data_3KG2
# 
_entry.id   3KG2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3KG2         pdb_00003kg2 10.2210/pdb3kg2/pdb 
RCSB  RCSB055947   ?            ?                   
WWPDB D_1000055947 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3KGC 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KG2 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sobolevsky, A.I.' 1 
'Rosconi, M.P.'    2 
'Gouaux, E.'       3 
# 
_citation.id                        primary 
_citation.title                     'X-ray structure, symmetry and mechanism of an AMPA-subtype glutamate receptor.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            462 
_citation.page_first                745 
_citation.page_last                 756 
_citation.year                      2009 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19946266 
_citation.pdbx_database_id_DOI      10.1038/nature08624 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sobolevsky, A.I.' 1 ? 
primary 'Rosconi, M.P.'    2 ? 
primary 'Gouaux, E.'       3 ? 
# 
_cell.entry_id           3KG2 
_cell.length_a           90.715 
_cell.length_b           109.848 
_cell.length_c           161.130 
_cell.angle_alpha        85.32 
_cell.angle_beta         84.75 
_cell.angle_gamma        78.92 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KG2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glutamate receptor 2' 92043.039 4 ? 'N241E, N385D, N392Q, K410A, E413A, M414A, E416A, and C589A' 
'sequence database residues 25-847' ? 
2 branched    man 
;beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   2 ? ?                                                            ?                                   ? 
3 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   2 ? 
?                                                            ?                                   ? 
4 non-polymer syn '{[7-morpholin-4-yl-2,3-dioxo-6-(trifluoromethyl)-3,4-dihydroquinoxalin-1(2H)-yl]methyl}phosphonic acid' 409.254 
4 ? ?                                                            ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GluR-2, GluR-B, GluR-K2, Glutamate receptor ionotropic, AMPA 2, AMPA-selective glutamate receptor 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFC
GTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNIN
NDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAEVSGFQIVD
YDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEI
ERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTEDDTSGLEQKTVVVTTILESPYVMMK
ANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVI
DFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTN
EFGIFNSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGT
LDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGIATPKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLV
ALIEFCYKSRAEAKRMKGLVPRG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFC
GTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNIN
NDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAEVSGFQIVD
YDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEI
ERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTEDDTSGLEQKTVVVTTILESPYVMMK
ANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVI
DFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTN
EFGIFNSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGT
LDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGIATPKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLV
ALIEFCYKSRAEAKRMKGLVPRG
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   SER n 
1 3   ILE n 
1 4   GLN n 
1 5   ILE n 
1 6   GLY n 
1 7   GLY n 
1 8   LEU n 
1 9   PHE n 
1 10  PRO n 
1 11  ARG n 
1 12  GLY n 
1 13  ALA n 
1 14  ASP n 
1 15  GLN n 
1 16  GLU n 
1 17  TYR n 
1 18  SER n 
1 19  ALA n 
1 20  PHE n 
1 21  ARG n 
1 22  VAL n 
1 23  GLY n 
1 24  MET n 
1 25  VAL n 
1 26  GLN n 
1 27  PHE n 
1 28  SER n 
1 29  THR n 
1 30  SER n 
1 31  GLU n 
1 32  PHE n 
1 33  ARG n 
1 34  LEU n 
1 35  THR n 
1 36  PRO n 
1 37  HIS n 
1 38  ILE n 
1 39  ASP n 
1 40  ASN n 
1 41  LEU n 
1 42  GLU n 
1 43  VAL n 
1 44  ALA n 
1 45  ASN n 
1 46  SER n 
1 47  PHE n 
1 48  ALA n 
1 49  VAL n 
1 50  THR n 
1 51  ASN n 
1 52  ALA n 
1 53  PHE n 
1 54  CYS n 
1 55  SER n 
1 56  GLN n 
1 57  PHE n 
1 58  SER n 
1 59  ARG n 
1 60  GLY n 
1 61  VAL n 
1 62  TYR n 
1 63  ALA n 
1 64  ILE n 
1 65  PHE n 
1 66  GLY n 
1 67  PHE n 
1 68  TYR n 
1 69  ASP n 
1 70  LYS n 
1 71  LYS n 
1 72  SER n 
1 73  VAL n 
1 74  ASN n 
1 75  THR n 
1 76  ILE n 
1 77  THR n 
1 78  SER n 
1 79  PHE n 
1 80  CYS n 
1 81  GLY n 
1 82  THR n 
1 83  LEU n 
1 84  HIS n 
1 85  VAL n 
1 86  SER n 
1 87  PHE n 
1 88  ILE n 
1 89  THR n 
1 90  PRO n 
1 91  SER n 
1 92  PHE n 
1 93  PRO n 
1 94  THR n 
1 95  ASP n 
1 96  GLY n 
1 97  THR n 
1 98  HIS n 
1 99  PRO n 
1 100 PHE n 
1 101 VAL n 
1 102 ILE n 
1 103 GLN n 
1 104 MET n 
1 105 ARG n 
1 106 PRO n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 GLY n 
1 111 ALA n 
1 112 LEU n 
1 113 LEU n 
1 114 SER n 
1 115 LEU n 
1 116 ILE n 
1 117 GLU n 
1 118 TYR n 
1 119 TYR n 
1 120 GLN n 
1 121 TRP n 
1 122 ASP n 
1 123 LYS n 
1 124 PHE n 
1 125 ALA n 
1 126 TYR n 
1 127 LEU n 
1 128 TYR n 
1 129 ASP n 
1 130 SER n 
1 131 ASP n 
1 132 ARG n 
1 133 GLY n 
1 134 LEU n 
1 135 SER n 
1 136 THR n 
1 137 LEU n 
1 138 GLN n 
1 139 ALA n 
1 140 VAL n 
1 141 LEU n 
1 142 ASP n 
1 143 SER n 
1 144 ALA n 
1 145 ALA n 
1 146 GLU n 
1 147 LYS n 
1 148 LYS n 
1 149 TRP n 
1 150 GLN n 
1 151 VAL n 
1 152 THR n 
1 153 ALA n 
1 154 ILE n 
1 155 ASN n 
1 156 VAL n 
1 157 GLY n 
1 158 ASN n 
1 159 ILE n 
1 160 ASN n 
1 161 ASN n 
1 162 ASP n 
1 163 LYS n 
1 164 LYS n 
1 165 ASP n 
1 166 GLU n 
1 167 THR n 
1 168 TYR n 
1 169 ARG n 
1 170 SER n 
1 171 LEU n 
1 172 PHE n 
1 173 GLN n 
1 174 ASP n 
1 175 LEU n 
1 176 GLU n 
1 177 LEU n 
1 178 LYS n 
1 179 LYS n 
1 180 GLU n 
1 181 ARG n 
1 182 ARG n 
1 183 VAL n 
1 184 ILE n 
1 185 LEU n 
1 186 ASP n 
1 187 CYS n 
1 188 GLU n 
1 189 ARG n 
1 190 ASP n 
1 191 LYS n 
1 192 VAL n 
1 193 ASN n 
1 194 ASP n 
1 195 ILE n 
1 196 VAL n 
1 197 ASP n 
1 198 GLN n 
1 199 VAL n 
1 200 ILE n 
1 201 THR n 
1 202 ILE n 
1 203 GLY n 
1 204 LYS n 
1 205 HIS n 
1 206 VAL n 
1 207 LYS n 
1 208 GLY n 
1 209 TYR n 
1 210 HIS n 
1 211 TYR n 
1 212 ILE n 
1 213 ILE n 
1 214 ALA n 
1 215 ASN n 
1 216 LEU n 
1 217 GLY n 
1 218 PHE n 
1 219 THR n 
1 220 ASP n 
1 221 GLY n 
1 222 ASP n 
1 223 LEU n 
1 224 LEU n 
1 225 LYS n 
1 226 ILE n 
1 227 GLN n 
1 228 PHE n 
1 229 GLY n 
1 230 GLY n 
1 231 ALA n 
1 232 GLU n 
1 233 VAL n 
1 234 SER n 
1 235 GLY n 
1 236 PHE n 
1 237 GLN n 
1 238 ILE n 
1 239 VAL n 
1 240 ASP n 
1 241 TYR n 
1 242 ASP n 
1 243 ASP n 
1 244 SER n 
1 245 LEU n 
1 246 VAL n 
1 247 SER n 
1 248 LYS n 
1 249 PHE n 
1 250 ILE n 
1 251 GLU n 
1 252 ARG n 
1 253 TRP n 
1 254 SER n 
1 255 THR n 
1 256 LEU n 
1 257 GLU n 
1 258 GLU n 
1 259 LYS n 
1 260 GLU n 
1 261 TYR n 
1 262 PRO n 
1 263 GLY n 
1 264 ALA n 
1 265 HIS n 
1 266 THR n 
1 267 ALA n 
1 268 THR n 
1 269 ILE n 
1 270 LYS n 
1 271 TYR n 
1 272 THR n 
1 273 SER n 
1 274 ALA n 
1 275 LEU n 
1 276 THR n 
1 277 TYR n 
1 278 ASP n 
1 279 ALA n 
1 280 VAL n 
1 281 GLN n 
1 282 VAL n 
1 283 MET n 
1 284 THR n 
1 285 GLU n 
1 286 ALA n 
1 287 PHE n 
1 288 ARG n 
1 289 ASN n 
1 290 LEU n 
1 291 ARG n 
1 292 LYS n 
1 293 GLN n 
1 294 ARG n 
1 295 ILE n 
1 296 GLU n 
1 297 ILE n 
1 298 SER n 
1 299 ARG n 
1 300 ARG n 
1 301 GLY n 
1 302 ASN n 
1 303 ALA n 
1 304 GLY n 
1 305 ASP n 
1 306 CYS n 
1 307 LEU n 
1 308 ALA n 
1 309 ASN n 
1 310 PRO n 
1 311 ALA n 
1 312 VAL n 
1 313 PRO n 
1 314 TRP n 
1 315 GLY n 
1 316 GLN n 
1 317 GLY n 
1 318 VAL n 
1 319 GLU n 
1 320 ILE n 
1 321 GLU n 
1 322 ARG n 
1 323 ALA n 
1 324 LEU n 
1 325 LYS n 
1 326 GLN n 
1 327 VAL n 
1 328 GLN n 
1 329 VAL n 
1 330 GLU n 
1 331 GLY n 
1 332 LEU n 
1 333 SER n 
1 334 GLY n 
1 335 ASN n 
1 336 ILE n 
1 337 LYS n 
1 338 PHE n 
1 339 ASP n 
1 340 GLN n 
1 341 ASN n 
1 342 GLY n 
1 343 LYS n 
1 344 ARG n 
1 345 ILE n 
1 346 ASN n 
1 347 TYR n 
1 348 THR n 
1 349 ILE n 
1 350 ASN n 
1 351 ILE n 
1 352 MET n 
1 353 GLU n 
1 354 LEU n 
1 355 LYS n 
1 356 THR n 
1 357 ASN n 
1 358 GLY n 
1 359 PRO n 
1 360 ARG n 
1 361 LYS n 
1 362 ILE n 
1 363 GLY n 
1 364 TYR n 
1 365 TRP n 
1 366 SER n 
1 367 GLU n 
1 368 VAL n 
1 369 ASP n 
1 370 LYS n 
1 371 MET n 
1 372 VAL n 
1 373 LEU n 
1 374 THR n 
1 375 GLU n 
1 376 ASP n 
1 377 ASP n 
1 378 THR n 
1 379 SER n 
1 380 GLY n 
1 381 LEU n 
1 382 GLU n 
1 383 GLN n 
1 384 LYS n 
1 385 THR n 
1 386 VAL n 
1 387 VAL n 
1 388 VAL n 
1 389 THR n 
1 390 THR n 
1 391 ILE n 
1 392 LEU n 
1 393 GLU n 
1 394 SER n 
1 395 PRO n 
1 396 TYR n 
1 397 VAL n 
1 398 MET n 
1 399 MET n 
1 400 LYS n 
1 401 ALA n 
1 402 ASN n 
1 403 HIS n 
1 404 ALA n 
1 405 ALA n 
1 406 LEU n 
1 407 ALA n 
1 408 GLY n 
1 409 ASN n 
1 410 GLU n 
1 411 ARG n 
1 412 TYR n 
1 413 GLU n 
1 414 GLY n 
1 415 TYR n 
1 416 CYS n 
1 417 VAL n 
1 418 ASP n 
1 419 LEU n 
1 420 ALA n 
1 421 ALA n 
1 422 GLU n 
1 423 ILE n 
1 424 ALA n 
1 425 LYS n 
1 426 HIS n 
1 427 CYS n 
1 428 GLY n 
1 429 PHE n 
1 430 LYS n 
1 431 TYR n 
1 432 LYS n 
1 433 LEU n 
1 434 THR n 
1 435 ILE n 
1 436 VAL n 
1 437 GLY n 
1 438 ASP n 
1 439 GLY n 
1 440 LYS n 
1 441 TYR n 
1 442 GLY n 
1 443 ALA n 
1 444 ARG n 
1 445 ASP n 
1 446 ALA n 
1 447 ASP n 
1 448 THR n 
1 449 LYS n 
1 450 ILE n 
1 451 TRP n 
1 452 ASN n 
1 453 GLY n 
1 454 MET n 
1 455 VAL n 
1 456 GLY n 
1 457 GLU n 
1 458 LEU n 
1 459 VAL n 
1 460 TYR n 
1 461 GLY n 
1 462 LYS n 
1 463 ALA n 
1 464 ASP n 
1 465 ILE n 
1 466 ALA n 
1 467 ILE n 
1 468 ALA n 
1 469 PRO n 
1 470 LEU n 
1 471 THR n 
1 472 ILE n 
1 473 THR n 
1 474 LEU n 
1 475 VAL n 
1 476 ARG n 
1 477 GLU n 
1 478 GLU n 
1 479 VAL n 
1 480 ILE n 
1 481 ASP n 
1 482 PHE n 
1 483 SER n 
1 484 LYS n 
1 485 PRO n 
1 486 PHE n 
1 487 MET n 
1 488 SER n 
1 489 LEU n 
1 490 GLY n 
1 491 ILE n 
1 492 SER n 
1 493 ILE n 
1 494 MET n 
1 495 ILE n 
1 496 LYS n 
1 497 LYS n 
1 498 PRO n 
1 499 GLN n 
1 500 LYS n 
1 501 SER n 
1 502 LYS n 
1 503 PRO n 
1 504 GLY n 
1 505 VAL n 
1 506 PHE n 
1 507 SER n 
1 508 PHE n 
1 509 LEU n 
1 510 ASP n 
1 511 PRO n 
1 512 LEU n 
1 513 ALA n 
1 514 TYR n 
1 515 GLU n 
1 516 ILE n 
1 517 TRP n 
1 518 MET n 
1 519 CYS n 
1 520 ILE n 
1 521 VAL n 
1 522 PHE n 
1 523 ALA n 
1 524 TYR n 
1 525 ILE n 
1 526 GLY n 
1 527 VAL n 
1 528 SER n 
1 529 VAL n 
1 530 VAL n 
1 531 LEU n 
1 532 PHE n 
1 533 LEU n 
1 534 VAL n 
1 535 SER n 
1 536 ARG n 
1 537 PHE n 
1 538 SER n 
1 539 PRO n 
1 540 TYR n 
1 541 GLU n 
1 542 TRP n 
1 543 HIS n 
1 544 THR n 
1 545 GLU n 
1 546 GLU n 
1 547 PHE n 
1 548 GLU n 
1 549 ASP n 
1 550 GLY n 
1 551 ARG n 
1 552 GLU n 
1 553 THR n 
1 554 GLN n 
1 555 SER n 
1 556 SER n 
1 557 GLU n 
1 558 SER n 
1 559 THR n 
1 560 ASN n 
1 561 GLU n 
1 562 PHE n 
1 563 GLY n 
1 564 ILE n 
1 565 PHE n 
1 566 ASN n 
1 567 SER n 
1 568 LEU n 
1 569 TRP n 
1 570 PHE n 
1 571 SER n 
1 572 LEU n 
1 573 GLY n 
1 574 ALA n 
1 575 PHE n 
1 576 MET n 
1 577 GLN n 
1 578 GLN n 
1 579 GLY n 
1 580 ALA n 
1 581 ASP n 
1 582 ILE n 
1 583 SER n 
1 584 PRO n 
1 585 ARG n 
1 586 SER n 
1 587 LEU n 
1 588 SER n 
1 589 GLY n 
1 590 ARG n 
1 591 ILE n 
1 592 VAL n 
1 593 GLY n 
1 594 GLY n 
1 595 VAL n 
1 596 TRP n 
1 597 TRP n 
1 598 PHE n 
1 599 PHE n 
1 600 THR n 
1 601 LEU n 
1 602 ILE n 
1 603 ILE n 
1 604 ILE n 
1 605 SER n 
1 606 SER n 
1 607 TYR n 
1 608 THR n 
1 609 ALA n 
1 610 ASN n 
1 611 LEU n 
1 612 ALA n 
1 613 ALA n 
1 614 PHE n 
1 615 LEU n 
1 616 THR n 
1 617 VAL n 
1 618 GLU n 
1 619 ARG n 
1 620 MET n 
1 621 VAL n 
1 622 SER n 
1 623 PRO n 
1 624 ILE n 
1 625 GLU n 
1 626 SER n 
1 627 ALA n 
1 628 GLU n 
1 629 ASP n 
1 630 LEU n 
1 631 SER n 
1 632 LYS n 
1 633 GLN n 
1 634 THR n 
1 635 GLU n 
1 636 ILE n 
1 637 ALA n 
1 638 TYR n 
1 639 GLY n 
1 640 THR n 
1 641 LEU n 
1 642 ASP n 
1 643 SER n 
1 644 GLY n 
1 645 SER n 
1 646 THR n 
1 647 LYS n 
1 648 GLU n 
1 649 PHE n 
1 650 PHE n 
1 651 ARG n 
1 652 ARG n 
1 653 SER n 
1 654 LYS n 
1 655 ILE n 
1 656 ALA n 
1 657 VAL n 
1 658 PHE n 
1 659 ASP n 
1 660 LYS n 
1 661 MET n 
1 662 TRP n 
1 663 THR n 
1 664 TYR n 
1 665 MET n 
1 666 ARG n 
1 667 SER n 
1 668 ALA n 
1 669 GLU n 
1 670 PRO n 
1 671 SER n 
1 672 VAL n 
1 673 PHE n 
1 674 VAL n 
1 675 ARG n 
1 676 THR n 
1 677 THR n 
1 678 ALA n 
1 679 GLU n 
1 680 GLY n 
1 681 VAL n 
1 682 ALA n 
1 683 ARG n 
1 684 VAL n 
1 685 ARG n 
1 686 LYS n 
1 687 SER n 
1 688 LYS n 
1 689 GLY n 
1 690 LYS n 
1 691 TYR n 
1 692 ALA n 
1 693 TYR n 
1 694 LEU n 
1 695 LEU n 
1 696 GLU n 
1 697 SER n 
1 698 THR n 
1 699 MET n 
1 700 ASN n 
1 701 GLU n 
1 702 TYR n 
1 703 ILE n 
1 704 GLU n 
1 705 GLN n 
1 706 ARG n 
1 707 LYS n 
1 708 PRO n 
1 709 CYS n 
1 710 ASP n 
1 711 THR n 
1 712 MET n 
1 713 LYS n 
1 714 VAL n 
1 715 GLY n 
1 716 GLY n 
1 717 ASN n 
1 718 LEU n 
1 719 ASP n 
1 720 SER n 
1 721 LYS n 
1 722 GLY n 
1 723 TYR n 
1 724 GLY n 
1 725 ILE n 
1 726 ALA n 
1 727 THR n 
1 728 PRO n 
1 729 LYS n 
1 730 GLY n 
1 731 SER n 
1 732 SER n 
1 733 LEU n 
1 734 GLY n 
1 735 THR n 
1 736 PRO n 
1 737 VAL n 
1 738 ASN n 
1 739 LEU n 
1 740 ALA n 
1 741 VAL n 
1 742 LEU n 
1 743 LYS n 
1 744 LEU n 
1 745 SER n 
1 746 GLU n 
1 747 GLN n 
1 748 GLY n 
1 749 LEU n 
1 750 LEU n 
1 751 ASP n 
1 752 LYS n 
1 753 LEU n 
1 754 LYS n 
1 755 ASN n 
1 756 LYS n 
1 757 TRP n 
1 758 TRP n 
1 759 TYR n 
1 760 ASP n 
1 761 LYS n 
1 762 GLY n 
1 763 GLU n 
1 764 CYS n 
1 765 GLY n 
1 766 ALA n 
1 767 LYS n 
1 768 ASP n 
1 769 SER n 
1 770 GLY n 
1 771 SER n 
1 772 LYS n 
1 773 GLU n 
1 774 LYS n 
1 775 THR n 
1 776 SER n 
1 777 ALA n 
1 778 LEU n 
1 779 SER n 
1 780 LEU n 
1 781 SER n 
1 782 ASN n 
1 783 VAL n 
1 784 ALA n 
1 785 GLY n 
1 786 VAL n 
1 787 PHE n 
1 788 TYR n 
1 789 ILE n 
1 790 LEU n 
1 791 VAL n 
1 792 GLY n 
1 793 GLY n 
1 794 LEU n 
1 795 GLY n 
1 796 LEU n 
1 797 ALA n 
1 798 MET n 
1 799 LEU n 
1 800 VAL n 
1 801 ALA n 
1 802 LEU n 
1 803 ILE n 
1 804 GLU n 
1 805 PHE n 
1 806 CYS n 
1 807 TYR n 
1 808 LYS n 
1 809 SER n 
1 810 ARG n 
1 811 ALA n 
1 812 GLU n 
1 813 ALA n 
1 814 LYS n 
1 815 ARG n 
1 816 MET n 
1 817 LYS n 
1 818 GLY n 
1 819 LEU n 
1 820 VAL n 
1 821 PRO n 
1 822 ARG n 
1 823 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               rat 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Gria2, Glur2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               pFastBac1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GRIA2_RAT 
_struct_ref.pdbx_db_accession          P19491 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFC
GTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNIN
NDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVD
YDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEI
ERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILES
PYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITL
VREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQ
SSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQT
EIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKV
GGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGL
GLAMLVALIEFCYKSRAEAKRMK
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KG2 A 1 ? 817 ? P19491 25 ? 847 ? 10 826 
2 1 3KG2 B 1 ? 817 ? P19491 25 ? 847 ? 10 826 
3 1 3KG2 C 1 ? 817 ? P19491 25 ? 847 ? 10 826 
4 1 3KG2 D 1 ? 817 ? P19491 25 ? 847 ? 10 826 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KG2 GLU A 232 ? UNP P19491 ASN 256 'engineered mutation' 241 1  
1 3KG2 ?   A ?   ? UNP P19491 VAL 397 deletion              ?   2  
1 3KG2 ?   A ?   ? UNP P19491 THR 398 deletion              ?   3  
1 3KG2 ?   A ?   ? UNP P19491 LEU 402 deletion              ?   4  
1 3KG2 ?   A ?   ? UNP P19491 PRO 403 deletion              ?   5  
1 3KG2 ?   A ?   ? UNP P19491 SER 404 deletion              ?   6  
1 3KG2 ?   A ?   ? UNP P19491 GLY 405 deletion              ?   7  
1 3KG2 ASP A 376 ? UNP P19491 ASN 406 'engineered mutation' 385 8  
1 3KG2 GLN A 383 ? UNP P19491 ASN 413 'engineered mutation' 392 9  
1 3KG2 ALA A 401 ? UNP P19491 LYS 431 'engineered mutation' 410 10 
1 3KG2 ALA A 404 ? UNP P19491 GLU 434 'engineered mutation' 413 11 
1 3KG2 ALA A 405 ? UNP P19491 MET 435 'engineered mutation' 414 12 
1 3KG2 ALA A 407 ? UNP P19491 GLU 437 'engineered mutation' 416 13 
1 3KG2 ALA A 580 ? UNP P19491 CYS 610 'engineered mutation' 589 14 
1 3KG2 THR A 735 ? UNP P19491 ASN 765 variant               744 15 
1 3KG2 PRO A 736 ? UNP P19491 ALA 766 variant               745 16 
1 3KG2 SER A 745 ? UNP P19491 ASN 775 variant               754 17 
2 3KG2 GLU B 232 ? UNP P19491 ASN 256 'engineered mutation' 241 18 
2 3KG2 ?   B ?   ? UNP P19491 VAL 397 deletion              ?   19 
2 3KG2 ?   B ?   ? UNP P19491 THR 398 deletion              ?   20 
2 3KG2 ?   B ?   ? UNP P19491 LEU 402 deletion              ?   21 
2 3KG2 ?   B ?   ? UNP P19491 PRO 403 deletion              ?   22 
2 3KG2 ?   B ?   ? UNP P19491 SER 404 deletion              ?   23 
2 3KG2 ?   B ?   ? UNP P19491 GLY 405 deletion              ?   24 
2 3KG2 ASP B 376 ? UNP P19491 ASN 406 'engineered mutation' 385 25 
2 3KG2 GLN B 383 ? UNP P19491 ASN 413 'engineered mutation' 392 26 
2 3KG2 ALA B 401 ? UNP P19491 LYS 431 'engineered mutation' 410 27 
2 3KG2 ALA B 404 ? UNP P19491 GLU 434 'engineered mutation' 413 28 
2 3KG2 ALA B 405 ? UNP P19491 MET 435 'engineered mutation' 414 29 
2 3KG2 ALA B 407 ? UNP P19491 GLU 437 'engineered mutation' 416 30 
2 3KG2 ALA B 580 ? UNP P19491 CYS 610 'engineered mutation' 589 31 
2 3KG2 THR B 735 ? UNP P19491 ASN 765 variant               744 32 
2 3KG2 PRO B 736 ? UNP P19491 ALA 766 variant               745 33 
2 3KG2 SER B 745 ? UNP P19491 ASN 775 variant               754 34 
3 3KG2 GLU C 232 ? UNP P19491 ASN 256 'engineered mutation' 241 35 
3 3KG2 ?   C ?   ? UNP P19491 VAL 397 deletion              ?   36 
3 3KG2 ?   C ?   ? UNP P19491 THR 398 deletion              ?   37 
3 3KG2 ?   C ?   ? UNP P19491 LEU 402 deletion              ?   38 
3 3KG2 ?   C ?   ? UNP P19491 PRO 403 deletion              ?   39 
3 3KG2 ?   C ?   ? UNP P19491 SER 404 deletion              ?   40 
3 3KG2 ?   C ?   ? UNP P19491 GLY 405 deletion              ?   41 
3 3KG2 ASP C 376 ? UNP P19491 ASN 406 'engineered mutation' 385 42 
3 3KG2 GLN C 383 ? UNP P19491 ASN 413 'engineered mutation' 392 43 
3 3KG2 ALA C 401 ? UNP P19491 LYS 431 'engineered mutation' 410 44 
3 3KG2 ALA C 404 ? UNP P19491 GLU 434 'engineered mutation' 413 45 
3 3KG2 ALA C 405 ? UNP P19491 MET 435 'engineered mutation' 414 46 
3 3KG2 ALA C 407 ? UNP P19491 GLU 437 'engineered mutation' 416 47 
3 3KG2 ALA C 580 ? UNP P19491 CYS 610 'engineered mutation' 589 48 
3 3KG2 THR C 735 ? UNP P19491 ASN 765 variant               744 49 
3 3KG2 PRO C 736 ? UNP P19491 ALA 766 variant               745 50 
3 3KG2 SER C 745 ? UNP P19491 ASN 775 variant               754 51 
4 3KG2 GLU D 232 ? UNP P19491 ASN 256 'engineered mutation' 241 52 
4 3KG2 ?   D ?   ? UNP P19491 VAL 397 deletion              ?   53 
4 3KG2 ?   D ?   ? UNP P19491 THR 398 deletion              ?   54 
4 3KG2 ?   D ?   ? UNP P19491 LEU 402 deletion              ?   55 
4 3KG2 ?   D ?   ? UNP P19491 PRO 403 deletion              ?   56 
4 3KG2 ?   D ?   ? UNP P19491 SER 404 deletion              ?   57 
4 3KG2 ?   D ?   ? UNP P19491 GLY 405 deletion              ?   58 
4 3KG2 ASP D 376 ? UNP P19491 ASN 406 'engineered mutation' 385 59 
4 3KG2 GLN D 383 ? UNP P19491 ASN 413 'engineered mutation' 392 60 
4 3KG2 ALA D 401 ? UNP P19491 LYS 431 'engineered mutation' 410 61 
4 3KG2 ALA D 404 ? UNP P19491 GLU 434 'engineered mutation' 413 62 
4 3KG2 ALA D 405 ? UNP P19491 MET 435 'engineered mutation' 414 63 
4 3KG2 ALA D 407 ? UNP P19491 GLU 437 'engineered mutation' 416 64 
4 3KG2 ALA D 580 ? UNP P19491 CYS 610 'engineered mutation' 589 65 
4 3KG2 THR D 735 ? UNP P19491 ASN 765 variant               744 66 
4 3KG2 PRO D 736 ? UNP P19491 ALA 766 variant               745 67 
4 3KG2 SER D 745 ? UNP P19491 ASN 775 variant               754 68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6'          180.156 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'      149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'        221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'        117.146 
ZK1 non-polymer                  . 
'{[7-morpholin-4-yl-2,3-dioxo-6-(trifluoromethyl)-3,4-dihydroquinoxalin-1(2H)-yl]methyl}phosphonic acid' 
'[[3,4-Dihydro-7-(4-morpholinyl)-2,3-dioxo-6-(trifluorom ethyl)-1(2H)-quinoxalinyl]methyl]phosphonic acid' 'C14 H15 F3 N3 O6 P' 
409.254 
# 
_exptl.entry_id          3KG2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.25 
_exptl_crystal.density_percent_sol   71.08 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   6.0-6.5 
_exptl_crystal_grow.pdbx_details    'Under paraffin oil, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-04-18 
_diffrn_detector.details                
'VERTICALLY COLLIMATING PREMIRROR, LN2 COOLED DOUBLE- CRYSTAL SILICON (111) MONOCHROMATOR, TOROIDAL FOCUSING M2 MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE-CRYSTAL, SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             1.0000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3KG2 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.600 
_reflns.number_obs                   69301 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.111 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.2 
_reflns.B_iso_Wilson_estimate        136.41 
_reflns.pdbx_redundancy              9.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.6 
_reflns_shell.d_res_low              3.73 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.981 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.08 
_reflns_shell.pdbx_redundancy        9.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3KG2 
_refine.ls_number_reflns_obs                     69301 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.960 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.89 
_refine.ls_d_res_high                            3.60 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.287 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.286 
_refine.ls_R_factor_R_free                       0.296 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.030 
_refine.ls_number_reflns_R_free                  3483 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               192.72 
_refine.aniso_B[1][1]                            -15.62790 
_refine.aniso_B[2][2]                            14.59740 
_refine.aniso_B[3][3]                            1.03040 
_refine.aniso_B[1][2]                            -1.42520 
_refine.aniso_B[1][3]                            35.07380 
_refine.aniso_B[2][3]                            -13.36310 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.21 
_refine.solvent_model_param_bsol                 58.87 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entries 3H5V and 1FTL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.010 
_refine.pdbx_overall_phase_error                 33.290 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        22400 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         286 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               22686 
_refine_hist.d_res_high                       3.60 
_refine_hist.d_res_low                        49.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002 ? ? 23200 'X-RAY DIFFRACTION' ? 
f_angle_d          0.442 ? ? 31770 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 9.696 ? ? 7414  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.027 ? ? 3788  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.002 ? ? 4032  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2209 ?     ? POSITIONAL 1  1  'X-RAY DIFFRACTION' ? ? ? 
2 B 2209 0.005 ? POSITIONAL 1  2  'X-RAY DIFFRACTION' ? ? ? 
3 C 2209 0.004 ? POSITIONAL 1  3  'X-RAY DIFFRACTION' ? ? ? 
4 D 2209 0.004 ? POSITIONAL 1  4  'X-RAY DIFFRACTION' ? ? ? 
1 A 28   ?     ? POSITIONAL 2  5  'X-RAY DIFFRACTION' ? ? ? 
2 D 28   0.003 ? POSITIONAL 2  6  'X-RAY DIFFRACTION' ? ? ? 
1 B 28   ?     ? POSITIONAL 3  7  'X-RAY DIFFRACTION' ? ? ? 
2 C 28   0.004 ? POSITIONAL 3  8  'X-RAY DIFFRACTION' ? ? ? 
1 A 498  ?     ? POSITIONAL 4  9  'X-RAY DIFFRACTION' ? ? ? 
2 B 498  0.005 ? POSITIONAL 4  10 'X-RAY DIFFRACTION' ? ? ? 
3 C 498  0.004 ? POSITIONAL 4  11 'X-RAY DIFFRACTION' ? ? ? 
4 D 498  0.004 ? POSITIONAL 4  12 'X-RAY DIFFRACTION' ? ? ? 
1 A 793  ?     ? POSITIONAL 5  13 'X-RAY DIFFRACTION' ? ? ? 
2 B 793  0.004 ? POSITIONAL 5  14 'X-RAY DIFFRACTION' ? ? ? 
3 C 793  0.004 ? POSITIONAL 5  15 'X-RAY DIFFRACTION' ? ? ? 
4 D 793  0.004 ? POSITIONAL 5  16 'X-RAY DIFFRACTION' ? ? ? 
1 A 254  ?     ? POSITIONAL 6  17 'X-RAY DIFFRACTION' ? ? ? 
2 B 254  0.002 ? POSITIONAL 6  18 'X-RAY DIFFRACTION' ? ? ? 
3 C 254  0.003 ? POSITIONAL 6  19 'X-RAY DIFFRACTION' ? ? ? 
4 D 254  0.003 ? POSITIONAL 6  20 'X-RAY DIFFRACTION' ? ? ? 
1 A 310  ?     ? POSITIONAL 7  21 'X-RAY DIFFRACTION' ? ? ? 
2 B 310  0.007 ? POSITIONAL 7  22 'X-RAY DIFFRACTION' ? ? ? 
3 C 310  0.006 ? POSITIONAL 7  23 'X-RAY DIFFRACTION' ? ? ? 
4 D 310  0.006 ? POSITIONAL 7  24 'X-RAY DIFFRACTION' ? ? ? 
1 A 95   ?     ? POSITIONAL 8  25 'X-RAY DIFFRACTION' ? ? ? 
2 C 95   0.133 ? POSITIONAL 8  26 'X-RAY DIFFRACTION' ? ? ? 
1 B 95   ?     ? POSITIONAL 9  27 'X-RAY DIFFRACTION' ? ? ? 
2 D 95   0.022 ? POSITIONAL 9  28 'X-RAY DIFFRACTION' ? ? ? 
1 A 995  ?     ? POSITIONAL 10 29 'X-RAY DIFFRACTION' ? ? ? 
2 B 995  0.005 ? POSITIONAL 10 30 'X-RAY DIFFRACTION' ? ? ? 
3 C 995  0.004 ? POSITIONAL 10 31 'X-RAY DIFFRACTION' ? ? ? 
4 D 995  0.004 ? POSITIONAL 10 32 'X-RAY DIFFRACTION' ? ? ? 
1 A 29   ?     ? POSITIONAL 11 33 'X-RAY DIFFRACTION' ? ? ? 
2 B 29   0.023 ? POSITIONAL 11 34 'X-RAY DIFFRACTION' ? ? ? 
3 C 29   0.007 ? POSITIONAL 11 35 'X-RAY DIFFRACTION' ? ? ? 
4 D 29   0.013 ? POSITIONAL 11 36 'X-RAY DIFFRACTION' ? ? ? 
1 A 217  ?     ? POSITIONAL 12 37 'X-RAY DIFFRACTION' ? ? ? 
2 B 217  0.003 ? POSITIONAL 12 38 'X-RAY DIFFRACTION' ? ? ? 
3 C 217  0.004 ? POSITIONAL 12 39 'X-RAY DIFFRACTION' ? ? ? 
4 D 217  0.004 ? POSITIONAL 12 40 'X-RAY DIFFRACTION' ? ? ? 
1 A 27   ?     ? POSITIONAL 13 41 'X-RAY DIFFRACTION' ? ? ? 
2 B 27   0.003 ? POSITIONAL 13 42 'X-RAY DIFFRACTION' ? ? ? 
3 C 27   0.003 ? POSITIONAL 13 43 'X-RAY DIFFRACTION' ? ? ? 
4 D 27   0.002 ? POSITIONAL 13 44 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.6029  3.6523  2574 0.4000 94.00  0.4564 . . 127 . . . . 
'X-RAY DIFFRACTION' . 3.6523  3.7044  2589 0.3898 100.00 0.4355 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.7044  3.7597  2669 0.3732 99.00  0.3651 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.7597  3.8184  2647 0.3718 99.00  0.3459 . . 133 . . . . 
'X-RAY DIFFRACTION' . 3.8184  3.8810  2623 0.3667 99.00  0.3863 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.8810  3.9479  2653 0.3662 98.00  0.3608 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.9479  4.0197  2586 0.3523 99.00  0.3646 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.0197  4.0969  2605 0.3375 98.00  0.2790 . . 153 . . . . 
'X-RAY DIFFRACTION' . 4.0969  4.1805  2601 0.3256 98.00  0.3299 . . 133 . . . . 
'X-RAY DIFFRACTION' . 4.1805  4.2714  2612 0.3207 98.00  0.3472 . . 168 . . . . 
'X-RAY DIFFRACTION' . 4.2714  4.3707  2626 0.2952 99.00  0.3240 . . 127 . . . . 
'X-RAY DIFFRACTION' . 4.3707  4.4799  2616 0.2918 99.00  0.3025 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.4799  4.6010  2661 0.2788 99.00  0.2891 . . 135 . . . . 
'X-RAY DIFFRACTION' . 4.6010  4.7363  2625 0.2786 99.00  0.3202 . . 132 . . . . 
'X-RAY DIFFRACTION' . 4.7363  4.8890  2615 0.2631 99.00  0.3309 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.8890  5.0636  2669 0.2669 99.00  0.2687 . . 145 . . . . 
'X-RAY DIFFRACTION' . 5.0636  5.2661  2613 0.2728 99.00  0.2830 . . 151 . . . . 
'X-RAY DIFFRACTION' . 5.2661  5.5055  2650 0.2789 100.00 0.2868 . . 144 . . . . 
'X-RAY DIFFRACTION' . 5.5055  5.7953  2667 0.2807 100.00 0.2639 . . 132 . . . . 
'X-RAY DIFFRACTION' . 5.7953  6.1578  2679 0.2859 100.00 0.2812 . . 124 . . . . 
'X-RAY DIFFRACTION' . 6.1578  6.6323  2664 0.2536 100.00 0.2980 . . 127 . . . . 
'X-RAY DIFFRACTION' . 6.6323  7.2979  2656 0.2547 100.00 0.2882 . . 143 . . . . 
'X-RAY DIFFRACTION' . 7.2979  8.3496  2670 0.2288 100.00 0.2441 . . 142 . . . . 
'X-RAY DIFFRACTION' . 8.3496  10.5035 2667 0.1980 100.00 0.2075 . . 138 . . . . 
'X-RAY DIFFRACTION' . 10.5035 49.8923 2581 0.3009 97.00  0.2758 . . 139 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1  
2 ? 1  
3 ? 1  
4 ? 1  
1 ? 2  
2 ? 2  
1 ? 3  
2 ? 3  
1 ? 4  
2 ? 4  
3 ? 4  
4 ? 4  
1 ? 5  
2 ? 5  
3 ? 5  
4 ? 5  
1 ? 6  
2 ? 6  
3 ? 6  
4 ? 6  
1 ? 7  
2 ? 7  
3 ? 7  
4 ? 7  
1 ? 8  
2 ? 8  
1 ? 9  
2 ? 9  
1 ? 10 
2 ? 10 
3 ? 10 
4 ? 10 
1 ? 11 
2 ? 11 
3 ? 11 
4 ? 11 
1 ? 12 
2 ? 12 
3 ? 12 
4 ? 12 
1 ? 13 
2 ? 13 
3 ? 13 
4 ? 13 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain A and resid 10:306'  
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain B and resid 10:306'  
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain C and resid 10:306'  
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain D and resid 10:306'  
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain A and resid 307:311' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain D and resid 307:311' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain B and resid 307:311' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain C and resid 307:311' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain A and resid 312:381' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain B and resid 312:381' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain C and resid 312:381' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain D and resid 312:381' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain A and resid 396:503' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain B and resid 396:503' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain C and resid 396:503' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain D and resid 396:503' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain A and resid 513:544' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain B and resid 513:544' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain C and resid 513:544' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain D and resid 513:544' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain A and resid 568:621' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain B and resid 568:621' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain C and resid 568:621' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain D and resid 568:621' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain A and resid 622:634' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain C and resid 622:634' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain B and resid 622:634' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain D and resid 622:634' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain A and resid 635:773' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain B and resid 635:773' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain C and resid 635:773' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain D and resid 635:773' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain A and resid 775:780' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain B and resid 775:780' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain C and resid 775:780' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain D and resid 775:780' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain A and resid 788:817' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain B and resid 788:817' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain C and resid 788:817' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain D and resid 788:817' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain A and resid 818'     
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain B and resid 818'     
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain C and resid 818'     
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain D and resid 818'     
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
# 
_struct.entry_id                  3KG2 
_struct.title                     'AMPA subtype ionotropic glutamate receptor in complex with competitive antagonist ZK 200775' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KG2 
_struct_keywords.pdbx_keywords   'membrane protein, transport protein' 
_struct_keywords.text            
;ion channel, membrane protein, Cell membrane, Glycoprotein, Ion transport, Membrane, Postsynaptic cell membrane, Receptor, RNA editing, Synapse, Transmembrane, Transport, tetramer, transport protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ALA A 13  ? PHE A 27  ? ALA A 22  PHE A 36  1 ? 15 
HELX_P HELX_P2   2   ASN A 45  ? ARG A 59  ? ASN A 54  ARG A 68  1 ? 15 
HELX_P HELX_P3   3   SER A 72  ? LEU A 83  ? SER A 81  LEU A 92  1 ? 12 
HELX_P HELX_P4   4   LEU A 108 ? TYR A 119 ? LEU A 117 TYR A 128 1 ? 12 
HELX_P HELX_P5   5   SER A 130 ? GLY A 133 ? SER A 139 GLY A 142 5 ? 4  
HELX_P HELX_P6   6   LEU A 134 ? LYS A 147 ? LEU A 143 LYS A 156 1 ? 14 
HELX_P HELX_P7   7   SER A 170 ? LEU A 175 ? SER A 179 LEU A 184 1 ? 6  
HELX_P HELX_P8   8   GLU A 188 ? GLY A 203 ? GLU A 197 GLY A 212 1 ? 16 
HELX_P HELX_P9   9   ASP A 243 ? SER A 254 ? ASP A 252 SER A 263 1 ? 12 
HELX_P HELX_P10  10  LYS A 270 ? LYS A 292 ? LYS A 279 LYS A 301 1 ? 23 
HELX_P HELX_P11  11  GLY A 315 ? LYS A 325 ? GLY A 324 LYS A 334 1 ? 11 
HELX_P HELX_P12  12  ASN A 402 ? LEU A 406 ? ASN A 411 LEU A 415 5 ? 5  
HELX_P HELX_P13  13  ALA A 407 ? GLU A 410 ? ALA A 416 GLU A 419 5 ? 4  
HELX_P HELX_P14  14  GLY A 414 ? GLY A 428 ? GLY A 423 GLY A 437 1 ? 15 
HELX_P HELX_P15  15  ASN A 452 ? TYR A 460 ? ASN A 461 TYR A 469 1 ? 9  
HELX_P HELX_P16  16  THR A 473 ? GLU A 478 ? THR A 482 GLU A 487 1 ? 6  
HELX_P HELX_P17  17  GLY A 504 ? PHE A 508 ? GLY A 513 PHE A 517 5 ? 5  
HELX_P HELX_P18  18  ALA A 513 ? VAL A 529 ? ALA A 522 VAL A 538 1 ? 17 
HELX_P HELX_P19  19  VAL A 530 ? VAL A 534 ? VAL A 539 VAL A 543 5 ? 5  
HELX_P HELX_P20  20  THR A 559 ? SER A 571 ? THR A 568 SER A 580 1 ? 13 
HELX_P HELX_P21  21  SER A 586 ? VAL A 621 ? SER A 595 VAL A 630 1 ? 36 
HELX_P HELX_P22  22  ALA A 627 ? GLN A 633 ? ALA A 636 GLN A 642 1 ? 7  
HELX_P HELX_P23  23  GLY A 644 ? SER A 653 ? GLY A 653 SER A 662 1 ? 10 
HELX_P HELX_P24  24  ILE A 655 ? ALA A 668 ? ILE A 664 ALA A 677 1 ? 14 
HELX_P HELX_P25  25  THR A 676 ? LYS A 686 ? THR A 685 LYS A 695 1 ? 11 
HELX_P HELX_P26  26  SER A 697 ? GLN A 705 ? SER A 706 GLN A 714 1 ? 9  
HELX_P HELX_P27  27  LEU A 733 ? GLN A 747 ? LEU A 742 GLN A 756 1 ? 15 
HELX_P HELX_P28  28  GLY A 748 ? TYR A 759 ? GLY A 757 TYR A 768 1 ? 12 
HELX_P HELX_P29  29  LEU A 780 ? LYS A 808 ? LEU A 789 LYS A 817 1 ? 29 
HELX_P HELX_P30  30  ALA B 13  ? PHE B 27  ? ALA B 22  PHE B 36  1 ? 15 
HELX_P HELX_P31  31  ASN B 45  ? ARG B 59  ? ASN B 54  ARG B 68  1 ? 15 
HELX_P HELX_P32  32  SER B 72  ? LEU B 83  ? SER B 81  LEU B 92  1 ? 12 
HELX_P HELX_P33  33  LEU B 108 ? TYR B 119 ? LEU B 117 TYR B 128 1 ? 12 
HELX_P HELX_P34  34  SER B 130 ? GLY B 133 ? SER B 139 GLY B 142 5 ? 4  
HELX_P HELX_P35  35  LEU B 134 ? LYS B 147 ? LEU B 143 LYS B 156 1 ? 14 
HELX_P HELX_P36  36  SER B 170 ? LEU B 175 ? SER B 179 LEU B 184 1 ? 6  
HELX_P HELX_P37  37  GLU B 188 ? GLY B 203 ? GLU B 197 GLY B 212 1 ? 16 
HELX_P HELX_P38  38  ASP B 243 ? SER B 254 ? ASP B 252 SER B 263 1 ? 12 
HELX_P HELX_P39  39  LYS B 270 ? LYS B 292 ? LYS B 279 LYS B 301 1 ? 23 
HELX_P HELX_P40  40  GLY B 315 ? LYS B 325 ? GLY B 324 LYS B 334 1 ? 11 
HELX_P HELX_P41  41  ASN B 402 ? LEU B 406 ? ASN B 411 LEU B 415 5 ? 5  
HELX_P HELX_P42  42  ALA B 407 ? GLU B 410 ? ALA B 416 GLU B 419 5 ? 4  
HELX_P HELX_P43  43  GLY B 414 ? GLY B 428 ? GLY B 423 GLY B 437 1 ? 15 
HELX_P HELX_P44  44  ASN B 452 ? TYR B 460 ? ASN B 461 TYR B 469 1 ? 9  
HELX_P HELX_P45  45  THR B 473 ? GLU B 478 ? THR B 482 GLU B 487 1 ? 6  
HELX_P HELX_P46  46  GLY B 504 ? PHE B 508 ? GLY B 513 PHE B 517 5 ? 5  
HELX_P HELX_P47  47  ALA B 513 ? VAL B 529 ? ALA B 522 VAL B 538 1 ? 17 
HELX_P HELX_P48  48  VAL B 530 ? VAL B 534 ? VAL B 539 VAL B 543 5 ? 5  
HELX_P HELX_P49  49  THR B 559 ? SER B 571 ? THR B 568 SER B 580 1 ? 13 
HELX_P HELX_P50  50  SER B 586 ? VAL B 617 ? SER B 595 VAL B 626 1 ? 32 
HELX_P HELX_P51  51  ALA B 627 ? GLN B 633 ? ALA B 636 GLN B 642 1 ? 7  
HELX_P HELX_P52  52  GLY B 644 ? SER B 653 ? GLY B 653 SER B 662 1 ? 10 
HELX_P HELX_P53  53  ILE B 655 ? ALA B 668 ? ILE B 664 ALA B 677 1 ? 14 
HELX_P HELX_P54  54  THR B 676 ? LYS B 686 ? THR B 685 LYS B 695 1 ? 11 
HELX_P HELX_P55  55  SER B 697 ? GLN B 705 ? SER B 706 GLN B 714 1 ? 9  
HELX_P HELX_P56  56  LEU B 733 ? GLN B 747 ? LEU B 742 GLN B 756 1 ? 15 
HELX_P HELX_P57  57  GLY B 748 ? TYR B 759 ? GLY B 757 TYR B 768 1 ? 12 
HELX_P HELX_P58  58  GLY B 765 ? GLY B 770 ? GLY B 774 GLY B 779 1 ? 6  
HELX_P HELX_P59  59  LEU B 780 ? LYS B 808 ? LEU B 789 LYS B 817 1 ? 29 
HELX_P HELX_P60  60  ALA C 13  ? PHE C 27  ? ALA C 22  PHE C 36  1 ? 15 
HELX_P HELX_P61  61  ASN C 45  ? ARG C 59  ? ASN C 54  ARG C 68  1 ? 15 
HELX_P HELX_P62  62  SER C 72  ? LEU C 83  ? SER C 81  LEU C 92  1 ? 12 
HELX_P HELX_P63  63  LEU C 108 ? TYR C 119 ? LEU C 117 TYR C 128 1 ? 12 
HELX_P HELX_P64  64  SER C 130 ? GLY C 133 ? SER C 139 GLY C 142 5 ? 4  
HELX_P HELX_P65  65  LEU C 134 ? LYS C 147 ? LEU C 143 LYS C 156 1 ? 14 
HELX_P HELX_P66  66  SER C 170 ? LEU C 175 ? SER C 179 LEU C 184 1 ? 6  
HELX_P HELX_P67  67  GLU C 188 ? GLY C 203 ? GLU C 197 GLY C 212 1 ? 16 
HELX_P HELX_P68  68  ASP C 243 ? SER C 254 ? ASP C 252 SER C 263 1 ? 12 
HELX_P HELX_P69  69  LYS C 270 ? LYS C 292 ? LYS C 279 LYS C 301 1 ? 23 
HELX_P HELX_P70  70  GLY C 315 ? LYS C 325 ? GLY C 324 LYS C 334 1 ? 11 
HELX_P HELX_P71  71  ASN C 402 ? LEU C 406 ? ASN C 411 LEU C 415 5 ? 5  
HELX_P HELX_P72  72  ALA C 407 ? GLU C 410 ? ALA C 416 GLU C 419 5 ? 4  
HELX_P HELX_P73  73  GLY C 414 ? GLY C 428 ? GLY C 423 GLY C 437 1 ? 15 
HELX_P HELX_P74  74  ASN C 452 ? TYR C 460 ? ASN C 461 TYR C 469 1 ? 9  
HELX_P HELX_P75  75  THR C 473 ? GLU C 478 ? THR C 482 GLU C 487 1 ? 6  
HELX_P HELX_P76  76  GLY C 504 ? PHE C 508 ? GLY C 513 PHE C 517 5 ? 5  
HELX_P HELX_P77  77  ALA C 513 ? VAL C 529 ? ALA C 522 VAL C 538 1 ? 17 
HELX_P HELX_P78  78  VAL C 530 ? VAL C 534 ? VAL C 539 VAL C 543 5 ? 5  
HELX_P HELX_P79  79  THR C 559 ? SER C 571 ? THR C 568 SER C 580 1 ? 13 
HELX_P HELX_P80  80  SER C 586 ? VAL C 621 ? SER C 595 VAL C 630 1 ? 36 
HELX_P HELX_P81  81  ALA C 627 ? GLN C 633 ? ALA C 636 GLN C 642 1 ? 7  
HELX_P HELX_P82  82  GLY C 644 ? SER C 653 ? GLY C 653 SER C 662 1 ? 10 
HELX_P HELX_P83  83  ILE C 655 ? ALA C 668 ? ILE C 664 ALA C 677 1 ? 14 
HELX_P HELX_P84  84  THR C 676 ? LYS C 686 ? THR C 685 LYS C 695 1 ? 11 
HELX_P HELX_P85  85  SER C 697 ? GLN C 705 ? SER C 706 GLN C 714 1 ? 9  
HELX_P HELX_P86  86  LEU C 733 ? GLN C 747 ? LEU C 742 GLN C 756 1 ? 15 
HELX_P HELX_P87  87  GLY C 748 ? TYR C 759 ? GLY C 757 TYR C 768 1 ? 12 
HELX_P HELX_P88  88  GLY C 765 ? GLY C 770 ? GLY C 774 GLY C 779 1 ? 6  
HELX_P HELX_P89  89  LEU C 780 ? LYS C 808 ? LEU C 789 LYS C 817 1 ? 29 
HELX_P HELX_P90  90  ALA D 13  ? PHE D 27  ? ALA D 22  PHE D 36  1 ? 15 
HELX_P HELX_P91  91  ASN D 45  ? ARG D 59  ? ASN D 54  ARG D 68  1 ? 15 
HELX_P HELX_P92  92  SER D 72  ? LEU D 83  ? SER D 81  LEU D 92  1 ? 12 
HELX_P HELX_P93  93  LEU D 108 ? TYR D 119 ? LEU D 117 TYR D 128 1 ? 12 
HELX_P HELX_P94  94  SER D 130 ? GLY D 133 ? SER D 139 GLY D 142 5 ? 4  
HELX_P HELX_P95  95  LEU D 134 ? LYS D 147 ? LEU D 143 LYS D 156 1 ? 14 
HELX_P HELX_P96  96  SER D 170 ? LEU D 175 ? SER D 179 LEU D 184 1 ? 6  
HELX_P HELX_P97  97  GLU D 188 ? GLY D 203 ? GLU D 197 GLY D 212 1 ? 16 
HELX_P HELX_P98  98  ASP D 243 ? SER D 254 ? ASP D 252 SER D 263 1 ? 12 
HELX_P HELX_P99  99  LYS D 270 ? LYS D 292 ? LYS D 279 LYS D 301 1 ? 23 
HELX_P HELX_P100 100 GLY D 315 ? LYS D 325 ? GLY D 324 LYS D 334 1 ? 11 
HELX_P HELX_P101 101 THR D 378 ? GLU D 382 ? THR D 387 GLU D 391 5 ? 5  
HELX_P HELX_P102 102 ASN D 402 ? LEU D 406 ? ASN D 411 LEU D 415 5 ? 5  
HELX_P HELX_P103 103 ALA D 407 ? GLU D 410 ? ALA D 416 GLU D 419 5 ? 4  
HELX_P HELX_P104 104 GLY D 414 ? GLY D 428 ? GLY D 423 GLY D 437 1 ? 15 
HELX_P HELX_P105 105 ASN D 452 ? TYR D 460 ? ASN D 461 TYR D 469 1 ? 9  
HELX_P HELX_P106 106 THR D 473 ? GLU D 478 ? THR D 482 GLU D 487 1 ? 6  
HELX_P HELX_P107 107 GLY D 504 ? PHE D 508 ? GLY D 513 PHE D 517 5 ? 5  
HELX_P HELX_P108 108 ALA D 513 ? VAL D 529 ? ALA D 522 VAL D 538 1 ? 17 
HELX_P HELX_P109 109 VAL D 530 ? VAL D 534 ? VAL D 539 VAL D 543 5 ? 5  
HELX_P HELX_P110 110 THR D 559 ? SER D 571 ? THR D 568 SER D 580 1 ? 13 
HELX_P HELX_P111 111 SER D 586 ? VAL D 617 ? SER D 595 VAL D 626 1 ? 32 
HELX_P HELX_P112 112 ALA D 627 ? GLN D 633 ? ALA D 636 GLN D 642 1 ? 7  
HELX_P HELX_P113 113 GLY D 644 ? SER D 653 ? GLY D 653 SER D 662 1 ? 10 
HELX_P HELX_P114 114 ILE D 655 ? ALA D 668 ? ILE D 664 ALA D 677 1 ? 14 
HELX_P HELX_P115 115 THR D 676 ? LYS D 686 ? THR D 685 LYS D 695 1 ? 11 
HELX_P HELX_P116 116 SER D 697 ? GLN D 705 ? SER D 706 GLN D 714 1 ? 9  
HELX_P HELX_P117 117 LEU D 733 ? GLN D 747 ? LEU D 742 GLN D 756 1 ? 15 
HELX_P HELX_P118 118 GLY D 748 ? TYR D 759 ? GLY D 757 TYR D 768 1 ? 12 
HELX_P HELX_P119 119 GLY D 765 ? GLY D 770 ? GLY D 774 GLY D 779 1 ? 6  
HELX_P HELX_P120 120 LEU D 780 ? LYS D 808 ? LEU D 789 LYS D 817 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 54  SG  ? ? ? 1_555 A CYS 306 SG ? ? A CYS 63  A CYS 315 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf2  disulf ?    ? A CYS 709 SG  ? ? ? 1_555 A CYS 764 SG ? ? A CYS 718 A CYS 773 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf3  disulf ?    ? B CYS 54  SG  ? ? ? 1_555 B CYS 306 SG ? ? B CYS 63  B CYS 315 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4  disulf ?    ? B CYS 709 SG  ? ? ? 1_555 B CYS 764 SG ? ? B CYS 718 B CYS 773 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf5  disulf ?    ? C CYS 54  SG  ? ? ? 1_555 C CYS 306 SG ? ? C CYS 63  C CYS 315 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf6  disulf ?    ? C CYS 709 SG  ? ? ? 1_555 C CYS 764 SG ? ? C CYS 718 C CYS 773 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf7  disulf ?    ? D CYS 54  SG  ? ? ? 1_555 D CYS 306 SG ? ? D CYS 63  D CYS 315 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf8  disulf ?    ? D CYS 709 SG  ? ? ? 1_555 D CYS 764 SG ? ? D CYS 718 D CYS 773 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
covale1  covale one  ? A ASN 346 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 355 E NAG 1   1_555 ? ? ? ? ? ? ? 1.464 ? N-Glycosylation 
covale2  covale one  ? B ASN 346 ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 355 F NAG 1   1_555 ? ? ? ? ? ? ? 1.463 ? N-Glycosylation 
covale3  covale one  ? C ASN 346 ND2 ? ? ? 1_555 G NAG .   C1 ? ? C ASN 355 G NAG 1   1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale4  covale one  ? D ASN 346 ND2 ? ? ? 1_555 H NAG .   C1 ? ? D ASN 355 H NAG 1   1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation 
covale5  covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale6  covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? E NAG 2   E BMA 3   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale7  covale both ? E BMA .   O3  ? ? ? 1_555 E BMA .   C1 ? ? E BMA 3   E BMA 4   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale8  covale both ? F NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale9  covale both ? F NAG .   O4  ? ? ? 1_555 F BMA .   C1 ? ? F NAG 2   F BMA 3   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale10 covale both ? F BMA .   O3  ? ? ? 1_555 F BMA .   C1 ? ? F BMA 3   F BMA 4   1_555 ? ? ? ? ? ? ? 1.450 ? ?               
covale11 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.453 ? ?               
covale12 covale both ? G NAG .   O4  ? ? ? 1_555 G BMA .   C1 ? ? G NAG 2   G BMA 3   1_555 ? ? ? ? ? ? ? 1.450 ? ?               
covale13 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale14 covale both ? H NAG .   O4  ? ? ? 1_555 H BMA .   C1 ? ? H NAG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.450 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 309 A . ? ASN 318 A PRO 310 A ? PRO 319 A 1 0.06  
2  SER 394 A . ? SER 403 A PRO 395 A ? PRO 404 A 1 -0.68 
3  GLU 669 A . ? GLU 678 A PRO 670 A ? PRO 679 A 1 -1.10 
4  LYS 707 A . ? LYS 716 A PRO 708 A ? PRO 717 A 1 -0.27 
5  ASN 309 B . ? ASN 318 B PRO 310 B ? PRO 319 B 1 0.08  
6  SER 394 B . ? SER 403 B PRO 395 B ? PRO 404 B 1 -0.66 
7  GLU 669 B . ? GLU 678 B PRO 670 B ? PRO 679 B 1 -1.12 
8  LYS 707 B . ? LYS 716 B PRO 708 B ? PRO 717 B 1 -0.43 
9  ASN 309 C . ? ASN 318 C PRO 310 C ? PRO 319 C 1 0.10  
10 SER 394 C . ? SER 403 C PRO 395 C ? PRO 404 C 1 -0.47 
11 GLU 669 C . ? GLU 678 C PRO 670 C ? PRO 679 C 1 -1.08 
12 LYS 707 C . ? LYS 716 C PRO 708 C ? PRO 717 C 1 -0.43 
13 ASN 309 D . ? ASN 318 D PRO 310 D ? PRO 319 D 1 0.06  
14 SER 394 D . ? SER 403 D PRO 395 D ? PRO 404 D 1 -0.66 
15 GLU 669 D . ? GLU 678 D PRO 670 D ? PRO 679 D 1 -1.14 
16 LYS 707 D . ? LYS 716 D PRO 708 D ? PRO 717 D 1 -0.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 8 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 2 ? 
F  ? 2 ? 
G  ? 2 ? 
H  ? 4 ? 
I  ? 5 ? 
J  ? 8 ? 
K  ? 2 ? 
L  ? 3 ? 
M  ? 2 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 8 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 4 ? 
X  ? 5 ? 
Y  ? 8 ? 
Z  ? 2 ? 
