.02  ? 181 ASP B O     1 
ATOM   3831 C  CB    . ASP B  1 181 ? 9.933   17.464  5.604  1.00 31.94  ? 181 ASP B CB    1 
ATOM   3832 C  CG    . ASP B  1 181 ? 10.956  17.278  4.519  1.00 39.99  ? 181 ASP B CG    1 
ATOM   3833 O  OD1   . ASP B  1 181 ? 11.049  18.172  3.654  1.00 39.27  ? 181 ASP B OD1   1 
ATOM   3834 O  OD2   . ASP B  1 181 ? 11.654  16.246  4.520  1.00 48.06  ? 181 ASP B OD2   1 
ATOM   3835 N  N     . THR B  1 182 ? 8.709   19.298  8.122  1.00 31.09  ? 182 THR B N     1 
ATOM   3836 C  CA    . THR B  1 182 ? 7.576   19.444  9.024  1.00 29.72  ? 182 THR B CA    1 
ATOM   3837 C  C     . THR B  1 182 ? 7.671   20.777  9.752  1.00 33.35  ? 182 THR B C     1 
ATOM   3838 O  O     . THR B  1 182 ? 8.635   21.055  10.479 1.00 31.94  ? 182 THR B O     1 
ATOM   3839 C  CB    . THR B  1 182 ? 7.508   18.304  10.077 1.00 27.34  ? 182 THR B CB    1 
ATOM   3840 O  OG1   . THR B  1 182 ? 7.458   17.043  9.413  1.00 32.53  ? 182 THR B OG1   1 
ATOM   3841 C  CG2   . THR B  1 182 ? 6.261   18.440  10.939 1.00 28.19  ? 182 THR B CG2   1 
ATOM   3842 N  N     . VAL B  1 183 ? 6.667   21.610  9.534  1.00 25.27  ? 183 VAL B N     1 
ATOM   3843 C  CA    . VAL B  1 183 ? 6.591   22.903  10.169 1.00 26.21  ? 183 VAL B CA    1 
ATOM   3844 C  C     . VAL B  1 183 ? 5.326   22.989  10.993 1.00 32.31  ? 183 VAL B C     1 
ATOM   3845 O  O     . VAL B  1 183 ? 4.237   22.804  10.457 1.00 29.64  ? 183 VAL B O     1 
ATOM   3846 C  CB    . VAL B  1 183 ? 6.540   24.043  9.126  1.00 26.70  ? 183 VAL B CB    1 
ATOM   3847 C  CG1   . VAL B  1 183 ? 6.365   25.405  9.846  1.00 27.98  ? 183 VAL B CG1   1 
ATOM   3848 C  CG2   . VAL B  1 183 ? 7.809   24.036  8.303  1.00 22.20  ? 183 VAL B CG2   1 
ATOM   3849 N  N     . VAL B  1 184 ? 5.441   23.194  12.303 1.00 30.78  ? 184 VAL B N     1 
ATOM   3850 C  CA    . VAL B  1 184 ? 4.212   23.391  13.077 1.00 30.43  ? 184 VAL B CA    1 
ATOM   3851 C  C     . VAL B  1 184 ? 4.304   24.750  13.796 1.00 33.65  ? 184 VAL B C     1 
ATOM   3852 O  O     . VAL B  1 184 ? 5.298   25.045  14.469 1.00 31.69  ? 184 VAL B O     1 
ATOM   3853 C  CB    . VAL B  1 184 ? 3.944   22.256  14.105 1.00 29.95  ? 184 VAL B CB    1 
ATOM   3854 C  CG1   . VAL B  1 184 ? 2.678   22.571  14.888 1.00 25.55  ? 184 VAL B CG1   1 
ATOM   3855 C  CG2   . VAL B  1 184 ? 3.762   20.900  13.382 1.00 23.37  ? 184 VAL B CG2   1 
ATOM   3856 N  N     . ILE B  1 185 ? 3.327   25.624  13.563 1.00 36.67  ? 185 ILE B N     1 
ATOM   3857 C  CA    . ILE B  1 185 ? 3.277   26.919  14.254 1.00 36.31  ? 185 ILE B CA    1 
ATOM   3858 C  C     . ILE B  1 185 ? 2.489   26.539  15.497 1.00 33.23  ? 185 ILE B C     1 
ATOM   3859 O  O     . ILE B  1 185 ? 1.287   26.280  15.437 1.00 33.15  ? 185 ILE B O     1 
ATOM   3860 C  CB    . ILE B  1 185 ? 2.548   27.996  13.425 1.00 30.84  ? 185 ILE B CB    1 
ATOM   3861 C  CG1   . ILE B  1 185 ? 3.363   28.285  12.166 1.00 23.15  ? 185 ILE B CG1   1 
ATOM   3862 C  CG2   . ILE B  1 185 ? 2.356   29.281  14.246 1.00 29.35  ? 185 ILE B CG2   1 
ATOM   3863 C  CD1   . ILE B  1 185 ? 2.722   29.329  11.212 1.00 30.44  ? 185 ILE B CD1   1 
ATOM   3864 N  N     . THR B  1 186 ? 3.185   26.485  16.621 1.00 31.81  ? 186 THR B N     1 
ATOM   3865 C  CA    . THR B  1 186 ? 2.604   26.049  17.880 1.00 26.06  ? 186 THR B CA    1 
ATOM   3866 C  C     . THR B  1 186 ? 1.628   26.973  18.591 1.00 28.91  ? 186 THR B C     1 
ATOM   3867 O  O     . THR B  1 186 ? 0.951   26.547  19.526 1.00 35.62  ? 186 THR B O     1 
ATOM   3868 C  CB    . THR B  1 186 ? 3.731   25.679  18.850 1.00 37.45  ? 186 THR B CB    1 
ATOM   3869 O  OG1   . THR B  1 186 ? 4.522   26.844  19.093 1.00 29.27  ? 186 THR B OG1   1 
ATOM   3870 C  CG2   . THR B  1 186 ? 4.640   24.612  18.226 1.00 31.43  ? 186 THR B CG2   1 
ATOM   3871 N  N     . SER B  1 187 ? 1.560   28.237  18.179 1.00 33.28  ? 187 SER B N     1 
ATOM   3872 C  CA    . SER B  1 187 ? 0.606   29.181  18.778 1.00 32.51  ? 187 SER B CA    1 
ATOM   3873 C  C     . SER B  1 187 ? 0.577   30.432  17.932 1.00 33.20  ? 187 SER B C     1 
ATOM   3874 O  O     . SER B  1 187 ? 1.596   30.829  17.355 1.00 37.54  ? 187 SER B O     1 
ATOM   3875 C  CB    . SER B  1 187 ? 0.983   29.540  20.231 1.00 23.73  ? 187 SER B CB    1 
ATOM   3876 O  OG    . SER B  1 187 ? 2.261   30.169  20.308 1.00 31.54  ? 187 SER B OG    1 
ATOM   3877 N  N     . SER B  1 188 ? -0.591  31.064  17.870 1.00 33.11  ? 188 SER B N     1 
ATOM   3878 C  CA    . SER B  1 188 ? -0.793  32.270  17.073 1.00 27.83  ? 188 SER B CA    1 
ATOM   3879 C  C     . SER B  1 188 ? -2.097  32.885  17.532 1.00 32.02  ? 188 SER B C     1 
ATOM   3880 O  O     . SER B  1 188 ? -2.956  32.181  18.058 1.00 34.89  ? 188 SER B O     1 
ATOM   3881 C  CB    . SER B  1 188 ? -0.934  31.906  15.592 1.00 29.50  ? 188 SER B CB    1 
ATOM   3882 O  OG    . SER B  1 188 ? -2.200  31.310  15.353 1.00 36.31  ? 188 SER B OG    1 
ATOM   3883 N  N     . ASP B  1 189 ? -2.259  34.184  17.319 1.00 30.29  ? 189 ASP B N     1 
ATOM   3884 C  CA    . ASP B  1 189 ? -3.498  34.845  17.713 1.00 50.42  ? 189 ASP B CA    1 
ATOM   3885 C  C     . ASP B  1 189 ? -4.462  35.003  16.526 1.00 49.22  ? 189 ASP B C     1 
ATOM   3886 O  O     . ASP B  1 189 ? -5.347  35.861  16.546 1.00 59.82  ? 189 ASP B O     1 
ATOM   3887 C  CB    . ASP B  1 189 ? -3.204  36.215  18.318 1.00 42.41  ? 189 ASP B CB    1 
ATOM   3888 C  CG    . ASP B  1 189 ? -2.371  37.079  17.405 1.00 60.39  ? 189 ASP B CG    1 
ATOM   3889 O  OD1   . ASP B  1 189 ? -2.575  37.023  16.165 1.00 64.63  ? 189 ASP B OD1   1 
ATOM   3890 O  OD2   . ASP B  1 189 ? -1.516  37.822  17.930 1.00 74.66  ? 189 ASP B OD2   1 
ATOM   3891 N  N     . LEU B  1 190 ? -4.281  34.178  15.498 1.00 42.86  ? 190 LEU B N     1 
ATOM   3892 C  CA    . LEU B  1 190 ? -5.145  34.226  14.326 1.00 41.11  ? 190 LEU B CA    1 
ATOM   3893 C  C     . LEU B  1 190 ? -6.603  34.134  14.766 1.00 40.41  ? 190 LEU B C     1 
ATOM   3894 O  O     . LEU B  1 190 ? -6.915  33.652  15.851 1.00 39.09  ? 190 LEU B O     1 
ATOM   3895 C  CB    . LEU B  1 190 ? -4.822  33.080  13.339 1.00 32.31  ? 190 LEU B CB    1 
ATOM   3896 C  CG    . LEU B  1 190 ? -3.505  33.138  12.571 1.00 38.09  ? 190 LEU B CG    1 
ATOM   3897 C  CD1   . LEU B  1 190 ? -3.412  31.919  11.679 1.00 37.41  ? 190 LEU B CD1   1 
ATOM   3898 C  CD2   . LEU B  1 190 ? -3.410  34.430  11.751 1.00 44.33  ? 190 LEU B CD2   1 
ATOM   3899 N  N     . PRO B  1 191 ? -7.520  34.607  13.917 1.00 44.11  ? 191 PRO B N     1 
ATOM   3900 C  CA    . PRO B  1 191 ? -8.955  34.586  14.218 1.00 43.02  ? 191 PRO B CA    1 
ATOM   3901 C  C     . PRO B  1 191 ? -9.550  33.179  14.266 1.00 44.32  ? 191 PRO B C     1 
ATOM   3902 O  O     . PRO B  1 191 ? -9.202  32.324  13.457 1.00 49.13  ? 191 PRO B O     1 
ATOM   3903 C  CB    . PRO B  1 191 ? -9.552  35.407  13.073 1.00 44.78  ? 191 PRO B CB    1 
ATOM   3904 C  CG    . PRO B  1 191 ? -8.391  36.241  12.560 1.00 33.31  ? 191 PRO B CG    1 
ATOM   3905 C  CD    . PRO B  1 191 ? -7.244  35.309  12.651 1.00 38.69  ? 191 PRO B CD    1 
ATOM   3906 N  N     . SER B  1 192 ? -10.461 32.944  15.203 1.00 47.81  ? 192 SER B N     1 
ATOM   3907 C  CA    . SER B  1 192 ? -11.130 31.652  15.318 1.00 43.20  ? 192 SER B CA    1 
ATOM   3908 C  C     . SER B  1 192 ? -12.636 31.807  15.229 1.00 52.37  ? 192 SER B C     1 
ATOM   3909 O  O     . SER B  1 192 ? -13.206 32.678  15.882 1.00 53.96  ? 192 SER B O     1 
ATOM   3910 C  CB    . SER B  1 192 ? -10.838 30.977  16.656 1.00 37.62  ? 192 SER B CB    1 
ATOM   3911 O  OG    . SER B  1 192 ? -11.745 29.878  16.857 1.00 36.31  ? 192 SER B OG    1 
ATOM   3912 N  N     . PRO B  1 193 ? -13.311 30.950  14.442 1.00 49.66  ? 193 PRO B N     1 
ATOM   3913 C  CA    . PRO B  1 193 ? -14.766 31.079  14.347 1.00 53.17  ? 193 PRO B CA    1 
ATOM   3914 C  C     . PRO B  1 193 ? -15.453 30.644  15.629 1.00 56.38  ? 193 PRO B C     1 
ATOM   3915 O  O     . PRO B  1 193 ? -16.679 30.641  15.725 1.00 65.72  ? 193 PRO B O     1 
ATOM   3916 C  CB    . PRO B  1 193 ? -15.126 30.193  13.149 1.00 53.41  ? 193 PRO B CB    1 
ATOM   3917 C  CG    . PRO B  1 193 ? -14.021 29.199  13.081 1.00 40.36  ? 193 PRO B CG    1 
ATOM   3918 C  CD    . PRO B  1 193 ? -12.793 30.016  13.424 1.00 51.99  ? 193 PRO B CD    1 
ATOM   3919 N  N     . GLN B  1 194 ? -14.650 30.293  16.624 1.00 56.71  ? 194 GLN B N     1 
ATOM   3920 C  CA    . GLN B  1 194 ? -15.184 29.850  17.898 1.00 50.38  ? 194 GLN B CA    1 
ATOM   3921 C  C     . GLN B  1 194 ? -15.075 30.914  18.991 1.00 53.17  ? 194 GLN B C     1 
ATOM   3922 O  O     . GLN B  1 194 ? -15.484 30.692  20.131 1.00 60.01  ? 194 GLN B O     1 
ATOM   3923 C  CB    . GLN B  1 194 ? -14.462 28.576  18.314 1.00 48.30  ? 194 GLN B CB    1 
ATOM   3924 C  CG    . GLN B  1 194 ? -15.342 27.367  18.297 1.00 73.70  ? 194 GLN B CG    1 
ATOM   3925 C  CD    . GLN B  1 194 ? -14.547 26.095  18.318 1.00 83.99  ? 194 GLN B CD    1 
ATOM   3926 O  OE1   . GLN B  1 194 ? -13.897 25.754  17.332 1.00 96.34  ? 194 GLN B OE1   1 
ATOM   3927 N  NE2   . GLN B  1 194 ? -14.579 25.384  19.443 1.00 86.49  ? 194 GLN B NE2   1 
ATOM   3928 N  N     . GLY B  1 195 ? -14.539 32.079  18.644 1.00 52.79  ? 195 GLY B N     1 
ATOM   3929 C  CA    . GLY B  1 195 ? -14.400 33.130  19.632 1.00 48.87  ? 195 GLY B CA    1 
ATOM   3930 C  C     . GLY B  1 195 ? -13.010 33.731  19.599 1.00 57.16  ? 195 GLY B C     1 
ATOM   3931 O  O     . GLY B  1 195 ? -12.156 33.327  18.803 1.00 63.77  ? 195 GLY B O     1 
ATOM   3932 N  N     . SER B  1 196 ? -12.771 34.700  20.469 1.00 54.32  ? 196 SER B N     1 
ATOM   3933 C  CA    . SER B  1 196 ? -11.471 35.350  20.508 1.00 57.72  ? 196 SER B CA    1 
ATOM   3934 C  C     . SER B  1 196 ? -10.536 34.688  21.510 1.00 53.26  ? 196 SER B C     1 
ATOM   3935 O  O     . SER B  1 196 ? -9.315  34.800  21.414 1.00 47.55  ? 196 SER B O     1 
ATOM   3936 C  CB    . SER B  1 196 ? -11.646 36.841  20.830 1.00 61.26  ? 196 SER B CB    1 
ATOM   3937 O  OG    . SER B  1 196 ? -12.588 37.033  21.875 1.00 64.93  ? 196 SER B OG    1 
ATOM   3938 N  N     . ASN B  1 197 ? -11.117 33.984  22.472 1.00 53.36  ? 197 ASN B N     1 
ATOM   3939 C  CA    . ASN B  1 197 ? -10.329 33.313  23.491 1.00 59.94  ? 197 ASN B CA    1 
ATOM   3940 C  C     . ASN B  1 197 ? -9.792  31.980  22.959 1.00 57.40  ? 197 ASN B C     1 
ATOM   3941 O  O     . ASN B  1 197 ? -9.915  30.928  23.602 1.00 46.34  ? 197 ASN B O     1 
ATOM   3942 C  CB    . ASN B  1 197 ? -11.188 33.101  24.742 1.00 74.74  ? 197 ASN B CB    1 
ATOM   3943 C  CG    . ASN B  1 197 ? -10.359 32.835  25.980 1.00 85.61  ? 197 ASN B CG    1 
ATOM   3944 O  OD1   . ASN B  1 197 ? -9.411  33.571  26.277 1.00 89.69  ? 197 ASN B OD1   1 
ATOM   3945 N  ND2   . ASN B  1 197 ? -10.719 31.786  26.721 1.00 87.37  ? 197 ASN B ND2   1 
ATOM   3946 N  N     . TYR B  1 198 ? -9.220  32.030  21.762 1.00 49.64  ? 198 TYR B N     1 
ATOM   3947 C  CA    . TYR B  1 198 ? -8.640  30.851  21.138 1.00 47.28  ? 198 TYR B CA    1 
ATOM   3948 C  C     . TYR B  1 198 ? -7.290  31.170  20.541 1.00 44.73  ? 198 TYR B C     1 
ATOM   3949 O  O     . TYR B  1 198 ? -7.061  32.276  20.060 1.00 56.88  ? 198 TYR B O     1 
ATOM   3950 C  CB    . TYR B  1 198 ? -9.529  30.312  20.018 1.00 44.90  ? 198 TYR B CB    1 
ATOM   3951 C  CG    . TYR B  1 198 ? -10.705 29.529  20.508 1.00 42.16  ? 198 TYR B CG    1 
ATOM   3952 C  CD1   . TYR B  1 198 ? -11.811 30.167  21.078 1.00 46.00  ? 198 TYR B CD1   1 
ATOM   3953 C  CD2   . TYR B  1 198 ? -10.703 28.141  20.442 1.00 41.12  ? 198 TYR B CD2   1 
ATOM   3954 C  CE1   . TYR B  1 198 ? -12.888 29.426  21.580 1.00 37.89  ? 198 TYR B CE1   1 
ATOM   3955 C  CE2   . TYR B  1 198 ? -11.768 27.391  20.940 1.00 47.96  ? 198 TYR B CE2   1 
ATOM   3956 C  CZ    . TYR B  1 198 ? -12.852 28.038  21.510 1.00 51.16  ? 198 TYR B CZ    1 
ATOM   3957 O  OH    . TYR B  1 198 ? -13.873 27.286  22.049 1.00 66.77  ? 198 TYR B OH    1 
ATOM   3958 N  N     . LEU B  1 199 ? -6.394  30.194  20.585 1.00 43.19  ? 199 LEU B N     1 
ATOM   3959 C  CA    . LEU B  1 199 ? -5.074  30.343  19.994 1.00 39.51  ? 199 LEU B CA    1 
ATOM   3960 C  C     . LEU B  1 199 ? -5.129  29.320  18.871 1.00 40.99  ? 199 LEU B C     1 
ATOM   3961 O  O     . LEU B  1 199 ? -5.855  28.323  18.957 1.00 34.30  ? 199 LEU B O     1 
ATOM   3962 C  CB    . LEU B  1 199 ? -3.981  30.020  21.015 1.00 39.03  ? 199 LEU B CB    1 
ATOM   3963 C  CG    . LEU B  1 199 ? -3.812  28.601  21.541 1.00 41.63  ? 199 LEU B CG    1 
ATOM   3964 C  CD1   . LEU B  1 199 ? -2.932  27.819  20.577 1.00 37.32  ? 199 LEU B CD1   1 
ATOM   3965 C  CD2   . LEU B  1 199 ? -3.178  28.642  22.930 1.00 41.30  ? 199 LEU B CD2   1 
ATOM   3966 N  N     . ILE B  1 200 ? -4.374  29.557  17.814 1.00 37.05  ? 200 ILE B N     1 
ATOM   3967 C  CA    . ILE B  1 200 ? -4.436  28.675  16.673 1.00 36.67  ? 200 ILE B CA    1 
ATOM   3968 C  C     . ILE B  1 200 ? -3.145  27.930  16.373 1.00 44.47  ? 200 ILE B C     1 
ATOM   3969 O  O     . ILE B  1 200 ? -2.070  28.526  16.323 1.00 33.63  ? 200 ILE B O     1 
ATOM   3970 C  CB    . ILE B  1 200 ? -4.839  29.496  15.419 1.00 40.05  ? 200 ILE B CB    1 
ATOM   3971 C  CG1   . ILE B  1 200 ? -6.184  30.179  15.666 1.00 44.54  ? 200 ILE B CG1   1 
ATOM   3972 C  CG2   . ILE B  1 200 ? -4.893  28.610  14.180 1.00 38.51  ? 200 ILE B CG2   1 
ATOM   3973 C  CD1   . ILE B  1 200 ? -7.320  29.231  15.900 1.00 46.91  ? 200 ILE B CD1   1 
ATOM   3974 N  N     . VAL B  1 201 ? -3.262  26.619  16.172 1.00 38.45  ? 201 VAL B N     1 
ATOM   3975 C  CA    . VAL B  1 201 ? -2.105  25.799  15.805 1.00 40.86  ? 201 VAL B CA    1 
ATOM   3976 C  C     . VAL B  1 201 ? -2.229  25.432  14.340 1.00 37.89  ? 201 VAL B C     1 
ATOM   3977 O  O     . VAL B  1 201 ? -3.306  25.052  13.876 1.00 25.72  ? 201 VAL B O     1 
ATOM   3978 C  CB    . VAL B  1 201 ? -2.017  24.481  16.625 1.00 38.81  ? 201 VAL B CB    1 
ATOM   3979 C  CG1   . VAL B  1 201 ? -1.006  23.500  15.973 1.00 22.86  ? 201 VAL B CG1   1 
ATOM   3980 C  CG2   . VAL B  1 201 ? -1.587  24.801  18.031 1.00 32.38  ? 201 VAL B CG2   1 
ATOM   3981 N  N     . LEU B  1 202 ? -1.134  25.559  13.606 1.00 27.69  ? 202 LEU B N     1 
ATOM   3982 C  CA    . LEU B  1 202 ? -1.142  25.185  12.202 1.00 23.44  ? 202 LEU B CA    1 
ATOM   3983 C  C     . LEU B  1 202 ? -0.028  24.196  11.936 1.00 31.89  ? 202 LEU B C     1 
ATOM   3984 O  O     . LEU B  1 202 ? 1.085   24.337  12.441 1.00 33.47  ? 202 LEU B O     1 
ATOM   3985 C  CB    . LEU B  1 202 ? -0.955  26.414  11.308 1.00 27.95  ? 202 LEU B CB    1 
ATOM   3986 C  CG    . LEU B  1 202 ? -2.067  27.459  11.370 1.00 36.79  ? 202 LEU B CG    1 
ATOM   3987 C  CD1   . LEU B  1 202 ? -1.653  28.685  10.614 1.00 27.36  ? 202 LEU B CD1   1 
ATOM   3988 C  CD2   . LEU B  1 202 ? -3.353  26.873  10.790 1.00 32.22  ? 202 LEU B CD2   1 
ATOM   3989 N  N     . GLY B  1 203 ? -0.319  23.187  11.135 1.00 24.89  ? 203 GLY B N     1 
ATOM   3990 C  CA    . GLY B  1 203 ? 0.704   22.215  10.831 1.00 35.27  ? 203 GLY B CA    1 
ATOM   3991 C  C     . GLY B  1 203 ? 0.747   21.889  9.354  1.00 40.48  ? 203 GLY B C     1 
ATOM   3992 O  O     . GLY B  1 203 ? -0.286  21.812  8.682  1.00 30.75  ? 203 GLY B O     1 
ATOM   3993 N  N     . SER B  1 204 ? 1.958   21.652  8.871  1.00 25.05  ? 204 SER B N     1 
ATOM   3994 C  CA    . SER B  1 204 ? 2.205   21.350  7.480  1.00 32.55  ? 204 SER B CA    1 
ATOM   3995 C  C     . SER B  1 204 ? 3.362   20.346  7.395  1.00 29.52  ? 204 SER B C     1 
ATOM   3996 O  O     . SER B  1 204 ? 4.418   20.548  7.988  1.00 28.68  ? 204 SER B O     1 
ATOM   3997 C  CB    . SER B  1 204 ? 2.557   22.659  6.753  1.00 32.03  ? 204 SER B CB    1 
ATOM   3998 O  OG    . SER B  1 204 ? 3.042   22.435  5.453  1.00 36.99  ? 204 SER B OG    1 
ATOM   3999 N  N     . GLN B  1 205 ? 3.162   19.266  6.649  1.00 28.83  ? 205 GLN B N     1 
ATOM   4000 C  CA    . GLN B  1 205 ? 4.195   18.266  6.513  1.00 31.82  ? 205 GLN B CA    1 
ATOM   4001 C  C     . GLN B  1 205 ? 4.317   17.800  5.078  1.00 34.08  ? 205 GLN B C     1 
ATOM   4002 O  O     . GLN B  1 205 ? 3.316   17.465  4.443  1.00 31.16  ? 205 GLN B O     1 
ATOM   4003 C  CB    . GLN B  1 205 ? 3.904   17.076  7.440  1.00 33.59  ? 205 GLN B CB    1 
ATOM   4004 C  CG    . GLN B  1 205 ? 4.994   15.983  7.423  1.00 30.57  ? 205 GLN B CG    1 
ATOM   4005 C  CD    . GLN B  1 205 ? 4.728   14.883  8.450  1.00 47.97  ? 205 GLN B CD    1 
ATOM   4006 O  OE1   . GLN B  1 205 ? 5.396   14.790  9.492  1.00 38.43  ? 205 GLN B OE1   1 
ATOM   4007 N  NE2   . GLN B  1 205 ? 3.738   14.055  8.165  1.00 23.22  ? 205 GLN B NE2   1 
ATOM   4008 N  N     . ARG B  1 206 ? 5.544   17.812  4.576  1.00 26.69  ? 206 ARG B N     1 
ATOM   4009 C  CA    . ARG B  1 206 ? 5.877   17.362  3.225  1.00 34.00  ? 206 ARG B CA    1 
ATOM   4010 C  C     . ARG B  1 206 ? 6.573   16.015  3.336  1.00 38.77  ? 206 ARG B C     1 
ATOM   4011 O  O     . ARG B  1 206 ? 7.536   15.845  4.099  1.00 35.33  ? 206 ARG B O     1 
ATOM   4012 C  CB    . ARG B  1 206 ? 6.829   18.348  2.515  1.00 25.37  ? 206 ARG B CB    1 
ATOM   4013 C  CG    . ARG B  1 206 ? 6.262   19.747  2.434  1.00 37.85  ? 206 ARG B CG    1 
ATOM   4014 C  CD    . ARG B  1 206 ? 7.185   20.671  1.695  1.00 30.58  ? 206 ARG B CD    1 
ATOM   4015 N  NE    . ARG B  1 206 ? 7.024   20.500  0.262  1.00 39.80  ? 206 ARG B NE    1 
ATOM   4016 C  CZ    . ARG B  1 206 ? 7.978   20.087  -0.550 1.00 52.69  ? 206 ARG B CZ    1 
ATOM   4017 N  NH1   . ARG B  1 206 ? 9.186   19.796  -0.067 1.00 51.36  ? 206 ARG B NH1   1 
ATOM   4018 N  NH2   . ARG B  1 206 ? 7.725   19.994  -1.846 1.00 42.91  ? 206 ARG B NH2   1 
ATOM   4019 N  N     . ARG B  1 207 ? 6.082   15.056  2.574  1.00 34.02  ? 207 ARG B N     1 
ATOM   4020 C  CA    . ARG B  1 207 ? 6.648   13.738  2.595  1.00 37.87  ? 207 ARG B CA    1 
ATOM   4021 C  C     . ARG B  1 207 ? 6.439   13.081  1.233  1.00 48.55  ? 207 ARG B C     1 
ATOM   4022 O  O     . ARG B  1 207 ? 5.541   13.446  0.463  1.00 38.09  ? 207 ARG B O     1 
ATOM   4023 C  CB    . ARG B  1 207 ? 5.988   12.913  3.709  1.00 33.21  ? 207 ARG B CB    1 
ATOM   4024 C  CG    . ARG B  1 207 ? 4.511   12.684  3.529  1.00 36.73  ? 207 ARG B CG    1 
ATOM   4025 C  CD    . ARG B  1 207 ? 3.815   12.404  4.855  1.00 31.11  ? 207 ARG B CD    1 
ATOM   4026 N  NE    . ARG B  1 207 ? 2.420   12.057  4.605  1.00 33.88  ? 207 ARG B NE    1 
ATOM   4027 C  CZ    . ARG B  1 207 ? 1.386   12.533  5.284  1.00 35.25  ? 207 ARG B CZ    1 
ATOM   4028 N  NH1   . ARG B  1 207 ? 1.562   13.388  6.279  1.00 26.14  ? 207 ARG B NH1   1 
ATOM   4029 N  NH2   . ARG B  1 207 ? 0.159   12.193  4.933  1.00 33.75  ? 207 ARG B NH2   1 
ATOM   4030 N  N     . ARG B  1 208 ? 7.294   12.122  0.948  1.00 47.26  ? 208 ARG B N     1 
ATOM   4031 C  CA    . ARG B  1 208 ? 7.251   11.366  -0.291 1.00 47.00  ? 208 ARG B CA    1 
ATOM   4032 C  C     . ARG B  1 208 ? 6.557   10.049  0.023  1.00 48.93  ? 208 ARG B C     1 
ATOM   4033 O  O     . ARG B  1 208 ? 7.090   9.264   0.795  1.00 50.83  ? 208 ARG B O     1 
ATOM   4034 C  CB    . ARG B  1 208 ? 8.670   11.099  -0.754 1.00 36.94  ? 208 ARG B CB    1 
ATOM   4035 C  CG    . ARG B  1 208 ? 8.794   10.443  -2.103 1.00 61.63  ? 208 ARG B CG    1 
ATOM   4036 C  CD    . ARG B  1 208 ? 10.276  10.200  -2.409 1.00 62.89  ? 208 ARG B CD    1 
ATOM   4037 N  NE    . ARG B  1 208 ? 11.051  11.430  -2.590 1.00 61.67  ? 208 ARG B NE    1 
ATOM   4038 C  CZ    . ARG B  1 208 ? 11.064  12.145  -3.711 1.00 65.52  ? 208 ARG B CZ    1 
ATOM   4039 N  NH1   . ARG B  1 208 ? 10.344  11.757  -4.759 1.00 67.57  ? 208 ARG B NH1   1 
ATOM   4040 N  NH2   . ARG B  1 208 ? 11.813  13.237  -3.798 1.00 63.64  ? 208 ARG B NH2   1 
ATOM   4041 N  N     . ASN B  1 209 ? 5.384   9.817   -0.569 1.00 45.27  ? 209 ASN B N     1 
ATOM   4042 C  CA    . ASN B  1 209 ? 4.619   8.587   -0.334 1.00 51.99  ? 209 ASN B CA    1 
ATOM   4043 C  C     . ASN B  1 209 ? 5.230   7.353   -1.010 1.00 55.72  ? 209 ASN B C     1 
ATOM   4044 O  O     . ASN B  1 209 ? 6.165   7.467   -1.807 1.00 57.39  ? 209 ASN B O     1 
ATOM   4045 C  CB    . ASN B  1 209 ? 3.146   8.758   -0.773 1.00 47.50  ? 209 ASN B CB    1 
ATOM   4046 C  CG    . ASN B  1 209 ? 2.977   8.921   -2.281 1.00 50.67  ? 209 ASN B CG    1 
ATOM   4047 O  OD1   . ASN B  1 209 ? 3.726   8.358   -3.071 1.00 43.92  ? 209 ASN B OD1   1 
ATOM   4048 N  ND2   . ASN B  1 209 ? 1.966   9.685   -2.681 1.00 66.34  ? 209 ASN B ND2   1 
ATOM   4049 N  N     . PRO B  1 210 ? 4.703   6.154   -0.703 1.00 57.52  ? 210 PRO B N     1 
ATOM   4050 C  CA    . PRO B  1 210 ? 5.198   4.893   -1.278 1.00 57.38  ? 210 PRO B CA    1 
ATOM   4051 C  C     . PRO B  1 210 ? 5.446   4.951   -2.788 1.00 58.54  ? 210 PRO B C     1 
ATOM   4052 O  O     . PRO B  1 210 ? 6.497   4.515   -3.263 1.00 51.12  ? 210 PRO B O     1 
ATOM   4053 C  CB    . PRO B  1 210 ? 4.102   3.901   -0.913 1.00 63.37  ? 210 PRO B CB    1 
ATOM   4054 C  CG    . PRO B  1 210 ? 3.607   4.433   0.404  1.00 65.54  ? 210 PRO B CG    1 
ATOM   4055 C  CD    . PRO B  1 210 ? 3.510   5.913   0.130  1.00 58.69  ? 210 PRO B CD    1 
ATOM   4056 N  N     . ALA B  1 211 ? 4.472   5.475   -3.532 1.00 51.50  ? 211 ALA B N     1 
ATOM   4057 C  CA    . ALA B  1 211 ? 4.586   5.608   -4.981 1.00 46.22  ? 211 ALA B CA    1 
ATOM   4058 C  C     . ALA B  1 211 ? 5.758   6.507   -5.338 1.00 53.75  ? 211 ALA B C     1 
ATOM   4059 O  O     . ALA B  1 211 ? 6.261   6.487   -6.460 1.00 63.72  ? 211 ALA B O     1 
ATOM   4060 C  CB    . ALA B  1 211 ? 3.315   6.189   -5.546 1.00 49.02  ? 211 ALA B CB    1 
ATOM   4061 N  N     . GLY B  1 212 ? 6.189   7.315   -4.381 1.00 57.07  ? 212 GLY B N     1 