AA ? 3 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
B  1 2 ? parallel      
B  2 3 ? parallel      
B  3 4 ? parallel      
B  4 5 ? parallel      
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
B  7 8 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? parallel      
D  2 3 ? parallel      
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? parallel      
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? parallel      
I  2 3 ? parallel      
I  3 4 ? parallel      
I  4 5 ? parallel      
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
J  4 5 ? parallel      
J  5 6 ? anti-parallel 
J  6 7 ? anti-parallel 
J  7 8 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? parallel      
L  2 3 ? parallel      
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? parallel      
Q  2 3 ? parallel      
Q  3 4 ? parallel      
Q  4 5 ? parallel      
R  1 2 ? parallel      
R  2 3 ? parallel      
R  3 4 ? parallel      
R  4 5 ? parallel      
R  5 6 ? anti-parallel 
R  6 7 ? anti-parallel 
R  7 8 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? parallel      
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? parallel      
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? parallel      
X  2 3 ? parallel      
X  3 4 ? parallel      
X  4 5 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Y  5 6 ? anti-parallel 
Y  6 7 ? anti-parallel 
Y  7 8 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG A 33  ? LEU A 41  ? ARG A 42  LEU A 50  
A  2 SER A 2   ? PRO A 10  ? SER A 11  PRO A 19  
A  3 ALA A 63  ? GLY A 66  ? ALA A 72  GLY A 75  
A  4 SER A 86  ? THR A 89  ? SER A 95  THR A 98  
A  5 VAL A 101 ? GLN A 103 ? VAL A 110 GLN A 112 
B  1 GLN A 150 ? ASN A 155 ? GLN A 159 ASN A 164 
B  2 LYS A 123 ? TYR A 128 ? LYS A 132 TYR A 137 
B  3 ARG A 182 ? ASP A 186 ? ARG A 191 ASP A 195 
B  4 HIS A 210 ? ILE A 213 ? HIS A 219 ILE A 222 
B  5 GLU A 232 ? GLN A 237 ? GLU A 241 GLN A 246 
B  6 THR A 348 ? LEU A 354 ? THR A 357 LEU A 363 
B  7 PRO A 359 ? SER A 366 ? PRO A 368 SER A 375 
B  8 LYS A 370 ? LEU A 373 ? LYS A 379 LEU A 382 
C  1 GLU A 330 ? GLY A 331 ? GLU A 339 GLY A 340 
C  2 GLY A 334 ? ASN A 335 ? GLY A 343 ASN A 344 
D  1 TYR A 431 ? ILE A 435 ? TYR A 440 ILE A 444 
D  2 VAL A 386 ? THR A 390 ? VAL A 395 THR A 399 
D  3 ILE A 465 ? ALA A 466 ? ILE A 474 ALA A 475 
E  1 MET A 398 ? MET A 399 ? MET A 407 MET A 408 
E  2 TYR A 412 ? GLU A 413 ? TYR A 421 GLU A 422 
F  1 ILE A 480 ? PHE A 482 ? ILE A 489 PHE A 491 
F  2 ALA A 726 ? PRO A 728 ? ALA A 735 PRO A 737 
G  1 MET A 487 ? LEU A 489 ? MET A 496 LEU A 498 
G  2 LYS A 721 ? TYR A 723 ? LYS A 730 TYR A 732 
H  1 ALA A 637 ? GLY A 639 ? ALA A 646 GLY A 648 
H  2 TYR A 691 ? GLU A 696 ? TYR A 700 GLU A 705 
H  3 ILE A 491 ? LYS A 496 ? ILE A 500 LYS A 505 
H  4 THR A 711 ? VAL A 714 ? THR A 720 VAL A 723 
I  1 ARG B 33  ? LEU B 41  ? ARG B 42  LEU B 50  
I  2 SER B 2   ? PRO B 10  ? SER B 11  PRO B 19  
I  3 ALA B 63  ? GLY B 66  ? ALA B 72  GLY B 75  
I  4 SER B 86  ? THR B 89  ? SER B 95  THR B 98  
I  5 VAL B 101 ? GLN B 103 ? VAL B 110 GLN B 112 
J  1 GLN B 150 ? ASN B 155 ? GLN B 159 ASN B 164 
J  2 LYS B 123 ? TYR B 128 ? LYS B 132 TYR B 137 
J  3 ARG B 182 ? ASP B 186 ? ARG B 191 ASP B 195 
J  4 HIS B 210 ? ILE B 213 ? HIS B 219 ILE B 222 
J  5 GLU B 232 ? GLN B 237 ? GLU B 241 GLN B 246 
J  6 THR B 348 ? LEU B 354 ? THR B 357 LEU B 363 
J  7 PRO B 359 ? SER B 366 ? PRO B 368 SER B 375 
J  8 LYS B 370 ? LEU B 373 ? LYS B 379 LEU B 382 
K  1 GLU B 330 ? GLY B 331 ? GLU B 339 GLY B 340 
K  2 GLY B 334 ? ASN B 335 ? GLY B 343 ASN B 344 
L  1 TYR B 431 ? ILE B 435 ? TYR B 440 ILE B 444 
L  2 VAL B 386 ? THR B 390 ? VAL B 395 THR B 399 
L  3 ILE B 465 ? ALA B 466 ? ILE B 474 ALA B 475 
M  1 MET B 398 ? MET B 399 ? MET B 407 MET B 408 
M  2 TYR B 412 ? GLU B 413 ? TYR B 421 GLU B 422 
N  1 ILE B 480 ? PHE B 482 ? ILE B 489 PHE B 491 
N  2 ALA B 726 ? PRO B 728 ? ALA B 735 PRO B 737 
O  1 MET B 487 ? LEU B 489 ? MET B 496 LEU B 498 
O  2 LYS B 721 ? TYR B 723 ? LYS B 730 TYR B 732 
P  1 ALA B 637 ? GLY B 639 ? ALA B 646 GLY B 648 
P  2 TYR B 691 ? GLU B 696 ? TYR B 700 GLU B 705 
P  3 ILE B 491 ? LYS B 496 ? ILE B 500 LYS B 505 
P  4 THR B 711 ? VAL B 714 ? THR B 720 VAL B 723 
Q  1 ARG C 33  ? LEU C 41  ? ARG C 42  LEU C 50  
Q  2 SER C 2   ? PRO C 10  ? SER C 11  PRO C 19  
Q  3 ALA C 63  ? GLY C 66  ? ALA C 72  GLY C 75  
Q  4 SER C 86  ? THR C 89  ? SER C 95  THR C 98  
Q  5 VAL C 101 ? GLN C 103 ? VAL C 110 GLN C 112 
R  1 GLN C 150 ? ASN C 155 ? GLN C 159 ASN C 164 
R  2 LYS C 123 ? TYR C 128 ? LYS C 132 TYR C 137 
R  3 ARG C 182 ? ASP C 186 ? ARG C 191 ASP C 195 
R  4 HIS C 210 ? ILE C 213 ? HIS C 219 ILE C 222 
R  5 GLU C 232 ? GLN C 237 ? GLU C 241 GLN C 246 
R  6 THR C 348 ? LEU C 354 ? THR C 357 LEU C 363 
R  7 PRO C 359 ? SER C 366 ? PRO C 368 SER C 375 
R  8 LYS C 370 ? LEU C 373 ? LYS C 379 LEU C 382 
S  1 GLU C 330 ? GLY C 331 ? GLU C 339 GLY C 340 
S  2 GLY C 334 ? ASN C 335 ? GLY C 343 ASN C 344 
T  1 TYR C 431 ? ILE C 435 ? TYR C 440 ILE C 444 
T  2 VAL C 386 ? THR C 390 ? VAL C 395 THR C 399 
T  3 ILE C 465 ? ALA C 466 ? ILE C 474 ALA C 475 
U  1 MET C 398 ? MET C 399 ? MET C 407 MET C 408 
U  2 TYR C 412 ? GLU C 413 ? TYR C 421 GLU C 422 
V  1 ILE C 480 ? PHE C 482 ? ILE C 489 PHE C 491 
V  2 ALA C 726 ? PRO C 728 ? ALA C 735 PRO C 737 
W  1 ALA C 637 ? GLY C 639 ? ALA C 646 GLY C 648 
W  2 TYR C 691 ? GLU C 696 ? TYR C 700 GLU C 705 
W  3 ILE C 491 ? LYS C 496 ? ILE C 500 LYS C 505 
W  4 THR C 711 ? VAL C 714 ? THR C 720 VAL C 723 
X  1 ARG D 33  ? LEU D 41  ? ARG D 42  LEU D 50  
X  2 SER D 2   ? PRO D 10  ? SER D 11  PRO D 19  
X  3 ALA D 63  ? GLY D 66  ? ALA D 72  GLY D 75  
X  4 SER D 86  ? THR D 89  ? SER D 95  THR D 98  
X  5 VAL D 101 ? GLN D 103 ? VAL D 110 GLN D 112 
Y  1 GLN D 150 ? ASN D 155 ? GLN D 159 ASN D 164 
Y  2 LYS D 123 ? TYR D 128 ? LYS D 132 TYR D 137 
Y  3 ARG D 182 ? ASP D 186 ? ARG D 191 ASP D 195 
Y  4 HIS D 210 ? ILE D 213 ? HIS D 219 ILE D 222 
Y  5 GLU D 232 ? GLN D 237 ? GLU D 241 GLN D 246 
Y  6 THR D 348 ? LEU D 354 ? THR D 357 LEU D 363 
Y  7 PRO D 359 ? SER D 366 ? PRO D 368 SER D 375 
Y  8 LYS D 370 ? LEU D 373 ? LYS D 379 LEU D 382 
Z  1 GLU D 330 ? GLY D 331 ? GLU D 339 GLY D 340 
Z  2 GLY D 334 ? ASN D 335 ? GLY D 343 ASN D 344 
AA 1 TYR D 431 ? ILE D 435 ? TYR D 440 ILE D 444 
AA 2 VAL D 386 ? THR D 390 ? VAL D 395 THR D 399 
AA 3 ILE D 465 ? ALA D 466 ? ILE D 474 ALA D 475 
AB 1 MET D 398 ? MET D 399 ? MET D 407 MET D 408 
AB 2 TYR D 412 ? GLU D 413 ? TYR D 421 GLU D 422 
AC 1 ILE D 480 ? PHE D 482 ? ILE D 489 PHE D 491 
AC 2 ALA D 726 ? PRO D 728 ? ALA D 735 PRO D 737 
AD 1 MET D 487 ? LEU D 489 ? MET D 496 LEU D 498 
AD 2 LYS D 721 ? TYR D 723 ? LYS D 730 TYR D 732 
AE 1 ALA D 637 ? GLY D 639 ? ALA D 646 GLY D 648 
AE 2 TYR D 691 ? GLU D 696 ? TYR D 700 GLU D 705 
AE 3 ILE D 491 ? LYS D 496 ? ILE D 500 LYS D 505 
AE 4 THR D 711 ? VAL D 714 ? THR D 720 VAL D 723 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ASP A 39  ? O ASP A 48  N GLY A 7   ? N GLY A 16  
A  2 3 N GLY A 6   ? N GLY A 15  O PHE A 65  ? O PHE A 74  
A  3 4 N ILE A 64  ? N ILE A 73  O SER A 86  ? O SER A 95  
A  4 5 N THR A 89  ? N THR A 98  O ILE A 102 ? O ILE A 111 
B  1 2 O ILE A 154 ? O ILE A 163 N TYR A 126 ? N TYR A 135 
B  2 3 N ALA A 125 ? N ALA A 134 O ARG A 182 ? O ARG A 191 
B  3 4 N LEU A 185 ? N LEU A 194 O ILE A 212 ? O ILE A 221 
B  4 5 N TYR A 211 ? N TYR A 220 O SER A 234 ? O SER A 243 
B  5 6 N GLN A 237 ? N GLN A 246 O ASN A 350 ? O ASN A 359 
B  6 7 N ILE A 351 ? N ILE A 360 O GLY A 363 ? O GLY A 372 
B  7 8 N SER A 366 ? N SER A 375 O LYS A 370 ? O LYS A 379 
C  1 2 N GLY A 331 ? N GLY A 340 O GLY A 334 ? O GLY A 343 
D  1 2 O THR A 434 ? O THR A 443 N VAL A 388 ? N VAL A 397 
D  2 3 N THR A 389 ? N THR A 398 O ILE A 465 ? O ILE A 474 
E  1 2 N MET A 398 ? N MET A 407 O GLU A 413 ? O GLU A 422 
F  1 2 N ASP A 481 ? N ASP A 490 O THR A 727 ? O THR A 736 
G  1 2 N LEU A 489 ? N LEU A 498 O LYS A 721 ? O LYS A 730 
H  1 2 N ALA A 637 ? N ALA A 646 O ALA A 692 ? O ALA A 701 
H  2 3 O LEU A 695 ? O LEU A 704 N SER A 492 ? N SER A 501 
H  3 4 N ILE A 495 ? N ILE A 504 O MET A 712 ? O MET A 721 
I  1 2 O ASP B 39  ? O ASP B 48  N GLY B 7   ? N GLY B 16  
I  2 3 N GLY B 6   ? N GLY B 15  O PHE B 65  ? O PHE B 74  
I  3 4 N ILE B 64  ? N ILE B 73  O ILE B 88  ? O ILE B 97  
I  4 5 N THR B 89  ? N THR B 98  O ILE B 102 ? O ILE B 111 
J  1 2 O ILE B 154 ? O ILE B 163 N TYR B 126 ? N TYR B 135 
J  2 3 N ALA B 125 ? N ALA B 134 O ARG B 182 ? O ARG B 191 
J  3 4 N LEU B 185 ? N LEU B 194 O ILE B 212 ? O ILE B 221 
J  4 5 N TYR B 211 ? N TYR B 220 O SER B 234 ? O SER B 243 
J  5 6 N VAL B 233 ? N VAL B 242 O LEU B 354 ? O LEU B 363 
J  6 7 N ILE B 351 ? N ILE B 360 O GLY B 363 ? O GLY B 372 
J  7 8 N SER B 366 ? N SER B 375 O LYS B 370 ? O LYS B 379 
K  1 2 N GLY B 331 ? N GLY B 340 O GLY B 334 ? O GLY B 343 
L  1 2 O THR B 434 ? O THR B 443 N VAL B 388 ? N VAL B 397 
L  2 3 N THR B 389 ? N THR B 398 O ILE B 465 ? O ILE B 474 
M  1 2 N MET B 398 ? N MET B 407 O GLU B 413 ? O GLU B 422 
N  1 2 N ASP B 481 ? N ASP B 490 O THR B 727 ? O THR B 736 
O  1 2 N LEU B 489 ? N LEU B 498 O LYS B 721 ? O LYS B 730 
P  1 2 N ALA B 637 ? N ALA B 646 O ALA B 692 ? O ALA B 701 
P  2 3 O LEU B 695 ? O LEU B 704 N SER B 492 ? N SER B 501 
P  3 4 N ILE B 495 ? N ILE B 504 O MET B 712 ? O MET B 721 
Q  1 2 O ASP C 39  ? O ASP C 48  N GLY C 7   ? N GLY C 16  
Q  2 3 N GLY C 6   ? N GLY C 15  O PHE C 65  ? O PHE C 74  
Q  3 4 N ILE C 64  ? N ILE C 73  O ILE C 88  ? O ILE C 97  
Q  4 5 N THR C 89  ? N THR C 98  O ILE C 102 ? O ILE C 111 
R  1 2 O ILE C 154 ? O ILE C 163 N TYR C 126 ? N TYR C 135 
R  2 3 N ALA C 125 ? N ALA C 134 O ARG C 182 ? O ARG C 191 
R  3 4 N LEU C 185 ? N LEU C 194 O ILE C 212 ? O ILE C 221 
R  4 5 N TYR C 211 ? N TYR C 220 O SER C 234 ? O SER C 243 
R  5 6 N VAL C 233 ? N VAL C 242 O LEU C 354 ? O LEU C 363 
R  6 7 N ILE C 351 ? N ILE C 360 O GLY C 363 ? O GLY C 372 
R  7 8 N SER C 366 ? N SER C 375 O LYS C 370 ? O LYS C 379 
S  1 2 N GLY C 331 ? N GLY C 340 O GLY C 334 ? O GLY C 343 
T  1 2 O THR C 434 ? O THR C 443 N VAL C 388 ? N VAL C 397 
T  2 3 N THR C 389 ? N THR C 398 O ILE C 465 ? O ILE C 474 
U  1 2 N MET C 398 ? N MET C 407 O GLU C 413 ? O GLU C 422 
V  1 2 N ASP C 481 ? N ASP C 490 O THR C 727 ? O THR C 736 
W  1 2 N ALA C 637 ? N ALA C 646 O ALA C 692 ? O ALA C 701 
W  2 3 O LEU C 695 ? O LEU C 704 N SER C 492 ? N SER C 501 
W  3 4 N ILE C 495 ? N ILE C 504 O MET C 712 ? O MET C 721 
X  1 2 O ASP D 39  ? O ASP D 48  N GLY D 7   ? N GLY D 16  
X  2 3 N GLY D 6   ? N GLY D 15  O PHE D 65  ? O PHE D 74  
X  3 4 N ILE D 64  ? N ILE D 73  O ILE D 88  ? O ILE D 97  
X  4 5 N THR D 89  ? N THR D 98  O ILE D 102 ? O ILE D 111 
Y  1 2 O ILE D 154 ? O ILE D 163 N TYR D 126 ? N TYR D 135 
Y  2 3 N LEU D 127 ? N LEU D 136 O ASP D 186 ? O ASP D 195 
Y  3 4 N LEU D 185 ? N LEU D 194 O ILE D 212 ? O ILE D 221 
Y  4 5 N TYR D 211 ? N TYR D 220 O SER D 234 ? O SER D 243 
Y  5 6 N GLN D 237 ? N GLN D 246 O ASN D 350 ? O ASN D 359 
Y  6 7 N ILE D 351 ? N ILE D 360 O GLY D 363 ? O GLY D 372 
Y  7 8 N SER D 366 ? N SER D 375 O LYS D 370 ? O LYS D 379 
Z  1 2 N GLY D 331 ? N GLY D 340 O GLY D 334 ? O GLY D 343 
AA 1 2 O THR D 434 ? O THR D 443 N VAL D 388 ? N VAL D 397 
AA 2 3 N THR D 389 ? N THR D 398 O ILE D 465 ? O ILE D 474 
AB 1 2 N MET D 398 ? N MET D 407 O GLU D 413 ? O GLU D 422 
AC 1 2 N ASP D 481 ? N ASP D 490 O THR D 727 ? O THR D 736 
AD 1 2 N LEU D 489 ? N LEU D 498 O LYS D 721 ? O LYS D 730 
AE 1 2 N ALA D 637 ? N ALA D 646 O ALA D 692 ? O ALA D 701 
AE 2 3 O LEU D 695 ? O LEU D 704 N SER D 492 ? N SER D 501 
AE 3 4 N ILE D 493 ? N ILE D 502 O VAL D 714 ? O VAL D 723 
# 
_database_PDB_matrix.entry_id          3KG2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KG2 
_atom_sites.fract_transf_matrix[1][1]   0.011024 
_atom_sites.fract_transf_matrix[1][2]   -0.002159 
_atom_sites.fract_transf_matrix[1][3]   -0.000873 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009276 
_atom_sites.fract_transf_matrix[2][3]   -0.000609 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006246 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASN A 1 1   ? -69.207 -37.729 -11.841  1.00 235.75 ? 10  ASN A N   1 
ATOM   2     C CA  . ASN A 1 1   ? -68.463 -36.493 -11.628  1.00 231.08 ? 10  ASN A CA  1 
ATOM   3     C C   . ASN A 1 1   ? -68.781 -35.449 -12.693  1.00 226.28 ? 10  ASN A C   1 
ATOM   4     O O   . ASN A 1 1   ? -68.261 -35.506 -13.807  1.00 224.02 ? 10  ASN A O   1 
ATOM   5     C CB  . ASN A 1 1   ? -66.957 -36.768 -11.596  1.00 230.46 ? 10  ASN A CB  1 
ATOM   6     C CG  . ASN A 1 1   ? -66.546 -37.655 -10.434  1.00 235.36 ? 10  ASN A CG  1 
ATOM   7     O OD1 . ASN A 1 1   ? -65.369 -37.726 -10.082  1.00 235.45 ? 10  ASN A OD1 1 
ATOM   8     N ND2 . ASN A 1 1   ? -67.516 -38.334 -9.832   1.00 239.81 ? 10  ASN A ND2 1 
ATOM   9     N N   . SER A 1 2   ? -69.639 -34.496 -12.344  1.00 297.28 ? 11  SER A N   1 
ATOM   10    C CA  . SER A 1 2   ? -70.043 -33.450 -13.277  1.00 293.30 ? 11  SER A CA  1 
ATOM   11    C C   . SER A 1 2   ? -69.485 -32.089 -12.870  1.00 289.40 ? 11  SER A C   1 
ATOM   12    O O   . SER A 1 2   ? -69.920 -31.500 -11.880  1.00 290.15 ? 11  SER A O   1 
ATOM   13    C CB  . SER A 1 2   ? -71.569 -33.384 -13.377  1.00 295.36 ? 11  SER A CB  1 
ATOM   14    O OG  . SER A 1 2   ? -71.979 -32.383 -14.293  1.00 292.02 ? 11  SER A OG  1 
ATOM   15    N N   . ILE A 1 3   ? -68.520 -31.596 -13.642  1.00 188.60 ? 12  ILE A N   1 
ATOM   16    C CA  . ILE A 1 3   ? -67.905 -30.302 -13.369  1.00 184.99 ? 12  ILE A CA  1 
ATOM   17    C C   . ILE A 1 3   ? -68.455 -29.224 -14.296  1.00 181.67 ? 12  ILE A C   1 
ATOM   18    O O   . ILE A 1 3   ? -68.142 -29.196 -15.487  1.00 179.43 ? 12  ILE A O   1 
ATOM   19    C CB  . ILE A 1 3   ? -66.375 -30.362 -13.522  1.00 183.13 ? 12  ILE A CB  1 
ATOM   20    C CG1 . ILE A 1 3   ? -65.795 -31.474 -12.647  1.00 186.94 ? 12  ILE A CG1 1 
ATOM   21    C CG2 . ILE A 1 3   ? -65.751 -29.021 -13.167  1.00 179.93 ? 12  ILE A CG2 1 
ATOM   22    C CD1 . ILE A 1 3   ? -64.293 -31.612 -12.752  1.00 185.87 ? 12  ILE A CD1 1 
ATOM   23    N N   . GLN A 1 4   ? -69.274 -28.336 -13.743  1.00 248.83 ? 13  GLN A N   1 
ATOM   24    C CA  . GLN A 1 4   ? -69.885 -27.267 -14.523  1.00 246.36 ? 13  GLN A CA  1 
ATOM   25    C C   . GLN A 1 4   ? -68.930 -26.091 -14.709  1.00 242.35 ? 13  GLN A C   1 
ATOM   26    O O   . GLN A 1 4   ? -68.351 -25.589 -13.745  1.00 242.12 ? 13  GLN A O   1 
ATOM   27    C CB  . GLN A 1 4   ? -71.182 -26.794 -13.860  1.00 248.57 ? 13  GLN A CB  1 
ATOM   28    N N   . ILE A 1 5   ? -68.768 -25.658 -15.956  1.00 153.10 ? 14  ILE A N   1 
ATOM   29    C CA  . ILE A 1 5   ? -67.916 -24.518 -16.268  1.00 149.42 ? 14  ILE A CA  1 
ATOM   30    C C   . ILE A 1 5   ? -68.646 -23.521 -17.163  1.00 147.78 ? 14  ILE A C   1 
ATOM   31    O O   . ILE A 1 5   ? -69.622 -23.868 -17.829  1.00 149.18 ? 14  ILE A O   1 
ATOM   32    C CB  . ILE A 1 5   ? -66.613 -24.956 -16.960  1.00 147.45 ? 14  ILE A CB  1 
ATOM   33    C CG1 . ILE A 1 5   ? -66.923 -25.654 -18.286  1.00 147.48 ? 14  ILE A CG1 1 
ATOM   34    C CG2 . ILE A 1 5   ? -65.807 -25.867 -16.048  1.00 149.39 ? 14  ILE A CG2 1 
ATOM   35    C CD1 . ILE A 1 5   ? -65.692 -26.113 -19.035  1.00 145.87 ? 14  ILE A CD1 1 
ATOM   36    N N   . GLY A 1 6   ? -68.166 -22.282 -17.174  1.00 145.43 ? 15  GLY A N   1 
ATOM   37    C CA  . GLY A 1 6   ? -68.767 -21.239 -17.984  1.00 144.08 ? 15  GLY A CA  1 
ATOM   38    C C   . GLY A 1 6   ? -68.032 -21.028 -19.294  1.00 141.19 ? 15  GLY A C   1 
ATOM   39    O O   . GLY A 1 6   ? -66.823 -21.242 -19.380  1.00 139.47 ? 15  GLY A O   1 
ATOM   40    N N   . GLY A 1 7   ? -68.767 -20.605 -20.317  1.00 169.42 ? 16  GLY A N   1 
ATOM   41    C CA  . GLY A 1 7   ? -68.185 -20.357 -21.622  1.00 167.06 ? 16  GLY A CA  1 
ATOM   42    C C   . GLY A 1 7   ? -68.672 -19.058 -22.234  1.00 166.18 ? 16  GLY A C   1 
ATOM   43    O O   . GLY A 1 7   ? -69.813 -18.964 -22.686  1.00 168.07 ? 16  GLY A O   1 
ATOM   44    N N   . LEU A 1 8   ? -67.803 -18.052 -22.248  1.00 134.16 ? 17  LEU A N   1 
ATOM   45    C CA  . LEU A 1 8   ? -68.146 -16.751 -22.811  1.00 133.47 ? 17  LEU A CA  1 
ATOM   46    C C   . LEU A 1 8   ? -67.557 -16.579 -24.207  1.00 131.50 ? 17  LEU A C   1 
ATOM   47    O O   . LEU A 1 8   ? -66.406 -16.171 -24.360  1.00 129.11 ? 17  LEU A O   1 
ATOM   48    C CB  . LEU A 1 8   ? -67.670 -15.620 -21.894  1.00 132.59 ? 17  LEU A CB  1 
ATOM   49    C CG  . LEU A 1 8   ? -68.513 -15.330 -20.648  1.00 135.02 ? 17  LEU A CG  1 
ATOM   50    C CD1 . LEU A 1 8   ? -68.554 -16.530 -19.715  1.00 136.57 ? 17  LEU A CD1 1 
ATOM   51    C CD2 . LEU A 1 8   ? -67.985 -14.103 -19.920  1.00 134.35 ? 17  LEU A CD2 1 
ATOM   52    N N   . PHE A 1 9   ? -68.354 -16.891 -25.224  1.00 131.23 ? 18  PHE A N   1 
ATOM   53    C CA  . PHE A 1 9   ? -67.911 -16.786 -26.608  1.00 129.95 ? 18  PHE A CA  1 
ATOM   54    C C   . PHE A 1 9   ? -68.545 -15.596 -27.317  1.00 130.46 ? 18  PHE A C   1 
ATOM   55    O O   . PHE A 1 9   ? -69.768 -15.510 -27.422  1.00 133.13 ? 18  PHE A O   1 
ATOM   56    C CB  . PHE A 1 9   ? -68.232 -18.073 -27.369  1.00 131.54 ? 18  PHE A CB  1 
ATOM   57    C CG  . PHE A 1 9   ? -67.369 -19.238 -26.983  1.00 130.96 ? 18  PHE A CG  1 
ATOM   58    C CD1 . PHE A 1 9   ? -66.331 -19.649 -27.804  1.00 129.40 ? 18  PHE A CD1 1 
ATOM   59    C CD2 . PHE A 1 9   ? -67.592 -19.920 -25.799  1.00 132.33 ? 18  PHE A CD2 1 
ATOM   60    C CE1 . PHE A 1 9   ? -65.533 -20.721 -27.453  1.00 129.32 ? 18  PHE A CE1 1 
ATOM   61    C CE2 . PHE A 1 9   ? -66.798 -20.992 -25.442  1.00 132.27 ? 18  PHE A CE2 1 
ATOM   62    C CZ  . PHE A 1 9   ? -65.767 -21.393 -26.271  1.00 130.81 ? 18  PHE A CZ  1 
ATOM   63    N N   . PRO A 1 10  ? -67.707 -14.672 -27.808  1.00 128.88 ? 19  PRO A N   1 
ATOM   64    C CA  . PRO A 1 10  ? -68.177 -13.504 -28.560  1.00 129.50 ? 19  PRO A CA  1 
ATOM   65    C C   . PRO A 1 10  ? -68.870 -13.929 -29.849  1.00 131.39 ? 19  PRO A C   1 
ATOM   66    O O   . PRO A 1 10  ? -68.379 -14.822 -30.539  1.00 130.81 ? 19  PRO A O   1 
ATOM   67    C CB  . PRO A 1 10  ? -66.881 -12.754 -28.889  1.00 126.64 ? 19  PRO A CB  1 
ATOM   68    C CG  . PRO A 1 10  ? -65.885 -13.242 -27.890  1.00 124.84 ? 19  PRO A CG  1 
ATOM   69    C CD  . PRO A 1 10  ? -66.245 -14.669 -27.639  1.00 126.02 ? 19  PRO A CD  1 
ATOM   70    N N   . ARG A 1 11  ? -69.997 -13.298 -30.162  1.00 175.70 ? 20  ARG A N   1 
ATOM   71    C CA  . ARG A 1 11  ? -70.733 -13.611 -31.381  1.00 178.18 ? 20  ARG A CA  1 
ATOM   72    C C   . ARG A 1 11  ? -69.826 -13.509 -32.604  1.00 176.52 ? 20  ARG A C   1 
ATOM   73    O O   . ARG A 1 11  ? -69.307 -12.437 -32.918  1.00 175.19 ? 20  ARG A O   1 
ATOM   74    C CB  . ARG A 1 11  ? -71.938 -12.681 -31.534  1.00 181.37 ? 20  ARG A CB  1 
ATOM   75    N N   . GLY A 1 12  ? -69.635 -14.632 -33.288  1.00 154.01 ? 21  GLY A N   1 
ATOM   76    C CA  . GLY A 1 12  ? -68.779 -14.674 -34.459  1.00 152.78 ? 21  GLY A CA  1 
ATOM   77    C C   . GLY A 1 12  ? -67.609 -15.624 -34.286  1.00 150.33 ? 21  GLY A C   1 
ATOM   78    O O   . GLY A 1 12  ? -66.903 -15.937 -35.245  1.00 149.70 ? 21  GLY A O   1 
ATOM   79    N N   . ALA A 1 13  ? -67.403 -16.081 -33.055  1.00 139.98 ? 22  ALA A N   1 
ATOM   80    C CA  . ALA A 1 13  ? -66.325 -17.017 -32.755  1.00 138.17 ? 22  ALA A CA  1 
ATOM   81    C C   . ALA A 1 13  ? -66.726 -18.440 -33.128  1.00 140.52 ? 22  ALA A C   1 
ATOM   82    O O   . ALA A 1 13  ? -66.806 -19.319 -32.270  1.00 141.13 ? 22  ALA A O   1 
ATOM   83    C CB  . ALA A 1 13  ? -65.945 -16.938 -31.285  1.00 136.70 ? 22  ALA A CB  1 
ATOM   84    N N   . ASP A 1 14  ? -66.976 -18.656 -34.415  1.00 159.64 ? 23  ASP A N   1 
ATOM   85    C CA  . ASP A 1 14  ? -67.412 -19.958 -34.905  1.00 162.51 ? 23  ASP A CA  1 
ATOM   86    C C   . ASP A 1 14  ? -66.314 -21.009 -34.780  1.00 161.37 ? 23  ASP A C   1 
ATOM   87    O O   . ASP A 1 14  ? -66.496 -22.030 -34.119  1.00 162.70 ? 23  ASP A O   1 
ATOM   88    C CB  . ASP A 1 14  ? -67.881 -19.852 -36.358  1.00 164.91 ? 23  ASP A CB  1 
ATOM   89    C CG  . ASP A 1 14  ? -69.083 -18.939 -36.517  1.00 167.02 ? 23  ASP A CG  1 
ATOM   90    O OD1 . ASP A 1 14  ? -69.645 -18.508 -35.488  1.00 166.90 ? 23  ASP A OD1 1 
ATOM   91    O OD2 . ASP A 1 14  ? -69.467 -18.653 -37.672  1.00 169.15 ? 23  ASP A OD2 1 
ATOM   92    N N   . GLN A 1 15  ? -65.175 -20.755 -35.417  1.00 152.29 ? 24  GLN A N   1 
ATOM   93    C CA  . GLN A 1 15  ? -64.065 -21.701 -35.390  1.00 151.51 ? 24  GLN A CA  1 
ATOM   94    C C   . GLN A 1 15  ? -63.547 -21.905 -33.971  1.00 149.89 ? 24  GLN A C   1 
ATOM   95    O O   . GLN A 1 15  ? -63.114 -22.999 -33.611  1.00 150.72 ? 24  GLN A O   1 
ATOM   96    C CB  . GLN A 1 15  ? -62.928 -21.236 -36.303  1.00 149.56 ? 24  GLN A CB  1 
ATOM   97    C CG  . GLN A 1 15  ? -61.831 -22.273 -36.491  1.00 149.51 ? 24  GLN A CG  1 
ATOM   98    C CD  . GLN A 1 15  ? -60.667 -21.754 -37.313  1.00 147.62 ? 24  GLN A CD  1 
ATOM   99    O OE1 . GLN A 1 15  ? -60.329 -20.572 -37.257  1.00 145.29 ? 24  GLN A OE1 1 
ATOM   100   N NE2 . GLN A 1 15  ? -60.043 -22.642 -38.078  1.00 148.91 ? 24  GLN A NE2 1 
ATOM   101   N N   . GLU A 1 16  ? -63.591 -20.847 -33.170  1.00 128.70 ? 25  GLU A N   1 
ATOM   102   C CA  . GLU A 1 16  ? -63.156 -20.926 -31.782  1.00 127.53 ? 25  GLU A CA  1 
ATOM   103   C C   . GLU A 1 16  ? -64.033 -21.896 -30.998  1.00 130.10 ? 25  GLU A C   1 
ATOM   104   O O   . GLU A 1 16  ? -63.532 -22.724 -30.238  1.00 130.43 ? 25  GLU A O   1 
ATOM   105   C CB  . GLU A 1 16  ? -63.177 -19.544 -31.124  1.00 125.61 ? 25  GLU A CB  1 
ATOM   106   C CG  . GLU A 1 16  ? -62.056 -18.618 -31.568  1.00 122.97 ? 25  GLU A CG  1 
ATOM   107   C CD  . GLU A 1 16  ? -62.317 -17.979 -32.919  1.00 123.12 ? 25  GLU A CD  1 
ATOM   108   O OE1 . GLU A 1 16  ? -63.401 -18.210 -33.495  1.00 125.38 ? 25  GLU A OE1 1 
ATOM   109   O OE2 . GLU A 1 16  ? -61.437 -17.239 -33.406  1.00 121.28 ? 25  GLU A OE2 1 
ATOM   110   N N   . TYR A 1 17  ? -65.344 -21.789 -31.190  1.00 151.21 ? 26  TYR A N   1 
ATOM   111   C CA  . TYR A 1 17  ? -66.284 -22.670 -30.507  1.00 154.06 ? 26  TYR A CA  1 
ATOM   112   C C   . TYR A 1 17  ? -66.201 -24.086 -31.064  1.00 156.47 ? 26  TYR A C   1 
ATOM   113   O O   . TYR A 1 17  ? -66.304 -25.061 -30.321  1.00 158.19 ? 26  TYR A O   1 
ATOM   114   C CB  . TYR A 1 17  ? -67.715 -22.138 -30.618  1.00 156.14 ? 26  TYR A CB  1 
ATOM   115   C CG  . TYR A 1 17  ? -68.722 -22.947 -29.833  1.00 159.23 ? 26  TYR A CG  1 
ATOM   116   C CD1 . TYR A 1 17  ? -68.762 -22.882 -28.447  1.00 158.86 ? 26  TYR A CD1 1 
ATOM   117   C CD2 . TYR A 1 17  ? -69.631 -23.776 -30.476  1.00 162.88 ? 26  TYR A CD2 1 
ATOM   118   C CE1 . TYR A 1 17  ? -69.678 -23.620 -27.723  1.00 161.90 ? 26  TYR A CE1 1 
ATOM   119   C CE2 . TYR A 1 17  ? -70.553 -24.518 -29.759  1.00 166.00 ? 26  TYR A CE2 1 
ATOM   120   C CZ  . TYR A 1 17  ? -70.571 -24.437 -28.383  1.00 165.42 ? 26  TYR A CZ  1 
ATOM   121   O OH  . TYR A 1 17  ? -71.486 -25.172 -27.664  1.00 168.72 ? 26  TYR A OH  1 
ATOM   122   N N   . SER A 1 18  ? -66.016 -24.194 -32.376  1.00 138.36 ? 27  SER A N   1 
ATOM   123   C CA  . SER A 1 18  ? -65.859 -25.493 -33.018  1.00 140.91 ? 27  SER A CA  1 
ATOM   124   C C   . SER A 1 18  ? -64.656 -26.221 -32.433  1.00 139.88 ? 27  SER A C   1 
ATOM   125   O O   . SER A 1 18  ? -64.711 -27.420 -32.164  1.00 142.46 ? 27  SER A O   1 
ATOM   126   C CB  . SER A 1 18  ? -65.695 -25.334 -34.530  1.00 141.38 ? 27  SER A CB  1 
ATOM   127   O OG  . SER A 1 18  ? -66.867 -24.796 -35.118  1.00 143.25 ? 27  SER A OG  1 
ATOM   128   N N   . ALA A 1 19  ? -63.568 -25.483 -32.239  1.00 137.21 ? 28  ALA A N   1 
ATOM   129   C CA  . ALA A 1 19  ? -62.369 -26.037 -31.628  1.00 136.34 ? 28  ALA A CA  1 
ATOM   130   C C   . ALA A 1 19  ? -62.627 -26.351 -30.160  1.00 137.02 ? 28  ALA A C   1 
ATOM   131   O O   . ALA A 1 19  ? -62.046 -27.281 -29.602  1.00 138.24 ? 28  ALA A O   1 
ATOM   132   C CB  . ALA A 1 19  ? -61.207 -25.069 -31.770  1.00 132.86 ? 28  ALA A CB  1 
ATOM   133   N N   . PHE A 1 20  ? -63.502 -25.566 -29.541  1.00 135.93 ? 29  PHE A N   1 
ATOM   134   C CA  . PHE A 1 20  ? -63.872 -25.779 -28.148  1.00 136.85 ? 29  PHE A CA  1 
ATOM   135   C C   . PHE A 1 20  ? -64.640 -27.087 -28.000  1.00 140.73 ? 29  PHE A C   1 
ATOM   136   O O   . PHE A 1 20  ? -64.483 -27.801 -27.011  1.00 142.17 ? 29  PHE A O   1 
ATOM   137   C CB  . PHE A 1 20  ? -64.714 -24.609 -27.634  1.00 135.89 ? 29  PHE A CB  1 
ATOM   138   C CG  . PHE A 1 20  ? -65.111 -24.734 -26.190  1.00 136.97 ? 29  PHE A CG  1 
ATOM   139   C CD1 . PHE A 1 20  ? -66.383 -25.156 -25.842  1.00 139.86 ? 29  PHE A CD1 1 
ATOM   140   C CD2 . PHE A 1 20  ? -64.211 -24.427 -25.182  1.00 135.46 ? 29  PHE A CD2 1 
ATOM   141   C CE1 . PHE A 1 20  ? -66.751 -25.271 -24.514  1.00 141.10 ? 29  PHE A CE1 1 
ATOM   142   C CE2 . PHE A 1 20  ? -64.573 -24.541 -23.852  1.00 136.81 ? 29  PHE A CE2 1 
ATOM   143   C CZ  . PHE A 1 20  ? -65.845 -24.963 -23.519  1.00 139.57 ? 29  PHE A CZ  1 
ATOM   144   N N   . ARG A 1 21  ? -65.471 -27.392 -28.992  1.00 148.44 ? 30  ARG A N   1 
ATOM   145   C CA  . ARG A 1 21  ? -66.252 -28.623 -28.991  1.00 152.60 ? 30  ARG A CA  1 
ATOM   146   C C   . ARG A 1 21  ? -65.356 -29.838 -29.203  1.00 154.14 ? 30  ARG A C   1 
ATOM   147   O O   . ARG A 1 21  ? -65.452 -30.827 -28.478  1.00 156.79 ? 30  ARG A O   1 
ATOM   148   C CB  . ARG A 1 21  ? -67.329 -28.576 -30.076  1.00 154.77 ? 30  ARG A CB  1 
ATOM   149   C CG  . ARG A 1 21  ? -68.404 -27.528 -29.848  1.00 154.43 ? 30  ARG A CG  1 
ATOM   150   C CD  . ARG A 1 21  ? -69.361 -27.466 -31.026  1.00 156.92 ? 30  ARG A CD  1 
ATOM   151   N NE  . ARG A 1 21  ? -69.927 -28.775 -31.339  1.00 161.41 ? 30  ARG A NE  1 
ATOM   152   C CZ  . ARG A 1 21  ? -70.758 -29.006 -32.350  1.00 164.69 ? 30  ARG A CZ  1 
ATOM   153   N NH1 . ARG A 1 21  ? -71.122 -28.013 -33.150  1.00 163.97 ? 30  ARG A NH1 1 
ATOM   154   N NH2 . ARG A 1 21  ? -71.226 -30.229 -32.561  1.00 169.08 ? 30  ARG A NH2 1 
ATOM   155   N N   . VAL A 1 22  ? -64.486 -29.756 -30.206  1.00 147.01 ? 31  VAL A N   1 
ATOM   156   C CA  . VAL A 1 22  ? -63.569 -30.846 -30.515  1.00 148.62 ? 31  VAL A CA  1 
ATOM   157   C C   . VAL A 1 22  ? -62.712 -31.193 -29.303  1.00 148.20 ? 31  VAL A C   1 
ATOM   158   O O   . VAL A 1 22  ? -62.402 -32.359 -29.064  1.00 151.15 ? 31  VAL A O   1 
ATOM   159   C CB  . VAL A 1 22  ? -62.657 -30.495 -31.705  1.00 146.78 ? 31  VAL A CB  1 
ATOM   160   C CG1 . VAL A 1 22  ? -61.659 -31.613 -31.959  1.00 148.71 ? 31  VAL A CG1 1 
ATOM   161   C CG2 . VAL A 1 22  ? -63.491 -30.225 -32.948  1.00 147.86 ? 31  VAL A CG2 1 
ATOM   162   N N   . GLY A 1 23  ? -62.336 -30.172 -28.540  1.00 146.01 ? 32  GLY A N   1 
ATOM   163   C CA  . GLY A 1 23  ? -61.554 -30.371 -27.334  1.00 145.81 ? 32  GLY A CA  1 
ATOM   164   C C   . GLY A 1 23  ? -62.332 -31.138 -26.283  1.00 148.98 ? 32  GLY A C   1 
ATOM   165   O O   . GLY A 1 23  ? -61.783 -31.994 -25.590  1.00 151.07 ? 32  GLY A O   1 
ATOM   166   N N   . MET A 1 24  ? -63.619 -30.827 -26.166  1.00 173.81 ? 33  MET A N   1 
ATOM   167   C CA  . MET A 1 24  ? -64.492 -31.513 -25.221  1.00 177.08 ? 33  MET A CA  1 
ATOM   168   C C   . MET A 1 24  ? -64.553 -33.004 -25.529  1.00 181.35 ? 33  MET A C   1 
ATOM   169   O O   . MET A 1 24  ? -64.675 -33.831 -24.625  1.00 184.31 ? 33  MET A O   1 
ATOM   170   C CB  . MET A 1 24  ? -65.900 -30.915 -25.264  1.00 177.42 ? 33  MET A CB  1 
ATOM   171   C CG  . MET A 1 24  ? -65.974 -29.456 -24.848  1.00 173.91 ? 33  MET A CG  1 
ATOM   172   S SD  . MET A 1 24  ? -65.509 -29.200 -23.125  1.00 173.39 ? 33  MET A SD  1 
ATOM   173   C CE  . MET A 1 24  ? -66.614 -30.348 -22.307  1.00 178.30 ? 33  MET A CE  1 
ATOM   174   N N   . VAL A 1 25  ? -64.463 -33.338 -26.812  1.00 182.06 ? 34  VAL A N   1 
ATOM   175   C CA  . VAL A 1 25  ? -64.551 -34.724 -27.257  1.00 186.50 ? 34  VAL A CA  1 
ATOM   176   C C   . VAL A 1 25  ? -63.222 -35.457 -27.099  1.00 187.24 ? 34  VAL A C   1 
ATOM   177   O O   . VAL A 1 25  ? -63.184 -36.599 -26.640  1.00 191.18 ? 34  VAL A O   1 
ATOM   178   C CB  . VAL A 1 25  ? -65.002 -34.812 -28.729  1.00 187.52 ? 34  VAL A CB  1 
ATOM   179   C CG1 . VAL A 1 25  ? -65.013 -36.259 -29.198  1.00 192.49 ? 34  VAL A CG1 1 
ATOM   180   C CG2 . VAL A 1 25  ? -66.374 -34.177 -28.902  1.00 187.69 ? 34  VAL A CG2 1 
ATOM   181   N N   . GLN A 1 26  ? -62.135 -34.794 -27.479  1.00 158.56 ? 35  GLN A N   1 
ATOM   182   C CA  . GLN A 1 26  ? -60.812 -35.406 -27.442  1.00 159.32 ? 35  GLN A CA  1 
ATOM   183   C C   . GLN A 1 26  ? -60.301 -35.604 -26.016  1.00 159.97 ? 35  GLN A C   1 
ATOM   184   O O   . GLN A 1 26  ? -59.499 -36.501 -25.756  1.00 162.64 ? 35  GLN A O   1 
ATOM   185   C CB  . GLN A 1 26  ? -59.814 -34.572 -28.249  1.00 155.58 ? 35  GLN A CB  1 
ATOM   186   C CG  . GLN A 1 26  ? -58.391 -35.109 -28.226  1.00 156.37 ? 35  GLN A CG  1 
ATOM   187   C CD  . GLN A 1 26  ? -58.286 -36.509 -28.799  1.00 161.10 ? 35  GLN A CD  1 
ATOM   188   O OE1 . GLN A 1 26  ? -59.181 -36.972 -29.505  1.00 163.35 ? 35  GLN A OE1 1 
ATOM   189   N NE2 . GLN A 1 26  ? -57.186 -37.189 -28.498  1.00 163.06 ? 35  GLN A NE2 1 
ATOM   190   N N   . PHE A 1 27  ? -60.769 -34.768 -25.096  1.00 166.86 ? 36  PHE A N   1 
ATOM   191   C CA  . PHE A 1 27  ? -60.311 -34.835 -23.712  1.00 167.54 ? 36  PHE A CA  1 
ATOM   192   C C   . PHE A 1 27  ? -61.428 -35.234 -22.752  1.00 170.31 ? 36  PHE A C   1 
ATOM   193   O O   . PHE A 1 27  ? -61.434 -34.830 -21.589  1.00 169.94 ? 36  PHE A O   1 
ATOM   194   C CB  . PHE A 1 27  ? -59.692 -33.501 -23.289  1.00 163.21 ? 36  PHE A CB  1 
ATOM   195   C CG  . PHE A 1 27  ? -58.548 -33.063 -24.159  1.00 160.63 ? 36  PHE A CG  1 
ATOM   196   C CD1 . PHE A 1 27  ? -57.307 -33.667 -24.049  1.00 162.11 ? 36  PHE A CD1 1 
ATOM   197   C CD2 . PHE A 1 27  ? -58.714 -32.048 -25.087  1.00 157.07 ? 36  PHE A CD2 1 
ATOM   198   C CE1 . PHE A 1 27  ? -56.253 -33.268 -24.848  1.00 159.99 ? 36  PHE A CE1 1 
ATOM   199   C CE2 . PHE A 1 27  ? -57.664 -31.644 -25.889  1.00 154.91 ? 36  PHE A CE2 1 
ATOM   200   C CZ  . PHE A 1 27  ? -56.432 -32.255 -25.769  1.00 156.32 ? 36  PHE A CZ  1 
ATOM   201   N N   . SER A 1 28  ? -62.370 -36.031 -23.246  1.00 254.94 ? 37  SER A N   1 
ATOM   202   C CA  . SER A 1 28  ? -63.461 -36.530 -22.416  1.00 258.21 ? 37  SER A CA  1 
ATOM   203   C C   . SER A 1 28  ? -63.093 -37.874 -21.798  1.00 263.08 ? 37  SER A C   1 
ATOM   204   O O   . SER A 1 28  ? -62.707 -38.807 -22.503  1.00 265.70 ? 37  SER A O   1 
ATOM   205   C CB  . SER A 1 28  ? -64.746 -36.660 -23.236  1.00 259.57 ? 37  SER A CB  1 
ATOM   206   O OG  . SER A 1 28  ? -64.605 -37.630 -24.260  1.00 262.38 ? 37  SER A OG  1 
ATOM   207   N N   . THR A 1 29  ? -63.211 -37.968 -20.478  1.00 233.07 ? 38  THR A N   1 
ATOM   208   C CA  . THR A 1 29  ? -62.872 -39.194 -19.765  1.00 238.05 ? 38  THR A CA  1 
ATOM   209   C C   . THR A 1 29  ? -64.034 -39.674 -18.900  1.00 241.71 ? 38  THR A C   1 
ATOM   210   O O   . THR A 1 29  ? -64.985 -38.933 -18.653  1.00 240.04 ? 38  THR A O   1 
ATOM   211   C CB  . THR A 1 29  ? -61.624 -39.004 -18.881  1.00 237.47 ? 38  THR A CB  1 
ATOM   212   O OG1 . THR A 1 29  ? -61.266 -40.253 -18.276  1.00 242.86 ? 38  THR A OG1 1 
ATOM   213   C CG2 . THR A 1 29  ? -61.893 -37.974 -17.793  1.00 235.14 ? 38  THR A CG2 1 
ATOM   214   N N   . SER A 1 30  ? -63.948 -40.920 -18.444  1.00 196.69 ? 39  SER A N   1 
ATOM   215   C CA  . SER A 1 30  ? -64.991 -41.506 -17.611  1.00 200.90 ? 39  SER A CA  1 
ATOM   216   C C   . SER A 1 30  ? -64.883 -41.029 -16.166  1.00 200.68 ? 39  SER A C   1 
ATOM   217   O O   . SER A 1 30  ? -65.867 -41.033 -15.426  1.00 202.58 ? 39  SER A O   1 
ATOM   218   C CB  . SER A 1 30  ? -64.922 -43.033 -17.665  1.00 207.17 ? 39  SER A CB  1 
ATOM   219   O OG  . SER A 1 30  ? -65.024 -43.500 -18.999  1.00 207.89 ? 39  SER A OG  1 
ATOM   220   N N   . GLU A 1 31  ? -63.680 -40.620 -15.772  1.00 251.66 ? 40  GLU A N   1 
ATOM   221   C CA  . GLU A 1 31  ? -63.438 -40.143 -14.416  1.00 251.73 ? 40  GLU A CA  1 
ATOM   222   C C   . GLU A 1 31  ? -64.308 -38.931 -14.093  1.00 248.23 ? 40  GLU A C   1 
ATOM   223   O O   . GLU A 1 31  ? -64.809 -38.795 -12.976  1.00 249.99 ? 40  GLU A O   1 
ATOM   224   C CB  . GLU A 1 31  ? -61.960 -39.796 -14.226  1.00 250.00 ? 40  GLU A CB  1 
ATOM   225   N N   . PHE A 1 32  ? -64.483 -38.057 -15.079  1.00 291.27 ? 41  PHE A N   1 
ATOM   226   C CA  . PHE A 1 32  ? -65.305 -36.863 -14.911  1.00 288.04 ? 41  PHE A CA  1 
ATOM   227   C C   . PHE A 1 32  ? -65.621 -36.212 -16.254  1.00 284.22 ? 41  PHE A C   1 
ATOM   228   O O   . PHE A 1 32  ? -64.840 -36.307 -17.202  1.00 282.54 ? 41  PHE A O   1 
ATOM   229   C CB  . PHE A 1 32  ? -64.614 -35.858 -13.986  1.00 285.60 ? 41  PHE A CB  1 
ATOM   230   C CG  . PHE A 1 32  ? -63.245 -35.449 -14.449  1.00 282.54 ? 41  PHE A CG  1 
ATOM   231   C CD1 . PHE A 1 32  ? -63.080 -34.358 -15.286  1.00 277.62 ? 41  PHE A CD1 1 
ATOM   232   C CD2 . PHE A 1 32  ? -62.123 -36.154 -14.046  1.00 284.96 ? 41  PHE A CD2 1 
ATOM   233   C CE1 . PHE A 1 32  ? -61.822 -33.978 -15.714  1.00 275.04 ? 41  PHE A CE1 1 
ATOM   234   C CE2 . PHE A 1 32  ? -60.863 -35.780 -14.471  1.00 282.49 ? 41  PHE A CE2 1 
ATOM   235   C CZ  . PHE A 1 32  ? -60.712 -34.691 -15.306  1.00 277.46 ? 41  PHE A CZ  1 
ATOM   236   N N   . ARG A 1 33  ? -66.772 -35.550 -16.327  1.00 267.56 ? 42  ARG A N   1 
ATOM   237   C CA  . ARG A 1 33  ? -67.193 -34.878 -17.550  1.00 264.46 ? 42  ARG A CA  1 
ATOM   238   C C   . ARG A 1 33  ? -67.409 -33.388 -17.312  1.00 260.51 ? 42  ARG A C   1 
ATOM   239   O O   . ARG A 1 33  ? -67.926 -32.985 -16.269  1.00 261.31 ? 42  ARG A O   1 
ATOM   240   C CB  . ARG A 1 33  ? -68.473 -35.514 -18.096  1.00 267.64 ? 42  ARG A CB  1 
ATOM   241   N N   . LEU A 1 34  ? -67.008 -32.573 -18.282  1.00 170.17 ? 43  LEU A N   1 
ATOM   242   C CA  . LEU A 1 34  ? -67.161 -31.126 -18.180  1.00 166.56 ? 43  LEU A CA  1 
ATOM   243   C C   . LEU A 1 34  ? -68.476 -30.669 -18.804  1.00 166.65 ? 43  LEU A C   1 
ATOM   244   O O   . LEU A 1 34  ? -68.810 -31.057 -19.924  1.00 167.19 ? 43  LEU A O   1 
ATOM   245   C CB  . LEU A 1 34  ? -65.982 -30.411 -18.845  1.00 162.48 ? 43  LEU A CB  1 
ATOM   246   C CG  . LEU A 1 34  ? -64.660 -30.347 -18.074  1.00 161.70 ? 43  LEU A CG  1 
ATOM   247   C CD1 . LEU A 1 34  ? -64.165 -31.736 -17.700  1.00 165.35 ? 43  LEU A CD1 1 
ATOM   248   C CD2 . LEU A 1 34  ? -63.609 -29.601 -18.882  1.00 157.84 ? 43  LEU A CD2 1 
ATOM   249   N N   . THR A 1 35  ? -69.219 -29.843 -18.073  1.00 222.80 ? 44  THR A N   1 
ATOM   250   C CA  . THR A 1 35  ? -70.506 -29.343 -18.543  1.00 223.38 ? 44  THR A CA  1 
ATOM   251   C C   . THR A 1 35  ? -70.432 -27.853 -18.866  1.00 219.64 ? 44  THR A C   1 
ATOM   252   O O   . THR A 1 35  ? -70.583 -27.013 -17.979  1.00 219.04 ? 44  THR A O   1 
ATOM   253   C CB  . THR A 1 35  ? -71.617 -29.583 -17.502  1.00 227.01 ? 44  THR A CB  1 
ATOM   254   O OG1 . THR A 1 35  ? -71.664 -30.974 -17.160  1.00 230.82 ? 44  THR A OG1 1 
ATOM   255   C CG2 . THR A 1 35  ? -72.969 -29.153 -18.053  1.00 228.23 ? 44  THR A CG2 1 
ATOM   256   N N   . PRO A 1 36  ? -70.193 -27.524 -20.143  1.00 169.19 ? 45  PRO A N   1 
ATOM   257   C CA  . PRO A 1 36  ? -70.067 -26.137 -20.602  1.00 165.85 ? 45  PRO A CA  1 
ATOM   258   C C   . PRO A 1 36  ? -71.415 -25.428 -20.697  1.00 167.16 ? 45  PRO A C   1 
ATOM   259   O O   . PRO A 1 36  ? -72.332 -25.932 -21.346  1.00 169.68 ? 45  PRO A O   1 
ATOM   260   C CB  . PRO A 1 36  ? -69.464 -26.283 -22.008  1.00 164.09 ? 45  PRO A CB  1 
ATOM   261   C CG  . PRO A 1 36  ? -68.991 -27.706 -22.104  1.00 166.09 ? 45  PRO A CG  1 
ATOM   262   C CD  . PRO A 1 36  ? -69.908 -28.482 -21.221  1.00 169.99 ? 45  PRO A CD  1 
ATOM   263   N N   . HIS A 1 37  ? -71.527 -24.270 -20.055  1.00 199.39 ? 46  HIS A N   1 
ATOM   264   C CA  . HIS A 1 37  ? -72.713 -23.433 -20.186  1.00 200.58 ? 46  HIS A CA  1 
ATOM   265   C C   . HIS A 1 37  ? -72.376 -22.228 -21.058  1.00 197.56 ? 46  HIS A C   1 
ATOM   266   O O   . HIS A 1 37  ? -71.814 -21.242 -20.582  1.00 195.37 ? 46  HIS A O   1 
ATOM   267   C CB  . HIS A 1 37  ? -73.213 -22.981 -18.814  1.00 202.09 ? 46  HIS A CB  1 
ATOM   268   C CG  . HIS A 1 37  ? -74.569 -22.348 -18.844  1.00 204.41 ? 46  HIS A CG  1 
ATOM   269   N ND1 . HIS A 1 37  ? -74.754 -20.984 -18.921  1.00 203.17 ? 46  HIS A ND1 1 
ATOM   270   C CD2 . HIS A 1 37  ? -75.809 -22.894 -18.809  1.00 208.29 ? 46  HIS A CD2 1 
ATOM   271   C CE1 . HIS A 1 37  ? -76.047 -20.717 -18.931  1.00 206.21 ? 46  HIS A CE1 1 
ATOM   272   N NE2 . HIS A 1 37  ? -76.709 -21.856 -18.864  1.00 209.33 ? 46  HIS A NE2 1 
ATOM   273   N N   . ILE A 1 38  ? -72.721 -22.318 -22.338  1.00 147.19 ? 47  ILE A N   1 
ATOM   274   C CA  . ILE A 1 38  ? -72.317 -21.314 -23.315  1.00 144.57 ? 47  ILE A CA  1 
ATOM   275   C C   . ILE A 1 38  ? -73.183 -20.058 -23.282  1.00 145.27 ? 47  ILE A C   1 
ATOM   276   O O   . ILE A 1 38  ? -74.411 -20.136 -23.229  1.00 148.53 ? 47  ILE A O   1 
ATOM   277   C CB  . ILE A 1 38  ? -72.328 -21.892 -24.743  1.00 145.01 ? 47  ILE A CB  1 
ATOM   278   C CG1 . ILE A 1 38  ? -71.570 -23.220 -24.784  1.00 145.09 ? 47  ILE A CG1 1 
ATOM   279   C CG2 . ILE A 1 38  ? -71.736 -20.895 -25.727  1.00 142.22 ? 47  ILE A CG2 1 
ATOM   280   C CD1 . ILE A 1 38  ? -70.152 -23.131 -24.260  1.00 141.93 ? 47  ILE A CD1 1 
ATOM   281   N N   . ASP A 1 39  ? -72.528 -18.901 -23.320  1.00 149.85 ? 48  ASP A N   1 
ATOM   282   C CA  . ASP A 1 39  ? -73.217 -17.617 -23.358  1.00 150.52 ? 48  ASP A CA  1 
ATOM   283   C C   . ASP A 1 39  ? -72.630 -16.726 -24.449  1.00 148.17 ? 48  ASP A C   1 
ATOM   284   O O   . ASP A 1 39  ? -71.520 -16.214 -24.312  1.00 145.19 ? 48  ASP A O   1 
ATOM   285   C CB  . ASP A 1 39  ? -73.122 -16.914 -22.001  1.00 150.38 ? 48  ASP A CB  1 
ATOM   286   C CG  . ASP A 1 39  ? -73.961 -17.588 -20.932  1.00 153.48 ? 48  ASP A CG  1 
ATOM   287   O OD1 . ASP A 1 39  ? -74.960 -18.250 -21.284  1.00 156.36 ? 48  ASP A OD1 1 
ATOM   288   O OD2 . ASP A 1 39  ? -73.623 -17.451 -19.738  1.00 153.35 ? 48  ASP A OD2 1 
ATOM   289   N N   . ASN A 1 40  ? -73.379 -16.548 -25.532  1.00 171.06 ? 49  ASN A N   1 
ATOM   290   C CA  . ASN A 1 40  ? -72.931 -15.714 -26.642  1.00 169.43 ? 49  ASN A CA  1 
ATOM   291   C C   . ASN A 1 40  ? -73.330 -14.253 -26.464  1.00 169.96 ? 49  ASN A C   1 
ATOM   292   O O   . ASN A 1 40  ? -74.478 -13.879 -26.705  1.00 173.13 ? 49  ASN A O   1 
ATOM   293   C CB  . ASN A 1 40  ? -73.474 -16.249 -27.969  1.00 171.40 ? 49  ASN A CB  1 
ATOM   294   C CG  . ASN A 1 40  ? -72.862 -17.582 -28.355  1.00 170.69 ? 49  ASN A CG  1 
ATOM   295   O OD1 . ASN A 1 40  ? -71.911 -18.046 -27.728  1.00 168.41 ? 49  ASN A OD1 1 
ATOM   296   N ND2 . ASN A 1 40  ? -73.406 -18.204 -29.395  1.00 173.08 ? 49  ASN A ND2 1 
ATOM   297   N N   . LEU A 1 41  ? -72.376 -13.430 -26.041  1.00 205.01 ? 50  LEU A N   1 
ATOM   298   C CA  . LEU A 1 41  ? -72.628 -12.008 -25.829  1.00 205.61 ? 50  LEU A CA  1 
ATOM   299   C C   . LEU A 1 41  ? -71.583 -11.142 -26.523  1.00 202.92 ? 50  LEU A C   1 
ATOM   300   O O   . LEU A 1 41  ? -70.501 -11.615 -26.869  1.00 200.15 ? 50  LEU A O   1 
ATOM   301   C CB  . LEU A 1 41  ? -72.660 -11.678 -24.334  1.00 205.99 ? 50  LEU A CB  1 
ATOM   302   C CG  . LEU A 1 41  ? -73.905 -12.074 -23.535  1.00 209.50 ? 50  LEU A CG  1 
ATOM   303   C CD1 . LEU A 1 41  ? -73.971 -13.580 -23.329  1.00 209.79 ? 50  LEU A CD1 1 
ATOM   304   C CD2 . LEU A 1 41  ? -73.924 -11.354 -22.195  1.00 210.19 ? 50  LEU A CD2 1 
ATOM   305   N N   . GLU A 1 42  ? -71.918 -9.871  -26.726  1.00 143.93 ? 51  GLU A N   1 
ATOM   306   C CA  . GLU A 1 42  ? -70.983 -8.915  -27.304  1.00 141.87 ? 51  GLU A CA  1 
ATOM   307   C C   . GLU A 1 42  ? -69.846 -8.660  -26.323  1.00 139.30 ? 51  GLU A C   1 
ATOM   308   O O   . GLU A 1 42  ? -69.998 -7.901  -25.367  1.00 140.29 ? 51  GLU A O   1 
ATOM   309   C CB  . GLU A 1 42  ? -71.693 -7.604  -27.645  1.00 144.42 ? 51  GLU A CB  1 
ATOM   310   N N   . VAL A 1 43  ? -68.709 -9.302  -26.568  1.00 132.41 ? 52  VAL A N   1 
ATOM   311   C CA  . VAL A 1 43  ? -67.571 -9.238  -25.659  1.00 130.28 ? 52  VAL A CA  1 
ATOM   312   C C   . VAL A 1 43  ? -67.144 -7.804  -25.347  1.00 130.22 ? 52  VAL A C   1 
ATOM   313   O O   . VAL A 1 43  ? -66.636 -7.523  -24.261  1.00 129.97 ? 52  VAL A O   1 
ATOM   314   C CB  . VAL A 1 43  ? -66.368 -10.024 -26.216  1.00 127.50 ? 52  VAL A CB  1 
ATOM   315   C CG1 . VAL A 1 43  ? -65.879 -9.399  -27.515  1.00 126.39 ? 52  VAL A CG1 1 
ATOM   316   C CG2 . VAL A 1 43  ? -65.252 -10.084 -25.190  1.00 125.94 ? 52  VAL A CG2 1 
ATOM   317   N N   . ALA A 1 44  ? -67.357 -6.901  -26.299  1.00 137.38 ? 53  ALA A N   1 
ATOM   318   C CA  . ALA A 1 44  ? -66.971 -5.504  -26.130  1.00 137.74 ? 53  ALA A CA  1 
ATOM   319   C C   . ALA A 1 44  ? -67.771 -4.820  -25.023  1.00 140.48 ? 53  ALA A C   1 
ATOM   320   O O   . ALA A 1 44  ? -67.217 -4.076  -24.214  1.00 140.57 ? 53  ALA A O   1 
ATOM   321   C CB  . ALA A 1 44  ? -67.127 -4.749  -27.441  1.00 138.37 ? 53  ALA A CB  1 
ATOM   322   N N   . ASN A 1 45  ? -69.075 -5.074  -24.997  1.00 141.97 ? 54  ASN A N   1 
ATOM   323   C CA  . ASN A 1 45  ? -69.955 -4.471  -24.002  1.00 145.06 ? 54  ASN A CA  1 
ATOM   324   C C   . ASN A 1 45  ? -69.608 -4.913  -22.584  1.00 144.67 ? 54  ASN A C   1 
ATOM   325   O O   . ASN A 1 45  ? -69.785 -6.077  -22.226  1.00 144.22 ? 54  ASN A O   1 
ATOM   326   C CB  . ASN A 1 45  ? -71.416 -4.800  -24.319  1.00 148.10 ? 54  ASN A CB  1 
ATOM   327   C CG  . ASN A 1 45  ? -72.391 -3.988  -23.490  1.00 151.88 ? 54  ASN A CG  1 
ATOM   328   O OD1 . ASN A 1 45  ? -72.016 -3.369  -22.496  1.00 152.21 ? 54  ASN A OD1 1 
ATOM   329   N ND2 . ASN A 1 45  ? -73.654 -3.985  -23.899  1.00 155.13 ? 54  ASN A ND2 1 
ATOM   330   N N   . SER A 1 46  ? -69.117 -3.975  -21.780  1.00 139.55 ? 55  SER A N   1 
ATOM   331   C CA  . SER A 1 46  ? -68.713 -4.272  -20.409  1.00 139.65 ? 55  SER A CA  1 
ATOM   332   C C   . SER A 1 46  ? -69.893 -4.716  -19.549  1.00 142.49 ? 55  SER A C   1 
ATOM   333   O O   . SER A 1 46  ? -69.767 -5.630  -18.736  1.00 142.20 ? 55  SER A O   1 
ATOM   334   C CB  . SER A 1 46  ? -68.026 -3.059  -19.777  1.00 140.46 ? 55  SER A CB  1 
ATOM   335   O OG  . SER A 1 46  ? -66.837 -2.727  -20.472  1.00 137.91 ? 55  SER A OG  1 
ATOM   336   N N   . PHE A 1 47  ? -71.036 -4.064  -19.732  1.00 146.08 ? 56  PHE A N   1 
ATOM   337   C CA  . PHE A 1 47  ? -72.234 -4.397  -18.971  1.00 149.27 ? 56  PHE A CA  1 
ATOM   338   C C   . PHE A 1 47  ? -72.647 -5.845  -19.197  1.00 148.49 ? 56  PHE A C   1 
ATOM   339   O O   . PHE A 1 47  ? -72.833 -6.603  -18.246  1.00 149.22 ? 56  PHE A O   1 
ATOM   340   C CB  . PHE A 1 47  ? -73.386 -3.462  -19.345  1.00 152.91 ? 56  PHE A CB  1 
ATOM   341   C CG  . PHE A 1 47  ? -74.710 -3.867  -18.760  1.00 156.44 ? 56  PHE A CG  1 
ATOM   342   C CD1 . PHE A 1 47  ? -75.064 -3.478  -17.479  1.00 159.24 ? 56  PHE A CD1 1 
ATOM   343   C CD2 . PHE A 1 47  ? -75.601 -4.635  -19.492  1.00 157.33 ? 56  PHE A CD2 1 
ATOM   344   C CE1 . PHE A 1 47  ? -76.281 -3.849  -16.939  1.00 162.72 ? 56  PHE A CE1 1 
ATOM   345   C CE2 . PHE A 1 47  ? -76.818 -5.009  -18.957  1.00 160.88 ? 56  PHE A CE2 1 
ATOM   346   C CZ  . PHE A 1 47  ? -77.159 -4.615  -17.679  1.00 163.52 ? 56  PHE A CZ  1 
ATOM   347   N N   . ALA A 1 48  ? -72.792 -6.221  -20.464  1.00 146.50 ? 57  ALA A N   1 
ATOM   348   C CA  . ALA A 1 48  ? -73.199 -7.575  -20.821  1.00 146.15 ? 57  ALA A CA  1 
ATOM   349   C C   . ALA A 1 48  ? -72.253 -8.611  -20.227  1.00 143.61 ? 57  ALA A C   1 
ATOM   350   O O   . ALA A 1 48  ? -72.690 -9.639  -19.710  1.00 144.59 ? 57  ALA A O   1 
ATOM   351   C CB  . ALA A 1 48  ? -73.272 -7.725  -22.333  1.00 145.27 ? 57  ALA A CB  1 
ATOM   352   N N   . VAL A 1 49  ? -70.955 -8.335  -20.305  1.00 139.83 ? 58  VAL A N   1 
ATOM   353   C CA  . VAL A 1 49  ? -69.945 -9.236  -19.763  1.00 137.69 ? 58  VAL A CA  1 
ATOM   354   C C   . VAL A 1 49  ? -70.124 -9.419  -18.259  1.00 139.61 ? 58  VAL A C   1 
ATOM   355   O O   . VAL A 1 49  ? -69.888 -10.502 -17.723  1.00 139.38 ? 58  VAL A O   1 
ATOM   356   C CB  . VAL A 1 49  ? -68.519 -8.728  -20.055  1.00 134.81 ? 58  VAL A CB  1 
ATOM   357   C CG1 . VAL A 1 49  ? -67.490 -9.582  -19.333  1.00 133.35 ? 58  VAL A CG1 1 
ATOM   358   C CG2 . VAL A 1 49  ? -68.257 -8.721  -21.552  1.00 132.91 ? 58  VAL A CG2 1 
ATOM   359   N N   . THR A 1 50  ? -70.549 -8.356  -17.584  1.00 142.52 ? 59  THR A N   1 
ATOM   360   C CA  . THR A 1 50  ? -70.779 -8.410  -16.146  1.00 144.87 ? 59  THR A CA  1 
ATOM   361   C C   . THR A 1 50  ? -71.928 -9.359  -15.816  1.00 147.20 ? 59  THR A C   1 
ATOM   362   O O   . THR A 1 50  ? -71.841 -10.151 -14.878  1.00 148.02 ? 59  THR A O   1 
ATOM   363   C CB  . THR A 1 50  ? -71.088 -7.017  -15.570  1.00 147.34 ? 59  THR A CB  1 
ATOM   364   O OG1 . THR A 1 50  ? -70.085 -6.087  -15.999  1.00 145.50 ? 59  THR A OG1 1 
ATOM   365   C CG2 . THR A 1 50  ? -71.114 -7.063  -14.051  1.00 149.76 ? 59  THR A CG2 1 
ATOM   366   N N   . ASN A 1 51  ? -73.003 -9.275  -16.594  1.00 201.65 ? 60  ASN A N   1 
ATOM   367   C CA  . ASN A 1 51  ? -74.148 -10.159 -16.411  1.00 204.19 ? 60  ASN A CA  1 
ATOM   368   C C   . ASN A 1 51  ? -73.800 -11.614 -16.702  1.00 202.55 ? 60  ASN A C   1 
ATOM   369   O O   . ASN A 1 51  ? -74.137 -12.508 -15.928  1.00 204.16 ? 60  ASN A O   1 
ATOM   370   C CB  . ASN A 1 51  ? -75.323 -9.719  -17.288  1.00 206.39 ? 60  ASN A CB  1 
ATOM   371   C CG  . ASN A 1 51  ? -76.074 -8.537  -16.708  1.00 209.72 ? 60  ASN A CG  1 
ATOM   372   O OD1 . ASN A 1 51  ? -75.503 -7.711  -15.996  1.00 209.61 ? 60  ASN A OD1 1 
ATOM   373   N ND2 . ASN A 1 51  ? -77.364 -8.449  -17.011  1.00 213.10 ? 60  ASN A ND2 1 
ATOM   374   N N   . ALA A 1 52  ? -73.124 -11.844 -17.823  1.00 182.36 ? 61  ALA A N   1 
ATOM   375   C CA  . ALA A 1 52  ? -72.736 -13.192 -18.221  1.00 180.96 ? 61  ALA A CA  1 
ATOM   376   C C   . ALA A 1 52  ? -71.839 -13.842 -17.174  1.00 180.18 ? 61  ALA A C   1 
ATOM   377   O O   . ALA A 1 52  ? -71.843 -15.062 -17.012  1.00 180.64 ? 61  ALA A O   1 
ATOM   378   C CB  . ALA A 1 52  ? -72.042 -13.166 -19.574  1.00 178.07 ? 61  ALA A CB  1 
ATOM   379   N N   . PHE A 1 53  ? -71.072 -13.020 -16.465  1.00 146.79 ? 62  PHE A N   1 
ATOM   380   C CA  . PHE A 1 53  ? -70.183 -13.515 -15.422  1.00 146.56 ? 62  PHE A CA  1 
ATOM   381   C C   . PHE A 1 53  ? -70.959 -13.861 -14.157  1.00 150.00 ? 62  PHE A C   1 
ATOM   382   O O   . PHE A 1 53  ? -70.780 -14.933 -13.580  1.00 150.81 ? 62  PHE A O   1 
ATOM   383   C CB  . PHE A 1 53  ? -69.098 -12.484 -15.107  1.00 145.08 ? 62  PHE A CB  1 
ATOM   384   C CG  . PHE A 1 53  ? -68.207 -12.873 -13.963  1.00 145.54 ? 62  PHE A CG  1 
ATOM   385   C CD1 . PHE A 1 53  ? -67.093 -13.669 -14.174  1.00 143.60 ? 62  PHE A CD1 1 
ATOM   386   C CD2 . PHE A 1 53  ? -68.484 -12.446 -12.675  1.00 148.33 ? 62  PHE A CD2 1 
ATOM   387   C CE1 . PHE A 1 53  ? -66.272 -14.029 -13.122  1.00 144.53 ? 62  PHE A CE1 1 
ATOM   388   C CE2 . PHE A 1 53  ? -67.668 -12.803 -11.619  1.00 149.24 ? 62  PHE A CE2 1 
ATOM   389   C CZ  . PHE A 1 53  ? -66.560 -13.595 -11.843  1.00 147.39 ? 62  PHE A CZ  1 
ATOM   390   N N   . CYS A 1 54  ? -71.822 -12.945 -13.728  1.00 149.27 ? 63  CYS A N   1 
ATOM   391   C CA  . CYS A 1 54  ? -72.629 -13.157 -12.534  1.00 152.90 ? 63  CYS A CA  1 
ATOM   392   C C   . CYS A 1 54  ? -73.656 -14.263 -12.752  1.00 154.75 ? 63  CYS A C   1 
ATOM   393   O O   . CYS A 1 54  ? -74.044 -14.956 -11.813  1.00 157.31 ? 63  CYS A O   1 
ATOM   394   C CB  . CYS A 1 54  ? -73.326 -11.859 -12.124  1.00 155.23 ? 63  CYS A CB  1 
ATOM   395   S SG  . CYS A 1 54  ? -72.196 -10.499 -11.747  1.00 154.00 ? 63  CYS A SG  1 
ATOM   396   N N   . SER A 1 55  ? -74.091 -14.421 -13.999  1.00 195.91 ? 64  SER A N   1 
ATOM   397   C CA  . SER A 1 55  ? -75.040 -15.468 -14.355  1.00 197.86 ? 64  SER A CA  1 
ATOM   398   C C   . SER A 1 55  ? -74.387 -16.838 -14.228  1.00 197.03 ? 64  SER A C   1 
ATOM   399   O O   . SER A 1 55  ? -74.955 -17.756 -13.636  1.00 199.69 ? 64  SER A O   1 
ATOM   400   C CB  . SER A 1 55  ? -75.555 -15.264 -15.781  1.00 197.25 ? 64  SER A CB  1 
ATOM   401   O OG  . SER A 1 55  ? -76.438 -16.305 -16.159  1.00 199.47 ? 64  SER A OG  1 
ATOM   402   N N   . GLN A 1 56  ? -73.189 -16.967 -14.787  1.00 192.90 ? 65  GLN A N   1 
ATOM   403   C CA  . GLN A 1 56  ? -72.437 -18.213 -14.710  1.00 192.20 ? 65  GLN A CA  1 
ATOM   404   C C   . GLN A 1 56  ? -71.957 -18.464 -13.284  1.00 193.60 ? 65  GLN A C   1 
ATOM   405   O O   . GLN A 1 56  ? -71.667 -19.599 -12.907  1.00 194.59 ? 65  GLN A O   1 
ATOM   406   C CB  . GLN A 1 56  ? -71.248 -18.185 -15.673  1.00 188.47 ? 65  GLN A CB  1 
ATOM   407   N N   . PHE A 1 57  ? -71.879 -17.399 -12.494  1.00 151.06 ? 66  PHE A N   1 
ATOM   408   C CA  . PHE A 1 57  ? -71.442 -17.507 -11.108  1.00 152.86 ? 66  PHE A CA  1 
ATOM   409   C C   . PHE A 1 57  ? -72.576 -17.981 -10.205  1.00 156.97 ? 66  PHE A C   1 
ATOM   410   O O   . PHE A 1 57  ? -72.355 -18.748 -9.267   1.00 159.00 ? 66  PHE A O   1 
ATOM   411   C CB  . PHE A 1 57  ? -70.893 -16.169 -10.614  1.00 152.22 ? 66  PHE A CB  1 
ATOM   412   C CG  . PHE A 1 57  ? -70.426 -16.195 -9.188   1.00 154.49 ? 66  PHE A CG  1 
ATOM   413   C CD1 . PHE A 1 57  ? -69.283 -16.891 -8.833   1.00 153.91 ? 66  PHE A CD1 1 
ATOM   414   C CD2 . PHE A 1 57  ? -71.128 -15.520 -8.203   1.00 157.62 ? 66  PHE A CD2 1 
ATOM   415   C CE1 . PHE A 1 57  ? -68.849 -16.917 -7.521   1.00 156.49 ? 66  PHE A CE1 1 
ATOM   416   C CE2 . PHE A 1 57  ? -70.699 -15.540 -6.889   1.00 160.11 ? 66  PHE A CE2 1 
ATOM   417   C CZ  . PHE A 1 57  ? -69.558 -16.240 -6.548   1.00 159.59 ? 66  PHE A CZ  1 
ATOM   418   N N   . SER A 1 58  ? -73.790 -17.520 -10.490  1.00 174.84 ? 67  SER A N   1 
ATOM   419   C CA  . SER A 1 58  ? -74.964 -17.943 -9.735   1.00 179.00 ? 67  SER A CA  1 
ATOM   420   C C   . SER A 1 58  ? -75.303 -19.393 -10.056  1.00 180.13 ? 67  SER A C   1 
ATOM   421   O O   . SER A 1 58  ? -75.806 -20.128 -9.206   1.00 183.46 ? 67  SER A O   1 
ATOM   422   C CB  . SER A 1 58  ? -76.159 -17.039 -10.040  1.00 180.64 ? 67  SER A CB  1 
ATOM   423   O OG  . SER A 1 58  ? -75.922 -15.714 -9.596   1.00 180.46 ? 67  SER A OG  1 
ATOM   424   N N   . ARG A 1 59  ? -75.021 -19.799 -11.291  1.00 222.07 ? 68  ARG A N   1 
ATOM   425   C CA  . ARG A 1 59  ? -75.229 -21.178 -11.712  1.00 223.14 ? 68  ARG A CA  1 
ATOM   426   C C   . ARG A 1 59  ? -74.217 -22.095 -11.034  1.00 223.15 ? 68  ARG A C   1 
ATOM   427   O O   . ARG A 1 59  ? -74.275 -23.316 -11.177  1.00 224.58 ? 68  ARG A O   1 
ATOM   428   C CB  . ARG A 1 59  ? -75.115 -21.299 -13.233  1.00 220.66 ? 68  ARG A CB  1 
ATOM   429   N N   . GLY A 1 60  ? -73.288 -21.493 -10.298  1.00 172.75 ? 69  GLY A N   1 
ATOM   430   C CA  . GLY A 1 60  ? -72.297 -22.238 -9.545   1.00 173.27 ? 69  GLY A CA  1 
ATOM   431   C C   . GLY A 1 60  ? -71.314 -23.001 -10.412  1.00 170.85 ? 69  GLY A C   1 
ATOM   432   O O   . GLY A 1 60  ? -71.347 -24.230 -10.466  1.00 172.56 ? 69  GLY A O   1 
ATOM   433   N N   . VAL A 1 61  ? -70.435 -22.272 -11.093  1.00 161.87 ? 70  VAL A N   1 
ATOM   434   C CA  . VAL A 1 61  ? -69.397 -22.896 -11.906  1.00 159.58 ? 70  VAL A CA  1 
ATOM   435   C C   . VAL A 1 61  ? -68.079 -22.954 -11.141  1.00 159.34 ? 70  VAL A C   1 
ATOM   436   O O   . VAL A 1 61  ? -67.874 -22.210 -10.183  1.00 160.09 ? 70  VAL A O   1 
ATOM   437   C CB  . VAL A 1 61  ? -69.176 -22.146 -13.233  1.00 155.89 ? 70  VAL A CB  1 
ATOM   438   C CG1 . VAL A 1 61  ? -70.424 -22.216 -14.099  1.00 156.58 ? 70  VAL A CG1 1 
ATOM   439   C CG2 . VAL A 1 61  ? -68.778 -20.702 -12.967  1.00 154.05 ? 70  VAL A CG2 1 
ATOM   440   N N   . TYR A 1 62  ? -67.190 -23.843 -11.570  1.00 194.13 ? 71  TYR A N   1 
ATOM   441   C CA  . TYR A 1 62  ? -65.896 -24.008 -10.920  1.00 194.35 ? 71  TYR A CA  1 
ATOM   442   C C   . TYR A 1 62  ? -64.815 -23.208 -11.640  1.00 190.64 ? 71  TYR A C   1 
ATOM   443   O O   . TYR A 1 62  ? -63.797 -22.845 -11.050  1.00 190.59 ? 71  TYR A O   1 
ATOM   444   C CB  . TYR A 1 62  ? -65.513 -25.488 -10.864  1.00 196.59 ? 71  TYR A CB  1 
ATOM   445   C CG  . TYR A 1 62  ? -66.523 -26.351 -10.141  1.00 200.66 ? 71  TYR A CG  1 
ATOM   446   C CD1 . TYR A 1 62  ? -66.402 -26.603 -8.781   1.00 204.09 ? 71  TYR A CD1 1 
ATOM   447   C CD2 . TYR A 1 62  ? -67.599 -26.910 -10.817  1.00 201.44 ? 71  TYR A CD2 1 
ATOM   448   C CE1 . TYR A 1 62  ? -67.324 -27.389 -8.115   1.00 208.05 ? 71  TYR A CE1 1 
ATOM   449   C CE2 . TYR A 1 62  ? -68.526 -27.697 -10.160  1.00 205.44 ? 71  TYR A CE2 1 
ATOM   450   C CZ  . TYR A 1 62  ? -68.383 -27.934 -8.809   1.00 208.66 ? 71  TYR A CZ  1 
ATOM   451   O OH  . TYR A 1 62  ? -69.303 -28.717 -8.150   1.00 212.87 ? 71  TYR A OH  1 
ATOM   452   N N   . ALA A 1 63  ? -65.047 -22.934 -12.920  1.00 169.90 ? 72  ALA A N   1 
ATOM   453   C CA  . ALA A 1 63  ? -64.110 -22.160 -13.726  1.00 166.43 ? 72  ALA A CA  1 
ATOM   454   C C   . ALA A 1 63  ? -64.812 -21.576 -14.946  1.00 164.15 ? 72  ALA A C   1 
ATOM   455   O O   . ALA A 1 63  ? -65.849 -22.081 -15.377  1.00 165.24 ? 72  ALA A O   1 
ATOM   456   C CB  . ALA A 1 63  ? -62.934 -23.024 -14.149  1.00 165.93 ? 72  ALA A CB  1 
ATOM   457   N N   . ILE A 1 64  ? -64.243 -20.510 -15.500  1.00 138.72 ? 73  ILE A N   1 
ATOM   458   C CA  . ILE A 1 64  ? -64.840 -19.842 -16.649  1.00 136.80 ? 73  ILE A CA  1 
ATOM   459   C C   . ILE A 1 64  ? -63.845 -19.681 -17.792  1.00 133.89 ? 73  ILE A C   1 
ATOM   460   O O   . ILE A 1 64  ? -62.743 -19.171 -17.599  1.00 132.56 ? 73  ILE A O   1 
ATOM   461   C CB  . ILE A 1 64  ? -65.380 -18.449 -16.273  1.00 136.67 ? 73  ILE A CB  1 
ATOM   462   C CG1 . ILE A 1 64  ? -66.358 -18.549 -15.102  1.00 139.83 ? 73  ILE A CG1 1 
ATOM   463   C CG2 . ILE A 1 64  ? -66.044 -17.793 -17.475  1.00 135.24 ? 73  ILE A CG2 1 
ATOM   464   C CD1 . ILE A 1 64  ? -66.906 -17.212 -14.652  1.00 140.30 ? 73  ILE A CD1 1 
ATOM   465   N N   . PHE A 1 65  ? -64.242 -20.121 -18.981  1.00 138.53 ? 74  PHE A N   1 
ATOM   466   C CA  . PHE A 1 65  ? -63.440 -19.915 -20.180  1.00 135.98 ? 74  PHE A CA  1 
ATOM   467   C C   . PHE A 1 65  ? -64.155 -18.969 -21.135  1.00 134.82 ? 74  PHE A C   1 
ATOM   468   O O   . PHE A 1 65  ? -65.305 -19.205 -21.507  1.00 136.24 ? 74  PHE A O   1 
ATOM   469   C CB  . PHE A 1 65  ? -63.154 -21.243 -20.881  1.00 136.53 ? 74  PHE A CB  1 
ATOM   470   C CG  . PHE A 1 65  ? -62.584 -21.084 -22.263  1.00 134.38 ? 74  PHE A CG  1 
ATOM   471   C CD1 . PHE A 1 65  ? -61.218 -20.967 -22.454  1.00 132.70 ? 74  PHE A CD1 1 
ATOM   472   C CD2 . PHE A 1 65  ? -63.416 -21.044 -23.369  1.00 134.39 ? 74  PHE A CD2 1 
ATOM   473   C CE1 . PHE A 1 65  ? -60.692 -20.817 -23.723  1.00 130.94 ? 74  PHE A CE1 1 
ATOM   474   C CE2 . PHE A 1 65  ? -62.896 -20.894 -24.640  1.00 132.74 ? 74  PHE A CE2 1 
ATOM   475   C CZ  . PHE A 1 65  ? -61.533 -20.780 -24.817  1.00 130.94 ? 74  PHE A CZ  1 
ATOM   476   N N   . GLY A 1 66  ? -63.473 -17.900 -21.533  1.00 127.82 ? 75  GLY A N   1 
ATOM   477   C CA  . GLY A 1 66  ? -64.060 -16.930 -22.438  1.00 126.97 ? 75  GLY A CA  1 
ATOM   478   C C   . GLY A 1 66  ? -63.049 -15.982 -23.051  1.00 124.54 ? 75  GLY A C   1 
ATOM   479   O O   . GLY A 1 66  ? -61.854 -16.271 -23.090  1.00 123.31 ? 75  GLY A O   1 
ATOM   480   N N   . PHE A 1 67  ? -63.539 -14.846 -23.535  1.00 130.89 ? 76  PHE A N   1 
ATOM   481   C CA  . PHE A 1 67  ? -62.689 -13.839 -24.152  1.00 128.94 ? 76  PHE A CA  1 
ATOM   482   C C   . PHE A 1 67  ? -63.029 -12.463 -23.599  1.00 129.49 ? 76  PHE A C   1 
ATOM   483   O O   . PHE A 1 67  ? -64.108 -12.259 -23.043  1.00 131.38 ? 76  PHE A O   1 
ATOM   484   C CB  . PHE A 1 67  ? -62.879 -13.840 -25.670  1.00 128.25 ? 76  PHE A CB  1 
ATOM   485   C CG  . PHE A 1 67  ? -62.605 -15.168 -26.317  1.00 128.14 ? 76  PHE A CG  1 
ATOM   486   C CD1 . PHE A 1 67  ? -63.556 -16.175 -26.297  1.00 130.07 ? 76  PHE A CD1 1 
ATOM   487   C CD2 . PHE A 1 67  ? -61.398 -15.405 -26.954  1.00 126.48 ? 76  PHE A CD2 1 
ATOM   488   C CE1 . PHE A 1 67  ? -63.307 -17.394 -26.894  1.00 130.42 ? 76  PHE A CE1 1 
ATOM   489   C CE2 . PHE A 1 67  ? -61.143 -16.622 -27.554  1.00 126.78 ? 76  PHE A CE2 1 
ATOM   490   C CZ  . PHE A 1 67  ? -62.099 -17.619 -27.523  1.00 128.79 ? 76  PHE A CZ  1 
ATOM   491   N N   . TYR A 1 68  ? -62.106 -11.519 -23.750  1.00 121.76 ? 77  TYR A N   1 
ATOM   492   C CA  . TYR A 1 68  ? -62.370 -10.138 -23.363  1.00 122.54 ? 77  TYR A CA  1 
ATOM   493   C C   . TYR A 1 68  ? -61.752 -9.144  -24.340  1.00 121.22 ? 77  TYR A C   1 
ATOM   494   O O   . TYR A 1 68  ? -60.821 -9.474  -25.074  1.00 119.48 ? 77  TYR A O   1 
ATOM   495   C CB  . TYR A 1 68  ? -61.896 -9.858  -21.933  1.00 123.43 ? 77  TYR A CB  1 
ATOM   496   C CG  . TYR A 1 68  ? -60.472 -10.274 -21.646  1.00 122.23 ? 77  TYR A CG  1 
ATOM   497   C CD1 . TYR A 1 68  ? -59.401 -9.621  -22.240  1.00 120.75 ? 77  TYR A CD1 1 
ATOM   498   C CD2 . TYR A 1 68  ? -60.198 -11.309 -20.764  1.00 122.97 ? 77  TYR A CD2 1 
ATOM   499   C CE1 . TYR A 1 68  ? -58.098 -9.996  -21.973  1.00 120.06 ? 77  TYR A CE1 1 
ATOM   500   C CE2 . TYR A 1 68  ? -58.900 -11.689 -20.490  1.00 122.39 ? 77  TYR A CE2 1 
ATOM   501   C CZ  . TYR A 1 68  ? -57.854 -11.031 -21.097  1.00 120.94 ? 77  TYR A CZ  1 
ATOM   502   O OH  . TYR A 1 68  ? -56.560 -11.412 -20.823  1.00 120.75 ? 77  TYR A OH  1 
ATOM   503   N N   . ASP A 1 69  ? -62.284 -7.927  -24.346  1.00 167.47 ? 78  ASP A N   1 
ATOM   504   C CA  . ASP A 1 69  ? -61.787 -6.874  -25.218  1.00 166.77 ? 78  ASP A CA  1 
ATOM   505   C C   . ASP A 1 69  ? -60.974 -5.875  -24.404  1.00 167.09 ? 78  ASP A C   1 
ATOM   506   O O   . ASP A 1 69  ? -60.905 -5.975  -23.180  1.00 168.07 ? 78  ASP A O   1 
ATOM   507   C CB  . ASP A 1 69  ? -62.955 -6.166  -25.909  1.00 168.42 ? 78  ASP A CB  1 
ATOM   508   C CG  . ASP A 1 69  ? -62.510 -5.303  -27.073  1.00 167.83 ? 78  ASP A CG  1 
ATOM   509   O OD1 . ASP A 1 69  ? -61.385 -5.512  -27.575  1.00 165.85 ? 78  ASP A OD1 1 
ATOM   510   O OD2 . ASP A 1 69  ? -63.288 -4.419  -27.490  1.00 169.66 ? 78  ASP A OD2 1 
ATOM   511   N N   . LYS A 1 70  ? -60.359 -4.914  -25.085  1.00 120.67 ? 79  LYS A N   1 
ATOM   512   C CA  . LYS A 1 70  ? -59.575 -3.884  -24.415  1.00 121.39 ? 79  LYS A CA  1 
ATOM   513   C C   . LYS A 1 70  ? -60.443 -3.064  -23.465  1.00 124.11 ? 79  LYS A C   1 
ATOM   514   O O   . LYS A 1 70  ? -59.931 -2.299  -22.647  1.00 125.39 ? 79  LYS A O   1 
ATOM   515   C CB  . LYS A 1 70  ? -58.911 -2.966  -25.442  1.00 120.81 ? 79  LYS A CB  1 
ATOM   516   N N   . LYS A 1 71  ? -61.757 -3.233  -23.578  1.00 129.07 ? 80  LYS A N   1 
ATOM   517   C CA  . LYS A 1 71  ? -62.703 -2.474  -22.768  1.00 132.01 ? 80  LYS A CA  1 
ATOM   518   C C   . LYS A 1 71  ? -63.259 -3.292  -21.604  1.00 133.01 ? 80  LYS A C   1 
ATOM   519   O O   . LYS A 1 71  ? -63.423 -2.779  -20.497  1.00 135.17 ? 80  LYS A O   1 
ATOM   520   C CB  . LYS A 1 71  ? -63.851 -1.953  -23.637  1.00 133.55 ? 80  LYS A CB  1 
ATOM   521   N N   . SER A 1 72  ? -63.544 -4.564  -21.858  1.00 146.33 ? 81  SER A N   1 
ATOM   522   C CA  . SER A 1 72  ? -64.163 -5.422  -20.853  1.00 147.50 ? 81  SER A CA  1 
ATOM   523   C C   . SER A 1 72  ? -63.139 -6.209  -20.037  1.00 146.48 ? 81  SER A C   1 
ATOM   524   O O   . SER A 1 72  ? -63.489 -6.852  -19.048  1.00 147.76 ? 81  SER A O   1 
ATOM   525   C CB  . SER A 1 72  ? -65.153 -6.384  -21.513  1.00 147.46 ? 81  SER A CB  1 
ATOM   526   O OG  . SER A 1 72  ? -64.503 -7.208  -22.464  1.00 144.96 ? 81  SER A OG  1 
ATOM   527   N N   . VAL A 1 73  ? -61.879 -6.155  -20.455  1.00 130.25 ? 82  VAL A N   1 
ATOM   528   C CA  . VAL A 1 73  ? -60.818 -6.906  -19.790  1.00 129.54 ? 82  VAL A CA  1 
ATOM   529   C C   . VAL A 1 73  ? -60.728 -6.583  -18.299  1.00 131.95 ? 82  VAL A C   1 
ATOM   530   O O   . VAL A 1 73  ? -60.529 -7.474  -17.473  1.00 132.57 ? 82  VAL A O   1 
ATOM   531   C CB  . VAL A 1 73  ? -59.448 -6.659  -20.453  1.00 127.61 ? 82  VAL A CB  1 
ATOM   532   C CG1 . VAL A 1 73  ? -59.155 -5.168  -20.534  1.00 128.42 ? 82  VAL A CG1 1 
ATOM   533   C CG2 . VAL A 1 73  ? -58.348 -7.392  -19.694  1.00 127.53 ? 82  VAL A CG2 1 
ATOM   534   N N   . ASN A 1 74  ? -60.880 -5.308  -17.960  1.00 136.61 ? 83  ASN A N   1 
ATOM   535   C CA  . ASN A 1 74  ? -60.804 -4.875  -16.570  1.00 139.38 ? 83  ASN A CA  1 
ATOM   536   C C   . ASN A 1 74  ? -61.924 -5.455  -15.711  1.00 141.39 ? 83  ASN A C   1 
ATOM   537   O O   . ASN A 1 74  ? -61.727 -5.737  -14.529  1.00 143.30 ? 83  ASN A O   1 
ATOM   538   C CB  . ASN A 1 74  ? -60.802 -3.348  -16.485  1.00 141.19 ? 83  ASN A CB  1 
ATOM   539   C CG  . ASN A 1 74  ? -59.511 -2.743  -16.990  1.00 140.01 ? 83  ASN A CG  1 
ATOM   540   O OD1 . ASN A 1 74  ? -58.422 -3.219  -16.669  1.00 139.39 ? 83  ASN A OD1 1 
ATOM   541   N ND2 . ASN A 1 74  ? -59.623 -1.685  -17.784  1.00 140.04 ? 83  ASN A ND2 1 
ATOM   542   N N   . THR A 1 75  ? -63.096 -5.632  -16.310  1.00 136.61 ? 84  THR A N   1 
ATOM   543   C CA  . THR A 1 75  ? -64.231 -6.215  -15.606  1.00 138.64 ? 84  THR A CA  1 
ATOM   544   C C   . THR A 1 75  ? -63.920 -7.647  -15.183  1.00 137.99 ? 84  THR A C   1 
ATOM   545   O O   . THR A 1 75  ? -64.113 -8.020  -14.026  1.00 140.18 ? 84  THR A O   1 
ATOM   546   C CB  . THR A 1 75  ? -65.500 -6.214  -16.479  1.00 138.78 ? 84  THR A CB  1 
ATOM   547   O OG1 . THR A 1 75  ? -65.815 -4.871  -16.867  1.00 139.87 ? 84  THR A OG1 1 
ATOM   548   C CG2 . THR A 1 75  ? -66.674 -6.804  -15.713  1.00 141.25 ? 84  THR A CG2 1 
ATOM   549   N N   . ILE A 1 76  ? -63.432 -8.441  -16.130  1.00 132.09 ? 85  ILE A N   1 
ATOM   550   C CA  . ILE A 1 76  ? -63.101 -9.837  -15.870  1.00 131.62 ? 85  ILE A CA  1 
ATOM   551   C C   . ILE A 1 76  ? -62.013 -9.976  -14.811  1.00 132.57 ? 85  ILE A C   1 
ATOM   552   O O   . ILE A 1 76  ? -62.207 -10.642 -13.795  1.00 134.59 ? 85  ILE A O   1 
ATOM   553   C CB  . ILE A 1 76  ? -62.644 -10.555 -17.153  1.00 128.79 ? 85  ILE A CB  1 
ATOM   554   C CG1 . ILE A 1 76  ? -63.796 -10.638 -18.156  1.00 128.48 ? 85  ILE A CG1 1 
ATOM   555   C CG2 . ILE A 1 76  ? -62.123 -11.945 -16.826  1.00 128.70 ? 85  ILE A CG2 1 
ATOM   556   C CD1 . ILE A 1 76  ? -64.977 -11.440 -17.662  1.00 130.55 ? 85  ILE A CD1 1 
ATOM   557   N N   . THR A 1 77  ? -60.870 -9.344  -15.053  1.00 131.66 ? 86  THR A N   1 
ATOM   558   C CA  . THR A 1 77  ? -59.739 -9.427  -14.134  1.00 132.86 ? 86  THR A CA  1 
ATOM   559   C C   . THR A 1 77  ? -60.122 -9.016  -12.716  1.00 136.36 ? 86  THR A C   1 
ATOM   560   O O   . THR A 1 77  ? -59.590 -9.546  -11.742  1.00 138.25 ? 86  THR A O   1 
ATOM   561   C CB  . THR A 1 77  ? -58.565 -8.548  -14.604  1.00 131.69 ? 86  THR A CB  1 
ATOM   562   O OG1 . THR A 1 77  ? -58.964 -7.172  -14.610  1.00 132.60 ? 86  THR A OG1 1 
ATOM   563   C CG2 . THR A 1 77  ? -58.126 -8.948  -16.002  1.00 128.46 ? 86  THR A CG2 1 
ATOM   564   N N   . SER A 1 78  ? -61.049 -8.070  -12.607  1.00 148.03 ? 87  SER A N   1 
ATOM   565   C CA  . SER A 1 78  ? -61.460 -7.550  -11.308  1.00 151.68 ? 87  SER A CA  1 
ATOM   566   C C   . SER A 1 78  ? -62.375 -8.522  -10.568  1.00 153.51 ? 87  SER A C   1 
ATOM   567   O O   . SER A 1 78  ? -62.097 -8.905  -9.431   1.00 156.04 ? 87  SER A O   1 
ATOM   568   C CB  . SER A 1 78  ? -62.148 -6.194  -11.469  1.00 152.78 ? 87  SER A CB  1 
ATOM   569   O OG  . SER A 1 78  ? -62.389 -5.592  -10.210  1.00 156.63 ? 87  SER A OG  1 
ATOM   570   N N   . PHE A 1 79  ? -63.467 -8.915  -11.216  1.00 141.79 ? 88  PHE A N   1 
ATOM   571   C CA  . PHE A 1 79  ? -64.424 -9.837  -10.614  1.00 143.65 ? 88  PHE A CA  1 
ATOM   572   C C   . PHE A 1 79  ? -63.786 -11.180 -10.277  1.00 143.50 ? 88  PHE A C   1 
ATOM   573   O O   . PHE A 1 79  ? -63.961 -11.699 -9.175   1.00 146.30 ? 88  PHE A O   1 
ATOM   574   C CB  . PHE A 1 79  ? -65.627 -10.044 -11.536  1.00 142.71 ? 88  PHE A CB  1 
ATOM   575   C CG  . PHE A 1 79  ? -66.688 -8.991  -11.394  1.00 144.78 ? 88  PHE A CG  1 
ATOM   576   C CD1 . PHE A 1 79  ? -67.832 -9.239  -10.654  1.00 147.81 ? 88  PHE A CD1 1 
ATOM   577   C CD2 . PHE A 1 79  ? -66.541 -7.753  -11.996  1.00 144.05 ? 88  PHE A CD2 1 
ATOM   578   C CE1 . PHE A 1 79  ? -68.811 -8.273  -10.520  1.00 150.11 ? 88  PHE A CE1 1 
ATOM   579   C CE2 . PHE A 1 79  ? -67.516 -6.783  -11.865  1.00 146.41 ? 88  PHE A CE2 1 
ATOM   580   C CZ  . PHE A 1 79  ? -68.652 -7.043  -11.126  1.00 149.46 ? 88  PHE A CZ  1 
ATOM   581   N N   . CYS A 1 80  ? -63.047 -11.739 -11.230  1.00 167.97 ? 89  CYS A N   1 
ATOM   582   C CA  . CYS A 1 80  ? -62.390 -13.026 -11.031  1.00 167.96 ? 89  CYS A CA  1 
ATOM   583   C C   . CYS A 1 80  ? -61.399 -12.977 -9.873   1.00 170.26 ? 89  CYS A C   1 
ATOM   584   O O   . CYS A 1 80  ? -61.132 -13.991 -9.230   1.00 171.98 ? 89  CYS A O   1 
ATOM   585   C CB  . CYS A 1 80  ? -61.685 -13.471 -12.313  1.00 164.61 ? 89  CYS A CB  1 
ATOM   586   S SG  . CYS A 1 80  ? -62.805 -13.833 -13.685  1.00 162.55 ? 89  CYS A SG  1 
ATOM   587   N N   . GLY A 1 81  ? -60.857 -11.792 -9.613   1.00 143.28 ? 90  GLY A N   1 
ATOM   588   C CA  . GLY A 1 81  ? -59.915 -11.612 -8.525   1.00 145.95 ? 90  GLY A CA  1 
ATOM   589   C C   . GLY A 1 81  ? -60.613 -11.467 -7.188   1.00 150.01 ? 90  GLY A C   1 
ATOM   590   O O   . GLY A 1 81  ? -60.099 -11.910 -6.154   1.00 152.97 ? 90  GLY A O   1 
ATOM   591   N N   . THR A 1 82  ? -61.788 -10.845 -7.208   1.00 152.58 ? 91  THR A N   1 
ATOM   592   C CA  . THR A 1 82  ? -62.557 -10.633 -5.987   1.00 156.61 ? 91  THR A CA  1 
ATOM   593   C C   . THR A 1 82  ? -63.299 -11.899 -5.573   1.00 157.96 ? 91  THR A C   1 
ATOM   594   O O   . THR A 1 82  ? -63.316 -12.266 -4.400   1.00 161.56 ? 91  THR A O   1 
ATOM   595   C CB  . THR A 1 82  ? -63.569 -9.487  -6.152   1.00 157.13 ? 91  THR A CB  1 
ATOM   596   O OG1 . THR A 1 82  ? -62.867 -8.264  -6.396   1.00 156.65 ? 91  THR A OG1 1 
ATOM   597   C CG2 . THR A 1 82  ? -64.419 -9.338  -4.905   1.00 161.54 ? 91  THR A CG2 1 
ATOM   598   N N   . LEU A 1 83  ? -63.917 -12.562 -6.544   1.00 172.48 ? 92  LEU A N   1 
ATOM   599   C CA  . LEU A 1 83  ? -64.711 -13.755 -6.275   1.00 173.84 ? 92  LEU A CA  1 
ATOM   600   C C   . LEU A 1 83  ? -63.872 -15.026 -6.361   1.00 173.28 ? 92  LEU A C   1 
ATOM   601   O O   . LEU A 1 83  ? -64.403 -16.134 -6.286   1.00 174.24 ? 92  LEU A O   1 
ATOM   602   C CB  . LEU A 1 83  ? -65.894 -13.836 -7.242   1.00 172.14 ? 92  LEU A CB  1 
ATOM   603   C CG  . LEU A 1 83  ? -66.824 -12.621 -7.265   1.00 172.99 ? 92  LEU A CG  1 
ATOM   604   C CD1 . LEU A 1 83  ? -67.979 -12.852 -8.226   1.00 171.84 ? 92  LEU A CD1 1 
ATOM   605   C CD2 . LEU A 1 83  ? -67.340 -12.311 -5.869   1.00 177.38 ? 92  LEU A CD2 1 
ATOM   606   N N   . HIS A 1 84  ? -62.562 -14.860 -6.515   1.00 157.88 ? 93  HIS A N   1 
ATOM   607   C CA  . HIS A 1 84  ? -61.642 -15.992 -6.571   1.00 157.79 ? 93  HIS A CA  1 
ATOM   608   C C   . HIS A 1 84  ? -62.036 -17.007 -7.640   1.00 155.42 ? 93  HIS A C   1 
ATOM   609   O O   . HIS A 1 84  ? -61.781 -18.202 -7.498   1.00 156.55 ? 93  HIS A O   1 
ATOM   610   C CB  . HIS A 1 84  ? -61.549 -16.669 -5.203   1.00 162.24 ? 93  HIS A CB  1 
ATOM   611   C CG  . HIS A 1 84  ? -60.687 -15.937 -4.224   1.00 164.86 ? 93  HIS A CG  1 
ATOM   612   N ND1 . HIS A 1 84  ? -60.828 -14.588 -3.969   1.00 165.24 ? 93  HIS A ND1 1 
ATOM   613   C CD2 . HIS A 1 84  ? -59.677 -16.363 -3.430   1.00 167.71 ? 93  HIS A CD2 1 
ATOM   614   C CE1 . HIS A 1 84  ? -59.941 -14.217 -3.066   1.00 168.18 ? 93  HIS A CE1 1 
ATOM   615   N NE2 . HIS A 1 84  ? -59.228 -15.277 -2.721   1.00 169.75 ? 93  HIS A NE2 1 
ATOM   616   N N   . VAL A 1 85  ? -62.658 -16.522 -8.709   1.00 149.16 ? 94  VAL A N   1 
ATOM   617   C CA  . VAL A 1 85  ? -63.049 -17.378 -9.820   1.00 147.09 ? 94  VAL A CA  1 
ATOM   618   C C   . VAL A 1 85  ? -61.948 -17.423 -10.873  1.00 143.94 ? 94  VAL A C   1 
ATOM   619   O O   . VAL A 1 85  ? -61.396 -16.389 -11.250  1.00 142.11 ? 94  VAL A O   1 
ATOM   620   C CB  . VAL A 1 85  ? -64.354 -16.893 -10.475  1.00 146.17 ? 94  VAL A CB  1 
ATOM   621   C CG1 . VAL A 1 85  ? -64.709 -17.770 -11.665  1.00 144.40 ? 94  VAL A CG1 1 
ATOM   622   C CG2 . VAL A 1 85  ? -65.481 -16.881 -9.455   1.00 149.57 ? 94  VAL A CG2 1 
ATOM   623   N N   . SER A 1 86  ? -61.627 -18.624 -11.341  1.00 142.95 ? 95  SER A N   1 
ATOM   624   C CA  . SER A 1 86  ? -60.591 -18.797 -12.354  1.00 140.34 ? 95  SER A CA  1 
ATOM   625   C C   . SER A 1 86  ? -61.133 -18.510 -13.751  1.00 137.35 ? 95  SER A C   1 
ATOM   626   O O   . SER A 1 86  ? -62.224 -18.958 -14.107  1.00 137.72 ? 95  SER A O   1 
ATOM   627   C CB  . SER A 1 86  ? -60.011 -20.211 -12.288  1.00 141.73 ? 95  SER A CB  1 
ATOM   628   O OG  . SER A 1 86  ? -59.437 -20.463 -11.015  1.00 144.87 ? 95  SER A OG  1 
ATOM   629   N N   . PHE A 1 87  ? -60.366 -17.760 -14.538  1.00 142.06 ? 96  PHE A N   1 
ATOM   630   C CA  . PHE A 1 87  ? -60.785 -17.381 -15.883  1.00 139.44 ? 96  PHE A CA  1 
ATOM   631   C C   . PHE A 1 87  ? -59.716 -17.721 -16.917  1.00 137.30 ? 96  PHE A C   1 
ATOM   632   O O   . PHE A 1 87  ? -58.657 -17.095 -16.957  1.00 136.27 ? 96  PHE A O   1 
ATOM   633   C CB  . PHE A 1 87  ? -61.109 -15.887 -15.940  1.00 138.57 ? 96  PHE A CB  1 
ATOM   634   C CG  . PHE A 1 87  ? -61.730 -15.447 -17.237  1.00 136.59 ? 96  PHE A CG  1 
ATOM   635   C CD1 . PHE A 1 87  ? -63.102 -15.517 -17.420  1.00 137.58 ? 96  PHE A CD1 1 
ATOM   636   C CD2 . PHE A 1 87  ? -60.946 -14.955 -18.269  1.00 134.13 ? 96  PHE A CD2 1 
ATOM   637   C CE1 . PHE A 1 87  ? -63.681 -15.109 -18.610  1.00 136.29 ? 96  PHE A CE1 1 
ATOM   638   C CE2 . PHE A 1 87  ? -61.520 -14.546 -19.461  1.00 132.72 ? 96  PHE A CE2 1 
ATOM   639   C CZ  . PHE A 1 87  ? -62.888 -14.624 -19.631  1.00 133.88 ? 96  PHE A CZ  1 
ATOM   640   N N   . ILE A 1 88  ? -60.001 -18.715 -17.754  1.00 138.53 ? 97  ILE A N   1 
ATOM   641   C CA  . ILE A 1 88  ? -59.086 -19.109 -18.819  1.00 136.81 ? 97  ILE A CA  1 
ATOM   642   C C   . ILE A 1 88  ? -59.477 -18.432 -20.128  1.00 134.50 ? 97  ILE A C   1 
ATOM   643   O O   . ILE A 1 88  ? -60.635 -18.488 -20.542  1.00 134.83 ? 97  ILE A O   1 
ATOM   644   C CB  . ILE A 1 88  ? -59.079 -20.637 -19.027  1.00 138.27 ? 97  ILE A CB  1 
ATOM   645   C CG1 . ILE A 1 88  ? -58.669 -21.355 -17.740  1.00 141.02 ? 97  ILE A CG1 1 
ATOM   646   C CG2 . ILE A 1 88  ? -58.153 -21.018 -20.170  1.00 136.76 ? 97  ILE A CG2 1 
ATOM   647   C CD1 . ILE A 1 88  ? -59.796 -21.545 -16.750  1.00 143.38 ? 97  ILE A CD1 1 
ATOM   648   N N   . THR A 1 89  ? -58.510 -17.794 -20.781  1.00 132.97 ? 98  THR A N   1 
ATOM   649   C CA  . THR A 1 89  ? -58.789 -17.054 -22.006  1.00 131.02 ? 98  THR A CA  1 
ATOM   650   C C   . THR A 1 89  ? -57.625 -17.089 -22.992  1.00 129.31 ? 98  THR A C   1 
ATOM   651   O O   . THR A 1 89  ? -56.464 -16.980 -22.598  1.00 129.16 ? 98  THR A O   1 
ATOM   652   C CB  . THR A 1 89  ? -59.139 -15.584 -21.705  1.00 130.57 ? 98  THR A CB  1 
ATOM   653   O OG1 . THR A 1 89  ? -59.414 -14.894 -22.930  1.00 129.06 ? 98  THR A OG1 1 
ATOM   654   C CG2 . THR A 1 89  ? -57.985 -14.897 -20.987  1.00 130.41 ? 98  THR A CG2 1 
ATOM   655   N N   . PRO A 1 90  ? -57.942 -17.254 -24.284  1.00 121.46 ? 99  PRO A N   1 
ATOM   656   C CA  . PRO A 1 90  ? -56.960 -17.217 -25.371  1.00 119.96 ? 99  PRO A CA  1 
ATOM   657   C C   . PRO A 1 90  ? -56.648 -15.783 -25.788  1.00 118.34 ? 99  PRO A C   1 
ATOM   658   O O   . PRO A 1 90  ? -55.703 -15.558 -26.543  1.00 117.16 ? 99  PRO A O   1 
ATOM   659   C CB  . PRO A 1 90  ? -57.678 -17.944 -26.519  1.00 120.26 ? 99  PRO A CB  1 
ATOM   660   C CG  . PRO A 1 90  ? -58.903 -18.574 -25.904  1.00 122.17 ? 99  PRO A CG  1 
ATOM   661   C CD  . PRO A 1 90  ? -59.261 -17.690 -24.762  1.00 122.38 ? 99  PRO A CD  1 
ATOM   662   N N   . SER A 1 91  ? -57.437 -14.831 -25.300  1.00 131.22 ? 100 SER A N   1 
ATOM   663   C CA  . SER A 1 91  ? -57.263 -13.426 -25.662  1.00 130.20 ? 100 SER A CA  1 
ATOM   664   C C   . SER A 1 91  ? -55.888 -12.893 -25.270  1.00 129.61 ? 100 SER A C   1 
ATOM   665   O O   . SER A 1 91  ? -55.087 -13.598 -24.655  1.00 130.14 ? 100 SER A O   1 
ATOM   666   C CB  . SER A 1 91  ? -58.359 -12.566 -25.027  1.00 131.22 ? 100 SER A CB  1 
ATOM   667   O OG  . SER A 1 91  ? -59.629 -12.868 -25.580  1.00 131.95 ? 100 SER A OG  1 
ATOM   668   N N   . PHE A 1 92  ? -55.624 -11.642 -25.633  1.00 126.58 ? 101 PHE A N   1 
ATOM   669   C CA  . PHE A 1 92  ? -54.339 -11.015 -25.349  1.00 126.32 ? 101 PHE A CA  1 
ATOM   670   C C   . PHE A 1 92  ? -54.031 -11.023 -23.856  1.00 127.86 ? 101 PHE A C   1 
ATOM   671   O O   . PHE A 1 92  ? -54.931 -10.866 -23.032  1.00 129.03 ? 101 PHE A O   1 
ATOM   672   C CB  . PHE A 1 92  ? -54.312 -9.581  -25.882  1.00 125.87 ? 101 PHE A CB  1 
ATOM   673   C CG  . PHE A 1 92  ? -55.315 -8.672  -25.232  1.00 127.04 ? 101 PHE A CG  1 
ATOM   674   C CD1 . PHE A 1 92  ? -54.983 -7.952  -24.096  1.00 128.35 ? 101 PHE A CD1 1 
ATOM   675   C CD2 . PHE A 1 92  ? -56.588 -8.533  -25.759  1.00 127.27 ? 101 PHE A CD2 1 
ATOM   676   C CE1 . PHE A 1 92  ? -55.903 -7.113  -23.495  1.00 129.79 ? 101 PHE A CE1 1 
ATOM   677   C CE2 . PHE A 1 92  ? -57.512 -7.695  -25.164  1.00 128.72 ? 101 PHE A CE2 1 
ATOM   678   C CZ  . PHE A 1 92  ? -57.170 -6.984  -24.030  1.00 129.95 ? 101 PHE A CZ  1 
ATOM   679   N N   . PRO A 1 93  ? -52.750 -11.210 -23.507  1.00 115.04 ? 102 PRO A N   1 
ATOM   680   C CA  . PRO A 1 93  ? -52.297 -11.226 -22.112  1.00 116.98 ? 102 PRO A CA  1 
ATOM   681   C C   . PRO A 1 93  ? -52.601 -9.912  -21.404  1.00 118.03 ? 102 PRO A C   1 
ATOM   682   O O   . PRO A 1 93  ? -52.553 -8.852  -22.027  1.00 117.29 ? 102 PRO A O   1 
ATOM   683   C CB  . PRO A 1 93  ? -50.782 -11.411 -22.238  1.00 117.17 ? 102 PRO A CB  1 
ATOM   684   C CG  . PRO A 1 93  ? -50.584 -12.043 -23.571  1.00 115.43 ? 102 PRO A CG  1 
ATOM   685   C CD  . PRO A 1 93  ? -51.646 -11.459 -24.448  1.00 113.98 ? 102 PRO A CD  1 
ATOM   686   N N   . THR A 1 94  ? -52.910 -9.986  -20.113  1.00 147.86 ? 103 THR A N   1 
ATOM   687   C CA  . THR A 1 94  ? -53.205 -8.794  -19.329  1.00 149.44 ? 103 THR A CA  1 
ATOM   688   C C   . THR A 1 94  ? -51.937 -7.994  -19.059  1.00 150.46 ? 103 THR A C   1 
ATOM   689   O O   . THR A 1 94  ? -50.875 -8.563  -18.804  1.00 151.13 ? 103 THR A O   1 
ATOM   690   C CB  . THR A 1 94  ? -53.871 -9.148  -17.985  1.00 151.78 ? 103 THR A CB  1 
ATOM   691   O OG1 . THR A 1 94  ? -52.969 -9.930  -17.192  1.00 153.34 ? 103 THR A OG1 1 
ATOM   692   C CG2 . THR A 1 94  ? -55.155 -9.932  -18.213  1.00 151.16 ? 103 THR A CG2 1 
ATOM   693   N N   . ASP A 1 95  ? -52.055 -6.672  -19.116  1.00 237.81 ? 104 ASP A N   1 
ATOM   694   C CA  . ASP A 1 95  ? -50.921 -5.792  -18.866  1.00 239.21 ? 104 ASP A CA  1 
ATOM   695   C C   . ASP A 1 95  ? -50.663 -5.642  -17.371  1.00 242.54 ? 104 ASP A C   1 
ATOM   696   O O   . ASP A 1 95  ? -50.962 -4.603  -16.782  1.00 244.54 ? 104 ASP A O   1 
ATOM   697   C CB  . ASP A 1 95  ? -51.158 -4.419  -19.500  1.00 238.97 ? 104 ASP A CB  1 
ATOM   698   C CG  . ASP A 1 95  ? -51.320 -4.493  -21.005  1.00 236.13 ? 104 ASP A CG  1 
ATOM   699   O OD1 . ASP A 1 95  ? -51.103 -5.583  -21.575  1.00 234.38 ? 104 ASP A OD1 1 
ATOM   700   O OD2 . ASP A 1 95  ? -51.664 -3.460  -21.618  1.00 236.00 ? 104 ASP A OD2 1 
ATOM   701   N N   . GLY A 1 96  ? -50.105 -6.684  -16.764  1.00 146.35 ? 105 GLY A N   1 
ATOM   702   C CA  . GLY A 1 96  ? -49.816 -6.673  -15.342  1.00 149.91 ? 105 GLY A CA  1 
ATOM   703   C C   . GLY A 1 96  ? -49.874 -8.057  -14.726  1.00 150.72 ? 105 GLY A C   1 
ATOM   704   O O   . GLY A 1 96  ? -49.698 -9.062  -15.415  1.00 148.81 ? 105 GLY A O   1 
ATOM   705   N N   . THR A 1 97  ? -50.124 -8.108  -13.421  1.00 165.82 ? 106 THR A N   1 
ATOM   706   C CA  . THR A 1 97  ? -50.187 -9.374  -12.701  1.00 167.31 ? 106 THR A CA  1 
ATOM   707   C C   . THR A 1 97  ? -51.550 -9.573  -12.044  1.00 168.08 ? 106 THR A C   1 
ATOM   708   O O   . THR A 1 97  ? -51.713 -9.339  -10.847  1.00 171.43 ? 106 THR A O   1 
ATOM   709   C CB  . THR A 1 97  ? -49.085 -9.466  -11.626  1.00 171.33 ? 106 THR A CB  1 
ATOM   710   O OG1 . THR A 1 97  ? -49.291 -8.450  -10.637  1.00 174.40 ? 106 THR A OG1 1 
ATOM   711   C CG2 . THR A 1 97  ? -47.713 -9.280  -12.255  1.00 171.00 ? 106 THR A CG2 1 
ATOM   712   N N   . HIS A 1 98  ? -52.525 -10.008 -12.835  1.00 188.38 ? 107 HIS A N   1 
ATOM   713   C CA  . HIS A 1 98  ? -53.877 -10.224 -12.333  1.00 189.07 ? 107 HIS A CA  1 
ATOM   714   C C   . HIS A 1 98  ? -54.118 -11.693 -11.994  1.00 189.76 ? 107 HIS A C   1 
ATOM   715   O O   . HIS A 1 98  ? -54.133 -12.546 -12.883  1.00 187.54 ? 107 HIS A O   1 
ATOM   716   C CB  . HIS A 1 98  ? -54.911 -9.740  -13.352  1.00 186.32 ? 107 HIS A CB  1 
ATOM   717   C CG  . HIS A 1 98  ? -54.764 -8.295  -13.722  1.00 185.95 ? 107 HIS A CG  1 
ATOM   718   N ND1 . HIS A 1 98  ? -54.007 -7.876  -14.793  1.00 183.72 ? 107 HIS A ND1 1 
ATOM   719   C CD2 . HIS A 1 98  ? -55.277 -7.176  -13.160  1.00 187.86 ? 107 HIS A CD2 1 
ATOM   720   C CE1 . HIS A 1 98  ? -54.060 -6.557  -14.878  1.00 184.27 ? 107 HIS A CE1 1 
ATOM   721   N NE2 . HIS A 1 98  ? -54.824 -6.109  -13.899  1.00 186.81 ? 107 HIS A NE2 1 
ATOM   722   N N   . PRO A 1 99  ? -54.307 -11.988 -10.699  1.00 164.54 ? 108 PRO A N   1 
ATOM   723   C CA  . PRO A 1 99  ? -54.536 -13.351 -10.208  1.00 166.01 ? 108 PRO A CA  1 
ATOM   724   C C   . PRO A 1 99  ? -55.843 -13.941 -10.728  1.00 164.32 ? 108 PRO A C   1 
ATOM   725   O O   . PRO A 1 99  ? -56.714 -13.203 -11.187  1.00 162.79 ? 108 PRO A O   1 
ATOM   726   C CB  . PRO A 1 99  ? -54.618 -13.166 -8.688   1.00 170.38 ? 108 PRO A CB  1 
ATOM   727   C CG  . PRO A 1 99  ? -53.932 -11.868 -8.416   1.00 171.42 ? 108 PRO A CG  1 
ATOM   728   C CD  . PRO A 1 99  ? -54.241 -11.011 -9.600   1.00 167.74 ? 108 PRO A CD  1 
ATOM   729   N N   . PHE A 1 100 ? -55.966 -15.262 -10.650  1.00 152.59 ? 109 PHE A N   1 
ATOM   730   C CA  . PHE A 1 100 ? -57.173 -15.962 -11.083  1.00 151.64 ? 109 PHE A CA  1 
ATOM   731   C C   . PHE A 1 100 ? -57.473 -15.755 -12.564  1.00 147.86 ? 109 PHE A C   1 
ATOM   732   O O   . PHE A 1 100 ? -58.634 -15.712 -12.972  1.00 147.04 ? 109 PHE A O   1 
ATOM   733   C CB  . PHE A 1 100 ? -58.374 -15.550 -10.230  1.00 153.65 ? 109 PHE A CB  1 
ATOM   734   C CG  . PHE A 1 100 ? -58.309 -16.049 -8.817   1.00 157.74 ? 109 PHE A CG  1 
ATOM   735   C CD1 . PHE A 1 100 ? -58.734 -17.328 -8.501   1.00 159.42 ? 109 PHE A CD1 1 
ATOM   736   C CD2 . PHE A 1 100 ? -57.819 -15.242 -7.804   1.00 160.30 ? 109 PHE A CD2 1 
ATOM   737   C CE1 . PHE A 1 100 ? -58.673 -17.793 -7.203   1.00 163.52 ? 109 PHE A CE1 1 
ATOM   738   C CE2 . PHE A 1 100 ? -57.756 -15.701 -6.503   1.00 164.48 ? 109 PHE A CE2 1 
ATOM   739   C CZ  . PHE A 1 100 ? -58.183 -16.978 -6.202   1.00 166.05 ? 109 PHE A CZ  1 
ATOM   740   N N   . VAL A 1 101 ? -56.419 -15.629 -13.364  1.00 135.85 ? 110 VAL A N   1 
ATOM   741   C CA  . VAL A 1 101 ? -56.565 -15.493 -14.807  1.00 132.55 ? 110 VAL A CA  1 
ATOM   742   C C   . VAL A 1 101 ? -55.519 -16.331 -15.535  1.00 131.54 ? 110 VAL A C   1 
ATOM   743   O O   . VAL A 1 101 ? -54.318 -16.142 -15.344  1.00 132.01 ? 110 VAL A O   1 
ATOM   744   C CB  . VAL A 1 101 ? -56.439 -14.026 -15.259  1.00 130.93 ? 110 VAL A CB  1 
ATOM   745   C CG1 . VAL A 1 101 ? -56.524 -13.932 -16.774  1.00 127.86 ? 110 VAL A CG1 1 
ATOM   746   C CG2 . VAL A 1 101 ? -57.515 -13.174 -14.608  1.00 132.21 ? 110 VAL A CG2 1 
ATOM   747   N N   . ILE A 1 102 ? -55.984 -17.260 -16.364  1.00 130.88 ? 111 ILE A N   1 
ATOM   748   C CA  . ILE A 1 102 ? -55.091 -18.110 -17.141  1.00 130.17 ? 111 ILE A CA  1 
ATOM   749   C C   . ILE A 1 102 ? -55.093 -17.683 -18.606  1.00 127.14 ? 111 ILE A C   1 
ATOM   750   O O   . ILE A 1 102 ? -56.128 -17.716 -19.271  1.00 126.14 ? 111 ILE A O   1 
ATOM   751   C CB  . ILE A 1 102 ? -55.496 -19.591 -17.037  1.00 131.89 ? 111 ILE A CB  1 
ATOM   752   C CG1 . ILE A 1 102 ? -55.592 -20.012 -15.569  1.00 135.25 ? 111 ILE A CG1 1 
ATOM   753   C CG2 . ILE A 1 102 ? -54.505 -20.467 -17.783  1.00 131.70 ? 111 ILE A CG2 1 
ATOM   754   C CD1 . ILE A 1 102 ? -54.315 -19.794 -14.787  1.00 136.93 ? 111 ILE A CD1 1 
ATOM   755   N N   . GLN A 1 103 ? -53.927 -17.284 -19.102  1.00 155.95 ? 112 GLN A N   1 
ATOM   756   C CA  . GLN A 1 103 ? -53.814 -16.742 -20.452  1.00 153.31 ? 112 GLN A CA  1 
ATOM   757   C C   . GLN A 1 103 ? -53.132 -17.718 -21.407  1.00 152.82 ? 112 GLN A C   1 
ATOM   758   O O   . GLN A 1 103 ? -51.979 -18.097 -21.204  1.00 153.77 ? 112 GLN A O   1 
ATOM   759   C CB  . GLN A 1 103 ? -53.062 -15.411 -20.418  1.00 152.50 ? 112 GLN A CB  1 
ATOM   760   C CG  . GLN A 1 103 ? -53.699 -14.382 -19.496  1.00 153.36 ? 112 GLN A CG  1 
ATOM   761   C CD  . GLN A 1 103 ? -52.744 -13.275 -19.096  1.00 153.78 ? 112 GLN A CD  1 
ATOM   762   O OE1 . GLN A 1 103 ? -53.103 -12.375 -18.337  1.00 154.86 ? 112 GLN A OE1 1 
ATOM   763   N NE2 . GLN A 1 103 ? -51.518 -13.338 -19.603  1.00 153.27 ? 112 GLN A NE2 1 
ATOM   764   N N   . MET A 1 104 ? -53.855 -18.116 -22.449  1.00 141.57 ? 113 MET A N   1 
ATOM   765   C CA  . MET A 1 104 ? -53.349 -19.084 -23.418  1.00 141.46 ? 113 MET A CA  1 
ATOM   766   C C   . MET A 1 104 ? -52.371 -18.458 -24.410  1.00 139.69 ? 113 MET A C   1 
ATOM   767   O O   . MET A 1 104 ? -51.498 -19.139 -24.948  1.00 140.05 ? 113 MET A O   1 
ATOM   768   C CB  . MET A 1 104 ? -54.508 -19.736 -24.177  1.00 141.46 ? 113 MET A CB  1 
ATOM   769   C CG  . MET A 1 104 ? -55.475 -20.533 -23.312  1.00 143.56 ? 113 MET A CG  1 
ATOM   770   S SD  . MET A 1 104 ? -54.783 -22.074 -22.680  1.00 146.42 ? 113 MET A SD  1 
ATOM   771   C CE  . MET A 1 104 ? -53.997 -21.503 -21.178  1.00 147.50 ? 113 MET A CE  1 
ATOM   772   N N   . ARG A 1 105 ? -52.528 -17.161 -24.655  1.00 137.13 ? 114 ARG A N   1 
ATOM   773   C CA  . ARG A 1 105 ? -51.687 -16.463 -25.621  1.00 135.59 ? 114 ARG A CA  1 
ATOM   774   C C   . ARG A 1 105 ? -50.373 -16.008 -24.997  1.00 136.18 ? 114 ARG A C   1 
ATOM   775   O O   . ARG A 1 105 ? -50.369 -15.251 -24.027  1.00 136.79 ? 114 ARG A O   1 
ATOM   776   C CB  . ARG A 1 105 ? -52.430 -15.263 -26.213  1.00 134.06 ? 114 ARG A CB  1 
ATOM   777   N N   . PRO A 1 106 ? -49.249 -16.484 -25.550  1.00 137.95 ? 115 PRO A N   1 
ATOM   778   C CA  . PRO A 1 106 ? -47.911 -16.080 -25.105  1.00 138.85 ? 115 PRO A CA  1 
ATOM   779   C C   . PRO A 1 106 ? -47.623 -14.631 -25.481  1.00 137.49 ? 115 PRO A C   1 
ATOM   780   O O   . PRO A 1 106 ? -48.223 -14.109 -26.421  1.00 135.75 ? 115 PRO A O   1 
ATOM   781   C CB  . PRO A 1 106 ? -46.981 -17.017 -25.887  1.00 139.41 ? 115 PRO A CB  1 
ATOM   782   C CG  . PRO A 1 106 ? -47.853 -18.144 -26.353  1.00 139.51 ? 115 PRO A CG  1 
ATOM   783   C CD  . PRO A 1 106 ? -49.192 -17.529 -26.584  1.00 137.90 ? 115 PRO A CD  1 
ATOM   784   N N   . ASP A 1 107 ? -46.712 -13.992 -24.755  1.00 157.58 ? 116 ASP A N   1 
ATOM   785   C CA  . ASP A 1 107 ? -46.367 -12.600 -25.021  1.00 156.83 ? 116 ASP A CA  1 
ATOM   786   C C   . ASP A 1 107 ? -45.496 -12.484 -26.268  1.00 155.89 ? 116 ASP A C   1 
ATOM   787   O O   . ASP A 1 107 ? -44.399 -13.038 -26.324  1.00 157.07 ? 116 ASP A O   1 
ATOM   788   C CB  . ASP A 1 107 ? -45.655 -11.983 -23.816  1.00 158.98 ? 116 ASP A CB  1 
ATOM   789   C CG  . ASP A 1 107 ? -45.593 -10.469 -23.889  1.00 158.64 ? 116 ASP A CG  1 
ATOM   790   O OD1 . ASP A 1 107 ? -46.274 -9.885  -24.757  1.00 156.75 ? 116 ASP A OD1 1 
ATOM   791   O OD2 . ASP A 1 107 ? -44.866 -9.863  -23.074  1.00 160.65 ? 116 ASP A OD2 1 
ATOM   792   N N   . LEU A 1 108 ? -45.993 -11.760 -27.266  1.00 113.48 ? 117 LEU A N   1 
ATOM   793   C CA  . LEU A 1 108 ? -45.277 -11.587 -28.524  1.00 112.67 ? 117 LEU A CA  1 
ATOM   794   C C   . LEU A 1 108 ? -44.294 -10.423 -28.453  1.00 113.30 ? 117 LEU A C   1 
ATOM   795   O O   . LEU A 1 108 ? -43.364 -10.335 -29.255  1.00 113.34 ? 117 LEU A O   1 
ATOM   796   C CB  . LEU A 1 108 ? -46.263 -11.369 -29.674  1.00 110.93 ? 117 LEU A CB  1 
ATOM   797   C CG  . LEU A 1 108 ? -45.661 -11.223 -31.071  1.00 110.25 ? 117 LEU A CG  1 
ATOM   798   C CD1 . LEU A 1 108 ? -44.889 -12.476 -31.443  1.00 110.96 ? 117 LEU A CD1 1 
ATOM   799   C CD2 . LEU A 1 108 ? -46.741 -10.931 -32.098  1.00 109.06 ? 117 LEU A CD2 1 
ATOM   800   N N   . LYS A 1 109 ? -44.508 -9.535  -27.487  1.00 136.28 ? 118 LYS A N   1 
ATOM   801   C CA  . LYS A 1 109 ? -43.673 -8.348  -27.318  1.00 137.35 ? 118 LYS A CA  1 
ATOM   802   C C   . LYS A 1 109 ? -42.185 -8.667  -27.436  1.00 138.77 ? 118 LYS A C   1 
ATOM   803   O O   . LYS A 1 109 ? -41.438 -7.947  -28.098  1.00 138.93 ? 118 LYS A O   1 
ATOM   804   C CB  . LYS A 1 109 ? -43.962 -7.679  -25.972  1.00 138.96 ? 118 LYS A CB  1 
ATOM   805   N N   . GLY A 1 110 ? -41.761 -9.751  -26.794  1.00 118.59 ? 119 GLY A N   1 
ATOM   806   C CA  . GLY A 1 110 ? -40.366 -10.151 -26.816  1.00 120.51 ? 119 GLY A CA  1 
ATOM   807   C C   . GLY A 1 110 ? -39.902 -10.602 -28.187  1.00 119.43 ? 119 GLY A C   1 
ATOM   808   O O   . GLY A 1 110 ? -38.864 -10.159 -28.676  1.00 120.30 ? 119 GLY A O   1 
ATOM   809   N N   . ALA A 1 111 ? -40.676 -11.486 -28.808  1.00 117.93 ? 120 ALA A N   1 
ATOM   810   C CA  . ALA A 1 111 ? -40.323 -12.033 -30.114  1.00 117.23 ? 120 ALA A CA  1 
ATOM   811   C C   . ALA A 1 111 ? -40.239 -10.950 -31.185  1.00 115.95 ? 120 ALA A C   1 
ATOM   812   O O   . ALA A 1 111 ? -39.429 -11.042 -32.107  1.00 116.28 ? 120 ALA A O   1 
ATOM   813   C CB  . ALA A 1 111 ? -41.317 -13.111 -30.523  1.00 116.11 ? 120 ALA A CB  1 
ATOM   814   N N   . LEU A 1 112 ? -41.077 -9.926  -31.060  1.00 116.39 ? 121 LEU A N   1 
ATOM   815   C CA  . LEU A 1 112 ? -41.098 -8.837  -32.030  1.00 115.51 ? 121 LEU A CA  1 
ATOM   816   C C   . LEU A 1 112 ? -39.809 -8.026  -31.948  1.00 117.16 ? 121 LEU A C   1 
ATOM   817   O O   . LEU A 1 112 ? -39.121 -7.835  -32.950  1.00 117.29 ? 121 LEU A O   1 
ATOM   818   C CB  . LEU A 1 112 ? -42.306 -7.928  -31.793  1.00 114.51 ? 121 LEU A CB  1 
ATOM   819   C CG  . LEU A 1 112 ? -42.849 -7.139  -32.989  1.00 113.40 ? 121 LEU A CG  1 
ATOM   820   C CD1 . LEU A 1 112 ? -44.034 -6.286  -32.565  1.00 113.03 ? 121 LEU A CD1 1 
ATOM   821   C CD2 . LEU A 1 112 ? -41.775 -6.275  -33.632  1.00 114.24 ? 121 LEU A CD2 1 
ATOM   822   N N   . LEU A 1 113 ? -39.487 -7.555  -30.748  1.00 120.45 ? 122 LEU A N   1 
ATOM   823   C CA  . LEU A 1 113 ? -38.295 -6.742  -30.536  1.00 122.57 ? 122 LEU A CA  1 
ATOM   824   C C   . LEU A 1 113 ? -37.033 -7.453  -31.012  1.00 123.92 ? 122 LEU A C   1 
ATOM   825   O O   . LEU A 1 113 ? -36.123 -6.825  -31.553  1.00 125.02 ? 122 LEU A O   1 
ATOM   826   C CB  . LEU A 1 113 ? -38.158 -6.361  -29.061  1.00 124.64 ? 122 LEU A CB  1 
ATOM   827   C CG  . LEU A 1 113 ? -39.275 -5.496  -28.478  1.00 124.04 ? 122 LEU A CG  1 
ATOM   828   C CD1 . LEU A 1 113 ? -38.972 -5.140  -27.033  1.00 126.71 ? 122 LEU A CD1 1 
ATOM   829   C CD2 . LEU A 1 113 ? -39.469 -4.241  -29.312  1.00 123.42 ? 122 LEU A CD2 1 
ATOM   830   N N   . SER A 1 114 ? -36.983 -8.765  -30.806  1.00 151.77 ? 123 SER A N   1 
ATOM   831   C CA  . SER A 1 114 ? -35.831 -9.557  -31.218  1.00 153.44 ? 123 SER A CA  1 
ATOM   832   C C   . SER A 1 114 ? -35.712 -9.610  -32.737  1.00 152.17 ? 123 SER A C   1 
ATOM   833   O O   . SER A 1 114 ? -34.612 -9.550  -33.286  1.00 153.71 ? 123 SER A O   1 
ATOM   834   C CB  . SER A 1 114 ? -35.922 -10.974 -30.648  1.00 154.26 ? 123 SER A CB  1 
ATOM   835   O OG  . SER A 1 114 ? -35.885 -10.957 -29.232  1.00 156.05 ? 123 SER A OG  1 
ATOM   836   N N   . LEU A 1 115 ? -36.852 -9.721  -33.412  1.00 118.81 ? 124 LEU A N   1 
ATOM   837   C CA  . LEU A 1 115 ? -36.875 -9.795  -34.867  1.00 117.82 ? 124 LEU A CA  1 
ATOM   838   C C   . LEU A 1 115 ? -36.398 -8.489  -35.492  1.00 118.05 ? 124 LEU A C   1 
ATOM   839   O O   . LEU A 1 115 ? -35.703 -8.495  -36.507  1.00 118.66 ? 124 LEU A O   1 
ATOM   840   C CB  . LEU A 1 115 ? -38.280 -10.136 -35.368  1.00 115.61 ? 124 LEU A CB  1 
ATOM   841   C CG  . LEU A 1 115 ? -38.389 -10.470 -36.857  1.00 115.04 ? 124 LEU A CG  1 
ATOM   842   C CD1 . LEU A 1 115 ? -37.594 -11.723 -37.177  1.00 116.52 ? 124 LEU A CD1 1 
ATOM   843   C CD2 . LEU A 1 115 ? -39.839 -10.639 -37.270  1.00 113.31 ? 124 LEU A CD2 1 
ATOM   844   N N   . ILE A 1 116 ? -36.776 -7.371  -34.880  1.00 122.92 ? 125 ILE A N   1 
ATOM   845   C CA  . ILE A 1 116 ? -36.377 -6.060  -35.376  1.00 123.51 ? 125 ILE A CA  1 
ATOM   846   C C   . ILE A 1 116 ? -34.859 -5.920  -35.396  1.00 126.03 ? 125 ILE A C   1 
ATOM   847   O O   . ILE A 1 116 ? -34.284 -5.438  -36.370  1.00 126.61 ? 125 ILE A O   1 
ATOM   848   C CB  . ILE A 1 116 ? -36.980 -4.923  -34.530  1.00 123.55 ? 125 ILE A CB  1 
ATOM   849   C CG1 . ILE A 1 116 ? -38.503 -4.904  -34.671  1.00 121.37 ? 125 ILE A CG1 1 
ATOM   850   C CG2 . ILE A 1 116 ? -36.393 -3.583  -34.943  1.00 124.91 ? 125 ILE A CG2 1 
ATOM   851   C CD1 . ILE A 1 116 ? -39.166 -3.742  -33.968  1.00 121.64 ? 125 ILE A CD1 1 
ATOM   852   N N   . GLU A 1 117 ? -34.215 -6.349  -34.315  1.00 189.61 ? 126 GLU A N   1 
ATOM   853   C CA  . GLU A 1 117 ? -32.762 -6.285  -34.220  1.00 192.56 ? 126 GLU A CA  1 
ATOM   854   C C   . GLU A 1 117 ? -32.096 -7.233  -35.211  1.00 193.00 ? 126 GLU A C   1 
ATOM   855   O O   . GLU A 1 117 ? -31.021 -6.941  -35.735  1.00 194.96 ? 126 GLU A O   1 
ATOM   856   C CB  . GLU A 1 117 ? -32.296 -6.595  -32.796  1.00 194.87 ? 126 GLU A CB  1 
ATOM   857   C CG  . GLU A 1 117 ? -32.616 -5.505  -31.786  1.00 195.61 ? 126 GLU A CG  1 
ATOM   858   C CD  . GLU A 1 117 ? -31.910 -5.713  -30.460  1.00 198.84 ? 126 GLU A CD  1 
ATOM   859   O OE1 . GLU A 1 117 ? -31.297 -6.785  -30.271  1.00 200.29 ? 126 GLU A OE1 1 
ATOM   860   O OE2 . GLU A 1 117 ? -31.967 -4.802  -29.606  1.00 200.30 ? 126 GLU A OE2 1 
ATOM   861   N N   . TYR A 1 118 ? -32.738 -8.369  -35.466  1.00 126.51 ? 127 TYR A N   1 
ATOM   862   C CA  . TYR A 1 118 ? -32.209 -9.346  -36.411  1.00 127.14 ? 127 TYR A CA  1 
ATOM   863   C C   . TYR A 1 118 ? -32.060 -8.740  -37.802  1.00 126.62 ? 127 TYR A C   1 
ATOM   864   O O   . TYR A 1 118 ? -31.010 -8.866  -38.432  1.00 128.56 ? 127 TYR A O   1 
ATOM   865   C CB  . TYR A 1 118 ? -33.104 -10.585 -36.466  1.00 125.68 ? 127 TYR A CB  1 
ATOM   866   C CG  . TYR A 1 118 ? -32.778 -11.524 -37.606  1.00 126.23 ? 127 TYR A CG  1 
ATOM   867   C CD1 . TYR A 1 118 ? -33.637 -11.654 -38.691  1.00 124.33 ? 127 TYR A CD1 1 
ATOM   868   C CD2 . TYR A 1 118 ? -31.610 -12.277 -37.601  1.00 129.09 ? 127 TYR A CD2 1 
ATOM   869   C CE1 . TYR A 1 118 ? -33.344 -12.510 -39.736  1.00 125.23 ? 127 TYR A CE1 1 
ATOM   870   C CE2 . TYR A 1 118 ? -31.309 -13.135 -38.642  1.00 129.97 ? 127 TYR A CE2 1 
ATOM   871   C CZ  . TYR A 1 118 ? -32.178 -13.248 -39.707  1.00 128.01 ? 127 TYR A CZ  1 
ATOM   872   O OH  . TYR A 1 118 ? -31.883 -14.101 -40.746  1.00 129.26 ? 127 TYR A OH  1 
ATOM   873   N N   . TYR A 1 119 ? -33.115 -8.084  -38.276  1.00 125.88 ? 128 TYR A N   1 
ATOM   874   C CA  . TYR A 1 119 ? -33.078 -7.416  -39.571  1.00 125.60 ? 128 TYR A CA  1 
ATOM   875   C C   . TYR A 1 119 ? -32.319 -6.097  -39.478  1.00 127.16 ? 128 TYR A C   1 
ATOM   876   O O   . TYR A 1 119 ? -32.115 -5.416  -40.483  1.00 127.52 ? 128 TYR A O   1 
ATOM   877   C CB  . TYR A 1 119 ? -34.493 -7.170  -40.095  1.00 123.15 ? 128 TYR A CB  1 
ATOM   878   C CG  . TYR A 1 119 ? -35.260 -8.431  -40.421  1.00 121.99 ? 128 TYR A CG  1 
ATOM   879   C CD1 . TYR A 1 119 ? -36.383 -8.791  -39.692  1.00 120.40 ? 128 TYR A CD1 1 
ATOM   880   C CD2 . TYR A 1 119 ? -34.860 -9.260  -41.458  1.00 122.82 ? 128 TYR A CD2 1 
ATOM   881   C CE1 . TYR A 1 119 ? -37.087 -9.941  -39.989  1.00 119.71 ? 128 TYR A CE1 1 
ATOM   882   C CE2 . TYR A 1 119 ? -35.557 -10.412 -41.760  1.00 122.22 ? 128 TYR A CE2 1 
ATOM   883   C CZ  . TYR A 1 119 ? -36.669 -10.748 -41.023  1.00 120.68 ? 128 TYR A CZ  1 
ATOM   884   O OH  . TYR A 1 119 ? -37.365 -11.896 -41.323  1.00 120.42 ? 128 TYR A OH  1 
ATOM   885   N N   . GLN A 1 120 ? -31.907 -5.744  -38.265  1.00 128.66 ? 129 GLN A N   1 
ATOM   886   C CA  . GLN A 1 120 ? -31.150 -4.519  -38.028  1.00 130.71 ? 129 GLN A CA  1 
ATOM   887   C C   . GLN A 1 120 ? -31.896 -3.285  -38.528  1.00 129.60 ? 129 GLN A C   1 
ATOM   888   O O   . GLN A 1 120 ? -31.401 -2.547  -39.382  1.00 130.72 ? 129 GLN A O   1 
ATOM   889   C CB  . GLN A 1 120 ? -29.767 -4.612  -38.675  1.00 133.35 ? 129 GLN A CB  1 
ATOM   890   C CG  . GLN A 1 120 ? -28.908 -5.740  -38.122  1.00 135.29 ? 129 GLN A CG  1 
ATOM   891   C CD  . GLN A 1 120 ? -27.604 -5.912  -38.880  1.00 138.04 ? 129 GLN A CD  1 
ATOM   892   O OE1 . GLN A 1 120 ? -27.380 -5.271  -39.907  1.00 138.25 ? 129 GLN A OE1 1 
ATOM   893   N NE2 . GLN A 1 120 ? -26.738 -6.784  -38.377  1.00 140.49 ? 129 GLN A NE2 1 
ATOM   894   N N   . TRP A 1 121 ? -33.091 -3.071  -37.985  1.00 140.62 ? 130 TRP A N   1 
ATOM   895   C CA  . TRP A 1 121 ? -33.917 -1.927  -38.349  1.00 139.86 ? 130 TRP A CA  1 
ATOM   896   C C   . TRP A 1 121 ? -33.641 -0.745  -37.427  1.00 141.77 ? 130 TRP A C   1 
ATOM   897   O O   . TRP A 1 121 ? -33.538 -0.906  -36.211  1.00 142.49 ? 130 TRP A O   1 
ATOM   898   C CB  . TRP A 1 121 ? -35.398 -2.306  -38.284  1.00 137.24 ? 130 TRP A CB  1 
ATOM   899   C CG  . TRP A 1 121 ? -35.861 -3.133  -39.444  1.00 135.75 ? 130 TRP A CG  1 
ATOM   900   C CD1 . TRP A 1 121 ? -35.081 -3.857  -40.297  1.00 136.37 ? 130 TRP A CD1 1 
ATOM   901   C CD2 . TRP A 1 121 ? -37.216 -3.342  -39.864  1.00 133.84 ? 130 TRP A CD2 1 
ATOM   902   N NE1 . TRP A 1 121 ? -35.865 -4.492  -41.231  1.00 135.00 ? 130 TRP A NE1 1 
ATOM   903   C CE2 . TRP A 1 121 ? -37.179 -4.193  -40.985  1.00 133.47 ? 130 TRP A CE2 1 
ATOM   904   C CE3 . TRP A 1 121 ? -38.455 -2.888  -39.403  1.00 132.75 ? 130 TRP A CE3 1 
ATOM   905   C CZ2 . TRP A 1 121 ? -38.333 -4.599  -41.653  1.00 132.18 ? 130 TRP A CZ2 1 
ATOM   906   C CZ3 . TRP A 1 121 ? -39.600 -3.291  -40.066  1.00 131.41 ? 130 TRP A CZ3 1 
ATOM   907   C CH2 . TRP A 1 121 ? -39.531 -4.138  -41.178  1.00 131.17 ? 130 TRP A CH2 1 
ATOM   908   N N   . ASP A 1 122 ? -33.519 0.440   -38.013  1.00 172.73 ? 131 ASP A N   1 
ATOM   909   C CA  . ASP A 1 122 ? -33.287 1.657   -37.244  1.00 175.00 ? 131 ASP A CA  1 
ATOM   910   C C   . ASP A 1 122 ? -34.394 2.680   -37.482  1.00 174.44 ? 131 ASP A C   1 
ATOM   911   O O   . ASP A 1 122 ? -34.639 3.550   -36.647  1.00 175.83 ? 131 ASP A O   1 
ATOM   912   C CB  . ASP A 1 122 ? -31.918 2.259   -37.577  1.00 178.12 ? 131 ASP A CB  1 
ATOM   913   C CG  . ASP A 1 122 ? -31.725 2.492   -39.065  1.00 178.08 ? 131 ASP A CG  1 
ATOM   914   O OD1 . ASP A 1 122 ? -30.701 3.100   -39.441  1.00 180.75 ? 131 ASP A OD1 1 
ATOM   915   O OD2 . ASP A 1 122 ? -32.593 2.070   -39.858  1.00 175.68 ? 131 ASP A OD2 1 
ATOM   916   N N   . LYS A 1 123 ? -35.062 2.564   -38.625  1.00 126.11 ? 132 LYS A N   1 
ATOM   917   C CA  . LYS A 1 123 ? -36.174 3.446   -38.959  1.00 125.83 ? 132 LYS A CA  1 
ATOM   918   C C   . LYS A 1 123 ? -37.284 2.659   -39.642  1.00 123.19 ? 132 LYS A C   1 
ATOM   919   O O   . LYS A 1 123 ? -37.101 2.143   -40.744  1.00 122.63 ? 132 LYS A O   1 
ATOM   920   C CB  . LYS A 1 123 ? -35.706 4.589   -39.862  1.00 128.14 ? 132 LYS A CB  1 
ATOM   921   N N   . PHE A 1 124 ? -38.435 2.569   -38.983  1.00 123.88 ? 133 PHE A N   1 
ATOM   922   C CA  . PHE A 1 124 ? -39.555 1.800   -39.509  1.00 121.72 ? 133 PHE A CA  1 
ATOM   923   C C   . PHE A 1 124 ? -40.898 2.394   -39.103  1.00 121.55 ? 133 PHE A C   1 
ATOM   924   O O   . PHE A 1 124 ? -40.993 3.131   -38.121  1.00 122.68 ? 133 PHE A O   1 
ATOM   925   C CB  . PHE A 1 124 ? -39.465 0.346   -39.040  1.00 119.93 ? 133 PHE A CB  1 
ATOM   926   C CG  . PHE A 1 124 ? -39.379 0.194   -37.548  1.00 120.04 ? 133 PHE A CG  1 
ATOM   927   C CD1 . PHE A 1 124 ? -40.527 0.139   -36.776  1.00 119.11 ? 133 PHE A CD1 1 
ATOM   928   C CD2 . PHE A 1 124 ? -38.149 0.100   -36.918  1.00 121.43 ? 133 PHE A CD2 1 
ATOM   929   C CE1 . PHE A 1 124 ? -40.450 -0.003  -35.403  1.00 119.51 ? 133 PHE A CE1 1 
ATOM   930   C CE2 . PHE A 1 124 ? -38.067 -0.042  -35.545  1.00 121.98 ? 133 PHE A CE2 1 
ATOM   931   C CZ  . PHE A 1 124 ? -39.219 -0.094  -34.788  1.00 120.98 ? 133 PHE A CZ  1 
ATOM   932   N N   . ALA A 1 125 ? -41.933 2.066   -39.867  1.00 129.81 ? 134 ALA A N   1 
ATOM   933   C CA  . ALA A 1 125 ? -43.287 2.506   -39.557  1.00 129.83 ? 134 ALA A CA  1 
ATOM   934   C C   . ALA A 1 125 ? -44.013 1.435   -38.753  1.00 127.91 ? 134 ALA A C   1 
ATOM   935   O O   . ALA A 1 125 ? -43.887 0.245   -39.038  1.00 126.42 ? 134 ALA A O   1 
ATOM   936   C CB  . ALA A 1 125 ? -44.047 2.820   -40.834  1.00 130.45 ? 134 ALA A CB  1 
ATOM   937   N N   . TYR A 1 126 ? -44.770 1.859   -37.748  1.00 116.93 ? 135 TYR A N   1 
ATOM   938   C CA  . TYR A 1 126 ? -45.473 0.922   -36.880  1.00 115.45 ? 135 TYR A CA  1 
ATOM   939   C C   . TYR A 1 126 ? -46.977 1.173   -36.886  1.00 115.64 ? 135 TYR A C   1 
ATOM   940   O O   . TYR A 1 126 ? -47.488 1.966   -36.095  1.00 116.85 ? 135 TYR A O   1 
ATOM   941   C CB  . TYR A 1 126 ? -44.929 1.009   -35.452  1.00 115.94 ? 135 TYR A CB  1 
ATOM   942   C CG  . TYR A 1 126 ? -45.526 0.001   -34.496  1.00 114.68 ? 135 TYR A CG  1 
ATOM   943   C CD1 . TYR A 1 126 ? -46.516 0.371   -33.595  1.00 115.24 ? 135 TYR A CD1 1 
ATOM   944   C CD2 . TYR A 1 126 ? -45.096 -1.319  -34.489  1.00 113.29 ? 135 TYR A CD2 1 
ATOM   945   C CE1 . TYR A 1 126 ? -47.063 -0.545  -32.717  1.00 114.33 ? 135 TYR A CE1 1 
ATOM   946   C CE2 . TYR A 1 126 ? -45.636 -2.242  -33.616  1.00 112.48 ? 135 TYR A CE2 1 
ATOM   947   C CZ  . TYR A 1 126 ? -46.619 -1.851  -32.732  1.00 112.95 ? 135 TYR A CZ  1 
ATOM   948   O OH  . TYR A 1 126 ? -47.159 -2.769  -31.861  1.00 112.36 ? 135 TYR A OH  1 
ATOM   949   N N   . LEU A 1 127 ? -47.679 0.495   -37.788  1.00 113.71 ? 136 LEU A N   1 
ATOM   950   C CA  . LEU A 1 127 ? -49.129 0.606   -37.869  1.00 114.18 ? 136 LEU A CA  1 
ATOM   951   C C   . LEU A 1 127 ? -49.773 -0.323  -36.847  1.00 112.98 ? 136 LEU A C   1 
ATOM   952   O O   . LEU A 1 127 ? -49.657 -1.544  -36.949  1.00 111.53 ? 136 LEU A O   1 
ATOM   953   C CB  . LEU A 1 127 ? -49.612 0.265   -39.279  1.00 114.38 ? 136 LEU A CB  1 
ATOM   954   C CG  . LEU A 1 127 ? -48.886 0.986   -40.416  1.00 115.61 ? 136 LEU A CG  1 
ATOM   955   C CD1 . LEU A 1 127 ? -49.528 0.663   -41.755  1.00 116.33 ? 136 LEU A CD1 1 
ATOM   956   C CD2 . LEU A 1 127 ? -48.868 2.486   -40.175  1.00 117.72 ? 136 LEU A CD2 1 
ATOM   957   N N   . TYR A 1 128 ? -50.451 0.257   -35.862  1.00 124.28 ? 137 TYR A N   1 
ATOM   958   C CA  . TYR A 1 128 ? -51.009 -0.524  -34.764  1.00 123.48 ? 137 TYR A CA  1 
ATOM   959   C C   . TYR A 1 128 ? -52.528 -0.432  -34.679  1.00 124.35 ? 137 TYR A C   1 
ATOM   960   O O   . TYR A 1 128 ? -53.146 0.462   -35.257  1.00 126.00 ? 137 TYR A O   1 
ATOM   961   C CB  . TYR A 1 128 ? -50.386 -0.093  -33.434  1.00 124.04 ? 137 TYR A CB  1 
ATOM   962   C CG  . TYR A 1 128 ? -50.654 1.351   -33.070  1.00 126.28 ? 137 TYR A CG  1 
ATOM   963   C CD1 . TYR A 1 128 ? -49.826 2.368   -33.525  1.00 127.55 ? 137 TYR A CD1 1 
ATOM   964   C CD2 . TYR A 1 128 ? -51.735 1.695   -32.270  1.00 127.47 ? 137 TYR A CD2 1 
ATOM   965   C CE1 . TYR A 1 128 ? -50.067 3.687   -33.195  1.00 130.03 ? 137 TYR A CE1 1 
ATOM   966   C CE2 . TYR A 1 128 ? -51.984 3.012   -31.934  1.00 129.94 ? 137 TYR A CE2 1 
ATOM   967   C CZ  . TYR A 1 128 ? -51.146 4.003   -32.399  1.00 131.26 ? 137 TYR A CZ  1 
ATOM   968   O OH  . TYR A 1 128 ? -51.389 5.317   -32.069  1.00 134.14 ? 137 TYR A OH  1 
ATOM   969   N N   . ASP A 1 129 ? -53.119 -1.372  -33.947  1.00 157.31 ? 138 ASP A N   1 
ATOM   970   C CA  . ASP A 1 129 ? -54.555 -1.387  -33.710  1.00 158.32 ? 138 ASP A CA  1 
ATOM   971   C C   . ASP A 1 129 ? -54.806 -1.446  -32.207  1.00 158.61 ? 138 ASP A C   1 
ATOM   972   O O   . ASP A 1 129 ? -54.287 -2.324  -31.517  1.00 157.40 ? 138 ASP A O   1 
ATOM   973   C CB  . ASP A 1 129 ? -55.200 -2.587  -34.407  1.00 157.55 ? 138 ASP A CB  1 
ATOM   974   C CG  . ASP A 1 129 ? -56.689 -2.405  -34.627  1.00 159.27 ? 138 ASP A CG  1 
ATOM   975   O OD1 . ASP A 1 129 ? -57.313 -3.303  -35.230  1.00 159.23 ? 138 ASP A OD1 1 
ATOM   976   O OD2 . ASP A 1 129 ? -57.233 -1.365  -34.201  1.00 161.01 ? 138 ASP A OD2 1 
ATOM   977   N N   . SER A 1 130 ? -55.599 -0.506  -31.703  1.00 152.09 ? 139 SER A N   1 
ATOM   978   C CA  . SER A 1 130 ? -55.821 -0.373  -30.267  1.00 152.92 ? 139 SER A CA  1 
ATOM   979   C C   . SER A 1 130 ? -56.731 -1.460  -29.697  1.00 152.49 ? 139 SER A C   1 
ATOM   980   O O   . SER A 1 130 ? -57.171 -1.369  -28.552  1.00 153.56 ? 139 SER A O   1 
ATOM   981   C CB  . SER A 1 130 ? -56.396 1.010   -29.947  1.00 155.62 ? 139 SER A CB  1 
ATOM   982   O OG  . SER A 1 130 ? -57.568 1.265   -30.703  1.00 156.92 ? 139 SER A OG  1 
ATOM   983   N N   . ASP A 1 131 ? -57.005 -2.488  -30.493  1.00 169.38 ? 140 ASP A N   1 
ATOM   984   C CA  . ASP A 1 131 ? -57.907 -3.556  -30.072  1.00 169.29 ? 140 ASP A CA  1 
ATOM   985   C C   . ASP A 1 131 ? -57.301 -4.454  -28.996  1.00 168.28 ? 140 ASP A C   1 
ATOM   986   O O   . ASP A 1 131 ? -57.983 -4.846  -28.049  1.00 169.05 ? 140 ASP A O   1 
ATOM   987   C CB  . ASP A 1 131 ? -58.349 -4.394  -31.274  1.00 168.75 ? 140 ASP A CB  1 
ATOM   988   C CG  . ASP A 1 131 ? -59.342 -3.665  -32.159  1.00 170.59 ? 140 ASP A CG  1 
ATOM   989   O OD1 . ASP A 1 131 ? -59.623 -2.478  -31.889  1.00 172.21 ? 140 ASP A OD1 1 
ATOM   990   O OD2 . ASP A 1 131 ? -59.843 -4.280  -33.124  1.00 170.81 ? 140 ASP A OD2 1 
ATOM   991   N N   . ARG A 1 132 ? -56.020 -4.778  -29.144  1.00 162.94 ? 141 ARG A N   1 
ATOM   992   C CA  . ARG A 1 132 ? -55.346 -5.666  -28.202  1.00 162.36 ? 141 ARG A CA  1 
ATOM   993   C C   . ARG A 1 132 ? -54.468 -4.895  -27.221  1.00 163.16 ? 141 ARG A C   1 
ATOM   994   O O   . ARG A 1 132 ? -53.508 -5.438  -26.674  1.00 162.86 ? 141 ARG A O   1 
ATOM   995   C CB  . ARG A 1 132 ? -54.512 -6.705  -28.951  1.00 160.84 ? 141 ARG A CB  1 
ATOM   996   C CG  . ARG A 1 132 ? -55.318 -7.571  -29.901  1.00 160.46 ? 141 ARG A CG  1 
ATOM   997   C CD  . ARG A 1 132 ? -54.409 -8.331  -30.851  1.00 159.33 ? 141 ARG A CD  1 
ATOM   998   N NE  . ARG A 1 132 ? -53.390 -7.461  -31.430  1.00 158.90 ? 141 ARG A NE  1 
ATOM   999   C CZ  . ARG A 1 132 ? -53.628 -6.558  -32.376  1.00 159.18 ? 141 ARG A CZ  1 
ATOM   1000  N NH1 . ARG A 1 132 ? -54.855 -6.400  -32.851  1.00 160.00 ? 141 ARG A NH1 1 
ATOM   1001  N NH2 . ARG A 1 132 ? -52.638 -5.810  -32.843  1.00 159.00 ? 141 ARG A NH2 1 
ATOM   1002  N N   . GLY A 1 133 ? -54.803 -3.628  -27.002  1.00 160.36 ? 142 GLY A N   1 
ATOM   1003  C CA  . GLY A 1 133 ? -54.058 -2.793  -26.078  1.00 161.72 ? 142 GLY A CA  1 
ATOM   1004  C C   . GLY A 1 133 ? -52.745 -2.304  -26.656  1.00 161.28 ? 142 GLY A C   1 
ATOM   1005  O O   . GLY A 1 133 ? -52.129 -2.979  -27.482  1.00 159.67 ? 142 GLY A O   1 
ATOM   1006  N N   . LEU A 1 134 ? -52.314 -1.126  -26.219  1.00 145.35 ? 143 LEU A N   1 
ATOM   1007  C CA  . LEU A 1 134 ? -51.068 -0.540  -26.697  1.00 145.47 ? 143 LEU A CA  1 
ATOM   1008  C C   . LEU A 1 134 ? -49.870 -1.091  -25.930  1.00 145.68 ? 143 LEU A C   1 
ATOM   1009  O O   . LEU A 1 134 ? -48.861 -0.408  -25.764  1.00 146.99 ? 143 LEU A O   1 
ATOM   1010  C CB  . LEU A 1 134 ? -51.106 0.986   -26.579  1.00 147.81 ? 143 LEU A CB  1 
ATOM   1011  C CG  . LEU A 1 134 ? -52.192 1.734   -27.357  1.00 148.41 ? 143 LEU A CG  1 
ATOM   1012  C CD1 . LEU A 1 134 ? -52.279 1.224   -28.787  1.00 146.38 ? 143 LEU A CD1 1 
ATOM   1013  C CD2 . LEU A 1 134 ? -53.541 1.620   -26.665  1.00 149.32 ? 143 LEU A CD2 1 
ATOM   1014  N N   . SER A 1 135 ? -49.991 -2.330  -25.464  1.00 155.85 ? 144 SER A N   1 
ATOM   1015  C CA  . SER A 1 135 ? -48.921 -2.975  -24.712  1.00 156.44 ? 144 SER A CA  1 
ATOM   1016  C C   . SER A 1 135 ? -47.672 -3.163  -25.567  1.00 155.62 ? 144 SER A C   1 
ATOM   1017  O O   . SER A 1 135 ? -46.553 -2.944  -25.102  1.00 157.09 ? 144 SER A O   1 
ATOM   1018  C CB  . SER A 1 135 ? -49.390 -4.324  -24.164  1.00 155.82 ? 144 SER A CB  1 
ATOM   1019  O OG  . SER A 1 135 ? -48.368 -4.949  -23.407  1.00 156.88 ? 144 SER A OG  1 
ATOM   1020  N N   . THR A 1 136 ? -47.868 -3.571  -26.817  1.00 161.06 ? 145 THR A N   1 
ATOM   1021  C CA  . THR A 1 136 ? -46.755 -3.775  -27.737  1.00 160.36 ? 145 THR A CA  1 
ATOM   1022  C C   . THR A 1 136 ? -46.262 -2.449  -28.310  1.00 161.21 ? 145 THR A C   1 
ATOM   1023  O O   . THR A 1 136 ? -45.088 -2.311  -28.653  1.00 161.69 ? 145 THR A O   1 
ATOM   1024  C CB  . THR A 1 136 ? -47.139 -4.719  -28.891  1.00 158.31 ? 145 THR A CB  1 
ATOM   1025  O OG1 . THR A 1 136 ? -48.316 -4.224  -29.542  1.00 157.74 ? 145 THR A OG1 1 
ATOM   1026  C CG2 . THR A 1 136 ? -47.407 -6.121  -28.366  1.00 157.86 ? 145 THR A CG2 1 
ATOM   1027  N N   . LEU A 1 137 ? -47.164 -1.479  -28.415  1.00 118.93 ? 146 LEU A N   1 
ATOM   1028  C CA  . LEU A 1 137 ? -46.801 -0.150  -28.893  1.00 120.24 ? 146 LEU A CA  1 
ATOM   1029  C C   . LEU A 1 137 ? -45.825 0.509   -27.926  1.00 122.63 ? 146 LEU A C   1 
ATOM   1030  O O   . LEU A 1 137 ? -44.806 1.060   -28.339  1.00 123.58 ? 146 LEU A O   1 
ATOM   1031  C CB  . LEU A 1 137 ? -48.045 0.725   -29.060  1.00 120.91 ? 146 LEU A CB  1 
ATOM   1032  C CG  . LEU A 1 137 ? -47.794 2.191   -29.422  1.00 122.92 ? 146 LEU A CG  1 
ATOM   1033  C CD1 . LEU A 1 137 ? -46.978 2.297   -30.701  1.00 122.23 ? 146 LEU A CD1 1 
ATOM   1034  C CD2 . LEU A 1 137 ? -49.107 2.945   -29.558  1.00 123.93 ? 146 LEU A CD2 1 
ATOM   1035  N N   . GLN A 1 138 ? -46.145 0.451   -26.638  1.00 150.80 ? 147 GLN A N   1 
ATOM   1036  C CA  . GLN A 1 138 ? -45.263 0.986   -25.610  1.00 153.57 ? 147 GLN A CA  1 
ATOM   1037  C C   . GLN A 1 138 ? -43.925 0.261   -25.639  1.00 153.59 ? 147 GLN A C   1 
ATOM   1038  O O   . GLN A 1 138 ? -42.879 0.855   -25.385  1.00 155.85 ? 147 GLN A O   1 
ATOM   1039  C CB  . GLN A 1 138 ? -45.898 0.850   -24.224  1.00 155.04 ? 147 GLN A CB  1 
ATOM   1040  C CG  . GLN A 1 138 ? -47.173 1.657   -24.038  1.00 155.79 ? 147 GLN A CG  1 
ATOM   1041  C CD  . GLN A 1 138 ? -47.736 1.536   -22.635  1.00 157.62 ? 147 GLN A CD  1 
ATOM   1042  O OE1 . GLN A 1 138 ? -47.148 0.885   -21.771  1.00 158.49 ? 147 GLN A OE1 1 
ATOM   1043  N NE2 . GLN A 1 138 ? -48.882 2.166   -22.401  1.00 158.55 ? 147 GLN A NE2 1 
ATOM   1044  N N   . ALA A 1 139 ? -43.967 -1.029  -25.957  1.00 132.66 ? 148 ALA A N   1 
ATOM   1045  C CA  . ALA A 1 139 ? -42.761 -1.845  -26.012  1.00 132.86 ? 148 ALA A CA  1 
ATOM   1046  C C   . ALA A 1 139 ? -41.764 -1.310  -27.036  1.00 133.06 ? 148 ALA A C   1 
ATOM   1047  O O   . ALA A 1 139 ? -40.591 -1.105  -26.723  1.00 135.19 ? 148 ALA A O   1 
ATOM   1048  C CB  . ALA A 1 139 ? -43.115 -3.291  -26.318  1.00 130.65 ? 148 ALA A CB  1 
ATOM   1049  N N   . VAL A 1 140 ? -42.235 -1.085  -28.259  1.00 124.36 ? 149 VAL A N   1 
ATOM   1050  C CA  . VAL A 1 140 ? -41.369 -0.610  -29.332  1.00 124.53 ? 149 VAL A CA  1 
ATOM   1051  C C   . VAL A 1 140 ? -40.967 0.849   -29.134  1.00 127.08 ? 149 VAL A C   1 
ATOM   1052  O O   . VAL A 1 140 ? -39.878 1.259   -29.534  1.00 128.47 ? 149 VAL A O   1 
ATOM   1053  C CB  . VAL A 1 140 ? -42.026 -0.782  -30.718  1.00 122.20 ? 149 VAL A CB  1 
ATOM   1054  C CG1 . VAL A 1 140 ? -42.375 -2.240  -30.959  1.00 120.12 ? 149 VAL A CG1 1 
ATOM   1055  C CG2 . VAL A 1 140 ? -43.263 0.090   -30.838  1.00 122.09 ? 149 VAL A CG2 1 
ATOM   1056  N N   . LEU A 1 141 ? -41.846 1.630   -28.514  1.00 124.07 ? 150 LEU A N   1 
ATOM   1057  C CA  . LEU A 1 141 ? -41.562 3.037   -28.257  1.00 126.96 ? 150 LEU A CA  1 
ATOM   1058  C C   . LEU A 1 141 ? -40.492 3.194   -27.183  1.00 129.98 ? 150 LEU A C   1 
ATOM   1059  O O   . LEU A 1 141 ? -39.579 4.007   -27.320  1.00 132.40 ? 150 LEU A O   1 
ATOM   1060  C CB  . LEU A 1 141 ? -42.834 3.787   -27.851  1.00 127.56 ? 150 LEU A CB  1 
ATOM   1061  C CG  . LEU A 1 141 ? -43.859 4.041   -28.958  1.00 125.83 ? 150 LEU A CG  1 
ATOM   1062  C CD1 . LEU A 1 141 ? -45.010 4.888   -28.441  1.00 127.31 ? 150 LEU A CD1 1 
ATOM   1063  C CD2 . LEU A 1 141 ? -43.199 4.710   -30.152  1.00 126.29 ? 150 LEU A CD2 1 
ATOM   1064  N N   . ASP A 1 142 ? -40.611 2.412   -26.116  1.00 171.80 ? 151 ASP A N   1 
ATOM   1065  C CA  . ASP A 1 142 ? -39.642 2.450   -25.028  1.00 175.06 ? 151 ASP A CA  1 
ATOM   1066  C C   . ASP A 1 142 ? -38.283 1.949   -25.502  1.00 175.52 ? 151 ASP A C   1 
ATOM   1067  O O   . ASP A 1 142 ? -37.244 2.495   -25.132  1.00 178.82 ? 151 ASP A O   1 
ATOM   1068  C CB  . ASP A 1 142 ? -40.129 1.615   -23.842  1.00 175.24 ? 151 ASP A CB  1 
ATOM   1069  C CG  . ASP A 1 142 ? -41.410 2.155   -23.234  1.00 175.48 ? 151 ASP A CG  1 
ATOM   1070  O OD1 . ASP A 1 142 ? -41.847 3.254   -23.639  1.00 176.02 ? 151 ASP A OD1 1 
ATOM   1071  O OD2 . ASP A 1 142 ? -41.981 1.481   -22.350  1.00 175.41 ? 151 ASP A OD2 1 
ATOM   1072  N N   . SER A 1 143 ? -38.299 0.905   -26.325  1.00 137.65 ? 152 SER A N   1 
ATOM   1073  C CA  . SER A 1 143 ? -37.070 0.343   -26.871  1.00 138.04 ? 152 SER A CA  1 
ATOM   1074  C C   . SER A 1 143 ? -36.466 1.272   -27.917  1.00 138.65 ? 152 SER A C   1 
ATOM   1075  O O   . SER A 1 143 ? -35.265 1.230   -28.179  1.00 140.38 ? 152 SER A O   1 
ATOM   1076  C CB  . SER A 1 143 ? -37.333 -1.034  -27.482  1.00 134.97 ? 152 SER A CB  1 
ATOM   1077  O OG  . SER A 1 143 ? -37.745 -1.961  -26.493  1.00 134.91 ? 152 SER A OG  1 
ATOM   1078  N N   . ALA A 1 144 ? -37.308 2.110   -28.514  1.00 132.72 ? 153 ALA A N   1 
ATOM   1079  C CA  . ALA A 1 144 ? -36.851 3.073   -29.509  1.00 133.56 ? 153 ALA A CA  1 
ATOM   1080  C C   . ALA A 1 144 ? -35.953 4.121   -28.865  1.00 137.78 ? 153 ALA A C   1 
ATOM   1081  O O   . ALA A 1 144 ? -35.130 4.744   -29.535  1.00 139.38 ? 153 ALA A O   1 
ATOM   1082  C CB  . ALA A 1 144 ? -38.036 3.735   -30.193  1.00 131.97 ? 153 ALA A CB  1 
ATOM   1083  N N   . ALA A 1 145 ? -36.120 4.313   -27.561  1.00 158.12 ? 154 ALA A N   1 
ATOM   1084  C CA  . ALA A 1 145 ? -35.299 5.257   -26.817  1.00 162.69 ? 154 ALA A CA  1 
ATOM   1085  C C   . ALA A 1 145 ? -33.916 4.672   -26.555  1.00 164.85 ? 154 ALA A C   1 
ATOM   1086  O O   . ALA A 1 145 ? -32.901 5.346   -26.732  1.00 167.98 ? 154 ALA A O   1 
ATOM   1087  C CB  . ALA A 1 145 ? -35.975 5.631   -25.508  1.00 164.60 ? 154 ALA A CB  1 
ATOM   1088  N N   . GLU A 1 146 ? -33.887 3.410   -26.138  1.00 154.60 ? 155 GLU A N   1 
ATOM   1089  C CA  . GLU A 1 146 ? -32.634 2.728   -25.833  1.00 156.90 ? 155 GLU A CA  1 
ATOM   1090  C C   . GLU A 1 146 ? -31.873 2.358   -27.103  1.00 155.65 ? 155 GLU A C   1 