ATOM   4062 C  CA    . GLY B  1 212 ? 7.304   8.197   -4.644 1.00 56.26  ? 212 GLY B CA    1 
ATOM   4063 C  C     . GLY B  1 212 ? 6.870   9.611   -4.956 1.00 57.43  ? 212 GLY B C     1 
ATOM   4064 O  O     . GLY B  1 212 ? 7.700   10.424  -5.355 1.00 51.74  ? 212 GLY B O     1 
ATOM   4065 N  N     . SER B  1 213 ? 5.583   9.916   -4.794 1.00 47.54  ? 213 SER B N     1 
ATOM   4066 C  CA    . SER B  1 213 ? 5.124   11.277  -5.056 1.00 46.54  ? 213 SER B CA    1 
ATOM   4067 C  C     . SER B  1 213 ? 5.319   12.126  -3.797 1.00 45.55  ? 213 SER B C     1 
ATOM   4068 O  O     . SER B  1 213 ? 5.019   11.669  -2.700 1.00 42.98  ? 213 SER B O     1 
ATOM   4069 C  CB    . SER B  1 213 ? 3.652   11.279  -5.451 1.00 51.82  ? 213 SER B CB    1 
ATOM   4070 O  OG    . SER B  1 213 ? 3.463   10.575  -6.662 1.00 64.17  ? 213 SER B OG    1 
ATOM   4071 N  N     . VAL B  1 214 ? 5.834   13.346  -3.962 1.00 42.28  ? 214 VAL B N     1 
ATOM   4072 C  CA    . VAL B  1 214 ? 6.046   14.261  -2.841 1.00 38.42  ? 214 VAL B CA    1 
ATOM   4073 C  C     . VAL B  1 214 ? 4.745   14.997  -2.572 1.00 34.93  ? 214 VAL B C     1 
ATOM   4074 O  O     . VAL B  1 214 ? 4.337   15.811  -3.385 1.00 39.31  ? 214 VAL B O     1 
ATOM   4075 C  CB    . VAL B  1 214 ? 7.123   15.332  -3.156 1.00 41.70  ? 214 VAL B CB    1 
ATOM   4076 C  CG1   . VAL B  1 214 ? 7.249   16.328  -2.002 1.00 40.68  ? 214 VAL B CG1   1 
ATOM   4077 C  CG2   . VAL B  1 214 ? 8.446   14.673  -3.404 1.00 27.29  ? 214 VAL B CG2   1 
ATOM   4078 N  N     . VAL B  1 215 ? 4.101   14.714  -1.443 1.00 32.53  ? 215 VAL B N     1 
ATOM   4079 C  CA    . VAL B  1 215 ? 2.858   15.389  -1.101 1.00 27.19  ? 215 VAL B CA    1 
ATOM   4080 C  C     . VAL B  1 215 ? 2.966   16.185  0.199  1.00 37.28  ? 215 VAL B C     1 
ATOM   4081 O  O     . VAL B  1 215 ? 3.982   16.131  0.904  1.00 33.74  ? 215 VAL B O     1 
ATOM   4082 C  CB    . VAL B  1 215 ? 1.682   14.387  -0.983 1.00 32.45  ? 215 VAL B CB    1 
ATOM   4083 C  CG1   . VAL B  1 215 ? 1.503   13.655  -2.304 1.00 35.86  ? 215 VAL B CG1   1 
ATOM   4084 C  CG2   . VAL B  1 215 ? 1.933   13.391  0.152  1.00 35.44  ? 215 VAL B CG2   1 
ATOM   4085 N  N     . MET B  1 216 ? 1.908   16.922  0.515  1.00 32.92  ? 216 MET B N     1 
ATOM   4086 C  CA    . MET B  1 216 ? 1.896   17.754  1.694  1.00 28.24  ? 216 MET B CA    1 
ATOM   4087 C  C     . MET B  1 216 ? 0.577   17.704  2.445  1.00 36.42  ? 216 MET B C     1 
ATOM   4088 O  O     . MET B  1 216 ? -0.495  17.876  1.861  1.00 31.58  ? 216 MET B O     1 
ATOM   4089 C  CB    . MET B  1 216 ? 2.191   19.193  1.298  1.00 22.83  ? 216 MET B CB    1 
ATOM   4090 C  CG    . MET B  1 216 ? 2.275   20.170  2.478  1.00 32.84  ? 216 MET B CG    1 
ATOM   4091 S  SD    . MET B  1 216 ? 2.431   21.876  1.890  1.00 47.86  ? 216 MET B SD    1 
ATOM   4092 C  CE    . MET B  1 216 ? 4.125   22.052  1.837  1.00 52.99  ? 216 MET B CE    1 
ATOM   4093 N  N     . GLU B  1 217 ? 0.669   17.457  3.741  1.00 31.36  ? 217 GLU B N     1 
ATOM   4094 C  CA    . GLU B  1 217 ? -0.501  17.403  4.588  1.00 37.39  ? 217 GLU B CA    1 
ATOM   4095 C  C     . GLU B  1 217 ? -0.483  18.698  5.383  1.00 35.22  ? 217 GLU B C     1 
ATOM   4096 O  O     . GLU B  1 217 ? 0.576   19.149  5.821  1.00 27.63  ? 217 GLU B O     1 
ATOM   4097 C  CB    . GLU B  1 217 ? -0.435  16.202  5.529  1.00 37.18  ? 217 GLU B CB    1 
ATOM   4098 C  CG    . GLU B  1 217 ? -1.739  15.970  6.260  1.00 33.98  ? 217 GLU B CG    1 
ATOM   4099 C  CD    . GLU B  1 217 ? -1.689  14.800  7.217  1.00 35.73  ? 217 GLU B CD    1 
ATOM   4100 O  OE1   . GLU B  1 217 ? -0.715  14.027  7.166  1.00 35.64  ? 217 GLU B OE1   1 
ATOM   4101 O  OE2   . GLU B  1 217 ? -2.639  14.640  8.008  1.00 33.91  ? 217 GLU B OE2   1 
ATOM   4102 N  N     . ARG B  1 218 ? -1.653  19.307  5.554  1.00 22.34  ? 218 ARG B N     1 
ATOM   4103 C  CA    . ARG B  1 218 ? -1.780  20.567  6.271  1.00 27.34  ? 218 ARG B CA    1 
ATOM   4104 C  C     . ARG B  1 218 ? -2.951  20.501  7.261  1.00 34.26  ? 218 ARG B C     1 
ATOM   4105 O  O     . ARG B  1 218 ? -4.012  20.000  6.920  1.00 28.65  ? 218 ARG B O     1 
ATOM   4106 C  CB    . ARG B  1 218 ? -1.996  21.701  5.257  1.00 25.95  ? 218 ARG B CB    1 
ATOM   4107 C  CG    . ARG B  1 218 ? -1.000  22.808  5.368  1.00 47.54  ? 218 ARG B CG    1 
ATOM   4108 C  CD    . ARG B  1 218 ? -0.376  23.193  4.042  1.00 45.62  ? 218 ARG B CD    1 
ATOM   4109 N  NE    . ARG B  1 218 ? -1.309  23.818  3.101  1.00 52.02  ? 218 ARG B NE    1 
ATOM   4110 C  CZ    . ARG B  1 218 ? -0.958  24.759  2.220  1.00 55.10  ? 218 ARG B CZ    1 
ATOM   4111 N  NH1   . ARG B  1 218 ? 0.299   25.196  2.155  1.00 47.26  ? 218 ARG B NH1   1 
ATOM   4112 N  NH2   . ARG B  1 218 ? -1.855  25.258  1.387  1.00 41.00  ? 218 ARG B NH2   1 
ATOM   4113 N  N     . ILE B  1 219 ? -2.756  20.974  8.487  1.00 32.03  ? 219 ILE B N     1 
ATOM   4114 C  CA    . ILE B  1 219 ? -3.854  20.940  9.451  1.00 29.31  ? 219 ILE B CA    1 
ATOM   4115 C  C     . ILE B  1 219 ? -3.916  22.193  10.282 1.00 34.28  ? 219 ILE B C     1 
ATOM   4116 O  O     . ILE B  1 219 ? -2.986  23.015  10.294 1.00 28.73  ? 219 ILE B O     1 
ATOM   4117 C  CB    . ILE B  1 219 ? -3.785  19.718  10.422 1.00 31.67  ? 219 ILE B CB    1 
ATOM   4118 C  CG1   . ILE B  1 219 ? -2.533  19.802  11.316 1.00 32.27  ? 219 ILE B CG1   1 
ATOM   4119 C  CG2   . ILE B  1 219 ? -3.855  18.407  9.606  1.00 18.86  ? 219 ILE B CG2   1 
ATOM   4120 C  CD1   . ILE B  1 219 ? -2.729  20.545  12.683 1.00 26.30  ? 219 ILE B CD1   1 
ATOM   4121 N  N     . ARG B  1 220 ? -5.035  22.321  10.980 1.00 27.16  ? 220 ARG B N     1 
ATOM   4122 C  CA    . ARG B  1 220 ? -5.285  23.447  11.841 1.00 33.41  ? 220 ARG B CA    1 
ATOM   4123 C  C     . ARG B  1 220 ? -6.052  22.996  13.062 1.00 34.39  ? 220 ARG B C     1 
ATOM   4124 O  O     . ARG B  1 220 ? -6.939  22.160  12.955 1.00 31.62  ? 220 ARG B O     1 
ATOM   4125 C  CB    . ARG B  1 220 ? -6.104  24.516  11.108 1.00 39.11  ? 220 ARG B CB    1 
ATOM   4126 C  CG    . ARG B  1 220 ? -6.668  25.575  12.050 1.00 45.03  ? 220 ARG B CG    1 
ATOM   4127 C  CD    . ARG B  1 220 ? -7.601  26.505  11.333 1.00 47.00  ? 220 ARG B CD    1 
ATOM   4128 N  NE    . ARG B  1 220 ? -8.227  27.446  12.248 1.00 37.31  ? 220 ARG B NE    1 
ATOM   4129 C  CZ    . ARG B  1 220 ? -8.251  28.765  12.074 1.00 37.64  ? 220 ARG B CZ    1 
ATOM   4130 N  NH1   . ARG B  1 220 ? -7.673  29.323  11.012 1.00 36.98  ? 220 ARG B NH1   1 
ATOM   4131 N  NH2   . ARG B  1 220 ? -8.861  29.526  12.967 1.00 31.25  ? 220 ARG B NH2   1 
ATOM   4132 N  N     . MET B  1 221 ? -5.729  23.593  14.206 1.00 34.15  ? 221 MET B N     1 
ATOM   4133 C  CA    . MET B  1 221 ? -6.399  23.307  15.468 1.00 40.45  ? 221 MET B CA    1 
ATOM   4134 C  C     . MET B  1 221 ? -6.738  24.612  16.204 1.00 36.38  ? 221 MET B C     1 
ATOM   4135 O  O     . MET B  1 221 ? -5.920  25.526  16.290 1.00 36.11  ? 221 MET B O     1 
ATOM   4136 C  CB    . MET B  1 221 ? -5.520  22.409  16.358 1.00 37.79  ? 221 MET B CB    1 
ATOM   4137 C  CG    . MET B  1 221 ? -5.390  21.011  15.835 1.00 37.36  ? 221 MET B CG    1 
ATOM   4138 S  SD    . MET B  1 221 ? -4.696  19.842  17.012 1.00 39.05  ? 221 MET B SD    1 
ATOM   4139 C  CE    . MET B  1 221 ? -3.067  19.987  16.504 1.00 48.89  ? 221 MET B CE    1 
ATOM   4140 N  N     . ASP B  1 222 ? -7.957  24.680  16.726 1.00 37.75  ? 222 ASP B N     1 
ATOM   4141 C  CA    . ASP B  1 222 ? -8.432  25.852  17.460 1.00 42.29  ? 222 ASP B CA    1 
ATOM   4142 C  C     . ASP B  1 222 ? -8.501  25.479  18.937 1.00 44.40  ? 222 ASP B C     1 
ATOM   4143 O  O     . ASP B  1 222 ? -9.431  24.797  19.385 1.00 39.02  ? 222 ASP B O     1 
ATOM   4144 C  CB    . ASP B  1 222 ? -9.820  26.283  16.929 1.00 38.52  ? 222 ASP B CB    1 
ATOM   4145 C  CG    . ASP B  1 222 ? -9.746  26.920  15.536 1.00 40.32  ? 222 ASP B CG    1 
ATOM   4146 O  OD1   . ASP B  1 222 ? -9.225  26.281  14.595 1.00 44.89  ? 222 ASP B OD1   1 
ATOM   4147 O  OD2   . ASP B  1 222 ? -10.209 28.069  15.378 1.00 49.30  ? 222 ASP B OD2   1 
ATOM   4148 N  N     . ILE B  1 223 ? -7.487  25.911  19.686 1.00 50.38  ? 223 ILE B N     1 
ATOM   4149 C  CA    . ILE B  1 223 ? -7.394  25.625  21.118 1.00 46.21  ? 223 ILE B CA    1 
ATOM   4150 C  C     . ILE B  1 223 ? -7.957  26.769  21.954 1.00 42.03  ? 223 ILE B C     1 
ATOM   4151 O  O     . ILE B  1 223 ? -7.610  27.930  21.743 1.00 45.24  ? 223 ILE B O     1 
ATOM   4152 C  CB    . ILE B  1 223 ? -5.911  25.391  21.563 1.00 42.06  ? 223 ILE B CB    1 
ATOM   4153 C  CG1   . ILE B  1 223 ? -5.356  24.116  20.942 1.00 41.18  ? 223 ILE B CG1   1 
ATOM   4154 C  CG2   . ILE B  1 223 ? -5.828  25.254  23.076 1.00 40.87  ? 223 ILE B CG2   1 
ATOM   4155 C  CD1   . ILE B  1 223 ? -5.056  24.231  19.491 1.00 45.42  ? 223 ILE B CD1   1 
ATOM   4156 N  N     . ARG B  1 224 ? -8.804  26.440  22.919 1.00 43.55  ? 224 ARG B N     1 
ATOM   4157 C  CA    . ARG B  1 224 ? -9.380  27.468  23.789 1.00 48.00  ? 224 ARG B CA    1 
ATOM   4158 C  C     . ARG B  1 224 ? -8.309  27.927  24.784 1.00 43.83  ? 224 ARG B C     1 
ATOM   4159 O  O     . ARG B  1 224 ? -7.660  27.100  25.417 1.00 46.78  ? 224 ARG B O     1 
ATOM   4160 C  CB    . ARG B  1 224 ? -10.588 26.899  24.542 1.00 49.84  ? 224 ARG B CB    1 
ATOM   4161 C  CG    . ARG B  1 224 ? -11.293 27.903  25.455 1.00 62.28  ? 224 ARG B CG    1 
ATOM   4162 C  CD    . ARG B  1 224 ? -12.299 27.201  26.367 1.00 69.54  ? 224 ARG B CD    1 
ATOM   4163 N  NE    . ARG B  1 224 ? -11.671 26.144  27.168 1.00 92.24  ? 224 ARG B NE    1 
ATOM   4164 C  CZ    . ARG B  1 224 ? -10.781 26.347  28.143 1.00 93.63  ? 224 ARG B CZ    1 
ATOM   4165 N  NH1   . ARG B  1 224 ? -10.391 27.578  28.460 1.00 85.18  ? 224 ARG B NH1   1 
ATOM   4166 N  NH2   . ARG B  1 224 ? -10.265 25.309  28.795 1.00 85.35  ? 224 ARG B NH2   1 
ATOM   4167 N  N     . LYS B  1 225 ? -8.123  29.237  24.921 1.00 51.20  ? 225 LYS B N     1 
ATOM   4168 C  CA    . LYS B  1 225 ? -7.116  29.765  25.841 1.00 55.89  ? 225 LYS B CA    1 
ATOM   4169 C  C     . LYS B  1 225 ? -7.491  29.668  27.307 1.00 59.26  ? 225 LYS B C     1 
ATOM   4170 O  O     . LYS B  1 225 ? -8.635  29.898  27.681 1.00 71.95  ? 225 LYS B O     1 
ATOM   4171 C  CB    . LYS B  1 225 ? -6.803  31.222  25.525 1.00 50.59  ? 225 LYS B CB    1 
ATOM   4172 C  CG    . LYS B  1 225 ? -5.725  31.390  24.489 1.00 53.77  ? 225 LYS B CG    1 
ATOM   4173 C  CD    . LYS B  1 225 ? -5.308  32.835  24.346 1.00 53.98  ? 225 LYS B CD    1 
ATOM   4174 C  CE    . LYS B  1 225 ? -6.438  33.705  23.801 1.00 73.59  ? 225 LYS B CE    1 
ATOM   4175 N  NZ    . LYS B  1 225 ? -6.059  35.155  23.760 1.00 68.04  ? 225 LYS B NZ    1 
ATOM   4176 N  N     . VAL B  1 226 ? -6.520  29.307  28.139 1.00 67.37  ? 226 VAL B N     1 
ATOM   4177 C  CA    . VAL B  1 226 ? -6.755  29.236  29.571 1.00 64.60  ? 226 VAL B CA    1 
ATOM   4178 C  C     . VAL B  1 226 ? -6.179  30.521  30.099 1.00 71.97  ? 226 VAL B C     1 
ATOM   4179 O  O     . VAL B  1 226 ? -5.259  31.080  29.502 1.00 67.36  ? 226 VAL B O     1 
ATOM   4180 C  CB    . VAL B  1 226 ? -6.020  28.084  30.253 1.00 72.84  ? 226 VAL B CB    1 
ATOM   4181 C  CG1   . VAL B  1 226 ? -6.185  28.192  31.756 1.00 74.67  ? 226 VAL B CG1   1 
ATOM   4182 C  CG2   . VAL B  1 226 ? -6.576  26.757  29.773 1.00 78.73  ? 226 VAL B CG2   1 
ATOM   4183 N  N     . ASP B  1 227 ? -6.723  30.968  31.220 1.00 83.92  ? 227 ASP B N     1 
ATOM   4184 C  CA    . ASP B  1 227 ? -6.327  32.206  31.884 1.00 89.13  ? 227 ASP B CA    1 
ATOM   4185 C  C     . ASP B  1 227 ? -5.095  32.022  32.761 1.00 88.57  ? 227 ASP B C     1 
ATOM   4186 O  O     . ASP B  1 227 ? -5.226  31.866  33.976 1.00 97.42  ? 227 ASP B O     1 
ATOM   4187 C  CB    . ASP B  1 227 ? -7.491  32.678  32.751 1.00 90.97  ? 227 ASP B CB    1 
ATOM   4188 C  CG    . ASP B  1 227 ? -7.400  34.138  33.108 1.00 94.74  ? 227 ASP B CG    1 
ATOM   4189 O  OD1   . ASP B  1 227 ? -8.039  34.549  34.103 1.00 93.66  ? 227 ASP B OD1   1 
ATOM   4190 O  OD2   . ASP B  1 227 ? -6.691  34.874  32.393 1.00 93.40  ? 227 ASP B OD2   1 
ATOM   4191 N  N     . ALA B  1 228 ? -3.913  32.027  32.150 1.00 78.66  ? 228 ALA B N     1 
ATOM   4192 C  CA    . ALA B  1 228 ? -2.668  31.876  32.879 1.00 60.54  ? 228 ALA B CA    1 
ATOM   4193 C  C     . ALA B  1 228 ? -1.529  31.741  31.915 1.00 60.73  ? 228 ALA B C     1 
ATOM   4194 O  O     . ALA B  1 228 ? -1.734  31.435  30.749 1.00 61.87  ? 228 ALA B O     1 
ATOM   4195 C  CB    . ALA B  1 228 ? -2.726  30.677  33.757 1.00 47.53  ? 228 ALA B CB    1 
ATOM   4196 N  N     . VAL B  1 229 ? -0.323  31.982  32.408 1.00 61.20  ? 229 VAL B N     1 
ATOM   4197 C  CA    . VAL B  1 229 ? 0.873   31.852  31.594 1.00 52.35  ? 229 VAL B CA    1 
ATOM   4198 C  C     . VAL B  1 229 ? 1.615   30.629  32.090 1.00 43.55  ? 229 VAL B C     1 
ATOM   4199 O  O     . VAL B  1 229 ? 1.879   30.473  33.282 1.00 37.70  ? 229 VAL B O     1 
ATOM   4200 C  CB    . VAL B  1 229 ? 1.770   33.077  31.696 1.00 56.84  ? 229 VAL B CB    1 
ATOM   4201 C  CG1   . VAL B  1 229 ? 3.051   32.842  30.932 1.00 56.19  ? 229 VAL B CG1   1 
ATOM   4202 C  CG2   . VAL B  1 229 ? 1.040   34.273  31.128 1.00 62.08  ? 229 VAL B CG2   1 
ATOM   4203 N  N     . PHE B  1 230 ? 1.905   29.735  31.164 1.00 35.23  ? 230 PHE B N     1 
ATOM   4204 C  CA    . PHE B  1 230 ? 2.599   28.510  31.493 1.00 35.81  ? 230 PHE B CA    1 
ATOM   4205 C  C     . PHE B  1 230 ? 3.995   28.572  30.893 1.00 41.46  ? 230 PHE B C     1 
ATOM   4206 O  O     . PHE B  1 230 ? 4.192   29.163  29.839 1.00 44.69  ? 230 PHE B O     1 
ATOM   4207 C  CB    . PHE B  1 230 ? 1.830   27.346  30.907 1.00 40.24  ? 230 PHE B CB    1 
ATOM   4208 C  CG    . PHE B  1 230 ? 0.482   27.157  31.520 1.00 36.62  ? 230 PHE B CG    1 
ATOM   4209 C  CD1   . PHE B  1 230 ? 0.351   26.518  32.749 1.00 37.35  ? 230 PHE B CD1   1 
ATOM   4210 C  CD2   . PHE B  1 230 ? -0.656  27.615  30.872 1.00 36.10  ? 230 PHE B CD2   1 
ATOM   4211 C  CE1   . PHE B  1 230 ? -0.916  26.330  33.333 1.00 41.29  ? 230 PHE B CE1   1 
ATOM   4212 C  CE2   . PHE B  1 230 ? -1.930  27.439  31.439 1.00 35.52  ? 230 PHE B CE2   1 
ATOM   4213 C  CZ    . PHE B  1 230 ? -2.057  26.791  32.679 1.00 35.84  ? 230 PHE B CZ    1 
ATOM   4214 N  N     . VAL B  1 231 ? 4.972   27.993  31.569 1.00 37.28  ? 231 VAL B N     1 
ATOM   4215 C  CA    . VAL B  1 231 ? 6.324   27.977  31.025 1.00 35.36  ? 231 VAL B CA    1 
ATOM   4216 C  C     . VAL B  1 231 ? 6.625   26.488  30.825 1.00 42.04  ? 231 VAL B C     1 
ATOM   4217 O  O     . VAL B  1 231 ? 6.201   25.655  31.627 1.00 36.42  ? 231 VAL B O     1 
ATOM   4218 C  CB    . VAL B  1 231 ? 7.310   28.612  32.011 1.00 34.06  ? 231 VAL B CB    1 
ATOM   4219 C  CG1   . VAL B  1 231 ? 8.656   28.802  31.342 1.00 33.64  ? 231 VAL B CG1   1 
ATOM   4220 C  CG2   . VAL B  1 231 ? 6.778   29.941  32.495 1.00 29.51  ? 231 VAL B CG2   1 
ATOM   4221 N  N     . GLY B  1 232 ? 7.321   26.143  29.749 1.00 39.19  ? 232 GLY B N     1 
ATOM   4222 C  CA    . GLY B  1 232 ? 7.613   24.742  29.493 1.00 36.88  ? 232 GLY B CA    1 
ATOM   4223 C  C     . GLY B  1 232 ? 6.667   24.017  28.531 1.00 31.17  ? 232 GLY B C     1 
ATOM   4224 O  O     . GLY B  1 232 ? 7.006   22.965  28.016 1.00 26.79  ? 232 GLY B O     1 
ATOM   4225 N  N     . THR B  1 233 ? 5.490   24.585  28.274 1.00 31.45  ? 233 THR B N     1 
ATOM   4226 C  CA    . THR B  1 233 ? 4.517   23.954  27.384 1.00 32.83  ? 233 THR B CA    1 
ATOM   4227 C  C     . THR B  1 233 ? 4.983   23.924  25.928 1.00 28.83  ? 233 THR B C     1 
ATOM   4228 O  O     . THR B  1 233 ? 4.608   23.038  25.167 1.00 34.01  ? 233 THR B O     1 
ATOM   4229 C  CB    . THR B  1 233 ? 3.152   24.671  27.473 1.00 36.58  ? 233 THR B CB    1 
ATOM   4230 O  OG1   . THR B  1 233 ? 3.372   26.083  27.445 1.00 35.95  ? 233 THR B OG1   1 
ATOM   4231 C  CG2   . THR B  1 233 ? 2.414   24.314  28.775 1.00 26.66  ? 233 THR B CG2   1 
ATOM   4232 N  N     . GLY B  1 234 ? 5.781   24.914  25.542 1.00 37.87  ? 234 GLY B N     1 
ATOM   4233 C  CA    . GLY B  1 234 ? 6.324   24.964  24.201 1.00 28.27  ? 234 GLY B CA    1 
ATOM   4234 C  C     . GLY B  1 234 ? 7.352   23.847  24.090 1.00 34.26  ? 234 GLY B C     1 
ATOM   4235 O  O     . GLY B  1 234 ? 7.475   23.179  23.059 1.00 30.06  ? 234 GLY B O     1 
ATOM   4236 N  N     . ASP B  1 235 ? 8.104   23.648  25.164 1.00 31.68  ? 235 ASP B N     1 
ATOM   4237 C  CA    . ASP B  1 235 ? 9.097   22.584  25.195 1.00 33.88  ? 235 ASP B CA    1 
ATOM   4238 C  C     . ASP B  1 235 ? 8.422   21.211  25.146 1.00 30.86  ? 235 ASP B C     1 
ATOM   4239 O  O     . ASP B  1 235 ? 8.880   20.305  24.449 1.00 24.40  ? 235 ASP B O     1 
ATOM   4240 C  CB    . ASP B  1 235 ? 9.923   22.677  26.460 1.00 34.65  ? 235 ASP B CB    1 
ATOM   4241 C  CG    . ASP B  1 235 ? 10.654  23.968  26.572 1.00 32.73  ? 235 ASP B CG    1 
ATOM   4242 O  OD1   . ASP B  1 235 ? 11.171  24.491  25.552 1.00 27.36  ? 235 ASP B OD1   1 
ATOM   4243 O  OD2   . ASP B  1 235 ? 10.719  24.457  27.702 1.00 33.76  ? 235 ASP B OD2   1 
ATOM   4244 N  N     . LEU B  1 236 ? 7.332   21.060  25.897 1.00 23.51  ? 236 LEU B N     1 
ATOM   4245 C  CA    . LEU B  1 236 ? 6.596   19.803  25.926 1.00 25.80  ? 236 LEU B CA    1 
ATOM   4246 C  C     . LEU B  1 236 ? 5.976   19.509  24.555 1.00 28.43  ? 236 LEU B C     1 
ATOM   4247 O  O     . LEU B  1 236 ? 5.891   18.346  24.139 1.00 31.14  ? 236 LEU B O     1 
ATOM   4248 C  CB    . LEU B  1 236 ? 5.480   19.853  27.014 1.00 18.41  ? 236 LEU B CB    1 
ATOM   4249 C  CG    . LEU B  1 236 ? 4.559   18.618  27.125 1.00 25.36  ? 236 LEU B CG    1 
ATOM   4250 C  CD1   . LEU B  1 236 ? 5.382   17.381  27.464 1.00 24.74  ? 236 LEU B CD1   1 
ATOM   4251 C  CD2   . LEU B  1 236 ? 3.513   18.822  28.213 1.00 19.27  ? 236 LEU B CD2   1 
ATOM   4252 N  N     . PHE B  1 237 ? 5.525   20.560  23.867 1.00 35.18  ? 237 PHE B N     1 
ATOM   4253 C  CA    . PHE B  1 237 ? 4.895   20.430  22.544 1.00 30.31  ? 237 PHE B CA    1 
ATOM   4254 C  C     . PHE B  1 237 ? 5.904   19.827  21.572 1.00 27.77  ? 237 PHE B C     1 
ATOM   4255 O  O     . PHE B  1 237 ? 5.623   18.846  20.886 1.00 23.88  ? 237 PHE B O     1 
ATOM   4256 C  CB    . PHE B  1 237 ? 4.449   21.813  22.013 1.00 26.45  ? 237 PHE B CB    1 
ATOM   4257 C  CG    . PHE B  1 237 ? 3.580   21.753  20.763 1.00 25.75  ? 237 PHE B CG    1 
ATOM   4258 C  CD1   . PHE B  1 237 ? 2.213   22.009  20.830 1.00 31.33  ? 237 PHE B CD1   1 
ATOM   4259 C  CD2   . PHE B  1 237 ? 4.113   21.382  19.539 1.00 18.69  ? 237 PHE B CD2   1 
ATOM   4260 C  CE1   . PHE B  1 237 ? 1.396   21.892  19.690 1.00 31.90  ? 237 PHE B CE1   1 
ATOM   4261 C  CE2   . PHE B  1 237 ? 3.311   21.256  18.395 1.00 29.39  ? 237 PHE B CE2   1 
ATOM   4262 C  CZ    . PHE B  1 237 ? 1.945   21.511  18.473 1.00 39.87  ? 237 PHE B CZ    1 
ATOM   4263 N  N     . ALA B  1 238 ? 7.094   20.409  21.516 1.00 29.25  ? 238 ALA B N     1 
ATOM   4264 C  CA    . ALA B  1 238 ? 8.081   19.901  20.594 1.00 24.23  ? 238 ALA B CA    1 
ATOM   4265 C  C     . ALA B  1 238 ? 8.410   18.437  20.925 1.00 26.77  ? 238 ALA B C     1 
ATOM   4266 O  O     . ALA B  1 238 ? 8.490   17.590  20.029 1.00 28.05  ? 238 ALA B O     1 
ATOM   4267 C  CB    . ALA B  1 238 ? 9.345   20.793  20.625 1.00 24.49  ? 238 ALA B CB    1 
ATOM   4268 N  N     . ALA B  1 239 ? 8.580   18.145  22.213 1.00 30.18  ? 239 ALA B N     1 
ATOM   4269 C  CA    . ALA B  1 239 ? 8.934   16.798  22.670 1.00 22.23  ? 239 ALA B CA    1 
ATOM   4270 C  C     . ALA B  1 239 ? 7.920   15.739  22.244 1.00 33.21  ? 239 ALA B C     1 
ATOM   4271 O  O     . ALA B  1 239 ? 8.290   14.641  21.799 1.00 27.60  ? 239 ALA B O     1 
ATOM   4272 C  CB    . ALA B  1 239 ? 9.080   16.793  24.199 1.00 22.13  ? 239 ALA B CB    1 
ATOM   4273 N  N     . MET B  1 240 ? 6.639   16.074  22.400 1.00 23.93  ? 240 MET B N     1 
ATOM   4274 C  CA    . MET B  1 240 ? 5.550   15.182  22.052 1.00 29.92  ? 240 MET B CA    1 
ATOM   4275 C  C     . MET B  1 240 ? 5.331   15.111  20.555 1.00 33.22  ? 240 MET B C     1 
ATOM   4276 O  O     . MET B  1 240 ? 4.872   14.083  20.056 1.00 37.28  ? 240 MET B O     1 
ATOM   4277 C  CB    . MET B  1 240 ? 4.247   15.610  22.751 1.00 23.83  ? 240 MET B CB    1 
ATOM   4278 C  CG    . MET B  1 240 ? 4.298   15.508  24.275 1.00 27.68  ? 240 MET B CG    1 
ATOM   4279 S  SD    . MET B  1 240 ? 4.588   13.835  24.884 1.00 36.33  ? 240 MET B SD    1 
ATOM   4280 C  CE    . MET B  1 240 ? 6.384   13.689  24.761 1.00 22.50  ? 240 MET B CE    1 
ATOM   4281 N  N     . LEU B  1 241 ? 5.639   16.198  19.847 1.00 31.89  ? 241 LEU B N     1 
ATOM   4282 C  CA    . LEU B  1 241 ? 5.495   16.227  18.405 1.00 28.58  ? 241 LEU B CA    1 
ATOM   4283 C  C     . LEU B  1 241 ? 6.484   15.214  17.864 1.00 30.93  ? 241 LEU B C     1 
ATOM   4284 O  O     . LEU B  1 241 ? 6.181   14.442  16.955 1.00 31.18  ? 241 LEU B O     1 
ATOM   4285 C  CB    . LEU B  1 241 ? 5.799   17.632  17.832 1.00 28.13  ? 241 LEU B CB    1 
ATOM   4286 C  CG    . LEU B  1 241 ? 5.588   17.707  16.308 1.00 32.14  ? 241 LEU B CG    1 
ATOM   4287 C  CD1   . LEU B  1 241 ? 4.146   17.378  15.981 1.00 25.35  ? 241 LEU B CD1   1 
ATOM   4288 C  CD2   . LEU B  1 241 ? 5.919   19.055  15.771 1.00 36.60  ? 241 LEU B CD2   1 
ATOM   4289 N  N     . LEU B  1 242 ? 7.676   15.212  18.445 1.00 27.76  ? 242 LEU B N     1 
ATOM   4290 C  CA    . LEU B  1 242 ? 8.723   14.265  18.050 1.00 24.36  ? 242 LEU B CA    1 
ATOM   4291 C  C     . LEU B  1 242 ? 8.211   12.855  18.283 1.00 22.95  ? 242 LEU B C     1 
ATOM   4292 O  O     . LEU B  1 242 ? 8.276   11.996  17.412 1.00 30.91  ? 242 LEU B O     1 