ATOM   1091  O O   . GLU A 1 146 ? -30.734 2.781   -27.300  1.00 158.70 ? 155 GLU A O   1 
ATOM   1092  C CB  . GLU A 1 146 ? -32.896 1.475   -24.995  1.00 156.15 ? 155 GLU A CB  1 
ATOM   1093  N N   . LYS A 1 147 ? -32.511 1.568   -27.961  1.00 197.24 ? 156 LYS A N   1 
ATOM   1094  C CA  . LYS A 1 147 ? -31.886 1.109   -29.197  1.00 195.98 ? 156 LYS A CA  1 
ATOM   1095  C C   . LYS A 1 147 ? -31.781 2.229   -30.229  1.00 196.14 ? 156 LYS A C   1 
ATOM   1096  O O   . LYS A 1 147 ? -31.212 2.042   -31.305  1.00 195.61 ? 156 LYS A O   1 
ATOM   1097  C CB  . LYS A 1 147 ? -32.660 -0.075  -29.781  1.00 191.90 ? 156 LYS A CB  1 
ATOM   1098  N N   . LYS A 1 148 ? -32.335 3.391   -29.895  1.00 141.63 ? 157 LYS A N   1 
ATOM   1099  C CA  . LYS A 1 148 ? -32.292 4.552   -30.778  1.00 142.37 ? 157 LYS A CA  1 
ATOM   1100  C C   . LYS A 1 148 ? -32.935 4.269   -32.134  1.00 138.75 ? 157 LYS A C   1 
ATOM   1101  O O   . LYS A 1 148 ? -32.244 4.151   -33.145  1.00 138.75 ? 157 LYS A O   1 
ATOM   1102  C CB  . LYS A 1 148 ? -30.850 5.030   -30.969  1.00 146.15 ? 157 LYS A CB  1 
ATOM   1103  N N   . TRP A 1 149 ? -34.260 4.160   -32.149  1.00 146.39 ? 158 TRP A N   1 
ATOM   1104  C CA  . TRP A 1 149 ? -34.994 3.957   -33.393  1.00 143.42 ? 158 TRP A CA  1 
ATOM   1105  C C   . TRP A 1 149 ? -35.849 5.173   -33.728  1.00 143.89 ? 158 TRP A C   1 
ATOM   1106  O O   . TRP A 1 149 ? -36.257 5.921   -32.840  1.00 145.57 ? 158 TRP A O   1 
ATOM   1107  C CB  . TRP A 1 149 ? -35.893 2.721   -33.307  1.00 140.05 ? 158 TRP A CB  1 
ATOM   1108  C CG  . TRP A 1 149 ? -35.158 1.427   -33.144  1.00 139.56 ? 158 TRP A CG  1 
ATOM   1109  C CD1 . TRP A 1 149 ? -33.909 1.130   -33.602  1.00 140.93 ? 158 TRP A CD1 1 
ATOM   1110  C CD2 . TRP A 1 149 ? -35.644 0.241   -32.503  1.00 137.88 ? 158 TRP A CD2 1 
ATOM   1111  N NE1 . TRP A 1 149 ? -33.578 -0.162  -33.270  1.00 140.35 ? 158 TRP A NE1 1 
ATOM   1112  C CE2 . TRP A 1 149 ? -34.628 -0.730  -32.597  1.00 138.48 ? 158 TRP A CE2 1 
ATOM   1113  C CE3 . TRP A 1 149 ? -36.837 -0.092  -31.854  1.00 136.23 ? 158 TRP A CE3 1 
ATOM   1114  C CZ2 . TRP A 1 149 ? -34.767 -2.010  -32.064  1.00 137.57 ? 158 TRP A CZ2 1 
ATOM   1115  C CZ3 . TRP A 1 149 ? -36.974 -1.364  -31.326  1.00 135.20 ? 158 TRP A CZ3 1 
ATOM   1116  C CH2 . TRP A 1 149 ? -35.945 -2.307  -31.435  1.00 135.91 ? 158 TRP A CH2 1 
ATOM   1117  N N   . GLN A 1 150 ? -36.117 5.362   -35.016  1.00 138.88 ? 159 GLN A N   1 
ATOM   1118  C CA  . GLN A 1 150 ? -37.030 6.406   -35.464  1.00 139.37 ? 159 GLN A CA  1 
ATOM   1119  C C   . GLN A 1 150 ? -38.359 5.789   -35.886  1.00 136.29 ? 159 GLN A C   1 
ATOM   1120  O O   . GLN A 1 150 ? -38.620 5.597   -37.073  1.00 135.09 ? 159 GLN A O   1 
ATOM   1121  C CB  . GLN A 1 150 ? -36.422 7.204   -36.619  1.00 141.12 ? 159 GLN A CB  1 
ATOM   1122  C CG  . GLN A 1 150 ? -35.243 8.077   -36.217  1.00 144.90 ? 159 GLN A CG  1 
ATOM   1123  C CD  . GLN A 1 150 ? -34.734 8.930   -37.363  1.00 146.90 ? 159 GLN A CD  1 
ATOM   1124  O OE1 . GLN A 1 150 ? -35.237 8.847   -38.484  1.00 145.48 ? 159 GLN A OE1 1 
ATOM   1125  N NE2 . GLN A 1 150 ? -33.732 9.756   -37.086  1.00 150.58 ? 159 GLN A NE2 1 
ATOM   1126  N N   . VAL A 1 151 ? -39.195 5.477   -34.900  1.00 134.56 ? 160 VAL A N   1 
ATOM   1127  C CA  . VAL A 1 151 ? -40.466 4.808   -35.150  1.00 131.92 ? 160 VAL A CA  1 
ATOM   1128  C C   . VAL A 1 151 ? -41.567 5.790   -35.534  1.00 132.76 ? 160 VAL A C   1 
ATOM   1129  O O   . VAL A 1 151 ? -41.727 6.838   -34.908  1.00 135.14 ? 160 VAL A O   1 
ATOM   1130  C CB  . VAL A 1 151 ? -40.926 4.006   -33.919  1.00 130.78 ? 160 VAL A CB  1 
ATOM   1131  C CG1 . VAL A 1 151 ? -42.230 3.283   -34.215  1.00 128.32 ? 160 VAL A CG1 1 
ATOM   1132  C CG2 . VAL A 1 151 ? -39.848 3.023   -33.497  1.00 130.46 ? 160 VAL A CG2 1 
ATOM   1133  N N   . THR A 1 152 ? -42.324 5.442   -36.568  1.00 125.36 ? 161 THR A N   1 
ATOM   1134  C CA  . THR A 1 152 ? -43.457 6.251   -36.994  1.00 126.36 ? 161 THR A CA  1 
ATOM   1135  C C   . THR A 1 152 ? -44.758 5.525   -36.672  1.00 124.52 ? 161 THR A C   1 
ATOM   1136  O O   . THR A 1 152 ? -45.328 4.847   -37.526  1.00 123.01 ? 161 THR A O   1 
ATOM   1137  C CB  . THR A 1 152 ? -43.402 6.553   -38.501  1.00 126.88 ? 161 THR A CB  1 
ATOM   1138  O OG1 . THR A 1 152 ? -42.138 7.146   -38.827  1.00 128.64 ? 161 THR A OG1 1 
ATOM   1139  C CG2 . THR A 1 152 ? -44.520 7.506   -38.896  1.00 128.71 ? 161 THR A CG2 1 
ATOM   1140  N N   . ALA A 1 153 ? -45.217 5.666   -35.432  1.00 125.45 ? 162 ALA A N   1 
ATOM   1141  C CA  . ALA A 1 153 ? -46.427 4.991   -34.975  1.00 124.01 ? 162 ALA A CA  1 
ATOM   1142  C C   . ALA A 1 153 ? -47.684 5.657   -35.524  1.00 125.21 ? 162 ALA A C   1 
ATOM   1143  O O   . ALA A 1 153 ? -47.841 6.874   -35.438  1.00 127.87 ? 162 ALA A O   1 
ATOM   1144  C CB  . ALA A 1 153 ? -46.469 4.947   -33.456  1.00 124.50 ? 162 ALA A CB  1 
ATOM   1145  N N   . ILE A 1 154 ? -48.575 4.850   -36.089  1.00 122.03 ? 163 ILE A N   1 
ATOM   1146  C CA  . ILE A 1 154 ? -49.821 5.360   -36.648  1.00 123.44 ? 163 ILE A CA  1 
ATOM   1147  C C   . ILE A 1 154 ? -50.995 4.450   -36.302  1.00 122.15 ? 163 ILE A C   1 
ATOM   1148  O O   . ILE A 1 154 ? -51.010 3.275   -36.667  1.00 120.02 ? 163 ILE A O   1 
ATOM   1149  C CB  . ILE A 1 154 ? -49.733 5.505   -38.176  1.00 123.95 ? 163 ILE A CB  1 
ATOM   1150  C CG1 . ILE A 1 154 ? -48.611 6.473   -38.556  1.00 125.63 ? 163 ILE A CG1 1 
ATOM   1151  C CG2 . ILE A 1 154 ? -51.062 5.980   -38.740  1.00 125.87 ? 163 ILE A CG2 1 
ATOM   1152  C CD1 . ILE A 1 154 ? -48.403 6.611   -40.046  1.00 126.34 ? 163 ILE A CD1 1 
ATOM   1153  N N   . ASN A 1 155 ? -51.977 5.000   -35.595  1.00 142.09 ? 164 ASN A N   1 
ATOM   1154  C CA  . ASN A 1 155 ? -53.163 4.241   -35.220  1.00 141.39 ? 164 ASN A CA  1 
ATOM   1155  C C   . ASN A 1 155 ? -54.059 3.970   -36.423  1.00 141.79 ? 164 ASN A C   1 
ATOM   1156  O O   . ASN A 1 155 ? -54.847 4.823   -36.829  1.00 144.37 ? 164 ASN A O   1 
ATOM   1157  C CB  . ASN A 1 155 ? -53.948 4.976   -34.132  1.00 143.49 ? 164 ASN A CB  1 
ATOM   1158  C CG  . ASN A 1 155 ? -55.072 4.136   -33.556  1.00 142.81 ? 164 ASN A CG  1 
ATOM   1159  O OD1 . ASN A 1 155 ? -55.233 2.967   -33.907  1.00 140.73 ? 164 ASN A OD1 1 
ATOM   1160  N ND2 . ASN A 1 155 ? -55.857 4.730   -32.664  1.00 144.88 ? 164 ASN A ND2 1 
ATOM   1161  N N   . VAL A 1 156 ? -53.932 2.774   -36.988  1.00 145.48 ? 165 VAL A N   1 
ATOM   1162  C CA  . VAL A 1 156 ? -54.705 2.388   -38.162  1.00 146.07 ? 165 VAL A CA  1 
ATOM   1163  C C   . VAL A 1 156 ? -56.035 1.758   -37.746  1.00 146.33 ? 165 VAL A C   1 
ATOM   1164  O O   . VAL A 1 156 ? -56.697 1.088   -38.538  1.00 146.58 ? 165 VAL A O   1 
ATOM   1165  C CB  . VAL A 1 156 ? -53.906 1.405   -39.048  1.00 144.15 ? 165 VAL A CB  1 
ATOM   1166  C CG1 . VAL A 1 156 ? -53.778 0.052   -38.361  1.00 141.71 ? 165 VAL A CG1 1 
ATOM   1167  C CG2 . VAL A 1 156 ? -54.550 1.263   -40.421  1.00 145.56 ? 165 VAL A CG2 1 
ATOM   1168  N N   . GLY A 1 157 ? -56.425 1.989   -36.496  1.00 130.63 ? 166 GLY A N   1 
ATOM   1169  C CA  . GLY A 1 157 ? -57.624 1.383   -35.947  1.00 130.96 ? 166 GLY A CA  1 
ATOM   1170  C C   . GLY A 1 157 ? -58.884 2.211   -36.105  1.00 134.20 ? 166 GLY A C   1 
ATOM   1171  O O   . GLY A 1 157 ? -59.906 1.713   -36.577  1.00 135.20 ? 166 GLY A O   1 
ATOM   1172  N N   . ASN A 1 158 ? -58.814 3.479   -35.709  1.00 169.30 ? 167 ASN A N   1 
ATOM   1173  C CA  . ASN A 1 158 ? -59.984 4.355   -35.729  1.00 172.90 ? 167 ASN A CA  1 
ATOM   1174  C C   . ASN A 1 158 ? -60.437 4.754   -37.129  1.00 175.22 ? 167 ASN A C   1 
ATOM   1175  O O   . ASN A 1 158 ? -61.193 5.705   -37.297  1.00 178.80 ? 167 ASN A O   1 
ATOM   1176  C CB  . ASN A 1 158 ? -59.727 5.613   -34.900  1.00 174.88 ? 167 ASN A CB  1 
ATOM   1177  C CG  . ASN A 1 158 ? -59.605 5.319   -33.421  1.00 173.75 ? 167 ASN A CG  1 
ATOM   1178  O OD1 . ASN A 1 158 ? -59.387 4.177   -33.019  1.00 170.97 ? 167 ASN A OD1 1 
ATOM   1179  N ND2 . ASN A 1 158 ? -59.745 6.353   -32.601  1.00 176.28 ? 167 ASN A ND2 1 
ATOM   1180  N N   . ILE A 1 159 ? -59.971 4.022   -38.132  1.00 154.62 ? 168 ILE A N   1 
ATOM   1181  C CA  . ILE A 1 159 ? -60.341 4.300   -39.514  1.00 156.97 ? 168 ILE A CA  1 
ATOM   1182  C C   . ILE A 1 159 ? -61.754 3.820   -39.823  1.00 159.10 ? 168 ILE A C   1 
ATOM   1183  O O   . ILE A 1 159 ? -62.007 2.619   -39.865  1.00 157.42 ? 168 ILE A O   1 
ATOM   1184  C CB  . ILE A 1 159 ? -59.365 3.632   -40.500  1.00 154.81 ? 168 ILE A CB  1 
ATOM   1185  C CG1 . ILE A 1 159 ? -57.932 4.105   -40.241  1.00 153.04 ? 168 ILE A CG1 1 
ATOM   1186  C CG2 . ILE A 1 159 ? -59.773 3.933   -41.934  1.00 157.69 ? 168 ILE A CG2 1 
ATOM   1187  C CD1 . ILE A 1 159 ? -56.945 3.653   -41.291  1.00 151.63 ? 168 ILE A CD1 1 
ATOM   1188  N N   . ASN A 1 160 ? -62.669 4.763   -40.039  1.00 203.15 ? 169 ASN A N   1 
ATOM   1189  C CA  . ASN A 1 160 ? -64.047 4.423   -40.390  1.00 206.01 ? 169 ASN A CA  1 
ATOM   1190  C C   . ASN A 1 160 ? -64.126 3.651   -41.709  1.00 206.32 ? 169 ASN A C   1 
ATOM   1191  O O   . ASN A 1 160 ? -63.663 4.126   -42.743  1.00 207.57 ? 169 ASN A O   1 
ATOM   1192  C CB  . ASN A 1 160 ? -64.940 5.672   -40.427  1.00 210.96 ? 169 ASN A CB  1 
ATOM   1193  C CG  . ASN A 1 160 ? -64.424 6.747   -41.380  1.00 213.34 ? 169 ASN A CG  1 
ATOM   1194  O OD1 . ASN A 1 160 ? -63.277 6.705   -41.830  1.00 211.00 ? 169 ASN A OD1 1 
ATOM   1195  N ND2 . ASN A 1 160 ? -65.274 7.722   -41.683  1.00 218.34 ? 169 ASN A ND2 1 
ATOM   1196  N N   . ASN A 1 161 ? -64.716 2.461   -41.666  1.00 183.79 ? 170 ASN A N   1 
ATOM   1197  C CA  . ASN A 1 161 ? -64.673 1.533   -42.798  1.00 183.73 ? 170 ASN A CA  1 
ATOM   1198  C C   . ASN A 1 161 ? -65.609 1.823   -43.991  1.00 188.63 ? 170 ASN A C   1 
ATOM   1199  O O   . ASN A 1 161 ? -65.472 1.193   -45.039  1.00 189.09 ? 170 ASN A O   1 
ATOM   1200  C CB  . ASN A 1 161 ? -64.903 0.096   -42.300  1.00 181.33 ? 170 ASN A CB  1 
ATOM   1201  C CG  . ASN A 1 161 ? -63.656 -0.532  -41.682  1.00 176.52 ? 170 ASN A CG  1 
ATOM   1202  O OD1 . ASN A 1 161 ? -62.588 0.079   -41.640  1.00 174.89 ? 170 ASN A OD1 1 
ATOM   1203  N ND2 . ASN A 1 161 ? -63.794 -1.769  -41.204  1.00 174.62 ? 170 ASN A ND2 1 
ATOM   1204  N N   . ASP A 1 162 ? -66.560 2.748   -43.814  1.00 230.15 ? 171 ASP A N   1 
ATOM   1205  C CA  . ASP A 1 162 ? -67.553 3.120   -44.844  1.00 235.64 ? 171 ASP A CA  1 
ATOM   1206  C C   . ASP A 1 162 ? -67.076 4.287   -45.724  1.00 238.19 ? 171 ASP A C   1 
ATOM   1207  O O   . ASP A 1 162 ? -67.871 5.111   -46.171  1.00 243.27 ? 171 ASP A O   1 
ATOM   1208  C CB  . ASP A 1 162 ? -68.903 3.469   -44.211  1.00 239.32 ? 171 ASP A CB  1 
ATOM   1209  C CG  . ASP A 1 162 ? -69.481 2.318   -43.421  1.00 237.53 ? 171 ASP A CG  1 
ATOM   1210  O OD1 . ASP A 1 162 ? -69.159 2.189   -42.216  1.00 234.20 ? 171 ASP A OD1 1 
ATOM   1211  O OD2 . ASP A 1 162 ? -70.252 1.526   -44.010  1.00 239.76 ? 171 ASP A OD2 1 
ATOM   1212  N N   . LYS A 1 163 ? -65.772 4.341   -45.976  1.00 194.95 ? 172 LYS A N   1 
ATOM   1213  C CA  . LYS A 1 163 ? -65.133 5.438   -46.709  1.00 196.86 ? 172 LYS A CA  1 
ATOM   1214  C C   . LYS A 1 163 ? -63.630 5.383   -46.432  1.00 192.10 ? 172 LYS A C   1 
ATOM   1215  O O   . LYS A 1 163 ? -62.937 6.384   -46.532  1.00 192.69 ? 172 LYS A O   1 
ATOM   1216  C CB  . LYS A 1 163 ? -65.712 6.799   -46.282  1.00 200.75 ? 172 LYS A CB  1 
ATOM   1217  N N   . LYS A 1 164 ? -63.130 4.208   -46.060  1.00 207.49 ? 173 LYS A N   1 
ATOM   1218  C CA  . LYS A 1 164 ? -61.716 4.068   -45.701  1.00 203.14 ? 173 LYS A CA  1 
ATOM   1219  C C   . LYS A 1 164 ? -60.814 3.869   -46.919  1.00 202.87 ? 173 LYS A C   1 
ATOM   1220  O O   . LYS A 1 164 ? -60.342 2.764   -47.178  1.00 200.31 ? 173 LYS A O   1 
ATOM   1221  C CB  . LYS A 1 164 ? -61.500 2.918   -44.714  1.00 198.85 ? 173 LYS A CB  1 
ATOM   1222  N N   . ASP A 1 165 ? -60.555 4.946   -47.651  1.00 197.80 ? 174 ASP A N   1 
ATOM   1223  C CA  . ASP A 1 165 ? -59.731 4.876   -48.851  1.00 198.17 ? 174 ASP A CA  1 
ATOM   1224  C C   . ASP A 1 165 ? -58.917 6.157   -48.990  1.00 199.33 ? 174 ASP A C   1 
ATOM   1225  O O   . ASP A 1 165 ? -57.712 6.116   -49.258  1.00 197.28 ? 174 ASP A O   1 
ATOM   1226  C CB  . ASP A 1 165 ? -60.614 4.669   -50.083  1.00 202.43 ? 174 ASP A CB  1 
ATOM   1227  C CG  . ASP A 1 165 ? -59.948 3.812   -51.141  1.00 201.65 ? 174 ASP A CG  1 
ATOM   1228  O OD1 . ASP A 1 165 ? -59.130 2.946   -50.768  1.00 197.41 ? 174 ASP A OD1 1 
ATOM   1229  O OD2 . ASP A 1 165 ? -60.246 3.995   -52.343  1.00 205.60 ? 174 ASP A OD2 1 
ATOM   1230  N N   . GLU A 1 166 ? -59.584 7.294   -48.806  1.00 227.54 ? 175 GLU A N   1 
ATOM   1231  C CA  . GLU A 1 166 ? -58.907 8.583   -48.780  1.00 229.11 ? 175 GLU A CA  1 
ATOM   1232  C C   . GLU A 1 166 ? -58.066 8.692   -47.515  1.00 225.29 ? 175 GLU A C   1 
ATOM   1233  O O   . GLU A 1 166 ? -57.304 9.644   -47.339  1.00 225.94 ? 175 GLU A O   1 
ATOM   1234  C CB  . GLU A 1 166 ? -59.924 9.722   -48.832  1.00 234.42 ? 175 GLU A CB  1 
ATOM   1235  N N   . THR A 1 167 ? -58.224 7.711   -46.632  1.00 178.06 ? 176 THR A N   1 
ATOM   1236  C CA  . THR A 1 167 ? -57.461 7.660   -45.394  1.00 174.55 ? 176 THR A CA  1 
ATOM   1237  C C   . THR A 1 167 ? -56.168 6.879   -45.598  1.00 170.80 ? 176 THR A C   1 
ATOM   1238  O O   . THR A 1 167 ? -55.116 7.261   -45.089  1.00 169.32 ? 176 THR A O   1 
ATOM   1239  C CB  . THR A 1 167 ? -58.272 7.007   -44.259  1.00 172.89 ? 176 THR A CB  1 
ATOM   1240  O OG1 . THR A 1 167 ? -58.670 5.688   -44.652  1.00 171.27 ? 176 THR A OG1 1 
ATOM   1241  C CG2 . THR A 1 167 ? -59.507 7.835   -43.941  1.00 176.82 ? 176 THR A CG2 1 
ATOM   1242  N N   . TYR A 1 168 ? -56.254 5.781   -46.343  1.00 147.25 ? 177 TYR A N   1 
ATOM   1243  C CA  . TYR A 1 168 ? -55.080 4.973   -46.654  1.00 144.21 ? 177 TYR A CA  1 
ATOM   1244  C C   . TYR A 1 168 ? -54.152 5.707   -47.617  1.00 145.83 ? 177 TYR A C   1 
ATOM   1245  O O   . TYR A 1 168 ? -52.930 5.609   -47.512  1.00 143.78 ? 177 TYR A O   1 
ATOM   1246  C CB  . TYR A 1 168 ? -55.487 3.617   -47.236  1.00 143.25 ? 177 TYR A CB  1 
ATOM   1247  C CG  . TYR A 1 168 ? -55.871 2.597   -46.188  1.00 140.43 ? 177 TYR A CG  1 
ATOM   1248  C CD1 . TYR A 1 168 ? -57.201 2.375   -45.858  1.00 141.75 ? 177 TYR A CD1 1 
ATOM   1249  C CD2 . TYR A 1 168 ? -54.900 1.854   -45.529  1.00 136.81 ? 177 TYR A CD2 1 
ATOM   1250  C CE1 . TYR A 1 168 ? -57.553 1.441   -44.900  1.00 139.42 ? 177 TYR A CE1 1 
ATOM   1251  C CE2 . TYR A 1 168 ? -55.242 0.919   -44.571  1.00 134.58 ? 177 TYR A CE2 1 
ATOM   1252  C CZ  . TYR A 1 168 ? -56.568 0.717   -44.261  1.00 135.84 ? 177 TYR A CZ  1 
ATOM   1253  O OH  . TYR A 1 168 ? -56.906 -0.214  -43.308  1.00 133.85 ? 177 TYR A OH  1 
ATOM   1254  N N   . ARG A 1 169 ? -54.740 6.432   -48.562  1.00 150.82 ? 178 ARG A N   1 
ATOM   1255  C CA  . ARG A 1 169 ? -53.963 7.226   -49.504  1.00 153.04 ? 178 ARG A CA  1 
ATOM   1256  C C   . ARG A 1 169 ? -53.218 8.331   -48.766  1.00 153.18 ? 178 ARG A C   1 
ATOM   1257  O O   . ARG A 1 169 ? -52.094 8.683   -49.122  1.00 153.10 ? 178 ARG A O   1 
ATOM   1258  C CB  . ARG A 1 169 ? -54.871 7.828   -50.578  1.00 157.94 ? 178 ARG A CB  1 
ATOM   1259  N N   . SER A 1 170 ? -53.854 8.871   -47.731  1.00 155.32 ? 179 SER A N   1 
ATOM   1260  C CA  . SER A 1 170 ? -53.244 9.906   -46.907  1.00 155.84 ? 179 SER A CA  1 
ATOM   1261  C C   . SER A 1 170 ? -52.351 9.281   -45.841  1.00 151.63 ? 179 SER A C   1 
ATOM   1262  O O   . SER A 1 170 ? -51.596 9.977   -45.162  1.00 151.74 ? 179 SER A O   1 
ATOM   1263  C CB  . SER A 1 170 ? -54.322 10.771  -46.249  1.00 158.76 ? 179 SER A CB  1 
ATOM   1264  O OG  . SER A 1 170 ? -53.744 11.809  -45.476  1.00 159.84 ? 179 SER A OG  1 
ATOM   1265  N N   . LEU A 1 171 ? -52.444 7.962   -45.700  1.00 143.59 ? 180 LEU A N   1 
ATOM   1266  C CA  . LEU A 1 171 ? -51.625 7.233   -44.740  1.00 139.84 ? 180 LEU A CA  1 
ATOM   1267  C C   . LEU A 1 171 ? -50.238 6.963   -45.309  1.00 138.58 ? 180 LEU A C   1 
ATOM   1268  O O   . LEU A 1 171 ? -49.228 7.219   -44.654  1.00 137.64 ? 180 LEU A O   1 
ATOM   1269  C CB  . LEU A 1 171 ? -52.294 5.914   -44.352  1.00 137.25 ? 180 LEU A CB  1 
ATOM   1270  C CG  . LEU A 1 171 ? -51.454 4.974   -43.487  1.00 133.60 ? 180 LEU A CG  1 
ATOM   1271  C CD1 . LEU A 1 171 ? -51.025 5.669   -42.207  1.00 133.46 ? 180 LEU A CD1 1 
ATOM   1272  C CD2 . LEU A 1 171 ? -52.222 3.700   -43.177  1.00 131.65 ? 180 LEU A CD2 1 
ATOM   1273  N N   . PHE A 1 172 ? -50.198 6.444   -46.531  1.00 147.17 ? 181 PHE A N   1 
ATOM   1274  C CA  . PHE A 1 172 ? -48.935 6.156   -47.198  1.00 146.39 ? 181 PHE A CA  1 
ATOM   1275  C C   . PHE A 1 172 ? -48.339 7.417   -47.816  1.00 149.45 ? 181 PHE A C   1 
ATOM   1276  O O   . PHE A 1 172 ? -47.261 7.381   -48.408  1.00 149.46 ? 181 PHE A O   1 
ATOM   1277  C CB  . PHE A 1 172 ? -49.120 5.071   -48.259  1.00 145.91 ? 181 PHE A CB  1 
ATOM   1278  C CG  . PHE A 1 172 ? -49.448 3.721   -47.690  1.00 142.93 ? 181 PHE A CG  1 
ATOM   1279  C CD1 . PHE A 1 172 ? -48.441 2.829   -47.367  1.00 140.26 ? 181 PHE A CD1 1 
ATOM   1280  C CD2 . PHE A 1 172 ? -50.762 3.348   -47.470  1.00 143.17 ? 181 PHE A CD2 1 
ATOM   1281  C CE1 . PHE A 1 172 ? -48.738 1.587   -46.840  1.00 137.91 ? 181 PHE A CE1 1 
ATOM   1282  C CE2 . PHE A 1 172 ? -51.066 2.107   -46.943  1.00 140.72 ? 181 PHE A CE2 1 
ATOM   1283  C CZ  . PHE A 1 172 ? -50.052 1.225   -46.628  1.00 138.10 ? 181 PHE A CZ  1 
ATOM   1284  N N   . GLN A 1 173 ? -49.052 8.529   -47.674  1.00 137.74 ? 182 GLN A N   1 
ATOM   1285  C CA  . GLN A 1 173 ? -48.543 9.823   -48.104  1.00 141.08 ? 182 GLN A CA  1 
ATOM   1286  C C   . GLN A 1 173 ? -47.576 10.351  -47.053  1.00 140.37 ? 182 GLN A C   1 
ATOM   1287  O O   . GLN A 1 173 ? -46.590 11.015  -47.375  1.00 141.93 ? 182 GLN A O   1 
ATOM   1288  C CB  . GLN A 1 173 ? -49.691 10.811  -48.313  1.00 144.99 ? 182 GLN A CB  1 
ATOM   1289  N N   . ASP A 1 174 ? -47.868 10.047  -45.792  1.00 150.16 ? 183 ASP A N   1 
ATOM   1290  C CA  . ASP A 1 174 ? -46.993 10.415  -44.685  1.00 149.56 ? 183 ASP A CA  1 
ATOM   1291  C C   . ASP A 1 174 ? -45.846 9.418   -44.580  1.00 146.49 ? 183 ASP A C   1 
ATOM   1292  O O   . ASP A 1 174 ? -44.759 9.750   -44.106  1.00 146.71 ? 183 ASP A O   1 
ATOM   1293  C CB  . ASP A 1 174 ? -47.777 10.455  -43.371  1.00 148.96 ? 183 ASP A CB  1 
ATOM   1294  C CG  . ASP A 1 174 ? -48.871 11.506  -43.373  1.00 152.48 ? 183 ASP A CG  1 
ATOM   1295  O OD1 . ASP A 1 174 ? -48.910 12.328  -44.314  1.00 155.68 ? 183 ASP A OD1 1 
ATOM   1296  O OD2 . ASP A 1 174 ? -49.693 11.512  -42.432  1.00 152.36 ? 183 ASP A OD2 1 
ATOM   1297  N N   . LEU A 1 175 ? -46.097 8.193   -45.029  1.00 154.00 ? 184 LEU A N   1 
ATOM   1298  C CA  . LEU A 1 175 ? -45.079 7.151   -45.028  1.00 151.42 ? 184 LEU A CA  1 
ATOM   1299  C C   . LEU A 1 175 ? -44.184 7.279   -46.254  1.00 152.70 ? 184 LEU A C   1 
ATOM   1300  O O   . LEU A 1 175 ? -43.414 6.373   -46.571  1.00 151.08 ? 184 LEU A O   1 
ATOM   1301  C CB  . LEU A 1 175 ? -45.728 5.766   -44.994  1.00 148.68 ? 184 LEU A CB  1 
ATOM   1302  C CG  . LEU A 1 175 ? -46.610 5.463   -43.782  1.00 147.28 ? 184 LEU A CG  1 
ATOM   1303  C CD1 . LEU A 1 175 ? -47.250 4.090   -43.917  1.00 145.07 ? 184 LEU A CD1 1 
ATOM   1304  C CD2 . LEU A 1 175 ? -45.807 5.561   -42.495  1.00 146.37 ? 184 LEU A CD2 1 
ATOM   1305  N N   . GLU A 1 176 ? -44.294 8.410   -46.943  1.00 138.91 ? 185 GLU A N   1 
ATOM   1306  C CA  . GLU A 1 176 ? -43.476 8.669   -48.120  1.00 140.70 ? 185 GLU A CA  1 
ATOM   1307  C C   . GLU A 1 176 ? -42.612 9.908   -47.910  1.00 143.35 ? 185 GLU A C   1 
ATOM   1308  O O   . GLU A 1 176 ? -41.636 10.125  -48.626  1.00 144.70 ? 185 GLU A O   1 
ATOM   1309  C CB  . GLU A 1 176 ? -44.356 8.834   -49.361  1.00 142.87 ? 185 GLU A CB  1 
ATOM   1310  C CG  . GLU A 1 176 ? -43.594 8.742   -50.674  1.00 144.32 ? 185 GLU A CG  1 
ATOM   1311  C CD  . GLU A 1 176 ? -42.891 7.408   -50.846  1.00 141.50 ? 185 GLU A CD  1 
ATOM   1312  O OE1 . GLU A 1 176 ? -41.905 7.350   -51.611  1.00 142.44 ? 185 GLU A OE1 1 
ATOM   1313  O OE2 . GLU A 1 176 ? -43.321 6.419   -50.215  1.00 138.63 ? 185 GLU A OE2 1 
ATOM   1314  N N   . LEU A 1 177 ? -42.980 10.719  -46.922  1.00 153.50 ? 186 LEU A N   1 
ATOM   1315  C CA  . LEU A 1 177 ? -42.193 11.893  -46.564  1.00 156.31 ? 186 LEU A CA  1 
ATOM   1316  C C   . LEU A 1 177 ? -40.802 11.460  -46.119  1.00 154.98 ? 186 LEU A C   1 
ATOM   1317  O O   . LEU A 1 177 ? -39.808 12.124  -46.412  1.00 157.32 ? 186 LEU A O   1 
ATOM   1318  C CB  . LEU A 1 177 ? -42.878 12.680  -45.445  1.00 157.57 ? 186 LEU A CB  1 
ATOM   1319  C CG  . LEU A 1 177 ? -44.223 13.328  -45.782  1.00 159.87 ? 186 LEU A CG  1 
ATOM   1320  C CD1 . LEU A 1 177 ? -44.849 13.940  -44.538  1.00 160.86 ? 186 LEU A CD1 1 
ATOM   1321  C CD2 . LEU A 1 177 ? -44.057 14.374  -46.873  1.00 164.06 ? 186 LEU A CD2 1 
ATOM   1322  N N   . LYS A 1 178 ? -40.745 10.339  -45.408  1.00 138.98 ? 187 LYS A N   1 
ATOM   1323  C CA  . LYS A 1 178 ? -39.480 9.772   -44.962  1.00 137.79 ? 187 LYS A CA  1 
ATOM   1324  C C   . LYS A 1 178 ? -39.144 8.519   -45.766  1.00 135.55 ? 187 LYS A C   1 
ATOM   1325  O O   . LYS A 1 178 ? -38.235 7.766   -45.414  1.00 134.21 ? 187 LYS A O   1 
ATOM   1326  C CB  . LYS A 1 178 ? -39.535 9.446   -43.468  1.00 136.21 ? 187 LYS A CB  1 
ATOM   1327  N N   . LYS A 1 179 ? -39.887 8.305   -46.849  1.00 134.03 ? 188 LYS A N   1 
ATOM   1328  C CA  . LYS A 1 179 ? -39.672 7.159   -47.725  1.00 132.48 ? 188 LYS A CA  1 
ATOM   1329  C C   . LYS A 1 179 ? -39.617 5.851   -46.942  1.00 129.20 ? 188 LYS A C   1 
ATOM   1330  O O   . LYS A 1 179 ? -38.710 5.041   -47.133  1.00 128.37 ? 188 LYS A O   1 
ATOM   1331  C CB  . LYS A 1 179 ? -38.391 7.340   -48.544  1.00 134.26 ? 188 LYS A CB  1 
ATOM   1332  N N   . GLU A 1 180 ? -40.591 5.652   -46.060  1.00 161.48 ? 189 GLU A N   1 
ATOM   1333  C CA  . GLU A 1 180 ? -40.660 4.438   -45.254  1.00 158.64 ? 189 GLU A CA  1 
ATOM   1334  C C   . GLU A 1 180 ? -40.840 3.205   -46.131  1.00 157.28 ? 189 GLU A C   1 
ATOM   1335  O O   . GLU A 1 180 ? -41.793 3.113   -46.904  1.00 157.60 ? 189 GLU A O   1 
ATOM   1336  C CB  . GLU A 1 180 ? -41.803 4.531   -44.240  1.00 157.68 ? 189 GLU A CB  1 
ATOM   1337  C CG  . GLU A 1 180 ? -41.575 5.548   -43.133  1.00 158.96 ? 189 GLU A CG  1 
ATOM   1338  C CD  . GLU A 1 180 ? -40.494 5.120   -42.161  1.00 158.25 ? 189 GLU A CD  1 
ATOM   1339  O OE1 . GLU A 1 180 ? -40.098 3.935   -42.193  1.00 156.43 ? 189 GLU A OE1 1 
ATOM   1340  O OE2 . GLU A 1 180 ? -40.040 5.967   -41.363  1.00 159.91 ? 189 GLU A OE2 1 
ATOM   1341  N N   . ARG A 1 181 ? -39.917 2.257   -46.005  1.00 129.56 ? 190 ARG A N   1 
ATOM   1342  C CA  . ARG A 1 181 ? -39.972 1.025   -46.781  1.00 128.62 ? 190 ARG A CA  1 
ATOM   1343  C C   . ARG A 1 181 ? -40.125 -0.190  -45.871  1.00 126.36 ? 190 ARG A C   1 
ATOM   1344  O O   . ARG A 1 181 ? -40.286 -1.314  -46.342  1.00 125.60 ? 190 ARG A O   1 
ATOM   1345  C CB  . ARG A 1 181 ? -38.717 0.879   -47.644  1.00 129.96 ? 190 ARG A CB  1 
ATOM   1346  C CG  . ARG A 1 181 ? -38.606 1.903   -48.762  1.00 132.46 ? 190 ARG A CG  1 
ATOM   1347  C CD  . ARG A 1 181 ? -39.662 1.671   -49.831  1.00 132.96 ? 190 ARG A CD  1 
ATOM   1348  N NE  . ARG A 1 181 ? -39.593 2.667   -50.896  1.00 135.75 ? 190 ARG A NE  1 
ATOM   1349  C CZ  . ARG A 1 181 ? -40.314 3.783   -50.924  1.00 137.24 ? 190 ARG A CZ  1 
ATOM   1350  N NH1 . ARG A 1 181 ? -41.164 4.051   -49.942  1.00 136.15 ? 190 ARG A NH1 1 
ATOM   1351  N NH2 . ARG A 1 181 ? -40.186 4.633   -51.933  1.00 140.15 ? 190 ARG A NH2 1 
ATOM   1352  N N   . ARG A 1 182 ? -40.076 0.045   -44.564  1.00 134.62 ? 191 ARG A N   1 
ATOM   1353  C CA  . ARG A 1 182 ? -40.184 -1.034  -43.591  1.00 132.84 ? 191 ARG A CA  1 
ATOM   1354  C C   . ARG A 1 182 ? -41.350 -0.799  -42.636  1.00 131.90 ? 191 ARG A C   1 
ATOM   1355  O O   . ARG A 1 182 ? -41.301 0.088   -41.785  1.00 132.51 ? 191 ARG A O   1 
ATOM   1356  C CB  . ARG A 1 182 ? -38.874 -1.182  -42.818  1.00 133.26 ? 191 ARG A CB  1 
ATOM   1357  C CG  . ARG A 1 182 ? -37.696 -1.554  -43.702  1.00 134.36 ? 191 ARG A CG  1 
ATOM   1358  C CD  . ARG A 1 182 ? -36.379 -1.515  -42.948  1.00 135.47 ? 191 ARG A CD  1 
ATOM   1359  N NE  . ARG A 1 182 ? -35.268 -1.950  -43.790  1.00 136.75 ? 191 ARG A NE  1 
ATOM   1360  C CZ  . ARG A 1 182 ? -33.996 -1.963  -43.405  1.00 138.33 ? 191 ARG A CZ  1 
ATOM   1361  N NH1 . ARG A 1 182 ? -33.665 -1.561  -42.185  1.00 138.90 ? 191 ARG A NH1 1 
ATOM   1362  N NH2 . ARG A 1 182 ? -33.053 -2.378  -44.242  1.00 139.70 ? 191 ARG A NH2 1 
ATOM   1363  N N   . VAL A 1 183 ? -42.398 -1.603  -42.784  1.00 116.41 ? 192 VAL A N   1 
ATOM   1364  C CA  . VAL A 1 183 ? -43.618 -1.428  -42.005  1.00 115.76 ? 192 VAL A CA  1 
ATOM   1365  C C   . VAL A 1 183 ? -43.900 -2.626  -41.103  1.00 114.18 ? 192 VAL A C   1 
ATOM   1366  O O   . VAL A 1 183 ? -43.686 -3.773  -41.495  1.00 113.59 ? 192 VAL A O   1 
ATOM   1367  C CB  . VAL A 1 183 ? -44.835 -1.206  -42.925  1.00 116.36 ? 192 VAL A CB  1 
ATOM   1368  C CG1 . VAL A 1 183 ? -46.084 -0.939  -42.102  1.00 116.11 ? 192 VAL A CG1 1 
ATOM   1369  C CG2 . VAL A 1 183 ? -44.570 -0.060  -43.888  1.00 118.32 ? 192 VAL A CG2 1 
ATOM   1370  N N   . ILE A 1 184 ? -44.378 -2.351  -39.894  1.00 116.24 ? 193 ILE A N   1 
ATOM   1371  C CA  . ILE A 1 184 ? -44.784 -3.402  -38.968  1.00 115.05 ? 193 ILE A CA  1 
ATOM   1372  C C   . ILE A 1 184 ? -46.290 -3.344  -38.745  1.00 114.79 ? 193 ILE A C   1 
ATOM   1373  O O   . ILE A 1 184 ? -46.808 -2.365  -38.206  1.00 115.46 ? 193 ILE A O   1 
ATOM   1374  C CB  . ILE A 1 184 ? -44.074 -3.269  -37.610  1.00 115.22 ? 193 ILE A CB  1 
ATOM   1375  C CG1 . ILE A 1 184 ? -42.558 -3.333  -37.792  1.00 115.94 ? 193 ILE A CG1 1 
ATOM   1376  C CG2 . ILE A 1 184 ? -44.539 -4.358  -36.659  1.00 114.30 ? 193 ILE A CG2 1 
ATOM   1377  C CD1 . ILE A 1 184 ? -41.786 -3.273  -36.493  1.00 116.66 ? 193 ILE A CD1 1 
ATOM   1378  N N   . LEU A 1 185 ? -46.991 -4.392  -39.163  1.00 109.57 ? 194 LEU A N   1 
ATOM   1379  C CA  . LEU A 1 185 ? -48.441 -4.442  -39.021  1.00 109.65 ? 194 LEU A CA  1 
ATOM   1380  C C   . LEU A 1 185 ? -48.863 -5.163  -37.744  1.00 108.87 ? 194 LEU A C   1 
ATOM   1381  O O   . LEU A 1 185 ? -48.846 -6.393  -37.679  1.00 108.26 ? 194 LEU A O   1 
ATOM   1382  C CB  . LEU A 1 185 ? -49.078 -5.110  -40.241  1.00 110.02 ? 194 LEU A CB  1 
ATOM   1383  C CG  . LEU A 1 185 ? -48.903 -4.378  -41.572  1.00 111.28 ? 194 LEU A CG  1 
ATOM   1384  C CD1 . LEU A 1 185 ? -49.708 -5.058  -42.668  1.00 112.15 ? 194 LEU A CD1 1 
ATOM   1385  C CD2 . LEU A 1 185 ? -49.300 -2.919  -41.435  1.00 112.41 ? 194 LEU A CD2 1 
ATOM   1386  N N   . ASP A 1 186 ? -49.237 -4.389  -36.731  1.00 120.72 ? 195 ASP A N   1 
ATOM   1387  C CA  . ASP A 1 186 ? -49.719 -4.948  -35.475  1.00 120.35 ? 195 ASP A CA  1 
ATOM   1388  C C   . ASP A 1 186 ? -51.240 -4.895  -35.437  1.00 120.84 ? 195 ASP A C   1 
ATOM   1389  O O   . ASP A 1 186 ? -51.822 -4.009  -34.814  1.00 121.69 ? 195 ASP A O   1 
ATOM   1390  C CB  . ASP A 1 186 ? -49.140 -4.175  -34.290  1.00 120.87 ? 195 ASP A CB  1 
ATOM   1391  C CG  . ASP A 1 186 ? -49.496 -4.801  -32.957  1.00 120.77 ? 195 ASP A CG  1 
ATOM   1392  O OD1 . ASP A 1 186 ? -49.746 -6.025  -32.918  1.00 120.08 ? 195 ASP A OD1 1 
ATOM   1393  O OD2 . ASP A 1 186 ? -49.524 -4.070  -31.946  1.00 121.67 ? 195 ASP A OD2 1 
ATOM   1394  N N   . CYS A 1 187 ? -51.879 -5.846  -36.110  1.00 138.53 ? 196 CYS A N   1 
ATOM   1395  C CA  . CYS A 1 187 ? -53.332 -5.856  -36.215  1.00 139.42 ? 196 CYS A CA  1 
ATOM   1396  C C   . CYS A 1 187 ? -53.895 -7.269  -36.122  1.00 139.17 ? 196 CYS A C   1 
ATOM   1397  O O   . CYS A 1 187 ? -53.149 -8.243  -36.015  1.00 138.36 ? 196 CYS A O   1 
ATOM   1398  C CB  . CYS A 1 187 ? -53.766 -5.215  -37.534  1.00 140.61 ? 196 CYS A CB  1 
ATOM   1399  S SG  . CYS A 1 187 ? -52.978 -3.627  -37.884  1.00 141.30 ? 196 CYS A SG  1 
ATOM   1400  N N   . GLU A 1 188 ? -55.219 -7.372  -36.163  1.00 208.74 ? 197 GLU A N   1 
ATOM   1401  C CA  . GLU A 1 188 ? -55.887 -8.666  -36.159  1.00 209.03 ? 197 GLU A CA  1 
ATOM   1402  C C   . GLU A 1 188 ? -55.821 -9.285  -37.549  1.00 209.59 ? 197 GLU A C   1 
ATOM   1403  O O   . GLU A 1 188 ? -55.440 -8.620  -38.512  1.00 209.89 ? 197 GLU A O   1 
ATOM   1404  C CB  . GLU A 1 188 ? -57.343 -8.518  -35.714  1.00 210.43 ? 197 GLU A CB  1 
ATOM   1405  N N   . ARG A 1 189 ? -56.195 -10.556 -37.650  1.00 167.87 ? 198 ARG A N   1 
ATOM   1406  C CA  . ARG A 1 189 ? -56.144 -11.271 -38.921  1.00 168.83 ? 198 ARG A CA  1 
ATOM   1407  C C   . ARG A 1 189 ? -56.981 -10.585 -39.998  1.00 170.67 ? 198 ARG A C   1 
ATOM   1408  O O   . ARG A 1 189 ? -56.757 -10.785 -41.192  1.00 171.64 ? 198 ARG A O   1 
ATOM   1409  C CB  . ARG A 1 189 ? -56.606 -12.718 -38.741  1.00 169.64 ? 198 ARG A CB  1 
ATOM   1410  N N   . ASP A 1 190 ? -57.944 -9.775  -39.570  1.00 174.76 ? 199 ASP A N   1 
ATOM   1411  C CA  . ASP A 1 190 ? -58.833 -9.085  -40.499  1.00 177.06 ? 199 ASP A CA  1 
ATOM   1412  C C   . ASP A 1 190 ? -58.252 -7.754  -40.964  1.00 176.95 ? 199 ASP A C   1 
ATOM   1413  O O   . ASP A 1 190 ? -58.134 -7.505  -42.165  1.00 178.27 ? 199 ASP A O   1 
ATOM   1414  C CB  . ASP A 1 190 ? -60.206 -8.867  -39.862  1.00 178.63 ? 199 ASP A CB  1 
ATOM   1415  C CG  . ASP A 1 190 ? -60.934 -10.168 -39.590  1.00 179.49 ? 199 ASP A CG  1 
ATOM   1416  O OD1 . ASP A 1 190 ? -60.362 -11.242 -39.873  1.00 178.89 ? 199 ASP A OD1 1 
ATOM   1417  O OD2 . ASP A 1 190 ? -62.080 -10.117 -39.094  1.00 181.05 ? 199 ASP A OD2 1 
ATOM   1418  N N   . LYS A 1 191 ? -57.894 -6.901  -40.009  1.00 147.91 ? 200 LYS A N   1 
ATOM   1419  C CA  . LYS A 1 191 ? -57.330 -5.592  -40.321  1.00 148.07 ? 200 LYS A CA  1 
ATOM   1420  C C   . LYS A 1 191 ? -56.047 -5.717  -41.137  1.00 147.10 ? 200 LYS A C   1 
ATOM   1421  O O   . LYS A 1 191 ? -55.644 -4.778  -41.823  1.00 147.87 ? 200 LYS A O   1 
ATOM   1422  C CB  . LYS A 1 191 ? -57.066 -4.798  -39.039  1.00 147.09 ? 200 LYS A CB  1 
ATOM   1423  N N   . VAL A 1 192 ? -55.408 -6.880  -41.057  1.00 124.13 ? 201 VAL A N   1 
ATOM   1424  C CA  . VAL A 1 192 ? -54.186 -7.134  -41.811  1.00 123.46 ? 201 VAL A CA  1 
ATOM   1425  C C   . VAL A 1 192 ? -54.483 -7.329  -43.294  1.00 125.40 ? 201 VAL A C   1 
ATOM   1426  O O   . VAL A 1 192 ? -53.816 -6.749  -44.149  1.00 125.92 ? 201 VAL A O   1 
ATOM   1427  C CB  . VAL A 1 192 ? -53.432 -8.365  -41.271  1.00 121.92 ? 201 VAL A CB  1 
ATOM   1428  C CG1 . VAL A 1 192 ? -52.371 -8.818  -42.262  1.00 121.95 ? 201 VAL A CG1 1 
ATOM   1429  C CG2 . VAL A 1 192 ? -52.808 -8.054  -39.922  1.00 120.32 ? 201 VAL A CG2 1 
ATOM   1430  N N   . ASN A 1 193 ? -55.486 -8.148  -43.594  1.00 164.39 ? 202 ASN A N   1 
ATOM   1431  C CA  . ASN A 1 193 ? -55.884 -8.387  -44.976  1.00 166.84 ? 202 ASN A CA  1 
ATOM   1432  C C   . ASN A 1 193 ? -56.325 -7.107  -45.675  1.00 168.84 ? 202 ASN A C   1 
ATOM   1433  O O   . ASN A 1 193 ? -56.061 -6.915  -46.861  1.00 170.49 ? 202 ASN A O   1 
ATOM   1434  C CB  . ASN A 1 193 ? -56.992 -9.438  -45.047  1.00 168.48 ? 202 ASN A CB  1 
ATOM   1435  C CG  . ASN A 1 193 ? -56.474 -10.845 -44.831  1.00 167.53 ? 202 ASN A CG  1 
ATOM   1436  O OD1 . ASN A 1 193 ? -55.269 -11.063 -44.704  1.00 165.78 ? 202 ASN A OD1 1 
ATOM   1437  N ND2 . ASN A 1 193 ? -57.384 -11.812 -44.793  1.00 169.06 ? 202 ASN A ND2 1 
ATOM   1438  N N   . ASP A 1 194 ? -56.999 -6.234  -44.933  1.00 183.82 ? 203 ASP A N   1 
ATOM   1439  C CA  . ASP A 1 194 ? -57.427 -4.947  -45.468  1.00 186.04 ? 203 ASP A CA  1 
ATOM   1440  C C   . ASP A 1 194 ? -56.218 -4.114  -45.880  1.00 185.35 ? 203 ASP A C   1 
ATOM   1441  O O   . ASP A 1 194 ? -56.191 -3.537  -46.967  1.00 187.55 ? 203 ASP A O   1 
ATOM   1442  C CB  . ASP A 1 194 ? -58.261 -4.184  -44.437  1.00 186.35 ? 203 ASP A CB  1 
ATOM   1443  C CG  . ASP A 1 194 ? -59.579 -4.868  -44.130  1.00 187.76 ? 203 ASP A CG  1 
ATOM   1444  O OD1 . ASP A 1 194 ? -59.849 -5.937  -44.717  1.00 188.56 ? 203 ASP A OD1 1 
ATOM   1445  O OD2 . ASP A 1 194 ? -60.346 -4.333  -43.303  1.00 188.36 ? 203 ASP A OD2 1 
ATOM   1446  N N   . ILE A 1 195 ? -55.220 -4.059  -45.005  1.00 132.34 ? 204 ILE A N   1 
ATOM   1447  C CA  . ILE A 1 195 ? -53.991 -3.324  -45.285  1.00 131.73 ? 204 ILE A CA  1 
ATOM   1448  C C   . ILE A 1 195 ? -53.225 -3.961  -46.440  1.00 132.05 ? 204 ILE A C   1 
ATOM   1449  O O   . ILE A 1 195 ? -52.800 -3.273  -47.366  1.00 133.53 ? 204 ILE A O   1 
ATOM   1450  C CB  . ILE A 1 195 ? -53.078 -3.254  -44.046  1.00 129.13 ? 204 ILE A CB  1 
ATOM   1451  C CG1 . ILE A 1 195 ? -53.757 -2.461  -42.929  1.00 129.25 ? 204 ILE A CG1 1 
ATOM   1452  C CG2 . ILE A 1 195 ? -51.741 -2.625  -44.403  1.00 128.80 ? 204 ILE A CG2 1 
ATOM   1453  C CD1 . ILE A 1 195 ? -52.912 -2.317  -41.683  1.00 127.28 ? 204 ILE A CD1 1 
ATOM   1454  N N   . VAL A 1 196 ? -53.056 -5.278  -46.380  1.00 120.26 ? 205 VAL A N   1 
ATOM   1455  C CA  . VAL A 1 196 ? -52.358 -6.011  -47.428  1.00 120.83 ? 205 VAL A CA  1 
ATOM   1456  C C   . VAL A 1 196 ? -52.985 -5.755  -48.794  1.00 124.01 ? 205 VAL A C   1 
ATOM   1457  O O   . VAL A 1 196 ? -52.278 -5.575  -49.785  1.00 125.12 ? 205 VAL A O   1 
ATOM   1458  C CB  . VAL A 1 196 ? -52.344 -7.524  -47.143  1.00 119.92 ? 205 VAL A CB  1 
ATOM   1459  C CG1 . VAL A 1 196 ? -51.885 -8.293  -48.369  1.00 121.43 ? 205 VAL A CG1 1 
ATOM   1460  C CG2 . VAL A 1 196 ? -51.452 -7.829  -45.950  1.00 117.21 ? 205 VAL A CG2 1 
ATOM   1461  N N   . ASP A 1 197 ? -54.313 -5.735  -48.841  1.00 168.64 ? 206 ASP A N   1 
ATOM   1462  C CA  . ASP A 1 197 ? -55.030 -5.467  -50.082  1.00 172.27 ? 206 ASP A CA  1 
ATOM   1463  C C   . ASP A 1 197 ? -54.741 -4.058  -50.592  1.00 173.70 ? 206 ASP A C   1 
ATOM   1464  O O   . ASP A 1 197 ? -54.493 -3.859  -51.781  1.00 176.05 ? 206 ASP A O   1 
ATOM   1465  C CB  . ASP A 1 197 ? -56.536 -5.665  -49.893  1.00 174.23 ? 206 ASP A CB  1 
ATOM   1466  C CG  . ASP A 1 197 ? -56.928 -7.129  -49.846  1.00 174.27 ? 206 ASP A CG  1 
ATOM   1467  O OD1 . ASP A 1 197 ? -56.090 -7.982  -50.208  1.00 173.46 ? 206 ASP A OD1 1 
ATOM   1468  O OD2 . ASP A 1 197 ? -58.076 -7.427  -49.452  1.00 175.42 ? 206 ASP A OD2 1 
ATOM   1469  N N   . GLN A 1 198 ? -54.775 -3.086  -49.687  1.00 159.05 ? 207 GLN A N   1 
ATOM   1470  C CA  . GLN A 1 198 ? -54.474 -1.703  -50.038  1.00 160.54 ? 207 GLN A CA  1 
ATOM   1471  C C   . GLN A 1 198 ? -53.036 -1.571  -50.527  1.00 159.60 ? 207 GLN A C   1 
ATOM   1472  O O   . GLN A 1 198 ? -52.759 -0.858  -51.491  1.00 161.94 ? 207 GLN A O   1 
ATOM   1473  C CB  . GLN A 1 198 ? -54.708 -0.784  -48.837  1.00 159.53 ? 207 GLN A CB  1 
ATOM   1474  C CG  . GLN A 1 198 ? -56.169 -0.613  -48.459  1.00 161.34 ? 207 GLN A CG  1 
ATOM   1475  C CD  . GLN A 1 198 ? -56.947 0.184   -49.488  1.00 165.70 ? 207 GLN A CD  1 
ATOM   1476  O OE1 . GLN A 1 198 ? -56.366 0.885   -50.317  1.00 167.30 ? 207 GLN A OE1 1 
ATOM   1477  N NE2 . GLN A 1 198 ? -58.271 0.083   -49.438  1.00 168.00 ? 207 GLN A NE2 1 
ATOM   1478  N N   . VAL A 1 199 ? -52.126 -2.267  -49.851  1.00 125.96 ? 208 VAL A N   1 
ATOM   1479  C CA  . VAL A 1 199 ? -50.712 -2.245  -50.205  1.00 125.08 ? 208 VAL A CA  1 
ATOM   1480  C C   . VAL A 1 199 ? -50.492 -2.694  -51.645  1.00 127.31 ? 208 VAL A C   1 
ATOM   1481  O O   . VAL A 1 199 ? -49.710 -2.092  -52.379  1.00 128.53 ? 208 VAL A O   1 
ATOM   1482  C CB  . VAL A 1 199 ? -49.884 -3.140  -49.261  1.00 121.89 ? 208 VAL A CB  1 
ATOM   1483  C CG1 . VAL A 1 199 ? -48.501 -3.387  -49.836  1.00 121.63 ? 208 VAL A CG1 1 
ATOM   1484  C CG2 . VAL A 1 199 ? -49.790 -2.510  -47.880  1.00 120.05 ? 208 VAL A CG2 1 
ATOM   1485  N N   . ILE A 1 200 ? -51.189 -3.753  -52.045  1.00 130.26 ? 209 ILE A N   1 
ATOM   1486  C CA  . ILE A 1 200 ? -51.072 -4.277  -53.400  1.00 132.82 ? 209 ILE A CA  1 
ATOM   1487  C C   . ILE A 1 200 ? -51.660 -3.306  -54.417  1.00 136.58 ? 209 ILE A C   1 
ATOM   1488  O O   . ILE A 1 200 ? -51.131 -3.147  -55.517  1.00 138.75 ? 209 ILE A O   1 
ATOM   1489  C CB  . ILE A 1 200 ? -51.780 -5.635  -53.542  1.00 133.39 ? 209 ILE A CB  1 
ATOM   1490  C CG1 . ILE A 1 200 ? -51.298 -6.604  -52.462  1.00 130.04 ? 209 ILE A CG1 1 
ATOM   1491  C CG2 . ILE A 1 200 ? -51.545 -6.218  -54.927  1.00 136.31 ? 209 ILE A CG2 1 
ATOM   1492  C CD1 . ILE A 1 200 ? -52.027 -7.925  -52.466  1.00 130.70 ? 209 ILE A CD1 1 
ATOM   1493  N N   . THR A 1 201 ? -52.759 -2.659  -54.042  1.00 138.36 ? 210 THR A N   1 
ATOM   1494  C CA  . THR A 1 201 ? -53.428 -1.711  -54.925  1.00 142.41 ? 210 THR A CA  1 
ATOM   1495  C C   . THR A 1 201 ? -52.514 -0.544  -55.279  1.00 143.08 ? 210 THR A C   1 
ATOM   1496  O O   . THR A 1 201 ? -52.360 -0.197  -56.450  1.00 146.31 ? 210 THR A O   1 
ATOM   1497  C CB  . THR A 1 201 ? -54.724 -1.168  -54.293  1.00 143.48 ? 210 THR A CB  1 
ATOM   1498  O OG1 . THR A 1 201 ? -55.624 -2.252  -54.035  1.00 143.38 ? 210 THR A OG1 1 
ATOM   1499  C CG2 . THR A 1 201 ? -55.394 -0.171  -55.227  1.00 148.22 ? 210 THR A CG2 1 
ATOM   1500  N N   . ILE A 1 202 ? -51.907 0.058   -54.261  1.00 148.21 ? 211 ILE A N   1 
ATOM   1501  C CA  . ILE A 1 202 ? -50.999 1.181   -54.467  1.00 148.87 ? 211 ILE A CA  1 
ATOM   1502  C C   . ILE A 1 202 ? -49.637 0.708   -54.969  1.00 147.82 ? 211 ILE A C   1 
ATOM   1503  O O   . ILE A 1 202 ? -48.788 1.516   -55.348  1.00 148.82 ? 211 ILE A O   1 
ATOM   1504  C CB  . ILE A 1 202 ? -50.821 2.010   -53.181  1.00 146.83 ? 211 ILE A CB  1 
ATOM   1505  C CG1 . ILE A 1 202 ? -50.318 1.128   -52.038  1.00 142.60 ? 211 ILE A CG1 1 
ATOM   1506  C CG2 . ILE A 1 202 ? -52.131 2.678   -52.796  1.00 148.67 ? 211 ILE A CG2 1 
ATOM   1507  C CD1 . ILE A 1 202 ? -50.228 1.846   -50.709  1.00 140.88 ? 211 ILE A CD1 1 
ATOM   1508  N N   . GLY A 1 203 ? -49.435 -0.606  -54.968  1.00 149.30 ? 212 GLY A N   1 
ATOM   1509  C CA  . GLY A 1 203 ? -48.224 -1.195  -55.509  1.00 148.79 ? 212 GLY A CA  1 
ATOM   1510  C C   . GLY A 1 203 ? -47.019 -1.132  -54.591  1.00 145.69 ? 212 GLY A C   1 
ATOM   1511  O O   . GLY A 1 203 ? -45.881 -1.240  -55.047  1.00 145.83 ? 212 GLY A O   1 
ATOM   1512  N N   . LYS A 1 204 ? -47.261 -0.959  -53.295  1.00 134.30 ? 213 LYS A N   1 
ATOM   1513  C CA  . LYS A 1 204 ? -46.176 -0.923  -52.320  1.00 131.68 ? 213 LYS A CA  1 
ATOM   1514  C C   . LYS A 1 204 ? -45.866 -2.315  -51.779  1.00 129.29 ? 213 LYS A C   1 
ATOM   1515  O O   . LYS A 1 204 ? -45.522 -2.476  -50.608  1.00 126.95 ? 213 LYS A O   1 
ATOM   1516  C CB  . LYS A 1 204 ? -46.504 0.032   -51.172  1.00 130.73 ? 213 LYS A CB  1 
ATOM   1517  C CG  . LYS A 1 204 ? -46.470 1.500   -51.561  1.00 133.19 ? 213 LYS A CG  1 
ATOM   1518  C CD  . LYS A 1 204 ? -46.522 2.395   -50.333  1.00 132.32 ? 213 LYS A CD  1 
ATOM   1519  C CE  . LYS A 1 204 ? -46.491 3.865   -50.719  1.00 135.23 ? 213 LYS A CE  1 
ATOM   1520  N NZ  . LYS A 1 204 ? -45.265 4.216   -51.486  1.00 136.49 ? 213 LYS A NZ  1 
ATOM   1521  N N   . HIS A 1 205 ? -45.987 -3.318  -52.642  1.00 140.23 ? 214 HIS A N   1 
ATOM   1522  C CA  . HIS A 1 205 ? -45.717 -4.698  -52.262  1.00 138.63 ? 214 HIS A CA  1 
ATOM   1523  C C   . HIS A 1 205 ? -44.611 -5.284  -53.129  1.00 139.69 ? 214 HIS A C   1 
ATOM   1524  O O   . HIS A 1 205 ? -44.398 -6.496  -53.146  1.00 139.37 ? 214 HIS A O   1 
ATOM   1525  C CB  . HIS A 1 205 ? -46.984 -5.542  -52.397  1.00 139.22 ? 214 HIS A CB  1 
ATOM   1526  C CG  . HIS A 1 205 ? -47.446 -5.713  -53.810  1.00 142.46 ? 214 HIS A CG  1 
ATOM   1527  N ND1 . HIS A 1 205 ? -47.323 -6.902  -54.494  1.00 143.66 ? 214 HIS A ND1 1 
ATOM   1528  C CD2 . HIS A 1 205 ? -48.025 -4.841  -54.670  1.00 145.18 ? 214 HIS A CD2 1 
ATOM   1529  C CE1 . HIS A 1 205 ? -47.812 -6.758  -55.715  1.00 146.97 ? 214 HIS A CE1 1 
ATOM   1530  N NE2 . HIS A 1 205 ? -48.243 -5.517  -55.846  1.00 147.96 ? 214 HIS A NE2 1 
ATOM   1531  N N   . VAL A 1 206 ? -43.912 -4.415  -53.851  1.00 153.23 ? 215 VAL A N   1 
ATOM   1532  C CA  . VAL A 1 206 ? -42.827 -4.840  -54.725  1.00 154.64 ? 215 VAL A CA  1 
ATOM   1533  C C   . VAL A 1 206 ? -41.504 -4.863  -53.970  1.00 153.01 ? 215 VAL A C   1 
ATOM   1534  O O   . VAL A 1 206 ? -41.436 -4.466  -52.807  1.00 150.97 ? 215 VAL A O   1 
ATOM   1535  C CB  . VAL A 1 206 ? -42.693 -3.912  -55.945  1.00 157.66 ? 215 VAL A CB  1 
ATOM   1536  C CG1 . VAL A 1 206 ? -43.967 -3.942  -56.772  1.00 159.97 ? 215 VAL A CG1 1 
ATOM   1537  C CG2 . VAL A 1 206 ? -42.376 -2.493  -55.499  1.00 157.41 ? 215 VAL A CG2 1 
ATOM   1538  N N   . LYS A 1 207 ? -40.455 -5.328  -54.640  1.00 140.53 ? 216 LYS A N   1 
ATOM   1539  C CA  . LYS A 1 207 ? -39.133 -5.403  -54.032  1.00 139.66 ? 216 LYS A CA  1 
ATOM   1540  C C   . LYS A 1 207 ? -38.704 -4.050  -53.479  1.00 139.26 ? 216 LYS A C   1 
ATOM   1541  O O   . LYS A 1 207 ? -38.801 -3.031  -54.162  1.00 140.95 ? 216 LYS A O   1 
ATOM   1542  C CB  . LYS A 1 207 ? -38.104 -5.904  -55.045  1.00 141.91 ? 216 LYS A CB  1 
ATOM   1543  C CG  . LYS A 1 207 ? -36.691 -5.971  -54.497  1.00 141.64 ? 216 LYS A CG  1 
ATOM   1544  C CD  . LYS A 1 207 ? -35.729 -6.527  -55.527  1.00 144.20 ? 216 LYS A CD  1 
ATOM   1545  C CE  . LYS A 1 207 ? -34.330 -6.649  -54.956  1.00 144.33 ? 216 LYS A CE  1 
ATOM   1546  N NZ  . LYS A 1 207 ? -33.405 -7.269  -55.937  1.00 147.08 ? 216 LYS A NZ  1 
ATOM   1547  N N   . GLY A 1 208 ? -38.227 -4.048  -52.239  1.00 136.21 ? 217 GLY A N   1 
ATOM   1548  C CA  . GLY A 1 208 ? -37.803 -2.822  -51.590  1.00 136.08 ? 217 GLY A CA  1 
ATOM   1549  C C   . GLY A 1 208 ? -38.537 -2.603  -50.284  1.00 133.95 ? 217 GLY A C   1 
ATOM   1550  O O   . GLY A 1 208 ? -38.015 -1.972  -49.366  1.00 133.53 ? 217 GLY A O   1 
ATOM   1551  N N   . TYR A 1 209 ? -39.755 -3.130  -50.205  1.00 132.78 ? 218 TYR A N   1 
ATOM   1552  C CA  . TYR A 1 209 ? -40.565 -3.017  -48.998  1.00 130.93 ? 218 TYR A CA  1 
ATOM   1553  C C   . TYR A 1 209 ? -40.423 -4.256  -48.122  1.00 129.22 ? 218 TYR A C   1 
ATOM   1554  O O   . TYR A 1 209 ? -40.194 -5.357  -48.621  1.00 129.50 ? 218 TYR A O   1 
ATOM   1555  C CB  . TYR A 1 209 ? -42.035 -2.790  -49.356  1.00 131.19 ? 218 TYR A CB  1 
ATOM   1556  C CG  . TYR A 1 209 ? -42.306 -1.459  -50.022  1.00 133.14 ? 218 TYR A CG  1 
ATOM   1557  C CD1 . TYR A 1 209 ? -42.176 -1.310  -51.396  1.00 135.40 ? 218 TYR A CD1 1 
ATOM   1558  C CD2 . TYR A 1 209 ? -42.692 -0.353  -49.276  1.00 133.10 ? 218 TYR A CD2 1 
ATOM   1559  C CE1 . TYR A 1 209 ? -42.423 -0.098  -52.009  1.00 137.59 ? 218 TYR A CE1 1 
ATOM   1560  C CE2 . TYR A 1 209 ? -42.942 0.865   -49.880  1.00 135.32 ? 218 TYR A CE2 1 
ATOM   1561  C CZ  . TYR A 1 209 ? -42.805 0.986   -51.247  1.00 137.55 ? 218 TYR A CZ  1 
ATOM   1562  O OH  . TYR A 1 209 ? -43.051 2.195   -51.857  1.00 140.14 ? 218 TYR A OH  1 
ATOM   1563  N N   . HIS A 1 210 ? -40.558 -4.070  -46.814  1.00 131.68 ? 219 HIS A N   1 
ATOM   1564  C CA  . HIS A 1 210 ? -40.450 -5.173  -45.868  1.00 130.34 ? 219 HIS A CA  1 
ATOM   1565  C C   . HIS A 1 210 ? -41.528 -5.056  -44.799  1.00 128.94 ? 219 HIS A C   1 
ATOM   1566  O O   . HIS A 1 210 ? -41.533 -4.109  -44.013  1.00 128.78 ? 219 HIS A O   1 
ATOM   1567  C CB  . HIS A 1 210 ? -39.068 -5.182  -45.215  1.00 130.68 ? 219 HIS A CB  1 
ATOM   1568  C CG  . HIS A 1 210 ? -38.709 -6.488  -44.578  1.00 130.16 ? 219 HIS A CG  1 
ATOM   1569  N ND1 . HIS A 1 210 ? -39.377 -6.992  -43.481  1.00 128.85 ? 219 HIS A ND1 1 
ATOM   1570  C CD2 . HIS A 1 210 ? -37.747 -7.391  -44.877  1.00 131.14 ? 219 HIS A CD2 1 
ATOM   1571  C CE1 . HIS A 1 210 ? -38.845 -8.149  -43.137  1.00 129.07 ? 219 HIS A CE1 1 
ATOM   1572  N NE2 . HIS A 1 210 ? -37.853 -8.416  -43.969  1.00 130.50 ? 219 HIS A NE2 1 
ATOM   1573  N N   . TYR A 1 211 ? -42.440 -6.021  -44.771  1.00 117.58 ? 220 TYR A N   1 
ATOM   1574  C CA  . TYR A 1 211 ? -43.538 -5.999  -43.813  1.00 116.47 ? 220 TYR A CA  1 
ATOM   1575  C C   . TYR A 1 211 ? -43.371 -7.063  -42.735  1.00 115.47 ? 220 TYR A C   1 
ATOM   1576  O O   . TYR A 1 211 ? -42.851 -8.147  -42.994  1.00 115.73 ? 220 TYR A O   1 
ATOM   1577  C CB  . TYR A 1 211 ? -44.877 -6.183  -44.528  1.00 116.85 ? 220 TYR A CB  1 
ATOM   1578  C CG  . TYR A 1 211 ? -45.222 -5.060  -45.477  1.00 118.23 ? 220 TYR A CG  1 
ATOM   1579  C CD1 . TYR A 1 211 ? -45.773 -3.875  -45.009  1.00 118.43 ? 220 TYR A CD1 1 
ATOM   1580  C CD2 . TYR A 1 211 ? -44.998 -5.184  -46.841  1.00 119.73 ? 220 TYR A CD2 1 
ATOM   1581  C CE1 . TYR A 1 211 ? -46.090 -2.846  -45.871  1.00 120.13 ? 220 TYR A CE1 1 
ATOM   1582  C CE2 . TYR A 1 211 ? -45.313 -4.160  -47.711  1.00 121.39 ? 220 TYR A CE2 1 
ATOM   1583  C CZ  . TYR A 1 211 ? -45.859 -2.993  -47.220  1.00 121.60 ? 220 TYR A CZ  1 
ATOM   1584  O OH  . TYR A 1 211 ? -46.176 -1.968  -48.079  1.00 123.67 ? 220 TYR A OH  1 
ATOM   1585  N N   . ILE A 1 212 ? -43.813 -6.741  -41.524  1.00 114.67 ? 221 ILE A N   1 
ATOM   1586  C CA  . ILE A 1 212 ? -43.776 -7.684  -40.414  1.00 114.00 ? 221 ILE A CA  1 
ATOM   1587  C C   . ILE A 1 212 ? -45.148 -7.784  -39.761  1.00 113.31 ? 221 ILE A C   1 
ATOM   1588  O O   . ILE A 1 212 ? -45.621 -6.830  -39.145  1.00 113.18 ? 221 ILE A O   1 
ATOM   1589  C CB  . ILE A 1 212 ? -42.746 -7.268  -39.350  1.00 114.21 ? 221 ILE A CB  1 
ATOM   1590  C CG1 . ILE A 1 212 ? -41.343 -7.219  -39.955  1.00 115.25 ? 221 ILE A CG1 1 
ATOM   1591  C CG2 . ILE A 1 212 ? -42.783 -8.225  -38.171  1.00 113.91 ? 221 ILE A CG2 1 
ATOM   1592  C CD1 . ILE A 1 212 ? -40.267 -6.839  -38.965  1.00 116.03 ? 221 ILE A CD1 1 
ATOM   1593  N N   . ILE A 1 213 ? -45.786 -8.941  -39.903  1.00 113.74 ? 222 ILE A N   1 
ATOM   1594  C CA  . ILE A 1 213 ? -47.099 -9.163  -39.313  1.00 113.37 ? 222 ILE A CA  1 
ATOM   1595  C C   . ILE A 1 213 ? -46.960 -9.493  -37.832  1.00 112.90 ? 222 ILE A C   1 
ATOM   1596  O O   . ILE A 1 213 ? -46.558 -10.598 -37.467  1.00 113.05 ? 222 ILE A O   1 
ATOM   1597  C CB  . ILE A 1 213 ? -47.850 -10.300 -40.028  1.00 113.88 ? 222 ILE A CB  1 
ATOM   1598  C CG1 . ILE A 1 213 ? -47.779 -10.113 -41.545  1.00 114.82 ? 222 ILE A CG1 1 
ATOM   1599  C CG2 . ILE A 1 213 ? -49.297 -10.360 -39.563  1.00 113.88 ? 222 ILE A CG2 1 
ATOM   1600  C CD1 . ILE A 1 213 ? -48.399 -8.820  -42.030  1.00 115.22 ? 222 ILE A CD1 1 
ATOM   1601  N N   . ALA A 1 214 ? -47.294 -8.525  -36.984  1.00 109.55 ? 223 ALA A N   1 
ATOM   1602  C CA  . ALA A 1 214 ? -47.116 -8.668  -35.543  1.00 109.50 ? 223 ALA A CA  1 
ATOM   1603  C C   . ALA A 1 214 ? -48.265 -9.424  -34.881  1.00 109.38 ? 223 ALA A C   1 
ATOM   1604  O O   . ALA A 1 214 ? -49.012 -8.860  -34.081  1.00 109.46 ? 223 ALA A O   1 
ATOM   1605  C CB  . ALA A 1 214 ? -46.934 -7.303  -34.895  1.00 109.83 ? 223 ALA A CB  1 
ATOM   1606  N N   . ASN A 1 215 ? -48.400 -10.703 -35.219  1.00 107.50 ? 224 ASN A N   1 
ATOM   1607  C CA  . ASN A 1 215 ? -49.376 -11.573 -34.573  1.00 107.71 ? 224 ASN A CA  1 
ATOM   1608  C C   . ASN A 1 215 ? -48.900 -13.022 -34.561  1.00 108.29 ? 224 ASN A C   1 
ATOM   1609  O O   . ASN A 1 215 ? -47.941 -13.375 -35.249  1.00 108.56 ? 224 ASN A O   1 
ATOM   1610  C CB  . ASN A 1 215 ? -50.749 -11.457 -35.243  1.00 107.89 ? 224 ASN A CB  1 
ATOM   1611  C CG  . ASN A 1 215 ? -50.740 -11.922 -36.687  1.00 108.31 ? 224 ASN A CG  1 
ATOM   1612  O OD1 . ASN A 1 215 ? -49.737 -12.433 -37.183  1.00 108.42 ? 224 ASN A OD1 1 
ATOM   1613  N ND2 . ASN A 1 215 ? -51.866 -11.748 -37.370  1.00 108.94 ? 224 ASN A ND2 1 
ATOM   1614  N N   . LEU A 1 216 ? -49.573 -13.859 -33.778  1.00 131.43 ? 225 LEU A N   1 
ATOM   1615  C CA  . LEU A 1 216 ? -49.180 -15.257 -33.643  1.00 132.44 ? 225 LEU A CA  1 
ATOM   1616  C C   . LEU A 1 216 ? -49.766 -16.125 -34.754  1.00 133.13 ? 225 LEU A C   1 
ATOM   1617  O O   . LEU A 1 216 ? -49.609 -17.345 -34.746  1.00 134.36 ? 225 LEU A O   1 
ATOM   1618  C CB  . LEU A 1 216 ? -49.596 -15.795 -32.272  1.00 133.12 ? 225 LEU A CB  1 
ATOM   1619  C CG  . LEU A 1 216 ? -49.044 -15.031 -31.066  1.00 133.03 ? 225 LEU A CG  1 
ATOM   1620  C CD1 . LEU A 1 216 ? -49.654 -15.545 -29.772  1.00 133.98 ? 225 LEU A CD1 1 
ATOM   1621  C CD2 . LEU A 1 216 ? -47.528 -15.120 -31.021  1.00 133.60 ? 225 LEU A CD2 1 
ATOM   1622  N N   . GLY A 1 217 ? -50.441 -15.490 -35.707  1.00 147.39 ? 226 GLY A N   1 
ATOM   1623  C CA  . GLY A 1 217 ? -51.039 -16.205 -36.819  1.00 148.46 ? 226 GLY A CA  1 
ATOM   1624  C C   . GLY A 1 217 ? -50.568 -15.696 -38.168  1.00 148.45 ? 226 GLY A C   1 
ATOM   1625  O O   . GLY A 1 217 ? -51.310 -15.021 -38.882  1.00 148.55 ? 226 GLY A O   1 
ATOM   1626  N N   . PHE A 1 218 ? -49.329 -16.024 -38.521  1.00 116.60 ? 227 PHE A N   1 
ATOM   1627  C CA  . PHE A 1 218 ? -48.742 -15.574 -39.779  1.00 116.81 ? 227 PHE A CA  1 
ATOM   1628  C C   . PHE A 1 218 ? -49.364 -16.280 -40.978  1.00 118.46 ? 227 PHE A C   1 
ATOM   1629  O O   . PHE A 1 218 ? -49.603 -15.663 -42.016  1.00 118.84 ? 227 PHE A O   1 
ATOM   1630  C CB  . PHE A 1 218 ? -47.227 -15.791 -39.770  1.00 116.96 ? 227 PHE A CB  1 
ATOM   1631  C CG  . PHE A 1 218 ? -46.544 -15.365 -41.040  1.00 117.40 ? 227 PHE A CG  1 
ATOM   1632  C CD1 . PHE A 1 218 ? -46.358 -14.023 -41.327  1.00 116.50 ? 227 PHE A CD1 1 
ATOM   1633  C CD2 . PHE A 1 218 ? -46.080 -16.308 -41.942  1.00 119.06 ? 227 PHE A CD2 1 
ATOM   1634  C CE1 . PHE A 1 218 ? -45.726 -13.629 -42.492  1.00 117.15 ? 227 PHE A CE1 1 
ATOM   1635  C CE2 . PHE A 1 218 ? -45.445 -15.920 -43.108  1.00 119.72 ? 227 PHE A CE2 1 
ATOM   1636  C CZ  . PHE A 1 218 ? -45.269 -14.579 -43.383  1.00 118.72 ? 227 PHE A CZ  1 
ATOM   1637  N N   . THR A 1 219 ? -49.621 -17.575 -40.831  1.00 137.85 ? 228 THR A N   1 
ATOM   1638  C CA  . THR A 1 219 ? -50.197 -18.367 -41.912  1.00 139.99 ? 228 THR A CA  1 
ATOM   1639  C C   . THR A 1 219 ? -51.721 -18.390 -41.836  1.00 140.66 ? 228 THR A C   1 
ATOM   1640  O O   . THR A 1 219 ? -52.382 -19.040 -42.646  1.00 142.83 ? 228 THR A O   1 
ATOM   1641  C CB  . THR A 1 219 ? -49.669 -19.814 -41.897  1.00 141.84 ? 228 THR A CB  1 
ATOM   1642  O OG1 . THR A 1 219 ? -49.992 -20.432 -40.645  1.00 141.75 ? 228 THR A OG1 1 
ATOM   1643  C CG2 . THR A 1 219 ? -48.161 -19.835 -42.094  1.00 141.76 ? 228 THR A CG2 1 
ATOM   1644  N N   . ASP A 1 220 ? -52.272 -17.677 -40.859  1.00 139.85 ? 229 ASP A N   1 
ATOM   1645  C CA  . ASP A 1 220 ? -53.717 -17.626 -40.670  1.00 140.62 ? 229 ASP A CA  1 
ATOM   1646  C C   . ASP A 1 220 ? -54.392 -16.762 -41.730  1.00 141.37 ? 229 ASP A C   1 
ATOM   1647  O O   . ASP A 1 220 ? -55.561 -16.967 -42.059  1.00 143.15 ? 229 ASP A O   1 
ATOM   1648  C CB  . ASP A 1 220 ? -54.060 -17.105 -39.273  1.00 139.06 ? 229 ASP A CB  1 
ATOM   1649  C CG  . ASP A 1 220 ? -53.675 -18.079 -38.176  1.00 139.06 ? 229 ASP A CG  1 
ATOM   1650  O OD1 . ASP A 1 220 ? -53.906 -17.760 -36.991  1.00 138.14 ? 229 ASP A OD1 1 
ATOM   1651  O OD2 . ASP A 1 220 ? -53.144 -19.163 -38.498  1.00 140.31 ? 229 ASP A OD2 1 
ATOM   1652  N N   . GLY A 1 221 ? -53.649 -15.797 -42.262  1.00 144.94 ? 230 GLY A N   1 
ATOM   1653  C CA  . GLY A 1 221 ? -54.177 -14.904 -43.277  1.00 145.92 ? 230 GLY A CA  1 
ATOM   1654  C C   . GLY A 1 221 ? -53.762 -15.302 -44.679  1.00 147.75 ? 230 GLY A C   1 
ATOM   1655  O O   . GLY A 1 221 ? -52.898 -16.160 -44.861  1.00 148.00 ? 230 GLY A O   1 
ATOM   1656  N N   . ASP A 1 222 ? -54.383 -14.679 -45.675  1.00 169.41 ? 231 ASP A N   1 
ATOM   1657  C CA  . ASP A 1 222 ? -54.052 -14.946 -47.069  1.00 171.58 ? 231 ASP A CA  1 
ATOM   1658  C C   . ASP A 1 222 ? -52.764 -14.229 -47.458  1.00 170.31 ? 231 ASP A C   1 
ATOM   1659  O O   . ASP A 1 222 ? -52.682 -13.003 -47.393  1.00 169.31 ? 231 ASP A O   1 
ATOM   1660  C CB  . ASP A 1 222 ? -55.196 -14.508 -47.985  1.00 174.35 ? 231 ASP A CB  1 
ATOM   1661  C CG  . ASP A 1 222 ? -54.942 -14.850 -49.442  1.00 177.20 ? 231 ASP A CG  1 
ATOM   1662  O OD1 . ASP A 1 222 ? -53.990 -15.609 -49.720  1.00 177.21 ? 231 ASP A OD1 1 
ATOM   1663  O OD2 . ASP A 1 222 ? -55.696 -14.361 -50.309  1.00 179.77 ? 231 ASP A OD2 1 
ATOM   1664  N N   . LEU A 1 223 ? -51.758 -15.000 -47.858  1.00 123.21 ? 232 LEU A N   1 
ATOM   1665  C CA  . LEU A 1 223 ? -50.466 -14.437 -48.234  1.00 122.35 ? 232 LEU A CA  1 
ATOM   1666  C C   . LEU A 1 223 ? -50.183 -14.607 -49.723  1.00 125.00 ? 232 LEU A C   1 
ATOM   1667  O O   . LEU A 1 223 ? -49.254 -14.004 -50.257  1.00 124.85 ? 232 LEU A O   1 
ATOM   1668  C CB  . LEU A 1 223 ? -49.340 -15.069 -47.411  1.00 120.79 ? 232 LEU A CB  1 
ATOM   1669  C CG  . LEU A 1 223 ? -49.010 -14.431 -46.059  1.00 118.05 ? 232 LEU A CG  1 
ATOM   1670  C CD1 . LEU A 1 223 ? -50.259 -14.236 -45.217  1.00 117.38 ? 232 LEU A CD1 1 
ATOM   1671  C CD2 . LEU A 1 223 ? -47.987 -15.270 -45.313  1.00 117.41 ? 232 LEU A CD2 1 
ATOM   1672  N N   . LEU A 1 224 ? -50.992 -15.425 -50.389  1.00 161.56 ? 233 LEU A N   1 
ATOM   1673  C CA  . LEU A 1 224 ? -50.818 -15.686 -51.814  1.00 164.70 ? 233 LEU A CA  1 
ATOM   1674  C C   . LEU A 1 224 ? -50.838 -14.405 -52.643  1.00 165.39 ? 233 LEU A C   1 
ATOM   1675  O O   . LEU A 1 224 ? -50.346 -14.379 -53.771  1.00 167.55 ? 233 LEU A O   1 
ATOM   1676  C CB  . LEU A 1 224 ? -51.896 -16.648 -52.320  1.00 167.97 ? 233 LEU A CB  1 
ATOM   1677  C CG  . LEU A 1 224 ? -51.750 -18.117 -51.915  1.00 168.72 ? 233 LEU A CG  1 
ATOM   1678  C CD1 . LEU A 1 224 ? -52.984 -18.910 -52.316  1.00 172.13 ? 233 LEU A CD1 1 
ATOM   1679  C CD2 . LEU A 1 224 ? -50.499 -18.719 -52.533  1.00 169.80 ? 233 LEU A CD2 1 
ATOM   1680  N N   . LYS A 1 225 ? -51.406 -13.344 -52.081  1.00 147.95 ? 234 LYS A N   1 
ATOM   1681  C CA  . LYS A 1 225 ? -51.525 -12.077 -52.793  1.00 148.94 ? 234 LYS A CA  1 
ATOM   1682  C C   . LYS A 1 225 ? -50.230 -11.262 -52.777  1.00 147.18 ? 234 LYS A C   1 
ATOM   1683  O O   . LYS A 1 225 ? -49.767 -10.805 -53.822  1.00 148.98 ? 234 LYS A O   1 
ATOM   1684  C CB  . LYS A 1 225 ? -52.699 -11.259 -52.244  1.00 148.69 ? 234 LYS A CB  1 
ATOM   1685  C CG  . LYS A 1 225 ? -52.887 -11.355 -50.739  1.00 145.61 ? 234 LYS A CG  1 
ATOM   1686  C CD  . LYS A 1 225 ? -54.228 -10.772 -50.318  1.00 146.25 ? 234 LYS A CD  1 
ATOM   1687  C CE  . LYS A 1 225 ? -54.464 -10.940 -48.825  1.00 143.57 ? 234 LYS A CE  1 
ATOM   1688  N NZ  . LYS A 1 225 ? -55.807 -10.444 -48.410  1.00 144.53 ? 234 LYS A NZ  1 
ATOM   1689  N N   . ILE A 1 226 ? -49.649 -11.081 -51.595  1.00 140.97 ? 235 ILE A N   1 
ATOM   1690  C CA  . ILE A 1 226 ? -48.377 -10.371 -51.477  1.00 139.53 ? 235 ILE A CA  1 
ATOM   1691  C C   . ILE A 1 226 ? -47.199 -11.338 -51.449  1.00 139.16 ? 235 ILE A C   1 
ATOM   1692  O O   . ILE A 1 226 ? -46.142 -11.029 -50.902  1.00 137.53 ? 235 ILE A O   1 
ATOM   1693  C CB  . ILE A 1 226 ? -48.327 -9.465  -50.225  1.00 136.86 ? 235 ILE A CB  1 
ATOM   1694  C CG1 . ILE A 1 226 ? -48.939 -10.174 -49.015  1.00 135.24 ? 235 ILE A CG1 1 
ATOM   1695  C CG2 . ILE A 1 226 ? -49.045 -8.156  -50.485  1.00 137.74 ? 235 ILE A CG2 1 
ATOM   1696  C CD1 . ILE A 1 226 ? -48.011 -11.159 -48.347  1.00 133.93 ? 235 ILE A CD1 1 
ATOM   1697  N N   . GLN A 1 227 ? -47.390 -12.510 -52.045  1.00 134.67 ? 236 GLN A N   1 
ATOM   1698  C CA  . GLN A 1 227 ? -46.359 -13.539 -52.058  1.00 134.95 ? 236 GLN A CA  1 
ATOM   1699  C C   . GLN A 1 227 ? -45.431 -13.389 -53.259  1.00 137.00 ? 236 GLN A C   1 
ATOM   1700  O O   . GLN A 1 227 ? -44.225 -13.614 -53.155  1.00 136.67 ? 236 GLN A O   1 
ATOM   1701  C CB  . GLN A 1 227 ? -46.996 -14.931 -52.055  1.00 136.43 ? 236 GLN A CB  1 