ATOM   4293 C  CB    . LEU B  1 242 ? 9.974   14.484  18.926 1.00 19.89  ? 242 LEU B CB    1 
ATOM   4294 C  CG    . LEU B  1 242 ? 11.220  13.605  18.706 1.00 34.13  ? 242 LEU B CG    1 
ATOM   4295 C  CD1   . LEU B  1 242 ? 12.447  14.251  19.396 1.00 28.51  ? 242 LEU B CD1   1 
ATOM   4296 C  CD2   . LEU B  1 242 ? 10.989  12.205  19.258 1.00 30.46  ? 242 LEU B CD2   1 
ATOM   4297 N  N     . ALA B  1 243 ? 7.695   12.627  19.485 1.00 27.84  ? 243 ALA B N     1 
ATOM   4298 C  CA    . ALA B  1 243 ? 7.202   11.309  19.864 1.00 27.26  ? 243 ALA B CA    1 
ATOM   4299 C  C     . ALA B  1 243 ? 6.053   10.765  18.991 1.00 29.39  ? 243 ALA B C     1 
ATOM   4300 O  O     . ALA B  1 243 ? 6.097   9.604   18.570 1.00 26.24  ? 243 ALA B O     1 
ATOM   4301 C  CB    . ALA B  1 243 ? 6.802   11.320  21.350 1.00 21.98  ? 243 ALA B CB    1 
ATOM   4302 N  N     . TRP B  1 244 ? 5.047   11.596  18.710 1.00 29.54  ? 244 TRP B N     1 
ATOM   4303 C  CA    . TRP B  1 244 ? 3.896   11.181  17.903 1.00 28.39  ? 244 TRP B CA    1 
ATOM   4304 C  C     . TRP B  1 244 ? 4.098   11.245  16.382 1.00 34.93  ? 244 TRP B C     1 
ATOM   4305 O  O     . TRP B  1 244 ? 3.361   10.607  15.654 1.00 31.20  ? 244 TRP B O     1 
ATOM   4306 C  CB    . TRP B  1 244 ? 2.660   11.964  18.334 1.00 21.57  ? 244 TRP B CB    1 
ATOM   4307 C  CG    . TRP B  1 244 ? 2.282   11.667  19.768 1.00 26.00  ? 244 TRP B CG    1 
ATOM   4308 C  CD1   . TRP B  1 244 ? 2.208   12.562  20.794 1.00 29.59  ? 244 TRP B CD1   1 
ATOM   4309 C  CD2   . TRP B  1 244 ? 1.966   10.380  20.333 1.00 25.49  ? 244 TRP B CD2   1 
ATOM   4310 N  NE1   . TRP B  1 244 ? 1.881   11.919  21.964 1.00 23.93  ? 244 TRP B NE1   1 
ATOM   4311 C  CE2   . TRP B  1 244 ? 1.727   10.581  21.713 1.00 22.67  ? 244 TRP B CE2   1 
ATOM   4312 C  CE3   . TRP B  1 244 ? 1.852   9.080   19.804 1.00 30.14  ? 244 TRP B CE3   1 
ATOM   4313 C  CZ2   . TRP B  1 244 ? 1.384   9.528   22.584 1.00 31.37  ? 244 TRP B CZ2   1 
ATOM   4314 C  CZ3   . TRP B  1 244 ? 1.503   8.027   20.667 1.00 23.71  ? 244 TRP B CZ3   1 
ATOM   4315 C  CH2   . TRP B  1 244 ? 1.279   8.264   22.045 1.00 42.46  ? 244 TRP B CH2   1 
ATOM   4316 N  N     . THR B  1 245 ? 5.055   12.023  15.870 1.00 34.80  ? 245 THR B N     1 
ATOM   4317 C  CA    . THR B  1 245 ? 5.279   11.929  14.427 1.00 31.84  ? 245 THR B CA    1 
ATOM   4318 C  C     . THR B  1 245 ? 6.152   10.682  14.225 1.00 29.97  ? 245 THR B C     1 
ATOM   4319 O  O     . THR B  1 245 ? 6.199   10.112  13.146 1.00 34.15  ? 245 THR B O     1 
ATOM   4320 C  CB    . THR B  1 245 ? 6.013   13.129  13.804 1.00 29.97  ? 245 THR B CB    1 
ATOM   4321 O  OG1   . THR B  1 245 ? 7.275   13.339  14.463 1.00 32.01  ? 245 THR B OG1   1 
ATOM   4322 C  CG2   . THR B  1 245 ? 5.128   14.348  13.854 1.00 21.88  ? 245 THR B CG2   1 
ATOM   4323 N  N     . HIS B  1 246 ? 6.860   10.277  15.270 1.00 34.75  ? 246 HIS B N     1 
ATOM   4324 C  CA    . HIS B  1 246 ? 7.676   9.067   15.211 1.00 34.08  ? 246 HIS B CA    1 
ATOM   4325 C  C     . HIS B  1 246 ? 6.730   7.852   15.094 1.00 40.30  ? 246 HIS B C     1 
ATOM   4326 O  O     . HIS B  1 246 ? 7.009   6.878   14.394 1.00 34.78  ? 246 HIS B O     1 
ATOM   4327 C  CB    . HIS B  1 246 ? 8.498   8.899   16.490 1.00 28.12  ? 246 HIS B CB    1 
ATOM   4328 C  CG    . HIS B  1 246 ? 9.211   7.585   16.561 1.00 35.82  ? 246 HIS B CG    1 
ATOM   4329 N  ND1   . HIS B  1 246 ? 10.298  7.290   15.765 1.00 34.21  ? 246 HIS B ND1   1 
ATOM   4330 C  CD2   . HIS B  1 246 ? 8.933   6.454   17.257 1.00 34.07  ? 246 HIS B CD2   1 
ATOM   4331 C  CE1   . HIS B  1 246 ? 10.659  6.035   15.967 1.00 25.52  ? 246 HIS B CE1   1 
ATOM   4332 N  NE2   . HIS B  1 246 ? 9.848   5.507   16.867 1.00 36.90  ? 246 HIS B NE2   1 
ATOM   4333 N  N     . LYS B  1 247 ? 5.604   7.940   15.795 1.00 40.21  ? 247 LYS B N     1 
ATOM   4334 C  CA    . LYS B  1 247 ? 4.598   6.888   15.836 1.00 35.24  ? 247 LYS B CA    1 
ATOM   4335 C  C     . LYS B  1 247 ? 3.671   6.888   14.601 1.00 44.00  ? 247 LYS B C     1 
ATOM   4336 O  O     . LYS B  1 247 ? 3.254   5.830   14.123 1.00 42.33  ? 247 LYS B O     1 
ATOM   4337 C  CB    . LYS B  1 247 ? 3.766   7.076   17.114 1.00 38.13  ? 247 LYS B CB    1 
ATOM   4338 C  CG    . LYS B  1 247 ? 2.773   5.981   17.429 1.00 57.98  ? 247 LYS B CG    1 
ATOM   4339 C  CD    . LYS B  1 247 ? 3.474   4.735   17.962 1.00 73.32  ? 247 LYS B CD    1 
ATOM   4340 C  CE    . LYS B  1 247 ? 2.464   3.692   18.438 1.00 78.68  ? 247 LYS B CE    1 
ATOM   4341 N  NZ    . LYS B  1 247 ? 1.551   3.240   17.345 1.00 72.17  ? 247 LYS B NZ    1 
ATOM   4342 N  N     . HIS B  1 248 ? 3.363   8.085   14.104 1.00 39.87  ? 248 HIS B N     1 
ATOM   4343 C  CA    . HIS B  1 248 ? 2.464   8.298   12.968 1.00 35.94  ? 248 HIS B CA    1 
ATOM   4344 C  C     . HIS B  1 248 ? 3.211   9.175   11.979 1.00 31.92  ? 248 HIS B C     1 
ATOM   4345 O  O     . HIS B  1 248 ? 2.823   10.320  11.720 1.00 34.53  ? 248 HIS B O     1 
ATOM   4346 C  CB    . HIS B  1 248 ? 1.200   9.021   13.462 1.00 24.88  ? 248 HIS B CB    1 
ATOM   4347 C  CG    . HIS B  1 248 ? 0.529   8.335   14.618 1.00 42.91  ? 248 HIS B CG    1 
ATOM   4348 N  ND1   . HIS B  1 248 ? -0.173  7.155   14.481 1.00 33.34  ? 248 HIS B ND1   1 
ATOM   4349 C  CD2   . HIS B  1 248 ? 0.474   8.652   15.934 1.00 39.74  ? 248 HIS B CD2   1 
ATOM   4350 C  CE1   . HIS B  1 248 ? -0.632  6.777   15.662 1.00 34.74  ? 248 HIS B CE1   1 
ATOM   4351 N  NE2   . HIS B  1 248 ? -0.254  7.667   16.561 1.00 34.94  ? 248 HIS B NE2   1 
ATOM   4352 N  N     . PRO B  1 249 ? 4.296   8.642   11.401 1.00 34.14  ? 249 PRO B N     1 
ATOM   4353 C  CA    . PRO B  1 249 ? 5.109   9.401   10.443 1.00 30.27  ? 249 PRO B CA    1 
ATOM   4354 C  C     . PRO B  1 249 ? 4.401   9.926   9.194  1.00 41.32  ? 249 PRO B C     1 
ATOM   4355 O  O     . PRO B  1 249 ? 4.855   10.887  8.589  1.00 47.17  ? 249 PRO B O     1 
ATOM   4356 C  CB    . PRO B  1 249 ? 6.242   8.429   10.104 1.00 26.17  ? 249 PRO B CB    1 
ATOM   4357 C  CG    . PRO B  1 249 ? 5.598   7.074   10.232 1.00 26.74  ? 249 PRO B CG    1 
ATOM   4358 C  CD    . PRO B  1 249 ? 4.700   7.222   11.454 1.00 29.84  ? 249 PRO B CD    1 
ATOM   4359 N  N     . ASN B  1 250 ? 3.291   9.322   8.800  1.00 35.10  ? 250 ASN B N     1 
ATOM   4360 C  CA    . ASN B  1 250 ? 2.634   9.800   7.592  1.00 40.22  ? 250 ASN B CA    1 
ATOM   4361 C  C     . ASN B  1 250 ? 1.282   10.289  7.927  1.00 34.85  ? 250 ASN B C     1 
ATOM   4362 O  O     . ASN B  1 250 ? 0.373   10.205  7.114  1.00 43.25  ? 250 ASN B O     1 
ATOM   4363 C  CB    . ASN B  1 250 ? 2.506   8.684   6.548  1.00 35.20  ? 250 ASN B CB    1 
ATOM   4364 C  CG    . ASN B  1 250 ? 3.845   8.204   6.064  1.00 35.06  ? 250 ASN B CG    1 
ATOM   4365 O  OD1   . ASN B  1 250 ? 4.627   8.980   5.514  1.00 45.45  ? 250 ASN B OD1   1 
ATOM   4366 N  ND2   . ASN B  1 250 ? 4.133   6.931   6.284  1.00 35.24  ? 250 ASN B ND2   1 
ATOM   4367 N  N     . ASN B  1 251 ? 1.138   10.804  9.131  1.00 31.15  ? 251 ASN B N     1 
ATOM   4368 C  CA    . ASN B  1 251 ? -0.157  11.287  9.535  1.00 30.78  ? 251 ASN B CA    1 
ATOM   4369 C  C     . ASN B  1 251 ? -0.003  12.447  10.512 1.00 27.75  ? 251 ASN B C     1 
ATOM   4370 O  O     . ASN B  1 251 ? -0.034  12.271  11.725 1.00 29.45  ? 251 ASN B O     1 
ATOM   4371 C  CB    . ASN B  1 251 ? -0.948  10.128  10.146 1.00 28.17  ? 251 ASN B CB    1 
ATOM   4372 C  CG    . ASN B  1 251 ? -2.424  10.429  10.252 1.00 35.40  ? 251 ASN B CG    1 
ATOM   4373 O  OD1   . ASN B  1 251 ? -2.826  11.578  10.464 1.00 31.56  ? 251 ASN B OD1   1 
ATOM   4374 N  ND2   . ASN B  1 251 ? -3.241  9.404   10.128 1.00 38.65  ? 251 ASN B ND2   1 
ATOM   4375 N  N     . LEU B  1 252 ? 0.166   13.643  9.958  1.00 27.07  ? 252 LEU B N     1 
ATOM   4376 C  CA    . LEU B  1 252 ? 0.358   14.835  10.757 1.00 30.90  ? 252 LEU B CA    1 
ATOM   4377 C  C     . LEU B  1 252 ? -0.852  15.153  11.623 1.00 36.00  ? 252 LEU B C     1 
ATOM   4378 O  O     . LEU B  1 252 ? -0.709  15.595  12.763 1.00 40.13  ? 252 LEU B O     1 
ATOM   4379 C  CB    . LEU B  1 252 ? 0.685   16.027  9.852  1.00 23.51  ? 252 LEU B CB    1 
ATOM   4380 C  CG    . LEU B  1 252 ? 1.058   17.290  10.632 1.00 29.13  ? 252 LEU B CG    1 
ATOM   4381 C  CD1   . LEU B  1 252 ? 2.386   17.056  11.384 1.00 26.03  ? 252 LEU B CD1   1 
ATOM   4382 C  CD2   . LEU B  1 252 ? 1.191   18.458  9.681  1.00 32.81  ? 252 LEU B CD2   1 
ATOM   4383 N  N     . LYS B  1 253 ? -2.041  14.932  11.078 1.00 32.72  ? 253 LYS B N     1 
ATOM   4384 C  CA    . LYS B  1 253 ? -3.280  15.190  11.801 1.00 36.32  ? 253 LYS B CA    1 
ATOM   4385 C  C     . LYS B  1 253 ? -3.312  14.447  13.153 1.00 36.47  ? 253 LYS B C     1 
ATOM   4386 O  O     . LYS B  1 253 ? -3.583  15.042  14.211 1.00 36.50  ? 253 LYS B O     1 
ATOM   4387 C  CB    . LYS B  1 253 ? -4.468  14.767  10.924 1.00 26.10  ? 253 LYS B CB    1 
ATOM   4388 C  CG    . LYS B  1 253 ? -5.837  14.964  11.563 1.00 29.67  ? 253 LYS B CG    1 
ATOM   4389 C  CD    . LYS B  1 253 ? -6.940  14.637  10.573 1.00 29.39  ? 253 LYS B CD    1 
ATOM   4390 C  CE    . LYS B  1 253 ? -8.324  15.003  11.117 1.00 42.45  ? 253 LYS B CE    1 
ATOM   4391 N  NZ    . LYS B  1 253 ? -8.685  14.281  12.374 1.00 40.72  ? 253 LYS B NZ    1 
ATOM   4392 N  N     . VAL B  1 254 ? -3.035  13.145  13.115 1.00 35.02  ? 254 VAL B N     1 
ATOM   4393 C  CA    . VAL B  1 254 ? -3.041  12.333  14.324 1.00 33.55  ? 254 VAL B CA    1 
ATOM   4394 C  C     . VAL B  1 254 ? -1.895  12.717  15.256 1.00 35.89  ? 254 VAL B C     1 
ATOM   4395 O  O     . VAL B  1 254 ? -2.088  12.848  16.449 1.00 31.27  ? 254 VAL B O     1 
ATOM   4396 C  CB    . VAL B  1 254 ? -2.953  10.837  13.971 1.00 43.01  ? 254 VAL B CB    1 
ATOM   4397 C  CG1   . VAL B  1 254 ? -2.613  9.994   15.213 1.00 35.56  ? 254 VAL B CG1   1 
ATOM   4398 C  CG2   . VAL B  1 254 ? -4.285  10.400  13.364 1.00 34.81  ? 254 VAL B CG2   1 
ATOM   4399 N  N     . ALA B  1 255 ? -0.705  12.912  14.705 1.00 23.44  ? 255 ALA B N     1 
ATOM   4400 C  CA    . ALA B  1 255 ? 0.422   13.290  15.521 1.00 30.95  ? 255 ALA B CA    1 
ATOM   4401 C  C     . ALA B  1 255 ? 0.105   14.586  16.260 1.00 32.19  ? 255 ALA B C     1 
ATOM   4402 O  O     . ALA B  1 255 ? 0.314   14.691  17.470 1.00 33.38  ? 255 ALA B O     1 
ATOM   4403 C  CB    . ALA B  1 255 ? 1.665   13.455  14.648 1.00 26.01  ? 255 ALA B CB    1 
ATOM   4404 N  N     . CYS B  1 256 ? -0.417  15.572  15.533 1.00 32.26  ? 256 CYS B N     1 
ATOM   4405 C  CA    . CYS B  1 256 ? -0.741  16.839  16.149 1.00 27.32  ? 256 CYS B CA    1 
ATOM   4406 C  C     . CYS B  1 256 ? -1.887  16.722  17.131 1.00 30.69  ? 256 CYS B C     1 
ATOM   4407 O  O     . CYS B  1 256 ? -1.886  17.397  18.161 1.00 31.01  ? 256 CYS B O     1 
ATOM   4408 C  CB    . CYS B  1 256 ? -1.041  17.911  15.084 1.00 32.11  ? 256 CYS B CB    1 
ATOM   4409 S  SG    . CYS B  1 256 ? 0.415   18.511  14.240 1.00 35.71  ? 256 CYS B SG    1 
ATOM   4410 N  N     . GLU B  1 257 ? -2.872  15.886  16.828 1.00 32.44  ? 257 GLU B N     1 
ATOM   4411 C  CA    . GLU B  1 257 ? -3.998  15.721  17.752 1.00 35.23  ? 257 GLU B CA    1 
ATOM   4412 C  C     . GLU B  1 257 ? -3.571  15.100  19.092 1.00 34.14  ? 257 GLU B C     1 
ATOM   4413 O  O     . GLU B  1 257 ? -4.061  15.484  20.158 1.00 33.83  ? 257 GLU B O     1 
ATOM   4414 C  CB    . GLU B  1 257 ? -5.097  14.882  17.099 1.00 36.72  ? 257 GLU B CB    1 
ATOM   4415 C  CG    . GLU B  1 257 ? -5.855  15.666  16.026 1.00 39.16  ? 257 GLU B CG    1 
ATOM   4416 C  CD    . GLU B  1 257 ? -6.881  14.828  15.286 1.00 40.45  ? 257 GLU B CD    1 
ATOM   4417 O  OE1   . GLU B  1 257 ? -6.783  13.589  15.345 1.00 44.09  ? 257 GLU B OE1   1 
ATOM   4418 O  OE2   . GLU B  1 257 ? -7.769  15.415  14.626 1.00 44.19  ? 257 GLU B OE2   1 
ATOM   4419 N  N     . LYS B  1 258 ? -2.669  14.131  19.038 1.00 32.83  ? 258 LYS B N     1 
ATOM   4420 C  CA    . LYS B  1 258 ? -2.174  13.511  20.260 1.00 27.71  ? 258 LYS B CA    1 
ATOM   4421 C  C     . LYS B  1 258 ? -1.267  14.494  21.008 1.00 32.59  ? 258 LYS B C     1 
ATOM   4422 O  O     . LYS B  1 258 ? -1.302  14.551  22.228 1.00 33.96  ? 258 LYS B O     1 
ATOM   4423 C  CB    . LYS B  1 258 ? -1.412  12.234  19.932 1.00 30.06  ? 258 LYS B CB    1 
ATOM   4424 C  CG    . LYS B  1 258 ? -2.306  11.103  19.518 1.00 31.70  ? 258 LYS B CG    1 
ATOM   4425 C  CD    . LYS B  1 258 ? -1.514  9.819   19.366 1.00 39.18  ? 258 LYS B CD    1 
ATOM   4426 C  CE    . LYS B  1 258 ? -2.424  8.641   19.034 1.00 46.65  ? 258 LYS B CE    1 
ATOM   4427 N  NZ    . LYS B  1 258 ? -1.643  7.389   18.796 1.00 52.92  ? 258 LYS B NZ    1 
ATOM   4428 N  N     . THR B  1 259 ? -0.461  15.267  20.281 1.00 28.81  ? 259 THR B N     1 
ATOM   4429 C  CA    . THR B  1 259 ? 0.421   16.243  20.927 1.00 27.90  ? 259 THR B CA    1 
ATOM   4430 C  C     . THR B  1 259 ? -0.404  17.309  21.673 1.00 31.20  ? 259 THR B C     1 
ATOM   4431 O  O     . THR B  1 259 ? -0.216  17.529  22.871 1.00 27.42  ? 259 THR B O     1 
ATOM   4432 C  CB    . THR B  1 259 ? 1.346   16.933  19.885 1.00 24.87  ? 259 THR B CB    1 
ATOM   4433 O  OG1   . THR B  1 259 ? 2.188   15.946  19.283 1.00 25.30  ? 259 THR B OG1   1 
ATOM   4434 C  CG2   . THR B  1 259 ? 2.255   17.948  20.548 1.00 26.65  ? 259 THR B CG2   1 
ATOM   4435 N  N     . VAL B  1 260 ? -1.319  17.956  20.957 1.00 38.57  ? 260 VAL B N     1 
ATOM   4436 C  CA    . VAL B  1 260 ? -2.187  18.992  21.516 1.00 34.98  ? 260 VAL B CA    1 
ATOM   4437 C  C     . VAL B  1 260 ? -3.110  18.463  22.613 1.00 29.27  ? 260 VAL B C     1 
ATOM   4438 O  O     . VAL B  1 260 ? -3.417  19.187  23.567 1.00 32.52  ? 260 VAL B O     1 
ATOM   4439 C  CB    . VAL B  1 260 ? -3.043  19.663  20.405 1.00 32.72  ? 260 VAL B CB    1 
ATOM   4440 C  CG1   . VAL B  1 260 ? -4.232  20.372  21.000 1.00 29.13  ? 260 VAL B CG1   1 
ATOM   4441 C  CG2   . VAL B  1 260 ? -2.206  20.660  19.665 1.00 31.15  ? 260 VAL B CG2   1 
ATOM   4442 N  N     . SER B  1 261 ? -3.551  17.212  22.490 1.00 33.59  ? 261 SER B N     1 
ATOM   4443 C  CA    . SER B  1 261 ? -4.432  16.621  23.511 1.00 34.75  ? 261 SER B CA    1 
ATOM   4444 C  C     . SER B  1 261 ? -3.662  16.366  24.797 1.00 36.82  ? 261 SER B C     1 
ATOM   4445 O  O     . SER B  1 261 ? -4.183  16.512  25.906 1.00 29.19  ? 261 SER B O     1 
ATOM   4446 C  CB    . SER B  1 261 ? -5.058  15.314  23.017 1.00 42.13  ? 261 SER B CB    1 
ATOM   4447 O  OG    . SER B  1 261 ? -6.132  15.574  22.123 1.00 42.25  ? 261 SER B OG    1 
ATOM   4448 N  N     . THR B  1 262 ? -2.406  15.981  24.644 1.00 27.66  ? 262 THR B N     1 
ATOM   4449 C  CA    . THR B  1 262 ? -1.557  15.729  25.788 1.00 31.96  ? 262 THR B CA    1 
ATOM   4450 C  C     . THR B  1 262 ? -1.340  17.029  26.579 1.00 33.07  ? 262 THR B C     1 
ATOM   4451 O  O     . THR B  1 262 ? -1.311  17.014  27.806 1.00 44.70  ? 262 THR B O     1 
ATOM   4452 C  CB    . THR B  1 262 ? -0.168  15.155  25.345 1.00 24.61  ? 262 THR B CB    1 
ATOM   4453 O  OG1   . THR B  1 262 ? -0.345  13.876  24.728 1.00 32.73  ? 262 THR B OG1   1 
ATOM   4454 C  CG2   . THR B  1 262 ? 0.751   14.994  26.564 1.00 35.28  ? 262 THR B CG2   1 
ATOM   4455 N  N     . LEU B  1 263 ? -1.180  18.149  25.883 1.00 35.87  ? 263 LEU B N     1 
ATOM   4456 C  CA    . LEU B  1 263 ? -0.953  19.416  26.573 1.00 36.49  ? 263 LEU B CA    1 
ATOM   4457 C  C     . LEU B  1 263 ? -2.203  19.802  27.318 1.00 32.59  ? 263 LEU B C     1 
ATOM   4458 O  O     . LEU B  1 263 ? -2.156  20.311  28.438 1.00 34.29  ? 263 LEU B O     1 
ATOM   4459 C  CB    . LEU B  1 263 ? -0.588  20.513  25.569 1.00 39.72  ? 263 LEU B CB    1 
ATOM   4460 C  CG    . LEU B  1 263 ? 0.883   20.564  25.160 1.00 25.95  ? 263 LEU B CG    1 
ATOM   4461 C  CD1   . LEU B  1 263 ? 0.989   21.040  23.731 1.00 47.19  ? 263 LEU B CD1   1 
ATOM   4462 C  CD2   . LEU B  1 263 ? 1.628   21.514  26.073 1.00 38.30  ? 263 LEU B CD2   1 
ATOM   4463 N  N     . HIS B  1 264 ? -3.330  19.543  26.684 1.00 36.43  ? 264 HIS B N     1 
ATOM   4464 C  CA    . HIS B  1 264 ? -4.617  19.857  27.276 1.00 33.04  ? 264 HIS B CA    1 
ATOM   4465 C  C     . HIS B  1 264 ? -4.778  19.125  28.600 1.00 26.35  ? 264 HIS B C     1 
ATOM   4466 O  O     . HIS B  1 264 ? -5.092  19.735  29.619 1.00 40.11  ? 264 HIS B O     1 
ATOM   4467 C  CB    . HIS B  1 264 ? -5.739  19.447  26.306 1.00 28.45  ? 264 HIS B CB    1 
ATOM   4468 C  CG    . HIS B  1 264 ? -7.104  19.452  26.921 1.00 40.46  ? 264 HIS B CG    1 
ATOM   4469 N  ND1   . HIS B  1 264 ? -7.899  20.579  26.964 1.00 43.59  ? 264 HIS B ND1   1 
ATOM   4470 C  CD2   . HIS B  1 264 ? -7.812  18.469  27.526 1.00 43.14  ? 264 HIS B CD2   1 
ATOM   4471 C  CE1   . HIS B  1 264 ? -9.036  20.289  27.566 1.00 33.43  ? 264 HIS B CE1   1 
ATOM   4472 N  NE2   . HIS B  1 264 ? -9.008  19.015  27.917 1.00 43.65  ? 264 HIS B NE2   1 
ATOM   4473 N  N     . HIS B  1 265 ? -4.557  17.811  28.593 1.00 31.81  ? 265 HIS B N     1 
ATOM   4474 C  CA    . HIS B  1 265 ? -4.731  17.028  29.816 1.00 30.08  ? 265 HIS B CA    1 
ATOM   4475 C  C     . HIS B  1 265 ? -3.792  17.510  30.893 1.00 39.40  ? 265 HIS B C     1 
ATOM   4476 O  O     . HIS B  1 265 ? -4.183  17.634  32.057 1.00 39.20  ? 265 HIS B O     1 
ATOM   4477 C  CB    . HIS B  1 265 ? -4.502  15.550  29.549 1.00 27.47  ? 265 HIS B CB    1 
ATOM   4478 C  CG    . HIS B  1 265 ? -5.487  14.960  28.595 1.00 41.30  ? 265 HIS B CG    1 
ATOM   4479 N  ND1   . HIS B  1 265 ? -6.843  14.979  28.831 1.00 39.50  ? 265 HIS B ND1   1 
ATOM   4480 C  CD2   . HIS B  1 265 ? -5.314  14.309  27.419 1.00 29.77  ? 265 HIS B CD2   1 
ATOM   4481 C  CE1   . HIS B  1 265 ? -7.464  14.355  27.845 1.00 32.54  ? 265 HIS B CE1   1 
ATOM   4482 N  NE2   . HIS B  1 265 ? -6.560  13.941  26.975 1.00 42.31  ? 265 HIS B NE2   1 
ATOM   4483 N  N     . VAL B  1 266 ? -2.550  17.778  30.499 1.00 28.63  ? 266 VAL B N     1 
ATOM   4484 C  CA    . VAL B  1 266 ? -1.567  18.278  31.429 1.00 31.01  ? 266 VAL B CA    1 
ATOM   4485 C  C     . VAL B  1 266 ? -1.987  19.647  31.961 1.00 32.80  ? 266 VAL B C     1 
ATOM   4486 O  O     . VAL B  1 266 ? -2.037  19.855  33.177 1.00 39.78  ? 266 VAL B O     1 
ATOM   4487 C  CB    . VAL B  1 266 ? -0.155  18.406  30.775 1.00 20.31  ? 266 VAL B CB    1 
ATOM   4488 C  CG1   . VAL B  1 266 ? 0.809   19.104  31.770 1.00 24.17  ? 266 VAL B CG1   1 
ATOM   4489 C  CG2   . VAL B  1 266 ? 0.379   16.988  30.406 1.00 15.31  ? 266 VAL B CG2   1 
ATOM   4490 N  N     . LEU B  1 267 ? -2.293  20.575  31.054 1.00 35.83  ? 267 LEU B N     1 
ATOM   4491 C  CA    . LEU B  1 267 ? -2.687  21.916  31.463 1.00 33.06  ? 267 LEU B CA    1 
ATOM   4492 C  C     . LEU B  1 267 ? -3.951  21.928  32.299 1.00 36.59  ? 267 LEU B C     1 
ATOM   4493 O  O     . LEU B  1 267 ? -4.081  22.726  33.235 1.00 32.45  ? 267 LEU B O     1 
ATOM   4494 C  CB    . LEU B  1 267 ? -2.854  22.837  30.249 1.00 27.34  ? 267 LEU B CB    1 
ATOM   4495 C  CG    . LEU B  1 267 ? -1.498  23.239  29.668 1.00 43.69  ? 267 LEU B CG    1 
ATOM   4496 C  CD1   . LEU B  1 267 ? -1.691  24.290  28.579 1.00 41.87  ? 267 LEU B CD1   1 
ATOM   4497 C  CD2   . LEU B  1 267 ? -0.619  23.778  30.770 1.00 30.84  ? 267 LEU B CD2   1 
ATOM   4498 N  N     . GLN B  1 268 ? -4.875  21.034  31.986 1.00 34.16  ? 268 GLN B N     1 
ATOM   4499 C  CA    . GLN B  1 268 ? -6.111  20.987  32.750 1.00 39.19  ? 268 GLN B CA    1 
ATOM   4500 C  C     . GLN B  1 268 ? -5.811  20.598  34.195 1.00 39.75  ? 268 GLN B C     1 
ATOM   4501 O  O     . GLN B  1 268 ? -6.238  21.274  35.139 1.00 39.32  ? 268 GLN B O     1 
ATOM   4502 C  CB    . GLN B  1 268 ? -7.088  19.988  32.131 1.00 38.44  ? 268 GLN B CB    1 
ATOM   4503 C  CG    . GLN B  1 268 ? -8.529  20.371  32.370 1.00 63.81  ? 268 GLN B CG    1 
ATOM   4504 C  CD    . GLN B  1 268 ? -8.890  21.695  31.700 1.00 73.65  ? 268 GLN B CD    1 
ATOM   4505 O  OE1   . GLN B  1 268 ? -9.870  22.339  32.076 1.00 86.36  ? 268 GLN B OE1   1 
ATOM   4506 N  NE2   . GLN B  1 268 ? -8.107  22.096  30.698 1.00 70.05  ? 268 GLN B NE2   1 
ATOM   4507 N  N     . ARG B  1 269 ? -5.045  19.524  34.364 1.00 36.40  ? 269 ARG B N     1 
ATOM   4508 C  CA    . ARG B  1 269 ? -4.690  19.043  35.699 1.00 40.44  ? 269 ARG B CA    1 
ATOM   4509 C  C     . ARG B  1 269 ? -3.929  20.132  36.451 1.00 36.35  ? 269 ARG B C     1 
ATOM   4510 O  O     . ARG B  1 269 ? -4.116  20.325  37.646 1.00 47.41  ? 269 ARG B O     1 
ATOM   4511 C  CB    . ARG B  1 269 ? -3.843  17.744  35.610 1.00 35.79  ? 269 ARG B CB    1 
ATOM   4512 C  CG    . ARG B  1 269 ? -3.585  17.097  36.965 1.00 36.71  ? 269 ARG B CG    1 
ATOM   4513 C  CD    . ARG B  1 269 ? -2.888  15.748  36.898 1.00 38.93  ? 269 ARG B CD    1 
ATOM   4514 N  NE    . ARG B  1 269 ? -3.792  14.635  36.618 1.00 31.98  ? 269 ARG B NE    1 
ATOM   4515 C  CZ    . ARG B  1 269 ? -3.932  14.088  35.413 1.00 43.74  ? 269 ARG B CZ    1 
ATOM   4516 N  NH1   . ARG B  1 269 ? -3.228  14.553  34.384 1.00 42.90  ? 269 ARG B NH1   1 
ATOM   4517 N  NH2   . ARG B  1 269 ? -4.768  13.075  35.229 1.00 45.40  ? 269 ARG B NH2   1 
ATOM   4518 N  N     . THR B  1 270 ? -3.096  20.857  35.724 1.00 34.20  ? 270 THR B N     1 
ATOM   4519 C  CA    . THR B  1 270 ? -2.279  21.916  36.288 1.00 30.86  ? 270 THR B CA    1 
ATOM   4520 C  C     . THR B  1 270 ? -3.114  23.118  36.696 1.00 45.91  ? 270 THR B C     1 
ATOM   4521 O  O     . THR B  1 270 ? -2.900  23.707  37.751 1.00 42.00  ? 270 THR B O     1 
ATOM   4522 C  CB    . THR B  1 270 ? -1.249  22.391  35.247 1.00 24.29  ? 270 THR B CB    1 
ATOM   4523 O  OG1   . THR B  1 270 ? -0.402  21.295  34.888 1.00 39.19  ? 270 THR B OG1   1 
ATOM   4524 C  CG2   . THR B  1 270 ? -0.432  23.541  35.775 1.00 33.84  ? 270 THR B CG2   1 