ATOM   1702  C CG  . GLN A 1 227 ? -46.000 -16.076 -52.028  1.00 137.21 ? 236 GLN A CG  1 
ATOM   1703  C CD  . GLN A 1 227 ? -46.674 -17.424 -51.865  1.00 138.76 ? 236 GLN A CD  1 
ATOM   1704  O OE1 . GLN A 1 227 ? -47.815 -17.508 -51.411  1.00 138.44 ? 236 GLN A OE1 1 
ATOM   1705  N NE2 . GLN A 1 227 ? -45.970 -18.488 -52.232  1.00 140.78 ? 236 GLN A NE2 1 
ATOM   1706  N N   . PHE A 1 228 ? -46.000 -13.005 -54.397  1.00 164.48 ? 237 PHE A N   1 
ATOM   1707  C CA  . PHE A 1 228 ? -45.229 -12.870 -55.627  1.00 166.94 ? 237 PHE A CA  1 
ATOM   1708  C C   . PHE A 1 228 ? -44.940 -11.408 -55.951  1.00 166.66 ? 237 PHE A C   1 
ATOM   1709  O O   . PHE A 1 228 ? -44.354 -11.098 -56.988  1.00 168.83 ? 237 PHE A O   1 
ATOM   1710  C CB  . PHE A 1 228 ? -45.966 -13.530 -56.795  1.00 170.74 ? 237 PHE A CB  1 
ATOM   1711  C CG  . PHE A 1 228 ? -46.363 -14.955 -56.533  1.00 171.61 ? 237 PHE A CG  1 
ATOM   1712  C CD1 . PHE A 1 228 ? -45.467 -15.988 -56.746  1.00 172.85 ? 237 PHE A CD1 1 
ATOM   1713  C CD2 . PHE A 1 228 ? -47.635 -15.260 -56.076  1.00 171.56 ? 237 PHE A CD2 1 
ATOM   1714  C CE1 . PHE A 1 228 ? -45.830 -17.299 -56.508  1.00 174.07 ? 237 PHE A CE1 1 
ATOM   1715  C CE2 . PHE A 1 228 ? -48.004 -16.570 -55.836  1.00 172.69 ? 237 PHE A CE2 1 
ATOM   1716  C CZ  . PHE A 1 228 ? -47.100 -17.591 -56.052  1.00 173.97 ? 237 PHE A CZ  1 
ATOM   1717  N N   . GLY A 1 229 ? -45.354 -10.514 -55.059  1.00 134.98 ? 238 GLY A N   1 
ATOM   1718  C CA  . GLY A 1 229 ? -45.148 -9.090  -55.251  1.00 134.90 ? 238 GLY A CA  1 
ATOM   1719  C C   . GLY A 1 229 ? -43.682 -8.705  -55.309  1.00 134.45 ? 238 GLY A C   1 
ATOM   1720  O O   . GLY A 1 229 ? -43.274 -7.903  -56.150  1.00 136.18 ? 238 GLY A O   1 
ATOM   1721  N N   . GLY A 1 230 ? -42.888 -9.280  -54.413  1.00 153.93 ? 239 GLY A N   1 
ATOM   1722  C CA  . GLY A 1 230 ? -41.467 -8.991  -54.362  1.00 153.74 ? 239 GLY A CA  1 
ATOM   1723  C C   . GLY A 1 230 ? -41.029 -8.515  -52.992  1.00 151.02 ? 239 GLY A C   1 
ATOM   1724  O O   . GLY A 1 230 ? -39.915 -8.800  -52.552  1.00 150.59 ? 239 GLY A O   1 
ATOM   1725  N N   . ALA A 1 231 ? -41.910 -7.786  -52.316  1.00 123.20 ? 240 ALA A N   1 
ATOM   1726  C CA  . ALA A 1 231 ? -41.616 -7.281  -50.981  1.00 120.96 ? 240 ALA A CA  1 
ATOM   1727  C C   . ALA A 1 231 ? -41.520 -8.426  -49.982  1.00 119.47 ? 240 ALA A C   1 
ATOM   1728  O O   . ALA A 1 231 ? -42.363 -9.322  -49.971  1.00 119.43 ? 240 ALA A O   1 
ATOM   1729  C CB  . ALA A 1 231 ? -42.676 -6.285  -50.544  1.00 120.24 ? 240 ALA A CB  1 
ATOM   1730  N N   . GLU A 1 232 ? -40.488 -8.393  -49.146  1.00 156.78 ? 241 GLU A N   1 
ATOM   1731  C CA  . GLU A 1 232 ? -40.290 -9.427  -48.138  1.00 155.77 ? 241 GLU A CA  1 
ATOM   1732  C C   . GLU A 1 232 ? -41.292 -9.285  -47.000  1.00 153.92 ? 241 GLU A C   1 
ATOM   1733  O O   . GLU A 1 232 ? -41.492 -8.193  -46.468  1.00 153.11 ? 241 GLU A O   1 
ATOM   1734  C CB  . GLU A 1 232 ? -38.864 -9.381  -47.590  1.00 156.00 ? 241 GLU A CB  1 
ATOM   1735  C CG  . GLU A 1 232 ? -37.796 -9.734  -48.612  1.00 158.09 ? 241 GLU A CG  1 
ATOM   1736  C CD  . GLU A 1 232 ? -36.401 -9.748  -48.018  1.00 158.72 ? 241 GLU A CD  1 
ATOM   1737  O OE1 . GLU A 1 232 ? -36.263 -9.451  -46.812  1.00 157.61 ? 241 GLU A OE1 1 
ATOM   1738  O OE2 . GLU A 1 232 ? -35.443 -10.055 -48.759  1.00 160.66 ? 241 GLU A OE2 1 
ATOM   1739  N N   . VAL A 1 233 ? -41.921 -10.396 -46.633  1.00 116.42 ? 242 VAL A N   1 
ATOM   1740  C CA  . VAL A 1 233 ? -42.897 -10.403 -45.552  1.00 114.92 ? 242 VAL A CA  1 
ATOM   1741  C C   . VAL A 1 233 ? -42.503 -11.403 -44.472  1.00 114.43 ? 242 VAL A C   1 
ATOM   1742  O O   . VAL A 1 233 ? -42.263 -12.575 -44.758  1.00 115.43 ? 242 VAL A O   1 
ATOM   1743  C CB  . VAL A 1 233 ? -44.307 -10.746 -46.065  1.00 115.32 ? 242 VAL A CB  1 
ATOM   1744  C CG1 . VAL A 1 233 ? -45.284 -10.847 -44.906  1.00 114.00 ? 242 VAL A CG1 1 
ATOM   1745  C CG2 . VAL A 1 233 ? -44.773 -9.706  -47.070  1.00 116.23 ? 242 VAL A CG2 1 
ATOM   1746  N N   . SER A 1 234 ? -42.436 -10.931 -43.232  1.00 114.20 ? 243 SER A N   1 
ATOM   1747  C CA  . SER A 1 234 ? -42.098 -11.788 -42.104  1.00 114.02 ? 243 SER A CA  1 
ATOM   1748  C C   . SER A 1 234 ? -43.221 -11.770 -41.074  1.00 112.86 ? 243 SER A C   1 
ATOM   1749  O O   . SER A 1 234 ? -44.093 -10.902 -41.111  1.00 112.17 ? 243 SER A O   1 
ATOM   1750  C CB  . SER A 1 234 ? -40.785 -11.335 -41.463  1.00 114.37 ? 243 SER A CB  1 
ATOM   1751  O OG  . SER A 1 234 ? -39.752 -11.253 -42.429  1.00 115.63 ? 243 SER A OG  1 
ATOM   1752  N N   . GLY A 1 235 ? -43.201 -12.732 -40.157  1.00 130.66 ? 244 GLY A N   1 
ATOM   1753  C CA  . GLY A 1 235 ? -44.226 -12.817 -39.134  1.00 129.85 ? 244 GLY A CA  1 
ATOM   1754  C C   . GLY A 1 235 ? -43.931 -13.865 -38.080  1.00 130.41 ? 244 GLY A C   1 
ATOM   1755  O O   . GLY A 1 235 ? -42.796 -14.320 -37.942  1.00 131.45 ? 244 GLY A O   1 
ATOM   1756  N N   . PHE A 1 236 ? -44.961 -14.250 -37.333  1.00 119.22 ? 245 PHE A N   1 
ATOM   1757  C CA  . PHE A 1 236 ? -44.802 -15.214 -36.252  1.00 120.00 ? 245 PHE A CA  1 
ATOM   1758  C C   . PHE A 1 236 ? -45.868 -16.301 -36.318  1.00 120.53 ? 245 PHE A C   1 
ATOM   1759  O O   . PHE A 1 236 ? -47.033 -16.026 -36.608  1.00 119.92 ? 245 PHE A O   1 
ATOM   1760  C CB  . PHE A 1 236 ? -44.864 -14.506 -34.899  1.00 119.50 ? 245 PHE A CB  1 
ATOM   1761  C CG  . PHE A 1 236 ? -43.929 -13.337 -34.784  1.00 119.31 ? 245 PHE A CG  1 
ATOM   1762  C CD1 . PHE A 1 236 ? -42.658 -13.500 -34.261  1.00 120.56 ? 245 PHE A CD1 1 
ATOM   1763  C CD2 . PHE A 1 236 ? -44.321 -12.077 -35.201  1.00 118.31 ? 245 PHE A CD2 1 
ATOM   1764  C CE1 . PHE A 1 236 ? -41.796 -12.427 -34.155  1.00 120.78 ? 245 PHE A CE1 1 
ATOM   1765  C CE2 . PHE A 1 236 ? -43.463 -11.000 -35.098  1.00 118.49 ? 245 PHE A CE2 1 
ATOM   1766  C CZ  . PHE A 1 236 ? -42.199 -11.175 -34.573  1.00 119.71 ? 245 PHE A CZ  1 
ATOM   1767  N N   . GLN A 1 237 ? -45.462 -17.537 -36.046  1.00 130.29 ? 246 GLN A N   1 
ATOM   1768  C CA  . GLN A 1 237 ? -46.385 -18.665 -36.050  1.00 131.32 ? 246 GLN A CA  1 
ATOM   1769  C C   . GLN A 1 237 ? -46.284 -19.441 -34.742  1.00 132.42 ? 246 GLN A C   1 
ATOM   1770  O O   . GLN A 1 237 ? -45.199 -19.861 -34.343  1.00 133.68 ? 246 GLN A O   1 
ATOM   1771  C CB  . GLN A 1 237 ? -46.097 -19.588 -37.235  1.00 132.91 ? 246 GLN A CB  1 
ATOM   1772  C CG  . GLN A 1 237 ? -47.132 -20.680 -37.437  1.00 134.33 ? 246 GLN A CG  1 
ATOM   1773  C CD  . GLN A 1 237 ? -48.503 -20.126 -37.767  1.00 133.37 ? 246 GLN A CD  1 
ATOM   1774  O OE1 . GLN A 1 237 ? -48.629 -19.011 -38.274  1.00 131.97 ? 246 GLN A OE1 1 
ATOM   1775  N NE2 . GLN A 1 237 ? -49.541 -20.904 -37.481  1.00 134.48 ? 246 GLN A NE2 1 
ATOM   1776  N N   . ILE A 1 238 ? -47.419 -19.625 -34.076  1.00 116.32 ? 247 ILE A N   1 
ATOM   1777  C CA  . ILE A 1 238 ? -47.450 -20.334 -32.802  1.00 117.59 ? 247 ILE A CA  1 
ATOM   1778  C C   . ILE A 1 238 ? -47.900 -21.779 -32.990  1.00 119.71 ? 247 ILE A C   1 
ATOM   1779  O O   . ILE A 1 238 ? -47.552 -22.657 -32.200  1.00 121.61 ? 247 ILE A O   1 
ATOM   1780  C CB  . ILE A 1 238 ? -48.374 -19.632 -31.786  1.00 116.52 ? 247 ILE A CB  1 
ATOM   1781  C CG1 . ILE A 1 238 ? -48.170 -20.212 -30.385  1.00 118.04 ? 247 ILE A CG1 1 
ATOM   1782  C CG2 . ILE A 1 238 ? -49.827 -19.744 -32.217  1.00 116.23 ? 247 ILE A CG2 1 
ATOM   1783  C CD1 . ILE A 1 238 ? -46.757 -20.063 -29.867  1.00 118.88 ? 247 ILE A CD1 1 
ATOM   1784  N N   . VAL A 1 239 ? -48.673 -22.020 -34.044  1.00 121.77 ? 248 VAL A N   1 
ATOM   1785  C CA  . VAL A 1 239 ? -49.144 -23.363 -34.356  1.00 124.15 ? 248 VAL A CA  1 
ATOM   1786  C C   . VAL A 1 239 ? -48.236 -24.023 -35.387  1.00 125.75 ? 248 VAL A C   1 
ATOM   1787  O O   . VAL A 1 239 ? -48.407 -23.832 -36.591  1.00 125.59 ? 248 VAL A O   1 
ATOM   1788  C CB  . VAL A 1 239 ? -50.582 -23.345 -34.901  1.00 124.09 ? 248 VAL A CB  1 
ATOM   1789  C CG1 . VAL A 1 239 ? -51.097 -24.764 -35.080  1.00 127.03 ? 248 VAL A CG1 1 
ATOM   1790  C CG2 . VAL A 1 239 ? -51.490 -22.558 -33.973  1.00 122.59 ? 248 VAL A CG2 1 
ATOM   1791  N N   . ASP A 1 240 ? -47.269 -24.799 -34.909  1.00 125.66 ? 249 ASP A N   1 
ATOM   1792  C CA  . ASP A 1 240 ? -46.330 -25.474 -35.797  1.00 127.66 ? 249 ASP A CA  1 
ATOM   1793  C C   . ASP A 1 240 ? -46.985 -26.679 -36.459  1.00 130.34 ? 249 ASP A C   1 
ATOM   1794  O O   . ASP A 1 240 ? -47.240 -27.693 -35.810  1.00 132.64 ? 249 ASP A O   1 
ATOM   1795  C CB  . ASP A 1 240 ? -45.079 -25.907 -35.030  1.00 129.36 ? 249 ASP A CB  1 
ATOM   1796  C CG  . ASP A 1 240 ? -43.954 -26.340 -35.951  1.00 131.25 ? 249 ASP A CG  1 
ATOM   1797  O OD1 . ASP A 1 240 ? -42.869 -26.690 -35.440  1.00 133.08 ? 249 ASP A OD1 1 
ATOM   1798  O OD2 . ASP A 1 240 ? -44.153 -26.327 -37.184  1.00 131.22 ? 249 ASP A OD2 1 
ATOM   1799  N N   . TYR A 1 241 ? -47.256 -26.563 -37.755  1.00 145.48 ? 250 TYR A N   1 
ATOM   1800  C CA  . TYR A 1 241 ? -47.904 -27.635 -38.497  1.00 148.37 ? 250 TYR A CA  1 
ATOM   1801  C C   . TYR A 1 241 ? -46.921 -28.752 -38.838  1.00 151.80 ? 250 TYR A C   1 
ATOM   1802  O O   . TYR A 1 241 ? -47.268 -29.708 -39.529  1.00 154.83 ? 250 TYR A O   1 
ATOM   1803  C CB  . TYR A 1 241 ? -48.562 -27.088 -39.766  1.00 147.71 ? 250 TYR A CB  1 
ATOM   1804  C CG  . TYR A 1 241 ? -49.685 -26.112 -39.494  1.00 145.15 ? 250 TYR A CG  1 
ATOM   1805  C CD1 . TYR A 1 241 ? -50.984 -26.559 -39.284  1.00 146.28 ? 250 TYR A CD1 1 
ATOM   1806  C CD2 . TYR A 1 241 ? -49.447 -24.746 -39.443  1.00 141.99 ? 250 TYR A CD2 1 
ATOM   1807  C CE1 . TYR A 1 241 ? -52.014 -25.671 -39.032  1.00 144.34 ? 250 TYR A CE1 1 
ATOM   1808  C CE2 . TYR A 1 241 ? -50.470 -23.850 -39.192  1.00 140.08 ? 250 TYR A CE2 1 
ATOM   1809  C CZ  . TYR A 1 241 ? -51.752 -24.318 -38.988  1.00 141.27 ? 250 TYR A CZ  1 
ATOM   1810  O OH  . TYR A 1 241 ? -52.773 -23.429 -38.738  1.00 139.74 ? 250 TYR A OH  1 
ATOM   1811  N N   . ASP A 1 242 ? -45.695 -28.629 -38.341  1.00 157.80 ? 251 ASP A N   1 
ATOM   1812  C CA  . ASP A 1 242 ? -44.676 -29.648 -38.563  1.00 161.37 ? 251 ASP A CA  1 
ATOM   1813  C C   . ASP A 1 242 ? -44.617 -30.646 -37.409  1.00 163.95 ? 251 ASP A C   1 
ATOM   1814  O O   . ASP A 1 242 ? -43.982 -31.696 -37.516  1.00 167.74 ? 251 ASP A O   1 
ATOM   1815  C CB  . ASP A 1 242 ? -43.305 -29.008 -38.789  1.00 160.60 ? 251 ASP A CB  1 
ATOM   1816  C CG  . ASP A 1 242 ? -43.156 -28.427 -40.182  1.00 159.75 ? 251 ASP A CG  1 
ATOM   1817  O OD1 . ASP A 1 242 ? -44.045 -28.667 -41.027  1.00 160.35 ? 251 ASP A OD1 1 
ATOM   1818  O OD2 . ASP A 1 242 ? -42.149 -27.733 -40.433  1.00 158.79 ? 251 ASP A OD2 1 
ATOM   1819  N N   . ASP A 1 243 ? -45.276 -30.314 -36.305  1.00 189.16 ? 252 ASP A N   1 
ATOM   1820  C CA  . ASP A 1 243 ? -45.367 -31.230 -35.176  1.00 191.73 ? 252 ASP A CA  1 
ATOM   1821  C C   . ASP A 1 243 ? -46.328 -32.366 -35.498  1.00 194.72 ? 252 ASP A C   1 
ATOM   1822  O O   . ASP A 1 243 ? -47.435 -32.133 -35.981  1.00 193.51 ? 252 ASP A O   1 
ATOM   1823  C CB  . ASP A 1 243 ? -45.834 -30.495 -33.918  1.00 189.19 ? 252 ASP A CB  1 
ATOM   1824  C CG  . ASP A 1 243 ? -44.711 -29.746 -33.229  1.00 188.00 ? 252 ASP A CG  1 
ATOM   1825  O OD1 . ASP A 1 243 ? -43.537 -29.977 -33.585  1.00 189.69 ? 252 ASP A OD1 1 
ATOM   1826  O OD2 . ASP A 1 243 ? -45.003 -28.932 -32.327  1.00 185.71 ? 252 ASP A OD2 1 
ATOM   1827  N N   . SER A 1 244 ? -45.898 -33.595 -35.233  1.00 155.52 ? 253 SER A N   1 
ATOM   1828  C CA  . SER A 1 244 ? -46.744 -34.760 -35.455  1.00 159.08 ? 253 SER A CA  1 
ATOM   1829  C C   . SER A 1 244 ? -48.032 -34.647 -34.645  1.00 157.89 ? 253 SER A C   1 
ATOM   1830  O O   . SER A 1 244 ? -49.063 -35.211 -35.013  1.00 159.58 ? 253 SER A O   1 
ATOM   1831  C CB  . SER A 1 244 ? -45.996 -36.043 -35.090  1.00 164.20 ? 253 SER A CB  1 
ATOM   1832  O OG  . SER A 1 244 ? -45.503 -35.985 -33.764  1.00 164.32 ? 253 SER A OG  1 
ATOM   1833  N N   . LEU A 1 245 ? -47.963 -33.910 -33.540  1.00 149.98 ? 254 LEU A N   1 
ATOM   1834  C CA  . LEU A 1 245 ? -49.126 -33.682 -32.694  1.00 148.73 ? 254 LEU A CA  1 
ATOM   1835  C C   . LEU A 1 245 ? -50.152 -32.830 -33.431  1.00 145.63 ? 254 LEU A C   1 
ATOM   1836  O O   . LEU A 1 245 ? -51.328 -33.185 -33.512  1.00 146.65 ? 254 LEU A O   1 
ATOM   1837  C CB  . LEU A 1 245 ? -48.708 -33.001 -31.388  1.00 146.86 ? 254 LEU A CB  1 
ATOM   1838  C CG  . LEU A 1 245 ? -49.702 -32.997 -30.222  1.00 146.76 ? 254 LEU A CG  1 
ATOM   1839  C CD1 . LEU A 1 245 ? -48.998 -32.633 -28.924  1.00 146.51 ? 254 LEU A CD1 1 
ATOM   1840  C CD2 . LEU A 1 245 ? -50.867 -32.054 -30.483  1.00 143.33 ? 254 LEU A CD2 1 
ATOM   1841  N N   . VAL A 1 246 ? -49.698 -31.703 -33.969  1.00 142.29 ? 255 VAL A N   1 
ATOM   1842  C CA  . VAL A 1 246 ? -50.571 -30.805 -34.714  1.00 139.58 ? 255 VAL A CA  1 
ATOM   1843  C C   . VAL A 1 246 ? -50.988 -31.433 -36.038  1.00 141.89 ? 255 VAL A C   1 
ATOM   1844  O O   . VAL A 1 246 ? -52.137 -31.310 -36.461  1.00 141.86 ? 255 VAL A O   1 
ATOM   1845  C CB  . VAL A 1 246 ? -49.887 -29.452 -34.987  1.00 135.83 ? 255 VAL A CB  1 
ATOM   1846  C CG1 . VAL A 1 246 ? -50.808 -28.542 -35.786  1.00 133.55 ? 255 VAL A CG1 1 
ATOM   1847  C CG2 . VAL A 1 246 ? -49.478 -28.791 -33.680  1.00 133.94 ? 255 VAL A CG2 1 
ATOM   1848  N N   . SER A 1 247 ? -50.046 -32.110 -36.687  1.00 143.54 ? 256 SER A N   1 
ATOM   1849  C CA  . SER A 1 247 ? -50.308 -32.763 -37.963  1.00 146.34 ? 256 SER A CA  1 
ATOM   1850  C C   . SER A 1 247 ? -51.441 -33.775 -37.839  1.00 149.72 ? 256 SER A C   1 
ATOM   1851  O O   . SER A 1 247 ? -52.259 -33.919 -38.748  1.00 151.08 ? 256 SER A O   1 
ATOM   1852  C CB  . SER A 1 247 ? -49.042 -33.451 -38.479  1.00 149.02 ? 256 SER A CB  1 
ATOM   1853  O OG  . SER A 1 247 ? -49.273 -34.077 -39.728  1.00 152.08 ? 256 SER A OG  1 
ATOM   1854  N N   . LYS A 1 248 ? -51.484 -34.473 -36.709  1.00 154.11 ? 257 LYS A N   1 
ATOM   1855  C CA  . LYS A 1 248 ? -52.530 -35.458 -36.457  1.00 157.60 ? 257 LYS A CA  1 
ATOM   1856  C C   . LYS A 1 248 ? -53.869 -34.775 -36.203  1.00 155.43 ? 257 LYS A C   1 
ATOM   1857  O O   . LYS A 1 248 ? -54.920 -35.280 -36.597  1.00 157.93 ? 257 LYS A O   1 
ATOM   1858  C CB  . LYS A 1 248 ? -52.157 -36.347 -35.269  1.00 160.19 ? 257 LYS A CB  1 
ATOM   1859  N N   . PHE A 1 249 ? -53.824 -33.623 -35.541  1.00 148.92 ? 258 PHE A N   1 
ATOM   1860  C CA  . PHE A 1 249 ? -55.030 -32.857 -35.259  1.00 146.81 ? 258 PHE A CA  1 
ATOM   1861  C C   . PHE A 1 249 ? -55.702 -32.405 -36.551  1.00 146.57 ? 258 PHE A C   1 
ATOM   1862  O O   . PHE A 1 249 ? -56.917 -32.524 -36.705  1.00 147.96 ? 258 PHE A O   1 
ATOM   1863  C CB  . PHE A 1 249 ? -54.701 -31.644 -34.386  1.00 142.51 ? 258 PHE A CB  1 
ATOM   1864  C CG  . PHE A 1 249 ? -55.873 -30.738 -34.138  1.00 140.36 ? 258 PHE A CG  1 
ATOM   1865  C CD1 . PHE A 1 249 ? -56.738 -30.973 -33.082  1.00 141.22 ? 258 PHE A CD1 1 
ATOM   1866  C CD2 . PHE A 1 249 ? -56.111 -29.650 -34.961  1.00 137.83 ? 258 PHE A CD2 1 
ATOM   1867  C CE1 . PHE A 1 249 ? -57.818 -30.141 -32.852  1.00 139.59 ? 258 PHE A CE1 1 
ATOM   1868  C CE2 . PHE A 1 249 ? -57.189 -28.814 -34.736  1.00 136.31 ? 258 PHE A CE2 1 
ATOM   1869  C CZ  . PHE A 1 249 ? -58.043 -29.061 -33.681  1.00 137.19 ? 258 PHE A CZ  1 
ATOM   1870  N N   . ILE A 1 250 ? -54.901 -31.886 -37.475  1.00 146.51 ? 259 ILE A N   1 
ATOM   1871  C CA  . ILE A 1 250 ? -55.409 -31.415 -38.758  1.00 146.53 ? 259 ILE A CA  1 
ATOM   1872  C C   . ILE A 1 250 ? -56.014 -32.556 -39.571  1.00 151.36 ? 259 ILE A C   1 
ATOM   1873  O O   . ILE A 1 250 ? -57.012 -32.372 -40.267  1.00 152.50 ? 259 ILE A O   1 
ATOM   1874  C CB  . ILE A 1 250 ? -54.307 -30.715 -39.581  1.00 144.49 ? 259 ILE A CB  1 
ATOM   1875  C CG1 . ILE A 1 250 ? -54.198 -29.242 -39.182  1.00 139.85 ? 259 ILE A CG1 1 
ATOM   1876  C CG2 . ILE A 1 250 ? -54.601 -30.818 -41.069  1.00 146.63 ? 259 ILE A CG2 1 
ATOM   1877  C CD1 . ILE A 1 250 ? -53.870 -29.017 -37.725  1.00 137.84 ? 259 ILE A CD1 1 
ATOM   1878  N N   . GLU A 1 251 ? -55.409 -33.735 -39.472  1.00 168.51 ? 260 GLU A N   1 
ATOM   1879  C CA  . GLU A 1 251 ? -55.899 -34.908 -40.188  1.00 173.71 ? 260 GLU A CA  1 
ATOM   1880  C C   . GLU A 1 251 ? -57.372 -35.167 -39.889  1.00 175.60 ? 260 GLU A C   1 
ATOM   1881  O O   . GLU A 1 251 ? -58.123 -35.609 -40.759  1.00 179.08 ? 260 GLU A O   1 
ATOM   1882  C CB  . GLU A 1 251 ? -55.067 -36.142 -39.831  1.00 177.12 ? 260 GLU A CB  1 
ATOM   1883  N N   . ARG A 1 252 ? -57.780 -34.887 -38.655  1.00 159.14 ? 261 ARG A N   1 
ATOM   1884  C CA  . ARG A 1 252 ? -59.162 -35.096 -38.238  1.00 160.89 ? 261 ARG A CA  1 
ATOM   1885  C C   . ARG A 1 252 ? -59.975 -33.811 -38.352  1.00 157.66 ? 261 ARG A C   1 
ATOM   1886  O O   . ARG A 1 252 ? -61.182 -33.848 -38.588  1.00 159.70 ? 261 ARG A O   1 
ATOM   1887  C CB  . ARG A 1 252 ? -59.214 -35.625 -36.804  1.00 161.36 ? 261 ARG A CB  1 
ATOM   1888  N N   . TRP A 1 253 ? -59.304 -32.677 -38.183  1.00 153.55 ? 262 TRP A N   1 
ATOM   1889  C CA  . TRP A 1 253 ? -59.959 -31.377 -38.255  1.00 150.49 ? 262 TRP A CA  1 
ATOM   1890  C C   . TRP A 1 253 ? -60.404 -31.059 -39.679  1.00 151.86 ? 262 TRP A C   1 
ATOM   1891  O O   . TRP A 1 253 ? -61.541 -30.650 -39.906  1.00 152.70 ? 262 TRP A O   1 
ATOM   1892  C CB  . TRP A 1 253 ? -59.021 -30.283 -37.735  1.00 145.65 ? 262 TRP A CB  1 
ATOM   1893  C CG  . TRP A 1 253 ? -59.564 -28.890 -37.868  1.00 142.68 ? 262 TRP A CG  1 
ATOM   1894  C CD1 . TRP A 1 253 ? -59.390 -28.041 -38.923  1.00 141.41 ? 262 TRP A CD1 1 
ATOM   1895  C CD2 . TRP A 1 253 ? -60.360 -28.180 -36.910  1.00 141.00 ? 262 TRP A CD2 1 
ATOM   1896  N NE1 . TRP A 1 253 ? -60.031 -26.849 -38.682  1.00 139.14 ? 262 TRP A NE1 1 
ATOM   1897  C CE2 . TRP A 1 253 ? -60.634 -26.910 -37.453  1.00 138.84 ? 262 TRP A CE2 1 
ATOM   1898  C CE3 . TRP A 1 253 ? -60.868 -28.498 -35.647  1.00 141.41 ? 262 TRP A CE3 1 
ATOM   1899  C CZ2 . TRP A 1 253 ? -61.392 -25.956 -36.778  1.00 137.18 ? 262 TRP A CZ2 1 
ATOM   1900  C CZ3 . TRP A 1 253 ? -61.622 -27.550 -34.978  1.00 139.64 ? 262 TRP A CZ3 1 
ATOM   1901  C CH2 . TRP A 1 253 ? -61.877 -26.295 -35.545  1.00 137.59 ? 262 TRP A CH2 1 
ATOM   1902  N N   . SER A 1 254 ? -59.504 -31.262 -40.636  1.00 161.24 ? 263 SER A N   1 
ATOM   1903  C CA  . SER A 1 254 ? -59.775 -30.936 -42.032  1.00 162.70 ? 263 SER A CA  1 
ATOM   1904  C C   . SER A 1 254 ? -60.907 -31.774 -42.623  1.00 167.88 ? 263 SER A C   1 
ATOM   1905  O O   . SER A 1 254 ? -61.469 -31.424 -43.660  1.00 169.59 ? 263 SER A O   1 
ATOM   1906  C CB  . SER A 1 254 ? -58.509 -31.110 -42.874  1.00 162.78 ? 263 SER A CB  1 
ATOM   1907  O OG  . SER A 1 254 ? -58.076 -32.460 -42.869  1.00 166.36 ? 263 SER A OG  1 
ATOM   1908  N N   . THR A 1 255 ? -61.237 -32.878 -41.961  1.00 174.33 ? 264 THR A N   1 
ATOM   1909  C CA  . THR A 1 255 ? -62.258 -33.790 -42.467  1.00 179.85 ? 264 THR A CA  1 
ATOM   1910  C C   . THR A 1 255 ? -63.627 -33.540 -41.841  1.00 180.46 ? 264 THR A C   1 
ATOM   1911  O O   . THR A 1 255 ? -64.654 -33.892 -42.421  1.00 184.68 ? 264 THR A O   1 
ATOM   1912  C CB  . THR A 1 255 ? -61.864 -35.261 -42.239  1.00 183.78 ? 264 THR A CB  1 
ATOM   1913  O OG1 . THR A 1 255 ? -61.737 -35.513 -40.834  1.00 182.18 ? 264 THR A OG1 1 
ATOM   1914  C CG2 . THR A 1 255 ? -60.544 -35.572 -42.927  1.00 183.96 ? 264 THR A CG2 1 
ATOM   1915  N N   . LEU A 1 256 ? -63.635 -32.933 -40.658  1.00 163.86 ? 265 LEU A N   1 
ATOM   1916  C CA  . LEU A 1 256 ? -64.879 -32.659 -39.944  1.00 164.30 ? 265 LEU A CA  1 
ATOM   1917  C C   . LEU A 1 256 ? -65.900 -31.952 -40.830  1.00 165.71 ? 265 LEU A C   1 
ATOM   1918  O O   . LEU A 1 256 ? -65.540 -31.149 -41.691  1.00 164.06 ? 265 LEU A O   1 
ATOM   1919  C CB  . LEU A 1 256 ? -64.608 -31.826 -38.689  1.00 159.44 ? 265 LEU A CB  1 
ATOM   1920  C CG  . LEU A 1 256 ? -63.821 -32.511 -37.571  1.00 158.63 ? 265 LEU A CG  1 
ATOM   1921  C CD1 . LEU A 1 256 ? -63.563 -31.545 -36.426  1.00 154.04 ? 265 LEU A CD1 1 
ATOM   1922  C CD2 . LEU A 1 256 ? -64.555 -33.748 -37.078  1.00 163.22 ? 265 LEU A CD2 1 
ATOM   1923  N N   . GLU A 1 257 ? -67.176 -32.258 -40.613  1.00 184.95 ? 266 GLU A N   1 
ATOM   1924  C CA  . GLU A 1 257 ? -68.255 -31.651 -41.382  1.00 187.14 ? 266 GLU A CA  1 
ATOM   1925  C C   . GLU A 1 257 ? -68.371 -30.164 -41.068  1.00 182.69 ? 266 GLU A C   1 
ATOM   1926  O O   . GLU A 1 257 ? -68.518 -29.775 -39.909  1.00 180.02 ? 266 GLU A O   1 
ATOM   1927  C CB  . GLU A 1 257 ? -69.579 -32.360 -41.090  1.00 192.10 ? 266 GLU A CB  1 
ATOM   1928  C CG  . GLU A 1 257 ? -70.747 -31.873 -41.930  1.00 195.54 ? 266 GLU A CG  1 
ATOM   1929  C CD  . GLU A 1 257 ? -72.035 -32.612 -41.619  1.00 200.85 ? 266 GLU A CD  1 
ATOM   1930  O OE1 . GLU A 1 257 ? -73.014 -32.447 -42.377  1.00 204.99 ? 266 GLU A OE1 1 
ATOM   1931  O OE2 . GLU A 1 257 ? -72.067 -33.359 -40.618  1.00 201.21 ? 266 GLU A OE2 1 
ATOM   1932  N N   . GLU A 1 258 ? -68.304 -29.335 -42.105  1.00 185.58 ? 267 GLU A N   1 
ATOM   1933  C CA  . GLU A 1 258 ? -68.360 -27.888 -41.932  1.00 181.79 ? 267 GLU A CA  1 
ATOM   1934  C C   . GLU A 1 258 ? -69.754 -27.423 -41.518  1.00 183.66 ? 267 GLU A C   1 
ATOM   1935  O O   . GLU A 1 258 ? -69.932 -26.294 -41.059  1.00 180.80 ? 267 GLU A O   1 
ATOM   1936  C CB  . GLU A 1 258 ? -67.922 -27.176 -43.214  1.00 181.49 ? 267 GLU A CB  1 
ATOM   1937  C CG  . GLU A 1 258 ? -67.697 -25.681 -43.048  1.00 177.28 ? 267 GLU A CG  1 
ATOM   1938  C CD  . GLU A 1 258 ? -67.141 -25.031 -44.300  1.00 177.04 ? 267 GLU A CD  1 
ATOM   1939  O OE1 . GLU A 1 258 ? -66.796 -23.832 -44.245  1.00 173.71 ? 267 GLU A OE1 1 
ATOM   1940  O OE2 . GLU A 1 258 ? -67.047 -25.721 -45.338  1.00 180.48 ? 267 GLU A OE2 1 
ATOM   1941  N N   . LYS A 1 259 ? -70.739 -28.299 -41.680  1.00 173.72 ? 268 LYS A N   1 
ATOM   1942  C CA  . LYS A 1 259 ? -72.110 -27.985 -41.298  1.00 176.30 ? 268 LYS A CA  1 
ATOM   1943  C C   . LYS A 1 259 ? -72.252 -27.925 -39.781  1.00 173.73 ? 268 LYS A C   1 
ATOM   1944  O O   . LYS A 1 259 ? -72.730 -26.933 -39.232  1.00 171.98 ? 268 LYS A O   1 
ATOM   1945  C CB  . LYS A 1 259 ? -73.080 -29.015 -41.879  1.00 182.99 ? 268 LYS A CB  1 
ATOM   1946  N N   . GLU A 1 260 ? -71.833 -28.994 -39.110  1.00 171.04 ? 269 GLU A N   1 
ATOM   1947  C CA  . GLU A 1 260 ? -71.906 -29.062 -37.654  1.00 169.08 ? 269 GLU A CA  1 
ATOM   1948  C C   . GLU A 1 260 ? -70.780 -28.262 -37.010  1.00 163.09 ? 269 GLU A C   1 
ATOM   1949  O O   . GLU A 1 260 ? -70.965 -27.643 -35.961  1.00 160.78 ? 269 GLU A O   1 
ATOM   1950  C CB  . GLU A 1 260 ? -71.856 -30.516 -37.181  1.00 171.94 ? 269 GLU A CB  1 
ATOM   1951  N N   . TYR A 1 261 ? -69.612 -28.279 -37.644  1.00 171.82 ? 270 TYR A N   1 
ATOM   1952  C CA  . TYR A 1 261 ? -68.459 -27.535 -37.153  1.00 166.55 ? 270 TYR A CA  1 
ATOM   1953  C C   . TYR A 1 261 ? -68.095 -26.411 -38.116  1.00 164.47 ? 270 TYR A C   1 
ATOM   1954  O O   . TYR A 1 261 ? -67.299 -26.606 -39.034  1.00 164.31 ? 270 TYR A O   1 
ATOM   1955  C CB  . TYR A 1 261 ? -67.262 -28.468 -36.958  1.00 165.73 ? 270 TYR A CB  1 
ATOM   1956  C CG  . TYR A 1 261 ? -67.495 -29.566 -35.945  1.00 167.81 ? 270 TYR A CG  1 
ATOM   1957  C CD1 . TYR A 1 261 ? -67.159 -29.388 -34.610  1.00 165.26 ? 270 TYR A CD1 1 
ATOM   1958  C CD2 . TYR A 1 261 ? -68.048 -30.781 -36.324  1.00 172.71 ? 270 TYR A CD2 1 
ATOM   1959  C CE1 . TYR A 1 261 ? -67.370 -30.389 -33.680  1.00 167.48 ? 270 TYR A CE1 1 
ATOM   1960  C CE2 . TYR A 1 261 ? -68.262 -31.788 -35.402  1.00 174.95 ? 270 TYR A CE2 1 
ATOM   1961  C CZ  . TYR A 1 261 ? -67.922 -31.587 -34.082  1.00 172.28 ? 270 TYR A CZ  1 
ATOM   1962  O OH  . TYR A 1 261 ? -68.134 -32.588 -33.159  1.00 174.82 ? 270 TYR A OH  1 
ATOM   1963  N N   . PRO A 1 262 ? -68.685 -25.225 -37.907  1.00 150.63 ? 271 PRO A N   1 
ATOM   1964  C CA  . PRO A 1 262 ? -68.473 -24.048 -38.757  1.00 149.07 ? 271 PRO A CA  1 
ATOM   1965  C C   . PRO A 1 262 ? -66.996 -23.696 -38.908  1.00 145.06 ? 271 PRO A C   1 
ATOM   1966  O O   . PRO A 1 262 ? -66.258 -23.695 -37.922  1.00 142.07 ? 271 PRO A O   1 
ATOM   1967  C CB  . PRO A 1 262 ? -69.207 -22.935 -37.990  1.00 147.94 ? 271 PRO A CB  1 
ATOM   1968  C CG  . PRO A 1 262 ? -69.374 -23.482 -36.589  1.00 147.46 ? 271 PRO A CG  1 
ATOM   1969  C CD  . PRO A 1 262 ? -69.631 -24.928 -36.822  1.00 151.02 ? 271 PRO A CD  1 
ATOM   1970  N N   . GLY A 1 263 ? -66.578 -23.402 -40.136  1.00 165.87 ? 272 GLY A N   1 
ATOM   1971  C CA  . GLY A 1 263 ? -65.205 -23.020 -40.415  1.00 162.51 ? 272 GLY A CA  1 
ATOM   1972  C C   . GLY A 1 263 ? -64.187 -23.984 -39.836  1.00 161.27 ? 272 GLY A C   1 
ATOM   1973  O O   . GLY A 1 263 ? -63.211 -23.569 -39.211  1.00 157.77 ? 272 GLY A O   1 
ATOM   1974  N N   . ALA A 1 264 ? -64.413 -25.276 -40.048  1.00 198.82 ? 273 ALA A N   1 
ATOM   1975  C CA  . ALA A 1 264 ? -63.531 -26.300 -39.504  1.00 198.51 ? 273 ALA A CA  1 
ATOM   1976  C C   . ALA A 1 264 ? -63.081 -27.291 -40.572  1.00 201.43 ? 273 ALA A C   1 
ATOM   1977  O O   . ALA A 1 264 ? -62.413 -28.276 -40.269  1.00 202.18 ? 273 ALA A O   1 
ATOM   1978  C CB  . ALA A 1 264 ? -64.213 -27.032 -38.356  1.00 199.95 ? 273 ALA A CB  1 
ATOM   1979  N N   . HIS A 1 265 ? -63.448 -27.025 -41.822  1.00 147.80 ? 274 HIS A N   1 
ATOM   1980  C CA  . HIS A 1 265 ? -63.091 -27.917 -42.920  1.00 151.12 ? 274 HIS A CA  1 
ATOM   1981  C C   . HIS A 1 265 ? -61.896 -27.381 -43.703  1.00 148.94 ? 274 HIS A C   1 
ATOM   1982  O O   . HIS A 1 265 ? -61.939 -27.280 -44.930  1.00 151.10 ? 274 HIS A O   1 
ATOM   1983  C CB  . HIS A 1 265 ? -64.287 -28.124 -43.853  1.00 155.83 ? 274 HIS A CB  1 
ATOM   1984  C CG  . HIS A 1 265 ? -64.165 -29.329 -44.732  1.00 160.44 ? 274 HIS A CG  1 
ATOM   1985  N ND1 . HIS A 1 265 ? -64.672 -30.562 -44.377  1.00 164.21 ? 274 HIS A ND1 1 
ATOM   1986  C CD2 . HIS A 1 265 ? -63.598 -29.493 -45.950  1.00 162.26 ? 274 HIS A CD2 1 
ATOM   1987  C CE1 . HIS A 1 265 ? -64.420 -31.432 -45.339  1.00 168.21 ? 274 HIS A CE1 1 
ATOM   1988  N NE2 . HIS A 1 265 ? -63.769 -30.809 -46.305  1.00 167.11 ? 274 HIS A NE2 1 
ATOM   1989  N N   . THR A 1 266 ? -60.831 -27.036 -42.986  1.00 179.81 ? 275 THR A N   1 
ATOM   1990  C CA  . THR A 1 266 ? -59.620 -26.512 -43.609  1.00 177.67 ? 275 THR A CA  1 
ATOM   1991  C C   . THR A 1 266 ? -58.377 -27.223 -43.086  1.00 176.68 ? 275 THR A C   1 
ATOM   1992  O O   . THR A 1 266 ? -58.435 -27.940 -42.087  1.00 177.02 ? 275 THR A O   1 
ATOM   1993  C CB  . THR A 1 266 ? -59.469 -24.996 -43.372  1.00 173.67 ? 275 THR A CB  1 
ATOM   1994  O OG1 . THR A 1 266 ? -59.458 -24.728 -41.964  1.00 170.90 ? 275 THR A OG1 1 
ATOM   1995  C CG2 . THR A 1 266 ? -60.616 -24.235 -44.020  1.00 175.09 ? 275 THR A CG2 1 
ATOM   1996  N N   . ALA A 1 267 ? -57.253 -27.018 -43.766  1.00 152.80 ? 276 ALA A N   1 
ATOM   1997  C CA  . ALA A 1 267 ? -55.996 -27.645 -43.377  1.00 152.29 ? 276 ALA A CA  1 
ATOM   1998  C C   . ALA A 1 267 ? -55.253 -26.807 -42.343  1.00 147.99 ? 276 ALA A C   1 
ATOM   1999  O O   . ALA A 1 267 ? -54.250 -27.245 -41.781  1.00 147.48 ? 276 ALA A O   1 
ATOM   2000  C CB  . ALA A 1 267 ? -55.120 -27.881 -44.598  1.00 153.91 ? 276 ALA A CB  1 
ATOM   2001  N N   . THR A 1 268 ? -55.750 -25.599 -42.097  1.00 164.00 ? 277 THR A N   1 
ATOM   2002  C CA  . THR A 1 268 ? -55.132 -24.702 -41.128  1.00 160.25 ? 277 THR A CA  1 
ATOM   2003  C C   . THR A 1 268 ? -56.121 -24.305 -40.038  1.00 159.14 ? 277 THR A C   1 
ATOM   2004  O O   . THR A 1 268 ? -57.299 -24.654 -40.100  1.00 161.16 ? 277 THR A O   1 
ATOM   2005  C CB  . THR A 1 268 ? -54.589 -23.430 -41.803  1.00 158.00 ? 277 THR A CB  1 
ATOM   2006  O OG1 . THR A 1 268 ? -55.668 -22.711 -42.412  1.00 158.44 ? 277 THR A OG1 1 
ATOM   2007  C CG2 . THR A 1 268 ? -53.560 -23.788 -42.864  1.00 159.19 ? 277 THR A CG2 1 
ATOM   2008  N N   . ILE A 1 269 ? -55.633 -23.573 -39.042  1.00 140.40 ? 278 ILE A N   1 
ATOM   2009  C CA  . ILE A 1 269 ? -56.470 -23.138 -37.930  1.00 139.38 ? 278 ILE A CA  1 
ATOM   2010  C C   . ILE A 1 269 ? -55.936 -21.857 -37.295  1.00 136.17 ? 278 ILE A C   1 
ATOM   2011  O O   . ILE A 1 269 ? -54.736 -21.727 -37.049  1.00 134.86 ? 278 ILE A O   1 
ATOM   2012  C CB  . ILE A 1 269 ? -56.589 -24.235 -36.853  1.00 140.78 ? 278 ILE A CB  1 
ATOM   2013  C CG1 . ILE A 1 269 ? -57.420 -23.739 -35.668  1.00 139.84 ? 278 ILE A CG1 1 
ATOM   2014  C CG2 . ILE A 1 269 ? -55.210 -24.684 -36.391  1.00 140.29 ? 278 ILE A CG2 1 
ATOM   2015  C CD1 . ILE A 1 269 ? -57.583 -24.765 -34.568  1.00 141.42 ? 278 ILE A CD1 1 
ATOM   2016  N N   . LYS A 1 270 ? -56.835 -20.911 -37.036  1.00 130.83 ? 279 LYS A N   1 
ATOM   2017  C CA  . LYS A 1 270 ? -56.461 -19.653 -36.401  1.00 128.27 ? 279 LYS A CA  1 
ATOM   2018  C C   . LYS A 1 270 ? -55.857 -19.917 -35.025  1.00 127.44 ? 279 LYS A C   1 
ATOM   2019  O O   . LYS A 1 270 ? -56.307 -20.806 -34.302  1.00 128.81 ? 279 LYS A O   1 
ATOM   2020  C CB  . LYS A 1 270 ? -57.677 -18.731 -36.280  1.00 128.25 ? 279 LYS A CB  1 
ATOM   2021  N N   . TYR A 1 271 ? -54.834 -19.147 -34.669  1.00 118.38 ? 280 TYR A N   1 
ATOM   2022  C CA  . TYR A 1 271 ? -54.138 -19.352 -33.403  1.00 118.00 ? 280 TYR A CA  1 
ATOM   2023  C C   . TYR A 1 271 ? -55.074 -19.168 -32.213  1.00 118.20 ? 280 TYR A C   1 
ATOM   2024  O O   . TYR A 1 271 ? -54.887 -19.783 -31.165  1.00 118.97 ? 280 TYR A O   1 
ATOM   2025  C CB  . TYR A 1 271 ? -52.921 -18.426 -33.289  1.00 116.33 ? 280 TYR A CB  1 
ATOM   2026  C CG  . TYR A 1 271 ? -53.249 -16.973 -33.021  1.00 114.88 ? 280 TYR A CG  1 
ATOM   2027  C CD1 . TYR A 1 271 ? -53.226 -16.465 -31.730  1.00 114.51 ? 280 TYR A CD1 1 
ATOM   2028  C CD2 . TYR A 1 271 ? -53.569 -16.108 -34.059  1.00 114.29 ? 280 TYR A CD2 1 
ATOM   2029  C CE1 . TYR A 1 271 ? -53.520 -15.138 -31.477  1.00 113.60 ? 280 TYR A CE1 1 
ATOM   2030  C CE2 . TYR A 1 271 ? -53.865 -14.778 -33.816  1.00 113.39 ? 280 TYR A CE2 1 
ATOM   2031  C CZ  . TYR A 1 271 ? -53.839 -14.299 -32.524  1.00 113.05 ? 280 TYR A CZ  1 
ATOM   2032  O OH  . TYR A 1 271 ? -54.133 -12.977 -32.276  1.00 112.57 ? 280 TYR A OH  1 
ATOM   2033  N N   . THR A 1 272 ? -56.085 -18.322 -32.384  1.00 127.53 ? 281 THR A N   1 
ATOM   2034  C CA  . THR A 1 272 ? -57.082 -18.105 -31.343  1.00 128.04 ? 281 THR A CA  1 
ATOM   2035  C C   . THR A 1 272 ? -57.888 -19.378 -31.104  1.00 130.18 ? 281 THR A C   1 
ATOM   2036  O O   . THR A 1 272 ? -58.198 -19.725 -29.966  1.00 130.97 ? 281 THR A O   1 
ATOM   2037  C CB  . THR A 1 272 ? -58.044 -16.961 -31.711  1.00 127.76 ? 281 THR A CB  1 
ATOM   2038  O OG1 . THR A 1 272 ? -58.677 -17.249 -32.964  1.00 128.84 ? 281 THR A OG1 1 
ATOM   2039  C CG2 . THR A 1 272 ? -57.289 -15.644 -31.822  1.00 126.00 ? 281 THR A CG2 1 
ATOM   2040  N N   . SER A 1 273 ? -58.222 -20.071 -32.188  1.00 143.35 ? 282 SER A N   1 
ATOM   2041  C CA  . SER A 1 273 ? -58.970 -21.319 -32.100  1.00 145.85 ? 282 SER A CA  1 
ATOM   2042  C C   . SER A 1 273 ? -58.101 -22.435 -31.531  1.00 146.70 ? 282 SER A C   1 
ATOM   2043  O O   . SER A 1 273 ? -58.560 -23.244 -30.726  1.00 148.45 ? 282 SER A O   1 
ATOM   2044  C CB  . SER A 1 273 ? -59.504 -21.722 -33.475  1.00 147.43 ? 282 SER A CB  1 
ATOM   2045  O OG  . SER A 1 273 ? -60.386 -20.739 -33.989  1.00 147.27 ? 282 SER A OG  1 
ATOM   2046  N N   . ALA A 1 274 ? -56.842 -22.471 -31.958  1.00 121.53 ? 283 ALA A N   1 
ATOM   2047  C CA  . ALA A 1 274 ? -55.902 -23.484 -31.493  1.00 122.67 ? 283 ALA A CA  1 
ATOM   2048  C C   . ALA A 1 274 ? -55.679 -23.376 -29.989  1.00 122.52 ? 283 ALA A C   1 
ATOM   2049  O O   . ALA A 1 274 ? -55.519 -24.384 -29.302  1.00 124.51 ? 283 ALA A O   1 
ATOM   2050  C CB  . ALA A 1 274 ? -54.583 -23.362 -32.238  1.00 121.78 ? 283 ALA A CB  1 
ATOM   2051  N N   . LEU A 1 275 ? -55.668 -22.147 -29.482  1.00 120.25 ? 284 LEU A N   1 
ATOM   2052  C CA  . LEU A 1 275 ? -55.503 -21.912 -28.053  1.00 120.34 ? 284 LEU A CA  1 
ATOM   2053  C C   . LEU A 1 275 ? -56.743 -22.355 -27.284  1.00 122.00 ? 284 LEU A C   1 
ATOM   2054  O O   . LEU A 1 275 ? -56.645 -22.827 -26.152  1.00 123.39 ? 284 LEU A O   1 
ATOM   2055  C CB  . LEU A 1 275 ? -55.206 -20.437 -27.777  1.00 118.18 ? 284 LEU A CB  1 
ATOM   2056  C CG  . LEU A 1 275 ? -53.828 -19.937 -28.212  1.00 116.87 ? 284 LEU A CG  1 
ATOM   2057  C CD1 . LEU A 1 275 ? -53.679 -18.452 -27.923  1.00 115.18 ? 284 LEU A CD1 1 
ATOM   2058  C CD2 . LEU A 1 275 ? -52.732 -20.733 -27.525  1.00 118.26 ? 284 LEU A CD2 1 
ATOM   2059  N N   . THR A 1 276 ? -57.908 -22.198 -27.905  1.00 123.80 ? 285 THR A N   1 
ATOM   2060  C CA  . THR A 1 276 ? -59.163 -22.636 -27.304  1.00 125.70 ? 285 THR A CA  1 
ATOM   2061  C C   . THR A 1 276 ? -59.139 -24.144 -27.076  1.00 128.38 ? 285 THR A C   1 
ATOM   2062  O O   . THR A 1 276 ? -59.528 -24.629 -26.014  1.00 130.09 ? 285 THR A O   1 
ATOM   2063  C CB  . THR A 1 276 ? -60.368 -22.277 -28.194  1.00 125.96 ? 285 THR A CB  1 
ATOM   2064  O OG1 . THR A 1 276 ? -60.435 -20.856 -28.365  1.00 123.90 ? 285 THR A OG1 1 
ATOM   2065  C CG2 . THR A 1 276 ? -61.662 -22.772 -27.566  1.00 128.32 ? 285 THR A CG2 1 
ATOM   2066  N N   . TYR A 1 277 ? -58.678 -24.878 -28.084  1.00 128.95 ? 286 TYR A N   1 
ATOM   2067  C CA  . TYR A 1 277 ? -58.552 -26.327 -27.993  1.00 131.86 ? 286 TYR A CA  1 
ATOM   2068  C C   . TYR A 1 277 ? -57.571 -26.714 -26.893  1.00 132.50 ? 286 TYR A C   1 
ATOM   2069  O O   . TYR A 1 277 ? -57.821 -27.640 -26.123  1.00 135.14 ? 286 TYR A O   1 
ATOM   2070  C CB  . TYR A 1 277 ? -58.094 -26.902 -29.333  1.00 132.49 ? 286 TYR A CB  1 
ATOM   2071  C CG  . TYR A 1 277 ? -57.746 -28.373 -29.297  1.00 135.73 ? 286 TYR A CG  1 
ATOM   2072  C CD1 . TYR A 1 277 ? -56.449 -28.794 -29.032  1.00 136.10 ? 286 TYR A CD1 1 
ATOM   2073  C CD2 . TYR A 1 277 ? -58.712 -29.341 -29.538  1.00 138.85 ? 286 TYR A CD2 1 
ATOM   2074  C CE1 . TYR A 1 277 ? -56.125 -30.137 -29.003  1.00 139.51 ? 286 TYR A CE1 1 
ATOM   2075  C CE2 . TYR A 1 277 ? -58.397 -30.688 -29.511  1.00 142.23 ? 286 TYR A CE2 1 
ATOM   2076  C CZ  . TYR A 1 277 ? -57.101 -31.079 -29.243  1.00 142.55 ? 286 TYR A CZ  1 
ATOM   2077  O OH  . TYR A 1 277 ? -56.779 -32.417 -29.215  1.00 146.33 ? 286 TYR A OH  1 
ATOM   2078  N N   . ASP A 1 278 ? -56.454 -25.999 -26.826  1.00 153.51 ? 287 ASP A N   1 
ATOM   2079  C CA  . ASP A 1 278 ? -55.444 -26.253 -25.806  1.00 154.37 ? 287 ASP A CA  1 
ATOM   2080  C C   . ASP A 1 278 ? -55.945 -25.849 -24.426  1.00 154.72 ? 287 ASP A C   1 
ATOM   2081  O O   . ASP A 1 278 ? -55.469 -26.356 -23.411  1.00 156.65 ? 287 ASP A O   1 
ATOM   2082  C CB  . ASP A 1 278 ? -54.147 -25.511 -26.136  1.00 152.34 ? 287 ASP A CB  1 
ATOM   2083  C CG  . ASP A 1 278 ? -53.413 -26.119 -27.315  1.00 152.80 ? 287 ASP A CG  1 
ATOM   2084  O OD1 . ASP A 1 278 ? -53.646 -27.311 -27.608  1.00 155.35 ? 287 ASP A OD1 1 
ATOM   2085  O OD2 . ASP A 1 278 ? -52.603 -25.408 -27.947  1.00 150.89 ? 287 ASP A OD2 1 
ATOM   2086  N N   . ALA A 1 279 ? -56.908 -24.935 -24.395  1.00 131.33 ? 288 ALA A N   1 
ATOM   2087  C CA  . ALA A 1 279 ? -57.494 -24.485 -23.140  1.00 131.83 ? 288 ALA A CA  1 
ATOM   2088  C C   . ALA A 1 279 ? -58.278 -25.614 -22.483  1.00 135.01 ? 288 ALA A C   1 
ATOM   2089  O O   . ALA A 1 279 ? -58.192 -25.821 -21.272  1.00 136.70 ? 288 ALA A O   1 
ATOM   2090  C CB  . ALA A 1 279 ? -58.389 -23.281 -23.375  1.00 129.90 ? 288 ALA A CB  1 
ATOM   2091  N N   . VAL A 1 280 ? -59.042 -26.342 -23.291  1.00 133.51 ? 289 VAL A N   1 
ATOM   2092  C CA  . VAL A 1 280 ? -59.818 -27.474 -22.800  1.00 136.88 ? 289 VAL A CA  1 
ATOM   2093  C C   . VAL A 1 280 ? -58.907 -28.507 -22.148  1.00 139.37 ? 289 VAL A C   1 
ATOM   2094  O O   . VAL A 1 280 ? -59.222 -29.048 -21.088  1.00 141.94 ? 289 VAL A O   1 
ATOM   2095  C CB  . VAL A 1 280 ? -60.614 -28.145 -23.937  1.00 138.10 ? 289 VAL A CB  1 
ATOM   2096  C CG1 . VAL A 1 280 ? -61.358 -29.365 -23.418  1.00 142.03 ? 289 VAL A CG1 1 
ATOM   2097  C CG2 . VAL A 1 280 ? -61.580 -27.152 -24.567  1.00 136.29 ? 289 VAL A CG2 1 
ATOM   2098  N N   . GLN A 1 281 ? -57.772 -28.772 -22.788  1.00 158.39 ? 290 GLN A N   1 
ATOM   2099  C CA  . GLN A 1 281 ? -56.811 -29.743 -22.280  1.00 161.08 ? 290 GLN A CA  1 
ATOM   2100  C C   . GLN A 1 281 ? -56.241 -29.309 -20.933  1.00 161.44 ? 290 GLN A C   1 
ATOM   2101  O O   . GLN A 1 281 ? -56.013 -30.137 -20.051  1.00 164.73 ? 290 GLN A O   1 
ATOM   2102  C CB  . GLN A 1 281 ? -55.679 -29.956 -23.288  1.00 160.44 ? 290 GLN A CB  1 
ATOM   2103  C CG  . GLN A 1 281 ? -54.619 -30.947 -22.833  1.00 163.59 ? 290 GLN A CG  1 
ATOM   2104  C CD  . GLN A 1 281 ? -53.545 -31.176 -23.880  1.00 163.28 ? 290 GLN A CD  1 
ATOM   2105  O OE1 . GLN A 1 281 ? -53.552 -30.549 -24.940  1.00 160.54 ? 290 GLN A OE1 1 
ATOM   2106  N NE2 . GLN A 1 281 ? -52.614 -32.077 -23.587  1.00 166.44 ? 290 GLN A NE2 1 
ATOM   2107  N N   . VAL A 1 282 ? -56.016 -28.008 -20.780  1.00 139.63 ? 291 VAL A N   1 
ATOM   2108  C CA  . VAL A 1 282 ? -55.478 -27.468 -19.537  1.00 140.10 ? 291 VAL A CA  1 
ATOM   2109  C C   . VAL A 1 282 ? -56.486 -27.607 -18.402  1.00 142.13 ? 291 VAL A C   1 
ATOM   2110  O O   . VAL A 1 282 ? -56.125 -27.957 -17.278  1.00 144.80 ? 291 VAL A O   1 
ATOM   2111  C CB  . VAL A 1 282 ? -55.084 -25.986 -19.686  1.00 136.69 ? 291 VAL A CB  1 
ATOM   2112  C CG1 . VAL A 1 282 ? -54.642 -25.418 -18.347  1.00 137.72 ? 291 VAL A CG1 1 
ATOM   2113  C CG2 . VAL A 1 282 ? -53.984 -25.831 -20.726  1.00 135.00 ? 291 VAL A CG2 1 
ATOM   2114  N N   . MET A 1 283 ? -57.751 -27.334 -18.706  1.00 140.32 ? 292 MET A N   1 
ATOM   2115  C CA  . MET A 1 283 ? -58.813 -27.418 -17.711  1.00 142.28 ? 292 MET A CA  1 
ATOM   2116  C C   . MET A 1 283 ? -59.062 -28.864 -17.295  1.00 146.33 ? 292 MET A C   1 
ATOM   2117  O O   . MET A 1 283 ? -59.426 -29.137 -16.151  1.00 148.97 ? 292 MET A O   1 
ATOM   2118  C CB  . MET A 1 283 ? -60.101 -26.790 -18.248  1.00 140.63 ? 292 MET A CB  1 
ATOM   2119  C CG  . MET A 1 283 ? -59.939 -25.352 -18.711  1.00 137.01 ? 292 MET A CG  1 
ATOM   2120  S SD  . MET A 1 283 ? -61.460 -24.657 -19.384  1.00 135.78 ? 292 MET A SD  1 
ATOM   2121  C CE  . MET A 1 283 ? -62.505 -24.663 -17.930  1.00 138.54 ? 292 MET A CE  1 
ATOM   2122  N N   . THR A 1 284 ? -58.863 -29.788 -18.230  1.00 149.26 ? 293 THR A N   1 
ATOM   2123  C CA  . THR A 1 284 ? -59.036 -31.208 -17.950  1.00 153.46 ? 293 THR A CA  1 
ATOM   2124  C C   . THR A 1 284 ? -57.936 -31.715 -17.024  1.00 156.10 ? 293 THR A C   1 
ATOM   2125  O O   . THR A 1 284 ? -58.212 -32.338 -15.999  1.00 159.63 ? 293 THR A O   1 
ATOM   2126  C CB  . THR A 1 284 ? -59.036 -32.044 -19.243  1.00 153.99 ? 293 THR A CB  1 
ATOM   2127  O OG1 . THR A 1 284 ? -60.167 -31.688 -20.047  1.00 152.46 ? 293 THR A OG1 1 
ATOM   2128  C CG2 . THR A 1 284 ? -59.100 -33.530 -18.919  1.00 158.83 ? 293 THR A CG2 1 
ATOM   2129  N N   . GLU A 1 285 ? -56.689 -31.438 -17.390  1.00 154.78 ? 294 GLU A N   1 
ATOM   2130  C CA  . GLU A 1 285 ? -55.542 -31.863 -16.598  1.00 157.51 ? 294 GLU A CA  1 
ATOM   2131  C C   . GLU A 1 285 ? -55.561 -31.226 -15.212  1.00 158.34 ? 294 GLU A C   1 
ATOM   2132  O O   . GLU A 1 285 ? -55.039 -31.791 -14.251  1.00 162.05 ? 294 GLU A O   1 
ATOM   2133  C CB  . GLU A 1 285 ? -54.238 -31.515 -17.320  1.00 155.63 ? 294 GLU A CB  1 
ATOM   2134  C CG  . GLU A 1 285 ? -52.977 -31.955 -16.591  1.00 158.82 ? 294 GLU A CG  1 
ATOM   2135  C CD  . GLU A 1 285 ? -52.783 -33.460 -16.608  1.00 163.42 ? 294 GLU A CD  1 
ATOM   2136  O OE1 . GLU A 1 285 ? -53.552 -34.155 -17.305  1.00 163.91 ? 294 GLU A OE1 1 
ATOM   2137  O OE2 . GLU A 1 285 ? -51.857 -33.947 -15.926  1.00 166.94 ? 294 GLU A OE2 1 
ATOM   2138  N N   . ALA A 1 286 ? -56.169 -30.049 -15.115  1.00 152.89 ? 295 ALA A N   1 
ATOM   2139  C CA  . ALA A 1 286 ? -56.242 -29.327 -13.850  1.00 153.65 ? 295 ALA A CA  1 
ATOM   2140  C C   . ALA A 1 286 ? -57.238 -29.981 -12.900  1.00 157.15 ? 295 ALA A C   1 
ATOM   2141  O O   . ALA A 1 286 ? -56.927 -30.232 -11.736  1.00 160.50 ? 295 ALA A O   1 
ATOM   2142  C CB  . ALA A 1 286 ? -56.614 -27.875 -14.090  1.00 149.64 ? 295 ALA A CB  1 
ATOM   2143  N N   . PHE A 1 287 ? -58.436 -30.255 -13.404  1.00 193.31 ? 296 PHE A N   1 
ATOM   2144  C CA  . PHE A 1 287 ? -59.473 -30.890 -12.601  1.00 196.71 ? 296 PHE A CA  1 
ATOM   2145  C C   . PHE A 1 287 ? -59.116 -32.346 -12.302  1.00 201.30 ? 296 PHE A C   1 
ATOM   2146  O O   . PHE A 1 287 ? -59.649 -32.945 -11.363  1.00 205.11 ? 296 PHE A O   1 
ATOM   2147  C CB  . PHE A 1 287 ? -60.825 -30.814 -13.313  1.00 195.33 ? 296 PHE A CB  1 
ATOM   2148  N N   . ARG A 1 288 ? -58.210 -32.908 -13.099  1.00 183.47 ? 297 ARG A N   1 
ATOM   2149  C CA  . ARG A 1 288 ? -57.758 -34.279 -12.901  1.00 188.08 ? 297 ARG A CA  1 
ATOM   2150  C C   . ARG A 1 288 ? -56.704 -34.356 -11.803  1.00 191.02 ? 297 ARG A C   1 
ATOM   2151  O O   . ARG A 1 288 ? -56.658 -35.322 -11.040  1.00 195.92 ? 297 ARG A O   1 
ATOM   2152  C CB  . ARG A 1 288 ? -57.196 -34.840 -14.205  1.00 187.25 ? 297 ARG A CB  1 
ATOM   2153  N N   . ASN A 1 289 ? -55.848 -33.341 -11.742  1.00 170.65 ? 298 ASN A N   1 
ATOM   2154  C CA  . ASN A 1 289 ? -54.817 -33.273 -10.715  1.00 173.51 ? 298 ASN A CA  1 
ATOM   2155  C C   . ASN A 1 289 ? -55.400 -32.962 -9.340   1.00 175.84 ? 298 ASN A C   1 
ATOM   2156  O O   . ASN A 1 289 ? -54.714 -33.072 -8.324   1.00 179.44 ? 298 ASN A O   1 
ATOM   2157  C CB  . ASN A 1 289 ? -53.755 -32.237 -11.087  1.00 170.22 ? 298 ASN A CB  1 
ATOM   2158  C CG  . ASN A 1 289 ? -52.878 -32.689 -12.239  1.00 169.31 ? 298 ASN A CG  1 
ATOM   2159  O OD1 . ASN A 1 289 ? -52.911 -33.853 -12.639  1.00 171.86 ? 298 ASN A OD1 1 
ATOM   2160  N ND2 . ASN A 1 289 ? -52.086 -31.769 -12.778  1.00 165.98 ? 298 ASN A ND2 1 
ATOM   2161  N N   . LEU A 1 290 ? -56.671 -32.573 -9.316   1.00 176.72 ? 299 LEU A N   1 
ATOM   2162  C CA  . LEU A 1 290 ? -57.369 -32.308 -8.062   1.00 179.08 ? 299 LEU A CA  1 
ATOM   2163  C C   . LEU A 1 290 ? -58.020 -33.573 -7.515   1.00 184.02 ? 299 LEU A C   1 
ATOM   2164  O O   . LEU A 1 290 ? -58.147 -33.742 -6.302   1.00 187.96 ? 299 LEU A O   1 
ATOM   2165  C CB  . LEU A 1 290 ? -58.416 -31.208 -8.248   1.00 175.26 ? 299 LEU A CB  1 
ATOM   2166  C CG  . LEU A 1 290 ? -57.971 -29.792 -7.875   1.00 172.80 ? 299 LEU A CG  1 
ATOM   2167  C CD1 . LEU A 1 290 ? -56.478 -29.614 -8.102   1.00 172.28 ? 299 LEU A CD1 1 
ATOM   2168  C CD2 . LEU A 1 290 ? -58.773 -28.749 -8.641   1.00 168.07 ? 299 LEU A CD2 1 
ATOM   2169  N N   . ARG A 1 291 ? -58.432 -34.457 -8.417   1.00 183.76 ? 300 ARG A N   1 
ATOM   2170  C CA  . ARG A 1 291 ? -59.027 -35.727 -8.024   1.00 188.70 ? 300 ARG A CA  1 
ATOM   2171  C C   . ARG A 1 291 ? -57.956 -36.670 -7.489   1.00 193.62 ? 300 ARG A C   1 
ATOM   2172  O O   . ARG A 1 291 ? -58.157 -37.348 -6.482   1.00 198.72 ? 300 ARG A O   1 
ATOM   2173  C CB  . ARG A 1 291 ? -59.751 -36.370 -9.208   1.00 187.66 ? 300 ARG A CB  1 
ATOM   2174  N N   . LYS A 1 292 ? -56.814 -36.702 -8.170   1.00 191.66 ? 301 LYS A N   1 
ATOM   2175  C CA  . LYS A 1 292 ? -55.704 -37.561 -7.774   1.00 196.42 ? 301 LYS A CA  1 
ATOM   2176  C C   . LYS A 1 292 ? -54.978 -37.010 -6.550   1.00 198.61 ? 301 LYS A C   1 
ATOM   2177  O O   . LYS A 1 292 ? -54.195 -37.714 -5.913   1.00 203.75 ? 301 LYS A O   1 
ATOM   2178  C CB  . LYS A 1 292 ? -54.722 -37.735 -8.933   1.00 194.53 ? 301 LYS A CB  1 
ATOM   2179  N N   . GLN A 1 293 ? -55.242 -35.747 -6.228   1.00 195.18 ? 302 GLN A N   1 
ATOM   2180  C CA  . GLN A 1 293 ? -54.621 -35.107 -5.074   1.00 197.26 ? 302 GLN A CA  1 
ATOM   2181  C C   . GLN A 1 293 ? -55.533 -35.167 -3.852   1.00 200.68 ? 302 GLN A C   1 
ATOM   2182  O O   . GLN A 1 293 ? -55.200 -34.637 -2.792   1.00 202.95 ? 302 GLN A O   1 
ATOM   2183  C CB  . GLN A 1 293 ? -54.261 -33.654 -5.392   1.00 192.06 ? 302 GLN A CB  1 
ATOM   2184  N N   . ARG A 1 294 ? -56.682 -35.816 -4.011   1.00 221.87 ? 303 ARG A N   1 
ATOM   2185  C CA  . ARG A 1 294 ? -57.642 -35.966 -2.922   1.00 225.34 ? 303 ARG A CA  1 
ATOM   2186  C C   . ARG A 1 294 ? -58.070 -34.615 -2.358   1.00 222.73 ? 303 ARG A C   1 
ATOM   2187  O O   . ARG A 1 294 ? -58.035 -34.398 -1.147   1.00 226.35 ? 303 ARG A O   1 
ATOM   2188  C CB  . ARG A 1 294 ? -57.060 -36.843 -1.810   1.00 232.48 ? 303 ARG A CB  1 
ATOM   2189  N N   . ILE A 1 295 ? -58.473 -33.709 -3.243   1.00 196.69 ? 304 ILE A N   1 
ATOM   2190  C CA  . ILE A 1 295 ? -58.906 -32.379 -2.833   1.00 194.09 ? 304 ILE A CA  1 
ATOM   2191  C C   . ILE A 1 295 ? -60.380 -32.150 -3.147   1.00 191.97 ? 304 ILE A C   1 
ATOM   2192  O O   . ILE A 1 295 ? -60.776 -32.095 -4.312   1.00 188.06 ? 304 ILE A O   1 
ATOM   2193  C CB  . ILE A 1 295 ? -58.068 -31.278 -3.512   1.00 189.26 ? 304 ILE A CB  1 
ATOM   2194  C CG1 . ILE A 1 295 ? -56.588 -31.434 -3.154   1.00 191.74 ? 304 ILE A CG1 1 
ATOM   2195  C CG2 . ILE A 1 295 ? -58.574 -29.900 -3.109   1.00 186.93 ? 304 ILE A CG2 1 
ATOM   2196  C CD1 . ILE A 1 295 ? -55.694 -30.384 -3.777   1.00 187.56 ? 304 ILE A CD1 1 
ATOM   2197  N N   . GLU A 1 296 ? -61.188 -32.017 -2.100   1.00 236.32 ? 305 GLU A N   1 
ATOM   2198  C CA  . GLU A 1 296 ? -62.615 -31.769 -2.258   1.00 235.07 ? 305 GLU A CA  1 
ATOM   2199  C C   . GLU A 1 296 ? -62.887 -30.285 -2.486   1.00 230.64 ? 305 GLU A C   1 
ATOM   2200  O O   . GLU A 1 296 ? -62.462 -29.437 -1.703   1.00 231.23 ? 305 GLU A O   1 
ATOM   2201  C CB  . GLU A 1 296 ? -63.387 -32.265 -1.034   1.00 240.49 ? 305 GLU A CB  1 
ATOM   2202  N N   . ILE A 1 297 ? -63.598 -29.977 -3.566   1.00 232.84 ? 306 ILE A N   1 
ATOM   2203  C CA  . ILE A 1 297 ? -63.897 -28.593 -3.920   1.00 228.73 ? 306 ILE A CA  1 
ATOM   2204  C C   . ILE A 1 297 ? -65.369 -28.399 -4.280   1.00 227.87 ? 306 ILE A C   1 
ATOM   2205  O O   . ILE A 1 297 ? -65.783 -27.300 -4.646   1.00 224.81 ? 306 ILE A O   1 
ATOM   2206  C CB  . ILE A 1 297 ? -63.016 -28.103 -5.088   1.00 223.93 ? 306 ILE A CB  1 
ATOM   2207  C CG1 . ILE A 1 297 ? -63.280 -28.936 -6.343   1.00 222.24 ? 306 ILE A CG1 1 
ATOM   2208  C CG2 . ILE A 1 297 ? -61.542 -28.162 -4.707   1.00 224.94 ? 306 ILE A CG2 1 
ATOM   2209  C CD1 . ILE A 1 297 ? -62.463 -28.509 -7.542   1.00 217.78 ? 306 ILE A CD1 1 
ATOM   2210  N N   . SER A 1 298 ? -66.160 -29.459 -4.150   1.00 225.40 ? 307 SER A N   1 
ATOM   2211  C CA  . SER A 1 298 ? -67.595 -29.371 -4.399   1.00 225.52 ? 307 SER A CA  1 
ATOM   2212  C C   . SER A 1 298 ? -68.226 -28.280 -3.539   1.00 226.18 ? 307 SER A C   1 
ATOM   2213  O O   . SER A 1 298 ? -68.066 -28.268 -2.318   1.00 229.66 ? 307 SER A O   1 
ATOM   2214  C CB  . SER A 1 298 ? -68.272 -30.714 -4.125   1.00 229.96 ? 307 SER A CB  1 
ATOM   2215  O OG  . SER A 1 298 ? -69.670 -30.632 -4.343   1.00 230.53 ? 307 SER A OG  1 
ATOM   2216  N N   . ARG A 1 299 ? -68.939 -27.363 -4.185   1.00 185.90 ? 308 ARG A N   1 
ATOM   2217  C CA  . ARG A 1 299 ? -69.578 -26.253 -3.487   1.00 186.50 ? 308 ARG A CA  1 
ATOM   2218  C C   . ARG A 1 299 ? -70.628 -26.744 -2.495   1.00 191.43 ? 308 ARG A C   1 
ATOM   2219  O O   . ARG A 1 299 ? -71.328 -27.725 -2.752   1.00 193.35 ? 308 ARG A O   1 
ATOM   2220  C CB  . ARG A 1 299 ? -70.211 -25.285 -4.490   1.00 182.79 ? 308 ARG A CB  1 
ATOM   2221  N N   . ARG A 1 300 ? -70.732 -26.057 -1.363   1.00 198.12 ? 309 ARG A N   1 
ATOM   2222  C CA  . ARG A 1 300 ? -71.694 -26.419 -0.327   1.00 203.09 ? 309 ARG A CA  1 
ATOM   2223  C C   . ARG A 1 300 ? -73.112 -26.010 -0.718   1.00 203.05 ? 309 ARG A C   1 
ATOM   2224  O O   . ARG A 1 300 ? -74.090 -26.548 -0.197   1.00 206.97 ? 309 ARG A O   1 
ATOM   2225  C CB  . ARG A 1 300 ? -71.311 -25.778 1.008    1.00 205.93 ? 309 ARG A CB  1 
ATOM   2226  N N   . GLY A 1 301 ? -73.214 -25.055 -1.636   1.00 257.89 ? 310 GLY A N   1 
ATOM   2227  C CA  . GLY A 1 301 ? -74.503 -24.576 -2.101   1.00 257.87 ? 310 GLY A CA  1 
ATOM   2228  C C   . GLY A 1 301 ? -74.367 -23.432 -3.087   1.00 253.33 ? 310 GLY A C   1 
ATOM   2229  O O   . GLY A 1 301 ? -73.276 -23.165 -3.595   1.00 249.80 ? 310 GLY A O   1 
ATOM   2230  N N   . ASN A 1 302 ? -75.478 -22.755 -3.362   1.00 259.42 ? 311 ASN A N   1 
ATOM   2231  C CA  . ASN A 1 302 ? -75.476 -21.617 -4.273   1.00 255.78 ? 311 ASN A CA  1 
ATOM   2232  C C   . ASN A 1 302 ? -74.469 -20.556 -3.841   1.00 254.00 ? 311 ASN A C   1 
ATOM   2233  O O   . ASN A 1 302 ? -74.288 -20.311 -2.648   1.00 256.74 ? 311 ASN A O   1 
ATOM   2234  C CB  . ASN A 1 302 ? -76.876 -21.009 -4.378   1.00 257.76 ? 311 ASN A CB  1 
ATOM   2235  C CG  . ASN A 1 302 ? -77.890 -21.980 -4.951   1.00 259.57 ? 311 ASN A CG  1 
ATOM   2236  O OD1 . ASN A 1 302 ? -77.533 -23.054 -5.435   1.00 258.86 ? 311 ASN A OD1 1 
ATOM   2237  N ND2 . ASN A 1 302 ? -79.162 -21.605 -4.901   1.00 262.30 ? 311 ASN A ND2 1 
ATOM   2238  N N   . ALA A 1 303 ? -73.814 -19.932 -4.816   1.00 201.80 ? 312 ALA A N   1 
ATOM   2239  C CA  . ALA A 1 303 ? -72.769 -18.957 -4.524   1.00 200.05 ? 312 ALA A CA  1 
ATOM   2240  C C   . ALA A 1 303 ? -73.357 -17.602 -4.146   1.00 201.22 ? 312 ALA A C   1 
ATOM   2241  O O   . ALA A 1 303 ? -72.714 -16.806 -3.459   1.00 201.70 ? 312 ALA A O   1 
ATOM   2242  C CB  . ALA A 1 303 ? -71.824 -18.820 -5.709   1.00 195.34 ? 312 ALA A CB  1 
ATOM   2243  N N   . GLY A 1 304 ? -74.581 -17.347 -4.597   1.00 180.00 ? 313 GLY A N   1 
ATOM   2244  C CA  . GLY A 1 304 ? -75.258 -16.098 -4.301   1.00 181.62 ? 313 GLY A CA  1 
ATOM   2245  C C   . GLY A 1 304 ? -74.959 -15.018 -5.322   1.00 178.19 ? 313 GLY A C   1 
ATOM   2246  O O   . GLY A 1 304 ? -74.255 -15.255 -6.304   1.00 174.42 ? 313 GLY A O   1 
ATOM   2247  N N   . ASP A 1 305 ? -75.498 -13.826 -5.089   1.00 209.11 ? 314 ASP A N   1 
ATOM   2248  C CA  . ASP A 1 305 ? -75.283 -12.700 -5.988   1.00 206.56 ? 314 ASP A CA  1 
ATOM   2249  C C   . ASP A 1 305 ? -73.840 -12.214 -5.894   1.00 203.99 ? 314 ASP A C   1 
ATOM   2250  O O   . ASP A 1 305 ? -73.291 -12.082 -4.801   1.00 205.84 ? 314 ASP A O   1 
ATOM   2251  C CB  . ASP A 1 305 ? -76.252 -11.562 -5.659   1.00 209.77 ? 314 ASP A CB  1 
ATOM   2252  C CG  . ASP A 1 305 ? -76.379 -10.558 -6.788   1.00 207.79 ? 314 ASP A CG  1 
ATOM   2253  O OD1 . ASP A 1 305 ? -77.129 -9.572  -6.626   1.00 210.49 ? 314 ASP A OD1 1 
ATOM   2254  O OD2 . ASP A 1 305 ? -75.733 -10.756 -7.840   1.00 203.85 ? 314 ASP A OD2 1 
ATOM   2255  N N   . CYS A 1 306 ? -73.230 -11.955 -7.046   1.00 197.75 ? 315 CYS A N   1 
ATOM   2256  C CA  . CYS A 1 306 ? -71.837 -11.522 -7.098   1.00 195.22 ? 315 CYS A CA  1 
ATOM   2257  C C   . CYS A 1 306 ? -71.645 -10.139 -6.483   1.00 196.98 ? 315 CYS A C   1 
ATOM   2258  O O   . CYS A 1 306 ? -70.551 -9.798  -6.032   1.00 196.57 ? 315 CYS A O   1 
ATOM   2259  C CB  . CYS A 1 306 ? -71.324 -11.538 -8.540   1.00 190.89 ? 315 CYS A CB  1 
ATOM   2260  S SG  . CYS A 1 306 ? -72.324 -10.586 -9.714   1.00 190.42 ? 315 CYS A SG  1 
ATOM   2261  N N   . LEU A 1 307 ? -72.711 -9.346  -6.468   1.00 182.79 ? 316 LEU A N   1 
ATOM   2262  C CA  . LEU A 1 307 ? -72.655 -8.005  -5.899   1.00 185.10 ? 316 LEU A CA  1 
ATOM   2263  C C   . LEU A 1 307 ? -72.817 -8.037  -4.383   1.00 189.47 ? 316 LEU A C   1 
ATOM   2264  O O   . LEU A 1 307 ? -72.908 -6.990  -3.739   1.00 192.39 ? 316 LEU A O   1 
ATOM   2265  C CB  . LEU A 1 307 ? -73.730 -7.111  -6.519   1.00 186.35 ? 316 LEU A CB  1 
ATOM   2266  C CG  . LEU A 1 307 ? -73.646 -6.867  -8.026   1.00 182.78 ? 316 LEU A CG  1 
ATOM   2267  C CD1 . LEU A 1 307 ? -74.733 -5.899  -8.465   1.00 185.11 ? 316 LEU A CD1 1 
ATOM   2268  C CD2 . LEU A 1 307 ? -72.274 -6.342  -8.410   1.00 179.68 ? 316 LEU A CD2 1 
ATOM   2269  N N   . ALA A 1 308 ? -72.856 -9.241  -3.819   1.00 218.68 ? 317 ALA A N   1 
ATOM   2270  C CA  . ALA A 1 308 ? -73.009 -9.410  -2.378   1.00 223.07 ? 317 ALA A CA  1 
ATOM   2271  C C   . ALA A 1 308 ? -71.989 -8.572  -1.616   1.00 224.37 ? 317 ALA A C   1 
ATOM   2272  O O   . ALA A 1 308 ? -70.794 -8.619  -1.904   1.00 221.67 ? 317 ALA A O   1 
ATOM   2273  C CB  . ALA A 1 308 ? -72.884 -10.877 -1.997   1.00 223.22 ? 317 ALA A CB  1 
ATOM   2274  N N   . ASN A 1 309 ? -72.471 -7.806  -0.643   1.00 240.54 ? 318 ASN A N   1 
ATOM   2275  C CA  . ASN A 1 309 ? -71.607 -6.941  0.151    1.00 242.72 ? 318 ASN A CA  1 
ATOM   2276  C C   . ASN A 1 309 ? -71.828 -7.158  1.646    1.00 248.06 ? 318 ASN A C   1 
ATOM   2277  O O   . ASN A 1 309 ? -72.950 -7.025  2.136    1.00 251.59 ? 318 ASN A O   1 
ATOM   2278  C CB  . ASN A 1 309 ? -71.843 -5.474  -0.219   1.00 243.42 ? 318 ASN A CB  1 
ATOM   2279  C CG  . ASN A 1 309 ? -70.747 -4.556  0.290    1.00 244.77 ? 318 ASN A CG  1 
ATOM   2280  O OD1 . ASN A 1 309 ? -70.185 -4.773  1.363    1.00 247.61 ? 318 ASN A OD1 1 
ATOM   2281  N ND2 . ASN A 1 309 ? -70.440 -3.519  -0.481   1.00 243.12 ? 318 ASN A ND2 1 
ATOM   2282  N N   . PRO A 1 310 ? -70.754 -7.496  2.377    1.00 208.60 ? 319 PRO A N   1 
ATOM   2283  C CA  . PRO A 1 310 ? -69.394 -7.670  1.851    1.00 204.93 ? 319 PRO A CA  1 
ATOM   2284  C C   . PRO A 1 310 ? -69.259 -8.912  0.975    1.00 200.59 ? 319 PRO A C   1 
ATOM   2285  O O   . PRO A 1 310 ? -69.926 -9.918  1.220    1.00 201.56 ? 319 PRO A O   1 
ATOM   2286  C CB  . PRO A 1 310 ? -68.543 -7.833  3.118    1.00 208.80 ? 319 PRO A CB  1 
ATOM   2287  C CG  . PRO A 1 310 ? -69.394 -7.320  4.239    1.00 214.51 ? 319 PRO A CG  1 
ATOM   2288  C CD  . PRO A 1 310 ? -70.795 -7.641  3.841    1.00 214.11 ? 319 PRO A CD  1 
ATOM   2289  N N   . ALA A 1 311 ? -68.398 -8.835  -0.035   1.00 180.06 ? 320 ALA A N   1 
ATOM   2290  C CA  . ALA A 1 311 ? -68.160 -9.962  -0.928   1.00 176.04 ? 320 ALA A CA  1 
ATOM   2291  C C   . ALA A 1 311 ? -67.154 -10.932 -0.319   1.00 176.80 ? 320 ALA A C   1 
ATOM   2292  O O   . ALA A 1 311 ? -66.005 -10.570 -0.064   1.00 177.00 ? 320 ALA A O   1 
ATOM   2293  C CB  . ALA A 1 311 ? -67.675 -9.472  -2.284   1.00 171.29 ? 320 ALA A CB  1 
ATOM   2294  N N   . VAL A 1 312 ? -67.592 -12.165 -0.087   1.00 194.28 ? 321 VAL A N   1 
ATOM   2295  C CA  . VAL A 1 312 ? -66.730 -13.183 0.502    1.00 195.57 ? 321 VAL A CA  1 
ATOM   2296  C C   . VAL A 1 312 ? -66.293 -14.219 -0.531   1.00 191.61 ? 321 VAL A C   1 
ATOM   2297  O O   . VAL A 1 312 ? -67.124 -14.923 -1.107   1.00 190.33 ? 321 VAL A O   1 
ATOM   2298  C CB  . VAL A 1 312 ? -67.414 -13.892 1.688    1.00 200.40 ? 321 VAL A CB  1 
ATOM   2299  C CG1 . VAL A 1 312 ? -68.810 -14.359 1.301    1.00 200.15 ? 321 VAL A CG1 1 
ATOM   2300  C CG2 . VAL A 1 312 ? -66.564 -15.056 2.173    1.00 201.78 ? 321 VAL A CG2 1 
ATOM   2301  N N   . PRO A 1 313 ? -64.977 -14.306 -0.771   1.00 180.52 ? 322 PRO A N   1 
ATOM   2302  C CA  . PRO A 1 313 ? -64.392 -15.262 -1.716   1.00 177.14 ? 322 PRO A CA  1 
ATOM   2303  C C   . PRO A 1 313 ? -64.411 -16.680 -1.160   1.00 179.59 ? 322 PRO A C   1 
ATOM   2304  O O   . PRO A 1 313 ? -63.952 -16.900 -0.039   1.00 183.51 ? 322 PRO A O   1 
ATOM   2305  C CB  . PRO A 1 313 ? -62.940 -14.783 -1.845   1.00 176.02 ? 322 PRO A CB  1 
ATOM   2306  C CG  . PRO A 1 313 ? -62.914 -13.400 -1.263   1.00 177.88 ? 322 PRO A CG  1 
ATOM   2307  C CD  . PRO A 1 313 ? -63.963 -13.403 -0.207   1.00 182.04 ? 322 PRO A CD  1 
ATOM   2308  N N   . TRP A 1 314 ? -64.932 -17.627 -1.934   1.00 209.78 ? 323 TRP A N   1 
ATOM   2309  C CA  . TRP A 1 314 ? -64.960 -19.021 -1.506   1.00 212.20 ? 323 TRP A CA  1 
ATOM   2310  C C   . TRP A 1 314 ? -63.569 -19.644 -1.596   1.00 211.87 ? 323 TRP A C   1 
ATOM   2311  O O   . TRP A 1 314 ? -62.965 -19.692 -2.667   1.00 208.12 ? 323 TRP A O   1 
ATOM   2312  C CB  . TRP A 1 314 ? -65.984 -19.824 -2.317   1.00 210.76 ? 323 TRP A CB  1 
ATOM   2313  C CG  . TRP A 1 314 ? -65.695 -19.896 -3.785   1.00 206.01 ? 323 TRP A CG  1 