ATOM   4525 N  N     . ILE B  1 271 ? -4.062  23.493  35.846 1.00 46.94  ? 271 ILE B N     1 
ATOM   4526 C  CA    . ILE B  1 271 ? -4.887  24.640  36.147 1.00 49.15  ? 271 ILE B CA    1 
ATOM   4527 C  C     . ILE B  1 271 ? -5.803  24.354  37.341 1.00 49.27  ? 271 ILE B C     1 
ATOM   4528 O  O     . ILE B  1 271 ? -6.088  25.244  38.129 1.00 54.61  ? 271 ILE B O     1 
ATOM   4529 C  CB    . ILE B  1 271 ? -5.705  25.103  34.900 1.00 45.59  ? 271 ILE B CB    1 
ATOM   4530 C  CG1   . ILE B  1 271 ? -6.374  26.434  35.208 1.00 55.98  ? 271 ILE B CG1   1 
ATOM   4531 C  CG2   . ILE B  1 271 ? -6.763  24.079  34.528 1.00 52.90  ? 271 ILE B CG2   1 
ATOM   4532 C  CD1   . ILE B  1 271 ? -5.403  27.500  35.698 1.00 66.23  ? 271 ILE B CD1   1 
ATOM   4533 N  N     . GLN B  1 272 ? -6.245  23.115  37.500 1.00 43.43  ? 272 GLN B N     1 
ATOM   4534 C  CA    . GLN B  1 272 ? -7.104  22.801  38.633 1.00 54.01  ? 272 GLN B CA    1 
ATOM   4535 C  C     . GLN B  1 272 ? -6.339  22.668  39.956 1.00 60.54  ? 272 GLN B C     1 
ATOM   4536 O  O     . GLN B  1 272 ? -6.904  22.909  41.025 1.00 60.25  ? 272 GLN B O     1 
ATOM   4537 C  CB    . GLN B  1 272 ? -7.910  21.534  38.353 1.00 48.83  ? 272 GLN B CB    1 
ATOM   4538 C  CG    . GLN B  1 272 ? -8.962  21.759  37.290 1.00 74.74  ? 272 GLN B CG    1 
ATOM   4539 C  CD    . GLN B  1 272 ? -9.695  20.492  36.907 1.00 95.11  ? 272 GLN B CD    1 
ATOM   4540 O  OE1   . GLN B  1 272 ? -10.569 20.510  36.034 1.00 99.56  ? 272 GLN B OE1   1 
ATOM   4541 N  NE2   . GLN B  1 272 ? -9.347  19.381  37.555 1.00 100.00 ? 272 GLN B NE2   1 
ATOM   4542 N  N     . CYS B  1 273 ? -5.065  22.282  39.901 1.00 53.88  ? 273 CYS B N     1 
ATOM   4543 C  CA    . CYS B  1 273 ? -4.288  22.176  41.131 1.00 66.20  ? 273 CYS B CA    1 
ATOM   4544 C  C     . CYS B  1 273 ? -3.459  23.446  41.328 1.00 69.07  ? 273 CYS B C     1 
ATOM   4545 O  O     . CYS B  1 273 ? -2.341  23.408  41.851 1.00 74.83  ? 273 CYS B O     1 
ATOM   4546 C  CB    . CYS B  1 273 ? -3.365  20.954  41.119 1.00 65.73  ? 273 CYS B CB    1 
ATOM   4547 S  SG    . CYS B  1 273 ? -2.660  20.604  42.764 1.00 82.35  ? 273 CYS B SG    1 
ATOM   4548 N  N     . ALA B  1 274 ? -4.021  24.563  40.882 1.00 57.11  ? 274 ALA B N     1 
ATOM   4549 C  CA    . ALA B  1 274 ? -3.384  25.865  41.000 1.00 61.20  ? 274 ALA B CA    1 
ATOM   4550 C  C     . ALA B  1 274 ? -4.484  26.751  41.536 1.00 63.11  ? 274 ALA B C     1 
ATOM   4551 O  O     . ALA B  1 274 ? -4.252  27.634  42.352 1.00 71.90  ? 274 ALA B O     1 
ATOM   4552 C  CB    . ALA B  1 274 ? -2.927  26.369  39.641 1.00 48.31  ? 274 ALA B CB    1 
ATOM   4553 N  N     . LYS B  1 275 ? -5.694  26.499  41.060 1.00 59.50  ? 275 LYS B N     1 
ATOM   4554 C  CA    . LYS B  1 275 ? -6.851  27.243  41.514 1.00 65.21  ? 275 LYS B CA    1 
ATOM   4555 C  C     . LYS B  1 275 ? -7.093  26.849  42.966 1.00 67.11  ? 275 LYS B C     1 
ATOM   4556 O  O     . LYS B  1 275 ? -7.324  27.705  43.825 1.00 70.20  ? 275 LYS B O     1 
ATOM   4557 C  CB    . LYS B  1 275 ? -8.074  26.887  40.667 1.00 48.92  ? 275 LYS B CB    1 
ATOM   4558 C  CG    . LYS B  1 275 ? -8.184  27.682  39.389 1.00 46.03  ? 275 LYS B CG    1 
ATOM   4559 C  CD    . LYS B  1 275 ? -9.350  27.184  38.579 1.00 55.20  ? 275 LYS B CD    1 
ATOM   4560 C  CE    . LYS B  1 275 ? -9.876  28.249  37.643 1.00 54.14  ? 275 LYS B CE    1 
ATOM   4561 N  NZ    . LYS B  1 275 ? -11.004 27.686  36.862 1.00 48.48  ? 275 LYS B NZ    1 
ATOM   4562 N  N     . ALA B  1 276 ? -7.030  25.545  43.222 1.00 58.52  ? 276 ALA B N     1 
ATOM   4563 C  CA    . ALA B  1 276 ? -7.237  24.991  44.555 1.00 62.64  ? 276 ALA B CA    1 
ATOM   4564 C  C     . ALA B  1 276 ? -6.137  25.408  45.529 1.00 71.33  ? 276 ALA B C     1 
ATOM   4565 O  O     . ALA B  1 276 ? -6.203  25.102  46.719 1.00 83.27  ? 276 ALA B O     1 
ATOM   4566 C  CB    . ALA B  1 276 ? -7.309  23.463  44.476 1.00 47.43  ? 276 ALA B CB    1 
ATOM   4567 N  N     . GLN B  1 277 ? -5.125  26.100  45.029 1.00 72.80  ? 277 GLN B N     1 
ATOM   4568 C  CA    . GLN B  1 277 ? -4.026  26.523  45.879 1.00 76.52  ? 277 GLN B CA    1 
ATOM   4569 C  C     . GLN B  1 277 ? -4.089  28.001  46.137 1.00 84.14  ? 277 GLN B C     1 
ATOM   4570 O  O     . GLN B  1 277 ? -3.887  28.454  47.264 1.00 82.65  ? 277 GLN B O     1 
ATOM   4571 C  CB    . GLN B  1 277 ? -2.686  26.206  45.230 1.00 75.03  ? 277 GLN B CB    1 
ATOM   4572 C  CG    . GLN B  1 277 ? -2.156  24.826  45.509 1.00 70.04  ? 277 GLN B CG    1 
ATOM   4573 C  CD    . GLN B  1 277 ? -0.687  24.723  45.159 1.00 75.72  ? 277 GLN B CD    1 
ATOM   4574 O  OE1   . GLN B  1 277 ? -0.323  24.305  44.061 1.00 72.73  ? 277 GLN B OE1   1 
ATOM   4575 N  NE2   . GLN B  1 277 ? 0.169   25.130  46.090 1.00 80.59  ? 277 GLN B NE2   1 
ATOM   4576 N  N     . ALA B  1 278 ? -4.359  28.749  45.074 1.00 88.73  ? 278 ALA B N     1 
ATOM   4577 C  CA    . ALA B  1 278 ? -4.439  30.194  45.169 1.00 93.11  ? 278 ALA B CA    1 
ATOM   4578 C  C     . ALA B  1 278 ? -5.300  30.555  46.373 1.00 96.84  ? 278 ALA B C     1 
ATOM   4579 O  O     . ALA B  1 278 ? -5.029  31.606  46.998 1.00 99.19  ? 278 ALA B O     1 
ATOM   4580 C  CB    . ALA B  1 278 ? -5.041  30.766  43.892 1.00 93.44  ? 278 ALA B CB    1 
ATOM   4581 N  N     . ARG B  1 283 ? -4.367  34.821  42.730 1.00 88.63  ? 283 ARG B N     1 
ATOM   4582 C  CA    . ARG B  1 283 ? -3.989  34.144  41.453 1.00 90.54  ? 283 ARG B CA    1 
ATOM   4583 C  C     . ARG B  1 283 ? -2.867  33.126  41.613 1.00 87.95  ? 283 ARG B C     1 
ATOM   4584 O  O     . ARG B  1 283 ? -1.966  33.300  42.435 1.00 88.65  ? 283 ARG B O     1 
ATOM   4585 C  CB    . ARG B  1 283 ? -3.529  35.158  40.400 1.00 86.10  ? 283 ARG B CB    1 
ATOM   4586 C  CG    . ARG B  1 283 ? -4.600  36.066  39.844 1.00 85.20  ? 283 ARG B CG    1 
ATOM   4587 C  CD    . ARG B  1 283 ? -4.107  36.745  38.570 1.00 78.43  ? 283 ARG B CD    1 
ATOM   4588 N  NE    . ARG B  1 283 ? -4.279  35.902  37.387 1.00 89.01  ? 283 ARG B NE    1 
ATOM   4589 C  CZ    . ARG B  1 283 ? -3.684  36.127  36.218 1.00 95.06  ? 283 ARG B CZ    1 
ATOM   4590 N  NH1   . ARG B  1 283 ? -2.872  37.166  36.079 1.00 100.00 ? 283 ARG B NH1   1 
ATOM   4591 N  NH2   . ARG B  1 283 ? -3.900  35.317  35.186 1.00 84.11  ? 283 ARG B NH2   1 
ATOM   4592 N  N     . PRO B  1 284 ? -2.911  32.046  40.817 1.00 82.40  ? 284 PRO B N     1 
ATOM   4593 C  CA    . PRO B  1 284 ? -1.852  31.044  40.914 1.00 70.64  ? 284 PRO B CA    1 
ATOM   4594 C  C     . PRO B  1 284 ? -0.548  31.736  40.539 1.00 67.58  ? 284 PRO B C     1 
ATOM   4595 O  O     . PRO B  1 284 ? -0.491  32.475  39.544 1.00 62.48  ? 284 PRO B O     1 
ATOM   4596 C  CB    . PRO B  1 284 ? -2.281  29.995  39.886 1.00 70.79  ? 284 PRO B CB    1 
ATOM   4597 C  CG    . PRO B  1 284 ? -3.064  30.805  38.883 1.00 77.79  ? 284 PRO B CG    1 
ATOM   4598 C  CD    . PRO B  1 284 ? -3.881  31.695  39.771 1.00 78.98  ? 284 PRO B CD    1 
ATOM   4599 N  N     . SER B  1 285 ? 0.481   31.532  41.360 1.00 59.37  ? 285 SER B N     1 
ATOM   4600 C  CA    . SER B  1 285 ? 1.798   32.119  41.117 1.00 54.48  ? 285 SER B CA    1 
ATOM   4601 C  C     . SER B  1 285 ? 2.559   31.165  40.200 1.00 51.51  ? 285 SER B C     1 
ATOM   4602 O  O     . SER B  1 285 ? 2.077   30.066  39.901 1.00 51.01  ? 285 SER B O     1 
ATOM   4603 C  CB    . SER B  1 285 ? 2.558   32.273  42.440 1.00 52.55  ? 285 SER B CB    1 
ATOM   4604 O  OG    . SER B  1 285 ? 2.738   31.016  43.067 1.00 49.93  ? 285 SER B OG    1 
ATOM   4605 N  N     . PRO B  1 286 ? 3.761   31.559  39.752 1.00 49.02  ? 286 PRO B N     1 
ATOM   4606 C  CA    . PRO B  1 286 ? 4.496   30.649  38.876 1.00 45.17  ? 286 PRO B CA    1 
ATOM   4607 C  C     . PRO B  1 286 ? 4.647   29.236  39.434 1.00 49.56  ? 286 PRO B C     1 
ATOM   4608 O  O     . PRO B  1 286 ? 4.549   28.260  38.683 1.00 54.06  ? 286 PRO B O     1 
ATOM   4609 C  CB    . PRO B  1 286 ? 5.833   31.363  38.697 1.00 41.58  ? 286 PRO B CB    1 
ATOM   4610 C  CG    . PRO B  1 286 ? 5.418   32.793  38.656 1.00 37.68  ? 286 PRO B CG    1 
ATOM   4611 C  CD    . PRO B  1 286 ? 4.447   32.860  39.839 1.00 44.64  ? 286 PRO B CD    1 
ATOM   4612 N  N     . MET B  1 287 ? 4.855   29.119  40.743 1.00 52.17  ? 287 MET B N     1 
ATOM   4613 C  CA    . MET B  1 287 ? 5.039   27.807  41.363 1.00 52.97  ? 287 MET B CA    1 
ATOM   4614 C  C     . MET B  1 287 ? 3.806   26.927  41.288 1.00 51.67  ? 287 MET B C     1 
ATOM   4615 O  O     . MET B  1 287 ? 3.906   25.713  41.138 1.00 57.85  ? 287 MET B O     1 
ATOM   4616 C  CB    . MET B  1 287 ? 5.431   27.957  42.824 1.00 61.20  ? 287 MET B CB    1 
ATOM   4617 C  CG    . MET B  1 287 ? 5.919   26.664  43.462 1.00 74.72  ? 287 MET B CG    1 
ATOM   4618 S  SD    . MET B  1 287 ? 5.958   26.801  45.259 1.00 88.43  ? 287 MET B SD    1 
ATOM   4619 C  CE    . MET B  1 287 ? 7.062   28.207  45.491 1.00 83.79  ? 287 MET B CE    1 
ATOM   4620 N  N     . GLN B  1 288 ? 2.639   27.544  41.399 1.00 55.39  ? 288 GLN B N     1 
ATOM   4621 C  CA    . GLN B  1 288 ? 1.385   26.802  41.361 1.00 63.87  ? 288 GLN B CA    1 
ATOM   4622 C  C     . GLN B  1 288 ? 1.009   26.426  39.925 1.00 59.19  ? 288 GLN B C     1 
ATOM   4623 O  O     . GLN B  1 288 ? 0.155   25.568  39.684 1.00 54.07  ? 288 GLN B O     1 
ATOM   4624 C  CB    . GLN B  1 288 ? 0.282   27.655  42.002 1.00 66.93  ? 288 GLN B CB    1 
ATOM   4625 C  CG    . GLN B  1 288 ? 0.639   28.135  43.406 1.00 68.98  ? 288 GLN B CG    1 
ATOM   4626 C  CD    . GLN B  1 288 ? -0.221  29.297  43.873 1.00 76.58  ? 288 GLN B CD    1 
ATOM   4627 O  OE1   . GLN B  1 288 ? -0.195  30.381  43.291 1.00 67.09  ? 288 GLN B OE1   1 
ATOM   4628 N  NE2   . GLN B  1 288 ? -0.987  29.073  44.934 1.00 81.10  ? 288 GLN B NE2   1 
ATOM   4629 N  N     . LEU B  1 289 ? 1.663   27.071  38.970 1.00 49.92  ? 289 LEU B N     1 
ATOM   4630 C  CA    . LEU B  1 289 ? 1.380   26.807  37.578 1.00 45.61  ? 289 LEU B CA    1 
ATOM   4631 C  C     . LEU B  1 289 ? 2.401   25.872  36.942 1.00 44.62  ? 289 LEU B C     1 
ATOM   4632 O  O     . LEU B  1 289 ? 2.373   25.664  35.731 1.00 41.03  ? 289 LEU B O     1 
ATOM   4633 C  CB    . LEU B  1 289 ? 1.316   28.132  36.820 1.00 43.66  ? 289 LEU B CB    1 
ATOM   4634 C  CG    . LEU B  1 289 ? 0.102   28.993  37.163 1.00 45.24  ? 289 LEU B CG    1 
ATOM   4635 C  CD1   . LEU B  1 289 ? 0.320   30.421  36.699 1.00 36.66  ? 289 LEU B CD1   1 
ATOM   4636 C  CD2   . LEU B  1 289 ? -1.141  28.371  36.523 1.00 39.96  ? 289 LEU B CD2   1 
ATOM   4637 N  N     . GLU B  1 290 ? 3.315   25.335  37.745 1.00 37.85  ? 290 GLU B N     1 
ATOM   4638 C  CA    . GLU B  1 290 ? 4.308   24.411  37.214 1.00 35.92  ? 290 GLU B CA    1 
ATOM   4639 C  C     . GLU B  1 290 ? 3.524   23.255  36.606 1.00 40.99  ? 290 GLU B C     1 
ATOM   4640 O  O     . GLU B  1 290 ? 2.550   22.793  37.198 1.00 29.44  ? 290 GLU B O     1 
ATOM   4641 C  CB    . GLU B  1 290 ? 5.210   23.879  38.325 1.00 35.16  ? 290 GLU B CB    1 
ATOM   4642 C  CG    . GLU B  1 290 ? 6.377   24.788  38.726 1.00 36.85  ? 290 GLU B CG    1 
ATOM   4643 C  CD    . GLU B  1 290 ? 7.425   24.982  37.624 1.00 38.95  ? 290 GLU B CD    1 
ATOM   4644 O  OE1   . GLU B  1 290 ? 7.460   24.214  36.635 1.00 44.07  ? 290 GLU B OE1   1 
ATOM   4645 O  OE2   . GLU B  1 290 ? 8.237   25.906  37.760 1.00 32.25  ? 290 GLU B OE2   1 
ATOM   4646 N  N     . LEU B  1 291 ? 3.916   22.792  35.422 1.00 33.11  ? 291 LEU B N     1 
ATOM   4647 C  CA    . LEU B  1 291 ? 3.183   21.686  34.818 1.00 40.39  ? 291 LEU B CA    1 
ATOM   4648 C  C     . LEU B  1 291 ? 3.177   20.495  35.760 1.00 44.73  ? 291 LEU B C     1 
ATOM   4649 O  O     . LEU B  1 291 ? 4.223   20.114  36.297 1.00 38.31  ? 291 LEU B O     1 
ATOM   4650 C  CB    . LEU B  1 291 ? 3.820   21.264  33.503 1.00 24.68  ? 291 LEU B CB    1 
ATOM   4651 C  CG    . LEU B  1 291 ? 3.947   22.374  32.470 1.00 38.54  ? 291 LEU B CG    1 
ATOM   4652 C  CD1   . LEU B  1 291 ? 4.673   21.822  31.250 1.00 25.66  ? 291 LEU B CD1   1 
ATOM   4653 C  CD2   . LEU B  1 291 ? 2.564   22.930  32.126 1.00 33.34  ? 291 LEU B CD2   1 
ATOM   4654 N  N     . ARG B  1 292 ? 1.996   19.921  35.969 1.00 30.58  ? 292 ARG B N     1 
ATOM   4655 C  CA    . ARG B  1 292 ? 1.854   18.741  36.814 1.00 32.76  ? 292 ARG B CA    1 
ATOM   4656 C  C     . ARG B  1 292 ? 2.283   17.575  35.942 1.00 37.15  ? 292 ARG B C     1 
ATOM   4657 O  O     . ARG B  1 292 ? 1.452   16.774  35.510 1.00 28.89  ? 292 ARG B O     1 
ATOM   4658 C  CB    . ARG B  1 292 ? 0.395   18.565  37.236 1.00 34.69  ? 292 ARG B CB    1 
ATOM   4659 C  CG    . ARG B  1 292 ? -0.079  19.663  38.118 1.00 42.80  ? 292 ARG B CG    1 
ATOM   4660 C  CD    . ARG B  1 292 ? 0.541   19.548  39.495 1.00 38.05  ? 292 ARG B CD    1 
ATOM   4661 N  NE    . ARG B  1 292 ? -0.168  18.545  40.277 1.00 58.67  ? 292 ARG B NE    1 
ATOM   4662 C  CZ    . ARG B  1 292 ? 0.032   18.319  41.570 1.00 63.27  ? 292 ARG B CZ    1 
ATOM   4663 N  NH1   . ARG B  1 292 ? 0.933   19.029  42.239 1.00 64.81  ? 292 ARG B NH1   1 
ATOM   4664 N  NH2   . ARG B  1 292 ? -0.685  17.391  42.195 1.00 62.18  ? 292 ARG B NH2   1 
ATOM   4665 N  N     . MET B  1 293 ? 3.589   17.497  35.685 1.00 37.46  ? 293 MET B N     1 
ATOM   4666 C  CA    . MET B  1 293 ? 4.170   16.481  34.814 1.00 33.94  ? 293 MET B CA    1 
ATOM   4667 C  C     . MET B  1 293 ? 4.012   15.035  35.279 1.00 32.16  ? 293 MET B C     1 
ATOM   4668 O  O     . MET B  1 293 ? 3.416   14.197  34.596 1.00 32.24  ? 293 MET B O     1 
ATOM   4669 C  CB    . MET B  1 293 ? 5.660   16.812  34.598 1.00 34.27  ? 293 MET B CB    1 
ATOM   4670 C  CG    . MET B  1 293 ? 6.326   16.042  33.479 1.00 39.10  ? 293 MET B CG    1 
ATOM   4671 S  SD    . MET B  1 293 ? 5.523   16.196  31.868 1.00 60.34  ? 293 MET B SD    1 
ATOM   4672 C  CE    . MET B  1 293 ? 5.057   17.907  31.848 1.00 28.29  ? 293 MET B CE    1 
ATOM   4673 N  N     . VAL B  1 294 ? 4.557   14.748  36.449 1.00 35.90  ? 294 VAL B N     1 
ATOM   4674 C  CA    . VAL B  1 294 ? 4.525   13.415  37.016 1.00 33.34  ? 294 VAL B CA    1 
ATOM   4675 C  C     . VAL B  1 294 ? 3.105   12.858  37.134 1.00 36.82  ? 294 VAL B C     1 
ATOM   4676 O  O     . VAL B  1 294 ? 2.868   11.673  36.892 1.00 37.48  ? 294 VAL B O     1 
ATOM   4677 C  CB    . VAL B  1 294 ? 5.228   13.443  38.408 1.00 35.88  ? 294 VAL B CB    1 
ATOM   4678 C  CG1   . VAL B  1 294 ? 4.770   12.308  39.263 1.00 28.33  ? 294 VAL B CG1   1 
ATOM   4679 C  CG2   . VAL B  1 294 ? 6.754   13.381  38.214 1.00 35.17  ? 294 VAL B CG2   1 
ATOM   4680 N  N     . GLN B  1 295 ? 2.158   13.709  37.491 1.00 36.97  ? 295 GLN B N     1 
ATOM   4681 C  CA    . GLN B  1 295 ? 0.778   13.258  37.662 1.00 32.04  ? 295 GLN B CA    1 
ATOM   4682 C  C     . GLN B  1 295 ? 0.040   12.997  36.356 1.00 33.63  ? 295 GLN B C     1 
ATOM   4683 O  O     . GLN B  1 295 ? -1.067  12.440  36.359 1.00 40.32  ? 295 GLN B O     1 
ATOM   4684 C  CB    . GLN B  1 295 ? 0.000   14.288  38.483 1.00 34.58  ? 295 GLN B CB    1 
ATOM   4685 C  CG    . GLN B  1 295 ? 0.542   14.554  39.888 1.00 32.77  ? 295 GLN B CG    1 
ATOM   4686 C  CD    . GLN B  1 295 ? 1.718   15.535  39.943 1.00 42.44  ? 295 GLN B CD    1 
ATOM   4687 O  OE1   . GLN B  1 295 ? 2.189   16.074  38.923 1.00 35.82  ? 295 GLN B OE1   1 
ATOM   4688 N  NE2   . GLN B  1 295 ? 2.197   15.769  41.150 1.00 42.02  ? 295 GLN B NE2   1 
ATOM   4689 N  N     . SER B  1 296 ? 0.632   13.394  35.239 1.00 29.84  ? 296 SER B N     1 
ATOM   4690 C  CA    . SER B  1 296 ? -0.038  13.218  33.955 1.00 30.68  ? 296 SER B CA    1 
ATOM   4691 C  C     . SER B  1 296 ? 0.485   12.005  33.194 1.00 32.30  ? 296 SER B C     1 
ATOM   4692 O  O     . SER B  1 296 ? 0.223   11.844  32.001 1.00 28.22  ? 296 SER B O     1 
ATOM   4693 C  CB    . SER B  1 296 ? 0.123   14.482  33.107 1.00 35.35  ? 296 SER B CB    1 
ATOM   4694 O  OG    . SER B  1 296 ? -0.448  15.608  33.752 1.00 32.50  ? 296 SER B OG    1 
ATOM   4695 N  N     . LYS B  1 297 ? 1.181   11.125  33.903 1.00 30.33  ? 297 LYS B N     1 
ATOM   4696 C  CA    . LYS B  1 297 ? 1.754   9.958   33.269 1.00 29.66  ? 297 LYS B CA    1 
ATOM   4697 C  C     . LYS B  1 297 ? 0.810   9.228   32.318 1.00 37.26  ? 297 LYS B C     1 
ATOM   4698 O  O     . LYS B  1 297 ? 1.131   9.027   31.147 1.00 33.96  ? 297 LYS B O     1 
ATOM   4699 C  CB    . LYS B  1 297 ? 2.284   8.982   34.322 1.00 31.46  ? 297 LYS B CB    1 
ATOM   4700 C  CG    . LYS B  1 297 ? 3.118   7.832   33.715 1.00 24.30  ? 297 LYS B CG    1 
ATOM   4701 C  CD    . LYS B  1 297 ? 3.569   6.845   34.772 1.00 28.43  ? 297 LYS B CD    1 
ATOM   4702 C  CE    . LYS B  1 297 ? 2.418   6.411   35.652 1.00 33.45  ? 297 LYS B CE    1 
ATOM   4703 N  NZ    . LYS B  1 297 ? 2.921   5.519   36.734 1.00 40.64  ? 297 LYS B NZ    1 
ATOM   4704 N  N     . ARG B  1 298 ? -0.356  8.844   32.818 1.00 33.41  ? 298 ARG B N     1 
ATOM   4705 C  CA    . ARG B  1 298 ? -1.325  8.124   32.015 1.00 34.58  ? 298 ARG B CA    1 
ATOM   4706 C  C     . ARG B  1 298 ? -1.702  8.874   30.757 1.00 30.41  ? 298 ARG B C     1 
ATOM   4707 O  O     . ARG B  1 298 ? -1.794  8.279   29.682 1.00 43.61  ? 298 ARG B O     1 
ATOM   4708 C  CB    . ARG B  1 298 ? -2.583  7.823   32.852 1.00 43.35  ? 298 ARG B CB    1 
ATOM   4709 C  CG    . ARG B  1 298 ? -2.534  6.524   33.664 1.00 57.03  ? 298 ARG B CG    1 
ATOM   4710 C  CD    . ARG B  1 298 ? -1.106  6.074   33.909 1.00 66.35  ? 298 ARG B CD    1 
ATOM   4711 N  NE    . ARG B  1 298 ? -1.012  4.904   34.772 1.00 65.94  ? 298 ARG B NE    1 
ATOM   4712 C  CZ    . ARG B  1 298 ? 0.017   4.060   34.764 1.00 73.87  ? 298 ARG B CZ    1 
ATOM   4713 N  NH1   . ARG B  1 298 ? 1.033   4.252   33.927 1.00 52.95  ? 298 ARG B NH1   1 
ATOM   4714 N  NH2   . ARG B  1 298 ? 0.041   3.032   35.603 1.00 75.85  ? 298 ARG B NH2   1 
ATOM   4715 N  N     . ASP B  1 299 ? -1.897  10.183  30.887 1.00 28.42  ? 299 ASP B N     1 
ATOM   4716 C  CA    . ASP B  1 299 ? -2.284  11.015  29.750 1.00 30.51  ? 299 ASP B CA    1 
ATOM   4717 C  C     . ASP B  1 299 ? -1.177  11.113  28.708 1.00 38.16  ? 299 ASP B C     1 
ATOM   4718 O  O     . ASP B  1 299 ? -1.445  11.246  27.511 1.00 38.47  ? 299 ASP B O     1 
ATOM   4719 C  CB    . ASP B  1 299 ? -2.699  12.414  30.225 1.00 34.96  ? 299 ASP B CB    1 
ATOM   4720 C  CG    . ASP B  1 299 ? -3.942  12.382  31.124 1.00 38.57  ? 299 ASP B CG    1 
ATOM   4721 O  OD1   . ASP B  1 299 ? -4.904  11.688  30.768 1.00 40.81  ? 299 ASP B OD1   1 
ATOM   4722 O  OD2   . ASP B  1 299 ? -3.967  13.052  32.171 1.00 46.19  ? 299 ASP B OD2   1 
ATOM   4723 N  N     . ILE B  1 300 ? 0.073   11.044  29.157 1.00 30.22  ? 300 ILE B N     1 
ATOM   4724 C  CA    . ILE B  1 300 ? 1.172   11.099  28.216 1.00 28.23  ? 300 ILE B CA    1 
ATOM   4725 C  C     . ILE B  1 300 ? 1.232   9.777   27.446 1.00 31.51  ? 300 ILE B C     1 
ATOM   4726 O  O     . ILE B  1 300 ? 1.350   9.767   26.218 1.00 32.85  ? 300 ILE B O     1 
ATOM   4727 C  CB    . ILE B  1 300 ? 2.505   11.360  28.943 1.00 28.50  ? 300 ILE B CB    1 
ATOM   4728 C  CG1   . ILE B  1 300 ? 2.514   12.804  29.464 1.00 29.54  ? 300 ILE B CG1   1 
ATOM   4729 C  CG2   . ILE B  1 300 ? 3.688   11.043  28.022 1.00 30.95  ? 300 ILE B CG2   1 
ATOM   4730 C  CD1   . ILE B  1 300 ? 3.492   13.050  30.609 1.00 28.87  ? 300 ILE B CD1   1 
ATOM   4731 N  N     . GLU B  1 301 ? 1.114   8.667   28.167 1.00 38.58  ? 301 GLU B N     1 
ATOM   4732 C  CA    . GLU B  1 301 ? 1.176   7.348   27.543 1.00 42.39  ? 301 GLU B CA    1 
ATOM   4733 C  C     . GLU B  1 301 ? 0.117   7.110   26.482 1.00 34.89  ? 301 GLU B C     1 
ATOM   4734 O  O     . GLU B  1 301 ? 0.403   6.532   25.444 1.00 33.86  ? 301 GLU B O     1 
ATOM   4735 C  CB    . GLU B  1 301 ? 1.039   6.235   28.584 1.00 29.38  ? 301 GLU B CB    1 
ATOM   4736 C  CG    . GLU B  1 301 ? 2.151   6.167   29.604 1.00 45.72  ? 301 GLU B CG    1 
ATOM   4737 C  CD    . GLU B  1 301 ? 1.899   5.113   30.669 1.00 42.25  ? 301 GLU B CD    1 
ATOM   4738 O  OE1   . GLU B  1 301 ? 0.789   5.114   31.230 1.00 32.70  ? 301 GLU B OE1   1 
ATOM   4739 O  OE2   . GLU B  1 301 ? 2.805   4.299   30.948 1.00 36.77  ? 301 GLU B OE2   1 
ATOM   4740 N  N     . ASP B  1 302 ? -1.104  7.550   26.748 1.00 39.82  ? 302 ASP B N     1 
ATOM   4741 C  CA    . ASP B  1 302 ? -2.200  7.336   25.818 1.00 33.70  ? 302 ASP B CA    1 
ATOM   4742 C  C     . ASP B  1 302 ? -3.202  8.470   25.978 1.00 34.95  ? 302 ASP B C     1 
ATOM   4743 O  O     . ASP B  1 302 ? -4.189  8.346   26.692 1.00 33.59  ? 302 ASP B O     1 
ATOM   4744 C  CB    . ASP B  1 302 ? -2.831  5.986   26.138 1.00 42.14  ? 302 ASP B CB    1 
ATOM   4745 C  CG    . ASP B  1 302 ? -4.037  5.694   25.294 1.00 56.33  ? 302 ASP B CG    1 
ATOM   4746 O  OD1   . ASP B  1 302 ? -3.976  5.918   24.059 1.00 47.69  ? 302 ASP B OD1   1 
ATOM   4747 O  OD2   . ASP B  1 302 ? -5.040  5.226   25.878 1.00 57.74  ? 302 ASP B OD2   1 
ATOM   4748 N  N     . PRO B  1 303 ? -2.958  9.596   25.304 1.00 30.16  ? 303 PRO B N     1 
ATOM   4749 C  CA    . PRO B  1 303 ? -3.817  10.773  25.366 1.00 40.45  ? 303 PRO B CA    1 
ATOM   4750 C  C     . PRO B  1 303 ? -5.210  10.552  24.772 1.00 38.77  ? 303 PRO B C     1 
ATOM   4751 O  O     . PRO B  1 303 ? -5.346  10.098  23.640 1.00 33.90  ? 303 PRO B O     1 
ATOM   4752 C  CB    . PRO B  1 303 ? -3.030  11.829  24.575 1.00 34.92  ? 303 PRO B CB    1 
ATOM   4753 C  CG    . PRO B  1 303 ? -1.722  11.192  24.248 1.00 46.07  ? 303 PRO B CG    1 
ATOM   4754 C  CD    . PRO B  1 303 ? -1.977  9.744   24.222 1.00 30.02  ? 303 PRO B CD    1 
ATOM   4755 N  N     . GLU B  1 304 ? -6.241  10.879  25.537 1.00 47.82  ? 304 GLU B N     1 
ATOM   4756 C  CA    . GLU B  1 304 ? -7.601  10.741  25.043 1.00 44.25  ? 304 GLU B CA    1 
ATOM   4757 C  C     . GLU B  1 304 ? -7.747  11.961  24.148 1.00 47.37  ? 304 GLU B C     1 
ATOM   4758 O  O     . GLU B  1 304 ? -7.562  13.092  24.600 1.00 41.57  ? 304 GLU B O     1 
ATOM   4759 C  CB    . GLU B  1 304 ? -8.589  10.821  26.201 1.00 58.15  ? 304 GLU B CB    1 
ATOM   4760 C  CG    . GLU B  1 304 ? -10.048 10.783  25.787 1.00 68.25  ? 304 GLU B CG    1 
ATOM   4761 C  CD    . GLU B  1 304 ? -10.965 11.276  26.896 1.00 84.91  ? 304 GLU B CD    1 
ATOM   4762 O  OE1   . GLU B  1 304 ? -10.756 10.872  28.064 1.00 89.93  ? 304 GLU B OE1   1 
ATOM   4763 O  OE2   . GLU B  1 304 ? -11.897 12.060  26.604 1.00 79.84  ? 304 GLU B OE2   1 
ATOM   4764 N  N     . ILE B  1 305 ? -8.060  11.754  22.878 1.00 52.06  ? 305 ILE B N     1 
ATOM   4765 C  CA    . ILE B  1 305 ? -8.172  12.895  21.980 1.00 48.66  ? 305 ILE B CA    1 
ATOM   4766 C  C     . ILE B  1 305 ? -9.384  13.766  22.298 1.00 46.82  ? 305 ILE B C     1 
ATOM   4767 O  O     . ILE B  1 305 ? -10.520 13.325  22.179 1.00 51.87  ? 305 ILE B O     1 
ATOM   4768 C  CB    . ILE B  1 305 ? -8.207  12.434  20.530 1.00 41.62  ? 305 ILE B CB    1 
ATOM   4769 C  CG1   . ILE B  1 305 ? -7.044  11.471  20.285 1.00 44.64  ? 305 ILE B CG1   1 
ATOM   4770 C  CG2   . ILE B  1 305 ? -8.122  13.646  19.596 1.00 47.17  ? 305 ILE B CG2   1 
ATOM   4771 C  CD1   . ILE B  1 305 ? -5.681  12.026  20.674 1.00 54.77  ? 305 ILE B CD1   1 
ATOM   4772 N  N     . VAL B  1 306 ? -9.125  15.006  22.697 1.00 44.07  ? 306 VAL B N     1 
ATOM   4773 C  CA    . VAL B  1 306 ? -10.174 15.940  23.079 1.00 44.67  ? 306 VAL B CA    1 
ATOM   4774 C  C     . VAL B  1 306 ? -10.414 17.090  22.116 1.00 50.44  ? 306 VAL B C     1 
ATOM   4775 O  O     . VAL B  1 306 ? -11.349 17.868  22.287 1.00 61.87  ? 306 VAL B O     1 
ATOM   4776 C  CB    . VAL B  1 306 ? -9.874  16.529  24.444 1.00 42.58  ? 306 VAL B CB    1 
ATOM   4777 C  CG1   . VAL B  1 306 ? -10.048 15.452  25.495 1.00 44.83  ? 306 VAL B CG1   1 
ATOM   4778 C  CG2   . VAL B  1 306 ? -8.449  17.071  24.464 1.00 44.90  ? 306 VAL B CG2   1 
ATOM   4779 N  N     . VAL B  1 307 ? -9.552  17.214  21.122 1.00 52.08  ? 307 VAL B N     1 
ATOM   4780 C  CA    . VAL B  1 307 ? -9.704  18.246  20.114 1.00 57.58  ? 307 VAL B CA    1 
ATOM   4781 C  C     . VAL B  1 307 ? -9.272  17.630  18.802 1.00 53.19  ? 307 VAL B C     1 
ATOM   4782 O  O     . VAL B  1 307 ? -8.199  17.054  18.695 1.00 49.48  ? 307 VAL B O     1 
ATOM   4783 C  CB    . VAL B  1 307 ? -8.841  19.502  20.385 1.00 67.11  ? 307 VAL B CB    1 
ATOM   4784 C  CG1   . VAL B  1 307 ? -7.354  19.134  20.395 1.00 78.72  ? 307 VAL B CG1   1 
ATOM   4785 C  CG2   . VAL B  1 307 ? -9.118  20.554  19.310 1.00 51.75  ? 307 VAL B CG2   1 
ATOM   4786 N  N     . GLN B  1 308 ? -10.107 17.745  17.802 1.00 45.27  ? 308 GLN B N     1 
ATOM   4787 C  CA    . GLN B  1 308 ? -9.797  17.169  16.518 1.00 51.84  ? 308 GLN B CA    1 
ATOM   4788 C  C     . GLN B  1 308 ? -9.288  18.265  15.624 1.00 48.01  ? 308 GLN B C     1 
ATOM   4789 O  O     . GLN B  1 308 ? -9.731  19.397  15.748 1.00 51.77  ? 308 GLN B O     1 
ATOM   4790 C  CB    . GLN B  1 308 ? -11.051 16.562  15.927 1.00 59.99  ? 308 GLN B CB    1 
ATOM   4791 C  CG    . GLN B  1 308 ? -10.790 15.659  14.770 1.00 81.94  ? 308 GLN B CG    1 
ATOM   4792 C  CD    . GLN B  1 308 ? -12.022 14.882  14.400 1.00 90.08  ? 308 GLN B CD    1 
ATOM   4793 O  OE1   . GLN B  1 308 ? -12.989 14.851  15.162 1.00 97.77  ? 308 GLN B OE1   1 
ATOM   4794 N  NE2   . GLN B  1 308 ? -11.999 14.240  13.234 1.00 89.58  ? 308 GLN B NE2   1 
ATOM   4795 N  N     . ALA B  1 309 ? -8.366  17.950  14.733 1.00 40.27  ? 309 ALA B N     1 
ATOM   4796 C  CA    . ALA B  1 309 ? -7.828  18.960  13.821 1.00 40.05  ? 309 ALA B CA    1 
ATOM   4797 C  C     . ALA B  1 309 ? -8.673  19.115  12.549 1.00 36.48  ? 309 ALA B C     1 
ATOM   4798 O  O     . ALA B  1 309 ? -9.288  18.167  12.066 1.00 40.73  ? 309 ALA B O     1 
ATOM   4799 C  CB    . ALA B  1 309 ? -6.394  18.620  13.430 1.00 31.91  ? 309 ALA B CB    1 
ATOM   4800 N  N     . THR B  1 310 ? -8.698  20.331  12.028 1.00 35.13  ? 310 THR B N     1 
ATOM   4801 C  CA    . THR B  1 310 ? -9.396  20.664  10.794 1.00 31.52  ? 310 THR B CA    1 
ATOM   4802 C  C     . THR B  1 310 ? -8.419  20.359  9.678  1.00 26.29  ? 310 THR B C     1 
ATOM   4803 O  O     . THR B  1 310 ? -7.251  20.732  9.746  1.00 31.82  ? 310 THR B O     1 
ATOM   4804 C  CB    . THR B  1 310 ? -9.716  22.179  10.740 1.00 34.36  ? 310 THR B CB    1 
ATOM   4805 O  OG1   . THR B  1 310 ? -10.710 22.477  11.715 1.00 45.09  ? 310 THR B OG1   1 
ATOM   4806 C  CG2   . THR B  1 310 ? -10.214 22.601  9.361  1.00 45.80  ? 310 THR B CG2   1 
ATOM   4807 N  N     . VAL B  1 311 ? -8.877  19.686  8.640  1.00 36.04  ? 311 VAL B N     1 
ATOM   4808 C  CA    . VAL B  1 311 ? -7.982  19.385  7.543  1.00 37.39  ? 311 VAL B CA    1 
ATOM   4809 C  C     . VAL B  1 311 ? -7.872  20.589  6.614  1.00 42.40  ? 311 VAL B C     1 
ATOM   4810 O  O     . VAL B  1 311 ? -8.875  21.189  6.246  1.00 53.11  ? 311 VAL B O     1 
ATOM   4811 C  CB    . VAL B  1 311 ? -8.480  18.156  6.772  1.00 37.89  ? 311 VAL B CB    1 
ATOM   4812 C  CG1   . VAL B  1 311 ? -7.725  18.005  5.491  1.00 38.51  ? 311 VAL B CG1   1 
ATOM   4813 C  CG2   . VAL B  1 311 ? -8.285  16.929  7.614  1.00 28.63  ? 311 VAL B CG2   1 
ATOM   4814 N  N     . LEU B  1 312 ? -6.646  20.960  6.260  1.00 44.41  ? 312 LEU B N     1 
ATOM   4815 C  CA    . LEU B  1 312 ? -6.410  22.083  5.353  1.00 41.18  ? 312 LEU B CA    1 
ATOM   4816 C  C     . LEU B  1 312 ? -5.829  21.562  4.039  1.00 36.65  ? 312 LEU B C     1 
ATOM   4817 O  O     . LEU B  1 312 ? -5.756  20.332  3.882  1.00 38.46  ? 312 LEU B O     1 
ATOM   4818 C  CB    . LEU B  1 312 ? -5.443  23.101  5.969  1.00 44.88  ? 312 LEU B CB    1 
ATOM   4819 C  CG    . LEU B  1 312 ? -5.974  23.974  7.101  1.00 39.13  ? 312 LEU B CG    1 
ATOM   4820 C  CD1   . LEU B  1 312 ? -4.859  24.857  7.623  1.00 49.75  ? 312 LEU B CD1   1 
ATOM   4821 C  CD2   . LEU B  1 312 ? -7.119  24.822  6.598  1.00 50.77  ? 312 LEU B CD2   1 
ATOM   4822 O  OXT   . LEU B  1 312 ? -5.474  22.376  3.168  1.00 41.87  ? 312 LEU B OXT   1 
HETATM 4823 MG MG    . MG  C  2 .   ? 28.712  -3.139  44.736 1.00 40.54  ? 400 MG  A MG    1 
HETATM 4824 MG MG    . MG  D  2 .   ? 26.334  4.550   43.536 1.00 57.15  ? 401 MG  A MG    1 
HETATM 4825 NA NA    . NA  E  3 .   ? 24.734  0.584   48.668 1.00 35.14  ? 402 NA  A NA    1 
HETATM 4826 P  PG    . ATP F  4 .   ? 26.885  1.392   46.475 1.00 64.92  ? 407 ATP A PG    1 
HETATM 4827 O  O1G   . ATP F  4 .   ? 26.124  2.538   45.634 1.00 32.61  ? 407 ATP A O1G   1 
HETATM 4828 O  O2G   . ATP F  4 .   ? 26.838  1.912   48.001 1.00 46.92  ? 407 ATP A O2G   1 
HETATM 4829 O  O3G   . ATP F  4 .   ? 28.272  1.164   46.013 1.00 54.93  ? 407 ATP A O3G   1 
HETATM 4830 P  PB    . ATP F  4 .   ? 26.362  -1.455  46.384 1.00 34.56  ? 407 ATP A PB    1 
HETATM 4831 O  O1B   . ATP F  4 .   ? 27.698  -1.717  45.797 1.00 26.03  ? 407 ATP A O1B   1 
HETATM 4832 O  O2B   . ATP F  4 .   ? 25.623  -2.413  47.231 1.00 31.25  ? 407 ATP A O2B   1 
HETATM 4833 O  O3B   . ATP F  4 .   ? 25.918  0.096   46.442 1.00 46.52  ? 407 ATP A O3B   1 
HETATM 4834 P  PA    . ATP F  4 .   ? 25.692  -2.882  43.981 1.00 36.00  ? 407 ATP A PA    1 
HETATM 4835 O  O1A   . ATP F  4 .   ? 25.160  -2.565  42.640 1.00 33.54  ? 407 ATP A O1A   1 
HETATM 4836 O  O2A   . ATP F  4 .   ? 26.754  -3.879  44.242 1.00 42.46  ? 407 ATP A O2A   1 
HETATM 4837 O  O3A   . ATP F  4 .   ? 25.472  -1.700  45.058 1.00 42.41  ? 407 ATP A O3A   1 
HETATM 4838 O  "O5'" . ATP F  4 .   ? 24.456  -3.778  44.500 1.00 25.76  ? 407 ATP A "O5'" 1 
HETATM 4839 C  "C5'" . ATP F  4 .   ? 23.180  -3.217  44.819 1.00 28.96  ? 407 ATP A "C5'" 1 
HETATM 4840 C  "C4'" . ATP F  4 .   ? 22.051  -4.132  44.336 1.00 34.10  ? 407 ATP A "C4'" 1 
HETATM 4841 O  "O4'" . ATP F  4 .   ? 22.037  -4.210  42.901 1.00 30.36  ? 407 ATP A "O4'" 1 
HETATM 4842 C  "C3'" . ATP F  4 .   ? 22.174  -5.571  44.844 1.00 28.77  ? 407 ATP A "C3'" 1 
HETATM 4843 O  "O3'" . ATP F  4 .   ? 21.465  -5.665  46.081 1.00 32.96  ? 407 ATP A "O3'" 1 
HETATM 4844 C  "C2'" . ATP F  4 .   ? 21.342  -6.301  43.792 1.00 37.31  ? 407 ATP A "C2'" 1 
HETATM 4845 O  "O2'" . ATP F  4 .   ? 19.950  -6.124  44.077 1.00 30.52  ? 407 ATP A "O2'" 1 
HETATM 4846 C  "C1'" . ATP F  4 .   ? 21.701  -5.554  42.509 1.00 34.71  ? 407 ATP A "C1'" 1 
HETATM 4847 N  N9    . ATP F  4 .   ? 22.897  -6.121  41.841 1.00 29.07  ? 407 ATP A N9    1 
HETATM 4848 C  C8    . ATP F  4 .   ? 24.000  -5.451  41.533 1.00 28.07  ? 407 ATP A C8    1 
HETATM 4849 N  N7    . ATP F  4 .   ? 24.834  -6.246  40.868 1.00 32.79  ? 407 ATP A N7    1 
HETATM 4850 C  C5    . ATP F  4 .   ? 24.260  -7.442  40.759 1.00 36.99  ? 407 ATP A C5    1 
HETATM 4851 C  C6    . ATP F  4 .   ? 24.625  -8.638  40.161 1.00 30.95  ? 407 ATP A C6    1 
HETATM 4852 N  N6    . ATP F  4 .   ? 25.802  -8.755  39.548 1.00 34.96  ? 407 ATP A N6    1 
HETATM 4853 N  N1    . ATP F  4 .   ? 23.776  -9.671  40.206 1.00 29.08  ? 407 ATP A N1    1 
HETATM 4854 C  C2    . ATP F  4 .   ? 22.604  -9.561  40.808 1.00 36.28  ? 407 ATP A C2    1 
HETATM 4855 N  N3    . ATP F  4 .   ? 22.220  -8.437  41.389 1.00 24.37  ? 407 ATP A N3    1 
HETATM 4856 C  C4    . ATP F  4 .   ? 23.018  -7.364  41.380 1.00 34.59  ? 407 ATP A C4    1 
HETATM 4857 N  N1    A PLP G  5 .   ? 27.815  7.986   39.533 0.50 89.18  ? 500 PLP A N1    1 
HETATM 4858 C  C2    A PLP G  5 .   ? 29.119  7.876   39.241 0.50 88.64  ? 500 PLP A C2    1 
HETATM 4859 C  C2A   A PLP G  5 .   ? 29.924  9.128   38.866 0.50 87.86  ? 500 PLP A C2A   1 
HETATM 4860 C  C3    A PLP G  5 .   ? 29.738  6.636   39.276 0.50 86.81  ? 500 PLP A C3    1 
HETATM 4861 O  O3    A PLP G  5 .   ? 31.047  6.512   38.934 0.50 92.30  ? 500 PLP A O3    1 
HETATM 4862 C  C4    A PLP G  5 .   ? 28.989  5.515   39.622 0.50 83.98  ? 500 PLP A C4    1 
HETATM 4863 C  C4A   A PLP G  5 .   ? 29.653  4.141   39.733 0.50 82.01  ? 500 PLP A C4A   1 
HETATM 4864 O  O4A   A PLP G  5 .   ? 30.819  4.026   40.093 0.50 63.60  ? 500 PLP A O4A   1 
HETATM 4865 C  C5    A PLP G  5 .   ? 27.635  5.655   39.908 0.50 82.13  ? 500 PLP A C5    1 
HETATM 4866 C  C6    A PLP G  5 .   ? 27.086  6.933   39.853 0.50 86.35  ? 500 PLP A C6    1 
HETATM 4867 C  C5A   A PLP G  5 .   ? 26.714  4.484   40.245 0.50 66.01  ? 500 PLP A C5A   1 
HETATM 4868 O  O4P   A PLP G  5 .   ? 27.240  3.689   41.317 0.50 72.47  ? 500 PLP A O4P   1 
HETATM 4869 P  P     A PLP G  5 .   ? 26.671  2.211   41.610 0.50 57.96  ? 500 PLP A P     1 
HETATM 4870 O  O1P   A PLP G  5 .   ? 25.108  2.224   41.238 0.50 60.25  ? 500 PLP A O1P   1 
HETATM 4871 O  O2P   A PLP G  5 .   ? 26.911  1.769   43.004 0.50 81.74  ? 500 PLP A O2P   1 
HETATM 4872 O  O3P   A PLP G  5 .   ? 27.393  1.257   40.532 0.50 62.52  ? 500 PLP A O3P   1 
HETATM 4873 C  C1    B MPD H  6 .   ? 30.016  9.567   36.615 0.50 50.59  ? 508 MPD A C1    1 
HETATM 4874 C  C2    B MPD H  6 .   ? 30.070  8.946   38.013 0.50 45.19  ? 508 MPD A C2    1 
HETATM 4875 O  O2    B MPD H  6 .   ? 30.762  7.696   37.940 0.50 52.53  ? 508 MPD A O2    1 
HETATM 4876 C  CM    B MPD H  6 .   ? 30.801  9.903   38.956 0.50 37.36  ? 508 MPD A CM    1 
HETATM 4877 C  C3    B MPD H  6 .   ? 28.643  8.694   38.506 0.50 47.98  ? 508 MPD A C3    1 
HETATM 4878 C  C4    B MPD H  6 .   ? 28.633  7.807   39.753 0.50 47.14  ? 508 MPD A C4    1 
HETATM 4879 O  O4    B MPD H  6 .   ? 27.311  7.782   40.294 0.50 45.91  ? 508 MPD A O4    1 
HETATM 4880 C  C5    B MPD H  6 .   ? 29.072  6.383   39.408 0.50 43.33  ? 508 MPD A C5    1 
HETATM 4881 C  C1    . MPD I  6 .   ? 27.060  -7.160  43.256 1.00 51.04  ? 512 MPD A C1    1 
HETATM 4882 C  C2    . MPD I  6 .   ? 28.503  -7.514  43.622 1.00 68.11  ? 512 MPD A C2    1 
HETATM 4883 O  O2    . MPD I  6 .   ? 28.514  -8.245  44.849 1.00 76.49  ? 512 MPD A O2    1 
HETATM 4884 C  CM    . MPD I  6 .   ? 29.132  -8.387  42.532 1.00 73.75  ? 512 MPD A CM    1 
HETATM 4885 C  C3    . MPD I  6 .   ? 29.323  -6.239  43.832 1.00 73.84  ? 512 MPD A C3    1 
HETATM 4886 C  C4    . MPD I  6 .   ? 29.207  -5.292  42.636 1.00 77.54  ? 512 MPD A C4    1 
HETATM 4887 O  O4    . MPD I  6 .   ? 29.844  -4.057  42.974 1.00 61.95  ? 512 MPD A O4    1 
HETATM 4888 C  C5    . MPD I  6 .   ? 29.848  -5.871  41.373 1.00 80.50  ? 512 MPD A C5    1 
HETATM 4889 C  C1    . MPD J  6 .   ? 4.519   20.474  52.015 1.00 64.56  ? 516 MPD A C1    1 
HETATM 4890 C  C2    . MPD J  6 .   ? 5.737   19.547  52.048 1.00 76.07  ? 516 MPD A C2    1 
HETATM 4891 O  O2    . MPD J  6 .   ? 5.411   18.370  52.793 1.00 61.39  ? 516 MPD A O2    1 
HETATM 4892 C  CM    . MPD J  6 .   ? 6.134   19.168  50.619 1.00 60.60  ? 516 MPD A CM    1 
HETATM 4893 C  C3    . MPD J  6 .   ? 6.907   20.256  52.733 1.00 69.49  ? 516 MPD A C3    1 
HETATM 4894 C  C4    . MPD J  6 .   ? 6.483   20.759  54.114 1.00 79.83  ? 516 MPD A C4    1 
HETATM 4895 O  O4    . MPD J  6 .   ? 6.175   19.641  54.949 1.00 89.06  ? 516 MPD A O4    1 
HETATM 4896 C  C5    . MPD J  6 .   ? 7.566   21.634  54.749 1.00 80.88  ? 516 MPD A C5    1 
HETATM 4897 S  S     . SO4 K  7 .   ? 38.196  -1.883  58.355 0.50 67.74  ? 524 SO4 A S     1 
HETATM 4898 O  O1    . SO4 K  7 .   ? 37.625  -2.969  59.173 0.50 63.10  ? 524 SO4 A O1    1 
HETATM 4899 O  O2    . SO4 K  7 .   ? 37.914  -2.139  56.927 0.50 60.06  ? 524 SO4 A O2    1 
HETATM 4900 O  O3    . SO4 K  7 .   ? 37.599  -0.599  58.761 0.50 65.23  ? 524 SO4 A O3    1 
HETATM 4901 O  O4    . SO4 K  7 .   ? 39.654  -1.820  58.566 0.50 57.85  ? 524 SO4 A O4    1 
HETATM 4902 S  S     . SO4 L  7 .   ? 23.350  27.659  53.861 0.50 64.87  ? 528 SO4 A S     1 
HETATM 4903 O  O1    . SO4 L  7 .   ? 24.460  27.431  54.807 0.50 60.32  ? 528 SO4 A O1    1 
HETATM 4904 O  O2    . SO4 L  7 .   ? 22.936  26.378  53.257 0.50 53.24  ? 528 SO4 A O2    1 
HETATM 4905 O  O3    . SO4 L  7 .   ? 22.198  28.240  54.570 0.50 61.42  ? 528 SO4 A O3    1 
HETATM 4906 O  O4    . SO4 L  7 .   ? 23.792  28.595  52.811 0.50 57.52  ? 528 SO4 A O4    1 
HETATM 4907 S  S     . SO4 M  7 .   ? 2.941   9.309   46.079 0.50 75.10  ? 538 SO4 A S     1 
HETATM 4908 O  O1    . SO4 M  7 .   ? 2.940   9.295   44.606 0.50 74.16  ? 538 SO4 A O1    1 
HETATM 4909 O  O2    . SO4 M  7 .   ? 1.554   9.480   46.562 0.50 73.81  ? 538 SO4 A O2    1 
HETATM 4910 O  O3    . SO4 M  7 .   ? 3.486   8.027   46.573 0.50 65.69  ? 538 SO4 A O3    1 
HETATM 4911 O  O4    . SO4 M  7 .   ? 3.777   10.428  46.561 0.50 65.01  ? 538 SO4 A O4    1 
HETATM 4912 MG MG    . MG  N  2 .   ? 3.867   31.218  23.735 1.00 37.97  ? 404 MG  B MG    1 
HETATM 4913 MG MG    . MG  O  2 .   ? 10.906  27.022  25.062 1.00 52.67  ? 405 MG  B MG    1 
HETATM 4914 NA NA    . NA  P  3 .   ? 6.951   26.687  19.490 1.00 35.21  ? 406 NA  B NA    1 
HETATM 4915 P  PG    . ATP Q  4 .   ? 7.981   28.344  21.954 1.00 63.90  ? 409 ATP B PG    1 
HETATM 4916 O  O1G   . ATP Q  4 .   ? 8.716   28.140  20.534 1.00 36.67  ? 409 ATP B O1G   1 
HETATM 4917 O  O2G   . ATP Q  4 .   ? 8.049   29.922  22.264 1.00 54.55  ? 409 ATP B O2G   1 
HETATM 4918 O  O3G   . ATP Q  4 .   ? 8.629   27.518  22.999 1.00 54.75  ? 409 ATP B O3G   1 
HETATM 4919 P  PB    . ATP Q  4 .   ? 5.070   28.705  21.873 1.00 32.76  ? 409 ATP B PB    1 
HETATM 4920 O  O1B   . ATP Q  4 .   ? 5.189   30.026  22.531 1.00 35.25  ? 409 ATP B O1B   1 
HETATM 4921 O  O2B   . ATP Q  4 .   ? 3.946   28.303  21.002 1.00 30.20  ? 409 ATP B O2B   1 
HETATM 4922 O  O3B   . ATP Q  4 .   ? 6.450   27.892  21.690 1.00 35.73  ? 409 ATP B O3B   1 
HETATM 4923 P  PA    . ATP Q  4 .   ? 3.364   28.191  24.101 1.00 35.70  ? 409 ATP B PA    1 
HETATM 4924 O  O1A   . ATP Q  4 .   ? 3.353   27.421  25.365 1.00 32.43  ? 409 ATP B O1A   1 
HETATM 4925 O  O2A   . ATP Q  4 .   ? 2.715   29.505  23.913 1.00 33.60  ? 409 ATP B O2A   1 
HETATM 4926 O  O3A   . ATP Q  4 .   ? 4.621   27.831  23.152 1.00 25.98  ? 409 ATP B O3A   1 
HETATM 4927 O  "O5'" . ATP Q  4 .   ? 2.272   27.306  23.310 1.00 28.01  ? 409 ATP B "O5'" 1 
HETATM 4928 C  "C5'" . ATP Q  4 .   ? 2.418   25.894  23.113 1.00 29.65  ? 409 ATP B "C5'" 1 
HETATM 4929 C  "C4'" . ATP Q  4 .   ? 1.123   25.119  23.390 1.00 34.52  ? 409 ATP B "C4'" 1 
HETATM 4930 O  "O4'" . ATP Q  4 .   ? 0.866   24.934  24.790 1.00 41.92  ? 409 ATP B "O4'" 1 
HETATM 4931 C  "C3'" . ATP Q  4 .   ? -0.140  25.752  22.804 1.00 44.07  ? 409 ATP B "C3'" 1 
HETATM 4932 O  "O3'" . ATP Q  4 .   ? -0.270  25.370  21.431 1.00 36.85  ? 409 ATP B "O3'" 1 
HETATM 4933 C  "C2'" . ATP Q  4 .   ? -1.192  25.005  23.621 1.00 36.87  ? 409 ATP B "C2'" 1 
HETATM 4934 O  "O2'" . ATP Q  4 .   ? -1.317  23.658  23.156 1.00 35.04  ? 409 ATP B "O2'" 1 
HETATM 4935 C  "C1'" . ATP Q  4 .   ? -0.554  25.012  25.012 1.00 39.21  ? 409 ATP B "C1'" 1 
HETATM 4936 N  N9    . ATP Q  4 .   ? -0.822  26.296  25.709 1.00 40.84  ? 409 ATP B N9    1 
HETATM 4937 C  C8    . ATP Q  4 .   ? 0.102   27.151  26.146 1.00 37.81  ? 409 ATP B C8    1 
HETATM 4938 N  N7    . ATP Q  4 .   ? -0.488  28.154  26.786 1.00 34.59  ? 409 ATP B N7    1 
HETATM 4939 C  C5    . ATP Q  4 .   ? -1.800  27.939  26.757 1.00 45.56  ? 409 ATP B C5    1 
HETATM 4940 C  C6    . ATP Q  4 .   ? -2.902  28.610  27.265 1.00 39.68  ? 409 ATP B C6    1 
HETATM 4941 N  N6    . ATP Q  4 .   ? -2.741  29.760  27.926 1.00 46.08  ? 409 ATP B N6    1 
HETATM 4942 N  N1    . ATP Q  4 .   ? -4.123  28.098  27.080 1.00 41.10  ? 409 ATP B N1    1 
HETATM 4943 C  C2    . ATP Q  4 .   ? -4.290  26.961  26.416 1.00 52.68  ? 409 ATP B C2    1 
HETATM 4944 N  N3    . ATP Q  4 .   ? -3.263  26.296  25.914 1.00 39.31  ? 409 ATP B N3    1 
HETATM 4945 C  C4    . ATP Q  4 .   ? -2.015  26.753  26.066 1.00 38.61  ? 409 ATP B C4    1 
HETATM 4946 C  C1    B MPD R  6 .   ? 15.262  28.481  32.974 0.50 25.05  ? 508 MPD B C1    1 
HETATM 4947 C  C2    B MPD R  6 .   ? 14.641  29.037  31.691 0.50 30.99  ? 508 MPD B C2    1 
HETATM 4948 O  O2    B MPD R  6 .   ? 13.540  29.884  32.033 0.50 29.56  ? 508 MPD B O2    1 
HETATM 4949 C  CM    B MPD R  6 .   ? 15.693  29.834  30.918 0.50 26.11  ? 508 MPD B CM    1 
HETATM 4950 C  C3    B MPD R  6 .   ? 14.133  27.874  30.835 0.50 37.45  ? 508 MPD B C3    1 
HETATM 4951 C  C4    B MPD R  6 .   ? 13.340  28.385  29.632 0.50 42.44  ? 508 MPD B C4    1 
HETATM 4952 O  O4    B MPD R  6 .   ? 13.131  27.304  28.722 0.50 54.27  ? 508 MPD B O4    1 
HETATM 4953 C  C5    B MPD R  6 .   ? 11.989  28.952  30.071 0.50 50.26  ? 508 MPD B C5    1 
HETATM 4954 N  N1    A PLP S  5 .   ? 13.507  26.670  29.297 0.50 75.92  ? 500 PLP B N1    1 
HETATM 4955 C  C2    A PLP S  5 .   ? 13.926  27.840  29.796 0.50 76.70  ? 500 PLP B C2    1 
HETATM 4956 C  C2A   A PLP S  5 .   ? 15.355  27.996  30.318 0.50 73.79  ? 500 PLP B C2A   1 
HETATM 4957 C  C3    A PLP S  5 .   ? 13.043  28.911  29.879 0.50 75.67  ? 500 PLP B C3    1 
HETATM 4958 O  O3    A PLP S  5 .   ? 13.457  30.085  30.431 0.50 78.88  ? 500 PLP B O3    1 
HETATM 4959 C  C4    A PLP S  5 .   ? 11.730  28.747  29.444 0.50 70.79  ? 500 PLP B C4    1 
HETATM 4960 C  C4A   A PLP S  5 .   ? 10.750  29.920  29.448 0.50 71.56  ? 500 PLP B C4A   1 
HETATM 4961 O  O4A   A PLP S  5 .   ? 10.967  30.924  28.783 0.50 55.41  ? 500 PLP B O4A   1 
HETATM 4962 C  C5    A PLP S  5 .   ? 11.315  27.512  28.955 0.50 63.63  ? 500 PLP B C5    1 
HETATM 4963 C  C6    A PLP S  5 .   ? 12.261  26.494  28.893 0.50 73.32  ? 500 PLP B C6    1 
HETATM 4964 C  C5A   A PLP S  5 .   ? 9.862   27.171  28.613 0.50 38.81  ? 500 PLP B C5A   1 
HETATM 4965 O  O4P   A PLP S  5 .   ? 9.473   27.550  27.283 0.50 54.92  ? 500 PLP B O4P   1 
HETATM 4966 P  P     A PLP S  5 .   ? 7.950   27.373  26.792 0.50 24.34  ? 500 PLP B P     1 
HETATM 4967 O  O1P   A PLP S  5 .   ? 7.834   28.107  25.359 0.50 48.33  ? 500 PLP B O1P   1 
HETATM 4968 O  O2P   A PLP S  5 .   ? 6.953   27.892  27.758 0.50 43.28  ? 500 PLP B O2P   1 
HETATM 4969 O  O3P   A PLP S  5 .   ? 7.760   25.805  26.504 0.50 48.29  ? 500 PLP B O3P   1 
HETATM 4970 C  C1    . MPD T  6 .   ? 9.755   15.142  1.226  1.00 40.60  ? 510 MPD B C1    1 
HETATM 4971 C  C2    . MPD T  6 .   ? 11.183  15.222  0.681  1.00 51.84  ? 510 MPD B C2    1 
HETATM 4972 O  O2    . MPD T  6 .   ? 11.842  16.338  1.285  1.00 42.05  ? 510 MPD B O2    1 
HETATM 4973 C  CM    . MPD T  6 .   ? 11.930  13.929  1.011  1.00 50.73  ? 510 MPD B CM    1 
HETATM 4974 C  C3    . MPD T  6 .   ? 11.122  15.457  -0.830 1.00 74.12  ? 510 MPD B C3    1 
HETATM 4975 C  C4    . MPD T  6 .   ? 12.438  16.017  -1.380 1.00 79.36  ? 510 MPD B C4    1 
HETATM 4976 O  O4    . MPD T  6 .   ? 12.721  17.272  -0.754 1.00 85.76  ? 510 MPD B O4    1 
HETATM 4977 C  C5    . MPD T  6 .   ? 13.605  15.042  -1.207 1.00 82.48  ? 510 MPD B C5    1 
HETATM 4978 C  C1    . MPD U  6 .   ? -0.093  30.543  24.254 1.00 45.94  ? 514 MPD B C1    1 
HETATM 4979 C  C2    . MPD U  6 .   ? -0.323  32.055  24.320 1.00 59.48  ? 514 MPD B C2    1 
HETATM 4980 O  O2    . MPD U  6 .   ? 0.461   32.706  23.319 1.00 53.42  ? 514 MPD B O2    1 
HETATM 4981 C  CM    . MPD U  6 .   ? -1.804  32.361  24.082 1.00 46.00  ? 514 MPD B CM    1 
HETATM 4982 C  C3    . MPD U  6 .   ? 0.104   32.583  25.692 1.00 50.39  ? 514 MPD B C3    1 
HETATM 4983 C  C4    . MPD U  6 .   ? 1.555   32.193  25.993 1.00 72.52  ? 514 MPD B C4    1 
HETATM 4984 O  O4    . MPD U  6 .   ? 2.426   32.782  25.021 1.00 65.47  ? 514 MPD B O4    1 
HETATM 4985 C  C5    . MPD U  6 .   ? 1.960   32.640  27.400 1.00 80.36  ? 514 MPD B C5    1 
HETATM 4986 C  C1    . MPD V  6 .   ? -11.323 26.093  3.001  0.50 64.64  ? 518 MPD B C1    1 
HETATM 4987 C  C2    . MPD V  6 .   ? -10.814 25.265  4.183  0.50 68.43  ? 518 MPD B C2    1 