ATOM   2314  C CD1 . TRP A 1 314 ? -65.407 -18.854 -4.618   1.00 202.41 ? 323 TRP A CD1 1 
ATOM   2315  C CD2 . TRP A 1 314 ? -65.690 -21.074 -4.602   1.00 204.74 ? 323 TRP A CD2 1 
ATOM   2316  N NE1 . TRP A 1 314 ? -65.211 -19.312 -5.899   1.00 198.93 ? 323 TRP A NE1 1 
ATOM   2317  C CE2 . TRP A 1 314 ? -65.381 -20.671 -5.916   1.00 200.31 ? 323 TRP A CE2 1 
ATOM   2318  C CE3 . TRP A 1 314 ? -65.914 -22.431 -4.347   1.00 207.26 ? 323 TRP A CE3 1 
ATOM   2319  C CZ2 . TRP A 1 314 ? -65.288 -21.576 -6.972   1.00 198.37 ? 323 TRP A CZ2 1 
ATOM   2320  C CZ3 . TRP A 1 314 ? -65.821 -23.328 -5.398   1.00 205.36 ? 323 TRP A CZ3 1 
ATOM   2321  C CH2 . TRP A 1 314 ? -65.511 -22.896 -6.693   1.00 200.97 ? 323 TRP A CH2 1 
ATOM   2322  N N   . GLY A 1 315 ? -63.067 -20.112 -0.456   1.00 197.37 ? 324 GLY A N   1 
ATOM   2323  C CA  . GLY A 1 315 ? -61.710 -20.618 -0.353   1.00 198.14 ? 324 GLY A CA  1 
ATOM   2324  C C   . GLY A 1 315 ? -61.347 -21.703 -1.348   1.00 195.78 ? 324 GLY A C   1 
ATOM   2325  O O   . GLY A 1 315 ? -60.171 -21.895 -1.661   1.00 195.02 ? 324 GLY A O   1 
ATOM   2326  N N   . GLN A 1 316 ? -62.351 -22.416 -1.846   1.00 198.85 ? 325 GLN A N   1 
ATOM   2327  C CA  . GLN A 1 316 ? -62.118 -23.500 -2.794   1.00 197.12 ? 325 GLN A CA  1 
ATOM   2328  C C   . GLN A 1 316 ? -61.552 -22.983 -4.115   1.00 192.03 ? 325 GLN A C   1 
ATOM   2329  O O   . GLN A 1 316 ? -61.024 -23.753 -4.919   1.00 190.60 ? 325 GLN A O   1 
ATOM   2330  C CB  . GLN A 1 316 ? -63.409 -24.284 -3.040   1.00 197.76 ? 325 GLN A CB  1 
ATOM   2331  N N   . GLY A 1 317 ? -61.662 -21.676 -4.333   1.00 225.37 ? 326 GLY A N   1 
ATOM   2332  C CA  . GLY A 1 317 ? -61.170 -21.061 -5.552   1.00 220.79 ? 326 GLY A CA  1 
ATOM   2333  C C   . GLY A 1 317 ? -59.658 -20.947 -5.586   1.00 220.48 ? 326 GLY A C   1 
ATOM   2334  O O   . GLY A 1 317 ? -59.046 -21.015 -6.652   1.00 217.35 ? 326 GLY A O   1 
ATOM   2335  N N   . VAL A 1 318 ? -59.055 -20.770 -4.414   1.00 165.11 ? 327 VAL A N   1 
ATOM   2336  C CA  . VAL A 1 318 ? -57.606 -20.642 -4.308   1.00 165.70 ? 327 VAL A CA  1 
ATOM   2337  C C   . VAL A 1 318 ? -56.904 -21.899 -4.813   1.00 165.86 ? 327 VAL A C   1 
ATOM   2338  O O   . VAL A 1 318 ? -55.822 -21.828 -5.394   1.00 164.40 ? 327 VAL A O   1 
ATOM   2339  C CB  . VAL A 1 318 ? -57.170 -20.366 -2.855   1.00 170.60 ? 327 VAL A CB  1 
ATOM   2340  C CG1 . VAL A 1 318 ? -55.659 -20.210 -2.774   1.00 171.60 ? 327 VAL A CG1 1 
ATOM   2341  C CG2 . VAL A 1 318 ? -57.870 -19.127 -2.316   1.00 170.98 ? 327 VAL A CG2 1 
ATOM   2342  N N   . GLU A 1 319 ? -57.532 -23.049 -4.588   1.00 198.56 ? 328 GLU A N   1 
ATOM   2343  C CA  . GLU A 1 319 ? -56.970 -24.327 -5.012   1.00 199.42 ? 328 GLU A CA  1 
ATOM   2344  C C   . GLU A 1 319 ? -57.136 -24.546 -6.512   1.00 194.99 ? 328 GLU A C   1 
ATOM   2345  O O   . GLU A 1 319 ? -56.268 -25.127 -7.163   1.00 194.41 ? 328 GLU A O   1 
ATOM   2346  C CB  . GLU A 1 319 ? -57.613 -25.478 -4.236   1.00 203.68 ? 328 GLU A CB  1 
ATOM   2347  C CG  . GLU A 1 319 ? -57.258 -25.505 -2.757   1.00 208.95 ? 328 GLU A CG  1 
ATOM   2348  C CD  . GLU A 1 319 ? -55.797 -25.833 -2.514   1.00 211.36 ? 328 GLU A CD  1 
ATOM   2349  O OE1 . GLU A 1 319 ? -55.312 -25.594 -1.388   1.00 215.45 ? 328 GLU A OE1 1 
ATOM   2350  O OE2 . GLU A 1 319 ? -55.133 -26.332 -3.448   1.00 209.50 ? 328 GLU A OE2 1 
ATOM   2351  N N   . ILE A 1 320 ? -58.256 -24.080 -7.055   1.00 165.09 ? 329 ILE A N   1 
ATOM   2352  C CA  . ILE A 1 320 ? -58.524 -24.211 -8.483   1.00 161.20 ? 329 ILE A CA  1 
ATOM   2353  C C   . ILE A 1 320 ? -57.497 -23.428 -9.295   1.00 157.87 ? 329 ILE A C   1 
ATOM   2354  O O   . ILE A 1 320 ? -57.144 -23.814 -10.409  1.00 155.62 ? 329 ILE A O   1 
ATOM   2355  C CB  . ILE A 1 320 ? -59.942 -23.725 -8.839   1.00 159.44 ? 329 ILE A CB  1 
ATOM   2356  C CG1 . ILE A 1 320 ? -60.984 -24.461 -7.995   1.00 163.04 ? 329 ILE A CG1 1 
ATOM   2357  C CG2 . ILE A 1 320 ? -60.219 -23.926 -10.320  1.00 156.02 ? 329 ILE A CG2 1 
ATOM   2358  C CD1 . ILE A 1 320 ? -62.411 -24.057 -8.298   1.00 161.99 ? 329 ILE A CD1 1 
ATOM   2359  N N   . GLU A 1 321 ? -57.017 -22.326 -8.726   1.00 165.14 ? 330 GLU A N   1 
ATOM   2360  C CA  . GLU A 1 321 ? -55.998 -21.511 -9.375   1.00 162.52 ? 330 GLU A CA  1 
ATOM   2361  C C   . GLU A 1 321 ? -54.652 -22.226 -9.372   1.00 164.13 ? 330 GLU A C   1 
ATOM   2362  O O   . GLU A 1 321 ? -53.985 -22.319 -10.402  1.00 161.78 ? 330 GLU A O   1 
ATOM   2363  C CB  . GLU A 1 321 ? -55.867 -20.158 -8.674   1.00 162.88 ? 330 GLU A CB  1 
ATOM   2364  C CG  . GLU A 1 321 ? -54.767 -19.276 -9.240   1.00 160.78 ? 330 GLU A CG  1 
ATOM   2365  C CD  . GLU A 1 321 ? -54.522 -18.038 -8.401   1.00 162.20 ? 330 GLU A CD  1 
ATOM   2366  O OE1 . GLU A 1 321 ? -53.816 -17.124 -8.878   1.00 160.45 ? 330 GLU A OE1 1 
ATOM   2367  O OE2 . GLU A 1 321 ? -55.036 -17.978 -7.263   1.00 165.36 ? 330 GLU A OE2 1 
ATOM   2368  N N   . ARG A 1 322 ? -54.260 -22.730 -8.206   1.00 158.61 ? 331 ARG A N   1 
ATOM   2369  C CA  . ARG A 1 322 ? -52.993 -23.436 -8.058   1.00 161.11 ? 331 ARG A CA  1 
ATOM   2370  C C   . ARG A 1 322 ? -52.965 -24.707 -8.902   1.00 160.78 ? 331 ARG A C   1 
ATOM   2371  O O   . ARG A 1 322 ? -51.906 -25.295 -9.118   1.00 162.17 ? 331 ARG A O   1 
ATOM   2372  C CB  . ARG A 1 322 ? -52.737 -23.774 -6.588   1.00 166.53 ? 331 ARG A CB  1 
ATOM   2373  N N   . ALA A 1 323 ? -54.134 -25.126 -9.374   1.00 182.09 ? 332 ALA A N   1 
ATOM   2374  C CA  . ALA A 1 323 ? -54.241 -26.310 -10.217  1.00 182.00 ? 332 ALA A CA  1 
ATOM   2375  C C   . ALA A 1 323 ? -53.963 -25.962 -11.674  1.00 177.64 ? 332 ALA A C   1 
ATOM   2376  O O   . ALA A 1 323 ? -53.084 -26.547 -12.306  1.00 177.80 ? 332 ALA A O   1 
ATOM   2377  C CB  . ALA A 1 323 ? -55.617 -26.935 -10.077  1.00 182.93 ? 332 ALA A CB  1 
ATOM   2378  N N   . LEU A 1 324 ? -54.723 -25.006 -12.198  1.00 148.98 ? 333 LEU A N   1 
ATOM   2379  C CA  . LEU A 1 324 ? -54.567 -24.566 -13.579  1.00 144.96 ? 333 LEU A CA  1 
ATOM   2380  C C   . LEU A 1 324 ? -53.155 -24.056 -13.845  1.00 144.11 ? 333 LEU A C   1 
ATOM   2381  O O   . LEU A 1 324 ? -52.556 -24.367 -14.874  1.00 142.68 ? 333 LEU A O   1 
ATOM   2382  C CB  . LEU A 1 324 ? -55.587 -23.474 -13.906  1.00 142.00 ? 333 LEU A CB  1 
ATOM   2383  C CG  . LEU A 1 324 ? -57.055 -23.902 -13.959  1.00 142.39 ? 333 LEU A CG  1 
ATOM   2384  C CD1 . LEU A 1 324 ? -57.972 -22.706 -13.764  1.00 140.90 ? 333 LEU A CD1 1 
ATOM   2385  C CD2 . LEU A 1 324 ? -57.362 -24.613 -15.269  1.00 140.95 ? 333 LEU A CD2 1 
ATOM   2386  N N   . LYS A 1 325 ? -52.628 -23.273 -12.909  1.00 147.71 ? 334 LYS A N   1 
ATOM   2387  C CA  . LYS A 1 325 ? -51.301 -22.685 -13.054  1.00 147.38 ? 334 LYS A CA  1 
ATOM   2388  C C   . LYS A 1 325 ? -50.198 -23.734 -12.945  1.00 150.41 ? 334 LYS A C   1 
ATOM   2389  O O   . LYS A 1 325 ? -49.067 -23.503 -13.373  1.00 150.08 ? 334 LYS A O   1 
ATOM   2390  C CB  . LYS A 1 325 ? -51.088 -21.586 -12.010  1.00 148.60 ? 334 LYS A CB  1 
ATOM   2391  N N   . GLN A 1 326 ? -50.531 -24.886 -12.370  1.00 165.75 ? 335 GLN A N   1 
ATOM   2392  C CA  . GLN A 1 326 ? -49.560 -25.962 -12.198  1.00 169.37 ? 335 GLN A CA  1 
ATOM   2393  C C   . GLN A 1 326 ? -49.565 -26.912 -13.392  1.00 168.30 ? 335 GLN A C   1 
ATOM   2394  O O   . GLN A 1 326 ? -48.652 -27.722 -13.558  1.00 170.77 ? 335 GLN A O   1 
ATOM   2395  C CB  . GLN A 1 326 ? -49.839 -26.736 -10.908  1.00 174.22 ? 335 GLN A CB  1 
ATOM   2396  N N   . VAL A 1 327 ? -50.598 -26.804 -14.221  1.00 159.13 ? 336 VAL A N   1 
ATOM   2397  C CA  . VAL A 1 327 ? -50.739 -27.661 -15.393  1.00 158.26 ? 336 VAL A CA  1 
ATOM   2398  C C   . VAL A 1 327 ? -49.562 -27.498 -16.350  1.00 156.87 ? 336 VAL A C   1 
ATOM   2399  O O   . VAL A 1 327 ? -49.027 -26.401 -16.509  1.00 154.59 ? 336 VAL A O   1 
ATOM   2400  C CB  . VAL A 1 327 ? -52.049 -27.364 -16.152  1.00 154.98 ? 336 VAL A CB  1 
ATOM   2401  C CG1 . VAL A 1 327 ? -52.135 -28.196 -17.423  1.00 154.36 ? 336 VAL A CG1 1 
ATOM   2402  C CG2 . VAL A 1 327 ? -53.249 -27.626 -15.258  1.00 156.72 ? 336 VAL A CG2 1 
ATOM   2403  N N   . GLN A 1 328 ? -49.161 -28.598 -16.979  1.00 174.41 ? 337 GLN A N   1 
ATOM   2404  C CA  . GLN A 1 328 ? -48.092 -28.568 -17.970  1.00 173.45 ? 337 GLN A CA  1 
ATOM   2405  C C   . GLN A 1 328 ? -48.207 -29.736 -18.946  1.00 174.47 ? 337 GLN A C   1 
ATOM   2406  O O   . GLN A 1 328 ? -47.691 -30.825 -18.694  1.00 178.52 ? 337 GLN A O   1 
ATOM   2407  C CB  . GLN A 1 328 ? -46.721 -28.576 -17.292  1.00 176.51 ? 337 GLN A CB  1 
ATOM   2408  C CG  . GLN A 1 328 ? -45.559 -28.432 -18.259  1.00 175.69 ? 337 GLN A CG  1 
ATOM   2409  C CD  . GLN A 1 328 ? -44.226 -28.304 -17.552  1.00 178.90 ? 337 GLN A CD  1 
ATOM   2410  O OE1 . GLN A 1 328 ? -44.170 -28.139 -16.334  1.00 181.37 ? 337 GLN A OE1 1 
ATOM   2411  N NE2 . GLN A 1 328 ? -43.143 -28.379 -18.315  1.00 179.22 ? 337 GLN A NE2 1 
ATOM   2412  N N   . VAL A 1 329 ? -48.888 -29.498 -20.063  1.00 166.60 ? 338 VAL A N   1 
ATOM   2413  C CA  . VAL A 1 329 ? -49.078 -30.523 -21.081  1.00 167.58 ? 338 VAL A CA  1 
ATOM   2414  C C   . VAL A 1 329 ? -48.616 -30.029 -22.446  1.00 164.60 ? 338 VAL A C   1 
ATOM   2415  O O   . VAL A 1 329 ? -48.152 -28.897 -22.583  1.00 161.78 ? 338 VAL A O   1 
ATOM   2416  C CB  . VAL A 1 329 ? -50.552 -30.956 -21.176  1.00 167.53 ? 338 VAL A CB  1 
ATOM   2417  C CG1 . VAL A 1 329 ? -50.971 -31.697 -19.915  1.00 171.30 ? 338 VAL A CG1 1 
ATOM   2418  C CG2 . VAL A 1 329 ? -51.445 -29.747 -21.415  1.00 163.33 ? 338 VAL A CG2 1 
ATOM   2419  N N   . GLU A 1 330 ? -48.747 -30.884 -23.455  1.00 190.19 ? 339 GLU A N   1 
ATOM   2420  C CA  . GLU A 1 330 ? -48.350 -30.530 -24.811  1.00 187.89 ? 339 GLU A CA  1 
ATOM   2421  C C   . GLU A 1 330 ? -49.581 -30.300 -25.680  1.00 185.51 ? 339 GLU A C   1 
ATOM   2422  O O   . GLU A 1 330 ? -50.464 -31.155 -25.758  1.00 187.41 ? 339 GLU A O   1 
ATOM   2423  C CB  . GLU A 1 330 ? -47.477 -31.631 -25.415  1.00 191.19 ? 339 GLU A CB  1 
ATOM   2424  C CG  . GLU A 1 330 ? -46.628 -31.176 -26.589  1.00 189.42 ? 339 GLU A CG  1 
ATOM   2425  C CD  . GLU A 1 330 ? -45.471 -30.295 -26.162  1.00 188.46 ? 339 GLU A CD  1 
ATOM   2426  O OE1 . GLU A 1 330 ? -44.799 -29.724 -27.047  1.00 186.68 ? 339 GLU A OE1 1 
ATOM   2427  O OE2 . GLU A 1 330 ? -45.233 -30.174 -24.941  1.00 189.79 ? 339 GLU A OE2 1 
ATOM   2428  N N   . GLY A 1 331 ? -49.638 -29.142 -26.330  1.00 139.02 ? 340 GLY A N   1 
ATOM   2429  C CA  . GLY A 1 331 ? -50.779 -28.793 -27.156  1.00 136.95 ? 340 GLY A CA  1 
ATOM   2430  C C   . GLY A 1 331 ? -50.391 -28.298 -28.535  1.00 134.91 ? 340 GLY A C   1 
ATOM   2431  O O   . GLY A 1 331 ? -49.235 -28.403 -28.939  1.00 135.40 ? 340 GLY A O   1 
ATOM   2432  N N   . LEU A 1 332 ? -51.367 -27.757 -29.257  1.00 131.89 ? 341 LEU A N   1 
ATOM   2433  C CA  . LEU A 1 332 ? -51.139 -27.244 -30.603  1.00 130.17 ? 341 LEU A CA  1 
ATOM   2434  C C   . LEU A 1 332 ? -50.163 -26.071 -30.594  1.00 127.61 ? 341 LEU A C   1 
ATOM   2435  O O   . LEU A 1 332 ? -49.414 -25.867 -31.550  1.00 127.05 ? 341 LEU A O   1 
ATOM   2436  C CB  . LEU A 1 332 ? -52.461 -26.815 -31.243  1.00 128.98 ? 341 LEU A CB  1 
ATOM   2437  C CG  . LEU A 1 332 ? -53.541 -27.891 -31.383  1.00 131.71 ? 341 LEU A CG  1 
ATOM   2438  C CD1 . LEU A 1 332 ? -54.815 -27.298 -31.964  1.00 130.66 ? 341 LEU A CD1 1 
ATOM   2439  C CD2 . LEU A 1 332 ? -53.043 -29.044 -32.239  1.00 134.54 ? 341 LEU A CD2 1 
ATOM   2440  N N   . SER A 1 333 ? -50.176 -25.304 -29.508  1.00 132.32 ? 342 SER A N   1 
ATOM   2441  C CA  . SER A 1 333 ? -49.312 -24.135 -29.384  1.00 130.24 ? 342 SER A CA  1 
ATOM   2442  C C   . SER A 1 333 ? -48.030 -24.460 -28.626  1.00 131.99 ? 342 SER A C   1 
ATOM   2443  O O   . SER A 1 333 ? -47.585 -23.685 -27.778  1.00 131.38 ? 342 SER A O   1 
ATOM   2444  C CB  . SER A 1 333 ? -50.056 -22.991 -28.693  1.00 128.23 ? 342 SER A CB  1 
ATOM   2445  O OG  . SER A 1 333 ? -50.532 -23.390 -27.419  1.00 129.70 ? 342 SER A OG  1 
ATOM   2446  N N   . GLY A 1 334 ? -47.441 -25.610 -28.935  1.00 133.16 ? 343 GLY A N   1 
ATOM   2447  C CA  . GLY A 1 334 ? -46.194 -26.022 -28.317  1.00 135.49 ? 343 GLY A CA  1 
ATOM   2448  C C   . GLY A 1 334 ? -46.340 -26.363 -26.847  1.00 137.46 ? 343 GLY A C   1 
ATOM   2449  O O   . GLY A 1 334 ? -47.444 -26.617 -26.366  1.00 137.60 ? 343 GLY A O   1 
ATOM   2450  N N   . ASN A 1 335 ? -45.219 -26.369 -26.133  1.00 146.52 ? 344 ASN A N   1 
ATOM   2451  C CA  . ASN A 1 335 ? -45.218 -26.687 -24.710  1.00 148.99 ? 344 ASN A CA  1 
ATOM   2452  C C   . ASN A 1 335 ? -45.963 -25.642 -23.888  1.00 146.89 ? 344 ASN A C   1 
ATOM   2453  O O   . ASN A 1 335 ? -45.644 -24.454 -23.939  1.00 144.66 ? 344 ASN A O   1 
ATOM   2454  C CB  . ASN A 1 335 ? -43.785 -26.836 -24.195  1.00 151.83 ? 344 ASN A CB  1 
ATOM   2455  C CG  . ASN A 1 335 ? -43.731 -27.292 -22.750  1.00 155.19 ? 344 ASN A CG  1 
ATOM   2456  O OD1 . ASN A 1 335 ? -44.684 -27.878 -22.236  1.00 156.14 ? 344 ASN A OD1 1 
ATOM   2457  N ND2 . ASN A 1 335 ? -42.612 -27.026 -22.087  1.00 157.35 ? 344 ASN A ND2 1 
ATOM   2458  N N   . ILE A 1 336 ? -46.954 -26.092 -23.126  1.00 135.53 ? 345 ILE A N   1 
ATOM   2459  C CA  . ILE A 1 336 ? -47.764 -25.189 -22.318  1.00 134.00 ? 345 ILE A CA  1 
ATOM   2460  C C   . ILE A 1 336 ? -47.340 -25.203 -20.853  1.00 136.77 ? 345 ILE A C   1 
ATOM   2461  O O   . ILE A 1 336 ? -47.424 -26.230 -20.181  1.00 140.06 ? 345 ILE A O   1 
ATOM   2462  C CB  . ILE A 1 336 ? -49.259 -25.543 -22.411  1.00 133.40 ? 345 ILE A CB  1 
ATOM   2463  C CG1 . ILE A 1 336 ? -49.707 -25.582 -23.873  1.00 131.27 ? 345 ILE A CG1 1 
ATOM   2464  C CG2 . ILE A 1 336 ? -50.090 -24.548 -21.621  1.00 131.97 ? 345 ILE A CG2 1 
ATOM   2465  C CD1 . ILE A 1 336 ? -51.167 -25.930 -24.054  1.00 131.09 ? 345 ILE A CD1 1 
ATOM   2466  N N   . LYS A 1 337 ? -46.881 -24.055 -20.366  1.00 153.82 ? 346 LYS A N   1 
ATOM   2467  C CA  . LYS A 1 337 ? -46.492 -23.909 -18.969  1.00 156.62 ? 346 LYS A CA  1 
ATOM   2468  C C   . LYS A 1 337 ? -46.874 -22.524 -18.459  1.00 154.72 ? 346 LYS A C   1 
ATOM   2469  O O   . LYS A 1 337 ? -47.013 -21.585 -19.243  1.00 151.48 ? 346 LYS A O   1 
ATOM   2470  C CB  . LYS A 1 337 ? -44.989 -24.140 -18.801  1.00 159.35 ? 346 LYS A CB  1 
ATOM   2471  N N   . PHE A 1 338 ? -47.044 -22.399 -17.147  1.00 143.72 ? 347 PHE A N   1 
ATOM   2472  C CA  . PHE A 1 338 ? -47.466 -21.135 -16.556  1.00 142.57 ? 347 PHE A CA  1 
ATOM   2473  C C   . PHE A 1 338 ? -46.617 -20.750 -15.352  1.00 145.90 ? 347 PHE A C   1 
ATOM   2474  O O   . PHE A 1 338 ? -45.940 -21.590 -14.759  1.00 149.55 ? 347 PHE A O   1 
ATOM   2475  C CB  . PHE A 1 338 ? -48.935 -21.207 -16.136  1.00 142.08 ? 347 PHE A CB  1 
ATOM   2476  C CG  . PHE A 1 338 ? -49.855 -21.659 -17.229  1.00 139.56 ? 347 PHE A CG  1 
ATOM   2477  C CD1 . PHE A 1 338 ? -50.093 -23.006 -17.437  1.00 141.11 ? 347 PHE A CD1 1 
ATOM   2478  C CD2 . PHE A 1 338 ? -50.485 -20.737 -18.046  1.00 136.11 ? 347 PHE A CD2 1 
ATOM   2479  C CE1 . PHE A 1 338 ? -50.940 -23.427 -18.441  1.00 139.29 ? 347 PHE A CE1 1 
ATOM   2480  C CE2 . PHE A 1 338 ? -51.334 -21.151 -19.052  1.00 134.30 ? 347 PHE A CE2 1 
ATOM   2481  C CZ  . PHE A 1 338 ? -51.561 -22.498 -19.250  1.00 135.90 ? 347 PHE A CZ  1 
ATOM   2482  N N   . ASP A 1 339 ? -46.659 -19.470 -15.000  1.00 145.93 ? 348 ASP A N   1 
ATOM   2483  C CA  . ASP A 1 339 ? -46.009 -18.985 -13.790  1.00 149.39 ? 348 ASP A CA  1 
ATOM   2484  C C   . ASP A 1 339 ? -47.056 -18.707 -12.715  1.00 150.59 ? 348 ASP A C   1 
ATOM   2485  O O   . ASP A 1 339 ? -48.232 -19.027 -12.889  1.00 148.99 ? 348 ASP A O   1 
ATOM   2486  C CB  . ASP A 1 339 ? -45.182 -17.729 -14.079  1.00 148.46 ? 348 ASP A CB  1 
ATOM   2487  C CG  . ASP A 1 339 ? -46.001 -16.623 -14.717  1.00 144.58 ? 348 ASP A CG  1 
ATOM   2488  O OD1 . ASP A 1 339 ? -47.229 -16.793 -14.862  1.00 142.79 ? 348 ASP A OD1 1 
ATOM   2489  O OD2 . ASP A 1 339 ? -45.413 -15.581 -15.076  1.00 143.65 ? 348 ASP A OD2 1 
ATOM   2490  N N   . GLN A 1 340 ? -46.628 -18.110 -11.608  1.00 156.31 ? 349 GLN A N   1 
ATOM   2491  C CA  . GLN A 1 340 ? -47.524 -17.850 -10.486  1.00 158.18 ? 349 GLN A CA  1 
ATOM   2492  C C   . GLN A 1 340 ? -48.655 -16.891 -10.855  1.00 154.79 ? 349 GLN A C   1 
ATOM   2493  O O   . GLN A 1 340 ? -49.693 -16.860 -10.193  1.00 155.57 ? 349 GLN A O   1 
ATOM   2494  C CB  . GLN A 1 340 ? -46.740 -17.304 -9.290   1.00 162.58 ? 349 GLN A CB  1 
ATOM   2495  N N   . ASN A 1 341 ? -48.451 -16.113 -11.913  1.00 174.42 ? 350 ASN A N   1 
ATOM   2496  C CA  . ASN A 1 341 ? -49.435 -15.119 -12.329  1.00 171.56 ? 350 ASN A CA  1 
ATOM   2497  C C   . ASN A 1 341 ? -50.457 -15.660 -13.325  1.00 168.29 ? 350 ASN A C   1 
ATOM   2498  O O   . ASN A 1 341 ? -51.659 -15.441 -13.173  1.00 167.64 ? 350 ASN A O   1 
ATOM   2499  C CB  . ASN A 1 341 ? -48.738 -13.885 -12.904  1.00 170.10 ? 350 ASN A CB  1 
ATOM   2500  C CG  . ASN A 1 341 ? -47.881 -13.174 -11.878  1.00 173.70 ? 350 ASN A CG  1 
ATOM   2501  O OD1 . ASN A 1 341 ? -48.027 -13.388 -10.674  1.00 177.19 ? 350 ASN A OD1 1 
ATOM   2502  N ND2 . ASN A 1 341 ? -46.979 -12.321 -12.349  1.00 173.23 ? 350 ASN A ND2 1 
ATOM   2503  N N   . GLY A 1 342 ? -49.974 -16.364 -14.343  1.00 138.39 ? 351 GLY A N   1 
ATOM   2504  C CA  . GLY A 1 342 ? -50.846 -16.926 -15.357  1.00 135.72 ? 351 GLY A CA  1 
ATOM   2505  C C   . GLY A 1 342 ? -50.287 -16.766 -16.756  1.00 132.85 ? 351 GLY A C   1 
ATOM   2506  O O   . GLY A 1 342 ? -50.789 -17.365 -17.708  1.00 131.05 ? 351 GLY A O   1 
ATOM   2507  N N   . LYS A 1 343 ? -49.246 -15.949 -16.884  1.00 140.40 ? 352 LYS A N   1 
ATOM   2508  C CA  . LYS A 1 343 ? -48.588 -15.746 -18.168  1.00 138.06 ? 352 LYS A CA  1 
ATOM   2509  C C   . LYS A 1 343 ? -47.801 -16.992 -18.559  1.00 138.98 ? 352 LYS A C   1 
ATOM   2510  O O   . LYS A 1 343 ? -47.097 -17.576 -17.735  1.00 141.99 ? 352 LYS A O   1 
ATOM   2511  C CB  . LYS A 1 343 ? -47.662 -14.529 -18.112  1.00 138.24 ? 352 LYS A CB  1 
ATOM   2512  N N   . ARG A 1 344 ? -47.928 -17.398 -19.818  1.00 125.94 ? 353 ARG A N   1 
ATOM   2513  C CA  . ARG A 1 344 ? -47.249 -18.594 -20.303  1.00 126.94 ? 353 ARG A CA  1 
ATOM   2514  C C   . ARG A 1 344 ? -45.734 -18.426 -20.315  1.00 128.34 ? 353 ARG A C   1 
ATOM   2515  O O   . ARG A 1 344 ? -45.220 -17.336 -20.566  1.00 127.29 ? 353 ARG A O   1 
ATOM   2516  C CB  . ARG A 1 344 ? -47.748 -18.974 -21.699  1.00 124.51 ? 353 ARG A CB  1 
ATOM   2517  C CG  . ARG A 1 344 ? -49.160 -19.529 -21.720  1.00 124.09 ? 353 ARG A CG  1 
ATOM   2518  C CD  . ARG A 1 344 ? -49.486 -20.142 -23.068  1.00 122.71 ? 353 ARG A CD  1 
ATOM   2519  N NE  . ARG A 1 344 ? -48.552 -21.203 -23.425  1.00 124.36 ? 353 ARG A NE  1 
ATOM   2520  C CZ  . ARG A 1 344 ? -48.611 -21.898 -24.556  1.00 123.96 ? 353 ARG A CZ  1 
ATOM   2521  N NH1 . ARG A 1 344 ? -49.562 -21.643 -25.444  1.00 122.00 ? 353 ARG A NH1 1 
ATOM   2522  N NH2 . ARG A 1 344 ? -47.719 -22.847 -24.802  1.00 125.91 ? 353 ARG A NH2 1 
ATOM   2523  N N   . ILE A 1 345 ? -45.028 -19.516 -20.037  1.00 160.07 ? 354 ILE A N   1 
ATOM   2524  C CA  . ILE A 1 345 ? -43.571 -19.510 -20.027  1.00 162.08 ? 354 ILE A CA  1 
ATOM   2525  C C   . ILE A 1 345 ? -43.023 -20.748 -20.727  1.00 163.27 ? 354 ILE A C   1 
ATOM   2526  O O   . ILE A 1 345 ? -43.766 -21.684 -21.023  1.00 163.08 ? 354 ILE A O   1 
ATOM   2527  C CB  . ILE A 1 345 ? -43.016 -19.454 -18.592  1.00 165.91 ? 354 ILE A CB  1 
ATOM   2528  C CG1 . ILE A 1 345 ? -43.557 -20.624 -17.766  1.00 168.54 ? 354 ILE A CG1 1 
ATOM   2529  C CG2 . ILE A 1 345 ? -43.367 -18.128 -17.935  1.00 165.24 ? 354 ILE A CG2 1 
ATOM   2530  C CD1 . ILE A 1 345 ? -43.087 -20.626 -16.327  1.00 172.77 ? 354 ILE A CD1 1 
ATOM   2531  N N   . ASN A 1 346 ? -41.720 -20.745 -20.987  1.00 161.27 ? 355 ASN A N   1 
ATOM   2532  C CA  . ASN A 1 346 ? -41.063 -21.855 -21.667  1.00 162.88 ? 355 ASN A CA  1 
ATOM   2533  C C   . ASN A 1 346 ? -41.790 -22.245 -22.951  1.00 160.00 ? 355 ASN A C   1 
ATOM   2534  O O   . ASN A 1 346 ? -42.008 -23.425 -23.220  1.00 161.38 ? 355 ASN A O   1 
ATOM   2535  C CB  . ASN A 1 346 ? -40.942 -23.062 -20.733  1.00 167.08 ? 355 ASN A CB  1 
ATOM   2536  C CG  . ASN A 1 346 ? -39.935 -24.084 -21.225  1.00 169.98 ? 355 ASN A CG  1 
ATOM   2537  O OD1 . ASN A 1 346 ? -39.247 -23.865 -22.222  1.00 168.95 ? 355 ASN A OD1 1 
ATOM   2538  N ND2 . ASN A 1 346 ? -39.841 -25.210 -20.523  1.00 173.96 ? 355 ASN A ND2 1 
ATOM   2539  N N   . TYR A 1 347 ? -42.165 -21.243 -23.739  1.00 137.68 ? 356 TYR A N   1 
ATOM   2540  C CA  . TYR A 1 347 ? -42.870 -21.477 -24.994  1.00 135.15 ? 356 TYR A CA  1 
ATOM   2541  C C   . TYR A 1 347 ? -41.970 -21.198 -26.192  1.00 134.31 ? 356 TYR A C   1 
ATOM   2542  O O   . TYR A 1 347 ? -40.843 -20.728 -26.037  1.00 135.45 ? 356 TYR A O   1 
ATOM   2543  C CB  . TYR A 1 347 ? -44.135 -20.618 -25.070  1.00 132.06 ? 356 TYR A CB  1 
ATOM   2544  C CG  . TYR A 1 347 ? -43.884 -19.136 -24.906  1.00 130.48 ? 356 TYR A CG  1 
ATOM   2545  C CD1 . TYR A 1 347 ? -43.649 -18.325 -26.009  1.00 128.24 ? 356 TYR A CD1 1 
ATOM   2546  C CD2 . TYR A 1 347 ? -43.882 -18.547 -23.649  1.00 131.60 ? 356 TYR A CD2 1 
ATOM   2547  C CE1 . TYR A 1 347 ? -43.419 -16.969 -25.864  1.00 127.17 ? 356 TYR A CE1 1 
ATOM   2548  C CE2 . TYR A 1 347 ? -43.653 -17.193 -23.494  1.00 130.61 ? 356 TYR A CE2 1 
ATOM   2549  C CZ  . TYR A 1 347 ? -43.422 -16.409 -24.605  1.00 128.39 ? 356 TYR A CZ  1 
ATOM   2550  O OH  . TYR A 1 347 ? -43.194 -15.061 -24.456  1.00 127.76 ? 356 TYR A OH  1 
ATOM   2551  N N   . THR A 1 348 ? -42.475 -21.488 -27.387  1.00 137.97 ? 357 THR A N   1 
ATOM   2552  C CA  . THR A 1 348 ? -41.700 -21.303 -28.608  1.00 137.37 ? 357 THR A CA  1 
ATOM   2553  C C   . THR A 1 348 ? -42.532 -20.665 -29.714  1.00 134.22 ? 357 THR A C   1 
ATOM   2554  O O   . THR A 1 348 ? -43.618 -21.143 -30.044  1.00 133.52 ? 357 THR A O   1 
ATOM   2555  C CB  . THR A 1 348 ? -41.132 -22.639 -29.119  1.00 140.04 ? 357 THR A CB  1 
ATOM   2556  O OG1 . THR A 1 348 ? -40.194 -23.157 -28.167  1.00 143.45 ? 357 THR A OG1 1 
ATOM   2557  C CG2 . THR A 1 348 ? -40.434 -22.444 -30.456  1.00 139.46 ? 357 THR A CG2 1 
ATOM   2558  N N   . ILE A 1 349 ? -42.014 -19.583 -30.284  1.00 132.42 ? 358 ILE A N   1 
ATOM   2559  C CA  . ILE A 1 349 ? -42.683 -18.900 -31.384  1.00 129.88 ? 358 ILE A CA  1 
ATOM   2560  C C   . ILE A 1 349 ? -41.822 -18.938 -32.640  1.00 130.13 ? 358 ILE A C   1 
ATOM   2561  O O   . ILE A 1 349 ? -40.750 -18.338 -32.686  1.00 130.56 ? 358 ILE A O   1 
ATOM   2562  C CB  . ILE A 1 349 ? -42.993 -17.435 -31.032  1.00 127.94 ? 358 ILE A CB  1 
ATOM   2563  C CG1 . ILE A 1 349 ? -43.760 -17.354 -29.711  1.00 128.09 ? 358 ILE A CG1 1 
ATOM   2564  C CG2 . ILE A 1 349 ? -43.779 -16.774 -32.156  1.00 125.76 ? 358 ILE A CG2 1 
ATOM   2565  C CD1 . ILE A 1 349 ? -44.049 -15.940 -29.258  1.00 126.76 ? 358 ILE A CD1 1 
ATOM   2566  N N   . ASN A 1 350 ? -42.297 -19.647 -33.658  1.00 119.54 ? 359 ASN A N   1 
ATOM   2567  C CA  . ASN A 1 350 ? -41.556 -19.783 -34.907  1.00 120.13 ? 359 ASN A CA  1 
ATOM   2568  C C   . ASN A 1 350 ? -41.573 -18.508 -35.742  1.00 118.07 ? 359 ASN A C   1 
ATOM   2569  O O   . ASN A 1 350 ? -42.633 -17.938 -35.998  1.00 116.29 ? 359 ASN A O   1 
ATOM   2570  C CB  . ASN A 1 350 ? -42.103 -20.950 -35.731  1.00 121.31 ? 359 ASN A CB  1 
ATOM   2571  C CG  . ASN A 1 350 ? -41.873 -22.293 -35.067  1.00 124.06 ? 359 ASN A CG  1 
ATOM   2572  O OD1 . ASN A 1 350 ? -41.680 -22.375 -33.854  1.00 124.77 ? 359 ASN A OD1 1 
ATOM   2573  N ND2 . ASN A 1 350 ? -41.891 -23.357 -35.863  1.00 126.02 ? 359 ASN A ND2 1 
ATOM   2574  N N   . ILE A 1 351 ? -40.393 -18.065 -36.162  1.00 122.42 ? 360 ILE A N   1 
ATOM   2575  C CA  . ILE A 1 351 ? -40.281 -16.906 -37.038  1.00 120.98 ? 360 ILE A CA  1 
ATOM   2576  C C   . ILE A 1 351 ? -40.462 -17.335 -38.489  1.00 121.34 ? 360 ILE A C   1 
ATOM   2577  O O   . ILE A 1 351 ? -39.787 -18.248 -38.963  1.00 123.33 ? 360 ILE A O   1 
ATOM   2578  C CB  . ILE A 1 351 ? -38.926 -16.192 -36.876  1.00 121.81 ? 360 ILE A CB  1 
ATOM   2579  C CG1 . ILE A 1 351 ? -38.899 -15.379 -35.580  1.00 121.33 ? 360 ILE A CG1 1 
ATOM   2580  C CG2 . ILE A 1 351 ? -38.666 -15.278 -38.058  1.00 121.06 ? 360 ILE A CG2 1 
ATOM   2581  C CD1 . ILE A 1 351 ? -38.835 -16.216 -34.324  1.00 122.79 ? 360 ILE A CD1 1 
ATOM   2582  N N   . MET A 1 352 ? -41.374 -16.672 -39.192  1.00 132.56 ? 361 MET A N   1 
ATOM   2583  C CA  . MET A 1 352 ? -41.722 -17.070 -40.550  1.00 133.19 ? 361 MET A CA  1 
ATOM   2584  C C   . MET A 1 352 ? -41.351 -16.013 -41.586  1.00 132.74 ? 361 MET A C   1 
ATOM   2585  O O   . MET A 1 352 ? -41.413 -14.815 -41.316  1.00 131.36 ? 361 MET A O   1 
ATOM   2586  C CB  . MET A 1 352 ? -43.218 -17.370 -40.640  1.00 132.60 ? 361 MET A CB  1 
ATOM   2587  C CG  . MET A 1 352 ? -43.711 -18.389 -39.629  1.00 133.19 ? 361 MET A CG  1 
ATOM   2588  S SD  . MET A 1 352 ? -43.174 -20.064 -40.014  1.00 136.18 ? 361 MET A SD  1 
ATOM   2589  C CE  . MET A 1 352 ? -43.987 -20.320 -41.590  1.00 137.04 ? 361 MET A CE  1 
ATOM   2590  N N   . GLU A 1 353 ? -40.964 -16.474 -42.771  1.00 122.21 ? 362 GLU A N   1 
ATOM   2591  C CA  . GLU A 1 353 ? -40.733 -15.596 -43.912  1.00 122.22 ? 362 GLU A CA  1 
ATOM   2592  C C   . GLU A 1 353 ? -41.508 -16.113 -45.118  1.00 123.34 ? 362 GLU A C   1 
ATOM   2593  O O   . GLU A 1 353 ? -41.637 -17.322 -45.308  1.00 124.93 ? 362 GLU A O   1 
ATOM   2594  C CB  . GLU A 1 353 ? -39.244 -15.509 -44.246  1.00 123.60 ? 362 GLU A CB  1 
ATOM   2595  C CG  . GLU A 1 353 ? -38.443 -14.600 -43.330  1.00 122.84 ? 362 GLU A CG  1 
ATOM   2596  C CD  . GLU A 1 353 ? -37.022 -14.386 -43.822  1.00 124.51 ? 362 GLU A CD  1 
ATOM   2597  O OE1 . GLU A 1 353 ? -36.301 -13.556 -43.225  1.00 124.35 ? 362 GLU A OE1 1 
ATOM   2598  O OE2 . GLU A 1 353 ? -36.626 -15.046 -44.807  1.00 126.29 ? 362 GLU A OE2 1 
ATOM   2599  N N   . LEU A 1 354 ? -42.029 -15.198 -45.927  1.00 117.21 ? 363 LEU A N   1 
ATOM   2600  C CA  . LEU A 1 354 ? -42.813 -15.581 -47.096  1.00 118.68 ? 363 LEU A CA  1 
ATOM   2601  C C   . LEU A 1 354 ? -41.962 -15.595 -48.360  1.00 120.67 ? 363 LEU A C   1 
ATOM   2602  O O   . LEU A 1 354 ? -41.554 -14.545 -48.856  1.00 120.45 ? 363 LEU A O   1 
ATOM   2603  C CB  . LEU A 1 354 ? -44.007 -14.643 -47.277  1.00 117.72 ? 363 LEU A CB  1 
ATOM   2604  C CG  . LEU A 1 354 ? -44.935 -14.975 -48.446  1.00 119.65 ? 363 LEU A CG  1 
ATOM   2605  C CD1 . LEU A 1 354 ? -45.469 -16.391 -48.316  1.00 120.98 ? 363 LEU A CD1 1 
ATOM   2606  C CD2 . LEU A 1 354 ? -46.075 -13.978 -48.527  1.00 119.01 ? 363 LEU A CD2 1 
ATOM   2607  N N   . LYS A 1 355 ? -41.701 -16.790 -48.879  1.00 132.16 ? 364 LYS A N   1 
ATOM   2608  C CA  . LYS A 1 355 ? -40.918 -16.938 -50.099  1.00 134.53 ? 364 LYS A CA  1 
ATOM   2609  C C   . LYS A 1 355 ? -41.827 -17.181 -51.299  1.00 136.53 ? 364 LYS A C   1 
ATOM   2610  O O   . LYS A 1 355 ? -43.047 -17.052 -51.201  1.00 135.94 ? 364 LYS A O   1 
ATOM   2611  C CB  . LYS A 1 355 ? -39.910 -18.080 -49.957  1.00 136.43 ? 364 LYS A CB  1 
ATOM   2612  N N   . THR A 1 356 ? -41.225 -17.537 -52.430  1.00 155.10 ? 365 THR A N   1 
ATOM   2613  C CA  . THR A 1 356 ? -41.979 -17.781 -53.654  1.00 157.70 ? 365 THR A CA  1 
ATOM   2614  C C   . THR A 1 356 ? -42.819 -19.050 -53.555  1.00 159.34 ? 365 THR A C   1 
ATOM   2615  O O   . THR A 1 356 ? -43.963 -19.085 -54.009  1.00 160.39 ? 365 THR A O   1 
ATOM   2616  C CB  . THR A 1 356 ? -41.049 -17.884 -54.875  1.00 160.63 ? 365 THR A CB  1 
ATOM   2617  O OG1 . THR A 1 356 ? -40.300 -16.670 -55.011  1.00 159.42 ? 365 THR A OG1 1 
ATOM   2618  C CG2 . THR A 1 356 ? -41.856 -18.120 -56.142  1.00 163.76 ? 365 THR A CG2 1 
ATOM   2619  N N   . ASN A 1 357 ? -42.248 -20.091 -52.958  1.00 166.61 ? 366 ASN A N   1 
ATOM   2620  C CA  . ASN A 1 357 ? -42.944 -21.364 -52.810  1.00 168.55 ? 366 ASN A CA  1 
ATOM   2621  C C   . ASN A 1 357 ? -43.940 -21.357 -51.653  1.00 166.14 ? 366 ASN A C   1 
ATOM   2622  O O   . ASN A 1 357 ? -44.681 -22.321 -51.453  1.00 167.63 ? 366 ASN A O   1 
ATOM   2623  C CB  . ASN A 1 357 ? -41.943 -22.509 -52.637  1.00 170.70 ? 366 ASN A CB  1 
ATOM   2624  C CG  . ASN A 1 357 ? -41.110 -22.371 -51.377  1.00 168.32 ? 366 ASN A CG  1 
ATOM   2625  O OD1 . ASN A 1 357 ? -41.026 -21.293 -50.789  1.00 165.17 ? 366 ASN A OD1 1 
ATOM   2626  N ND2 . ASN A 1 357 ? -40.488 -23.466 -50.957  1.00 170.24 ? 366 ASN A ND2 1 
ATOM   2627  N N   . GLY A 1 358 ? -43.953 -20.265 -50.895  1.00 144.46 ? 367 GLY A N   1 
ATOM   2628  C CA  . GLY A 1 358 ? -44.850 -20.133 -49.762  1.00 142.18 ? 367 GLY A CA  1 
ATOM   2629  C C   . GLY A 1 358 ? -44.109 -19.853 -48.470  1.00 139.64 ? 367 GLY A C   1 
ATOM   2630  O O   . GLY A 1 358 ? -42.886 -19.722 -48.469  1.00 139.69 ? 367 GLY A O   1 
ATOM   2631  N N   . PRO A 1 359 ? -44.851 -19.758 -47.356  1.00 132.20 ? 368 PRO A N   1 
ATOM   2632  C CA  . PRO A 1 359 ? -44.283 -19.513 -46.027  1.00 130.12 ? 368 PRO A CA  1 
ATOM   2633  C C   . PRO A 1 359 ? -43.213 -20.539 -45.672  1.00 131.73 ? 368 PRO A C   1 
ATOM   2634  O O   . PRO A 1 359 ? -43.279 -21.679 -46.134  1.00 134.33 ? 368 PRO A O   1 
ATOM   2635  C CB  . PRO A 1 359 ? -45.498 -19.671 -45.099  1.00 129.04 ? 368 PRO A CB  1 
ATOM   2636  C CG  . PRO A 1 359 ? -46.519 -20.415 -45.931  1.00 131.27 ? 368 PRO A CG  1 
ATOM   2637  C CD  . PRO A 1 359 ? -46.317 -19.852 -47.293  1.00 132.26 ? 368 PRO A CD  1 
ATOM   2638  N N   . ARG A 1 360 ? -42.241 -20.134 -44.861  1.00 127.64 ? 369 ARG A N   1 
ATOM   2639  C CA  . ARG A 1 360 ? -41.151 -21.021 -44.472  1.00 129.50 ? 369 ARG A CA  1 
ATOM   2640  C C   . ARG A 1 360 ? -40.519 -20.578 -43.157  1.00 128.12 ? 369 ARG A C   1 
ATOM   2641  O O   . ARG A 1 360 ? -40.130 -19.419 -43.004  1.00 126.41 ? 369 ARG A O   1 
ATOM   2642  C CB  . ARG A 1 360 ? -40.091 -21.078 -45.572  1.00 131.49 ? 369 ARG A CB  1 
ATOM   2643  N N   . LYS A 1 361 ? -40.419 -21.507 -42.212  1.00 125.23 ? 370 LYS A N   1 
ATOM   2644  C CA  . LYS A 1 361 ? -39.827 -21.219 -40.912  1.00 124.61 ? 370 LYS A CA  1 
ATOM   2645  C C   . LYS A 1 361 ? -38.320 -21.029 -41.034  1.00 126.03 ? 370 LYS A C   1 
ATOM   2646  O O   . LYS A 1 361 ? -37.611 -21.914 -41.514  1.00 128.80 ? 370 LYS A O   1 
ATOM   2647  C CB  . LYS A 1 361 ? -40.134 -22.344 -39.922  1.00 126.04 ? 370 LYS A CB  1 
ATOM   2648  N N   . ILE A 1 362 ? -37.836 -19.871 -40.598  1.00 124.42 ? 371 ILE A N   1 
ATOM   2649  C CA  . ILE A 1 362 ? -36.411 -19.569 -40.664  1.00 125.93 ? 371 ILE A CA  1 
ATOM   2650  C C   . ILE A 1 362 ? -35.764 -19.668 -39.288  1.00 126.92 ? 371 ILE A C   1 
ATOM   2651  O O   . ILE A 1 362 ? -34.556 -19.477 -39.145  1.00 128.67 ? 371 ILE A O   1 
ATOM   2652  C CB  . ILE A 1 362 ? -36.156 -18.162 -41.236  1.00 124.27 ? 371 ILE A CB  1 
ATOM   2653  C CG1 . ILE A 1 362 ? -36.509 -17.091 -40.204  1.00 122.07 ? 371 ILE A CG1 1 
ATOM   2654  C CG2 . ILE A 1 362 ? -36.948 -17.957 -42.519  1.00 123.35 ? 371 ILE A CG2 1 
ATOM   2655  C CD1 . ILE A 1 362 ? -36.177 -15.684 -40.651  1.00 120.94 ? 371 ILE A CD1 1 
ATOM   2656  N N   . GLY A 1 363 ? -36.574 -19.969 -38.279  1.00 140.08 ? 372 GLY A N   1 
ATOM   2657  C CA  . GLY A 1 363 ? -36.084 -20.094 -36.919  1.00 141.30 ? 372 GLY A CA  1 
ATOM   2658  C C   . GLY A 1 363 ? -37.195 -19.975 -35.895  1.00 139.57 ? 372 GLY A C   1 
ATOM   2659  O O   . GLY A 1 363 ? -38.373 -19.939 -36.248  1.00 137.63 ? 372 GLY A O   1 
ATOM   2660  N N   . TYR A 1 364 ? -36.820 -19.916 -34.622  1.00 134.78 ? 373 TYR A N   1 
ATOM   2661  C CA  . TYR A 1 364 ? -37.795 -19.794 -33.546  1.00 133.56 ? 373 TYR A CA  1 
ATOM   2662  C C   . TYR A 1 364 ? -37.339 -18.779 -32.505  1.00 133.49 ? 373 TYR A C   1 
ATOM   2663  O O   . TYR A 1 364 ? -36.224 -18.264 -32.573  1.00 134.70 ? 373 TYR A O   1 
ATOM   2664  C CB  . TYR A 1 364 ? -38.036 -21.152 -32.882  1.00 135.85 ? 373 TYR A CB  1 
ATOM   2665  C CG  . TYR A 1 364 ? -36.861 -21.660 -32.077  1.00 139.39 ? 373 TYR A CG  1 
ATOM   2666  C CD1 . TYR A 1 364 ? -36.738 -21.363 -30.726  1.00 140.28 ? 373 TYR A CD1 1 
ATOM   2667  C CD2 . TYR A 1 364 ? -35.875 -22.439 -32.667  1.00 142.27 ? 373 TYR A CD2 1 
ATOM   2668  C CE1 . TYR A 1 364 ? -35.666 -21.825 -29.987  1.00 144.03 ? 373 TYR A CE1 1 
ATOM   2669  C CE2 . TYR A 1 364 ? -34.799 -22.906 -31.935  1.00 146.00 ? 373 TYR A CE2 1 
ATOM   2670  C CZ  . TYR A 1 364 ? -34.700 -22.596 -30.596  1.00 146.91 ? 373 TYR A CZ  1 
ATOM   2671  O OH  . TYR A 1 364 ? -33.631 -23.057 -29.862  1.00 151.11 ? 373 TYR A OH  1 
ATOM   2672  N N   . TRP A 1 365 ? -38.209 -18.497 -31.541  1.00 139.77 ? 374 TRP A N   1 
ATOM   2673  C CA  . TRP A 1 365 ? -37.888 -17.553 -30.479  1.00 140.05 ? 374 TRP A CA  1 
ATOM   2674  C C   . TRP A 1 365 ? -38.242 -18.123 -29.113  1.00 141.62 ? 374 TRP A C   1 
ATOM   2675  O O   . TRP A 1 365 ? -39.401 -18.435 -28.841  1.00 140.40 ? 374 TRP A O   1 
ATOM   2676  C CB  . TRP A 1 365 ? -38.618 -16.226 -30.696  1.00 137.12 ? 374 TRP A CB  1 
ATOM   2677  C CG  . TRP A 1 365 ? -38.221 -15.161 -29.719  1.00 137.74 ? 374 TRP A CG  1 
ATOM   2678  C CD1 . TRP A 1 365 ? -37.246 -14.220 -29.884  1.00 138.45 ? 374 TRP A CD1 1 
ATOM   2679  C CD2 . TRP A 1 365 ? -38.790 -14.925 -28.425  1.00 138.10 ? 374 TRP A CD2 1 
ATOM   2680  N NE1 . TRP A 1 365 ? -37.172 -13.414 -28.774  1.00 139.35 ? 374 TRP A NE1 1 
ATOM   2681  C CE2 . TRP A 1 365 ? -38.110 -13.826 -27.864  1.00 139.15 ? 374 TRP A CE2 1 
ATOM   2682  C CE3 . TRP A 1 365 ? -39.808 -15.536 -27.686  1.00 137.92 ? 374 TRP A CE3 1 
ATOM   2683  C CZ2 . TRP A 1 365 ? -38.414 -13.325 -26.600  1.00 140.09 ? 374 TRP A CZ2 1 
ATOM   2684  C CZ3 . TRP A 1 365 ? -40.109 -15.036 -26.431  1.00 138.72 ? 374 TRP A CZ3 1 
ATOM   2685  C CH2 . TRP A 1 365 ? -39.415 -13.943 -25.901  1.00 139.82 ? 374 TRP A CH2 1 
ATOM   2686  N N   . SER A 1 366 ? -37.235 -18.258 -28.257  1.00 154.00 ? 375 SER A N   1 
ATOM   2687  C CA  . SER A 1 366 ? -37.443 -18.733 -26.897  1.00 156.10 ? 375 SER A CA  1 
ATOM   2688  C C   . SER A 1 366 ? -37.293 -17.580 -25.912  1.00 156.41 ? 375 SER A C   1 
ATOM   2689  O O   . SER A 1 366 ? -36.479 -16.682 -26.118  1.00 156.71 ? 375 SER A O   1 
ATOM   2690  C CB  . SER A 1 366 ? -36.452 -19.848 -26.560  1.00 160.23 ? 375 SER A CB  1 
ATOM   2691  O OG  . SER A 1 366 ? -36.661 -20.336 -25.247  1.00 162.65 ? 375 SER A OG  1 
ATOM   2692  N N   . GLU A 1 367 ? -38.081 -17.609 -24.843  1.00 206.07 ? 376 GLU A N   1 
ATOM   2693  C CA  . GLU A 1 367 ? -38.025 -16.562 -23.830  1.00 206.81 ? 376 GLU A CA  1 
ATOM   2694  C C   . GLU A 1 367 ? -36.670 -16.537 -23.132  1.00 210.93 ? 376 GLU A C   1 
ATOM   2695  O O   . GLU A 1 367 ? -36.339 -15.580 -22.435  1.00 212.15 ? 376 GLU A O   1 
ATOM   2696  C CB  . GLU A 1 367 ? -39.138 -16.753 -22.798  1.00 206.78 ? 376 GLU A CB  1 
ATOM   2697  C CG  . GLU A 1 367 ? -39.001 -18.015 -21.964  1.00 210.08 ? 376 GLU A CG  1 
ATOM   2698  C CD  . GLU A 1 367 ? -39.961 -18.050 -20.790  1.00 210.69 ? 376 GLU A CD  1 
ATOM   2699  O OE1 . GLU A 1 367 ? -39.788 -18.916 -19.906  1.00 214.01 ? 376 GLU A OE1 1 
ATOM   2700  O OE2 . GLU A 1 367 ? -40.883 -17.210 -20.749  1.00 208.16 ? 376 GLU A OE2 1 
ATOM   2701  N N   . VAL A 1 368 ? -35.889 -17.593 -23.325  1.00 138.79 ? 377 VAL A N   1 
ATOM   2702  C CA  . VAL A 1 368 ? -34.600 -17.725 -22.654  1.00 143.40 ? 377 VAL A CA  1 
ATOM   2703  C C   . VAL A 1 368 ? -33.431 -17.742 -23.635  1.00 144.36 ? 377 VAL A C   1 
ATOM   2704  O O   . VAL A 1 368 ? -32.287 -17.500 -23.250  1.00 147.93 ? 377 VAL A O   1 
ATOM   2705  C CB  . VAL A 1 368 ? -34.542 -19.001 -21.788  1.00 147.09 ? 377 VAL A CB  1 
ATOM   2706  C CG1 . VAL A 1 368 ? -35.585 -18.936 -20.685  1.00 146.88 ? 377 VAL A CG1 1 
ATOM   2707  C CG2 . VAL A 1 368 ? -34.748 -20.237 -22.652  1.00 146.55 ? 377 VAL A CG2 1 
ATOM   2708  N N   . ASP A 1 369 ? -33.723 -18.027 -24.900  1.00 178.90 ? 378 ASP A N   1 
ATOM   2709  C CA  . ASP A 1 369 ? -32.681 -18.126 -25.917  1.00 179.83 ? 378 ASP A CA  1 
ATOM   2710  C C   . ASP A 1 369 ? -32.833 -17.063 -27.001  1.00 176.23 ? 378 ASP A C   1 
ATOM   2711  O O   . ASP A 1 369 ? -32.069 -17.040 -27.966  1.00 176.58 ? 378 ASP A O   1 
ATOM   2712  C CB  . ASP A 1 369 ? -32.691 -19.517 -26.554  1.00 180.70 ? 378 ASP A CB  1 
ATOM   2713  C CG  . ASP A 1 369 ? -32.433 -20.622 -25.548  1.00 184.93 ? 378 ASP A CG  1 
ATOM   2714  O OD1 . ASP A 1 369 ? -31.923 -20.320 -24.450  1.00 187.91 ? 378 ASP A OD1 1 
ATOM   2715  O OD2 . ASP A 1 369 ? -32.740 -21.792 -25.858  1.00 185.63 ? 378 ASP A OD2 1 
ATOM   2716  N N   . LYS A 1 370 ? -33.817 -16.185 -26.836  1.00 146.74 ? 379 LYS A N   1 
ATOM   2717  C CA  . LYS A 1 370 ? -34.113 -15.174 -27.845  1.00 143.45 ? 379 LYS A CA  1 
ATOM   2718  C C   . LYS A 1 370 ? -34.352 -15.837 -29.199  1.00 141.63 ? 379 LYS A C   1 
ATOM   2719  O O   . LYS A 1 370 ? -34.971 -16.897 -29.275  1.00 141.35 ? 379 LYS A O   1 
ATOM   2720  C CB  . LYS A 1 370 ? -32.975 -14.155 -27.942  1.00 145.10 ? 379 LYS A CB  1 
ATOM   2721  N N   . MET A 1 371 ? -33.856 -15.215 -30.263  1.00 130.67 ? 380 MET A N   1 
ATOM   2722  C CA  . MET A 1 371 ? -34.027 -15.760 -31.606  1.00 129.32 ? 380 MET A CA  1 
ATOM   2723  C C   . MET A 1 371 ? -32.924 -16.746 -31.968  1.00 132.49 ? 380 MET A C   1 
ATOM   2724  O O   . MET A 1 371 ? -31.746 -16.492 -31.715  1.00 135.24 ? 380 MET A O   1 
ATOM   2725  C CB  . MET A 1 371 ? -34.085 -14.637 -32.643  1.00 127.08 ? 380 MET A CB  1 
ATOM   2726  C CG  . MET A 1 371 ? -34.190 -15.132 -34.075  1.00 126.14 ? 380 MET A CG  1 
ATOM   2727  S SD  . MET A 1 371 ? -34.686 -13.832 -35.217  1.00 123.26 ? 380 MET A SD  1 
ATOM   2728  C CE  . MET A 1 371 ? -36.212 -13.299 -34.451  1.00 120.59 ? 380 MET A CE  1 
ATOM   2729  N N   . VAL A 1 372 ? -33.315 -17.871 -32.559  1.00 164.96 ? 381 VAL A N   1 
ATOM   2730  C CA  . VAL A 1 372 ? -32.366 -18.892 -32.995  1.00 168.19 ? 381 VAL A CA  1 
ATOM   2731  C C   . VAL A 1 372 ? -32.748 -19.424 -34.374  1.00 167.02 ? 381 VAL A C   1 
ATOM   2732  O O   . VAL A 1 372 ? -33.819 -20.015 -34.542  1.00 165.56 ? 381 VAL A O   1 
ATOM   2733  C CB  . VAL A 1 372 ? -32.297 -20.068 -31.996  1.00 171.21 ? 381 VAL A CB  1 
ATOM   2734  C CG1 . VAL A 1 372 ? -31.400 -21.169 -32.540  1.00 174.80 ? 381 VAL A CG1 1 
ATOM   2735  C CG2 . VAL A 1 372 ? -31.797 -19.581 -30.641  1.00 173.17 ? 381 VAL A CG2 1 
ATOM   2736  N N   . LEU A 1 373 ? -31.866 -19.220 -35.351  1.00 115.50 ? 382 LEU A N   1 
ATOM   2737  C CA  . LEU A 1 373 ? -32.152 -19.589 -36.736  1.00 115.50 ? 382 LEU A CA  1 
ATOM   2738  C C   . LEU A 1 373 ? -32.099 -21.096 -36.989  1.00 115.50 ? 382 LEU A C   1 
ATOM   2739  O O   . LEU A 1 373 ? -31.251 -21.799 -36.440  1.00 115.50 ? 382 LEU A O   1 
ATOM   2740  C CB  . LEU A 1 373 ? -31.201 -18.867 -37.694  1.00 115.50 ? 382 LEU A CB  1 
ATOM   2741  C CG  . LEU A 1 373 ? -31.323 -17.347 -37.819  1.00 115.50 ? 382 LEU A CG  1 
ATOM   2742  C CD1 . LEU A 1 373 ? -30.799 -16.654 -36.568  1.00 115.50 ? 382 LEU A CD1 1 
ATOM   2743  C CD2 . LEU A 1 373 ? -30.587 -16.846 -39.051  1.00 115.50 ? 382 LEU A CD2 1 
ATOM   2744  N N   . THR A 1 374 ? -33.009 -21.580 -37.831  1.00 180.34 ? 383 THR A N   1 
ATOM   2745  C CA  . THR A 1 374 ? -33.027 -22.982 -38.235  1.00 180.34 ? 383 THR A CA  1 
ATOM   2746  C C   . THR A 1 374 ? -32.444 -23.123 -39.638  1.00 180.34 ? 383 THR A C   1 
ATOM   2747  O O   . THR A 1 374 ? -33.047 -22.687 -40.618  1.00 180.34 ? 383 THR A O   1 
ATOM   2748  C CB  . THR A 1 374 ? -34.454 -23.559 -38.203  1.00 180.34 ? 383 THR A CB  1 
ATOM   2749  O OG1 . THR A 1 374 ? -34.945 -23.553 -36.856  1.00 180.34 ? 383 THR A OG1 1 
ATOM   2750  C CG2 . THR A 1 374 ? -34.470 -24.985 -38.732  1.00 180.34 ? 383 THR A CG2 1 
ATOM   2751  N N   . GLU A 1 375 ? -31.270 -23.741 -39.725  1.00 221.93 ? 384 GLU A N   1 
ATOM   2752  C CA  . GLU A 1 375 ? -30.500 -23.771 -40.966  1.00 221.93 ? 384 GLU A CA  1 
ATOM   2753  C C   . GLU A 1 375 ? -31.051 -24.718 -42.032  1.00 221.93 ? 384 GLU A C   1 
ATOM   2754  O O   . GLU A 1 375 ? -30.942 -25.939 -41.916  1.00 221.93 ? 384 GLU A O   1 
ATOM   2755  C CB  . GLU A 1 375 ? -29.035 -24.107 -40.675  1.00 221.93 ? 384 GLU A CB  1 
ATOM   2756  N N   . ASP A 1 376 ? -31.643 -24.133 -43.069  1.00 177.63 ? 385 ASP A N   1 
ATOM   2757  C CA  . ASP A 1 376 ? -32.023 -24.863 -44.271  1.00 177.63 ? 385 ASP A CA  1 
ATOM   2758  C C   . ASP A 1 376 ? -31.474 -24.103 -45.476  1.00 177.63 ? 385 ASP A C   1 
ATOM   2759  O O   . ASP A 1 376 ? -32.226 -23.471 -46.220  1.00 177.63 ? 385 ASP A O   1 
ATOM   2760  C CB  . ASP A 1 376 ? -33.543 -25.003 -44.368  1.00 177.63 ? 385 ASP A CB  1 
ATOM   2761  N N   . ASP A 1 377 ? -30.156 -24.165 -45.651  1.00 293.50 ? 386 ASP A N   1 
ATOM   2762  C CA  . ASP A 1 377 ? -29.450 -23.371 -46.660  1.00 293.50 ? 386 ASP A CA  1 
ATOM   2763  C C   . ASP A 1 377 ? -30.188 -23.270 -47.994  1.00 293.50 ? 386 ASP A C   1 
ATOM   2764  O O   . ASP A 1 377 ? -30.845 -22.267 -48.275  1.00 293.50 ? 386 ASP A O   1 
ATOM   2765  C CB  . ASP A 1 377 ? -28.036 -23.919 -46.884  1.00 293.50 ? 386 ASP A CB  1 
ATOM   2766  N N   . THR A 1 378 ? -30.068 -24.308 -48.815  1.00 253.89 ? 387 THR A N   1 
ATOM   2767  C CA  . THR A 1 378 ? -30.701 -24.326 -50.129  1.00 253.89 ? 387 THR A CA  1 
ATOM   2768  C C   . THR A 1 378 ? -32.171 -24.727 -50.033  1.00 253.89 ? 387 THR A C   1 
ATOM   2769  O O   . THR A 1 378 ? -32.491 -25.887 -49.776  1.00 253.89 ? 387 THR A O   1 
ATOM   2770  C CB  . THR A 1 378 ? -29.975 -25.289 -51.088  1.00 253.89 ? 387 THR A CB  1 
ATOM   2771  N N   . SER A 1 379 ? -33.063 -23.763 -50.242  1.00 269.65 ? 388 SER A N   1 
ATOM   2772  C CA  . SER A 1 379 ? -34.498 -24.008 -50.117  1.00 269.65 ? 388 SER A CA  1 
ATOM   2773  C C   . SER A 1 379 ? -35.192 -24.041 -51.476  1.00 269.65 ? 388 SER A C   1 
ATOM   2774  O O   . SER A 1 379 ? -35.836 -25.030 -51.832  1.00 269.65 ? 388 SER A O   1 
ATOM   2775  C CB  . SER A 1 379 ? -35.144 -22.945 -49.225  1.00 269.65 ? 388 SER A CB  1 
ATOM   2776  N N   . GLY A 1 380 ? -35.062 -22.951 -52.226  1.00 194.79 ? 389 GLY A N   1 
ATOM   2777  C CA  . GLY A 1 380 ? -35.641 -22.848 -53.555  1.00 194.79 ? 389 GLY A CA  1 
ATOM   2778  C C   . GLY A 1 380 ? -34.729 -22.055 -54.470  1.00 194.79 ? 389 GLY A C   1 
ATOM   2779  O O   . GLY A 1 380 ? -35.088 -20.978 -54.949  1.00 194.79 ? 389 GLY A O   1 
ATOM   2780  N N   . LEU A 1 381 ? -33.544 -22.608 -54.710  1.00 255.16 ? 390 LEU A N   1 
ATOM   2781  C CA  . LEU A 1 381 ? -32.467 -21.923 -55.421  1.00 255.16 ? 390 LEU A CA  1 
ATOM   2782  C C   . LEU A 1 381 ? -32.882 -21.232 -56.718  1.00 255.16 ? 390 LEU A C   1 
ATOM   2783  O O   . LEU A 1 381 ? -32.925 -21.854 -57.781  1.00 255.16 ? 390 LEU A O   1 
ATOM   2784  C CB  . LEU A 1 381 ? -31.316 -22.895 -55.701  1.00 255.16 ? 390 LEU A CB  1 
ATOM   2785  N N   . GLU A 1 382 ? -33.183 -19.940 -56.616  1.00 260.34 ? 391 GLU A N   1 
ATOM   2786  C CA  . GLU A 1 382 ? -33.337 -19.079 -57.780  1.00 260.34 ? 391 GLU A CA  1 
ATOM   2787  C C   . GLU A 1 382 ? -32.203 -18.068 -57.725  1.00 260.34 ? 391 GLU A C   1 
ATOM   2788  O O   . GLU A 1 382 ? -31.785 -17.514 -58.747  1.00 260.34 ? 391 GLU A O   1 
ATOM   2789  C CB  . GLU A 1 382 ? -34.688 -18.365 -57.753  1.00 260.34 ? 391 GLU A CB  1 
ATOM   2790  N N   . GLN A 1 383 ? -31.712 -17.843 -56.509  1.00 231.26 ? 392 GLN A N   1 
ATOM   2791  C CA  . GLN A 1 383 ? -30.566 -16.971 -56.263  1.00 231.26 ? 392 GLN A CA  1 
ATOM   2792  C C   . GLN A 1 383 ? -30.850 -15.499 -56.546  1.00 231.26 ? 392 GLN A C   1 
ATOM   2793  O O   . GLN A 1 383 ? -29.931 -14.730 -56.827  1.00 231.26 ? 392 GLN A O   1 
ATOM   2794  C CB  . GLN A 1 383 ? -29.346 -17.449 -57.054  1.00 231.26 ? 392 GLN A CB  1 
ATOM   2795  N N   . LYS A 1 384 ? -32.120 -15.112 -56.465  1.00 228.74 ? 393 LYS A N   1 
ATOM   2796  C CA  . LYS A 1 384 ? -32.527 -13.729 -56.723  1.00 228.74 ? 393 LYS A CA  1 
ATOM   2797  C C   . LYS A 1 384 ? -31.796 -13.121 -57.923  1.00 228.74 ? 393 LYS A C   1 
ATOM   2798  O O   . LYS A 1 384 ? -30.737 -12.511 -57.758  1.00 228.74 ? 393 LYS A O   1 
ATOM   2799  C CB  . LYS A 1 384 ? -32.286 -12.856 -55.482  1.00 228.74 ? 393 LYS A CB  1 
ATOM   2800  N N   . THR A 1 385 ? -32.361 -13.288 -59.116  1.00 189.18 ? 394 THR A N   1 
ATOM   2801  C CA  . THR A 1 385 ? -31.799 -12.686 -60.313  1.00 189.18 ? 394 THR A CA  1 
ATOM   2802  C C   . THR A 1 385 ? -31.539 -11.206 -60.020  1.00 189.18 ? 394 THR A C   1 
ATOM   2803  O O   . THR A 1 385 ? -32.470 -10.405 -59.941  1.00 189.18 ? 394 THR A O   1 
ATOM   2804  C CB  . THR A 1 385 ? -32.739 -12.863 -61.523  1.00 189.18 ? 394 THR A CB  1 
ATOM   2805  O OG1 . THR A 1 385 ? -33.417 -11.634 -61.812  1.00 189.18 ? 394 THR A OG1 1 
ATOM   2806  C CG2 . THR A 1 385 ? -33.763 -13.969 -61.254  1.00 189.18 ? 394 THR A CG2 1 
ATOM   2807  N N   . VAL A 1 386 ? -30.268 -10.853 -59.841  1.00 187.22 ? 395 VAL A N   1 
ATOM   2808  C CA  . VAL A 1 386 ? -29.890 -9.561  -59.257  1.00 187.22 ? 395 VAL A CA  1 
ATOM   2809  C C   . VAL A 1 386 ? -30.383 -8.368  -60.068  1.00 187.22 ? 395 VAL A C   1 
ATOM   2810  O O   . VAL A 1 386 ? -30.379 -8.402  -61.301  1.00 187.22 ? 395 VAL A O   1 
ATOM   2811  C CB  . VAL A 1 386 ? -28.365 -9.477  -59.081  1.00 187.22 ? 395 VAL A CB  1 
ATOM   2812  C CG1 . VAL A 1 386 ? -27.948 -8.314  -58.173  1.00 187.22 ? 395 VAL A CG1 1 
ATOM   2813  C CG2 . VAL A 1 386 ? -27.844 -10.802 -58.547  1.00 187.22 ? 395 VAL A CG2 1 
ATOM   2814  N N   . VAL A 1 387 ? -30.797 -7.313  -59.370  1.00 135.07 ? 396 VAL A N   1 
ATOM   2815  C CA  . VAL A 1 387 ? -31.262 -6.095  -60.025  1.00 134.38 ? 396 VAL A CA  1 
ATOM   2816  C C   . VAL A 1 387 ? -30.122 -5.092  -60.151  1.00 132.42 ? 396 VAL A C   1 
ATOM   2817  O O   . VAL A 1 387 ? -29.681 -4.512  -59.160  1.00 130.78 ? 396 VAL A O   1 
ATOM   2818  C CB  . VAL A 1 387 ? -32.426 -5.446  -59.250  1.00 134.13 ? 396 VAL A CB  1 
ATOM   2819  C CG1 . VAL A 1 387 ? -32.906 -4.180  -59.955  1.00 133.84 ? 396 VAL A CG1 1 
ATOM   2820  C CG2 . VAL A 1 387 ? -33.568 -6.432  -59.089  1.00 136.19 ? 396 VAL A CG2 1 
ATOM   2821  N N   . VAL A 1 388 ? -29.648 -4.892  -61.376  1.00 151.64 ? 397 VAL A N   1 
ATOM   2822  C CA  . VAL A 1 388 ? -28.549 -3.969  -61.630  1.00 150.06 ? 397 VAL A CA  1 
ATOM   2823  C C   . VAL A 1 388 ? -29.066 -2.639  -62.160  1.00 149.63 ? 397 VAL A C   1 
ATOM   2824  O O   . VAL A 1 388 ? -29.617 -2.571  -63.259  1.00 151.12 ? 397 VAL A O   1 
ATOM   2825  C CB  . VAL A 1 388 ? -27.546 -4.552  -62.641  1.00 150.99 ? 397 VAL A CB  1 
ATOM   2826  C CG1 . VAL A 1 388 ? -26.420 -3.564  -62.904  1.00 149.48 ? 397 VAL A CG1 1 
ATOM   2827  C CG2 . VAL A 1 388 ? -26.994 -5.873  -62.136  1.00 151.83 ? 397 VAL A CG2 1 
ATOM   2828  N N   . THR A 1 389 ? -28.886 -1.582  -61.376  1.00 128.82 ? 398 THR A N   1 
ATOM   2829  C CA  . THR A 1 389 ? -29.305 -0.251  -61.794  1.00 128.58 ? 398 THR A CA  1 
ATOM   2830  C C   . THR A 1 389 ? -28.163 0.480   -62.491  1.00 127.78 ? 398 THR A C   1 
ATOM   2831  O O   . THR A 1 389 ? -27.001 0.348   -62.107  1.00 126.60 ? 398 THR A O   1 
ATOM   2832  C CB  . THR A 1 389 ? -29.802 0.589   -60.604  1.00 127.55 ? 398 THR A CB  1 
ATOM   2833  O OG1 . THR A 1 389 ? -30.270 1.859   -61.074  1.00 127.80 ? 398 THR A OG1 1 
ATOM   2834  C CG2 . THR A 1 389 ? -28.682 0.806   -59.599  1.00 125.73 ? 398 THR A CG2 1 
ATOM   2835  N N   . THR A 1 390 ? -28.502 1.246   -63.523  1.00 129.52 ? 399 THR A N   1 
ATOM   2836  C CA  . THR A 1 390 ? -27.506 1.995   -64.278  1.00 129.11 ? 399 THR A CA  1 
ATOM   2837  C C   . THR A 1 390 ? -28.145 3.187   -64.984  1.00 130.02 ? 399 THR A C   1 
ATOM   2838  O O   . THR A 1 390 ? -29.359 3.227   -65.178  1.00 131.46 ? 399 THR A O   1 
ATOM   2839  C CB  . THR A 1 390 ? -26.795 1.104   -65.315  1.00 130.26 ? 399 THR A CB  1 
ATOM   2840  O OG1 . THR A 1 390 ? -25.765 1.854   -65.970  1.00 129.88 ? 399 THR A OG1 1 
ATOM   2841  C CG2 . THR A 1 390 ? -27.787 0.594   -66.349  1.00 132.73 ? 399 THR A CG2 1 
ATOM   2842  N N   . ILE A 1 391 ? -27.319 4.156   -65.366  1.00 129.05 ? 400 ILE A N   1 
ATOM   2843  C CA  . ILE A 1 391 ? -27.805 5.358   -66.031  1.00 130.13 ? 400 ILE A CA  1 
ATOM   2844  C C   . ILE A 1 391 ? -27.453 5.349   -67.516  1.00 131.86 ? 400 ILE A C   1 
ATOM   2845  O O   . ILE A 1 391 ? -26.456 4.754   -67.923  1.00 131.65 ? 400 ILE A O   1 
ATOM   2846  C CB  . ILE A 1 391 ? -27.228 6.631   -65.382  1.00 128.63 ? 400 ILE A CB  1 
ATOM   2847  C CG1 . ILE A 1 391 ? -27.943 7.876   -65.912  1.00 130.12 ? 400 ILE A CG1 1 
ATOM   2848  C CG2 . ILE A 1 391 ? -25.729 6.723   -65.624  1.00 127.51 ? 400 ILE A CG2 1 
ATOM   2849  C CD1 . ILE A 1 391 ? -27.406 9.172   -65.352  1.00 129.07 ? 400 ILE A CD1 1 
ATOM   2850  N N   . LEU A 1 392 ? -28.283 6.006   -68.320  1.00 134.26 ? 401 LEU A N   1 
ATOM   2851  C CA  . LEU A 1 392 ? -28.036 6.113   -69.753  1.00 136.35 ? 401 LEU A CA  1 
ATOM   2852  C C   . LEU A 1 392 ? -27.023 7.213   -70.049  1.00 135.76 ? 401 LEU A C   1 
ATOM   2853  O O   . LEU A 1 392 ? -27.384 8.382   -70.183  1.00 136.48 ? 401 LEU A O   1 
ATOM   2854  C CB  . LEU A 1 392 ? -29.341 6.385   -70.505  1.00 139.19 ? 401 LEU A CB  1 
ATOM   2855  C CG  . LEU A 1 392 ? -30.343 5.232   -70.578  1.00 140.60 ? 401 LEU A CG  1 
ATOM   2856  C CD1 . LEU A 1 392 ? -31.656 5.701   -71.185  1.00 143.46 ? 401 LEU A CD1 1 
ATOM   2857  C CD2 . LEU A 1 392 ? -29.765 4.070   -71.371  1.00 141.58 ? 401 LEU A CD2 1 
ATOM   2858  N N   . GLU A 1 393 ? -25.755 6.830   -70.149  1.00 156.28 ? 402 GLU A N   1 
ATOM   2859  C CA  . GLU A 1 393 ? -24.683 7.781   -70.414  1.00 155.73 ? 402 GLU A CA  1 
ATOM   2860  C C   . GLU A 1 393 ? -23.647 7.170   -71.350  1.00 156.59 ? 402 GLU A C   1 
ATOM   2861  O O   . GLU A 1 393 ? -22.982 6.195   -71.000  1.00 155.62 ? 402 GLU A O   1 
ATOM   2862  C CB  . GLU A 1 393 ? -24.016 8.211   -69.106  1.00 152.95 ? 402 GLU A CB  1 
ATOM   2863  C CG  . GLU A 1 393 ? -23.121 9.434   -69.231  1.00 152.50 ? 402 GLU A CG  1 
ATOM   2864  C CD  . GLU A 1 393 ? -23.909 10.729  -69.297  1.00 153.54 ? 402 GLU A CD  1 
ATOM   2865  O OE1 . GLU A 1 393 ? -23.407 11.702  -69.898  1.00 154.37 ? 402 GLU A OE1 1 
ATOM   2866  O OE2 . GLU A 1 393 ? -25.030 10.773  -68.747  1.00 153.75 ? 402 GLU A OE2 1 
ATOM   2867  N N   . SER A 1 394 ? -23.516 7.745   -72.540  1.00 139.67 ? 403 SER A N   1 
ATOM   2868  C CA  . SER A 1 394 ? -22.562 7.256   -73.528  1.00 140.99 ? 403 SER A CA  1 
ATOM   2869  C C   . SER A 1 394 ? -21.128 7.546   -73.097  1.00 139.07 ? 403 SER A C   1 
ATOM   2870  O O   . SER A 1 394 ? -20.846 8.609   -72.542  1.00 137.67 ? 403 SER A O   1 
ATOM   2871  C CB  . SER A 1 394 ? -22.837 7.891   -74.892  1.00 144.08 ? 403 SER A CB  1 
ATOM   2872  O OG  . SER A 1 394 ? -24.188 7.705   -75.277  1.00 146.12 ? 403 SER A OG  1 
ATOM   2873  N N   . PRO A 1 395 ? -20.213 6.599   -73.357  1.00 138.06 ? 404 PRO A N   1 
ATOM   2874  C CA  . PRO A 1 395 ? -20.494 5.318   -74.004  1.00 140.02 ? 404 PRO A CA  1 
ATOM   2875  C C   . PRO A 1 395 ? -20.577 4.174   -72.997  1.00 138.52 ? 404 PRO A C   1 
ATOM   2876  O O   . PRO A 1 395 ? -20.237 3.039   -73.329  1.00 139.74 ? 404 PRO A O   1 
ATOM   2877  C CB  . PRO A 1 395 ? -19.262 5.138   -74.877  1.00 141.43 ? 404 PRO A CB  1 
ATOM   2878  C CG  . PRO A 1 395 ? -18.152 5.647   -73.987  1.00 138.84 ? 404 PRO A CG  1 
ATOM   2879  C CD  . PRO A 1 395 ? -18.764 6.762   -73.134  1.00 136.88 ? 404 PRO A CD  1 
ATOM   2880  N N   . TYR A 1 396 ? -21.022 4.474   -71.782  1.00 137.99 ? 405 TYR A N   1 
ATOM   2881  C CA  . TYR A 1 396 ? -21.114 3.466   -70.732  1.00 136.64 ? 405 TYR A CA  1 
ATOM   2882  C C   . TYR A 1 396 ? -22.340 2.579   -70.915  1.00 138.12 ? 405 TYR A C   1 
ATOM   2883  O O   . TYR A 1 396 ? -22.236 1.352   -70.916  1.00 138.92 ? 405 TYR A O   1 
ATOM   2884  C CB  . TYR A 1 396 ? -21.139 4.128   -69.355  1.00 133.95 ? 405 TYR A CB  1 
ATOM   2885  C CG  . TYR A 1 396 ? -19.911 4.956   -69.058  1.00 132.54 ? 405 TYR A CG  1 
ATOM   2886  C CD1 . TYR A 1 396 ? -18.810 4.397   -68.423  1.00 131.47 ? 405 TYR A CD1 1 
ATOM   2887  C CD2 . TYR A 1 396 ? -19.852 6.297   -69.414  1.00 132.56 ? 405 TYR A CD2 1 
ATOM   2888  C CE1 . TYR A 1 396 ? -17.685 5.150   -68.150  1.00 130.38 ? 405 TYR A CE1 1 
ATOM   2889  C CE2 . TYR A 1 396 ? -18.732 7.058   -69.144  1.00 131.43 ? 405 TYR A CE2 1 
ATOM   2890  C CZ  . TYR A 1 396 ? -17.652 6.480   -68.512  1.00 130.31 ? 405 TYR A CZ  1 
ATOM   2891  O OH  . TYR A 1 396 ? -16.533 7.235   -68.242  1.00 129.38 ? 405 TYR A OH  1 
ATOM   2892  N N   . VAL A 1 397 ? -23.502 3.205   -71.066  1.00 138.49 ? 406 VAL A N   1 
ATOM   2893  C CA  . VAL A 1 397 ? -24.741 2.475   -71.307  1.00 140.18 ? 406 VAL A CA  1 
ATOM   2894  C C   . VAL A 1 397 ? -25.595 3.196   -72.344  1.00 142.50 ? 406 VAL A C   1 
ATOM   2895  O O   . VAL A 1 397 ? -26.098 4.292   -72.097  1.00 142.00 ? 406 VAL A O   1 
ATOM   2896  C CB  . VAL A 1 397 ? -25.558 2.289   -70.015  1.00 138.54 ? 406 VAL A CB  1 
ATOM   2897  C CG1 . VAL A 1 397 ? -26.906 1.658   -70.328  1.00 140.55 ? 406 VAL A CG1 1 
ATOM   2898  C CG2 . VAL A 1 397 ? -24.787 1.442   -69.015  1.00 136.80 ? 406 VAL A CG2 1 
ATOM   2899  N N   . MET A 1 398 ? -25.753 2.574   -73.507  1.00 166.07 ? 407 MET A N   1 
ATOM   2900  C CA  . MET A 1 398 ? -26.506 3.173   -74.600  1.00 168.85 ? 407 MET A CA  1 
ATOM   2901  C C   . MET A 1 398 ? -27.535 2.196   -75.154  1.00 171.57 ? 407 MET A C   1 
ATOM   2902  O O   . MET A 1 398 ? -27.405 0.984   -74.990  1.00 171.77 ? 407 MET A O   1 
ATOM   2903  C CB  . MET A 1 398 ? -25.559 3.609   -75.717  1.00 170.41 ? 407 MET A CB  1 
ATOM   2904  C CG  . MET A 1 398 ? -24.413 4.491   -75.252  1.00 167.99 ? 407 MET A CG  1 
ATOM   2905  S SD  . MET A 1 398 ? -23.141 4.684   -76.515  1.00 169.94 ? 407 MET A SD  1 
ATOM   2906  C CE  . MET A 1 398 ? -22.627 2.983   -76.738  1.00 171.00 ? 407 MET A CE  1 
ATOM   2907  N N   . MET A 1 399 ? -28.557 2.731   -75.811  1.00 155.00 ? 408 MET A N   1 
ATOM   2908  C CA  . MET A 1 399 ? -29.572 1.903   -76.447  1.00 158.08 ? 408 MET A CA  1 
ATOM   2909  C C   . MET A 1 399 ? -29.046 1.341   -77.762  1.00 161.18 ? 408 MET A C   1 
ATOM   2910  O O   . MET A 1 399 ? -28.661 2.094   -78.657  1.00 162.78 ? 408 MET A O   1 
ATOM   2911  C CB  . MET A 1 399 ? -30.846 2.713   -76.697  1.00 159.91 ? 408 MET A CB  1 
ATOM   2912  C CG  . MET A 1 399 ? -31.499 3.251   -75.436  1.00 157.46 ? 408 MET A CG  1 
ATOM   2913  S SD  . MET A 1 399 ? -32.122 1.946   -74.358  1.00 156.16 ? 408 MET A SD  1 
ATOM   2914  C CE  . MET A 1 399 ? -33.387 1.218   -75.396  1.00 160.64 ? 408 MET A CE  1 
ATOM   2915  N N   . LYS A 1 400 ? -29.026 0.016   -77.872  1.00 200.38 ? 409 LYS A N   1 
ATOM   2916  C CA  . LYS A 1 400 ? -28.557 -0.642  -79.087  1.00 203.72 ? 409 LYS A CA  1 
ATOM   2917  C C   . LYS A 1 400 ? -29.349 -0.166  -80.300  1.00 207.68 ? 409 LYS A C   1 
ATOM   2918  O O   . LYS A 1 400 ? -30.466 0.334   -80.164  1.00 208.22 ? 409 LYS A O   1 
ATOM   2919  C CB  . LYS A 1 400 ? -28.662 -2.162  -78.950  1.00 204.75 ? 409 LYS A CB  1 
ATOM   2920  N N   . ALA A 1 401 ? -28.763 -0.322  -81.484  1.00 172.31 ? 410 ALA A N   1 
ATOM   2921  C CA  . ALA A 1 401 ? -29.403 0.108   -82.723  1.00 176.59 ? 410 ALA A CA  1 
ATOM   2922  C C   . ALA A 1 401 ? -30.847 -0.376  -82.804  1.00 178.90 ? 410 ALA A C   1 
ATOM   2923  O O   . ALA A 1 401 ? -31.785 0.414   -82.695  1.00 179.24 ? 410 ALA A O   1 
ATOM   2924  C CB  . ALA A 1 401 ? -28.611 -0.379  -83.926  1.00 180.03 ? 410 ALA A CB  1 
ATOM   2925  N N   . ASN A 1 402 ? -31.018 -1.680  -82.993  1.00 229.47 ? 411 ASN A N   1 