HETATM 4988 O  O2    . MPD V  6 .   ? -9.534  24.707  3.879  0.50 71.90  ? 518 MPD B O2    1 
HETATM 4989 C  CM    . MPD V  6 .   ? -10.694 26.162  5.416  0.50 57.87  ? 518 MPD B CM    1 
HETATM 4990 C  C3    . MPD V  6 .   ? -11.776 24.111  4.478  0.50 69.04  ? 518 MPD B C3    1 
HETATM 4991 C  C4    . MPD V  6 .   ? -11.818 23.112  3.314  0.50 68.80  ? 518 MPD B C4    1 
HETATM 4992 O  O4    . MPD V  6 .   ? -12.223 23.777  2.112  0.50 62.85  ? 518 MPD B O4    1 
HETATM 4993 C  C5    . MPD V  6 .   ? -10.469 22.407  3.118  0.50 69.35  ? 518 MPD B C5    1 
HETATM 4994 C  C1    . MPD W  6 .   ? 6.521   25.033  -2.141 1.00 83.54  ? 520 MPD B C1    1 
HETATM 4995 C  C2    . MPD W  6 .   ? 7.539   26.161  -1.949 1.00 87.45  ? 520 MPD B C2    1 
HETATM 4996 O  O2    . MPD W  6 .   ? 8.248   26.372  -3.174 1.00 93.36  ? 520 MPD B O2    1 
HETATM 4997 C  CM    . MPD W  6 .   ? 6.812   27.449  -1.556 1.00 87.32  ? 520 MPD B CM    1 
HETATM 4998 C  C3    . MPD W  6 .   ? 8.565   25.789  -0.879 1.00 91.92  ? 520 MPD B C3    1 
HETATM 4999 C  C4    . MPD W  6 .   ? 9.089   24.369  -1.096 1.00 88.58  ? 520 MPD B C4    1 
HETATM 5000 O  O4    . MPD W  6 .   ? 10.442  24.290  -0.637 1.00 87.83  ? 520 MPD B O4    1 
HETATM 5001 C  C5    . MPD W  6 .   ? 8.236   23.371  -0.311 1.00 93.47  ? 520 MPD B C5    1 
HETATM 5002 C  C1    . MPD X  6 .   ? -11.228 32.781  7.093  1.00 88.31  ? 522 MPD B C1    1 
HETATM 5003 C  C2    . MPD X  6 .   ? -10.725 31.728  8.083  1.00 89.85  ? 522 MPD B C2    1 
HETATM 5004 O  O2    . MPD X  6 .   ? -11.596 30.597  8.064  1.00 94.19  ? 522 MPD B O2    1 
HETATM 5005 C  CM    . MPD X  6 .   ? -9.310  31.291  7.696  1.00 88.12  ? 522 MPD B CM    1 
HETATM 5006 C  C3    . MPD X  6 .   ? -10.713 32.306  9.500  1.00 91.20  ? 522 MPD B C3    1 
HETATM 5007 C  C4    . MPD X  6 .   ? -12.126 32.737  9.898  1.00 95.84  ? 522 MPD B C4    1 
HETATM 5008 O  O4    . MPD X  6 .   ? -12.987 31.593  9.878  1.00 99.90  ? 522 MPD B O4    1 
HETATM 5009 C  C5    . MPD X  6 .   ? -12.134 33.390  11.281 1.00 88.63  ? 522 MPD B C5    1 
HETATM 5010 S  S     . SO4 Y  7 .   ? 33.223  18.838  16.545 0.50 67.82  ? 526 SO4 B S     1 
HETATM 5011 O  O1    . SO4 Y  7 .   ? 33.576  19.741  15.432 0.50 63.33  ? 526 SO4 B O1    1 
HETATM 5012 O  O2    . SO4 Y  7 .   ? 33.147  17.452  16.056 0.50 55.68  ? 526 SO4 B O2    1 
HETATM 5013 O  O3    . SO4 Y  7 .   ? 31.912  19.230  17.091 0.50 39.51  ? 526 SO4 B O3    1 
HETATM 5014 O  O4    . SO4 Y  7 .   ? 34.256  18.926  17.596 0.50 59.24  ? 526 SO4 B O4    1 
HETATM 5015 S  S     . SO4 Z  7 .   ? 14.261  4.155   15.439 0.50 78.69  ? 530 SO4 B S     1 
HETATM 5016 O  O1    . SO4 Z  7 .   ? 15.157  4.561   16.537 0.50 65.40  ? 530 SO4 B O1    1 
HETATM 5017 O  O2    . SO4 Z  7 .   ? 14.869  3.038   14.682 0.50 67.29  ? 530 SO4 B O2    1 
HETATM 5018 O  O3    . SO4 Z  7 .   ? 12.968  3.718   16.000 0.50 75.75  ? 530 SO4 B O3    1 
HETATM 5019 O  O4    . SO4 Z  7 .   ? 14.042  5.306   14.540 0.50 73.78  ? 530 SO4 B O4    1 
HETATM 5020 S  S     . SO4 AA 7 .   ? 8.948   40.748  11.173 0.50 67.16  ? 532 SO4 B S     1 
HETATM 5021 O  O1    . SO4 AA 7 .   ? 8.000   40.732  10.046 0.50 62.59  ? 532 SO4 B O1    1 
HETATM 5022 O  O2    . SO4 AA 7 .   ? 10.068  39.842  10.873 0.50 58.71  ? 532 SO4 B O2    1 
HETATM 5023 O  O3    . SO4 AA 7 .   ? 9.469   42.116  11.348 0.50 63.16  ? 532 SO4 B O3    1 
HETATM 5024 O  O4    . SO4 AA 7 .   ? 8.257   40.310  12.405 0.50 57.47  ? 532 SO4 B O4    1 
HETATM 5025 S  S     . SO4 BA 7 .   ? 9.689   3.327   20.792 0.50 59.09  ? 534 SO4 B S     1 
HETATM 5026 O  O1    . SO4 BA 7 .   ? 10.734  2.350   20.446 0.50 48.50  ? 534 SO4 B O1    1 
HETATM 5027 O  O2    . SO4 BA 7 .   ? 8.833   3.597   19.620 0.50 48.11  ? 534 SO4 B O2    1 
HETATM 5028 O  O3    . SO4 BA 7 .   ? 8.840   2.789   21.880 0.50 40.88  ? 534 SO4 B O3    1 
HETATM 5029 O  O4    . SO4 BA 7 .   ? 10.373  4.563   21.220 0.50 28.73  ? 534 SO4 B O4    1 
HETATM 5030 S  S     . SO4 CA 7 .   ? 18.647  34.164  30.498 0.50 77.00  ? 536 SO4 B S     1 
HETATM 5031 O  O1    . SO4 CA 7 .   ? 19.897  34.782  30.009 0.50 70.96  ? 536 SO4 B O1    1 
HETATM 5032 O  O2    . SO4 CA 7 .   ? 17.589  34.296  29.480 0.50 73.85  ? 536 SO4 B O2    1 
HETATM 5033 O  O3    . SO4 CA 7 .   ? 18.892  32.732  30.783 0.50 66.25  ? 536 SO4 B O3    1 
HETATM 5034 O  O4    . SO4 CA 7 .   ? 18.203  34.863  31.718 0.50 68.41  ? 536 SO4 B O4    1 
HETATM 5035 O  O     . HOH DA 8 .   ? 9.691   20.121  40.368 1.00 27.72  ? 600 HOH A O     1 
HETATM 5036 O  O     . HOH DA 8 .   ? 18.046  13.008  32.339 1.00 23.73  ? 602 HOH A O     1 
HETATM 5037 O  O     . HOH DA 8 .   ? 16.307  8.207   28.945 1.00 32.98  ? 605 HOH A O     1 
HETATM 5038 O  O     . HOH DA 8 .   ? 8.869   3.667   29.340 1.00 31.55  ? 606 HOH A O     1 
HETATM 5039 O  O     . HOH DA 8 .   ? 23.240  19.525  34.866 1.00 30.42  ? 608 HOH A O     1 
HETATM 5040 O  O     . HOH DA 8 .   ? 19.564  7.227   44.481 1.00 31.06  ? 617 HOH A O     1 
HETATM 5041 O  O     . HOH DA 8 .   ? 26.829  6.137   31.718 1.00 54.98  ? 618 HOH A O     1 
HETATM 5042 O  O     . HOH DA 8 .   ? 16.058  9.074   34.784 1.00 26.97  ? 619 HOH A O     1 
HETATM 5043 O  O     . HOH DA 8 .   ? 25.542  10.486  50.021 1.00 37.92  ? 621 HOH A O     1 
HETATM 5044 O  O     . HOH DA 8 .   ? 30.597  9.733   48.379 1.00 27.84  ? 622 HOH A O     1 
HETATM 5045 O  O     . HOH DA 8 .   ? 25.426  -0.820  33.973 1.00 30.63  ? 623 HOH A O     1 
HETATM 5046 O  O     . HOH DA 8 .   ? 7.983   -2.043  31.296 1.00 45.74  ? 624 HOH A O     1 
HETATM 5047 O  O     . HOH DA 8 .   ? 17.346  13.576  36.511 1.00 31.95  ? 625 HOH A O     1 
HETATM 5048 O  O     . HOH DA 8 .   ? 28.159  20.622  32.674 1.00 35.56  ? 628 HOH A O     1 
HETATM 5049 O  O     . HOH DA 8 .   ? 20.048  14.066  36.118 1.00 25.20  ? 633 HOH A O     1 
HETATM 5050 O  O     . HOH DA 8 .   ? 7.330   -7.324  37.352 1.00 42.91  ? 634 HOH A O     1 
HETATM 5051 O  O     . HOH DA 8 .   ? 9.769   18.894  44.507 1.00 37.65  ? 635 HOH A O     1 
HETATM 5052 O  O     . HOH DA 8 .   ? 28.652  21.331  57.285 1.00 54.69  ? 644 HOH A O     1 
HETATM 5053 O  O     . HOH DA 8 .   ? 12.560  -8.709  63.334 1.00 50.60  ? 646 HOH A O     1 
HETATM 5054 O  O     . HOH DA 8 .   ? 5.412   7.214   54.447 1.00 48.65  ? 647 HOH A O     1 
HETATM 5055 O  O     . HOH DA 8 .   ? 27.505  0.103   32.271 1.00 39.01  ? 648 HOH A O     1 
HETATM 5056 O  O     . HOH DA 8 .   ? 24.664  -10.011 68.172 1.00 58.16  ? 651 HOH A O     1 
HETATM 5057 O  O     . HOH DA 8 .   ? 31.886  -10.380 66.358 1.00 67.25  ? 652 HOH A O     1 
HETATM 5058 O  O     . HOH DA 8 .   ? 7.346   15.570  55.261 1.00 40.71  ? 655 HOH A O     1 
HETATM 5059 O  O     . HOH DA 8 .   ? 22.926  1.881   47.358 1.00 35.85  ? 656 HOH A O     1 
HETATM 5060 O  O     . HOH DA 8 .   ? 9.076   33.425  44.427 1.00 45.21  ? 657 HOH A O     1 
HETATM 5061 O  O     . HOH DA 8 .   ? 33.416  22.142  45.336 1.00 50.69  ? 658 HOH A O     1 
HETATM 5062 O  O     . HOH DA 8 .   ? 3.400   -0.094  56.375 1.00 38.91  ? 659 HOH A O     1 
HETATM 5063 O  O     . HOH DA 8 .   ? 4.439   2.185   27.185 1.00 86.56  ? 663 HOH A O     1 
HETATM 5064 O  O     . HOH DA 8 .   ? 26.729  10.677  42.194 1.00 36.86  ? 677 HOH A O     1 
HETATM 5065 O  O     . HOH DA 8 .   ? 23.692  1.784   33.841 1.00 51.05  ? 679 HOH A O     1 
HETATM 5066 O  O     . HOH DA 8 .   ? 31.879  26.164  49.603 1.00 62.78  ? 680 HOH A O     1 
HETATM 5067 O  O     . HOH DA 8 .   ? 31.446  23.865  51.702 1.00 47.53  ? 681 HOH A O     1 
HETATM 5068 O  O     . HOH DA 8 .   ? 30.011  23.657  54.155 1.00 52.22  ? 682 HOH A O     1 
HETATM 5069 O  O     . HOH DA 8 .   ? 34.445  0.854   27.374 1.00 40.12  ? 683 HOH A O     1 
HETATM 5070 O  O     . HOH DA 8 .   ? 14.534  20.226  63.132 1.00 57.14  ? 684 HOH A O     1 
HETATM 5071 O  O     . HOH DA 8 .   ? 25.737  19.478  36.488 1.00 37.56  ? 685 HOH A O     1 
HETATM 5072 O  O     . HOH DA 8 .   ? 28.493  23.082  36.698 1.00 53.57  ? 686 HOH A O     1 
HETATM 5073 O  O     . HOH DA 8 .   ? 12.477  21.252  53.763 1.00 48.17  ? 688 HOH A O     1 
HETATM 5074 O  O     . HOH DA 8 .   ? 30.881  -4.203  49.549 1.00 41.77  ? 690 HOH A O     1 
HETATM 5075 O  O     . HOH DA 8 .   ? 26.777  -15.700 58.176 1.00 37.02  ? 691 HOH A O     1 
HETATM 5076 O  O     . HOH DA 8 .   ? 22.855  -16.975 64.678 1.00 55.25  ? 692 HOH A O     1 
HETATM 5077 O  O     . HOH DA 8 .   ? 28.857  9.468   64.904 1.00 50.01  ? 693 HOH A O     1 
HETATM 5078 O  O     . HOH DA 8 .   ? 26.927  -17.910 48.960 1.00 57.65  ? 694 HOH A O     1 
HETATM 5079 O  O     . HOH DA 8 .   ? 14.998  -8.403  65.738 1.00 64.36  ? 695 HOH A O     1 
HETATM 5080 O  O     . HOH DA 8 .   ? 15.281  -14.259 50.514 1.00 47.74  ? 696 HOH A O     1 
HETATM 5081 O  O     . HOH DA 8 .   ? 30.578  -6.876  33.321 1.00 49.26  ? 697 HOH A O     1 
HETATM 5082 O  O     . HOH DA 8 .   ? 10.080  0.515   56.140 1.00 42.12  ? 698 HOH A O     1 
HETATM 5083 O  O     . HOH DA 8 .   ? 9.396   3.231   60.699 1.00 66.95  ? 699 HOH A O     1 
HETATM 5084 O  O     . HOH DA 8 .   ? 5.223   -10.173 52.632 1.00 57.33  ? 700 HOH A O     1 
HETATM 5085 O  O     . HOH DA 8 .   ? 29.538  -2.035  33.432 1.00 42.78  ? 701 HOH A O     1 
HETATM 5086 O  O     . HOH DA 8 .   ? 19.585  1.442   28.477 1.00 35.00  ? 702 HOH A O     1 
HETATM 5087 O  O     . HOH DA 8 .   ? 3.000   2.770   40.918 1.00 54.02  ? 704 HOH A O     1 
HETATM 5088 O  O     . HOH DA 8 .   ? 4.252   -10.057 43.297 1.00 46.46  ? 705 HOH A O     1 
HETATM 5089 O  O     . HOH DA 8 .   ? 6.760   20.837  41.110 1.00 48.60  ? 706 HOH A O     1 
HETATM 5090 O  O     . HOH DA 8 .   ? 37.039  19.742  49.130 1.00 49.81  ? 719 HOH A O     1 
HETATM 5091 O  O     . HOH DA 8 .   ? 26.331  -3.491  20.386 1.00 65.46  ? 720 HOH A O     1 
HETATM 5092 O  O     . HOH DA 8 .   ? 4.874   16.916  38.261 1.00 28.80  ? 721 HOH A O     1 
HETATM 5093 O  O     . HOH DA 8 .   ? 11.563  -10.460 34.906 1.00 47.48  ? 722 HOH A O     1 
HETATM 5094 O  O     . HOH DA 8 .   ? 31.534  0.209   26.389 1.00 41.43  ? 723 HOH A O     1 
HETATM 5095 O  O     . HOH DA 8 .   ? 28.561  13.736  42.989 1.00 63.19  ? 743 HOH A O     1 
HETATM 5096 O  O     . HOH DA 8 .   ? 20.788  -4.573  63.297 1.00 47.16  ? 744 HOH A O     1 
HETATM 5097 O  O     . HOH DA 8 .   ? 16.578  -15.019 52.900 1.00 52.38  ? 745 HOH A O     1 
HETATM 5098 O  O     . HOH DA 8 .   ? 0.144   17.674  50.485 1.00 67.51  ? 750 HOH A O     1 
HETATM 5099 O  O     . HOH DA 8 .   ? 34.643  20.897  35.921 1.00 64.75  ? 751 HOH A O     1 
HETATM 5100 O  O     . HOH DA 8 .   ? 30.199  17.440  42.756 1.00 53.89  ? 752 HOH A O     1 
HETATM 5101 O  O     . HOH DA 8 .   ? 22.403  25.138  57.992 1.00 60.74  ? 753 HOH A O     1 
HETATM 5102 O  O     . HOH DA 8 .   ? 29.957  -17.196 46.515 1.00 58.71  ? 754 HOH A O     1 
HETATM 5103 O  O     . HOH DA 8 .   ? 5.099   -10.576 49.479 1.00 61.85  ? 755 HOH A O     1 
HETATM 5104 O  O     . HOH DA 8 .   ? 7.686   -9.934  35.914 1.00 50.40  ? 756 HOH A O     1 
HETATM 5105 O  O     . HOH DA 8 .   ? 0.729   10.833  40.224 1.00 56.08  ? 775 HOH A O     1 
HETATM 5106 O  O     . HOH DA 8 .   ? 9.589   -8.257  33.613 1.00 56.93  ? 778 HOH A O     1 
HETATM 5107 O  O     . HOH DA 8 .   ? 2.124   7.876   39.821 1.00 65.54  ? 779 HOH A O     1 
HETATM 5108 O  O     . HOH DA 8 .   ? 8.848   12.985  54.909 1.00 54.21  ? 780 HOH A O     1 
HETATM 5109 O  O     . HOH DA 8 .   ? 28.403  20.263  35.831 1.00 47.51  ? 783 HOH A O     1 
HETATM 5110 O  O     . HOH DA 8 .   ? 30.653  -8.277  30.781 1.00 56.18  ? 784 HOH A O     1 
HETATM 5111 O  O     . HOH DA 8 .   ? 24.964  8.545   43.334 1.00 34.23  ? 786 HOH A O     1 
HETATM 5112 O  O     . HOH DA 8 .   ? 42.607  10.297  50.100 1.00 68.13  ? 787 HOH A O     1 
HETATM 5113 O  O     . HOH DA 8 .   ? 12.688  -8.316  33.425 1.00 46.67  ? 788 HOH A O     1 
HETATM 5114 O  O     . HOH DA 8 .   ? 16.791  -1.745  25.208 1.00 48.61  ? 789 HOH A O     1 
HETATM 5115 O  O     . HOH DA 8 .   ? 9.776   -0.034  41.907 1.00 37.31  ? 790 HOH A O     1 
HETATM 5116 O  O     . HOH DA 8 .   ? 30.760  -0.420  42.258 1.00 48.96  ? 791 HOH A O     1 
HETATM 5117 O  O     . HOH DA 8 .   ? 28.318  -1.228  43.371 1.00 45.81  ? 792 HOH A O     1 
HETATM 5118 O  O     . HOH DA 8 .   ? 32.218  -5.316  30.297 1.00 51.02  ? 803 HOH A O     1 
HETATM 5119 O  O     . HOH DA 8 .   ? 15.245  -7.550  27.185 1.00 74.72  ? 804 HOH A O     1 
HETATM 5120 O  O     . HOH DA 8 .   ? 26.922  -5.276  39.629 1.00 34.54  ? 805 HOH A O     1 
HETATM 5121 O  O     . HOH DA 8 .   ? 28.578  -4.743  46.533 1.00 39.59  ? 806 HOH A O     1 
HETATM 5122 O  O     . HOH DA 8 .   ? 1.915   12.230  42.360 1.00 51.88  ? 807 HOH A O     1 
HETATM 5123 O  O     . HOH DA 8 .   ? 31.835  14.290  42.876 1.00 55.22  ? 808 HOH A O     1 
HETATM 5124 O  O     . HOH DA 8 .   ? 40.690  9.554   27.370 1.00 61.31  ? 810 HOH A O     1 
HETATM 5125 O  O     . HOH DA 8 .   ? 34.287  25.313  46.032 1.00 55.26  ? 812 HOH A O     1 
HETATM 5126 O  O     . HOH DA 8 .   ? 29.390  24.441  57.715 1.00 56.72  ? 813 HOH A O     1 
HETATM 5127 O  O     . HOH DA 8 .   ? 33.424  16.898  62.779 1.00 60.84  ? 814 HOH A O     1 
HETATM 5128 O  O     . HOH DA 8 .   ? 19.783  10.679  62.018 1.00 50.01  ? 815 HOH A O     1 
HETATM 5129 O  O     . HOH DA 8 .   ? 17.464  9.574   63.255 1.00 64.48  ? 816 HOH A O     1 
HETATM 5130 O  O     . HOH DA 8 .   ? 14.370  10.173  64.370 1.00 71.23  ? 817 HOH A O     1 
HETATM 5131 O  O     . HOH DA 8 .   ? 16.570  8.698   65.821 1.00 59.93  ? 818 HOH A O     1 
HETATM 5132 O  O     . HOH DA 8 .   ? 37.215  3.201   59.571 1.00 58.72  ? 819 HOH A O     1 
HETATM 5133 O  O     . HOH DA 8 .   ? 29.407  -16.461 57.664 1.00 60.63  ? 820 HOH A O     1 
HETATM 5134 O  O     . HOH DA 8 .   ? 21.549  -13.505 63.431 1.00 52.85  ? 821 HOH A O     1 
HETATM 5135 O  O     . HOH DA 8 .   ? 28.961  -8.053  47.133 1.00 52.76  ? 822 HOH A O     1 
HETATM 5136 O  O     . HOH DA 8 .   ? 19.285  -8.482  41.215 1.00 41.79  ? 824 HOH A O     1 
HETATM 5137 O  O     . HOH DA 8 .   ? 18.632  -11.918 37.679 1.00 72.62  ? 825 HOH A O     1 
HETATM 5138 O  O     . HOH DA 8 .   ? 12.278  -9.671  30.573 1.00 56.28  ? 826 HOH A O     1 
HETATM 5139 O  O     . HOH DA 8 .   ? 26.255  -9.877  17.523 1.00 61.50  ? 827 HOH A O     1 
HETATM 5140 O  O     . HOH DA 8 .   ? 31.686  -3.942  32.760 1.00 49.55  ? 828 HOH A O     1 
HETATM 5141 O  O     . HOH DA 8 .   ? 29.916  -10.753 31.811 1.00 53.29  ? 829 HOH A O     1 
HETATM 5142 O  O     . HOH DA 8 .   ? 27.410  -13.847 31.031 1.00 58.42  ? 830 HOH A O     1 
HETATM 5143 O  O     . HOH DA 8 .   ? 29.876  -14.527 29.581 1.00 77.18  ? 831 HOH A O     1 
HETATM 5144 O  O     . HOH DA 8 .   ? 5.483   -3.803  29.599 1.00 67.08  ? 832 HOH A O     1 
HETATM 5145 O  O     . HOH DA 8 .   ? 4.681   -9.376  36.333 1.00 74.00  ? 833 HOH A O     1 
HETATM 5146 O  O     . HOH DA 8 .   ? -0.233  -5.660  43.286 1.00 68.85  ? 834 HOH A O     1 
HETATM 5147 O  O     . HOH DA 8 .   ? 27.270  -2.555  41.026 1.00 39.76  ? 849 HOH A O     1 
HETATM 5148 O  O     . HOH DA 8 .   ? 17.706  -13.674 43.200 1.00 41.95  ? 850 HOH A O     1 
HETATM 5149 O  O     . HOH DA 8 .   ? 14.385  -16.259 44.532 1.00 75.22  ? 851 HOH A O     1 
HETATM 5150 O  O     . HOH DA 8 .   ? 3.716   13.951  44.378 1.00 54.22  ? 852 HOH A O     1 
HETATM 5151 O  O     . HOH DA 8 .   ? 17.052  33.591  51.777 1.00 64.05  ? 854 HOH A O     1 
HETATM 5152 O  O     . HOH DA 8 .   ? 16.875  13.393  61.907 1.00 71.41  ? 855 HOH A O     1 
HETATM 5153 O  O     . HOH DA 8 .   ? 32.289  5.291   63.734 1.00 54.47  ? 856 HOH A O     1 
HETATM 5154 O  O     . HOH DA 8 .   ? 35.113  4.613   63.895 1.00 68.43  ? 857 HOH A O     1 
HETATM 5155 O  O     . HOH DA 8 .   ? 21.578  -7.604  66.918 1.00 47.93  ? 858 HOH A O     1 
HETATM 5156 O  O     . HOH DA 8 .   ? 24.631  -4.906  68.908 1.00 45.65  ? 859 HOH A O     1 
HETATM 5157 O  O     . HOH DA 8 .   ? 18.710  -11.385 40.587 1.00 59.29  ? 860 HOH A O     1 
HETATM 5158 O  O     . HOH DA 8 .   ? 17.393  -8.346  43.177 1.00 50.83  ? 861 HOH A O     1 
HETATM 5159 O  O     . HOH DA 8 .   ? 22.679  -0.801  25.628 1.00 58.97  ? 862 HOH A O     1 
HETATM 5160 O  O     . HOH DA 8 .   ? 32.902  26.820  37.851 1.00 69.19  ? 886 HOH A O     1 
HETATM 5161 O  O     . HOH DA 8 .   ? 25.795  12.960  46.001 1.00 81.02  ? 887 HOH A O     1 
HETATM 5162 O  O     . HOH DA 8 .   ? 25.293  -15.516 55.693 1.00 57.56  ? 888 HOH A O     1 
HETATM 5163 O  O     . HOH DA 8 .   ? 36.310  17.706  34.909 1.00 74.06  ? 889 HOH A O     1 
HETATM 5164 O  O     . HOH DA 8 .   ? 35.078  8.379   39.775 1.00 69.81  ? 890 HOH A O     1 
HETATM 5165 O  O     . HOH DA 8 .   ? 25.419  -17.008 60.173 1.00 63.87  ? 891 HOH A O     1 
HETATM 5166 O  O     . HOH DA 8 .   ? 21.615  0.771   68.762 1.00 67.95  ? 892 HOH A O     1 
HETATM 5167 O  O     . HOH DA 8 .   ? 6.931   -6.357  58.346 1.00 55.38  ? 893 HOH A O     1 
HETATM 5168 O  O     . HOH DA 8 .   ? 17.451  -14.483 63.973 1.00 73.03  ? 894 HOH A O     1 
HETATM 5169 O  O     . HOH DA 8 .   ? 3.259   18.002  54.338 1.00 58.12  ? 907 HOH A O     1 
HETATM 5170 O  O     . HOH DA 8 .   ? 6.728   32.153  46.025 1.00 70.66  ? 909 HOH A O     1 
HETATM 5171 O  O     . HOH DA 8 .   ? 35.657  10.324  62.044 1.00 63.52  ? 910 HOH A O     1 
HETATM 5172 O  O     . HOH DA 8 .   ? 32.629  -11.420 54.466 1.00 58.27  ? 911 HOH A O     1 
HETATM 5173 O  O     . HOH DA 8 .   ? 30.468  -7.233  49.322 1.00 55.65  ? 912 HOH A O     1 
HETATM 5174 O  O     . HOH DA 8 .   ? 18.435  -15.477 38.018 1.00 79.46  ? 913 HOH A O     1 
HETATM 5175 O  O     . HOH DA 8 .   ? 11.983  -13.306 36.553 1.00 47.23  ? 914 HOH A O     1 
HETATM 5176 O  O     . HOH DA 8 .   ? 21.558  -12.343 19.312 1.00 57.06  ? 915 HOH A O     1 
HETATM 5177 O  O     . HOH DA 8 .   ? 26.707  -12.581 25.565 1.00 59.40  ? 916 HOH A O     1 
HETATM 5178 O  O     . HOH DA 8 .   ? 16.171  -11.581 66.683 1.00 60.66  ? 917 HOH A O     1 
HETATM 5179 O  O     . HOH DA 8 .   ? 23.220  6.540   45.414 1.00 39.16  ? 918 HOH A O     1 
HETATM 5180 O  O     . HOH DA 8 .   ? 31.618  -7.790  45.577 1.00 60.51  ? 919 HOH A O     1 
HETATM 5181 O  O     . HOH DA 8 .   ? 33.628  -1.713  33.546 1.00 68.09  ? 920 HOH A O     1 
HETATM 5182 O  O     . HOH DA 8 .   ? 4.921   13.360  51.333 1.00 55.76  ? 924 HOH A O     1 
HETATM 5183 O  O     . HOH DA 8 .   ? 32.879  -2.461  42.225 1.00 54.63  ? 928 HOH A O     1 
HETATM 5184 O  O     . HOH EA 8 .   ? 16.220  15.294  31.917 1.00 28.95  ? 601 HOH B O     1 
HETATM 5185 O  O     . HOH EA 8 .   ? 13.601  11.874  34.043 1.00 22.00  ? 603 HOH B O     1 
HETATM 5186 O  O     . HOH EA 8 .   ? 11.595  15.319  33.234 1.00 27.13  ? 604 HOH B O     1 
HETATM 5187 O  O     . HOH EA 8 .   ? 13.907  3.194   22.989 1.00 37.82  ? 607 HOH B O     1 
HETATM 5188 O  O     . HOH EA 8 .   ? 17.748  6.761   12.909 1.00 34.69  ? 609 HOH B O     1 
HETATM 5189 O  O     . HOH EA 8 .   ? 15.623  8.822   12.786 1.00 49.53  ? 610 HOH B O     1 
HETATM 5190 O  O     . HOH EA 8 .   ? 16.563  25.124  18.881 1.00 32.25  ? 611 HOH B O     1 
HETATM 5191 O  O     . HOH EA 8 .   ? 24.948  36.409  13.971 1.00 45.44  ? 612 HOH B O     1 
HETATM 5192 O  O     . HOH EA 8 .   ? 2.088   24.893  4.007  1.00 38.43  ? 613 HOH B O     1 
HETATM 5193 O  O     . HOH EA 8 .   ? 3.298   13.003  11.065 1.00 40.76  ? 614 HOH B O     1 
HETATM 5194 O  O     . HOH EA 8 .   ? 3.855   9.070   37.495 1.00 35.16  ? 615 HOH B O     1 
HETATM 5195 O  O     . HOH EA 8 .   ? 2.709   1.913   32.232 1.00 45.94  ? 616 HOH B O     1 
HETATM 5196 O  O     . HOH EA 8 .   ? 19.279  16.223  34.409 1.00 24.73  ? 620 HOH B O     1 
HETATM 5197 O  O     . HOH EA 8 .   ? 21.230  6.961   28.022 1.00 34.18  ? 626 HOH B O     1 
HETATM 5198 O  O     . HOH EA 8 .   ? 14.284  14.795  33.727 1.00 23.91  ? 627 HOH B O     1 
HETATM 5199 O  O     . HOH EA 8 .   ? 17.146  29.817  21.222 1.00 34.12  ? 629 HOH B O     1 
HETATM 5200 O  O     . HOH EA 8 .   ? 24.414  35.117  21.574 1.00 50.04  ? 630 HOH B O     1 
HETATM 5201 O  O     . HOH EA 8 .   ? 8.331   14.338  6.122  1.00 58.91  ? 631 HOH B O     1 
HETATM 5202 O  O     . HOH EA 8 .   ? 15.531  15.779  36.186 1.00 27.78  ? 632 HOH B O     1 
HETATM 5203 O  O     . HOH EA 8 .   ? 20.974  12.145  30.002 1.00 70.93  ? 636 HOH B O     1 
HETATM 5204 O  O     . HOH EA 8 .   ? 17.569  17.736  32.626 1.00 23.78  ? 637 HOH B O     1 
HETATM 5205 O  O     . HOH EA 8 .   ? 24.195  9.933   15.120 1.00 39.37  ? 638 HOH B O     1 
HETATM 5206 O  O     . HOH EA 8 .   ? 10.584  20.700  2.901  1.00 39.58  ? 639 HOH B O     1 
HETATM 5207 O  O     . HOH EA 8 .   ? -8.104  33.941  18.279 1.00 63.77  ? 640 HOH B O     1 
HETATM 5208 O  O     . HOH EA 8 .   ? -9.785  22.187  16.069 1.00 44.79  ? 641 HOH B O     1 
HETATM 5209 O  O     . HOH EA 8 .   ? -6.440  10.754  28.873 1.00 39.20  ? 642 HOH B O     1 
HETATM 5210 O  O     . HOH EA 8 .   ? 0.681   22.905  39.529 1.00 54.58  ? 643 HOH B O     1 
HETATM 5211 O  O     . HOH EA 8 .   ? 25.561  23.438  36.893 1.00 50.17  ? 645 HOH B O     1 
HETATM 5212 O  O     . HOH EA 8 .   ? 5.413   28.500  36.052 1.00 34.75  ? 649 HOH B O     1 
HETATM 5213 O  O     . HOH EA 8 .   ? -6.448  16.011  32.877 1.00 49.64  ? 650 HOH B O     1 
HETATM 5214 O  O     . HOH EA 8 .   ? 14.882  18.840  38.729 1.00 25.94  ? 653 HOH B O     1 
HETATM 5215 O  O     . HOH EA 8 .   ? 9.893   15.124  38.979 1.00 30.85  ? 654 HOH B O     1 
HETATM 5216 O  O     . HOH EA 8 .   ? 13.689  24.579  25.684 1.00 23.03  ? 660 HOH B O     1 
HETATM 5217 O  O     . HOH EA 8 .   ? 11.466  19.857  23.850 1.00 25.38  ? 661 HOH B O     1 
HETATM 5218 O  O     . HOH EA 8 .   ? 10.655  26.002  37.025 1.00 33.81  ? 662 HOH B O     1 