ATOM   2926  C CA  . ASN A 1 402 ? -32.347 -2.275  -83.063  1.00 231.85 ? 411 ASN A CA  1 
ATOM   2927  C C   . ASN A 1 402 ? -32.858 -2.697  -81.689  1.00 228.44 ? 411 ASN A C   1 
ATOM   2928  O O   . ASN A 1 402 ? -33.223 -3.853  -81.480  1.00 229.32 ? 411 ASN A O   1 
ATOM   2929  C CB  . ASN A 1 402 ? -32.350 -3.469  -84.022  1.00 236.16 ? 411 ASN A CB  1 
ATOM   2930  C CG  . ASN A 1 402 ? -31.267 -4.482  -83.699  1.00 234.83 ? 411 ASN A CG  1 
ATOM   2931  O OD1 . ASN A 1 402 ? -30.510 -4.318  -82.742  1.00 230.64 ? 411 ASN A OD1 1 
ATOM   2932  N ND2 . ASN A 1 402 ? -31.190 -5.539  -84.500  1.00 238.71 ? 411 ASN A ND2 1 
ATOM   2933  N N   . HIS A 1 403 ? -32.883 -1.749  -80.757  1.00 218.34 ? 412 HIS A N   1 
ATOM   2934  C CA  . HIS A 1 403 ? -33.322 -2.025  -79.393  1.00 215.08 ? 412 HIS A CA  1 
ATOM   2935  C C   . HIS A 1 403 ? -34.815 -2.329  -79.338  1.00 217.23 ? 412 HIS A C   1 
ATOM   2936  O O   . HIS A 1 403 ? -35.292 -2.973  -78.403  1.00 215.74 ? 412 HIS A O   1 
ATOM   2937  C CB  . HIS A 1 403 ? -32.995 -0.846  -78.474  1.00 211.19 ? 412 HIS A CB  1 
ATOM   2938  C CG  . HIS A 1 403 ? -33.818 0.376   -78.742  1.00 212.38 ? 412 HIS A CG  1 
ATOM   2939  N ND1 . HIS A 1 403 ? -35.043 0.592   -78.150  1.00 212.46 ? 412 HIS A ND1 1 
ATOM   2940  C CD2 . HIS A 1 403 ? -33.590 1.447   -79.539  1.00 213.85 ? 412 HIS A CD2 1 
ATOM   2941  C CE1 . HIS A 1 403 ? -35.536 1.745   -78.570  1.00 213.99 ? 412 HIS A CE1 1 
ATOM   2942  N NE2 . HIS A 1 403 ? -34.674 2.283   -79.413  1.00 214.86 ? 412 HIS A NE2 1 
ATOM   2943  N N   . ALA A 1 404 ? -35.548 -1.861  -80.343  1.00 177.73 ? 413 ALA A N   1 
ATOM   2944  C CA  . ALA A 1 404 ? -36.987 -2.085  -80.410  1.00 180.35 ? 413 ALA A CA  1 
ATOM   2945  C C   . ALA A 1 404 ? -37.300 -3.537  -80.754  1.00 182.98 ? 413 ALA A C   1 
ATOM   2946  O O   . ALA A 1 404 ? -38.375 -4.045  -80.430  1.00 184.15 ? 413 ALA A O   1 
ATOM   2947  C CB  . ALA A 1 404 ? -37.624 -1.148  -81.425  1.00 184.02 ? 413 ALA A CB  1 
ATOM   2948  N N   . ALA A 1 405 ? -36.355 -4.200  -81.413  1.00 183.94 ? 414 ALA A N   1 
ATOM   2949  C CA  . ALA A 1 405 ? -36.524 -5.596  -81.800  1.00 186.79 ? 414 ALA A CA  1 
ATOM   2950  C C   . ALA A 1 405 ? -35.854 -6.529  -80.797  1.00 183.68 ? 414 ALA A C   1 
ATOM   2951  O O   . ALA A 1 405 ? -35.772 -7.738  -81.017  1.00 185.73 ? 414 ALA A O   1 
ATOM   2952  C CB  . ALA A 1 405 ? -35.969 -5.830  -83.197  1.00 190.82 ? 414 ALA A CB  1 
ATOM   2953  N N   . LEU A 1 406 ? -35.377 -5.959  -79.695  1.00 175.89 ? 415 LEU A N   1 
ATOM   2954  C CA  . LEU A 1 406 ? -34.709 -6.736  -78.658  1.00 172.89 ? 415 LEU A CA  1 
ATOM   2955  C C   . LEU A 1 406 ? -35.386 -6.558  -77.303  1.00 169.79 ? 415 LEU A C   1 
ATOM   2956  O O   . LEU A 1 406 ? -36.229 -5.677  -77.130  1.00 169.50 ? 415 LEU A O   1 
ATOM   2957  C CB  . LEU A 1 406 ? -33.233 -6.346  -78.561  1.00 170.34 ? 415 LEU A CB  1 
ATOM   2958  C CG  . LEU A 1 406 ? -32.362 -6.689  -79.770  1.00 173.27 ? 415 LEU A CG  1 
ATOM   2959  C CD1 . LEU A 1 406 ? -30.969 -6.097  -79.616  1.00 170.59 ? 415 LEU A CD1 1 
ATOM   2960  C CD2 . LEU A 1 406 ? -32.292 -8.195  -79.969  1.00 175.84 ? 415 LEU A CD2 1 
ATOM   2961  N N   . ALA A 1 407 ? -35.010 -7.400  -76.347  1.00 171.47 ? 416 ALA A N   1 
ATOM   2962  C CA  . ALA A 1 407 ? -35.572 -7.338  -75.004  1.00 168.71 ? 416 ALA A CA  1 
ATOM   2963  C C   . ALA A 1 407 ? -34.538 -7.743  -73.961  1.00 165.44 ? 416 ALA A C   1 
ATOM   2964  O O   . ALA A 1 407 ? -33.479 -8.274  -74.296  1.00 165.75 ? 416 ALA A O   1 
ATOM   2965  C CB  . ALA A 1 407 ? -36.805 -8.223  -74.904  1.00 171.19 ? 416 ALA A CB  1 
ATOM   2966  N N   . GLY A 1 408 ? -34.850 -7.487  -72.695  1.00 157.85 ? 417 GLY A N   1 
ATOM   2967  C CA  . GLY A 1 408 ? -33.963 -7.843  -71.604  1.00 154.96 ? 417 GLY A CA  1 
ATOM   2968  C C   . GLY A 1 408 ? -32.692 -7.018  -71.587  1.00 152.50 ? 417 GLY A C   1 
ATOM   2969  O O   . GLY A 1 408 ? -32.727 -5.800  -71.763  1.00 151.43 ? 417 GLY A O   1 
ATOM   2970  N N   . ASN A 1 409 ? -31.563 -7.687  -71.375  1.00 167.00 ? 418 ASN A N   1 
ATOM   2971  C CA  . ASN A 1 409 ? -30.272 -7.013  -71.300  1.00 164.80 ? 418 ASN A CA  1 
ATOM   2972  C C   . ASN A 1 409 ? -29.654 -6.781  -72.675  1.00 166.81 ? 418 ASN A C   1 
ATOM   2973  O O   . ASN A 1 409 ? -28.719 -5.994  -72.821  1.00 165.34 ? 418 ASN A O   1 
ATOM   2974  C CB  . ASN A 1 409 ? -29.305 -7.807  -70.419  1.00 163.46 ? 418 ASN A CB  1 
ATOM   2975  C CG  . ASN A 1 409 ? -29.843 -8.036  -69.020  1.00 161.66 ? 418 ASN A CG  1 
ATOM   2976  O OD1 . ASN A 1 409 ? -30.888 -7.502  -68.648  1.00 161.09 ? 418 ASN A OD1 1 
ATOM   2977  N ND2 . ASN A 1 409 ? -29.129 -8.834  -68.235  1.00 161.05 ? 418 ASN A ND2 1 
ATOM   2978  N N   . GLU A 1 410 ? -30.183 -7.471  -73.680  1.00 169.13 ? 419 GLU A N   1 
ATOM   2979  C CA  . GLU A 1 410 ? -29.674 -7.353  -75.042  1.00 171.71 ? 419 GLU A CA  1 
ATOM   2980  C C   . GLU A 1 410 ? -29.985 -5.983  -75.636  1.00 171.57 ? 419 GLU A C   1 
ATOM   2981  O O   . GLU A 1 410 ? -29.405 -5.587  -76.647  1.00 173.10 ? 419 GLU A O   1 
ATOM   2982  C CB  . GLU A 1 410 ? -30.259 -8.455  -75.927  1.00 176.00 ? 419 GLU A CB  1 
ATOM   2983  N N   . ARG A 1 411 ? -30.902 -5.262  -75.000  1.00 188.94 ? 420 ARG A N   1 
ATOM   2984  C CA  . ARG A 1 411 ? -31.310 -3.945  -75.473  1.00 189.06 ? 420 ARG A CA  1 
ATOM   2985  C C   . ARG A 1 411 ? -30.190 -2.921  -75.334  1.00 186.55 ? 420 ARG A C   1 
ATOM   2986  O O   . ARG A 1 411 ? -30.113 -1.966  -76.106  1.00 187.50 ? 420 ARG A O   1 
ATOM   2987  C CB  . ARG A 1 411 ? -32.542 -3.461  -74.705  1.00 188.12 ? 420 ARG A CB  1 
ATOM   2988  C CG  . ARG A 1 411 ? -33.769 -4.339  -74.868  1.00 190.82 ? 420 ARG A CG  1 
ATOM   2989  C CD  . ARG A 1 411 ? -34.924 -3.824  -74.025  1.00 189.84 ? 420 ARG A CD  1 
ATOM   2990  N NE  . ARG A 1 411 ? -34.593 -3.802  -72.603  1.00 186.19 ? 420 ARG A NE  1 
ATOM   2991  C CZ  . ARG A 1 411 ? -35.408 -3.356  -71.653  1.00 184.89 ? 420 ARG A CZ  1 
ATOM   2992  N NH1 . ARG A 1 411 ? -36.608 -2.890  -71.970  1.00 186.91 ? 420 ARG A NH1 1 
ATOM   2993  N NH2 . ARG A 1 411 ? -35.023 -3.374  -70.383  1.00 181.85 ? 420 ARG A NH2 1 
ATOM   2994  N N   . TYR A 1 412 ? -29.324 -3.122  -74.347  1.00 154.69 ? 421 TYR A N   1 
ATOM   2995  C CA  . TYR A 1 412 ? -28.296 -2.138  -74.027  1.00 152.09 ? 421 TYR A CA  1 
ATOM   2996  C C   . TYR A 1 412 ? -26.895 -2.580  -74.445  1.00 152.32 ? 421 TYR A C   1 
ATOM   2997  O O   . TYR A 1 412 ? -26.620 -3.772  -74.586  1.00 153.75 ? 421 TYR A O   1 
ATOM   2998  C CB  . TYR A 1 412 ? -28.317 -1.817  -72.531  1.00 148.58 ? 421 TYR A CB  1 
ATOM   2999  C CG  . TYR A 1 412 ? -29.695 -1.500  -71.998  1.00 148.49 ? 421 TYR A CG  1 
ATOM   3000  C CD1 . TYR A 1 412 ? -30.204 -0.210  -72.059  1.00 148.19 ? 421 TYR A CD1 1 
ATOM   3001  C CD2 . TYR A 1 412 ? -30.486 -2.491  -71.434  1.00 148.98 ? 421 TYR A CD2 1 
ATOM   3002  C CE1 . TYR A 1 412 ? -31.462 0.085   -71.574  1.00 148.44 ? 421 TYR A CE1 1 
ATOM   3003  C CE2 . TYR A 1 412 ? -31.747 -2.206  -70.946  1.00 149.12 ? 421 TYR A CE2 1 
ATOM   3004  C CZ  . TYR A 1 412 ? -32.230 -0.916  -71.018  1.00 148.87 ? 421 TYR A CZ  1 
ATOM   3005  O OH  . TYR A 1 412 ? -33.485 -0.626  -70.533  1.00 149.32 ? 421 TYR A OH  1 
ATOM   3006  N N   . GLU A 1 413 ? -26.018 -1.601  -74.638  1.00 149.61 ? 422 GLU A N   1 
ATOM   3007  C CA  . GLU A 1 413 ? -24.627 -1.856  -74.986  1.00 149.74 ? 422 GLU A CA  1 
ATOM   3008  C C   . GLU A 1 413 ? -23.753 -0.711  -74.489  1.00 146.97 ? 422 GLU A C   1 
ATOM   3009  O O   . GLU A 1 413 ? -24.180 0.443   -74.480  1.00 146.20 ? 422 GLU A O   1 
ATOM   3010  C CB  . GLU A 1 413 ? -24.472 -2.011  -76.499  1.00 153.44 ? 422 GLU A CB  1 
ATOM   3011  C CG  . GLU A 1 413 ? -24.927 -0.798  -77.295  1.00 154.54 ? 422 GLU A CG  1 
ATOM   3012  C CD  . GLU A 1 413 ? -24.519 -0.870  -78.755  1.00 158.20 ? 422 GLU A CD  1 
ATOM   3013  O OE1 . GLU A 1 413 ? -25.080 -0.107  -79.570  1.00 160.17 ? 422 GLU A OE1 1 
ATOM   3014  O OE2 . GLU A 1 413 ? -23.638 -1.691  -79.088  1.00 159.39 ? 422 GLU A OE2 1 
ATOM   3015  N N   . GLY A 1 414 ? -22.532 -1.031  -74.074  1.00 144.71 ? 423 GLY A N   1 
ATOM   3016  C CA  . GLY A 1 414 ? -21.611 -0.016  -73.598  1.00 142.29 ? 423 GLY A CA  1 
ATOM   3017  C C   . GLY A 1 414 ? -20.565 -0.548  -72.638  1.00 140.46 ? 423 GLY A C   1 
ATOM   3018  O O   . GLY A 1 414 ? -20.513 -1.746  -72.360  1.00 141.19 ? 423 GLY A O   1 
ATOM   3019  N N   . TYR A 1 415 ? -19.729 0.352   -72.131  1.00 138.79 ? 424 TYR A N   1 
ATOM   3020  C CA  . TYR A 1 415 ? -18.655 -0.018  -71.216  1.00 137.21 ? 424 TYR A CA  1 
ATOM   3021  C C   . TYR A 1 415 ? -19.192 -0.709  -69.967  1.00 135.83 ? 424 TYR A C   1 
ATOM   3022  O O   . TYR A 1 415 ? -18.723 -1.783  -69.592  1.00 136.37 ? 424 TYR A O   1 
ATOM   3023  C CB  . TYR A 1 415 ? -17.843 1.217   -70.821  1.00 135.18 ? 424 TYR A CB  1 
ATOM   3024  C CG  . TYR A 1 415 ? -16.723 0.931   -69.845  1.00 133.70 ? 424 TYR A CG  1 
ATOM   3025  C CD1 . TYR A 1 415 ? -16.938 0.992   -68.474  1.00 131.50 ? 424 TYR A CD1 1 
ATOM   3026  C CD2 . TYR A 1 415 ? -15.451 0.605   -70.295  1.00 134.83 ? 424 TYR A CD2 1 
ATOM   3027  C CE1 . TYR A 1 415 ? -15.917 0.733   -67.578  1.00 130.49 ? 424 TYR A CE1 1 
ATOM   3028  C CE2 . TYR A 1 415 ? -14.424 0.345   -69.406  1.00 133.81 ? 424 TYR A CE2 1 
ATOM   3029  C CZ  . TYR A 1 415 ? -14.663 0.410   -68.049  1.00 131.65 ? 424 TYR A CZ  1 
ATOM   3030  O OH  . TYR A 1 415 ? -13.644 0.153   -67.161  1.00 130.96 ? 424 TYR A OH  1 
ATOM   3031  N N   . CYS A 1 416 ? -20.175 -0.087  -69.325  1.00 137.30 ? 425 CYS A N   1 
ATOM   3032  C CA  . CYS A 1 416 ? -20.757 -0.636  -68.106  1.00 136.09 ? 425 CYS A CA  1 
ATOM   3033  C C   . CYS A 1 416 ? -21.576 -1.892  -68.381  1.00 138.07 ? 425 CYS A C   1 
ATOM   3034  O O   . CYS A 1 416 ? -21.662 -2.781  -67.536  1.00 137.84 ? 425 CYS A O   1 
ATOM   3035  C CB  . CYS A 1 416 ? -21.615 0.414   -67.397  1.00 134.34 ? 425 CYS A CB  1 
ATOM   3036  S SG  . CYS A 1 416 ? -20.669 1.757   -66.641  1.00 131.89 ? 425 CYS A SG  1 
ATOM   3037  N N   . VAL A 1 417 ? -22.180 -1.959  -69.563  1.00 137.34 ? 426 VAL A N   1 
ATOM   3038  C CA  . VAL A 1 417 ? -22.954 -3.132  -69.952  1.00 139.63 ? 426 VAL A CA  1 
ATOM   3039  C C   . VAL A 1 417 ? -22.053 -4.360  -70.019  1.00 141.03 ? 426 VAL A C   1 
ATOM   3040  O O   . VAL A 1 417 ? -22.434 -5.448  -69.587  1.00 141.91 ? 426 VAL A O   1 
ATOM   3041  C CB  . VAL A 1 417 ? -23.650 -2.932  -71.310  1.00 142.16 ? 426 VAL A CB  1 
ATOM   3042  C CG1 . VAL A 1 417 ? -24.398 -4.193  -71.714  1.00 144.81 ? 426 VAL A CG1 1 
ATOM   3043  C CG2 . VAL A 1 417 ? -24.596 -1.744  -71.250  1.00 141.24 ? 426 VAL A CG2 1 
ATOM   3044  N N   . ASP A 1 418 ? -20.854 -4.175  -70.562  1.00 180.99 ? 427 ASP A N   1 
ATOM   3045  C CA  . ASP A 1 418 ? -19.869 -5.247  -70.625  1.00 182.54 ? 427 ASP A CA  1 
ATOM   3046  C C   . ASP A 1 418 ? -19.269 -5.494  -69.246  1.00 180.54 ? 427 ASP A C   1 
ATOM   3047  O O   . ASP A 1 418 ? -19.020 -6.637  -68.862  1.00 181.79 ? 427 ASP A O   1 
ATOM   3048  C CB  . ASP A 1 418 ? -18.761 -4.908  -71.625  1.00 183.83 ? 427 ASP A CB  1 
ATOM   3049  C CG  . ASP A 1 418 ? -19.242 -4.940  -73.064  1.00 186.73 ? 427 ASP A CG  1 
ATOM   3050  O OD1 . ASP A 1 418 ? -18.402 -4.795  -73.977  1.00 188.40 ? 427 ASP A OD1 1 
ATOM   3051  O OD2 . ASP A 1 418 ? -20.460 -5.112  -73.282  1.00 187.57 ? 427 ASP A OD2 1 
ATOM   3052  N N   . LEU A 1 419 ? -19.038 -4.414  -68.506  1.00 137.94 ? 428 LEU A N   1 
ATOM   3053  C CA  . LEU A 1 419 ? -18.479 -4.512  -67.164  1.00 136.13 ? 428 LEU A CA  1 
ATOM   3054  C C   . LEU A 1 419 ? -19.418 -5.285  -66.246  1.00 136.02 ? 428 LEU A C   1 
ATOM   3055  O O   . LEU A 1 419 ? -18.976 -5.963  -65.318  1.00 135.94 ? 428 LEU A O   1 
ATOM   3056  C CB  . LEU A 1 419 ? -18.209 -3.120  -66.590  1.00 133.40 ? 428 LEU A CB  1 
ATOM   3057  C CG  . LEU A 1 419 ? -17.598 -3.073  -65.189  1.00 131.64 ? 428 LEU A CG  1 
ATOM   3058  C CD1 . LEU A 1 419 ? -16.334 -3.918  -65.126  1.00 132.97 ? 428 LEU A CD1 1 
ATOM   3059  C CD2 . LEU A 1 419 ? -17.311 -1.638  -64.776  1.00 129.36 ? 428 LEU A CD2 1 
ATOM   3060  N N   . ALA A 1 420 ? -20.716 -5.179  -66.513  1.00 137.61 ? 429 ALA A N   1 
ATOM   3061  C CA  . ALA A 1 420 ? -21.718 -5.894  -65.733  1.00 137.77 ? 429 ALA A CA  1 
ATOM   3062  C C   . ALA A 1 420 ? -21.579 -7.397  -65.933  1.00 140.40 ? 429 ALA A C   1 
ATOM   3063  O O   . ALA A 1 420 ? -21.537 -8.160  -64.969  1.00 140.50 ? 429 ALA A O   1 
ATOM   3064  C CB  . ALA A 1 420 ? -23.116 -5.433  -66.115  1.00 137.88 ? 429 ALA A CB  1 
ATOM   3065  N N   . ALA A 1 421 ? -21.508 -7.814  -67.193  1.00 143.46 ? 430 ALA A N   1 
ATOM   3066  C CA  . ALA A 1 421 ? -21.370 -9.227  -67.526  1.00 146.48 ? 430 ALA A CA  1 
ATOM   3067  C C   . ALA A 1 421 ? -20.104 -9.818  -66.916  1.00 146.79 ? 430 ALA A C   1 
ATOM   3068  O O   . ALA A 1 421 ? -20.101 -10.957 -66.451  1.00 148.46 ? 430 ALA A O   1 
ATOM   3069  C CB  . ALA A 1 421 ? -21.373 -9.418  -69.035  1.00 149.20 ? 430 ALA A CB  1 
ATOM   3070  N N   . GLU A 1 422 ? -19.029 -9.037  -66.923  1.00 165.76 ? 431 GLU A N   1 
ATOM   3071  C CA  . GLU A 1 422 ? -17.760 -9.477  -66.356  1.00 166.16 ? 431 GLU A CA  1 
ATOM   3072  C C   . GLU A 1 422 ? -17.860 -9.667  -64.846  1.00 164.65 ? 431 GLU A C   1 
ATOM   3073  O O   . GLU A 1 422 ? -17.427 -10.687 -64.311  1.00 166.32 ? 431 GLU A O   1 
ATOM   3074  C CB  . GLU A 1 422 ? -16.646 -8.484  -66.693  1.00 164.98 ? 431 GLU A CB  1 
ATOM   3075  C CG  . GLU A 1 422 ? -16.250 -8.472  -68.161  1.00 167.18 ? 431 GLU A CG  1 
ATOM   3076  C CD  . GLU A 1 422 ? -15.579 -9.762  -68.595  1.00 170.75 ? 431 GLU A CD  1 
ATOM   3077  O OE1 . GLU A 1 422 ? -15.215 -10.571 -67.715  1.00 171.37 ? 431 GLU A OE1 1 
ATOM   3078  O OE2 . GLU A 1 422 ? -15.412 -9.966  -69.817  1.00 173.23 ? 431 GLU A OE2 1 
ATOM   3079  N N   . ILE A 1 423 ? -18.433 -8.679  -64.165  1.00 138.97 ? 432 ILE A N   1 
ATOM   3080  C CA  . ILE A 1 423 ? -18.620 -8.756  -62.722  1.00 137.64 ? 432 ILE A CA  1 
ATOM   3081  C C   . ILE A 1 423 ? -19.507 -9.941  -62.358  1.00 139.41 ? 432 ILE A C   1 
ATOM   3082  O O   . ILE A 1 423 ? -19.230 -10.669 -61.404  1.00 140.15 ? 432 ILE A O   1 
ATOM   3083  C CB  . ILE A 1 423 ? -19.250 -7.466  -62.164  1.00 134.68 ? 432 ILE A CB  1 
ATOM   3084  C CG1 . ILE A 1 423 ? -18.283 -6.291  -62.315  1.00 132.97 ? 432 ILE A CG1 1 
ATOM   3085  C CG2 . ILE A 1 423 ? -19.634 -7.648  -60.706  1.00 133.80 ? 432 ILE A CG2 1 
ATOM   3086  C CD1 . ILE A 1 423 ? -16.987 -6.467  -61.554  1.00 132.97 ? 432 ILE A CD1 1 
ATOM   3087  N N   . ALA A 1 424 ? -20.572 -10.130 -63.129  1.00 139.95 ? 433 ALA A N   1 
ATOM   3088  C CA  . ALA A 1 424 ? -21.520 -11.210 -62.880  1.00 141.77 ? 433 ALA A CA  1 
ATOM   3089  C C   . ALA A 1 424 ? -20.883 -12.578 -63.092  1.00 144.99 ? 433 ALA A C   1 
ATOM   3090  O O   . ALA A 1 424 ? -21.283 -13.561 -62.470  1.00 146.53 ? 433 ALA A O   1 
ATOM   3091  C CB  . ALA A 1 424 ? -22.745 -11.052 -63.765  1.00 142.32 ? 433 ALA A CB  1 
ATOM   3092  N N   . LYS A 1 425 ? -19.891 -12.636 -63.974  1.00 148.41 ? 434 LYS A N   1 
ATOM   3093  C CA  . LYS A 1 425 ? -19.215 -13.891 -64.282  1.00 151.89 ? 434 LYS A CA  1 
ATOM   3094  C C   . LYS A 1 425 ? -18.269 -14.305 -63.161  1.00 152.10 ? 434 LYS A C   1 
ATOM   3095  O O   . LYS A 1 425 ? -18.161 -15.486 -62.832  1.00 154.84 ? 434 LYS A O   1 
ATOM   3096  C CB  . LYS A 1 425 ? -18.449 -13.778 -65.603  1.00 153.47 ? 434 LYS A CB  1 
ATOM   3097  N N   . HIS A 1 426 ? -17.586 -13.326 -62.575  1.00 165.24 ? 435 HIS A N   1 
ATOM   3098  C CA  . HIS A 1 426 ? -16.625 -13.592 -61.510  1.00 165.49 ? 435 HIS A CA  1 
ATOM   3099  C C   . HIS A 1 426 ? -17.299 -13.723 -60.147  1.00 164.47 ? 435 HIS A C   1 
ATOM   3100  O O   . HIS A 1 426 ? -16.733 -14.301 -59.219  1.00 165.68 ? 435 HIS A O   1 
ATOM   3101  C CB  . HIS A 1 426 ? -15.553 -12.501 -61.470  1.00 163.46 ? 435 HIS A CB  1 
ATOM   3102  C CG  . HIS A 1 426 ? -14.618 -12.532 -62.639  1.00 165.10 ? 435 HIS A CG  1 
ATOM   3103  N ND1 . HIS A 1 426 ? -13.403 -13.181 -62.602  1.00 167.58 ? 435 HIS A ND1 1 
ATOM   3104  C CD2 . HIS A 1 426 ? -14.722 -12.000 -63.879  1.00 164.93 ? 435 HIS A CD2 1 
ATOM   3105  C CE1 . HIS A 1 426 ? -12.797 -13.045 -63.768  1.00 168.81 ? 435 HIS A CE1 1 
ATOM   3106  N NE2 . HIS A 1 426 ? -13.577 -12.332 -64.561  1.00 167.24 ? 435 HIS A NE2 1 
ATOM   3107  N N   . CYS A 1 427 ? -18.508 -13.184 -60.031  1.00 145.63 ? 436 CYS A N   1 
ATOM   3108  C CA  . CYS A 1 427 ? -19.263 -13.272 -58.786  1.00 144.81 ? 436 CYS A CA  1 
ATOM   3109  C C   . CYS A 1 427 ? -20.324 -14.366 -58.863  1.00 147.06 ? 436 CYS A C   1 
ATOM   3110  O O   . CYS A 1 427 ? -20.885 -14.773 -57.847  1.00 147.37 ? 436 CYS A O   1 
ATOM   3111  C CB  . CYS A 1 427 ? -19.908 -11.927 -58.451  1.00 141.42 ? 436 CYS A CB  1 
ATOM   3112  S SG  . CYS A 1 427 ? -18.730 -10.616 -58.055  1.00 138.84 ? 436 CYS A SG  1 
ATOM   3113  N N   . GLY A 1 428 ? -20.591 -14.835 -60.077  1.00 155.82 ? 437 GLY A N   1 
ATOM   3114  C CA  . GLY A 1 428 ? -21.540 -15.912 -60.293  1.00 158.36 ? 437 GLY A CA  1 
ATOM   3115  C C   . GLY A 1 428 ? -22.965 -15.549 -59.927  1.00 156.90 ? 437 GLY A C   1 
ATOM   3116  O O   . GLY A 1 428 ? -23.451 -15.913 -58.856  1.00 157.04 ? 437 GLY A O   1 
ATOM   3117  N N   . PHE A 1 429 ? -23.640 -14.832 -60.820  1.00 148.81 ? 438 PHE A N   1 
ATOM   3118  C CA  . PHE A 1 429 ? -25.039 -14.476 -60.613  1.00 147.82 ? 438 PHE A CA  1 
ATOM   3119  C C   . PHE A 1 429 ? -25.684 -13.942 -61.886  1.00 147.77 ? 438 PHE A C   1 
ATOM   3120  O O   . PHE A 1 429 ? -25.022 -13.324 -62.719  1.00 147.15 ? 438 PHE A O   1 
ATOM   3121  C CB  . PHE A 1 429 ? -25.180 -13.449 -59.484  1.00 144.76 ? 438 PHE A CB  1 
ATOM   3122  C CG  . PHE A 1 429 ? -24.577 -12.108 -59.801  1.00 142.12 ? 438 PHE A CG  1 
ATOM   3123  C CD1 . PHE A 1 429 ? -25.278 -11.175 -60.549  1.00 140.91 ? 438 PHE A CD1 1 
ATOM   3124  C CD2 . PHE A 1 429 ? -23.314 -11.778 -59.346  1.00 141.11 ? 438 PHE A CD2 1 
ATOM   3125  C CE1 . PHE A 1 429 ? -24.728 -9.943  -60.840  1.00 138.75 ? 438 PHE A CE1 1 
ATOM   3126  C CE2 . PHE A 1 429 ? -22.758 -10.546 -59.632  1.00 138.85 ? 438 PHE A CE2 1 
ATOM   3127  C CZ  . PHE A 1 429 ? -23.466 -9.628  -60.380  1.00 137.66 ? 438 PHE A CZ  1 
ATOM   3128  N N   . LYS A 1 430 ? -26.981 -14.188 -62.030  1.00 149.42 ? 439 LYS A N   1 
ATOM   3129  C CA  . LYS A 1 430 ? -27.748 -13.635 -63.135  1.00 149.58 ? 439 LYS A CA  1 
ATOM   3130  C C   . LYS A 1 430 ? -28.220 -12.237 -62.762  1.00 146.54 ? 439 LYS A C   1 
ATOM   3131  O O   . LYS A 1 430 ? -28.413 -11.936 -61.587  1.00 144.90 ? 439 LYS A O   1 
ATOM   3132  C CB  . LYS A 1 430 ? -28.944 -14.533 -63.458  1.00 152.26 ? 439 LYS A CB  1 
ATOM   3133  N N   . TYR A 1 431 ? -28.409 -11.384 -63.762  1.00 144.67 ? 440 TYR A N   1 
ATOM   3134  C CA  . TYR A 1 431 ? -28.803 -10.006 -63.499  1.00 142.14 ? 440 TYR A CA  1 
ATOM   3135  C C   . TYR A 1 431 ? -29.768 -9.450  -64.541  1.00 143.03 ? 440 TYR A C   1 
ATOM   3136  O O   . TYR A 1 431 ? -29.888 -9.982  -65.644  1.00 145.41 ? 440 TYR A O   1 
ATOM   3137  C CB  . TYR A 1 431 ? -27.568 -9.107  -63.396  1.00 139.92 ? 440 TYR A CB  1 
ATOM   3138  C CG  . TYR A 1 431 ? -26.762 -9.013  -64.672  1.00 140.89 ? 440 TYR A CG  1 
ATOM   3139  C CD1 . TYR A 1 431 ? -25.771 -9.942  -64.962  1.00 142.48 ? 440 TYR A CD1 1 
ATOM   3140  C CD2 . TYR A 1 431 ? -26.989 -7.992  -65.584  1.00 140.52 ? 440 TYR A CD2 1 
ATOM   3141  C CE1 . TYR A 1 431 ? -25.031 -9.857  -66.126  1.00 143.64 ? 440 TYR A CE1 1 
ATOM   3142  C CE2 . TYR A 1 431 ? -26.254 -7.899  -66.751  1.00 141.65 ? 440 TYR A CE2 1 
ATOM   3143  C CZ  . TYR A 1 431 ? -25.277 -8.834  -67.017  1.00 143.19 ? 440 TYR A CZ  1 
ATOM   3144  O OH  . TYR A 1 431 ? -24.544 -8.745  -68.178  1.00 144.58 ? 440 TYR A OH  1 
ATOM   3145  N N   . LYS A 1 432 ? -30.453 -8.374  -64.171  1.00 146.70 ? 441 LYS A N   1 
ATOM   3146  C CA  . LYS A 1 432 ? -31.377 -7.695  -65.069  1.00 147.59 ? 441 LYS A CA  1 
ATOM   3147  C C   . LYS A 1 432 ? -31.059 -6.205  -65.116  1.00 145.46 ? 441 LYS A C   1 
ATOM   3148  O O   . LYS A 1 432 ? -31.307 -5.478  -64.155  1.00 143.62 ? 441 LYS A O   1 
ATOM   3149  C CB  . LYS A 1 432 ? -32.822 -7.912  -64.616  1.00 148.57 ? 441 LYS A CB  1 
ATOM   3150  N N   . LEU A 1 433 ? -30.502 -5.757  -66.237  1.00 140.63 ? 442 LEU A N   1 
ATOM   3151  C CA  . LEU A 1 433 ? -30.143 -4.355  -66.405  1.00 138.98 ? 442 LEU A CA  1 
ATOM   3152  C C   . LEU A 1 433 ? -31.379 -3.463  -66.407  1.00 139.25 ? 442 LEU A C   1 
ATOM   3153  O O   . LEU A 1 433 ? -32.298 -3.658  -67.203  1.00 141.56 ? 442 LEU A O   1 
ATOM   3154  C CB  . LEU A 1 433 ? -29.348 -4.153  -67.696  1.00 140.03 ? 442 LEU A CB  1 
ATOM   3155  C CG  . LEU A 1 433 ? -27.969 -4.813  -67.753  1.00 139.83 ? 442 LEU A CG  1 
ATOM   3156  C CD1 . LEU A 1 433 ? -27.303 -4.549  -69.093  1.00 141.25 ? 442 LEU A CD1 1 
ATOM   3157  C CD2 . LEU A 1 433 ? -27.095 -4.322  -66.610  1.00 136.97 ? 442 LEU A CD2 1 
ATOM   3158  N N   . THR A 1 434 ? -31.395 -2.484  -65.509  1.00 140.15 ? 443 THR A N   1 
ATOM   3159  C CA  . THR A 1 434 ? -32.514 -1.555  -65.405  1.00 140.51 ? 443 THR A CA  1 
ATOM   3160  C C   . THR A 1 434 ? -32.021 -0.115  -65.340  1.00 138.97 ? 443 THR A C   1 
ATOM   3161  O O   . THR A 1 434 ? -31.045 0.186   -64.654  1.00 136.85 ? 443 THR A O   1 
ATOM   3162  C CB  . THR A 1 434 ? -33.372 -1.843  -64.161  1.00 140.12 ? 443 THR A CB  1 
ATOM   3163  O OG1 . THR A 1 434 ? -32.577 -1.669  -62.981  1.00 137.75 ? 443 THR A OG1 1 
ATOM   3164  C CG2 . THR A 1 434 ? -33.909 -3.265  -64.199  1.00 141.86 ? 443 THR A CG2 1 
ATOM   3165  N N   . ILE A 1 435 ? -32.701 0.772   -66.059  1.00 139.16 ? 444 ILE A N   1 
ATOM   3166  C CA  . ILE A 1 435 ? -32.348 2.186   -66.058  1.00 138.18 ? 444 ILE A CA  1 
ATOM   3167  C C   . ILE A 1 435 ? -33.039 2.913   -64.910  1.00 137.37 ? 444 ILE A C   1 
ATOM   3168  O O   . ILE A 1 435 ? -34.238 2.745   -64.689  1.00 138.76 ? 444 ILE A O   1 
ATOM   3169  C CB  . ILE A 1 435 ? -32.722 2.865   -67.388  1.00 140.43 ? 444 ILE A CB  1 
ATOM   3170  C CG1 . ILE A 1 435 ? -32.056 2.140   -68.559  1.00 141.64 ? 444 ILE A CG1 1 
ATOM   3171  C CG2 . ILE A 1 435 ? -32.323 4.333   -67.369  1.00 139.63 ? 444 ILE A CG2 1 
ATOM   3172  C CD1 . ILE A 1 435 ? -30.552 2.043   -68.438  1.00 139.68 ? 444 ILE A CD1 1 
ATOM   3173  N N   . VAL A 1 436 ? -32.273 3.717   -64.180  1.00 134.47 ? 445 VAL A N   1 
ATOM   3174  C CA  . VAL A 1 436 ? -32.809 4.473   -63.054  1.00 133.86 ? 445 VAL A CA  1 
ATOM   3175  C C   . VAL A 1 436 ? -33.953 5.383   -63.496  1.00 135.96 ? 445 VAL A C   1 
ATOM   3176  O O   . VAL A 1 436 ? -33.904 5.981   -64.571  1.00 137.21 ? 445 VAL A O   1 
ATOM   3177  C CB  . VAL A 1 436 ? -31.712 5.309   -62.365  1.00 131.72 ? 445 VAL A CB  1 
ATOM   3178  C CG1 . VAL A 1 436 ? -31.006 6.198   -63.377  1.00 131.88 ? 445 VAL A CG1 1 
ATOM   3179  C CG2 . VAL A 1 436 ? -32.303 6.137   -61.235  1.00 131.54 ? 445 VAL A CG2 1 
ATOM   3180  N N   . GLY A 1 437 ? -34.983 5.478   -62.661  1.00 154.81 ? 446 GLY A N   1 
ATOM   3181  C CA  . GLY A 1 437 ? -36.164 6.261   -62.978  1.00 157.19 ? 446 GLY A CA  1 
ATOM   3182  C C   . GLY A 1 437 ? -35.878 7.713   -63.312  1.00 157.55 ? 446 GLY A C   1 
ATOM   3183  O O   . GLY A 1 437 ? -35.953 8.117   -64.472  1.00 159.19 ? 446 GLY A O   1 
ATOM   3184  N N   . ASP A 1 438 ? -35.551 8.499   -62.291  1.00 142.04 ? 447 ASP A N   1 
ATOM   3185  C CA  . ASP A 1 438 ? -35.325 9.932   -62.465  1.00 142.61 ? 447 ASP A CA  1 
ATOM   3186  C C   . ASP A 1 438 ? -34.122 10.238  -63.358  1.00 141.69 ? 447 ASP A C   1 
ATOM   3187  O O   . ASP A 1 438 ? -33.947 11.370  -63.810  1.00 142.63 ? 447 ASP A O   1 
ATOM   3188  C CB  . ASP A 1 438 ? -35.175 10.625  -61.106  1.00 141.56 ? 447 ASP A CB  1 
ATOM   3189  C CG  . ASP A 1 438 ? -34.097 9.996   -60.243  1.00 138.71 ? 447 ASP A CG  1 
ATOM   3190  O OD1 . ASP A 1 438 ? -33.942 10.426  -59.080  1.00 137.96 ? 447 ASP A OD1 1 
ATOM   3191  O OD2 . ASP A 1 438 ? -33.407 9.075   -60.725  1.00 137.51 ? 447 ASP A OD2 1 
ATOM   3192  N N   . GLY A 1 439 ? -33.296 9.227   -63.608  1.00 145.07 ? 448 GLY A N   1 
ATOM   3193  C CA  . GLY A 1 439 ? -32.149 9.381   -64.484  1.00 144.41 ? 448 GLY A CA  1 
ATOM   3194  C C   . GLY A 1 439 ? -31.031 10.207  -63.880  1.00 142.50 ? 448 GLY A C   1 
ATOM   3195  O O   . GLY A 1 439 ? -30.250 10.831  -64.599  1.00 142.54 ? 448 GLY A O   1 
ATOM   3196  N N   . LYS A 1 440 ? -30.954 10.215  -62.554  1.00 132.91 ? 449 LYS A N   1 
ATOM   3197  C CA  . LYS A 1 440 ? -29.895 10.932  -61.856  1.00 131.22 ? 449 LYS A CA  1 
ATOM   3198  C C   . LYS A 1 440 ? -28.861 9.956   -61.303  1.00 129.01 ? 449 LYS A C   1 
ATOM   3199  O O   . LYS A 1 440 ? -29.083 8.745   -61.293  1.00 128.85 ? 449 LYS A O   1 
ATOM   3200  C CB  . LYS A 1 440 ? -30.476 11.783  -60.725  1.00 131.61 ? 449 LYS A CB  1 
ATOM   3201  N N   . TYR A 1 441 ? -27.730 10.485  -60.846  1.00 147.17 ? 450 TYR A N   1 
ATOM   3202  C CA  . TYR A 1 441 ? -26.663 9.649   -60.307  1.00 145.37 ? 450 TYR A CA  1 
ATOM   3203  C C   . TYR A 1 441 ? -26.880 9.337   -58.830  1.00 144.65 ? 450 TYR A C   1 
ATOM   3204  O O   . TYR A 1 441 ? -27.269 8.225   -58.475  1.00 144.61 ? 450 TYR A O   1 
ATOM   3205  C CB  . TYR A 1 441 ? -25.297 10.305  -60.521  1.00 144.40 ? 450 TYR A CB  1 
ATOM   3206  C CG  . TYR A 1 441 ? -24.810 10.239  -61.950  1.00 144.99 ? 450 TYR A CG  1 
ATOM   3207  C CD1 . TYR A 1 441 ? -24.971 11.317  -62.811  1.00 146.25 ? 450 TYR A CD1 1 
ATOM   3208  C CD2 . TYR A 1 441 ? -24.193 9.097   -62.440  1.00 144.63 ? 450 TYR A CD2 1 
ATOM   3209  C CE1 . TYR A 1 441 ? -24.527 11.259  -64.120  1.00 147.09 ? 450 TYR A CE1 1 
ATOM   3210  C CE2 . TYR A 1 441 ? -23.746 9.029   -63.747  1.00 145.49 ? 450 TYR A CE2 1 
ATOM   3211  C CZ  . TYR A 1 441 ? -23.916 10.112  -64.582  1.00 146.70 ? 450 TYR A CZ  1 
ATOM   3212  O OH  . TYR A 1 441 ? -23.474 10.049  -65.884  1.00 147.83 ? 450 TYR A OH  1 
ATOM   3213  N N   . GLY A 1 442 ? -26.626 10.320  -57.973  1.00 123.25 ? 451 GLY A N   1 
ATOM   3214  C CA  . GLY A 1 442 ? -26.789 10.133  -56.543  1.00 122.90 ? 451 GLY A CA  1 
ATOM   3215  C C   . GLY A 1 442 ? -26.535 11.389  -55.733  1.00 123.03 ? 451 GLY A C   1 
ATOM   3216  O O   . GLY A 1 442 ? -25.409 11.645  -55.304  1.00 122.04 ? 451 GLY A O   1 
ATOM   3217  N N   . ALA A 1 443 ? -27.586 12.173  -55.522  1.00 153.62 ? 452 ALA A N   1 
ATOM   3218  C CA  . ALA A 1 443 ? -27.490 13.386  -54.720  1.00 154.27 ? 452 ALA A CA  1 
ATOM   3219  C C   . ALA A 1 443 ? -28.425 13.306  -53.518  1.00 155.35 ? 452 ALA A C   1 
ATOM   3220  O O   . ALA A 1 443 ? -29.200 12.359  -53.386  1.00 155.60 ? 452 ALA A O   1 
ATOM   3221  C CB  . ALA A 1 443 ? -27.807 14.609  -55.565  1.00 155.69 ? 452 ALA A CB  1 
ATOM   3222  N N   . ARG A 1 444 ? -28.352 14.304  -52.644  1.00 156.08 ? 453 ARG A N   1 
ATOM   3223  C CA  . ARG A 1 444 ? -29.187 14.322  -51.449  1.00 157.45 ? 453 ARG A CA  1 
ATOM   3224  C C   . ARG A 1 444 ? -29.838 15.683  -51.225  1.00 159.72 ? 453 ARG A C   1 
ATOM   3225  O O   . ARG A 1 444 ? -29.178 16.636  -50.812  1.00 160.05 ? 453 ARG A O   1 
ATOM   3226  C CB  . ARG A 1 444 ? -28.371 13.924  -50.218  1.00 156.59 ? 453 ARG A CB  1 
ATOM   3227  C CG  . ARG A 1 444 ? -29.213 13.682  -48.979  1.00 158.05 ? 453 ARG A CG  1 
ATOM   3228  C CD  . ARG A 1 444 ? -28.381 13.111  -47.847  1.00 157.37 ? 453 ARG A CD  1 
ATOM   3229  N NE  . ARG A 1 444 ? -29.213 12.413  -46.873  1.00 158.55 ? 453 ARG A NE  1 
ATOM   3230  C CZ  . ARG A 1 444 ? -28.740 11.738  -45.831  1.00 158.47 ? 453 ARG A CZ  1 
ATOM   3231  N NH1 . ARG A 1 444 ? -27.432 11.668  -45.622  1.00 157.29 ? 453 ARG A NH1 1 
ATOM   3232  N NH2 . ARG A 1 444 ? -29.577 11.131  -44.998  1.00 159.82 ? 453 ARG A NH2 1 
ATOM   3233  N N   . ASP A 1 445 ? -31.135 15.764  -51.502  1.00 164.17 ? 454 ASP A N   1 
ATOM   3234  C CA  . ASP A 1 445 ? -31.892 16.989  -51.278  1.00 166.86 ? 454 ASP A CA  1 
ATOM   3235  C C   . ASP A 1 445 ? -31.778 17.408  -49.816  1.00 167.83 ? 454 ASP A C   1 
ATOM   3236  O O   . ASP A 1 445 ? -32.142 16.653  -48.917  1.00 167.90 ? 454 ASP A O   1 
ATOM   3237  C CB  . ASP A 1 445 ? -33.359 16.785  -51.662  1.00 168.87 ? 454 ASP A CB  1 
ATOM   3238  C CG  . ASP A 1 445 ? -34.150 18.080  -51.668  1.00 172.03 ? 454 ASP A CG  1 
ATOM   3239  O OD1 . ASP A 1 445 ? -33.704 19.061  -51.036  1.00 172.91 ? 454 ASP A OD1 1 
ATOM   3240  O OD2 . ASP A 1 445 ? -35.224 18.115  -52.306  1.00 173.91 ? 454 ASP A OD2 1 
ATOM   3241  N N   . ALA A 1 446 ? -31.266 18.613  -49.587  1.00 143.71 ? 455 ALA A N   1 
ATOM   3242  C CA  . ALA A 1 446 ? -31.042 19.113  -48.233  1.00 144.91 ? 455 ALA A CA  1 
ATOM   3243  C C   . ALA A 1 446 ? -32.308 19.079  -47.380  1.00 147.49 ? 455 ALA A C   1 
ATOM   3244  O O   . ALA A 1 446 ? -32.282 18.631  -46.234  1.00 147.72 ? 455 ALA A O   1 
ATOM   3245  C CB  . ALA A 1 446 ? -30.471 20.523  -48.279  1.00 146.18 ? 455 ALA A CB  1 
ATOM   3246  N N   . ASP A 1 447 ? -33.413 19.555  -47.945  1.00 195.75 ? 456 ASP A N   1 
ATOM   3247  C CA  . ASP A 1 447 ? -34.672 19.643  -47.212  1.00 198.68 ? 456 ASP A CA  1 
ATOM   3248  C C   . ASP A 1 447 ? -35.241 18.271  -46.859  1.00 197.79 ? 456 ASP A C   1 
ATOM   3249  O O   . ASP A 1 447 ? -35.256 17.877  -45.693  1.00 198.21 ? 456 ASP A O   1 
ATOM   3250  C CB  . ASP A 1 447 ? -35.699 20.452  -48.007  1.00 201.45 ? 456 ASP A CB  1 
ATOM   3251  C CG  . ASP A 1 447 ? -35.298 21.906  -48.165  1.00 203.25 ? 456 ASP A CG  1 
ATOM   3252  O OD1 . ASP A 1 447 ? -34.332 22.333  -47.498  1.00 202.67 ? 456 ASP A OD1 1 
ATOM   3253  O OD2 . ASP A 1 447 ? -35.950 22.623  -48.953  1.00 205.49 ? 456 ASP A OD2 1 
ATOM   3254  N N   . THR A 1 448 ? -35.707 17.548  -47.873  1.00 146.67 ? 457 THR A N   1 
ATOM   3255  C CA  . THR A 1 448 ? -36.344 16.252  -47.665  1.00 146.14 ? 457 THR A CA  1 
ATOM   3256  C C   . THR A 1 448 ? -35.360 15.196  -47.172  1.00 143.35 ? 457 THR A C   1 
ATOM   3257  O O   . THR A 1 448 ? -35.765 14.156  -46.652  1.00 143.22 ? 457 THR A O   1 
ATOM   3258  C CB  . THR A 1 448 ? -37.025 15.744  -48.951  1.00 145.96 ? 457 THR A CB  1 
ATOM   3259  O OG1 . THR A 1 448 ? -36.044 15.583  -49.984  1.00 143.43 ? 457 THR A OG1 1 
ATOM   3260  C CG2 . THR A 1 448 ? -38.086 16.728  -49.416  1.00 149.20 ? 457 THR A CG2 1 
ATOM   3261  N N   . LYS A 1 449 ? -34.069 15.468  -47.338  1.00 139.39 ? 458 LYS A N   1 
ATOM   3262  C CA  . LYS A 1 449 ? -33.026 14.531  -46.932  1.00 136.97 ? 458 LYS A CA  1 
ATOM   3263  C C   . LYS A 1 449 ? -33.197 13.184  -47.630  1.00 135.35 ? 458 LYS A C   1 
ATOM   3264  O O   . LYS A 1 449 ? -32.899 12.135  -47.059  1.00 134.40 ? 458 LYS A O   1 
ATOM   3265  C CB  . LYS A 1 449 ? -33.029 14.348  -45.413  1.00 138.10 ? 458 LYS A CB  1 
ATOM   3266  N N   . ILE A 1 450 ? -33.678 13.226  -48.868  1.00 137.56 ? 459 ILE A N   1 
ATOM   3267  C CA  . ILE A 1 450 ? -33.925 12.014  -49.641  1.00 136.46 ? 459 ILE A CA  1 
ATOM   3268  C C   . ILE A 1 450 ? -32.881 11.825  -50.736  1.00 134.29 ? 459 ILE A C   1 
ATOM   3269  O O   . ILE A 1 450 ? -32.515 12.775  -51.428  1.00 134.31 ? 459 ILE A O   1 
ATOM   3270  C CB  . ILE A 1 450 ? -35.323 12.039  -50.289  1.00 138.45 ? 459 ILE A CB  1 
ATOM   3271  C CG1 . ILE A 1 450 ? -36.408 12.166  -49.219  1.00 140.87 ? 459 ILE A CG1 1 
ATOM   3272  C CG2 . ILE A 1 450 ? -35.545 10.792  -51.133  1.00 137.51 ? 459 ILE A CG2 1 
ATOM   3273  C CD1 . ILE A 1 450 ? -37.812 12.249  -49.779  1.00 143.22 ? 459 ILE A CD1 1 
ATOM   3274  N N   . TRP A 1 451 ? -32.406 10.594  -50.888  1.00 129.54 ? 460 TRP A N   1 
ATOM   3275  C CA  . TRP A 1 451 ? -31.462 10.264  -51.947  1.00 127.77 ? 460 TRP A CA  1 
ATOM   3276  C C   . TRP A 1 451 ? -32.197 10.009  -53.256  1.00 128.42 ? 460 TRP A C   1 
ATOM   3277  O O   . TRP A 1 451 ? -33.283 9.429   -53.265  1.00 129.63 ? 460 TRP A O   1 
ATOM   3278  C CB  . TRP A 1 451 ? -30.634 9.036   -51.567  1.00 126.23 ? 460 TRP A CB  1 
ATOM   3279  C CG  . TRP A 1 451 ? -29.655 9.288   -50.465  1.00 125.57 ? 460 TRP A CG  1 
ATOM   3280  C CD1 . TRP A 1 451 ? -29.860 9.109   -49.128  1.00 126.37 ? 460 TRP A CD1 1 
ATOM   3281  C CD2 . TRP A 1 451 ? -28.311 9.765   -50.605  1.00 124.27 ? 460 TRP A CD2 1 
ATOM   3282  N NE1 . TRP A 1 451 ? -28.727 9.445   -48.427  1.00 125.71 ? 460 TRP A NE1 1 
ATOM   3283  C CE2 . TRP A 1 451 ? -27.763 9.852   -49.310  1.00 124.38 ? 460 TRP A CE2 1 
ATOM   3284  C CE3 . TRP A 1 451 ? -27.519 10.129  -51.699  1.00 123.23 ? 460 TRP A CE3 1 
ATOM   3285  C CZ2 . TRP A 1 451 ? -26.459 10.285  -49.080  1.00 123.47 ? 460 TRP A CZ2 1 
ATOM   3286  C CZ3 . TRP A 1 451 ? -26.226 10.559  -51.468  1.00 122.26 ? 460 TRP A CZ3 1 
ATOM   3287  C CH2 . TRP A 1 451 ? -25.709 10.634  -50.170  1.00 122.37 ? 460 TRP A CH2 1 
ATOM   3288  N N   . ASN A 1 452 ? -31.602 10.447  -54.359  1.00 129.70 ? 461 ASN A N   1 
ATOM   3289  C CA  . ASN A 1 452 ? -32.189 10.242  -55.678  1.00 130.55 ? 461 ASN A CA  1 
ATOM   3290  C C   . ASN A 1 452 ? -31.232 9.517   -56.617  1.00 129.10 ? 461 ASN A C   1 
ATOM   3291  O O   . ASN A 1 452 ? -30.052 9.352   -56.309  1.00 127.46 ? 461 ASN A O   1 
ATOM   3292  C CB  . ASN A 1 452 ? -32.622 11.576  -56.290  1.00 132.18 ? 461 ASN A CB  1 
ATOM   3293  C CG  . ASN A 1 452 ? -31.467 12.546  -56.454  1.00 131.26 ? 461 ASN A CG  1 
ATOM   3294  O OD1 . ASN A 1 452 ? -30.359 12.297  -55.981  1.00 129.42 ? 461 ASN A OD1 1 
ATOM   3295  N ND2 . ASN A 1 452 ? -31.724 13.661  -57.127  1.00 132.77 ? 461 ASN A ND2 1 
ATOM   3296  N N   . GLY A 1 453 ? -31.747 9.084   -57.762  1.00 147.55 ? 462 GLY A N   1 
ATOM   3297  C CA  . GLY A 1 453 ? -30.936 8.385   -58.740  1.00 146.69 ? 462 GLY A CA  1 
ATOM   3298  C C   . GLY A 1 453 ? -30.590 6.973   -58.312  1.00 145.71 ? 462 GLY A C   1 
ATOM   3299  O O   . GLY A 1 453 ? -31.321 6.350   -57.543  1.00 146.16 ? 462 GLY A O   1 
ATOM   3300  N N   . MET A 1 454 ? -29.468 6.469   -58.814  1.00 124.97 ? 463 MET A N   1 
ATOM   3301  C CA  . MET A 1 454 ? -29.035 5.110   -58.517  1.00 124.36 ? 463 MET A CA  1 
ATOM   3302  C C   . MET A 1 454 ? -28.720 4.932   -57.037  1.00 123.45 ? 463 MET A C   1 
ATOM   3303  O O   . MET A 1 454 ? -29.163 3.975   -56.409  1.00 123.83 ? 463 MET A O   1 
ATOM   3304  C CB  . MET A 1 454 ? -27.816 4.743   -59.364  1.00 123.69 ? 463 MET A CB  1 
ATOM   3305  C CG  . MET A 1 454 ? -28.075 4.776   -60.857  1.00 124.93 ? 463 MET A CG  1 
ATOM   3306  S SD  . MET A 1 454 ? -26.579 4.516   -61.830  1.00 124.42 ? 463 MET A SD  1 
ATOM   3307  C CE  . MET A 1 454 ? -25.564 5.872   -61.251  1.00 122.87 ? 463 MET A CE  1 
ATOM   3308  N N   . VAL A 1 455 ? -27.946 5.857   -56.484  1.00 124.51 ? 464 VAL A N   1 
ATOM   3309  C CA  . VAL A 1 455 ? -27.601 5.817   -55.070  1.00 123.95 ? 464 VAL A CA  1 
ATOM   3310  C C   . VAL A 1 455 ? -28.860 5.709   -54.220  1.00 125.07 ? 464 VAL A C   1 
ATOM   3311  O O   . VAL A 1 455 ? -28.867 5.053   -53.181  1.00 125.14 ? 464 VAL A O   1 
ATOM   3312  C CB  . VAL A 1 455 ? -26.796 7.064   -54.644  1.00 123.22 ? 464 VAL A CB  1 
ATOM   3313  C CG1 . VAL A 1 455 ? -26.590 7.076   -53.136  1.00 123.12 ? 464 VAL A CG1 1 
ATOM   3314  C CG2 . VAL A 1 455 ? -25.467 7.107   -55.367  1.00 122.19 ? 464 VAL A CG2 1 
ATOM   3315  N N   . GLY A 1 456 ? -29.929 6.354   -54.675  1.00 126.59 ? 465 GLY A N   1 
ATOM   3316  C CA  . GLY A 1 456 ? -31.204 6.294   -53.988  1.00 128.00 ? 465 GLY A CA  1 
ATOM   3317  C C   . GLY A 1 456 ? -31.826 4.913   -54.061  1.00 128.63 ? 465 GLY A C   1 
ATOM   3318  O O   . GLY A 1 456 ? -32.195 4.334   -53.040  1.00 129.09 ? 465 GLY A O   1 
ATOM   3319  N N   . GLU A 1 457 ? -31.932 4.378   -55.273  1.00 138.25 ? 466 GLU A N   1 
ATOM   3320  C CA  . GLU A 1 457 ? -32.535 3.067   -55.485  1.00 139.14 ? 466 GLU A CA  1 
ATOM   3321  C C   . GLU A 1 457 ? -31.799 1.964   -54.729  1.00 138.43 ? 466 GLU A C   1 
ATOM   3322  O O   . GLU A 1 457 ? -32.331 0.872   -54.535  1.00 139.36 ? 466 GLU A O   1 
ATOM   3323  C CB  . GLU A 1 457 ? -32.597 2.736   -56.978  1.00 139.71 ? 466 GLU A CB  1 
ATOM   3324  C CG  . GLU A 1 457 ? -33.535 3.631   -57.768  1.00 141.10 ? 466 GLU A CG  1 
ATOM   3325  C CD  . GLU A 1 457 ? -33.762 3.135   -59.182  1.00 142.23 ? 466 GLU A CD  1 
ATOM   3326  O OE1 . GLU A 1 457 ? -33.235 2.056   -59.527  1.00 141.99 ? 466 GLU A OE1 1 
ATOM   3327  O OE2 . GLU A 1 457 ? -34.469 3.822   -59.949  1.00 143.67 ? 466 GLU A OE2 1 
ATOM   3328  N N   . LEU A 1 458 ? -30.573 2.254   -54.306  1.00 136.78 ? 467 LEU A N   1 
ATOM   3329  C CA  . LEU A 1 458 ? -29.792 1.302   -53.525  1.00 136.38 ? 467 LEU A CA  1 
ATOM   3330  C C   . LEU A 1 458 ? -30.169 1.359   -52.049  1.00 136.86 ? 467 LEU A C   1 
ATOM   3331  O O   . LEU A 1 458 ? -30.352 0.327   -51.403  1.00 137.63 ? 467 LEU A O   1 
ATOM   3332  C CB  . LEU A 1 458 ? -28.295 1.570   -53.689  1.00 135.01 ? 467 LEU A CB  1 
ATOM   3333  C CG  . LEU A 1 458 ? -27.674 1.199   -55.033  1.00 134.78 ? 467 LEU A CG  1 
ATOM   3334  C CD1 . LEU A 1 458 ? -26.220 1.630   -55.072  1.00 133.56 ? 467 LEU A CD1 1 
ATOM   3335  C CD2 . LEU A 1 458 ? -27.799 -0.294  -55.283  1.00 135.79 ? 467 LEU A CD2 1 
ATOM   3336  N N   . VAL A 1 459 ? -30.283 2.574   -51.523  1.00 125.55 ? 468 VAL A N   1 
ATOM   3337  C CA  . VAL A 1 459 ? -30.583 2.777   -50.111  1.00 126.25 ? 468 VAL A CA  1 
ATOM   3338  C C   . VAL A 1 459 ? -32.012 2.362   -49.764  1.00 127.94 ? 468 VAL A C   1 
ATOM   3339  O O   . VAL A 1 459 ? -32.294 1.958   -48.635  1.00 128.89 ? 468 VAL A O   1 
ATOM   3340  C CB  . VAL A 1 459 ? -30.364 4.247   -49.698  1.00 125.98 ? 468 VAL A CB  1 
ATOM   3341  C CG1 . VAL A 1 459 ? -30.666 4.439   -48.219  1.00 127.07 ? 468 VAL A CG1 1 
ATOM   3342  C CG2 . VAL A 1 459 ? -28.943 4.678   -50.014  1.00 124.45 ? 468 VAL A CG2 1 
ATOM   3343  N N   . TYR A 1 460 ? -32.911 2.453   -50.738  1.00 128.73 ? 469 TYR A N   1 
ATOM   3344  C CA  . TYR A 1 460 ? -34.320 2.158   -50.499  1.00 130.54 ? 469 TYR A CA  1 
ATOM   3345  C C   . TYR A 1 460 ? -34.731 0.784   -51.029  1.00 131.23 ? 469 TYR A C   1 
ATOM   3346  O O   . TYR A 1 460 ? -35.919 0.485   -51.151  1.00 132.80 ? 469 TYR A O   1 
ATOM   3347  C CB  . TYR A 1 460 ? -35.205 3.260   -51.084  1.00 131.41 ? 469 TYR A CB  1 
ATOM   3348  C CG  . TYR A 1 460 ? -34.791 4.649   -50.649  1.00 131.02 ? 469 TYR A CG  1 
ATOM   3349  C CD1 . TYR A 1 460 ? -34.766 4.997   -49.305  1.00 131.54 ? 469 TYR A CD1 1 
ATOM   3350  C CD2 . TYR A 1 460 ? -34.423 5.610   -51.580  1.00 130.40 ? 469 TYR A CD2 1 
ATOM   3351  C CE1 . TYR A 1 460 ? -34.386 6.263   -48.901  1.00 131.48 ? 469 TYR A CE1 1 
ATOM   3352  C CE2 . TYR A 1 460 ? -34.042 6.879   -51.186  1.00 130.28 ? 469 TYR A CE2 1 
ATOM   3353  C CZ  . TYR A 1 460 ? -34.025 7.200   -49.845  1.00 130.82 ? 469 TYR A CZ  1 
ATOM   3354  O OH  . TYR A 1 460 ? -33.647 8.461   -49.446  1.00 130.98 ? 469 TYR A OH  1 
ATOM   3355  N N   . GLY A 1 461 ? -33.739 -0.044  -51.342  1.00 157.46 ? 470 GLY A N   1 
ATOM   3356  C CA  . GLY A 1 461 ? -33.974 -1.431  -51.705  1.00 158.34 ? 470 GLY A CA  1 
ATOM   3357  C C   . GLY A 1 461 ? -34.586 -1.664  -53.073  1.00 159.04 ? 470 GLY A C   1 
ATOM   3358  O O   . GLY A 1 461 ? -35.128 -2.737  -53.339  1.00 160.33 ? 470 GLY A O   1 
ATOM   3359  N N   . LYS A 1 462 ? -34.500 -0.667  -53.946  1.00 134.86 ? 471 LYS A N   1 
ATOM   3360  C CA  . LYS A 1 462 ? -35.038 -0.793  -55.295  1.00 135.78 ? 471 LYS A CA  1 
ATOM   3361  C C   . LYS A 1 462 ? -34.132 -1.654  -56.171  1.00 135.40 ? 471 LYS A C   1 
ATOM   3362  O O   . LYS A 1 462 ? -34.604 -2.374  -57.050  1.00 136.74 ? 471 LYS A O   1 
ATOM   3363  C CB  . LYS A 1 462 ? -35.233 0.585   -55.929  1.00 135.65 ? 471 LYS A CB  1 
ATOM   3364  N N   . ALA A 1 463 ? -32.828 -1.575  -55.922  1.00 133.21 ? 472 ALA A N   1 
ATOM   3365  C CA  . ALA A 1 463 ? -31.850 -2.343  -56.686  1.00 133.00 ? 472 ALA A CA  1 
ATOM   3366  C C   . ALA A 1 463 ? -30.852 -3.040  -55.766  1.00 132.38 ? 472 ALA A C   1 
ATOM   3367  O O   . ALA A 1 463 ? -30.724 -2.687  -54.595  1.00 131.76 ? 472 ALA A O   1 
ATOM   3368  C CB  . ALA A 1 463 ? -31.124 -1.444  -57.673  1.00 132.07 ? 472 ALA A CB  1 
ATOM   3369  N N   . ASP A 1 464 ? -30.146 -4.028  -56.306  1.00 134.81 ? 473 ASP A N   1 
ATOM   3370  C CA  . ASP A 1 464 ? -29.183 -4.797  -55.525  1.00 134.73 ? 473 ASP A CA  1 
ATOM   3371  C C   . ASP A 1 464 ? -27.759 -4.295  -55.722  1.00 133.35 ? 473 ASP A C   1 
ATOM   3372  O O   . ASP A 1 464 ? -26.897 -4.503  -54.869  1.00 133.00 ? 473 ASP A O   1 
ATOM   3373  C CB  . ASP A 1 464 ? -29.253 -6.278  -55.899  1.00 136.59 ? 473 ASP A CB  1 
ATOM   3374  C CG  . ASP A 1 464 ? -30.579 -6.908  -55.539  1.00 138.16 ? 473 ASP A CG  1 
ATOM   3375  O OD1 . ASP A 1 464 ? -31.305 -6.327  -54.705  1.00 137.81 ? 473 ASP A OD1 1 
ATOM   3376  O OD2 . ASP A 1 464 ? -30.891 -7.987  -56.086  1.00 139.94 ? 473 ASP A OD2 1 
ATOM   3377  N N   . ILE A 1 465 ? -27.516 -3.639  -56.851  1.00 128.64 ? 474 ILE A N   1 
ATOM   3378  C CA  . ILE A 1 465 ? -26.176 -3.178  -57.188  1.00 127.57 ? 474 ILE A CA  1 
ATOM   3379  C C   . ILE A 1 465 ? -26.224 -2.095  -58.260  1.00 126.98 ? 474 ILE A C   1 
ATOM   3380  O O   . ILE A 1 465 ? -27.145 -2.055  -59.075  1.00 127.91 ? 474 ILE A O   1 
ATOM   3381  C CB  . ILE A 1 465 ? -25.295 -4.345  -57.678  1.00 128.67 ? 474 ILE A CB  1 
ATOM   3382  C CG1 . ILE A 1 465 ? -23.824 -3.932  -57.730  1.00 127.70 ? 474 ILE A CG1 1 
ATOM   3383  C CG2 . ILE A 1 465 ? -25.771 -4.841  -59.035  1.00 130.12 ? 474 ILE A CG2 1 
ATOM   3384  C CD1 . ILE A 1 465 ? -22.896 -5.054  -58.137  1.00 129.08 ? 474 ILE A CD1 1 
ATOM   3385  N N   . ALA A 1 466 ? -25.227 -1.216  -58.252  1.00 124.95 ? 475 ALA A N   1 
ATOM   3386  C CA  . ALA A 1 466 ? -25.158 -0.122  -59.213  1.00 124.51 ? 475 ALA A CA  1 
ATOM   3387  C C   . ALA A 1 466 ? -23.880 -0.185  -60.042  1.00 124.43 ? 475 ALA A C   1 
ATOM   3388  O O   . ALA A 1 466 ? -22.786 0.063   -59.536  1.00 123.49 ? 475 ALA A O   1 
ATOM   3389  C CB  . ALA A 1 466 ? -25.263 1.217   -58.500  1.00 123.28 ? 475 ALA A CB  1 
ATOM   3390  N N   . ILE A 1 467 ? -24.028 -0.518  -61.320  1.00 124.67 ? 476 ILE A N   1 
ATOM   3391  C CA  . ILE A 1 467 ? -22.896 -0.567  -62.236  1.00 125.00 ? 476 ILE A CA  1 
ATOM   3392  C C   . ILE A 1 467 ? -22.987 0.561   -63.256  1.00 125.04 ? 476 ILE A C   1 
ATOM   3393  O O   . ILE A 1 467 ? -23.639 0.427   -64.291  1.00 126.52 ? 476 ILE A O   1 
ATOM   3394  C CB  . ILE A 1 467 ? -22.815 -1.921  -62.965  1.00 126.96 ? 476 ILE A CB  1 
ATOM   3395  C CG1 . ILE A 1 467 ? -22.759 -3.064  -61.950  1.00 127.28 ? 476 ILE A CG1 1 
ATOM   3396  C CG2 . ILE A 1 467 ? -21.601 -1.960  -63.880  1.00 127.57 ? 476 ILE A CG2 1 
ATOM   3397  C CD1 . ILE A 1 467 ? -22.682 -4.436  -62.578  1.00 129.52 ? 476 ILE A CD1 1 
ATOM   3398  N N   . ALA A 1 468 ? -22.330 1.674   -62.951  1.00 125.43 ? 477 ALA A N   1 
ATOM   3399  C CA  . ALA A 1 468 ? -22.374 2.857   -63.798  1.00 125.53 ? 477 ALA A CA  1 
ATOM   3400  C C   . ALA A 1 468 ? -21.212 3.779   -63.445  1.00 124.18 ? 477 ALA A C   1 
ATOM   3401  O O   . ALA A 1 468 ? -20.465 3.499   -62.508  1.00 123.20 ? 477 ALA A O   1 
ATOM   3402  C CB  . ALA A 1 468 ? -23.702 3.574   -63.622  1.00 125.70 ? 477 ALA A CB  1 
ATOM   3403  N N   . PRO A 1 469 ? -21.044 4.878   -64.201  1.00 124.14 ? 478 PRO A N   1 
ATOM   3404  C CA  . PRO A 1 469 ? -19.987 5.843   -63.878  1.00 123.02 ? 478 PRO A CA  1 
ATOM   3405  C C   . PRO A 1 469 ? -20.308 6.622   -62.608  1.00 121.74 ? 478 PRO A C   1 
ATOM   3406  O O   . PRO A 1 469 ? -20.369 7.850   -62.642  1.00 121.58 ? 478 PRO A O   1 
ATOM   3407  C CB  . PRO A 1 469 ? -19.995 6.795   -65.081  1.00 124.01 ? 478 PRO A CB  1 
ATOM   3408  C CG  . PRO A 1 469 ? -20.727 6.070   -66.157  1.00 125.82 ? 478 PRO A CG  1 
ATOM   3409  C CD  . PRO A 1 469 ? -21.727 5.214   -65.461  1.00 125.75 ? 478 PRO A CD  1 
ATOM   3410  N N   . LEU A 1 470 ? -20.514 5.914   -61.504  1.00 120.57 ? 479 LEU A N   1 
ATOM   3411  C CA  . LEU A 1 470 ? -20.844 6.556   -60.239  1.00 119.70 ? 479 LEU A CA  1 
ATOM   3412  C C   . LEU A 1 470 ? -19.582 6.998   -59.509  1.00 118.71 ? 479 LEU A C   1 
ATOM   3413  O O   . LEU A 1 470 ? -18.743 6.174   -59.144  1.00 118.51 ? 479 LEU A O   1 
ATOM   3414  C CB  . LEU A 1 470 ? -21.663 5.614   -59.357  1.00 119.81 ? 479 LEU A CB  1 
ATOM   3415  C CG  . LEU A 1 470 ? -22.328 6.244   -58.132  1.00 119.44 ? 479 LEU A CG  1 
ATOM   3416  C CD1 . LEU A 1 470 ? -23.250 7.378   -58.552  1.00 120.01 ? 479 LEU A CD1 1 
ATOM   3417  C CD2 . LEU A 1 470 ? -23.091 5.195   -57.342  1.00 119.82 ? 479 LEU A CD2 1 
ATOM   3418  N N   . THR A 1 471 ? -19.452 8.303   -59.302  1.00 119.28 ? 480 THR A N   1 
ATOM   3419  C CA  . THR A 1 471 ? -18.285 8.861   -58.630  1.00 118.56 ? 480 THR A CA  1 
ATOM   3420  C C   . THR A 1 471 ? -18.230 8.427   -57.169  1.00 118.14 ? 480 THR A C   1 
ATOM   3421  O O   . THR A 1 471 ? -19.250 8.401   -56.480  1.00 118.32 ? 480 THR A O   1 
ATOM   3422  C CB  . THR A 1 471 ? -18.283 10.400  -58.701  1.00 118.61 ? 480 THR A CB  1 
ATOM   3423  O OG1 . THR A 1 471 ? -18.447 10.818  -60.062  1.00 119.34 ? 480 THR A OG1 1 
ATOM   3424  C CG2 . THR A 1 471 ? -16.977 10.959  -58.155  1.00 118.09 ? 480 THR A CG2 1 
ATOM   3425  N N   . ILE A 1 472 ? -17.035 8.080   -56.702  1.00 117.87 ? 481 ILE A N   1 
ATOM   3426  C CA  . ILE A 1 472 ? -16.844 7.690   -55.311  1.00 117.82 ? 481 ILE A CA  1 
ATOM   3427  C C   . ILE A 1 472 ? -16.637 8.920   -54.437  1.00 117.65 ? 481 ILE A C   1 
ATOM   3428  O O   . ILE A 1 472 ? -15.527 9.443   -54.337  1.00 117.52 ? 481 ILE A O   1 
ATOM   3429  C CB  . ILE A 1 472 ? -15.642 6.742   -55.146  1.00 118.04 ? 481 ILE A CB  1 
ATOM   3430  C CG1 . ILE A 1 472 ? -15.821 5.499   -56.020  1.00 118.58 ? 481 ILE A CG1 1 
ATOM   3431  C CG2 . ILE A 1 472 ? -15.472 6.346   -53.687  1.00 118.36 ? 481 ILE A CG2 1 
ATOM   3432  C CD1 . ILE A 1 472 ? -14.701 4.494   -55.882  1.00 119.25 ? 481 ILE A CD1 1 
ATOM   3433  N N   . THR A 1 473 ? -17.714 9.379   -53.808  1.00 124.04 ? 482 THR A N   1 
ATOM   3434  C CA  . THR A 1 473 ? -17.660 10.564  -52.959  1.00 124.28 ? 482 THR A CA  1 
ATOM   3435  C C   . THR A 1 473 ? -17.880 10.208  -51.493  1.00 124.80 ? 482 THR A C   1 
ATOM   3436  O O   . THR A 1 473 ? -18.500 9.193   -51.176  1.00 125.03 ? 482 THR A O   1 
ATOM   3437  C CB  . THR A 1 473 ? -18.706 11.609  -53.386  1.00 124.69 ? 482 THR A CB  1 
ATOM   3438  O OG1 . THR A 1 473 ? -20.023 11.076  -53.201  1.00 125.13 ? 482 THR A OG1 1 
ATOM   3439  C CG2 . THR A 1 473 ? -18.518 11.981  -54.848  1.00 124.53 ? 482 THR A CG2 1 
ATOM   3440  N N   . LEU A 1 474 ? -17.370 11.053  -50.603  1.00 118.34 ? 483 LEU A N   1 
ATOM   3441  C CA  . LEU A 1 474 ? -17.502 10.837  -49.167  1.00 119.21 ? 483 LEU A CA  1 
ATOM   3442  C C   . LEU A 1 474 ? -18.964 10.798  -48.738  1.00 119.88 ? 483 LEU A C   1 
ATOM   3443  O O   . LEU A 1 474 ? -19.361 9.968   -47.920  1.00 120.48 ? 483 LEU A O   1 
ATOM   3444  C CB  . LEU A 1 474 ? -16.762 11.931  -48.395  1.00 119.87 ? 483 LEU A CB  1 
ATOM   3445  C CG  . LEU A 1 474 ? -16.934 11.928  -46.875  1.00 121.22 ? 483 LEU A CG  1 
ATOM   3446  C CD1 . LEU A 1 474 ? -16.537 10.583  -46.286  1.00 121.50 ? 483 LEU A CD1 1 
ATOM   3447  C CD2 . LEU A 1 474 ? -16.124 13.050  -46.247  1.00 122.07 ? 483 LEU A CD2 1 
ATOM   3448  N N   . VAL A 1 475 ? -19.763 11.701  -49.298  1.00 124.60 ? 484 VAL A N   1 
ATOM   3449  C CA  . VAL A 1 475 ? -21.176 11.798  -48.950  1.00 125.52 ? 484 VAL A CA  1 
ATOM   3450  C C   . VAL A 1 475 ? -21.935 10.514  -49.275  1.00 125.29 ? 484 VAL A C   1 
ATOM   3451  O O   . VAL A 1 475 ? -22.947 10.207  -48.646  1.00 126.20 ? 484 VAL A O   1 
ATOM   3452  C CB  . VAL A 1 475 ? -21.852 12.983  -49.666  1.00 125.99 ? 484 VAL A CB  1 
ATOM   3453  C CG1 . VAL A 1 475 ? -21.211 14.295  -49.239  1.00 126.63 ? 484 VAL A CG1 1 
ATOM   3454  C CG2 . VAL A 1 475 ? -21.770 12.812  -51.175  1.00 125.08 ? 484 VAL A CG2 1 
ATOM   3455  N N   . ARG A 1 476 ? -21.438 9.766   -50.255  1.00 118.69 ? 485 ARG A N   1 
ATOM   3456  C CA  . ARG A 1 476 ? -22.082 8.527   -50.678  1.00 118.65 ? 485 ARG A CA  1 
ATOM   3457  C C   . ARG A 1 476 ? -21.501 7.318   -49.955  1.00 118.76 ? 485 ARG A C   1 
ATOM   3458  O O   . ARG A 1 476 ? -22.219 6.372   -49.633  1.00 119.34 ? 485 ARG A O   1 
ATOM   3459  C CB  . ARG A 1 476 ? -21.943 8.339   -52.188  1.00 118.00 ? 485 ARG A CB  1 
ATOM   3460  C CG  . ARG A 1 476 ? -22.676 9.375   -53.020  1.00 118.30 ? 485 ARG A CG  1 
ATOM   3461  C CD  . ARG A 1 476 ? -22.296 9.255   -54.483  1.00 117.89 ? 485 ARG A CD  1 
ATOM   3462  N NE  . ARG A 1 476 ? -22.974 10.246  -55.313  1.00 118.51 ? 485 ARG A NE  1 
ATOM   3463  C CZ  . ARG A 1 476 ? -22.663 10.491  -56.581  1.00 118.52 ? 485 ARG A CZ  1 
ATOM   3464  N NH1 . ARG A 1 476 ? -21.680 9.819   -57.164  1.00 117.89 ? 485 ARG A NH1 1 
ATOM   3465  N NH2 . ARG A 1 476 ? -23.330 11.408  -57.267  1.00 119.46 ? 485 ARG A NH2 1 
ATOM   3466  N N   . GLU A 1 477 ? -20.196 7.353   -49.705  1.00 128.16 ? 486 GLU A N   1 
ATOM   3467  C CA  . GLU A 1 477 ? -19.515 6.253   -49.031  1.00 128.61 ? 486 GLU A CA  1 
ATOM   3468  C C   . GLU A 1 477 ? -20.093 6.023   -47.639  1.00 129.82 ? 486 GLU A C   1 
ATOM   3469  O O   . GLU A 1 477 ? -19.905 4.962   -47.044  1.00 130.60 ? 486 GLU A O   1 
ATOM   3470  C CB  . GLU A 1 477 ? -18.014 6.536   -48.939  1.00 128.39 ? 486 GLU A CB  1 
ATOM   3471  C CG  . GLU A 1 477 ? -17.180 5.373   -48.415  1.00 129.13 ? 486 GLU A CG  1 
ATOM   3472  C CD  . GLU A 1 477 ? -16.939 4.301   -49.461  1.00 128.93 ? 486 GLU A CD  1 
ATOM   3473  O OE1 . GLU A 1 477 ? -17.827 4.081   -50.310  1.00 128.53 ? 486 GLU A OE1 1 
ATOM   3474  O OE2 . GLU A 1 477 ? -15.858 3.676   -49.432  1.00 129.45 ? 486 GLU A OE2 1 
ATOM   3475  N N   . GLU A 1 478 ? -20.802 7.025   -47.128  1.00 139.03 ? 487 GLU A N   1 
ATOM   3476  C CA  . GLU A 1 478 ? -21.401 6.949   -45.801  1.00 140.47 ? 487 GLU A CA  1 
ATOM   3477  C C   . GLU A 1 478 ? -22.686 6.124   -45.799  1.00 141.05 ? 487 GLU A C   1 
ATOM   3478  O O   . GLU A 1 478 ? -23.011 5.470   -44.807  1.00 142.32 ? 487 GLU A O   1 
ATOM   3479  C CB  . GLU A 1 478 ? -21.689 8.353   -45.266  1.00 141.10 ? 487 GLU A CB  1 
ATOM   3480  C CG  . GLU A 1 478 ? -20.451 9.200   -45.031  1.00 140.98 ? 487 GLU A CG  1 
ATOM   3481  C CD  . GLU A 1 478 ? -20.790 10.618  -44.614  1.00 141.84 ? 487 GLU A CD  1 
ATOM   3482  O OE1 . GLU A 1 478 ? -19.897 11.313  -44.085  1.00 142.34 ? 487 GLU A OE1 1 
ATOM   3483  O OE2 . GLU A 1 478 ? -21.950 11.036  -44.814  1.00 142.27 ? 487 GLU A OE2 1 
ATOM   3484  N N   . VAL A 1 479 ? -23.414 6.159   -46.910  1.00 124.87 ? 488 VAL A N   1 
ATOM   3485  C CA  . VAL A 1 479 ? -24.698 5.471   -47.001  1.00 125.55 ? 488 VAL A CA  1 
ATOM   3486  C C   . VAL A 1 479 ? -24.602 4.140   -47.746  1.00 125.20 ? 488 VAL A C   1 
ATOM   3487  O O   . VAL A 1 479 ? -25.338 3.200   -47.447  1.00 126.11 ? 488 VAL A O   1 
ATOM   3488  C CB  . VAL A 1 479 ? -25.768 6.357   -47.667  1.00 125.62 ? 488 VAL A CB  1 
ATOM   3489  C CG1 . VAL A 1 479 ? -26.037 7.587   -46.816  1.00 126.55 ? 488 VAL A CG1 1 
ATOM   3490  C CG2 . VAL A 1 479 ? -25.332 6.757   -49.067  1.00 124.38 ? 488 VAL A CG2 1 
ATOM   3491  N N   . ILE A 1 480 ? -23.693 4.062   -48.713  1.00 135.09 ? 489 ILE A N   1 
ATOM   3492  C CA  . ILE A 1 480 ? -23.509 2.840   -49.489  1.00 135.04 ? 489 ILE A CA  1 
ATOM   3493  C C   . ILE A 1 480 ? -22.049 2.400   -49.494  1.00 134.77 ? 489 ILE A C   1 
ATOM   3494  O O   . ILE A 1 480 ? -21.193 3.043   -48.886  1.00 134.57 ? 489 ILE A O   1 
ATOM   3495  C CB  . ILE A 1 480 ? -23.990 3.011   -50.944  1.00 134.48 ? 489 ILE A CB  1 
ATOM   3496  C CG1 . ILE A 1 480 ? -23.149 4.066   -51.664  1.00 133.43 ? 489 ILE A CG1 1 
ATOM   3497  C CG2 . ILE A 1 480 ? -25.464 3.382   -50.980  1.00 135.10 ? 489 ILE A CG2 1 
ATOM   3498  C CD1 . ILE A 1 480 ? -23.576 4.311   -53.093  1.00 133.20 ? 489 ILE A CD1 1 
ATOM   3499  N N   . ASP A 1 481 ? -21.771 1.298   -50.183  1.00 123.50 ? 490 ASP A N   1 
ATOM   3500  C CA  . ASP A 1 481 ? -20.415 0.772   -50.276  1.00 123.63 ? 490 ASP A CA  1 
ATOM   3501  C C   . ASP A 1 481 ? -19.876 0.882   -51.697  1.00 122.91 ? 490 ASP A C   1 
ATOM   3502  O O   . ASP A 1 481 ? -20.542 0.495   -52.657  1.00 123.02 ? 490 ASP A O   1 
ATOM   3503  C CB  . ASP A 1 481 ? -20.369 -0.686  -49.814  1.00 125.12 ? 490 ASP A CB  1 
ATOM   3504  C CG  . ASP A 1 481 ? -20.532 -0.827  -48.315  1.00 126.19 ? 490 ASP A CG  1 
ATOM   3505  O OD1 . ASP A 1 481 ? -20.488 0.205   -47.613  1.00 125.79 ? 490 ASP A OD1 1 
ATOM   3506  O OD2 . ASP A 1 481 ? -20.700 -1.970  -47.839  1.00 127.68 ? 490 ASP A OD2 1 
ATOM   3507  N N   . PHE A 1 482 ? -18.666 1.415   -51.823  1.00 132.66 ? 491 PHE A N   1 
ATOM   3508  C CA  . PHE A 1 482 ? -18.017 1.540   -53.121  1.00 132.22 ? 491 PHE A CA  1 
ATOM   3509  C C   . PHE A 1 482 ? -16.851 0.570   -53.254  1.00 133.16 ? 491 PHE A C   1 
ATOM   3510  O O   . PHE A 1 482 ? -15.952 0.546   -52.414  1.00 133.57 ? 491 PHE A O   1 
ATOM   3511  C CB  . PHE A 1 482 ? -17.519 2.969   -53.342  1.00 131.14 ? 491 PHE A CB  1 
ATOM   3512  C CG  . PHE A 1 482 ? -18.569 3.905   -53.864  1.00 130.52 ? 491 PHE A CG  1 
ATOM   3513  C CD1 . PHE A 1 482 ? -18.925 3.889   -55.202  1.00 130.51 ? 491 PHE A CD1 1 
ATOM   3514  C CD2 . PHE A 1 482 ? -19.193 4.807   -53.020  1.00 130.31 ? 491 PHE A CD2 1 
ATOM   3515  C CE1 . PHE A 1 482 ? -19.888 4.750   -55.688  1.00 130.31 ? 491 PHE A CE1 1 
ATOM   3516  C CE2 . PHE A 1 482 ? -20.157 5.671   -53.500  1.00 130.12 ? 491 PHE A CE2 1 
ATOM   3517  C CZ  . PHE A 1 482 ? -20.505 5.643   -54.836  1.00 130.12 ? 491 PHE A CZ  1 
ATOM   3518  N N   . SER A 1 483 ? -16.873 -0.231  -54.313  1.00 128.02 ? 492 SER A N   1 
ATOM   3519  C CA  . SER A 1 483 ? -15.742 -1.089  -54.631  1.00 129.20 ? 492 SER A CA  1 
ATOM   3520  C C   . SER A 1 483 ? -14.581 -0.212  -55.078  1.00 128.56 ? 492 SER A C   1 
ATOM   3521  O O   . SER A 1 483 ? -14.760 0.980   -55.325  1.00 127.25 ? 492 SER A O   1 
ATOM   3522  C CB  . SER A 1 483 ? -16.110 -2.072  -55.741  1.00 130.31 ? 492 SER A CB  1 
ATOM   3523  O OG  . SER A 1 483 ? -16.342 -1.393  -56.963  1.00 129.61 ? 492 SER A OG  1 
ATOM   3524  N N   . LYS A 1 484 ? -13.393 -0.797  -55.175  1.00 126.39 ? 493 LYS A N   1 
ATOM   3525  C CA  . LYS A 1 484 ? -12.235 -0.061  -55.666  1.00 126.07 ? 493 LYS A CA  1 
ATOM   3526  C C   . LYS A 1 484 ? -12.541 0.518   -57.044  1.00 125.40 ? 493 LYS A C   1 
ATOM   3527  O O   . LYS A 1 484 ? -13.344 -0.042  -57.790  1.00 125.85 ? 493 LYS A O   1 
ATOM   3528  C CB  . LYS A 1 484 ? -11.003 -0.965  -55.720  1.00 127.92 ? 493 LYS A CB  1 
ATOM   3529  C CG  . LYS A 1 484 ? -10.487 -1.379  -54.353  1.00 128.91 ? 493 LYS A CG  1 
ATOM   3530  C CD  . LYS A 1 484 ? -10.062 -0.167  -53.538  1.00 127.77 ? 493 LYS A CD  1 
ATOM   3531  C CE  . LYS A 1 484 ? -9.663  -0.559  -52.125  1.00 129.02 ? 493 LYS A CE  1 
ATOM   3532  N NZ  . LYS A 1 484 ? -10.809 -1.126  -51.359  1.00 129.23 ? 493 LYS A NZ  1 
ATOM   3533  N N   . PRO A 1 485 ? -11.909 1.651   -57.381  1.00 125.36 ? 494 PRO A N   1 
ATOM   3534  C CA  . PRO A 1 485 ? -12.177 2.339   -58.648  1.00 124.91 ? 494 PRO A CA  1 
ATOM   3535  C C   . PRO A 1 485 ? -11.888 1.455   -59.854  1.00 126.42 ? 494 PRO A C   1 
ATOM   3536  O O   . PRO A 1 485 ? -10.820 0.849   -59.928  1.00 127.66 ? 494 PRO A O   1 
ATOM   3537  C CB  . PRO A 1 485 ? -11.201 3.519   -58.619  1.00 124.25 ? 494 PRO A CB  1 