HETATM 5219 O  O     . HOH EA 8 .   ? 7.581   34.232  41.827 1.00 32.79  ? 664 HOH B O     1 
HETATM 5220 O  O     . HOH EA 8 .   ? 29.341  29.753  24.945 1.00 47.52  ? 665 HOH B O     1 
HETATM 5221 O  O     . HOH EA 8 .   ? 36.405  22.390  23.706 1.00 72.41  ? 666 HOH B O     1 
HETATM 5222 O  O     . HOH EA 8 .   ? 24.324  27.256  27.377 1.00 43.98  ? 667 HOH B O     1 
HETATM 5223 O  O     . HOH EA 8 .   ? -7.642  34.382  8.989  1.00 28.78  ? 668 HOH B O     1 
HETATM 5224 O  O     . HOH EA 8 .   ? -9.715  27.278  8.378  1.00 47.20  ? 669 HOH B O     1 
HETATM 5225 O  O     . HOH EA 8 .   ? -5.779  29.772  3.947  1.00 42.04  ? 670 HOH B O     1 
HETATM 5226 O  O     . HOH EA 8 .   ? -6.925  33.629  5.756  1.00 44.33  ? 671 HOH B O     1 
HETATM 5227 O  O     . HOH EA 8 .   ? 13.905  22.210  1.595  1.00 62.00  ? 672 HOH B O     1 
HETATM 5228 O  O     . HOH EA 8 .   ? -6.160  38.998  15.376 1.00 71.14  ? 673 HOH B O     1 
HETATM 5229 O  O     . HOH EA 8 .   ? 1.418   10.272  2.652  1.00 33.10  ? 674 HOH B O     1 
HETATM 5230 O  O     . HOH EA 8 .   ? -11.957 19.661  18.491 1.00 49.09  ? 675 HOH B O     1 
HETATM 5231 O  O     . HOH EA 8 .   ? -11.922 19.165  8.709  1.00 48.07  ? 676 HOH B O     1 
HETATM 5232 O  O     . HOH EA 8 .   ? 16.336  11.867  34.405 1.00 32.54  ? 678 HOH B O     1 
HETATM 5233 O  O     . HOH EA 8 .   ? 26.899  23.448  33.936 1.00 67.34  ? 687 HOH B O     1 
HETATM 5234 O  O     . HOH EA 8 .   ? 8.925   23.601  48.223 1.00 46.33  ? 689 HOH B O     1 
HETATM 5235 O  O     . HOH EA 8 .   ? 16.466  2.746   29.455 1.00 38.98  ? 703 HOH B O     1 
HETATM 5236 O  O     . HOH EA 8 .   ? 4.384   26.592  34.287 1.00 37.81  ? 707 HOH B O     1 
HETATM 5237 O  O     . HOH EA 8 .   ? 12.705  37.098  36.622 1.00 57.16  ? 708 HOH B O     1 
HETATM 5238 O  O     . HOH EA 8 .   ? 3.975   30.850  34.956 1.00 46.85  ? 709 HOH B O     1 
HETATM 5239 O  O     . HOH EA 8 .   ? 20.235  4.585   17.464 1.00 50.66  ? 710 HOH B O     1 
HETATM 5240 O  O     . HOH EA 8 .   ? 21.929  27.843  25.663 1.00 47.19  ? 711 HOH B O     1 
HETATM 5241 O  O     . HOH EA 8 .   ? 23.847  24.211  8.095  1.00 63.81  ? 712 HOH B O     1 
HETATM 5242 O  O     . HOH EA 8 .   ? 13.476  38.399  9.615  1.00 56.46  ? 713 HOH B O     1 
HETATM 5243 O  O     . HOH EA 8 .   ? 11.198  37.533  3.485  1.00 68.54  ? 714 HOH B O     1 
HETATM 5244 O  O     . HOH EA 8 .   ? 14.958  34.276  5.942  1.00 50.00  ? 715 HOH B O     1 
HETATM 5245 O  O     . HOH EA 8 .   ? 4.311   12.613  -8.186 1.00 41.83  ? 716 HOH B O     1 
HETATM 5246 O  O     . HOH EA 8 .   ? -9.747  23.900  13.614 1.00 38.44  ? 717 HOH B O     1 
HETATM 5247 O  O     . HOH EA 8 .   ? -10.142 8.393   28.603 1.00 72.84  ? 718 HOH B O     1 
HETATM 5248 O  O     . HOH EA 8 .   ? 21.236  2.511   19.695 1.00 72.09  ? 724 HOH B O     1 
HETATM 5249 O  O     . HOH EA 8 .   ? 20.331  7.446   23.987 1.00 32.93  ? 725 HOH B O     1 
HETATM 5250 O  O     . HOH EA 8 .   ? 23.912  22.085  33.506 1.00 46.15  ? 726 HOH B O     1 
HETATM 5251 O  O     . HOH EA 8 .   ? 6.112   32.735  34.513 1.00 42.79  ? 727 HOH B O     1 
HETATM 5252 O  O     . HOH EA 8 .   ? 29.295  32.905  25.543 1.00 52.61  ? 728 HOH B O     1 
HETATM 5253 O  O     . HOH EA 8 .   ? 12.713  21.527  21.807 1.00 53.34  ? 729 HOH B O     1 
HETATM 5254 O  O     . HOH EA 8 .   ? 11.884  23.774  23.219 1.00 40.21  ? 730 HOH B O     1 
HETATM 5255 O  O     . HOH EA 8 .   ? 28.618  33.641  21.803 1.00 46.68  ? 731 HOH B O     1 
HETATM 5256 O  O     . HOH EA 8 .   ? 26.635  29.795  27.047 1.00 58.97  ? 732 HOH B O     1 
HETATM 5257 O  O     . HOH EA 8 .   ? 17.685  29.719  4.814  1.00 56.13  ? 733 HOH B O     1 
HETATM 5258 O  O     . HOH EA 8 .   ? 13.731  17.724  6.247  1.00 34.83  ? 734 HOH B O     1 
HETATM 5259 O  O     . HOH EA 8 .   ? 7.122   9.705   5.810  1.00 45.20  ? 735 HOH B O     1 
HETATM 5260 O  O     . HOH EA 8 .   ? 8.900   10.810  3.233  1.00 51.93  ? 736 HOH B O     1 
HETATM 5261 O  O     . HOH EA 8 .   ? -2.660  19.897  2.319  1.00 41.13  ? 737 HOH B O     1 
HETATM 5262 O  O     . HOH EA 8 .   ? -3.932  18.249  4.439  1.00 56.59  ? 738 HOH B O     1 
HETATM 5263 O  O     . HOH EA 8 .   ? 6.337   24.386  34.396 1.00 33.73  ? 739 HOH B O     1 
HETATM 5264 O  O     . HOH EA 8 .   ? 1.817   12.298  24.778 1.00 37.18  ? 741 HOH B O     1 
HETATM 5265 O  O     . HOH EA 8 .   ? -4.147  8.324   22.363 1.00 53.95  ? 742 HOH B O     1 
HETATM 5266 O  O     . HOH EA 8 .   ? 1.040   34.611  19.281 1.00 51.85  ? 746 HOH B O     1 
HETATM 5267 O  O     . HOH EA 8 .   ? -7.884  31.549  4.128  1.00 45.97  ? 747 HOH B O     1 
HETATM 5268 O  O     . HOH EA 8 .   ? 1.380   30.647  -0.701 1.00 56.78  ? 748 HOH B O     1 
HETATM 5269 O  O     . HOH EA 8 .   ? -5.369  36.059  30.747 1.00 55.93  ? 749 HOH B O     1 
HETATM 5270 O  O     . HOH EA 8 .   ? 10.751  37.449  47.728 1.00 67.64  ? 757 HOH B O     1 
HETATM 5271 O  O     . HOH EA 8 .   ? 36.891  18.313  21.587 1.00 76.76  ? 758 HOH B O     1 
HETATM 5272 O  O     . HOH EA 8 .   ? 18.584  22.237  3.885  1.00 52.94  ? 759 HOH B O     1 
HETATM 5273 O  O     . HOH EA 8 .   ? 9.682   15.833  8.642  1.00 45.20  ? 760 HOH B O     1 
HETATM 5274 O  O     . HOH EA 8 .   ? 17.441  40.491  21.967 1.00 41.48  ? 761 HOH B O     1 
HETATM 5275 O  O     . HOH EA 8 .   ? 12.798  42.605  21.084 1.00 51.09  ? 762 HOH B O     1 
HETATM 5276 O  O     . HOH EA 8 .   ? 4.006   29.340  -1.288 1.00 54.64  ? 763 HOH B O     1 
HETATM 5277 O  O     . HOH EA 8 .   ? 10.702  30.963  -0.419 1.00 55.74  ? 764 HOH B O     1 
HETATM 5278 O  O     . HOH EA 8 .   ? 5.096   21.153  -0.853 1.00 42.81  ? 765 HOH B O     1 
HETATM 5279 O  O     . HOH EA 8 .   ? 1.025   29.840  28.372 1.00 38.79  ? 766 HOH B O     1 
HETATM 5280 O  O     . HOH EA 8 .   ? 3.525   29.817  27.368 1.00 34.41  ? 767 HOH B O     1 
HETATM 5281 O  O     . HOH EA 8 .   ? -0.894  6.347   11.661 1.00 48.19  ? 768 HOH B O     1 
HETATM 5282 O  O     . HOH EA 8 .   ? 1.445   6.994   9.854  1.00 21.03  ? 769 HOH B O     1 
HETATM 5283 O  O     . HOH EA 8 .   ? -4.995  15.861  7.365  1.00 50.44  ? 770 HOH B O     1 
HETATM 5284 O  O     . HOH EA 8 .   ? -0.764  9.096   35.785 1.00 55.73  ? 771 HOH B O     1 
HETATM 5285 O  O     . HOH EA 8 .   ? -11.611 17.272  10.825 1.00 55.28  ? 772 HOH B O     1 
HETATM 5286 O  O     . HOH EA 8 .   ? 27.096  38.645  17.205 1.00 71.70  ? 774 HOH B O     1 
HETATM 5287 O  O     . HOH EA 8 .   ? 31.672  25.111  35.346 1.00 80.11  ? 776 HOH B O     1 
HETATM 5288 O  O     . HOH EA 8 .   ? 16.325  37.145  5.824  1.00 57.22  ? 777 HOH B O     1 
HETATM 5289 O  O     . HOH EA 8 .   ? 24.788  5.494   20.212 1.00 62.73  ? 781 HOH B O     1 
HETATM 5290 O  O     . HOH EA 8 .   ? -7.787  32.375  11.275 1.00 54.05  ? 782 HOH B O     1 
HETATM 5291 O  O     . HOH EA 8 .   ? 11.655  21.786  -0.201 1.00 51.36  ? 785 HOH B O     1 
HETATM 5292 O  O     . HOH EA 8 .   ? 32.759  30.600  22.466 1.00 64.97  ? 793 HOH B O     1 
HETATM 5293 O  O     . HOH EA 8 .   ? 31.173  27.610  18.971 1.00 42.96  ? 794 HOH B O     1 
HETATM 5294 O  O     . HOH EA 8 .   ? 7.472   32.470  26.515 1.00 59.81  ? 795 HOH B O     1 
HETATM 5295 O  O     . HOH EA 8 .   ? 7.706   24.641  20.883 1.00 26.43  ? 796 HOH B O     1 
HETATM 5296 O  O     . HOH EA 8 .   ? 5.389   30.660  25.410 1.00 33.41  ? 797 HOH B O     1 
HETATM 5297 O  O     . HOH EA 8 .   ? 2.591   32.171  21.982 1.00 35.69  ? 798 HOH B O     1 
HETATM 5298 O  O     . HOH EA 8 .   ? 15.678  42.360  20.597 1.00 48.51  ? 799 HOH B O     1 
HETATM 5299 O  O     . HOH EA 8 .   ? 6.193   41.630  6.185  1.00 49.00  ? 800 HOH B O     1 
HETATM 5300 O  O     . HOH EA 8 .   ? 9.726   12.189  13.881 1.00 33.47  ? 801 HOH B O     1 
HETATM 5301 O  O     . HOH EA 8 .   ? -2.312  16.791  40.048 1.00 46.07  ? 802 HOH B O     1 
HETATM 5302 O  O     . HOH EA 8 .   ? 36.550  16.036  31.132 1.00 51.92  ? 811 HOH B O     1 
HETATM 5303 O  O     . HOH EA 8 .   ? 20.048  25.615  25.259 1.00 53.36  ? 835 HOH B O     1 
HETATM 5304 O  O     . HOH EA 8 .   ? 27.780  30.161  34.780 1.00 41.40  ? 836 HOH B O     1 
HETATM 5305 O  O     . HOH EA 8 .   ? 31.439  26.062  16.498 1.00 51.97  ? 837 HOH B O     1 
HETATM 5306 O  O     . HOH EA 8 .   ? 34.303  6.898   17.108 1.00 54.12  ? 838 HOH B O     1 
HETATM 5307 O  O     . HOH EA 8 .   ? 18.596  37.764  9.645  1.00 50.64  ? 839 HOH B O     1 
HETATM 5308 O  O     . HOH EA 8 .   ? 20.316  35.989  7.660  1.00 61.70  ? 840 HOH B O     1 
HETATM 5309 O  O     . HOH EA 8 .   ? 16.684  23.487  1.718  1.00 84.67  ? 841 HOH B O     1 
HETATM 5310 O  O     . HOH EA 8 .   ? 14.367  19.508  -0.082 1.00 56.19  ? 842 HOH B O     1 
HETATM 5311 O  O     . HOH EA 8 .   ? 18.321  17.805  7.062  1.00 58.57  ? 843 HOH B O     1 
HETATM 5312 O  O     . HOH EA 8 .   ? 3.940   34.404  18.760 1.00 38.49  ? 844 HOH B O     1 
HETATM 5313 O  O     . HOH EA 8 .   ? -9.678  23.201  23.148 1.00 50.62  ? 845 HOH B O     1 
HETATM 5314 O  O     . HOH EA 8 .   ? -4.484  23.543  25.874 1.00 49.38  ? 846 HOH B O     1 
HETATM 5315 O  O     . HOH EA 8 .   ? 2.426   33.321  35.799 1.00 49.20  ? 847 HOH B O     1 
HETATM 5316 O  O     . HOH EA 8 .   ? 3.440   31.191  45.612 1.00 60.73  ? 848 HOH B O     1 
HETATM 5317 O  O     . HOH EA 8 .   ? 29.347  25.210  33.660 1.00 75.91  ? 853 HOH B O     1 
HETATM 5318 O  O     . HOH EA 8 .   ? 5.415   23.563  42.147 1.00 66.68  ? 863 HOH B O     1 
HETATM 5319 O  O     . HOH EA 8 .   ? 20.270  23.988  22.889 1.00 54.49  ? 864 HOH B O     1 
HETATM 5320 O  O     . HOH EA 8 .   ? 22.993  32.582  39.610 1.00 44.29  ? 865 HOH B O     1 
HETATM 5321 O  O     . HOH EA 8 .   ? 34.330  16.982  20.083 1.00 73.97  ? 866 HOH B O     1 
HETATM 5322 O  O     . HOH EA 8 .   ? 34.585  3.074   24.975 1.00 57.50  ? 867 HOH B O     1 
HETATM 5323 O  O     . HOH EA 8 .   ? 15.950  39.735  24.401 1.00 65.78  ? 868 HOH B O     1 
HETATM 5324 O  O     . HOH EA 8 .   ? 13.202  7.313   12.762 1.00 56.35  ? 869 HOH B O     1 
HETATM 5325 O  O     . HOH EA 8 .   ? 16.511  20.378  6.718  1.00 39.50  ? 870 HOH B O     1 
HETATM 5326 O  O     . HOH EA 8 .   ? 13.218  19.419  2.531  1.00 62.35  ? 871 HOH B O     1 
HETATM 5327 O  O     . HOH EA 8 .   ? 16.345  20.295  2.989  1.00 60.67  ? 872 HOH B O     1 
HETATM 5328 O  O     . HOH EA 8 .   ? 16.340  18.179  4.815  1.00 67.84  ? 873 HOH B O     1 
HETATM 5329 O  O     . HOH EA 8 .   ? 14.307  17.013  3.290  1.00 95.41  ? 874 HOH B O     1 
HETATM 5330 O  O     . HOH EA 8 .   ? -3.396  38.228  13.696 1.00 67.55  ? 875 HOH B O     1 
HETATM 5331 O  O     . HOH EA 8 .   ? -6.948  36.286  3.872  1.00 54.55  ? 876 HOH B O     1 
HETATM 5332 O  O     . HOH EA 8 .   ? -9.169  28.984  32.613 1.00 50.92  ? 877 HOH B O     1 
HETATM 5333 O  O     . HOH EA 8 .   ? -0.387  33.592  34.883 1.00 50.40  ? 878 HOH B O     1 
HETATM 5334 O  O     . HOH EA 8 .   ? 6.673   12.370  7.483  1.00 58.47  ? 879 HOH B O     1 
HETATM 5335 O  O     . HOH EA 8 .   ? -5.899  11.602  17.555 1.00 56.09  ? 880 HOH B O     1 
HETATM 5336 O  O     . HOH EA 8 .   ? -9.014  11.724  30.219 1.00 62.93  ? 881 HOH B O     1 
HETATM 5337 O  O     . HOH EA 8 .   ? -5.968  7.839   20.211 1.00 47.95  ? 882 HOH B O     1 
HETATM 5338 O  O     . HOH EA 8 .   ? -11.549 23.184  18.294 1.00 54.87  ? 883 HOH B O     1 
HETATM 5339 O  O     . HOH EA 8 .   ? 3.583   35.180  25.045 1.00 54.12  ? 884 HOH B O     1 
HETATM 5340 O  O     . HOH EA 8 .   ? 5.552   34.580  27.011 1.00 64.16  ? 885 HOH B O     1 
HETATM 5341 O  O     . HOH EA 8 .   ? 10.730  8.670   12.224 1.00 57.14  ? 895 HOH B O     1 
HETATM 5342 O  O     . HOH EA 8 .   ? 17.907  34.723  26.512 1.00 57.59  ? 896 HOH B O     1 
HETATM 5343 O  O     . HOH EA 8 .   ? 18.440  38.078  25.365 1.00 53.13  ? 897 HOH B O     1 
HETATM 5344 O  O     . HOH EA 8 .   ? 20.304  36.500  27.232 1.00 63.69  ? 898 HOH B O     1 
HETATM 5345 O  O     . HOH EA 8 .   ? -0.035  10.258  0.029  0.50 15.77  ? 899 HOH B O     1 
HETATM 5346 O  O     . HOH EA 8 .   ? 1.708   8.758   -5.860 1.00 55.17  ? 900 HOH B O     1 
HETATM 5347 O  O     . HOH EA 8 .   ? -6.958  23.228  27.702 1.00 61.68  ? 901 HOH B O     1 
HETATM 5348 O  O     . HOH EA 8 .   ? -5.172  38.188  34.089 1.00 81.23  ? 903 HOH B O     1 
HETATM 5349 O  O     . HOH EA 8 .   ? 8.758   6.324   12.403 1.00 71.76  ? 904 HOH B O     1 
HETATM 5350 O  O     . HOH EA 8 .   ? -7.877  30.567  43.658 1.00 72.60  ? 905 HOH B O     1 
HETATM 5351 O  O     . HOH EA 8 .   ? -0.373  36.804  37.763 1.00 90.81  ? 906 HOH B O     1 
HETATM 5352 O  O     . HOH EA 8 .   ? 25.020  33.750  43.142 1.00 67.10  ? 908 HOH B O     1 
HETATM 5353 O  O     . HOH EA 8 .   ? -10.861 16.666  28.939 1.00 59.62  ? 921 HOH B O     1 
HETATM 5354 O  O     . HOH EA 8 .   ? 16.211  25.391  26.787 1.00 41.47  ? 923 HOH B O     1 
HETATM 5355 O  O     . HOH EA 8 .   ? 2.783   36.993  3.818  1.00 80.22  ? 925 HOH B O     1 
HETATM 5356 O  O     . HOH EA 8 .   ? 18.421  26.689  3.331  1.00 63.94  ? 926 HOH B O     1 
HETATM 5357 O  O     . HOH EA 8 .   ? -7.100  13.134  32.318 1.00 65.19  ? 927 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   CYS 5   5   5   CYS CYS A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  HIS 51  51  51  HIS HIS A . n 
A 1 52  TRP 52  52  52  TRP TRP A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 CYS 112 112 112 CYS CYS A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 MET 126 126 126 MET MET A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 HIS 176 176 176 HIS HIS A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 MET 178 178 178 MET MET A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 SER 204 204 204 SER SER A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ARG 208 208 ?   ?   ?   A . n 
A 1 209 ASN 209 209 ?   ?   ?   A . n 
A 1 210 PRO 210 210 ?   ?   ?   A . n 
A 1 211 ALA 211 211 ?   ?   ?   A . n 
A 1 212 GLY 212 212 ?   ?   ?   A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 MET 216 216 216 MET MET A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 PHE 237 237 237 PHE PHE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 MET 240 240 240 MET MET A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 TRP 244 244 244 TRP TRP A . n 
A 1 245 THR 245 245 245 THR THR A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 HIS 265 265 265 HIS HIS A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 GLN 268 268 268 GLN GLN A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 THR 270 270 270 THR THR A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 CYS 273 273 273 CYS CYS A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 GLN 277 277 277 GLN GLN A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 MET 287 287 287 MET MET A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLU 2   2   ?   ?   ?   B . n 
B 1 3   GLU 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   CYS 5   5   5   CYS CYS B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  ILE 15  15  15  ILE ILE B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  TYR 18  18  18  TYR TYR B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  ASN 21  21  21  ASN ASN B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  PRO 27  27  27  PRO PRO B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  PHE 33  33  33  PHE PHE B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ASN 45  45  45  ASN ASN B . n 
B 1 46  HIS 46  46  46  HIS HIS B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  HIS 51  51  51  HIS HIS B . n 
B 1 52  TRP 52  52  52  TRP TRP B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  TYR 66  66  66  TYR TYR B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  MET 74  74  74  MET MET B . n 
B 1 75  ASN 75  75  75  ASN ASN B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  TYR 79  79  79  TYR TYR B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  TYR 84  84  84  TYR TYR B . n 
B 1 85  THR 85  85  85  THR THR B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  PHE 90  90  90  PHE PHE B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ALA 92  92  92  ALA ALA B . n 
B 1 93  MET 93  93  93  MET MET B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  ASP 96  96  96  ASP ASP B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 GLN 103 103 103 GLN GLN B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 CYS 112 112 112 CYS CYS B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 TRP 120 120 120 TRP TRP B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 MET 126 126 126 MET MET B . n 
B 1 127 TYR 127 127 127 TYR TYR B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 PRO 129 129 129 PRO PRO B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 PRO 134 134 134 PRO PRO B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 TYR 136 136 136 TYR TYR B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 LYS 139 139 139 LYS LYS B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASP 145 145 145 ASP ASP B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 LEU 157 157 157 LEU LEU B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 HIS 163 163 163 HIS HIS B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 GLN 165 165 165 GLN GLN B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 MET 172 172 172 MET MET B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 MET 174 174 174 MET MET B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 HIS 176 176 176 HIS HIS B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 MET 178 178 178 MET MET B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 THR 186 186 186 THR THR B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 SER 188 188 188 SER SER B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 PRO 193 193 193 PRO PRO B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 GLY 195 195 195 GLY GLY B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 ASN 197 197 197 ASN ASN B . n 
B 1 198 TYR 198 198 198 TYR TYR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 ILE 200 200 200 ILE ILE B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 SER 204 204 204 SER SER B . n 
B 1 205 GLN 205 205 205 GLN GLN B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 ARG 207 207 207 ARG ARG B . n 
B 1 208 ARG 208 208 208 ARG ARG B . n 
B 1 209 ASN 209 209 209 ASN ASN B . n 
B 1 210 PRO 210 210 210 PRO PRO B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 MET 216 216 216 MET MET B . n 
B 1 217 GLU 217 217 217 GLU GLU B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 MET 221 221 221 MET MET B . n 
B 1 222 ASP 222 222 222 ASP ASP B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 LYS 225 225 225 LYS LYS B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 ASP 227 227 227 ASP ASP B . n 
B 1 228 ALA 228 228 228 ALA ALA B . n 
B 1 229 VAL 229 229 229 VAL VAL B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 VAL 231 231 231 VAL VAL B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 THR 233 233 233 THR THR B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 PHE 237 237 237 PHE PHE B . n 
B 1 238 ALA 238 238 238 ALA ALA B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 MET 240 240 240 MET MET B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 TRP 244 244 244 TRP TRP B . n 
B 1 245 THR 245 245 245 THR THR B . n 
B 1 246 HIS 246 246 246 HIS HIS B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 PRO 249 249 249 PRO PRO B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 VAL 254 254 254 VAL VAL B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 CYS 256 256 256 CYS CYS B . n 
B 1 257 GLU 257 257 257 GLU GLU B . n 
B 1 258 LYS 258 258 258 LYS LYS B . n 
B 1 259 THR 259 259 259 THR THR B . n 
B 1 260 VAL 260 260 260 VAL VAL B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 THR 262 262 262 THR THR B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 HIS 264 264 264 HIS HIS B . n 
B 1 265 HIS 265 265 265 HIS HIS B . n 
B 1 266 VAL 266 266 266 VAL VAL B . n 
B 1 267 LEU 267 267 267 LEU LEU B . n 
B 1 268 GLN 268 268 268 GLN GLN B . n 
B 1 269 ARG 269 269 269 ARG ARG B . n 
B 1 270 THR 270 270 270 THR THR B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 CYS 273 273 273 CYS CYS B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 LYS 275 275 275 LYS LYS B . n 
B 1 276 ALA 276 276 276 ALA ALA B . n 
B 1 277 GLN 277 277 277 GLN GLN B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLY 279 279 ?   ?   ?   B . n 
B 1 280 GLU 280 280 ?   ?   ?   B . n 
B 1 281 GLY 281 281 ?   ?   ?   B . n 
B 1 282 VAL 282 282 ?   ?   ?   B . n 
B 1 283 ARG 283 283 283 ARG ARG B . n 
B 1 284 PRO 284 284 284 PRO PRO B . n 
B 1 285 SER 285 285 285 SER SER B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 MET 287 287 287 MET MET B . n 
B 1 288 GLN 288 288 288 GLN GLN B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 GLU 290 290 290 GLU GLU B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 ARG 292 292 292 ARG ARG B . n 
B 1 293 MET 293 293 293 MET MET B . n 
B 1 294 VAL 294 294 294 VAL VAL B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 LYS 297 297 297 LYS LYS B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 ASP 299 299 299 ASP ASP B . n 
B 1 300 ILE 300 300 300 ILE ILE B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 ASP 302 302 302 ASP ASP B . n 
B 1 303 PRO 303 303 303 PRO PRO B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 ILE 305 305 305 ILE ILE B . n 
B 1 306 VAL 306 306 306 VAL VAL B . n 
B 1 307 VAL 307 307 307 VAL VAL B . n 
B 1 308 GLN 308 308 308 GLN GLN B . n 
B 1 309 ALA 309 309 309 ALA ALA B . n 
B 1 310 THR 310 310 310 THR THR B . n 
B 1 311 VAL 311 311 311 VAL VAL B . n 
B 1 312 LEU 312 312 312 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C  2 MG  1   400 400 MG  MG  A . 
D  2 MG  1   401 401 MG  MG  A . 
E  3 NA  1   402 402 NA  NA  A . 
F  4 ATP 1   407 407 ATP ATP A . 
G  5 PLP 1   500 500 PLP PLP A . 
H  6 MPD 1   508 508 MPD MPD A . 
I  6 MPD 1   512 512 MPD MPD A . 
J  6 MPD 1   516 516 MPD MPD A . 
K  7 SO4 1   524 524 SO4 SO4 A . 
L  7 SO4 1   528 528 SO4 SO4 A . 
M  7 SO4 1   538 538 SO4 SO4 A . 
N  2 MG  1   404 404 MG  MG  B . 
O  2 MG  1   405 405 MG  MG  B . 
P  3 NA  1   406 406 NA  NA  B . 
Q  4 ATP 1   409 409 ATP ATP B . 
R  6 MPD 1   508 508 MPD MPD B . 
S  5 PLP 1   500 500 PLP PLP B . 
T  6 MPD 1   510 510 MPD MPD B . 
U  6 MPD 1   514 514 MPD MPD B . 
V  6 MPD 1   518 518 MPD MPD B . 
W  6 MPD 1   520 520 MPD MPD B . 
X  6 MPD 1   522 522 MPD MPD B . 
Y  7 SO4 1   526 526 SO4 SO4 B . 
Z  7 SO4 1   530 530 SO4 SO4 B . 
AA 7 SO4 1   532 532 SO4 SO4 B . 
BA 7 SO4 1   534 534 SO4 SO4 B . 
CA 7 SO4 1   536 536 SO4 SO4 B . 
DA 8 HOH 1   600 600 HOH HOH A . 
DA 8 HOH 2   602 602 HOH HOH A . 
DA 8 HOH 3   605 605 HOH HOH A . 
DA 8 HOH 4   606 606 HOH HOH A . 
DA 8 HOH 5   608 608 HOH HOH A . 
DA 8 HOH 6   617 617 HOH HOH A . 
DA 8 HOH 7   618 618 HOH HOH A . 
DA 8 HOH 8   619 619 HOH HOH A . 
DA 8 HOH 9   621 621 HOH HOH A . 
DA 8 HOH 10  622 622 HOH HOH A . 
DA 8 HOH 11  623 623 HOH HOH A . 
DA 8 HOH 12  624 624 HOH HOH A . 
DA 8 HOH 13  625 625 HOH HOH A . 
DA 8 HOH 14  628 628 HOH HOH A . 
DA 8 HOH 15  633 633 HOH HOH A . 
DA 8 HOH 16  634 634 HOH HOH A . 
DA 8 HOH 17  635 635 HOH HOH A . 
DA 8 HOH 18  644 644 HOH HOH A . 
DA 8 HOH 19  646 646 HOH HOH A . 
DA 8 HOH 20  647 647 HOH HOH A . 
DA 8 HOH 21  648 648 HOH HOH A . 
DA 8 HOH 22  651 651 HOH HOH A . 
DA 8 HOH 23  652 652 HOH HOH A . 
DA 8 HOH 24  655 655 HOH HOH A . 
DA 8 HOH 25  656 656 HOH HOH A . 
DA 8 HOH 26  657 657 HOH HOH A . 
DA 8 HOH 27  658 658 HOH HOH A . 
DA 8 HOH 28  659 659 HOH HOH A . 
DA 8 HOH 29  663 663 HOH HOH A . 
DA 8 HOH 30  677 677 HOH HOH A . 
DA 8 HOH 31  679 679 HOH HOH A . 
DA 8 HOH 32  680 680 HOH HOH A . 
DA 8 HOH 33  681 681 HOH HOH A . 
DA 8 HOH 34  682 682 HOH HOH A . 
DA 8 HOH 35  683 683 HOH HOH A . 
DA 8 HOH 36  684 684 HOH HOH A . 
DA 8 HOH 37  685 685 HOH HOH A . 
DA 8 HOH 38  686 686 HOH HOH A . 
DA 8 HOH 39  688 688 HOH HOH A . 
DA 8 HOH 40  690 690 HOH HOH A . 
DA 8 HOH 41  691 691 HOH HOH A . 
DA 8 HOH 42  692 692 HOH HOH A . 
DA 8 HOH 43  693 693 HOH HOH A . 
DA 8 HOH 44  694 694 HOH HOH A . 
DA 8 HOH 45  695 695 HOH HOH A . 
DA 8 HOH 46  696 696 HOH HOH A . 
DA 8 HOH 47  697 697 HOH HOH A . 
DA 8 HOH 48  698 698 HOH HOH A . 
DA 8 HOH 49  699 699 HOH HOH A . 
DA 8 HOH 50  700 700 HOH HOH A . 
DA 8 HOH 51  701 701 HOH HOH A . 
DA 8 HOH 52  702 702 HOH HOH A . 
DA 8 HOH 53  704 704 HOH HOH A . 
DA 8 HOH 54  705 705 HOH HOH A . 
DA 8 HOH 55  706 706 HOH HOH A . 
DA 8 HOH 56  719 719 HOH HOH A . 
DA 8 HOH 57  720 720 HOH HOH A . 
DA 8 HOH 58  721 721 HOH HOH A . 
DA 8 HOH 59  722 722 HOH HOH A . 
DA 8 HOH 60  723 723 HOH HOH A . 
DA 8 HOH 61  743 743 HOH HOH A . 
DA 8 HOH 62  744 744 HOH HOH A . 
DA 8 HOH 63  745 745 HOH HOH A . 
DA 8 HOH 64  750 750 HOH HOH A . 
DA 8 HOH 65  751 751 HOH HOH A . 
DA 8 HOH 66  752 752 HOH HOH A . 
DA 8 HOH 67  753 753 HOH HOH A . 
DA 8 HOH 68  754 754 HOH HOH A . 
DA 8 HOH 69  755 755 HOH HOH A . 
DA 8 HOH 70  756 756 HOH HOH A . 
DA 8 HOH 71  775 775 HOH HOH A . 
DA 8 HOH 72  778 778 HOH HOH A . 
DA 8 HOH 73  779 779 HOH HOH A . 
DA 8 HOH 74  780 780 HOH HOH A . 
DA 8 HOH 75  783 783 HOH HOH A . 
DA 8 HOH 76  784 784 HOH HOH A . 
DA 8 HOH 77  786 786 HOH HOH A . 
DA 8 HOH 78  787 787 HOH HOH A . 
DA 8 HOH 79  788 788 HOH HOH A . 
DA 8 HOH 80  789 789 HOH HOH A . 
DA 8 HOH 81  790 790 HOH HOH A . 
DA 8 HOH 82  791 791 HOH HOH A . 
DA 8 HOH 83  792 792 HOH HOH A . 
DA 8 HOH 84  803 803 HOH HOH A . 
DA 8 HOH 85  804 804 HOH HOH A . 
DA 8 HOH 86  805 805 HOH HOH A . 
DA 8 HOH 87  806 806 HOH HOH A . 
DA 8 HOH 88  807 807 HOH HOH A . 
DA 8 HOH 89  808 808 HOH HOH A . 
DA 8 HOH 90  810 810 HOH HOH A . 
DA 8 HOH 91  812 812 HOH HOH A . 
DA 8 HOH 92  813 813 HOH HOH A . 
DA 8 HOH 93  814 814 HOH HOH A . 
DA 8 HOH 94  815 815 HOH HOH A . 
DA 8 HOH 95  816 816 HOH HOH A . 
DA 8 HOH 96  817 817 HOH HOH A . 
DA 8 HOH 97  818 818 HOH HOH A . 
DA 8 HOH 98  819 819 HOH HOH A . 
DA 8 HOH 99  820 820 HOH HOH A . 
DA 8 HOH 100 821 821 HOH HOH A . 
DA 8 HOH 101 822 822 HOH HOH A . 
DA 8 HOH 102 824 824 HOH HOH A . 
DA 8 HOH 103 825 825 HOH HOH A . 
DA 8 HOH 104 826 826 HOH HOH A . 
DA 8 HOH 105 827 827 HOH HOH A . 
DA 8 HOH 106 828 828 HOH HOH A . 
DA 8 HOH 107 829 829 HOH HOH A . 
DA 8 HOH 108 830 830 HOH HOH A . 
DA 8 HOH 109 831 831 HOH HOH A . 
DA 8 HOH 110 832 832 HOH HOH A . 
DA 8 HOH 111 833 833 HOH HOH A . 
DA 8 HOH 112 834 834 HOH HOH A . 
DA 8 HOH 113 849 849 HOH HOH A . 
DA 8 HOH 114 850 850 HOH HOH A . 
DA 8 HOH 115 851 851 HOH HOH A . 
DA 8 HOH 116 852 852 HOH HOH A . 
DA 8 HOH 117 854 854 HOH HOH A . 
DA 8 HOH 118 855 855 HOH HOH A . 
DA 8 HOH 119 856 856 HOH HOH A . 
DA 8 HOH 120 857 857 HOH HOH A . 
DA 8 HOH 121 858 858 HOH HOH A . 
DA 8 HOH 122 859 859 HOH HOH A . 
DA 8 HOH 123 860 860 HOH HOH A . 
DA 8 HOH 124 861 861 HOH HOH A . 
DA 8 HOH 125 862 862 HOH HOH A . 
DA 8 HOH 126 886 886 HOH HOH A . 
DA 8 HOH 127 887 887 HOH HOH A . 
DA 8 HOH 128 888 888 HOH HOH A . 
DA 8 HOH 129 889 889 HOH HOH A . 
DA 8 HOH 130 890 890 HOH HOH A . 
DA 8 HOH 131 891 891 HOH HOH A . 
DA 8 HOH 132 892 892 HOH HOH A . 
DA 8 HOH 133 893 893 HOH HOH A . 
DA 8 HOH 134 894 894 HOH HOH A . 
DA 8 HOH 135 907 907 HOH HOH A . 
DA 8 HOH 136 909 909 HOH HOH A . 
DA 8 HOH 137 910 910 HOH HOH A . 
DA 8 HOH 138 911 911 HOH HOH A . 
DA 8 HOH 139 912 912 HOH HOH A . 
DA 8 HOH 140 913 913 HOH HOH A . 
DA 8 HOH 141 914 914 HOH HOH A . 
DA 8 HOH 142 915 915 HOH HOH A . 
DA 8 HOH 143 916 916 HOH HOH A . 
DA 8 HOH 144 917 917 HOH HOH A . 
DA 8 HOH 145 918 918 HOH HOH A . 
DA 8 HOH 146 919 919 HOH HOH A . 
DA 8 HOH 147 920 920 HOH HOH A . 
DA 8 HOH 148 924 924 HOH HOH A . 
DA 8 HOH 149 928 928 HOH HOH A . 
EA 8 HOH 1   601 601 HOH HOH B . 
EA 8 HOH 2   603 603 HOH HOH B . 
EA 8 HOH 3   604 604 HOH HOH B . 
EA 8 HOH 4   607 607 HOH HOH B . 
EA 8 HOH 5   609 609 HOH HOH B . 
EA 8 HOH 6   610 610 HOH HOH B . 
EA 8 HOH 7   611 611 HOH HOH B . 
EA 8 HOH 8   612 612 HOH HOH B . 
EA 8 HOH 9   613 613 HOH HOH B . 
EA 8 HOH 10  614 614 HOH HOH B . 
EA 8 HOH 11  615 615 HOH HOH B . 
EA 8 HOH 12  616 616 HOH HOH B . 
EA 8 HOH 13  620 620 HOH HOH B . 
EA 8 HOH 14  626 626 HOH HOH B . 
EA 8 HOH 15  627 627 HOH HOH B . 
EA 8 HOH 16  629 629 HOH HOH B . 
EA 8 HOH 17  630 630 HOH HOH B . 
EA 8 HOH 18  631 631 HOH HOH B . 
EA 8 HOH 19  632 632 HOH HOH B . 
EA 8 HOH 20  636 636 HOH HOH B . 
EA 8 HOH 21  637 637 HOH HOH B . 
EA 8 HOH 22  638 638 HOH HOH B . 
EA 8 HOH 23  639 639 HOH HOH B . 
EA 8 HOH 24  640 640 HOH HOH B . 
EA 8 HOH 25  641 641 HOH HOH B . 
EA 8 HOH 26  642 642 HOH HOH B . 
EA 8 HOH 27  643 643 HOH HOH B . 
EA 8 HOH 28  645 645 HOH HOH B . 
EA 8 HOH 29  649 649 HOH HOH B . 
EA 8 HOH 30  650 650 HOH HOH B . 
EA 8 HOH 31  653 653 HOH HOH B . 
EA 8 HOH 32  654 654 HOH HOH B . 
EA 8 HOH 33  660 660 HOH HOH B . 
EA 8 HOH 34  661 661 HOH HOH B . 
EA 8 HOH 35  662 662 HOH HOH B . 
EA 8 HOH 36  664 664 HOH HOH B . 
EA 8 HOH 37  665 665 HOH HOH B . 
EA 8 HOH 38  666 666 HOH HOH B . 
EA 8 HOH 39  667 667 HOH HOH B . 
EA 8 HOH 40  668 668 HOH HOH B . 
EA 8 HOH 41  669 669 HOH HOH B . 
EA 8 HOH 42  670 670 HOH HOH B . 
EA 8 HOH 43  671 671 HOH HOH B . 
EA 8 HOH 44  672 672 HOH HOH B . 
EA 8 HOH 45  673 673 HOH HOH B . 
EA 8 HOH 46  674 674 HOH HOH B . 
EA 8 HOH 47  675 675 HOH HOH B . 
EA 8 HOH 48  676 676 HOH HOH B . 
EA 8 HOH 49  678 678 HOH HOH B . 
EA 8 HOH 50  687 687 HOH HOH B . 
EA 8 HOH 51  689 689 HOH HOH B . 
EA 8 HOH 52  703 703 HOH HOH B . 
EA 8 HOH 53  707 707 HOH HOH B . 
EA 8 HOH 54  708 708 HOH HOH B . 
EA 8 HOH 55  709 709 HOH HOH B . 
EA 8 HOH 56  710 710 HOH HOH B . 
EA 8 HOH 57  711 711 HOH HOH B . 
EA 8 HOH 58  712 712 HOH HOH B . 
EA 8 HOH 59  713 713 HOH HOH B . 
EA 8 HOH 60  714 714 HOH HOH B . 
EA 8 HOH 61  715 715 HOH HOH B . 
EA 8 HOH 62  716 716 HOH HOH B . 
EA 8 HOH 63  717 717 HOH HOH B . 
EA 8 HOH 64  718 718 HOH HOH B . 
EA 8 HOH 65  724 724 HOH HOH B . 
EA 8 HOH 66  725 725 HOH HOH B . 
EA 8 HOH 67  726 726 HOH HOH B . 
EA 8 HOH 68  727 727 HOH HOH B . 
EA 8 HOH 69  728 728 HOH HOH B . 
EA 8 HOH 70  729 729 HOH HOH B . 
EA 8 HOH 71  730 730 HOH HOH B . 
EA 8 HOH 72  731 731 HOH HOH B . 
EA 8 HOH 73  732 732 HOH HOH B . 
EA 8 HOH 74  733 733 HOH HOH B . 
EA 8 HOH 75  734 734 HOH HOH B . 
EA 8 HOH 76  735 735 HOH HOH B . 
EA 8 HOH 77  736 736 HOH HOH B . 
EA 8 HOH 78  737 737 HOH HOH B . 
EA 8 HOH 79  738 738 HOH HOH B . 
EA 8 HOH 80  739 739 HOH HOH B . 
EA 8 HOH 81  741 741 HOH HOH B . 
EA 8 HOH 82  742 742 HOH HOH B . 
EA 8 HOH 83  746 746 HOH HOH B . 
EA 8 HOH 84  747 747 HOH HOH B . 
EA 8 HOH 85  748 748 HOH HOH B . 
EA 8 HOH 86  749 749 HOH HOH B . 
EA 8 HOH 87  757 757 HOH HOH B . 
EA 8 HOH 88  758 758 HOH HOH B . 
EA 8 HOH 89  759 759 HOH HOH B . 
EA 8 HOH 90  760 760 HOH HOH B . 
EA 8 HOH 91  761 761 HOH HOH B . 
EA 8 HOH 92  762 762 HOH HOH B . 
EA 8 HOH 93  763 763 HOH HOH B . 
EA 8 HOH 94  764 764 HOH HOH B . 
EA 8 HOH 95  765 765 HOH HOH B . 
EA 8 HOH 96  766 766 HOH HOH B . 
EA 8 HOH 97  767 767 HOH HOH B . 
EA 8 HOH 98  768 768 HOH HOH B . 
EA 8 HOH 99  769 769 HOH HOH B . 
EA 8 HOH 100 770 770 HOH HOH B . 
EA 8 HOH 101 771 771 HOH HOH B . 
EA 8 HOH 102 772 772 HOH HOH B . 
EA 8 HOH 103 774 774 HOH HOH B . 
EA 8 HOH 104 776 776 HOH HOH B . 
EA 8 HOH 105 777 777 HOH HOH B . 
EA 8 HOH 106 781 781 HOH HOH B . 
EA 8 HOH 107 782 782 HOH HOH B . 
EA 8 HOH 108 785 785 HOH HOH B . 
EA 8 HOH 109 793 793 HOH HOH B . 
EA 8 HOH 110 794 794 HOH HOH B . 
EA 8 HOH 111 795 795 HOH HOH B . 
EA 8 HOH 112 796 796 HOH HOH B . 
EA 8 HOH 113 797 797 HOH HOH B . 
EA 8 HOH 114 798 798 HOH HOH B . 
EA 8 HOH 115 799 799 HOH HOH B . 
EA 8 HOH 116 800 800 HOH HOH B . 
EA 8 HOH 117 801 801 HOH HOH B . 
EA 8 HOH 118 802 802 HOH HOH B . 
EA 8 HOH 119 811 811 HOH HOH B . 
EA 8 HOH 120 835 835 HOH HOH B . 
EA 8 HOH 121 836 836 HOH HOH B . 
EA 8 HOH 122 837 837 HOH HOH B . 
EA 8 HOH 123 838 838 HOH HOH B . 
EA 8 HOH 124 839 839 HOH HOH B . 
EA 8 HOH 125 840 840 HOH HOH B . 
EA 8 HOH 126 841 841 HOH HOH B . 
EA 8 HOH 127 842 842 HOH HOH B . 
EA 8 HOH 128 843 843 HOH HOH B . 
EA 8 HOH 129 844 844 HOH HOH B . 
EA 8 HOH 130 845 845 HOH HOH B . 
EA 8 HOH 131 846 846 HOH HOH B . 
EA 8 HOH 132 847 847 HOH HOH B . 
EA 8 HOH 133 848 848 HOH HOH B . 
EA 8 HOH 134 853 853 HOH HOH B . 
EA 8 HOH 135 863 863 HOH HOH B . 
EA 8 HOH 136 864 864 HOH HOH B . 
EA 8 HOH 137 865 865 HOH HOH B . 
EA 8 HOH 138 866 866 HOH HOH B . 
EA 8 HOH 139 867 867 HOH HOH B . 
EA 8 HOH 140 868 868 HOH HOH B . 
EA 8 HOH 141 869 869 HOH HOH B . 
EA 8 HOH 142 870 870 HOH HOH B . 
EA 8 HOH 143 871 871 HOH HOH B . 
EA 8 HOH 144 872 872 HOH HOH B . 
EA 8 HOH 145 873 873 HOH HOH B . 
EA 8 HOH 146 874 874 HOH HOH B . 
EA 8 HOH 147 875 875 HOH HOH B . 
EA 8 HOH 148 876 876 HOH HOH B . 
EA 8 HOH 149 877 877 HOH HOH B . 
EA 8 HOH 150 878 878 HOH HOH B . 
EA 8 HOH 151 879 879 HOH HOH B . 
EA 8 HOH 152 880 880 HOH HOH B . 
EA 8 HOH 153 881 881 HOH HOH B . 
EA 8 HOH 154 882 882 HOH HOH B . 
EA 8 HOH 155 883 883 HOH HOH B . 
EA 8 HOH 156 884 884 HOH HOH B . 
EA 8 HOH 157 885 885 HOH HOH B . 
EA 8 HOH 158 895 895 HOH HOH B . 
EA 8 HOH 159 896 896 HOH HOH B . 
EA 8 HOH 160 897 897 HOH HOH B . 
EA 8 HOH 161 898 898 HOH HOH B . 
EA 8 HOH 162 899 899 HOH HOH B . 
EA 8 HOH 163 900 900 HOH HOH B . 
EA 8 HOH 164 901 901 HOH HOH B . 
EA 8 HOH 165 903 903 HOH HOH B . 
EA 8 HOH 166 904 904 HOH HOH B . 
EA 8 HOH 167 905 905 HOH HOH B . 
EA 8 HOH 168 906 906 HOH HOH B . 
EA 8 HOH 169 908 908 HOH HOH B . 
EA 8 HOH 170 921 921 HOH HOH B . 
EA 8 HOH 171 923 923 HOH HOH B . 
EA 8 HOH 172 925 925 HOH HOH B . 
EA 8 HOH 173 926 926 HOH HOH B . 
EA 8 HOH 174 927 927 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12280 ? 
1 MORE         -288  ? 
1 'SSA (A^2)'  23200 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     899 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   EA 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A  ASP 118 ? A ASP 118 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O1B ? F  ATP .   ? A ATP 407 ? 1_555 90.7  ? 
2  OD2 ? A  ASP 118 ? A ASP 118 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O2A ? F  ATP .   ? A ATP 407 ? 1_555 173.9 ? 
3  O1B ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O2A ? F  ATP .   ? A ATP 407 ? 1_555 84.7  ? 
4  OD2 ? A  ASP 118 ? A ASP 118 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 792 ? 1_555 85.1  ? 
5  O1B ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 792 ? 1_555 69.9  ? 
6  O2A ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 792 ? 1_555 89.6  ? 
7  OD2 ? A  ASP 118 ? A ASP 118 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O4  ? I  MPD .   ? A MPD 512 ? 1_555 85.1  ? 
8  O1B ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O4  ? I  MPD .   ? A MPD 512 ? 1_555 157.7 ? 
9  O2A ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O4  ? I  MPD .   ? A MPD 512 ? 1_555 97.8  ? 
10 O   ? DA HOH .   ? A HOH 792 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O4  ? I  MPD .   ? A MPD 512 ? 1_555 87.8  ? 
11 OD2 ? A  ASP 118 ? A ASP 118 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 806 ? 1_555 100.3 ? 
12 O1B ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 806 ? 1_555 92.8  ? 
13 O2A ? F  ATP .   ? A ATP 407 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 806 ? 1_555 83.8  ? 
14 O   ? DA HOH .   ? A HOH 792 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 806 ? 1_555 162.1 ? 
15 O4  ? I  MPD .   ? A MPD 512 ? 1_555 MG ? C MG . ? A MG 400 ? 1_555 O   ? DA HOH .   ? A HOH 806 ? 1_555 109.5 ? 
16 O   ? A  THR 148 ? A THR 148 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 OG1 ? A  THR 186 ? A THR 186 ? 1_555 101.6 ? 
17 O   ? A  THR 148 ? A THR 148 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O3B ? F  ATP .   ? A ATP 407 ? 1_555 163.0 ? 
18 OG1 ? A  THR 186 ? A THR 186 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O3B ? F  ATP .   ? A ATP 407 ? 1_555 94.2  ? 
19 O   ? A  THR 148 ? A THR 148 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O2G ? F  ATP .   ? A ATP 407 ? 1_555 103.4 ? 
20 OG1 ? A  THR 186 ? A THR 186 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O2G ? F  ATP .   ? A ATP 407 ? 1_555 140.1 ? 
21 O3B ? F  ATP .   ? A ATP 407 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O2G ? F  ATP .   ? A ATP 407 ? 1_555 59.8  ? 
22 O   ? A  THR 148 ? A THR 148 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O   ? DA HOH .   ? A HOH 656 ? 1_555 91.9  ? 
23 OG1 ? A  THR 186 ? A THR 186 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O   ? DA HOH .   ? A HOH 656 ? 1_555 109.3 ? 
24 O3B ? F  ATP .   ? A ATP 407 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O   ? DA HOH .   ? A HOH 656 ? 1_555 88.8  ? 
25 O2G ? F  ATP .   ? A ATP 407 ? 1_555 NA ? E NA . ? A NA 402 ? 1_555 O   ? DA HOH .   ? A HOH 656 ? 1_555 100.5 ? 
26 OD2 ? B  ASP 118 ? B ASP 118 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O1B ? Q  ATP .   ? B ATP 409 ? 1_555 86.0  ? 
27 OD2 ? B  ASP 118 ? B ASP 118 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 798 ? 1_555 85.4  ? 
28 O1B ? Q  ATP .   ? B ATP 409 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 798 ? 1_555 98.0  ? 
29 OD2 ? B  ASP 118 ? B ASP 118 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O2A ? Q  ATP .   ? B ATP 409 ? 1_555 172.1 ? 
30 O1B ? Q  ATP .   ? B ATP 409 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O2A ? Q  ATP .   ? B ATP 409 ? 1_555 86.1  ? 
31 O   ? EA HOH .   ? B HOH 798 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O2A ? Q  ATP .   ? B ATP 409 ? 1_555 95.5  ? 
32 OD2 ? B  ASP 118 ? B ASP 118 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O4  ? U  MPD .   ? B MPD 514 ? 1_555 89.1  ? 
33 O1B ? Q  ATP .   ? B ATP 409 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O4  ? U  MPD .   ? B MPD 514 ? 1_555 174.7 ? 
34 O   ? EA HOH .   ? B HOH 798 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O4  ? U  MPD .   ? B MPD 514 ? 1_555 79.5  ? 
35 O2A ? Q  ATP .   ? B ATP 409 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O4  ? U  MPD .   ? B MPD 514 ? 1_555 98.8  ? 
36 OD2 ? B  ASP 118 ? B ASP 118 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 797 ? 1_555 83.1  ? 
37 O1B ? Q  ATP .   ? B ATP 409 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 797 ? 1_555 82.4  ? 
38 O   ? EA HOH .   ? B HOH 798 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 797 ? 1_555 168.5 ? 
39 O2A ? Q  ATP .   ? B ATP 409 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 797 ? 1_555 95.9  ? 
40 O4  ? U  MPD .   ? B MPD 514 ? 1_555 MG ? N MG . ? B MG 404 ? 1_555 O   ? EA HOH .   ? B HOH 797 ? 1_555 99.1  ? 
41 O   ? B  THR 148 ? B THR 148 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 OG1 ? B  THR 186 ? B THR 186 ? 1_555 108.2 ? 
42 O   ? B  THR 148 ? B THR 148 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O1G ? Q  ATP .   ? B ATP 409 ? 1_555 102.9 ? 
43 OG1 ? B  THR 186 ? B THR 186 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O1G ? Q  ATP .   ? B ATP 409 ? 1_555 136.2 ? 
44 O   ? B  THR 148 ? B THR 148 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O3B ? Q  ATP .   ? B ATP 409 ? 1_555 163.4 ? 
45 OG1 ? B  THR 186 ? B THR 186 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O3B ? Q  ATP .   ? B ATP 409 ? 1_555 85.2  ? 
46 O1G ? Q  ATP .   ? B ATP 409 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O3B ? Q  ATP .   ? B ATP 409 ? 1_555 60.5  ? 
47 O   ? B  THR 148 ? B THR 148 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O   ? EA HOH .   ? B HOH 796 ? 1_555 94.7  ? 
48 OG1 ? B  THR 186 ? B THR 186 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O   ? EA HOH .   ? B HOH 796 ? 1_555 115.1 ? 
49 O1G ? Q  ATP .   ? B ATP 409 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O   ? EA HOH .   ? B HOH 796 ? 1_555 91.6  ? 
50 O3B ? Q  ATP .   ? B ATP 409 ? 1_555 NA ? P NA . ? B NA 406 ? 1_555 O   ? EA HOH .   ? B HOH 796 ? 1_555 88.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-03 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 d*TREK       9.2SSI 'Nov 2 2004'    package 'Jim W. Pflugrath' Jim.Pflugrath@Rigaku.com 'data scaling'    
http://www.rigaku.com/software/dtrek.html ?          ? 
2 CNS          1.0    ?               package 'Axel T. Brunger'  axel.brunger@yale.edu    refinement        http://cns-online.org/ 
Fortran_77 ? 
3 PDB_EXTRACT  3.005  'June 11, 2008' package PDB                help@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
4 CrystalClear .      ?               ?       ?                  ?                        'data collection' ? ?          ? 
5 d*TREK       .      ?               ?       ?                  ?                        'data reduction'  ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 52  ? ? -172.54 144.81  
2  1 ASN A 75  ? ? -94.69  47.69   
3  1 TRP A 120 ? ? -97.36  -94.53  
4  1 ASP A 131 ? ? -56.04  -9.53   
5  1 SER A 187 ? ? -172.19 149.87  
6  1 ASN A 197 ? ? -80.64  47.94   
7  1 ALA A 228 ? ? 177.54  160.63  
8  1 ASN A 251 ? ? -152.06 67.91   
9  1 ASP A 302 ? ? -150.14 88.52   
10 1 THR B 47  ? ? -66.70  6.02    
11 1 TRP B 52  ? ? -170.13 138.31  
12 1 ASP B 121 ? ? 68.00   -121.85 
13 1 ASN B 197 ? ? -81.15  47.95   
14 1 ALA B 228 ? ? 172.62  161.21  
15 1 CYS B 273 ? ? -97.41  33.12   
16 1 ALA B 274 ? ? -132.79 -37.27  
17 1 ASP B 302 ? ? -151.14 84.26   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A ARG 208 ? A ARG 208 
4  1 Y 1 A ASN 209 ? A ASN 209 
5  1 Y 1 A PRO 210 ? A PRO 210 
6  1 Y 1 A ALA 211 ? A ALA 211 
7  1 Y 1 A GLY 212 ? A GLY 212 
8  1 Y 1 B MET 1   ? B MET 1   
9  1 Y 1 B GLU 2   ? B GLU 2   
10 1 Y 1 B GLU 3   ? B GLU 3   
11 1 Y 1 B GLY 279 ? B GLY 279 
12 1 Y 1 B GLU 280 ? B GLU 280 
13 1 Y 1 B GLY 281 ? B GLY 281 
14 1 Y 1 B VAL 282 ? B VAL 282 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                 MG  
3 'SODIUM ION'                    NA  
4 "ADENOSINE-5'-TRIPHOSPHATE"     ATP 
5 "PYRIDOXAL-5'-PHOSPHATE"        PLP 
6 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 
7 'SULFATE ION'                   SO4 
8 water                           HOH 
#