ATOM   3538  C CG  . PRO A 1 485 ? -10.888 3.725   -57.177  1.00 123.87 ? 494 PRO A CG  1 
ATOM   3539  C CD  . PRO A 1 485 ? -10.903 2.359   -56.571  1.00 125.03 ? 494 PRO A CD  1 
ATOM   3540  N N   . PHE A 1 486 ? -12.835 1.382   -60.784  1.00 123.28 ? 495 PHE A N   1 
ATOM   3541  C CA  . PHE A 1 486 ? -12.635 0.629   -62.015  1.00 124.99 ? 495 PHE A CA  1 
ATOM   3542  C C   . PHE A 1 486 ? -12.221 1.560   -63.148  1.00 125.04 ? 495 PHE A C   1 
ATOM   3543  O O   . PHE A 1 486 ? -12.061 1.131   -64.291  1.00 126.60 ? 495 PHE A O   1 
ATOM   3544  C CB  . PHE A 1 486 ? -13.896 -0.154  -62.395  1.00 125.72 ? 495 PHE A CB  1 
ATOM   3545  C CG  . PHE A 1 486 ? -15.068 0.713   -62.763  1.00 124.77 ? 495 PHE A CG  1 
ATOM   3546  C CD1 . PHE A 1 486 ? -15.222 1.182   -64.058  1.00 125.45 ? 495 PHE A CD1 1 
ATOM   3547  C CD2 . PHE A 1 486 ? -16.024 1.046   -61.818  1.00 123.54 ? 495 PHE A CD2 1 
ATOM   3548  C CE1 . PHE A 1 486 ? -16.301 1.974   -64.400  1.00 124.96 ? 495 PHE A CE1 1 
ATOM   3549  C CE2 . PHE A 1 486 ? -17.107 1.838   -62.155  1.00 123.02 ? 495 PHE A CE2 1 
ATOM   3550  C CZ  . PHE A 1 486 ? -17.245 2.302   -63.447  1.00 123.75 ? 495 PHE A CZ  1 
ATOM   3551  N N   . MET A 1 487 ? -12.046 2.836   -62.820  1.00 135.55 ? 496 MET A N   1 
ATOM   3552  C CA  . MET A 1 487 ? -11.648 3.838   -63.802  1.00 135.65 ? 496 MET A CA  1 
ATOM   3553  C C   . MET A 1 487 ? -11.319 5.169   -63.135  1.00 134.16 ? 496 MET A C   1 
ATOM   3554  O O   . MET A 1 487 ? -12.212 5.877   -62.673  1.00 133.08 ? 496 MET A O   1 
ATOM   3555  C CB  . MET A 1 487 ? -12.749 4.033   -64.845  1.00 136.18 ? 496 MET A CB  1 
ATOM   3556  C CG  . MET A 1 487 ? -12.457 5.125   -65.857  1.00 136.55 ? 496 MET A CG  1 
ATOM   3557  S SD  . MET A 1 487 ? -13.680 5.191   -67.181  1.00 137.92 ? 496 MET A SD  1 
ATOM   3558  C CE  . MET A 1 487 ? -13.444 3.583   -67.935  1.00 140.14 ? 496 MET A CE  1 
ATOM   3559  N N   . SER A 1 488 ? -10.033 5.503   -63.088  1.00 145.62 ? 497 SER A N   1 
ATOM   3560  C CA  . SER A 1 488 ? -9.589  6.760   -62.495  1.00 144.54 ? 497 SER A CA  1 
ATOM   3561  C C   . SER A 1 488 ? -9.706  7.905   -63.498  1.00 144.66 ? 497 SER A C   1 
ATOM   3562  O O   . SER A 1 488 ? -9.357  7.752   -64.669  1.00 145.91 ? 497 SER A O   1 
ATOM   3563  C CB  . SER A 1 488 ? -8.147  6.639   -61.998  1.00 144.97 ? 497 SER A CB  1 
ATOM   3564  O OG  . SER A 1 488 ? -8.018  5.597   -61.046  1.00 145.20 ? 497 SER A OG  1 
ATOM   3565  N N   . LEU A 1 489 ? -10.196 9.051   -63.035  1.00 122.49 ? 498 LEU A N   1 
ATOM   3566  C CA  . LEU A 1 489 ? -10.380 10.205  -63.907  1.00 122.85 ? 498 LEU A CA  1 
ATOM   3567  C C   . LEU A 1 489 ? -10.144 11.521  -63.174  1.00 122.09 ? 498 LEU A C   1 
ATOM   3568  O O   . LEU A 1 489 ? -9.543  11.549  -62.101  1.00 121.45 ? 498 LEU A O   1 
ATOM   3569  C CB  . LEU A 1 489 ? -11.784 10.202  -64.512  1.00 123.17 ? 498 LEU A CB  1 
ATOM   3570  C CG  . LEU A 1 489 ? -12.939 10.433  -63.534  1.00 122.17 ? 498 LEU A CG  1 
ATOM   3571  C CD1 . LEU A 1 489 ? -14.118 11.083  -64.240  1.00 122.82 ? 498 LEU A CD1 1 
ATOM   3572  C CD2 . LEU A 1 489 ? -13.355 9.136   -62.858  1.00 121.81 ? 498 LEU A CD2 1 
ATOM   3573  N N   . GLY A 1 490 ? -10.626 12.609  -63.768  1.00 120.17 ? 499 GLY A N   1 
ATOM   3574  C CA  . GLY A 1 490 ? -10.486 13.932  -63.187  1.00 119.85 ? 499 GLY A CA  1 
ATOM   3575  C C   . GLY A 1 490 ? -11.040 15.009  -64.100  1.00 120.84 ? 499 GLY A C   1 
ATOM   3576  O O   . GLY A 1 490 ? -11.715 14.712  -65.084  1.00 121.69 ? 499 GLY A O   1 
ATOM   3577  N N   . ILE A 1 491 ? -10.755 16.265  -63.772  1.00 120.60 ? 500 ILE A N   1 
ATOM   3578  C CA  . ILE A 1 491 ? -11.206 17.392  -64.582  1.00 121.89 ? 500 ILE A CA  1 
ATOM   3579  C C   . ILE A 1 491 ? -10.159 17.760  -65.630  1.00 123.05 ? 500 ILE A C   1 
ATOM   3580  O O   . ILE A 1 491 ? -8.987  17.952  -65.308  1.00 122.84 ? 500 ILE A O   1 
ATOM   3581  C CB  . ILE A 1 491 ? -11.514 18.624  -63.713  1.00 121.93 ? 500 ILE A CB  1 
ATOM   3582  C CG1 . ILE A 1 491 ? -12.569 18.281  -62.659  1.00 121.06 ? 500 ILE A CG1 1 
ATOM   3583  C CG2 . ILE A 1 491 ? -11.982 19.784  -64.577  1.00 123.66 ? 500 ILE A CG2 1 
ATOM   3584  C CD1 . ILE A 1 491 ? -12.956 19.447  -61.778  1.00 121.46 ? 500 ILE A CD1 1 
ATOM   3585  N N   . SER A 1 492 ? -10.589 17.859  -66.884  1.00 143.04 ? 501 SER A N   1 
ATOM   3586  C CA  . SER A 1 492 ? -9.672  18.132  -67.986  1.00 144.50 ? 501 SER A CA  1 
ATOM   3587  C C   . SER A 1 492 ? -10.048 19.395  -68.756  1.00 146.34 ? 501 SER A C   1 
ATOM   3588  O O   . SER A 1 492 ? -11.068 20.025  -68.476  1.00 146.61 ? 501 SER A O   1 
ATOM   3589  C CB  . SER A 1 492 ? -9.619  16.938  -68.941  1.00 145.18 ? 501 SER A CB  1 
ATOM   3590  O OG  . SER A 1 492 ? -10.902 16.657  -69.473  1.00 145.88 ? 501 SER A OG  1 
ATOM   3591  N N   . ILE A 1 493 ? -9.216  19.754  -69.728  1.00 130.75 ? 502 ILE A N   1 
ATOM   3592  C CA  . ILE A 1 493 ? -9.442  20.942  -70.543  1.00 132.92 ? 502 ILE A CA  1 
ATOM   3593  C C   . ILE A 1 493 ? -9.729  20.562  -71.991  1.00 135.02 ? 502 ILE A C   1 
ATOM   3594  O O   . ILE A 1 493 ? -9.042  19.719  -72.567  1.00 135.32 ? 502 ILE A O   1 
ATOM   3595  C CB  . ILE A 1 493 ? -8.223  21.883  -70.512  1.00 133.55 ? 502 ILE A CB  1 
ATOM   3596  C CG1 . ILE A 1 493 ? -7.817  22.187  -69.068  1.00 131.71 ? 502 ILE A CG1 1 
ATOM   3597  C CG2 . ILE A 1 493 ? -8.517  23.166  -71.273  1.00 136.01 ? 502 ILE A CG2 1 
ATOM   3598  C CD1 . ILE A 1 493 ? -6.575  23.043  -68.949  1.00 132.34 ? 502 ILE A CD1 1 
ATOM   3599  N N   . MET A 1 494 ? -10.746 21.186  -72.576  1.00 136.97 ? 503 MET A N   1 
ATOM   3600  C CA  . MET A 1 494 ? -11.103 20.925  -73.966  1.00 139.44 ? 503 MET A CA  1 
ATOM   3601  C C   . MET A 1 494 ? -10.981 22.180  -74.821  1.00 142.28 ? 503 MET A C   1 
ATOM   3602  O O   . MET A 1 494 ? -11.602 23.204  -74.534  1.00 143.03 ? 503 MET A O   1 
ATOM   3603  C CB  . MET A 1 494 ? -12.520 20.359  -74.068  1.00 139.65 ? 503 MET A CB  1 
ATOM   3604  C CG  . MET A 1 494 ? -12.990 20.141  -75.498  1.00 142.62 ? 503 MET A CG  1 
ATOM   3605  S SD  . MET A 1 494 ? -14.738 19.716  -75.617  1.00 143.40 ? 503 MET A SD  1 
ATOM   3606  C CE  . MET A 1 494 ? -14.766 18.136  -74.777  1.00 140.38 ? 503 MET A CE  1 
ATOM   3607  N N   . ILE A 1 495 ? -10.171 22.086  -75.871  1.00 150.76 ? 504 ILE A N   1 
ATOM   3608  C CA  . ILE A 1 495 ? -9.978  23.184  -76.808  1.00 150.76 ? 504 ILE A CA  1 
ATOM   3609  C C   . ILE A 1 495 ? -10.259 22.713  -78.231  1.00 150.76 ? 504 ILE A C   1 
ATOM   3610  O O   . ILE A 1 495 ? -10.362 21.513  -78.488  1.00 150.76 ? 504 ILE A O   1 
ATOM   3611  C CB  . ILE A 1 495 ? -8.543  23.736  -76.741  1.00 150.76 ? 504 ILE A CB  1 
ATOM   3612  C CG1 . ILE A 1 495 ? -7.555  22.723  -77.323  1.00 150.76 ? 504 ILE A CG1 1 
ATOM   3613  C CG2 . ILE A 1 495 ? -8.174  24.090  -75.309  1.00 150.76 ? 504 ILE A CG2 1 
ATOM   3614  C CD1 . ILE A 1 495 ? -6.128  23.219  -77.375  1.00 150.76 ? 504 ILE A CD1 1 
ATOM   3615  N N   . LYS A 1 496 ? -10.380 23.661  -79.153  1.00 143.95 ? 505 LYS A N   1 
ATOM   3616  C CA  . LYS A 1 496 ? -10.643 23.336  -80.550  1.00 143.95 ? 505 LYS A CA  1 
ATOM   3617  C C   . LYS A 1 496 ? -9.370  22.886  -81.257  1.00 143.95 ? 505 LYS A C   1 
ATOM   3618  O O   . LYS A 1 496 ? -8.315  23.502  -81.102  1.00 143.95 ? 505 LYS A O   1 
ATOM   3619  C CB  . LYS A 1 496 ? -11.253 24.537  -81.277  1.00 143.95 ? 505 LYS A CB  1 
ATOM   3620  N N   . LYS A 1 497 ? -9.473  21.807  -82.029  1.00 161.91 ? 506 LYS A N   1 
ATOM   3621  C CA  . LYS A 1 497 ? -8.342  21.305  -82.800  1.00 161.91 ? 506 LYS A CA  1 
ATOM   3622  C C   . LYS A 1 497 ? -7.774  22.413  -83.679  1.00 161.91 ? 506 LYS A C   1 
ATOM   3623  O O   . LYS A 1 497 ? -8.508  23.047  -84.437  1.00 161.91 ? 506 LYS A O   1 
ATOM   3624  C CB  . LYS A 1 497 ? -8.763  20.112  -83.660  1.00 161.91 ? 506 LYS A CB  1 
ATOM   3625  N N   . PRO A 1 498 ? -6.459  22.649  -83.579  1.00 183.57 ? 507 PRO A N   1 
ATOM   3626  C CA  . PRO A 1 498 ? -5.818  23.739  -84.322  1.00 183.57 ? 507 PRO A CA  1 
ATOM   3627  C C   . PRO A 1 498 ? -5.757  23.452  -85.818  1.00 183.57 ? 507 PRO A C   1 
ATOM   3628  O O   . PRO A 1 498 ? -5.366  22.356  -86.220  1.00 183.57 ? 507 PRO A O   1 
ATOM   3629  C CB  . PRO A 1 498 ? -4.405  23.777  -83.738  1.00 183.57 ? 507 PRO A CB  1 
ATOM   3630  C CG  . PRO A 1 498 ? -4.171  22.411  -83.201  1.00 183.57 ? 507 PRO A CG  1 
ATOM   3631  C CD  . PRO A 1 498 ? -5.497  21.848  -82.802  1.00 183.57 ? 507 PRO A CD  1 
ATOM   3632  N N   . GLN A 1 499 ? -6.152  24.428  -86.629  1.00 231.38 ? 508 GLN A N   1 
ATOM   3633  C CA  . GLN A 1 499 ? -6.053  24.303  -88.077  1.00 231.38 ? 508 GLN A CA  1 
ATOM   3634  C C   . GLN A 1 499 ? -4.589  24.351  -88.498  1.00 231.38 ? 508 GLN A C   1 
ATOM   3635  O O   . GLN A 1 499 ? -4.038  25.425  -88.745  1.00 231.38 ? 508 GLN A O   1 
ATOM   3636  C CB  . GLN A 1 499 ? -6.842  25.417  -88.769  1.00 231.38 ? 508 GLN A CB  1 
ATOM   3637  N N   . LYS A 1 500 ? -3.962  23.181  -88.575  1.00 249.65 ? 509 LYS A N   1 
ATOM   3638  C CA  . LYS A 1 500 ? -2.540  23.085  -88.890  1.00 249.65 ? 509 LYS A CA  1 
ATOM   3639  C C   . LYS A 1 500 ? -2.254  23.370  -90.361  1.00 249.65 ? 509 LYS A C   1 
ATOM   3640  O O   . LYS A 1 500 ? -1.339  22.792  -90.947  1.00 249.65 ? 509 LYS A O   1 
ATOM   3641  C CB  . LYS A 1 500 ? -1.998  21.707  -88.507  1.00 249.65 ? 509 LYS A CB  1 
ATOM   3642  N N   . SER A 1 501 ? -3.042  24.263  -90.949  1.00 252.81 ? 510 SER A N   1 
ATOM   3643  C CA  . SER A 1 501 ? -2.852  24.665  -92.337  1.00 252.81 ? 510 SER A CA  1 
ATOM   3644  C C   . SER A 1 501 ? -3.154  26.150  -92.501  1.00 252.81 ? 510 SER A C   1 
ATOM   3645  O O   . SER A 1 501 ? -4.194  26.634  -92.052  1.00 252.81 ? 510 SER A O   1 
ATOM   3646  C CB  . SER A 1 501 ? -3.747  23.839  -93.263  1.00 252.81 ? 510 SER A CB  1 
ATOM   3647  N N   . LYS A 1 502 ? -2.239  26.870  -93.140  1.00 260.22 ? 511 LYS A N   1 
ATOM   3648  C CA  . LYS A 1 502 ? -2.409  28.302  -93.351  1.00 260.22 ? 511 LYS A CA  1 
ATOM   3649  C C   . LYS A 1 502 ? -1.375  28.857  -94.326  1.00 260.22 ? 511 LYS A C   1 
ATOM   3650  O O   . LYS A 1 502 ? -0.450  29.562  -93.921  1.00 260.22 ? 511 LYS A O   1 
ATOM   3651  C CB  . LYS A 1 502 ? -2.331  29.053  -92.018  1.00 260.22 ? 511 LYS A CB  1 
ATOM   3652  N N   . PRO A 1 503 ? -1.529  28.534  -95.620  1.00 197.59 ? 512 PRO A N   1 
ATOM   3653  C CA  . PRO A 1 503 ? -0.630  29.054  -96.654  1.00 197.59 ? 512 PRO A CA  1 
ATOM   3654  C C   . PRO A 1 503 ? -0.867  30.537  -96.914  1.00 197.59 ? 512 PRO A C   1 
ATOM   3655  O O   . PRO A 1 503 ? -0.424  31.384  -96.137  1.00 197.59 ? 512 PRO A O   1 
ATOM   3656  C CB  . PRO A 1 503 ? -1.017  28.247  -97.901  1.00 197.59 ? 512 PRO A CB  1 
ATOM   3657  C CG  . PRO A 1 503 ? -1.798  27.076  -97.395  1.00 197.59 ? 512 PRO A CG  1 
ATOM   3658  C CD  . PRO A 1 503 ? -2.494  27.568  -96.169  1.00 197.59 ? 512 PRO A CD  1 
ATOM   3659  N N   . GLY A 1 504 ? -1.568  30.838  -98.003  1.00 239.50 ? 513 GLY A N   1 
ATOM   3660  C CA  . GLY A 1 504 ? -1.830  32.210  -98.387  1.00 239.78 ? 513 GLY A CA  1 
ATOM   3661  C C   . GLY A 1 504 ? -0.557  32.950  -98.743  1.00 238.60 ? 513 GLY A C   1 
ATOM   3662  O O   . GLY A 1 504 ? 0.187   33.382  -97.864  1.00 235.70 ? 513 GLY A O   1 
ATOM   3663  N N   . VAL A 1 505 ? -0.308  33.096  -100.041 1.00 178.45 ? 514 VAL A N   1 
ATOM   3664  C CA  . VAL A 1 505 ? 0.862   33.822  -100.523 1.00 177.95 ? 514 VAL A CA  1 
ATOM   3665  C C   . VAL A 1 505 ? 0.832   35.269  -100.032 1.00 176.40 ? 514 VAL A C   1 
ATOM   3666  O O   . VAL A 1 505 ? 1.795   36.017  -100.206 1.00 175.67 ? 514 VAL A O   1 
ATOM   3667  C CB  . VAL A 1 505 ? 0.937   33.801  -102.062 1.00 181.63 ? 514 VAL A CB  1 
ATOM   3668  C CG1 . VAL A 1 505 ? 2.341   34.145  -102.535 1.00 181.26 ? 514 VAL A CG1 1 
ATOM   3669  C CG2 . VAL A 1 505 ? 0.517   32.439  -102.594 1.00 184.08 ? 514 VAL A CG2 1 
ATOM   3670  N N   . PHE A 1 506 ? -0.282  35.654  -99.414  1.00 289.93 ? 515 PHE A N   1 
ATOM   3671  C CA  . PHE A 1 506 ? -0.461  37.010  -98.903  1.00 288.88 ? 515 PHE A CA  1 
ATOM   3672  C C   . PHE A 1 506 ? 0.284   37.252  -97.591  1.00 285.26 ? 515 PHE A C   1 
ATOM   3673  O O   . PHE A 1 506 ? 0.188   38.332  -97.010  1.00 284.27 ? 515 PHE A O   1 
ATOM   3674  C CB  . PHE A 1 506 ? -1.947  37.338  -98.732  1.00 290.37 ? 515 PHE A CB  1 
ATOM   3675  C CG  . PHE A 1 506 ? -2.681  37.512  -100.030 1.00 294.32 ? 515 PHE A CG  1 
ATOM   3676  C CD1 . PHE A 1 506 ? -2.147  38.295  -101.040 1.00 296.06 ? 515 PHE A CD1 1 
ATOM   3677  C CD2 . PHE A 1 506 ? -3.910  36.905  -100.238 1.00 296.60 ? 515 PHE A CD2 1 
ATOM   3678  C CE1 . PHE A 1 506 ? -2.818  38.462  -102.237 1.00 300.07 ? 515 PHE A CE1 1 
ATOM   3679  C CE2 . PHE A 1 506 ? -4.587  37.070  -101.433 1.00 300.60 ? 515 PHE A CE2 1 
ATOM   3680  C CZ  . PHE A 1 506 ? -4.040  37.849  -102.434 1.00 302.36 ? 515 PHE A CZ  1 
ATOM   3681  N N   . SER A 1 507 ? 1.018   36.247  -97.124  1.00 329.92 ? 516 SER A N   1 
ATOM   3682  C CA  . SER A 1 507 ? 1.860   36.410  -95.944  1.00 326.86 ? 516 SER A CA  1 
ATOM   3683  C C   . SER A 1 507 ? 3.256   36.840  -96.377  1.00 326.39 ? 516 SER A C   1 
ATOM   3684  O O   . SER A 1 507 ? 4.144   37.051  -95.549  1.00 324.21 ? 516 SER A O   1 
ATOM   3685  C CB  . SER A 1 507 ? 1.930   35.112  -95.137  1.00 325.61 ? 516 SER A CB  1 
ATOM   3686  O OG  . SER A 1 507 ? 2.687   34.126  -95.817  1.00 326.43 ? 516 SER A OG  1 
ATOM   3687  N N   . PHE A 1 508 ? 3.434   36.962  -97.689  1.00 183.53 ? 517 PHE A N   1 
ATOM   3688  C CA  . PHE A 1 508 ? 4.699   37.391  -98.271  1.00 183.72 ? 517 PHE A CA  1 
ATOM   3689  C C   . PHE A 1 508 ? 4.589   38.831  -98.749  1.00 184.90 ? 517 PHE A C   1 
ATOM   3690  O O   . PHE A 1 508 ? 5.577   39.558  -98.803  1.00 184.47 ? 517 PHE A O   1 
ATOM   3691  C CB  . PHE A 1 508 ? 5.074   36.475  -99.437  1.00 185.97 ? 517 PHE A CB  1 
ATOM   3692  C CG  . PHE A 1 508 ? 6.219   36.981  -100.267 1.00 187.02 ? 517 PHE A CG  1 
ATOM   3693  C CD1 . PHE A 1 508 ? 7.528   36.754  -99.878  1.00 185.46 ? 517 PHE A CD1 1 
ATOM   3694  C CD2 . PHE A 1 508 ? 5.985   37.679  -101.441 1.00 189.88 ? 517 PHE A CD2 1 
ATOM   3695  C CE1 . PHE A 1 508 ? 8.583   37.216  -100.643 1.00 186.68 ? 517 PHE A CE1 1 
ATOM   3696  C CE2 . PHE A 1 508 ? 7.035   38.144  -102.210 1.00 191.15 ? 517 PHE A CE2 1 
ATOM   3697  C CZ  . PHE A 1 508 ? 8.337   37.912  -101.810 1.00 189.51 ? 517 PHE A CZ  1 
ATOM   3698  N N   . LEU A 1 509 ? 3.371   39.233  -99.093  1.00 268.08 ? 518 LEU A N   1 
ATOM   3699  C CA  . LEU A 1 509 ? 3.108   40.592  -99.548  1.00 269.68 ? 518 LEU A CA  1 
ATOM   3700  C C   . LEU A 1 509 ? 2.862   41.520  -98.361  1.00 267.72 ? 518 LEU A C   1 
ATOM   3701  O O   . LEU A 1 509 ? 2.805   42.740  -98.516  1.00 268.73 ? 518 LEU A O   1 
ATOM   3702  C CB  . LEU A 1 509 ? 1.906   40.616  -100.497 1.00 272.99 ? 518 LEU A CB  1 
ATOM   3703  C CG  . LEU A 1 509 ? 1.980   39.664  -101.695 1.00 275.51 ? 518 LEU A CG  1 
ATOM   3704  C CD1 . LEU A 1 509 ? 0.679   39.673  -102.491 1.00 278.94 ? 518 LEU A CD1 1 
ATOM   3705  C CD2 . LEU A 1 509 ? 3.164   40.002  -102.591 1.00 276.72 ? 518 LEU A CD2 1 
ATOM   3706  N N   . ASP A 1 510 ? 2.719   40.936  -97.177  1.00 273.72 ? 519 ASP A N   1 
ATOM   3707  C CA  . ASP A 1 510 ? 2.458   41.710  -95.966  1.00 272.02 ? 519 ASP A CA  1 
ATOM   3708  C C   . ASP A 1 510 ? 3.724   42.341  -95.394  1.00 270.26 ? 519 ASP A C   1 
ATOM   3709  O O   . ASP A 1 510 ? 3.758   43.550  -95.156  1.00 270.55 ? 519 ASP A O   1 
ATOM   3710  C CB  . ASP A 1 510 ? 1.770   40.847  -94.907  1.00 270.44 ? 519 ASP A CB  1 
ATOM   3711  C CG  . ASP A 1 510 ? 0.331   40.545  -95.255  1.00 272.39 ? 519 ASP A CG  1 
ATOM   3712  O OD1 . ASP A 1 510 ? -0.126  41.000  -96.325  1.00 275.01 ? 519 ASP A OD1 1 
ATOM   3713  O OD2 . ASP A 1 510 ? -0.345  39.856  -94.464  1.00 271.57 ? 519 ASP A OD2 1 
ATOM   3714  N N   . PRO A 1 511 ? 4.771   41.525  -95.177  1.00 156.22 ? 520 PRO A N   1 
ATOM   3715  C CA  . PRO A 1 511 ? 6.021   42.044  -94.618  1.00 154.77 ? 520 PRO A CA  1 
ATOM   3716  C C   . PRO A 1 511 ? 6.409   43.330  -95.324  1.00 156.44 ? 520 PRO A C   1 
ATOM   3717  O O   . PRO A 1 511 ? 6.519   44.384  -94.693  1.00 156.07 ? 520 PRO A O   1 
ATOM   3718  C CB  . PRO A 1 511 ? 7.026   40.946  -94.949  1.00 154.31 ? 520 PRO A CB  1 
ATOM   3719  C CG  . PRO A 1 511 ? 6.207   39.700  -94.961  1.00 154.37 ? 520 PRO A CG  1 
ATOM   3720  C CD  . PRO A 1 511 ? 4.882   40.102  -95.541  1.00 156.25 ? 520 PRO A CD  1 
ATOM   3721  N N   . LEU A 1 512 ? 6.616   43.252  -96.628  1.00 252.85 ? 521 LEU A N   1 
ATOM   3722  C CA  . LEU A 1 512 ? 6.874   44.459  -97.376  1.00 254.94 ? 521 LEU A CA  1 
ATOM   3723  C C   . LEU A 1 512 ? 5.562   44.870  -98.051  1.00 257.38 ? 521 LEU A C   1 
ATOM   3724  O O   . LEU A 1 512 ? 4.985   44.137  -98.855  1.00 258.87 ? 521 LEU A O   1 
ATOM   3725  C CB  . LEU A 1 512 ? 8.029   44.232  -98.358  1.00 256.15 ? 521 LEU A CB  1 
ATOM   3726  C CG  . LEU A 1 512 ? 8.831   45.375  -99.024  1.00 258.09 ? 521 LEU A CG  1 
ATOM   3727  C CD1 . LEU A 1 512 ? 10.139  44.804  -99.575  1.00 258.36 ? 521 LEU A CD1 1 
ATOM   3728  C CD2 . LEU A 1 512 ? 8.011   46.061  -100.110 1.00 261.39 ? 521 LEU A CD2 1 
ATOM   3729  N N   . ALA A 1 513 ? 5.077   46.035  -97.633  1.00 189.22 ? 522 ALA A N   1 
ATOM   3730  C CA  . ALA A 1 513 ? 3.781   46.571  -98.023  1.00 191.51 ? 522 ALA A CA  1 
ATOM   3731  C C   . ALA A 1 513 ? 3.693   46.706  -99.528  1.00 194.92 ? 522 ALA A C   1 
ATOM   3732  O O   . ALA A 1 513 ? 4.699   46.953  -100.198 1.00 195.86 ? 522 ALA A O   1 
ATOM   3733  C CB  . ALA A 1 513 ? 3.544   47.919  -97.356  1.00 191.83 ? 522 ALA A CB  1 
ATOM   3734  N N   . TYR A 1 514 ? 2.485   46.557  -100.057 1.00 219.66 ? 523 TYR A N   1 
ATOM   3735  C CA  . TYR A 1 514 ? 2.261   46.701  -101.489 1.00 223.44 ? 523 TYR A CA  1 
ATOM   3736  C C   . TYR A 1 514 ? 2.735   48.067  -101.972 1.00 225.67 ? 523 TYR A C   1 
ATOM   3737  O O   . TYR A 1 514 ? 3.234   48.206  -103.088 1.00 228.24 ? 523 TYR A O   1 
ATOM   3738  C CB  . TYR A 1 514 ? 0.777   46.539  -101.803 1.00 225.66 ? 523 TYR A CB  1 
ATOM   3739  C CG  . TYR A 1 514 ? 0.195   45.197  -101.415 1.00 224.11 ? 523 TYR A CG  1 
ATOM   3740  C CD1 . TYR A 1 514 ? -0.296  44.968  -100.135 1.00 221.42 ? 523 TYR A CD1 1 
ATOM   3741  C CD2 . TYR A 1 514 ? 0.121   44.163  -102.338 1.00 225.70 ? 523 TYR A CD2 1 
ATOM   3742  C CE1 . TYR A 1 514 ? -0.836  43.744  -99.785  1.00 220.33 ? 523 TYR A CE1 1 
ATOM   3743  C CE2 . TYR A 1 514 ? -0.416  42.938  -101.999 1.00 224.64 ? 523 TYR A CE2 1 
ATOM   3744  C CZ  . TYR A 1 514 ? -0.893  42.732  -100.722 1.00 221.94 ? 523 TYR A CZ  1 
ATOM   3745  O OH  . TYR A 1 514 ? -1.428  41.509  -100.388 1.00 221.18 ? 523 TYR A OH  1 
ATOM   3746  N N   . GLU A 1 515 ? 2.567   49.074  -101.121 1.00 211.15 ? 524 GLU A N   1 
ATOM   3747  C CA  . GLU A 1 515 ? 2.964   50.433  -101.455 1.00 213.42 ? 524 GLU A CA  1 
ATOM   3748  C C   . GLU A 1 515 ? 4.477   50.523  -101.580 1.00 212.50 ? 524 GLU A C   1 
ATOM   3749  O O   . GLU A 1 515 ? 5.001   51.282  -102.396 1.00 215.24 ? 524 GLU A O   1 
ATOM   3750  C CB  . GLU A 1 515 ? 2.471   51.417  -100.393 1.00 212.82 ? 524 GLU A CB  1 
ATOM   3751  C CG  . GLU A 1 515 ? 0.957   51.553  -100.309 1.00 214.45 ? 524 GLU A CG  1 
ATOM   3752  C CD  . GLU A 1 515 ? 0.295   50.378  -99.613  1.00 211.84 ? 524 GLU A CD  1 
ATOM   3753  O OE1 . GLU A 1 515 ? 0.998   49.632  -98.898  1.00 208.41 ? 524 GLU A OE1 1 
ATOM   3754  O OE2 . GLU A 1 515 ? -0.931  50.205  -99.777  1.00 213.49 ? 524 GLU A OE2 1 
ATOM   3755  N N   . ILE A 1 516 ? 5.174   49.741  -100.764 1.00 171.62 ? 525 ILE A N   1 
ATOM   3756  C CA  . ILE A 1 516 ? 6.630   49.746  -100.759 1.00 170.62 ? 525 ILE A CA  1 
ATOM   3757  C C   . ILE A 1 516 ? 7.195   48.977  -101.952 1.00 172.14 ? 525 ILE A C   1 
ATOM   3758  O O   . ILE A 1 516 ? 8.185   49.398  -102.551 1.00 173.63 ? 525 ILE A O   1 
ATOM   3759  C CB  . ILE A 1 516 ? 7.196   49.159  -99.453  1.00 166.59 ? 525 ILE A CB  1 
ATOM   3760  C CG1 . ILE A 1 516 ? 6.504   49.783  -98.240  1.00 165.26 ? 525 ILE A CG1 1 
ATOM   3761  C CG2 . ILE A 1 516 ? 8.702   49.367  -99.384  1.00 165.99 ? 525 ILE A CG2 1 
ATOM   3762  C CD1 . ILE A 1 516 ? 7.018   49.262  -96.921  1.00 161.71 ? 525 ILE A CD1 1 
ATOM   3763  N N   . TRP A 1 517 ? 6.568   47.853  -102.297 1.00 194.78 ? 526 TRP A N   1 
ATOM   3764  C CA  . TRP A 1 517 ? 6.979   47.093  -103.476 1.00 196.72 ? 526 TRP A CA  1 
ATOM   3765  C C   . TRP A 1 517 ? 6.854   47.963  -104.719 1.00 201.13 ? 526 TRP A C   1 
ATOM   3766  O O   . TRP A 1 517 ? 7.636   47.841  -105.662 1.00 203.18 ? 526 TRP A O   1 
ATOM   3767  C CB  . TRP A 1 517 ? 6.131   45.829  -103.651 1.00 196.49 ? 526 TRP A CB  1 
ATOM   3768  C CG  . TRP A 1 517 ? 6.418   44.738  -102.668 1.00 192.79 ? 526 TRP A CG  1 
ATOM   3769  C CD1 . TRP A 1 517 ? 5.599   44.306  -101.666 1.00 190.52 ? 526 TRP A CD1 1 
ATOM   3770  C CD2 . TRP A 1 517 ? 7.598   43.927  -102.598 1.00 191.31 ? 526 TRP A CD2 1 
ATOM   3771  N NE1 . TRP A 1 517 ? 6.195   43.282  -100.974 1.00 187.75 ? 526 TRP A NE1 1 
ATOM   3772  C CE2 . TRP A 1 517 ? 7.423   43.032  -101.525 1.00 188.18 ? 526 TRP A CE2 1 
ATOM   3773  C CE3 . TRP A 1 517 ? 8.786   43.877  -103.335 1.00 192.58 ? 526 TRP A CE3 1 
ATOM   3774  C CZ2 . TRP A 1 517 ? 8.390   42.095  -101.170 1.00 186.35 ? 526 TRP A CZ2 1 
ATOM   3775  C CZ3 . TRP A 1 517 ? 9.745   42.942  -102.980 1.00 190.70 ? 526 TRP A CZ3 1 
ATOM   3776  C CH2 . TRP A 1 517 ? 9.540   42.065  -101.908 1.00 187.64 ? 526 TRP A CH2 1 
ATOM   3777  N N   . MET A 1 518 ? 5.860   48.844  -104.713 1.00 181.30 ? 527 MET A N   1 
ATOM   3778  C CA  . MET A 1 518 ? 5.624   49.734  -105.841 1.00 185.87 ? 527 MET A CA  1 
ATOM   3779  C C   . MET A 1 518 ? 6.743   50.758  -105.976 1.00 186.89 ? 527 MET A C   1 
ATOM   3780  O O   . MET A 1 518 ? 7.389   50.849  -107.019 1.00 189.72 ? 527 MET A O   1 
ATOM   3781  C CB  . MET A 1 518 ? 4.277   50.446  -105.694 1.00 187.56 ? 527 MET A CB  1 
ATOM   3782  C CG  . MET A 1 518 ? 3.072   49.524  -105.786 1.00 187.71 ? 527 MET A CG  1 
ATOM   3783  S SD  . MET A 1 518 ? 2.973   48.668  -107.370 1.00 191.54 ? 527 MET A SD  1 
ATOM   3784  C CE  . MET A 1 518 ? 2.752   50.050  -108.488 1.00 197.20 ? 527 MET A CE  1 
ATOM   3785  N N   . CYS A 1 519 ? 6.971   51.524  -104.914 1.00 200.87 ? 528 CYS A N   1 
ATOM   3786  C CA  . CYS A 1 519 ? 7.983   52.573  -104.928 1.00 201.97 ? 528 CYS A CA  1 
ATOM   3787  C C   . CYS A 1 519 ? 9.380   52.029  -105.214 1.00 201.19 ? 528 CYS A C   1 
ATOM   3788  O O   . CYS A 1 519 ? 10.174  52.676  -105.897 1.00 203.87 ? 528 CYS A O   1 
ATOM   3789  C CB  . CYS A 1 519 ? 7.975   53.350  -103.609 1.00 199.70 ? 528 CYS A CB  1 
ATOM   3790  S SG  . CYS A 1 519 ? 6.507   54.374  -103.361 1.00 201.79 ? 528 CYS A SG  1 
ATOM   3791  N N   . ILE A 1 520 ? 9.680   50.844  -104.691 1.00 241.21 ? 529 ILE A N   1 
ATOM   3792  C CA  . ILE A 1 520 ? 10.978  50.223  -104.927 1.00 240.53 ? 529 ILE A CA  1 
ATOM   3793  C C   . ILE A 1 520 ? 11.129  49.848  -106.399 1.00 244.16 ? 529 ILE A C   1 
ATOM   3794  O O   . ILE A 1 520 ? 12.242  49.683  -106.898 1.00 245.15 ? 529 ILE A O   1 
ATOM   3795  C CB  . ILE A 1 520 ? 11.190  48.973  -104.045 1.00 236.45 ? 529 ILE A CB  1 
ATOM   3796  C CG1 . ILE A 1 520 ? 12.664  48.565  -104.040 1.00 235.68 ? 529 ILE A CG1 1 
ATOM   3797  C CG2 . ILE A 1 520 ? 10.322  47.823  -104.524 1.00 236.62 ? 529 ILE A CG2 1 
ATOM   3798  C CD1 . ILE A 1 520 ? 12.930  47.253  -103.335 1.00 232.35 ? 529 ILE A CD1 1 
ATOM   3799  N N   . VAL A 1 521 ? 9.999   49.718  -107.088 1.00 186.25 ? 530 VAL A N   1 
ATOM   3800  C CA  . VAL A 1 521 ? 10.000  49.433  -108.518 1.00 190.32 ? 530 VAL A CA  1 
ATOM   3801  C C   . VAL A 1 521 ? 10.061  50.728  -109.325 1.00 194.69 ? 530 VAL A C   1 
ATOM   3802  O O   . VAL A 1 521 ? 10.702  50.787  -110.374 1.00 198.02 ? 530 VAL A O   1 
ATOM   3803  C CB  . VAL A 1 521 ? 8.759   48.617  -108.935 1.00 191.21 ? 530 VAL A CB  1 
ATOM   3804  C CG1 . VAL A 1 521 ? 8.612   48.604  -110.449 1.00 196.34 ? 530 VAL A CG1 1 
ATOM   3805  C CG2 . VAL A 1 521 ? 8.851   47.200  -108.391 1.00 187.79 ? 530 VAL A CG2 1 
ATOM   3806  N N   . PHE A 1 522 ? 9.394   51.765  -108.827 1.00 196.91 ? 531 PHE A N   1 
ATOM   3807  C CA  . PHE A 1 522 ? 9.434   53.075  -109.467 1.00 201.13 ? 531 PHE A CA  1 
ATOM   3808  C C   . PHE A 1 522 ? 10.839  53.661  -109.402 1.00 201.33 ? 531 PHE A C   1 
ATOM   3809  O O   . PHE A 1 522 ? 11.337  54.213  -110.383 1.00 205.43 ? 531 PHE A O   1 
ATOM   3810  C CB  . PHE A 1 522 ? 8.430   54.030  -108.818 1.00 201.22 ? 531 PHE A CB  1 
ATOM   3811  C CG  . PHE A 1 522 ? 7.005   53.777  -109.220 1.00 203.01 ? 531 PHE A CG  1 
ATOM   3812  C CD1 . PHE A 1 522 ? 6.129   53.140  -108.357 1.00 199.71 ? 531 PHE A CD1 1 
ATOM   3813  C CD2 . PHE A 1 522 ? 6.542   54.176  -110.463 1.00 208.30 ? 531 PHE A CD2 1 
ATOM   3814  C CE1 . PHE A 1 522 ? 4.817   52.906  -108.725 1.00 201.62 ? 531 PHE A CE1 1 
ATOM   3815  C CE2 . PHE A 1 522 ? 5.231   53.945  -110.837 1.00 210.28 ? 531 PHE A CE2 1 
ATOM   3816  C CZ  . PHE A 1 522 ? 4.368   53.309  -109.967 1.00 206.91 ? 531 PHE A CZ  1 
ATOM   3817  N N   . ALA A 1 523 ? 11.472  53.540  -108.239 1.00 200.96 ? 532 ALA A N   1 
ATOM   3818  C CA  . ALA A 1 523 ? 12.848  53.987  -108.068 1.00 200.90 ? 532 ALA A CA  1 
ATOM   3819  C C   . ALA A 1 523 ? 13.791  53.063  -108.829 1.00 201.56 ? 532 ALA A C   1 
ATOM   3820  O O   . ALA A 1 523 ? 14.889  53.459  -109.220 1.00 203.44 ? 532 ALA A O   1 
ATOM   3821  C CB  . ALA A 1 523 ? 13.213  54.028  -106.594 1.00 196.48 ? 532 ALA A CB  1 
ATOM   3822  N N   . TYR A 1 524 ? 13.350  51.826  -109.033 1.00 227.27 ? 533 TYR A N   1 
ATOM   3823  C CA  . TYR A 1 524 ? 14.116  50.844  -109.790 1.00 228.18 ? 533 TYR A CA  1 
ATOM   3824  C C   . TYR A 1 524 ? 14.319  51.320  -111.224 1.00 233.70 ? 533 TYR A C   1 
ATOM   3825  O O   . TYR A 1 524 ? 15.447  51.400  -111.709 1.00 235.49 ? 533 TYR A O   1 
ATOM   3826  C CB  . TYR A 1 524 ? 13.400  49.492  -109.772 1.00 226.33 ? 533 TYR A CB  1 
ATOM   3827  C CG  . TYR A 1 524 ? 14.008  48.444  -110.674 1.00 227.97 ? 533 TYR A CG  1 
ATOM   3828  C CD1 . TYR A 1 524 ? 14.961  47.555  -110.194 1.00 225.32 ? 533 TYR A CD1 1 
ATOM   3829  C CD2 . TYR A 1 524 ? 13.621  48.334  -112.003 1.00 232.49 ? 533 TYR A CD2 1 
ATOM   3830  C CE1 . TYR A 1 524 ? 15.516  46.592  -111.014 1.00 227.10 ? 533 TYR A CE1 1 
ATOM   3831  C CE2 . TYR A 1 524 ? 14.169  47.375  -112.831 1.00 234.32 ? 533 TYR A CE2 1 
ATOM   3832  C CZ  . TYR A 1 524 ? 15.115  46.506  -112.332 1.00 231.60 ? 533 TYR A CZ  1 
ATOM   3833  O OH  . TYR A 1 524 ? 15.664  45.550  -113.155 1.00 233.70 ? 533 TYR A OH  1 
ATOM   3834  N N   . ILE A 1 525 ? 13.217  51.636  -111.897 1.00 201.59 ? 534 ILE A N   1 
ATOM   3835  C CA  . ILE A 1 525 ? 13.279  52.172  -113.249 1.00 207.33 ? 534 ILE A CA  1 
ATOM   3836  C C   . ILE A 1 525 ? 13.734  53.626  -113.212 1.00 209.56 ? 534 ILE A C   1 
ATOM   3837  O O   . ILE A 1 525 ? 14.162  54.181  -114.224 1.00 214.29 ? 534 ILE A O   1 
ATOM   3838  C CB  . ILE A 1 525 ? 11.915  52.087  -113.960 1.00 210.21 ? 534 ILE A CB  1 
ATOM   3839  C CG1 . ILE A 1 525 ? 10.920  53.063  -113.330 1.00 209.82 ? 534 ILE A CG1 1 
ATOM   3840  C CG2 . ILE A 1 525 ? 11.380  50.663  -113.918 1.00 208.07 ? 534 ILE A CG2 1 
ATOM   3841  C CD1 . ILE A 1 525 ? 9.571   53.085  -114.014 1.00 213.09 ? 534 ILE A CD1 1 
ATOM   3842  N N   . GLY A 1 526 ? 13.640  54.237  -112.034 1.00 219.24 ? 535 GLY A N   1 
ATOM   3843  C CA  . GLY A 1 526 ? 14.070  55.610  -111.848 1.00 221.13 ? 535 GLY A CA  1 
ATOM   3844  C C   . GLY A 1 526 ? 15.580  55.730  -111.843 1.00 221.28 ? 535 GLY A C   1 
ATOM   3845  O O   . GLY A 1 526 ? 16.129  56.814  -112.041 1.00 224.21 ? 535 GLY A O   1 
ATOM   3846  N N   . VAL A 1 527 ? 16.254  54.608  -111.612 1.00 249.79 ? 536 VAL A N   1 
ATOM   3847  C CA  . VAL A 1 527 ? 17.711  54.570  -111.628 1.00 250.01 ? 536 VAL A CA  1 
ATOM   3848  C C   . VAL A 1 527 ? 18.219  54.069  -112.976 1.00 253.98 ? 536 VAL A C   1 
ATOM   3849  O O   . VAL A 1 527 ? 19.239  54.540  -113.481 1.00 256.97 ? 536 VAL A O   1 
ATOM   3850  C CB  . VAL A 1 527 ? 18.265  53.674  -110.504 1.00 244.73 ? 536 VAL A CB  1 
ATOM   3851  C CG1 . VAL A 1 527 ? 19.763  53.465  -110.675 1.00 245.47 ? 536 VAL A CG1 1 
ATOM   3852  C CG2 . VAL A 1 527 ? 17.958  54.282  -109.145 1.00 241.32 ? 536 VAL A CG2 1 
ATOM   3853  N N   . SER A 1 528 ? 17.497  53.117  -113.558 1.00 232.29 ? 537 SER A N   1 
ATOM   3854  C CA  . SER A 1 528 ? 17.859  52.571  -114.860 1.00 236.34 ? 537 SER A CA  1 
ATOM   3855  C C   . SER A 1 528 ? 17.655  53.606  -115.961 1.00 242.35 ? 537 SER A C   1 
ATOM   3856  O O   . SER A 1 528 ? 18.157  53.448  -117.074 1.00 246.65 ? 537 SER A O   1 
ATOM   3857  C CB  . SER A 1 528 ? 17.046  51.310  -115.161 1.00 235.40 ? 537 SER A CB  1 
ATOM   3858  O OG  . SER A 1 528 ? 15.661  51.600  -115.230 1.00 236.02 ? 537 SER A OG  1 
ATOM   3859  N N   . VAL A 1 529 ? 16.913  54.664  -115.646 1.00 222.73 ? 538 VAL A N   1 
ATOM   3860  C CA  . VAL A 1 529 ? 16.692  55.751  -116.593 1.00 228.60 ? 538 VAL A CA  1 
ATOM   3861  C C   . VAL A 1 529 ? 17.734  56.848  -116.399 1.00 230.17 ? 538 VAL A C   1 
ATOM   3862  O O   . VAL A 1 529 ? 18.137  57.512  -117.355 1.00 235.55 ? 538 VAL A O   1 
ATOM   3863  C CB  . VAL A 1 529 ? 15.275  56.348  -116.465 1.00 229.29 ? 538 VAL A CB  1 
ATOM   3864  C CG1 . VAL A 1 529 ? 15.100  57.024  -115.115 1.00 225.34 ? 538 VAL A CG1 1 
ATOM   3865  C CG2 . VAL A 1 529 ? 15.008  57.329  -117.596 1.00 236.07 ? 538 VAL A CG2 1 
ATOM   3866  N N   . VAL A 1 530 ? 18.170  57.032  -115.156 1.00 228.50 ? 539 VAL A N   1 
ATOM   3867  C CA  . VAL A 1 530 ? 19.220  57.994  -114.846 1.00 229.67 ? 539 VAL A CA  1 
ATOM   3868  C C   . VAL A 1 530 ? 20.555  57.509  -115.401 1.00 231.22 ? 539 VAL A C   1 
ATOM   3869  O O   . VAL A 1 530 ? 21.328  58.285  -115.963 1.00 235.47 ? 539 VAL A O   1 
ATOM   3870  C CB  . VAL A 1 530 ? 19.347  58.229  -113.329 1.00 224.57 ? 539 VAL A CB  1 
ATOM   3871  C CG1 . VAL A 1 530 ? 20.657  58.930  -113.004 1.00 225.51 ? 539 VAL A CG1 1 
ATOM   3872  C CG2 . VAL A 1 530 ? 18.162  59.034  -112.817 1.00 224.23 ? 539 VAL A CG2 1 
ATOM   3873  N N   . LEU A 1 531 ? 20.815  56.215  -115.240 1.00 269.36 ? 540 LEU A N   1 
ATOM   3874  C CA  . LEU A 1 531 ? 22.010  55.597  -115.799 1.00 270.89 ? 540 LEU A CA  1 
ATOM   3875  C C   . LEU A 1 531 ? 21.942  55.613  -117.321 1.00 276.95 ? 540 LEU A C   1 
ATOM   3876  O O   . LEU A 1 531 ? 22.962  55.737  -117.999 1.00 280.55 ? 540 LEU A O   1 
ATOM   3877  C CB  . LEU A 1 531 ? 22.151  54.158  -115.299 1.00 266.35 ? 540 LEU A CB  1 
ATOM   3878  C CG  . LEU A 1 531 ? 22.379  53.963  -113.799 1.00 260.53 ? 540 LEU A CG  1 
ATOM   3879  C CD1 . LEU A 1 531 ? 22.230  52.497  -113.419 1.00 256.58 ? 540 LEU A CD1 1 
ATOM   3880  C CD2 . LEU A 1 531 ? 23.743  54.495  -113.387 1.00 260.92 ? 540 LEU A CD2 1 
ATOM   3881  N N   . PHE A 1 532 ? 20.730  55.486  -117.851 1.00 231.75 ? 541 PHE A N   1 
ATOM   3882  C CA  . PHE A 1 532 ? 20.512  55.489  -119.292 1.00 237.77 ? 541 PHE A CA  1 
ATOM   3883  C C   . PHE A 1 532 ? 20.919  56.819  -119.917 1.00 243.34 ? 541 PHE A C   1 
ATOM   3884  O O   . PHE A 1 532 ? 21.278  56.879  -121.094 1.00 248.86 ? 541 PHE A O   1 
ATOM   3885  C CB  . PHE A 1 532 ? 19.046  55.182  -119.610 1.00 238.12 ? 541 PHE A CB  1 
ATOM   3886  C CG  . PHE A 1 532 ? 18.679  55.400  -121.049 1.00 244.89 ? 541 PHE A CG  1 
ATOM   3887  C CD1 . PHE A 1 532 ? 19.100  54.516  -122.028 1.00 247.80 ? 541 PHE A CD1 1 
ATOM   3888  C CD2 . PHE A 1 532 ? 17.909  56.489  -121.423 1.00 248.69 ? 541 PHE A CD2 1 
ATOM   3889  C CE1 . PHE A 1 532 ? 18.763  54.715  -123.355 1.00 254.40 ? 541 PHE A CE1 1 
ATOM   3890  C CE2 . PHE A 1 532 ? 17.568  56.694  -122.748 1.00 255.30 ? 541 PHE A CE2 1 
ATOM   3891  C CZ  . PHE A 1 532 ? 17.996  55.806  -123.714 1.00 258.17 ? 541 PHE A CZ  1 
ATOM   3892  N N   . LEU A 1 533 ? 20.863  57.884  -119.123 1.00 260.33 ? 542 LEU A N   1 
ATOM   3893  C CA  . LEU A 1 533 ? 21.225  59.214  -119.600 1.00 265.58 ? 542 LEU A CA  1 
ATOM   3894  C C   . LEU A 1 533 ? 22.729  59.448  -119.507 1.00 266.46 ? 542 LEU A C   1 
ATOM   3895  O O   . LEU A 1 533 ? 23.249  60.424  -120.048 1.00 271.49 ? 542 LEU A O   1 
ATOM   3896  C CB  . LEU A 1 533 ? 20.477  60.289  -118.809 1.00 264.48 ? 542 LEU A CB  1 
ATOM   3897  C CG  . LEU A 1 533 ? 18.949  60.229  -118.855 1.00 264.08 ? 542 LEU A CG  1 
ATOM   3898  C CD1 . LEU A 1 533 ? 18.344  61.352  -118.026 1.00 263.29 ? 542 LEU A CD1 1 
ATOM   3899  C CD2 . LEU A 1 533 ? 18.449  60.288  -120.290 1.00 270.43 ? 542 LEU A CD2 1 
ATOM   3900  N N   . VAL A 1 534 ? 23.424  58.547  -118.820 1.00 276.18 ? 543 VAL A N   1 
ATOM   3901  C CA  . VAL A 1 534 ? 24.867  58.662  -118.645 1.00 276.71 ? 543 VAL A CA  1 
ATOM   3902  C C   . VAL A 1 534 ? 25.623  58.248  -119.906 1.00 281.75 ? 543 VAL A C   1 
ATOM   3903  O O   . VAL A 1 534 ? 26.494  58.975  -120.385 1.00 286.23 ? 543 VAL A O   1 
ATOM   3904  C CB  . VAL A 1 534 ? 25.361  57.815  -117.456 1.00 270.32 ? 543 VAL A CB  1 
ATOM   3905  C CG1 . VAL A 1 534 ? 26.878  57.871  -117.357 1.00 271.40 ? 543 VAL A CG1 1 
ATOM   3906  C CG2 . VAL A 1 534 ? 24.718  58.293  -116.164 1.00 265.72 ? 543 VAL A CG2 1 
ATOM   3907  N N   . SER A 1 535 ? 25.284  57.078  -120.439 1.00 271.37 ? 544 SER A N   1 
ATOM   3908  C CA  . SER A 1 535 ? 25.932  56.567  -121.642 1.00 276.20 ? 544 SER A CA  1 
ATOM   3909  C C   . SER A 1 535 ? 25.643  57.458  -122.845 1.00 283.37 ? 544 SER A C   1 
ATOM   3910  O O   . SER A 1 535 ? 26.547  58.090  -123.392 1.00 288.07 ? 544 SER A O   1 
ATOM   3911  C CB  . SER A 1 535 ? 25.481  55.133  -121.929 1.00 274.31 ? 544 SER A CB  1 
ATOM   3912  O OG  . SER A 1 535 ? 24.095  55.081  -122.218 1.00 274.53 ? 544 SER A OG  1 
ATOM   3913  N N   . THR A 1 559 ? 20.342  54.904  -134.226 1.00 347.29 ? 568 THR A N   1 
ATOM   3914  C CA  . THR A 1 559 ? 20.437  55.638  -132.971 1.00 341.20 ? 568 THR A CA  1 
ATOM   3915  C C   . THR A 1 559 ? 19.320  55.242  -132.011 1.00 334.63 ? 568 THR A C   1 
ATOM   3916  O O   . THR A 1 559 ? 19.494  55.275  -130.792 1.00 327.70 ? 568 THR A O   1 
ATOM   3917  C CB  . THR A 1 559 ? 20.388  57.160  -133.201 1.00 345.72 ? 568 THR A CB  1 
ATOM   3918  N N   . ASN A 1 560 ? 18.172  54.868  -132.568 1.00 308.99 ? 569 ASN A N   1 
ATOM   3919  C CA  . ASN A 1 560 ? 17.029  54.453  -131.764 1.00 303.55 ? 569 ASN A CA  1 
ATOM   3920  C C   . ASN A 1 560 ? 17.249  53.087  -131.122 1.00 297.37 ? 569 ASN A C   1 
ATOM   3921  O O   . ASN A 1 560 ? 16.855  52.857  -129.977 1.00 290.50 ? 569 ASN A O   1 
ATOM   3922  C CB  . ASN A 1 560 ? 15.755  54.437  -132.611 1.00 308.73 ? 569 ASN A CB  1 
ATOM   3923  N N   . GLU A 1 561 ? 17.880  52.186  -131.868 1.00 378.36 ? 570 GLU A N   1 
ATOM   3924  C CA  . GLU A 1 561 ? 18.183  50.850  -131.367 1.00 373.39 ? 570 GLU A CA  1 
ATOM   3925  C C   . GLU A 1 561 ? 19.325  50.899  -130.358 1.00 367.80 ? 570 GLU A C   1 
ATOM   3926  O O   . GLU A 1 561 ? 19.370  50.106  -129.417 1.00 361.43 ? 570 GLU A O   1 
ATOM   3927  C CB  . GLU A 1 561 ? 18.539  49.912  -132.522 1.00 378.80 ? 570 GLU A CB  1 
ATOM   3928  N N   . PHE A 1 562 ? 20.247  51.835  -130.563 1.00 294.68 ? 571 PHE A N   1 
ATOM   3929  C CA  . PHE A 1 562 ? 21.369  52.020  -129.651 1.00 290.18 ? 571 PHE A CA  1 
ATOM   3930  C C   . PHE A 1 562 ? 20.870  52.401  -128.261 1.00 283.07 ? 571 PHE A C   1 
ATOM   3931  O O   . PHE A 1 562 ? 21.539  52.149  -127.258 1.00 277.57 ? 571 PHE A O   1 
ATOM   3932  C CB  . PHE A 1 562 ? 22.321  53.092  -130.183 1.00 295.23 ? 571 PHE A CB  1 
ATOM   3933  N N   . GLY A 1 563 ? 19.689  53.010  -128.211 1.00 297.85 ? 572 GLY A N   1 
ATOM   3934  C CA  . GLY A 1 563 ? 19.073  53.380  -126.951 1.00 291.69 ? 572 GLY A CA  1 
ATOM   3935  C C   . GLY A 1 563 ? 18.330  52.213  -126.329 1.00 286.42 ? 572 GLY A C   1 
ATOM   3936  O O   . GLY A 1 563 ? 18.119  52.172  -125.117 1.00 280.15 ? 572 GLY A O   1 
ATOM   3937  N N   . ILE A 1 564 ? 17.930  51.261  -127.167 1.00 294.12 ? 573 ILE A N   1 
ATOM   3938  C CA  . ILE A 1 564 ? 17.230  50.071  -126.699 1.00 289.93 ? 573 ILE A CA  1 
ATOM   3939  C C   . ILE A 1 564 ? 18.209  49.073  -126.091 1.00 285.50 ? 573 ILE A C   1 
ATOM   3940  O O   . ILE A 1 564 ? 17.946  48.495  -125.036 1.00 279.40 ? 573 ILE A O   1 
ATOM   3941  C CB  . ILE A 1 564 ? 16.455  49.386  -127.841 1.00 295.10 ? 573 ILE A CB  1 
ATOM   3942  N N   . PHE A 1 565 ? 19.338  48.875  -126.764 1.00 331.75 ? 574 PHE A N   1 
ATOM   3943  C CA  . PHE A 1 565 ? 20.374  47.974  -126.276 1.00 328.41 ? 574 PHE A CA  1 
ATOM   3944  C C   . PHE A 1 565 ? 20.948  48.481  -124.958 1.00 322.53 ? 574 PHE A C   1 
ATOM   3945  O O   . PHE A 1 565 ? 21.311  47.695  -124.083 1.00 317.46 ? 574 PHE A O   1 
ATOM   3946  C CB  . PHE A 1 565 ? 21.489  47.827  -127.314 1.00 333.99 ? 574 PHE A CB  1 
ATOM   3947  N N   . ASN A 1 566 ? 21.025  49.802  -124.827 1.00 272.79 ? 575 ASN A N   1 
ATOM   3948  C CA  . ASN A 1 566 ? 21.524  50.424  -123.607 1.00 267.89 ? 575 ASN A CA  1 
ATOM   3949  C C   . ASN A 1 566 ? 20.497  50.362  -122.482 1.00 262.06 ? 575 ASN A C   1 
ATOM   3950  O O   . ASN A 1 566 ? 20.841  50.100  -121.329 1.00 256.51 ? 575 ASN A O   1 
ATOM   3951  C CB  . ASN A 1 566 ? 21.928  51.875  -123.872 1.00 271.49 ? 575 ASN A CB  1 
ATOM   3952  N N   . SER A 1 567 ? 19.235  50.604  -122.824 1.00 333.20 ? 576 SER A N   1 
ATOM   3953  C CA  . SER A 1 567 ? 18.151  50.547  -121.850 1.00 328.34 ? 576 SER A CA  1 
ATOM   3954  C C   . SER A 1 567 ? 17.999  49.134  -121.300 1.00 323.88 ? 576 SER A C   1 
ATOM   3955  O O   . SER A 1 567 ? 17.511  48.939  -120.187 1.00 318.55 ? 576 SER A O   1 
ATOM   3956  C CB  . SER A 1 567 ? 16.836  51.012  -122.480 1.00 331.87 ? 576 SER A CB  1 
ATOM   3957  N N   . LEU A 1 568 ? 18.420  48.151  -122.091 1.00 360.60 ? 577 LEU A N   1 
ATOM   3958  C CA  . LEU A 1 568 ? 18.386  46.758  -121.668 1.00 357.12 ? 577 LEU A CA  1 
ATOM   3959  C C   . LEU A 1 568 ? 19.628  46.420  -120.852 1.00 353.37 ? 577 LEU A C   1 
ATOM   3960  O O   . LEU A 1 568 ? 19.630  45.473  -120.064 1.00 348.99 ? 577 LEU A O   1 
ATOM   3961  C CB  . LEU A 1 568 ? 18.283  45.831  -122.879 1.00 361.90 ? 577 LEU A CB  1 
ATOM   3962  N N   . TRP A 1 569 ? 20.685  47.203  -121.049 1.00 340.59 ? 578 TRP A N   1 
ATOM   3963  C CA  . TRP A 1 569 ? 21.924  47.025  -120.302 1.00 337.64 ? 578 TRP A CA  1 
ATOM   3964  C C   . TRP A 1 569 ? 21.815  47.678  -118.929 1.00 332.33 ? 578 TRP A C   1 
ATOM   3965  O O   . TRP A 1 569 ? 22.322  47.152  -117.937 1.00 327.90 ? 578 TRP A O   1 
ATOM   3966  C CB  . TRP A 1 569 ? 23.105  47.615  -121.076 1.00 342.37 ? 578 TRP A CB  1 
ATOM   3967  N N   . PHE A 1 570 ? 21.148  48.827  -118.879 1.00 273.35 ? 579 PHE A N   1 
ATOM   3968  C CA  . PHE A 1 570 ? 20.924  49.529  -117.622 1.00 268.87 ? 579 PHE A CA  1 
ATOM   3969  C C   . PHE A 1 570 ? 19.843  48.816  -116.814 1.00 264.25 ? 579 PHE A C   1 
ATOM   3970  O O   . PHE A 1 570 ? 19.775  48.957  -115.590 1.00 259.55 ? 579 PHE A O   1 
ATOM   3971  C CB  . PHE A 1 570 ? 20.519  50.981  -117.877 1.00 271.75 ? 579 PHE A CB  1 
ATOM   3972  N N   . SER A 1 571 ? 18.999  48.055  -117.508 1.00 235.22 ? 580 SER A N   1 
ATOM   3973  C CA  . SER A 1 571 ? 17.984  47.239  -116.854 1.00 231.40 ? 580 SER A CA  1 
ATOM   3974  C C   . SER A 1 571 ? 18.631  45.986  -116.278 1.00 228.01 ? 580 SER A C   1 
ATOM   3975  O O   . SER A 1 571 ? 18.091  45.358  -115.367 1.00 223.74 ? 580 SER A O   1 
ATOM   3976  C CB  . SER A 1 571 ? 16.883  46.861  -117.844 1.00 234.93 ? 580 SER A CB  1 
ATOM   3977  N N   . LEU A 1 572 ? 19.788  45.626  -116.827 1.00 249.34 ? 581 LEU A N   1 
ATOM   3978  C CA  . LEU A 1 572 ? 20.577  44.515  -116.313 1.00 246.72 ? 581 LEU A CA  1 
ATOM   3979  C C   . LEU A 1 572 ? 21.443  45.012  -115.164 1.00 243.08 ? 581 LEU A C   1 
ATOM   3980  O O   . LEU A 1 572 ? 21.746  44.270  -114.227 1.00 239.18 ? 581 LEU A O   1 
ATOM   3981  C CB  . LEU A 1 572 ? 21.449  43.919  -117.418 1.00 251.16 ? 581 LEU A CB  1 
ATOM   3982  N N   . GLY A 1 573 ? 21.845  46.277  -115.248 1.00 213.19 ? 582 GLY A N   1 
ATOM   3983  C CA  . GLY A 1 573 ? 22.522  46.935  -114.148 1.00 210.12 ? 582 GLY A CA  1 
ATOM   3984  C C   . GLY A 1 573 ? 21.504  47.264  -113.076 1.00 205.95 ? 582 GLY A C   1 
ATOM   3985  O O   . GLY A 1 573 ? 21.854  47.625  -111.952 1.00 202.61 ? 582 GLY A O   1 
ATOM   3986  N N   . ALA A 1 574 ? 20.231  47.139  -113.441 1.00 332.77 ? 583 ALA A N   1 
ATOM   3987  C CA  . ALA A 1 574 ? 19.127  47.339  -112.511 1.00 329.20 ? 583 ALA A CA  1 
ATOM   3988  C C   . ALA A 1 574 ? 18.821  46.031  -111.792 1.00 325.29 ? 583 ALA A C   1 
ATOM   3989  O O   . ALA A 1 574 ? 18.926  45.954  -110.565 1.00 321.12 ? 583 ALA A O   1 
ATOM   3990  C CB  . ALA A 1 574 ? 17.900  47.847  -113.247 1.00 332.01 ? 583 ALA A CB  1 
ATOM   3991  N N   . PHE A 1 575 ? 18.434  45.012  -112.560 1.00 338.30 ? 584 PHE A N   1 
ATOM   3992  C CA  . PHE A 1 575 ? 18.338  43.654  -112.038 1.00 335.45 ? 584 PHE A CA  1 
ATOM   3993  C C   . PHE A 1 575 ? 19.586  43.440  -111.191 1.00 332.89 ? 584 PHE A C   1 
ATOM   3994  O O   . PHE A 1 575 ? 20.688  43.282  -111.719 1.00 335.11 ? 584 PHE A O   1 
ATOM   3995  C CB  . PHE A 1 575 ? 18.265  42.637  -113.180 1.00 338.87 ? 584 PHE A CB  1 
ATOM   3996  N N   . MET A 1 576 ? 19.402  43.445  -109.875 1.00 198.58 ? 585 MET A N   1 
ATOM   3997  C CA  . MET A 1 576 ? 20.481  43.758  -108.936 1.00 196.36 ? 585 MET A CA  1 
ATOM   3998  C C   . MET A 1 576 ? 21.615  42.744  -108.790 1.00 195.99 ? 585 MET A C   1 
ATOM   3999  O O   . MET A 1 576 ? 21.495  41.578  -109.165 1.00 196.52 ? 585 MET A O   1 
ATOM   4000  C CB  . MET A 1 576 ? 19.902  44.084  -107.554 1.00 192.10 ? 585 MET A CB  1 
ATOM   4001  N N   . GLN A 1 577 ? 22.720  43.234  -108.233 1.00 184.92 ? 586 GLN A N   1 
ATOM   4002  C CA  . GLN A 1 577 ? 23.856  42.415  -107.828 1.00 184.22 ? 586 GLN A CA  1 
ATOM   4003  C C   . GLN A 1 577 ? 24.471  43.009  -106.562 1.00 181.50 ? 586 GLN A C   1 
ATOM   4004  O O   . GLN A 1 577 ? 24.105  44.110  -106.140 1.00 180.68 ? 586 GLN A O   1 
ATOM   4005  C CB  . GLN A 1 577 ? 24.903  42.340  -108.941 1.00 188.45 ? 586 GLN A CB  1 
ATOM   4006  N N   . PRO A 1 584 ? 33.668  52.209  -115.865 1.00 273.11 ? 593 PRO A N   1 
ATOM   4007  C CA  . PRO A 1 584 ? 34.717  52.389  -114.856 1.00 271.44 ? 593 PRO A CA  1 
ATOM   4008  C C   . PRO A 1 584 ? 34.334  53.422  -113.799 1.00 268.70 ? 593 PRO A C   1 
ATOM   4009  O O   . PRO A 1 584 ? 33.223  53.378  -113.266 1.00 264.93 ? 593 PRO A O   1 
ATOM   4010  C CB  . PRO A 1 584 ? 35.903  52.891  -115.681 1.00 277.35 ? 593 PRO A CB  1 
ATOM   4011  C CG  . PRO A 1 584 ? 35.698  52.281  -117.022 1.00 281.07 ? 593 PRO A CG  1 
ATOM   4012  C CD  . PRO A 1 584 ? 34.208  52.233  -117.236 1.00 279.26 ? 593 PRO A CD  1 
ATOM   4013  N N   . ARG A 1 585 ? 35.248  54.342  -113.507 1.00 308.20 ? 594 ARG A N   1 
ATOM   4014  C CA  . ARG A 1 585 ? 35.027  55.341  -112.467 1.00 306.09 ? 594 ARG A CA  1 
ATOM   4015  C C   . ARG A 1 585 ? 34.345  56.598  -112.997 1.00 309.13 ? 594 ARG A C   1 
ATOM   4016  O O   . ARG A 1 585 ? 34.893  57.695  -112.907 1.00 312.04 ? 594 ARG A O   1 
ATOM   4017  C CB  . ARG A 1 585 ? 36.349  55.707  -111.787 1.00 307.00 ? 594 ARG A CB  1 
ATOM   4018  N N   . SER A 1 586 ? 33.148  56.432  -113.548 1.00 255.92 ? 595 SER A N   1 
ATOM   4019  C CA  . SER A 1 586 ? 32.341  57.570  -113.970 1.00 258.50 ? 595 SER A CA  1 
ATOM   4020  C C   . SER A 1 586 ? 31.608  58.140  -112.760 1.00 254.44 ? 595 SER A C   1 
ATOM   4021  O O   . SER A 1 586 ? 30.473  57.767  -112.473 1.00 251.06 ? 595 SER A O   1 
ATOM   4022  C CB  . SER A 1 586 ? 31.340  57.159  -115.050 1.00 260.08 ? 595 SER A CB  1 
ATOM   4023  O OG  . SER A 1 586 ? 30.530  56.076  -114.622 1.00 255.20 ? 595 SER A OG  1 
ATOM   4024  N N   . LEU A 1 587 ? 32.275  59.046  -112.054 1.00 246.44 ? 596 LEU A N   1 
ATOM   4025  C CA  . LEU A 1 587 ? 31.776  59.597  -110.793 1.00 242.87 ? 596 LEU A CA  1 
ATOM   4026  C C   . LEU A 1 587 ? 30.272  59.859  -110.795 1.00 241.36 ? 596 LEU A C   1 
ATOM   4027  O O   . LEU A 1 587 ? 29.589  59.586  -109.810 1.00 236.70 ? 596 LEU A O   1 
ATOM   4028  C CB  . LEU A 1 587 ? 32.534  60.880  -110.432 1.00 245.98 ? 596 LEU A CB  1 
ATOM   4029  C CG  . LEU A 1 587 ? 32.293  61.414  -109.018 1.00 242.64 ? 596 LEU A CG  1 
ATOM   4030  C CD1 . LEU A 1 587 ? 32.705  60.381  -107.984 1.00 237.72 ? 596 LEU A CD1 1 
ATOM   4031  C CD2 . LEU A 1 587 ? 33.042  62.720  -108.806 1.00 246.61 ? 596 LEU A CD2 1 
ATOM   4032  N N   . SER A 1 588 ? 29.764  60.394  -111.901 1.00 228.35 ? 597 SER A N   1 
ATOM   4033  C CA  . SER A 1 588 ? 28.339  60.685  -112.026 1.00 227.74 ? 597 SER A CA  1 
ATOM   4034  C C   . SER A 1 588 ? 27.484  59.474  -111.660 1.00 222.62 ? 597 SER A C   1 
ATOM   4035  O O   . SER A 1 588 ? 26.897  59.420  -110.578 1.00 218.32 ? 597 SER A O   1 
ATOM   4036  C CB  . SER A 1 588 ? 28.005  61.149  -113.445 1.00 233.43 ? 597 SER A CB  1 
ATOM   4037  O OG  . SER A 1 588 ? 26.610  61.344  -113.601 1.00 233.03 ? 597 SER A OG  1 
ATOM   4038  N N   . GLY A 1 589 ? 27.423  58.502  -112.566 1.00 226.56 ? 598 GLY A N   1 
ATOM   4039  C CA  . GLY A 1 589 ? 26.641  57.300  -112.345 1.00 222.36 ? 598 GLY A CA  1 
ATOM   4040  C C   . GLY A 1 589 ? 27.234  56.399  -111.279 1.00 217.54 ? 598 GLY A C   1 
ATOM   4041  O O   . GLY A 1 589 ? 26.616  55.416  -110.872 1.00 213.63 ? 598 GLY A O   1 
ATOM   4042  N N   . ARG A 1 590 ? 28.438  56.737  -110.827 1.00 215.88 ? 599 ARG A N   1 
ATOM   4043  C CA  . ARG A 1 590 ? 29.120  55.955  -109.803 1.00 211.93 ? 599 ARG A CA  1 
ATOM   4044  C C   . ARG A 1 590 ? 28.406  56.061  -108.459 1.00 207.18 ? 599 ARG A C   1 
ATOM   4045  O O   . ARG A 1 590 ? 28.092  55.049  -107.832 1.00 203.04 ? 599 ARG A O   1 
ATOM   4046  C CB  . ARG A 1 590 ? 30.575  56.405  -109.664 1.00 214.34 ? 599 ARG A CB  1 
ATOM   4047  N N   . ILE A 1 591 ? 28.151  57.290  -108.020 1.00 214.99 ? 600 ILE A N   1 
ATOM   4048  C CA  . ILE A 1 591 ? 27.466  57.517  -106.753 1.00 211.07 ? 600 ILE A CA  1 
ATOM   4049  C C   . ILE A 1 591 ? 26.019  57.041  -106.824 1.00 208.68 ? 600 ILE A C   1 
ATOM   4050  O O   . ILE A 1 591 ? 25.400  56.758  -105.800 1.00 204.67 ? 600 ILE A O   1 
ATOM   4051  C CB  . ILE A 1 591 ? 27.503  59.001  -106.336 1.00 213.25 ? 600 ILE A CB  1 
ATOM   4052  C CG1 . ILE A 1 591 ? 26.719  59.861  -107.331 1.00 217.14 ? 600 ILE A CG1 1 
ATOM   4053  C CG2 . ILE A 1 591 ? 28.940  59.486  -106.214 1.00 215.81 ? 600 ILE A CG2 1 
ATOM   4054  C CD1 . ILE A 1 591 ? 26.651  61.324  -106.948 1.00 219.60 ? 600 ILE A CD1 1 
ATOM   4055  N N   . VAL A 1 592 ? 25.486  56.957  -108.039 1.00 205.34 ? 601 VAL A N   1 
ATOM   4056  C CA  . VAL A 1 592 ? 24.141  56.436  -108.248 1.00 203.67 ? 601 VAL A CA  1 
ATOM   4057  C C   . VAL A 1 592 ? 24.078  54.963  -107.864 1.00 199.62 ? 601 VAL A C   1 
ATOM   4058  O O   . VAL A 1 592 ? 23.155  54.530  -107.172 1.00 196.07 ? 601 VAL A O   1 
ATOM   4059  C CB  . VAL A 1 592 ? 23.690  56.596  -109.712 1.00 208.12 ? 601 VAL A CB  1 
ATOM   4060  C CG1 . VAL A 1 592 ? 22.517  55.675  -110.012 1.00 206.38 ? 601 VAL A CG1 1 
ATOM   4061  C CG2 . VAL A 1 592 ? 23.329  58.044  -110.000 1.00 211.84 ? 601 VAL A CG2 1 
ATOM   4062  N N   . GLY A 1 593 ? 25.067  54.198  -108.315 1.00 203.79 ? 602 GLY A N   1 
ATOM   4063  C CA  . GLY A 1 593 ? 25.149  52.787  -107.990 1.00 200.51 ? 602 GLY A CA  1 
ATOM   4064  C C   . GLY A 1 593 ? 25.392  52.561  -106.511 1.00 196.18 ? 602 GLY A C   1 
ATOM   4065  O O   . GLY A 1 593 ? 24.914  51.583  -105.936 1.00 192.64 ? 602 GLY A O   1 
ATOM   4066  N N   . GLY A 1 594 ? 26.138  53.472  -105.893 1.00 214.82 ? 603 GLY A N   1 
ATOM   4067  C CA  . GLY A 1 594 ? 26.432  53.386  -104.475 1.00 211.32 ? 603 GLY A CA  1 
ATOM   4068  C C   . GLY A 1 594 ? 25.226  53.713  -103.615 1.00 208.48 ? 603 GLY A C   1 
ATOM   4069  O O   . GLY A 1 594 ? 24.906  52.984  -102.676 1.00 204.72 ? 603 GLY A O   1 
ATOM   4070  N N   . VAL A 1 595 ? 24.554  54.813  -103.940 1.00 189.17 ? 604 VAL A N   1 
ATOM   4071  C CA  . VAL A 1 595 ? 23.368  55.234  -103.203 1.00 187.10 ? 604 VAL A CA  1 
ATOM   4072  C C   . VAL A 1 595 ? 22.225  54.239  -103.381 1.00 184.80 ? 604 VAL A C   1 
ATOM   4073  O O   . VAL A 1 595 ? 21.502  53.936  -102.431 1.00 181.48 ? 604 VAL A O   1 
ATOM   4074  C CB  . VAL A 1 595 ? 22.901  56.640  -103.632 1.00 190.52 ? 604 VAL A CB  1 
ATOM   4075  C CG1 . VAL A 1 595 ? 21.533  56.950  -103.045 1.00 188.73 ? 604 VAL A CG1 1 
ATOM   4076  C CG2 . VAL A 1 595 ? 23.918  57.687  -103.205 1.00 192.54 ? 604 VAL A CG2 1 
ATOM   4077  N N   . TRP A 1 596 ? 22.069  53.731  -104.599 1.00 191.16 ? 605 TRP A N   1 
ATOM   4078  C CA  . TRP A 1 596 ? 21.049  52.727  -104.879 1.00 189.52 ? 605 TRP A CA  1 
ATOM   4079  C C   . TRP A 1 596 ? 21.326  51.444  -104.104 1.00 185.72 ? 605 TRP A C   1 
ATOM   4080  O O   . TRP A 1 596 ? 20.402  50.753  -103.675 1.00 183.07 ? 605 TRP A O   1 
ATOM   4081  C CB  . TRP A 1 596 ? 20.976  52.431  -106.377 1.00 193.06 ? 605 TRP A CB  1 
ATOM   4082  C CG  . TRP A 1 596 ? 20.123  51.245  -106.707 1.00 191.69 ? 605 TRP A CG  1 
ATOM   4083  C CD1 . TRP A 1 596 ? 20.551  49.992  -107.035 1.00 191.11 ? 605 TRP A CD1 1 
ATOM   4084  C CD2 . TRP A 1 596 ? 18.690  51.198  -106.731 1.00 191.04 ? 605 TRP A CD2 1 
ATOM   4085  N NE1 . TRP A 1 596 ? 19.476  49.169  -107.267 1.00 190.18 ? 605 TRP A NE1 1 
ATOM   4086  C CE2 . TRP A 1 596 ? 18.322  49.885  -107.087 1.00 190.10 ? 605 TRP A CE2 1 
ATOM   4087  C CE3 . TRP A 1 596 ? 17.685  52.139  -106.489 1.00 191.44 ? 605 TRP A CE3 1 
ATOM   4088  C CZ2 . TRP A 1 596 ? 16.991  49.490  -107.207 1.00 189.54 ? 605 TRP A CZ2 1 
ATOM   4089  C CZ3 . TRP A 1 596 ? 16.365  51.744  -106.608 1.00 190.85 ? 605 TRP A CZ3 1 
ATOM   4090  C CH2 . TRP A 1 596 ? 16.030  50.432  -106.964 1.00 189.90 ? 605 TRP A CH2 1 
ATOM   4091  N N   . TRP A 1 597 ? 22.606  51.131  -103.930 1.00 201.43 ? 606 TRP A N   1 
ATOM   4092  C CA  . TRP A 1 597 ? 23.012  49.958  -103.167 1.00 198.29 ? 606 TRP A CA  1 
ATOM   4093  C C   . TRP A 1 597 ? 22.687  50.140  -101.689 1.00 194.85 ? 606 TRP A C   1 
ATOM   4094  O O   . TRP A 1 597 ? 22.186  49.226  -101.035 1.00 191.85 ? 606 TRP A O   1 
ATOM   4095  C CB  . TRP A 1 597 ? 24.507  49.692  -103.347 1.00 199.72 ? 606 TRP A CB  1 
ATOM   4096  C CG  . TRP A 1 597 ? 25.007  48.523  -102.557 1.00 196.96 ? 606 TRP A CG  1 
ATOM   4097  C CD1 . TRP A 1 597 ? 25.119  47.232  -102.985 1.00 196.67 ? 606 TRP A CD1 1 
ATOM   4098  C CD2 . TRP A 1 597 ? 25.466  48.537  -101.200 1.00 194.47 ? 606 TRP A CD2 1 
ATOM   4099  N NE1 . TRP A 1 597 ? 25.619  46.441  -101.979 1.00 194.16 ? 606 TRP A NE1 1 
ATOM   4100  C CE2 . TRP A 1 597 ? 25.840  47.219  -100.872 1.00 192.78 ? 606 TRP A CE2 1 
ATOM   4101  C CE3 . TRP A 1 597 ? 25.597  49.536  -100.230 1.00 193.80 ? 606 TRP A CE3 1 
ATOM   4102  C CZ2 . TRP A 1 597 ? 26.335  46.873  -99.616  1.00 190.51 ? 606 TRP A CZ2 1 
ATOM   4103  C CZ3 . TRP A 1 597 ? 26.089  49.192  -98.984  1.00 191.53 ? 606 TRP A CZ3 1 
ATOM   4104  C CH2 . TRP A 1 597 ? 26.452  47.872  -98.688  1.00 189.93 ? 606 TRP A CH2 1 
ATOM   4105  N N   . PHE A 1 598 ? 22.982  51.326  -101.167 1.00 194.28 ? 607 PHE A N   1 
ATOM   4106  C CA  . PHE A 1 598 ? 22.674  51.647  -99.779  1.00 191.61 ? 607 PHE A CA  1 
ATOM   4107  C C   . PHE A 1 598 ? 21.166  51.653  -99.562  1.00 190.02 ? 607 PHE A C   1 
ATOM   4108  O O   . PHE A 1 598 ? 20.681  51.319  -98.481  1.00 187.10 ? 607 PHE A O   1 
ATOM   4109  C CB  . PHE A 1 598 ? 23.268  53.004  -99.400  1.00 193.51 ? 607 PHE A CB  1 
ATOM   4110  C CG  . PHE A 1 598 ? 22.940  53.441  -98.001  1.00 191.33 ? 607 PHE A CG  1 
ATOM   4111  C CD1 . PHE A 1 598 ? 23.689  52.991  -96.926  1.00 189.42 ? 607 PHE A CD1 1 
ATOM   4112  C CD2 . PHE A 1 598 ? 21.886  54.306  -97.761  1.00 191.51 ? 607 PHE A CD2 1 
ATOM   4113  C CE1 . PHE A 1 598 ? 23.390  53.393  -95.637  1.00 187.77 ? 607 PHE A CE1 1 
ATOM   4114  C CE2 . PHE A 1 598 ? 21.582  54.712  -96.475  1.00 189.82 ? 607 PHE A CE2 1 
ATOM   4115  C CZ  . PHE A 1 598 ? 22.335  54.255  -95.411  1.00 187.95 ? 607 PHE A CZ  1 
ATOM   4116  N N   . PHE A 1 599 ? 20.430  52.033  -100.601 1.00 172.17 ? 608 PHE A N   1 
ATOM   4117  C CA  . PHE A 1 599 ? 18.974  52.057  -100.547 1.00 171.28 ? 608 PHE A CA  1 
ATOM   4118  C C   . PHE A 1 599 ? 18.400  50.649  -100.427 1.00 168.67 ? 608 PHE A C   1 
ATOM   4119  O O   . PHE A 1 599 ? 17.586  50.374  -99.545  1.00 166.11 ? 608 PHE A O   1 
ATOM   4120  C CB  . PHE A 1 599 ? 18.409  52.752  -101.787 1.00 174.87 ? 608 PHE A CB  1 
ATOM   4121  C CG  . PHE A 1 599 ? 16.933  52.550  -101.976 1.00 174.45 ? 608 PHE A CG  1 
ATOM   4122  C CD1 . PHE A 1 599 ? 16.020  53.392  -101.364 1.00 174.21 ? 608 PHE A CD1 1 
ATOM   4123  C CD2 . PHE A 1 599 ? 16.458  51.519  -102.771 1.00 174.61 ? 608 PHE A CD2 1 
ATOM   4124  C CE1 . PHE A 1 599 ? 14.663  53.208  -101.538 1.00 174.10 ? 608 PHE A CE1 1 
ATOM   4125  C CE2 . PHE A 1 599 ? 15.102  51.330  -102.949 1.00 174.53 ? 608 PHE A CE2 1 
ATOM   4126  C CZ  . PHE A 1 599 ? 14.205  52.176  -102.332 1.00 174.25 ? 608 PHE A CZ  1 
ATOM   4127  N N   . THR A 1 600 ? 18.825  49.762  -101.321 1.00 187.09 ? 609 THR A N   1 
ATOM   4128  C CA  . THR A 1 600 ? 18.347  48.385  -101.312 1.00 185.16 ? 609 THR A CA  1 
ATOM   4129  C C   . THR A 1 600 ? 18.833  47.639  -100.072 1.00 181.89 ? 609 THR A C   1 
ATOM   4130  O O   . THR A 1 600 ? 18.167  46.724  -99.590  1.00 179.65 ? 609 THR A O   1 
ATOM   4131  C CB  . THR A 1 600 ? 18.780  47.621  -102.582 1.00 187.43 ? 609 THR A CB  1 
ATOM   4132  O OG1 . THR A 1 600 ? 18.291  46.275  -102.524 1.00 185.73 ? 609 THR A OG1 1 
ATOM   4133  C CG2 . THR A 1 600 ? 20.293  47.599  -102.706 1.00 188.51 ? 609 THR A CG2 1 
ATOM   4134  N N   . LEU A 1 601 ? 19.993  48.037  -99.560  1.00 189.26 ? 610 LEU A N   1 
ATOM   4135  C CA  . LEU A 1 601 ? 20.537  47.442  -98.346  1.00 186.63 ? 610 LEU A CA  1 
ATOM   4136  C C   . LEU A 1 601 ? 19.582  47.654  -97.177  1.00 184.14 ? 610 LEU A C   1 
ATOM   4137  O O   . LEU A 1 601 ? 19.275  46.722  -96.434  1.00 181.76 ? 610 LEU A O   1 
ATOM   4138  C CB  . LEU A 1 601 ? 21.902  48.048  -98.017  1.00 187.70 ? 610 LEU A CB  1 
ATOM   4139  C CG  . LEU A 1 601 ? 22.547  47.572  -96.714  1.00 185.50 ? 610 LEU A CG  1 
ATOM   4140  C CD1 . LEU A 1 601 ? 22.932  46.103  -96.810  1.00 184.60 ? 610 LEU A CD1 1 
ATOM   4141  C CD2 . LEU A 1 601 ? 23.758  48.424  -96.366  1.00 187.01 ? 610 LEU A CD2 1 
ATOM   4142  N N   . ILE A 1 602 ? 19.116  48.888  -97.023  1.00 161.06 ? 611 ILE A N   1 
ATOM   4143  C CA  . ILE A 1 602 ? 18.186  49.231  -95.954  1.00 159.21 ? 611 ILE A CA  1 
ATOM   4144  C C   . ILE A 1 602 ? 16.876  48.462  -96.093  1.00 157.94 ? 611 ILE A C   1 
ATOM   4145  O O   . ILE A 1 602 ? 16.354  47.926  -95.115  1.00 155.60 ? 611 ILE A O   1 
ATOM   4146  C CB  . ILE A 1 602 ? 17.883  50.741  -95.933  1.00 161.02 ? 611 ILE A CB  1 
ATOM   4147  C CG1 . ILE A 1 602 ? 19.161  51.539  -95.665  1.00 162.42 ? 611 ILE A CG1 1 
ATOM   4148  C CG2 . ILE A 1 602 ? 16.826  51.056  -94.888  1.00 159.40 ? 611 ILE A CG2 1 
ATOM   4149  C CD1 . ILE A 1 602 ? 19.863  51.157  -94.378  1.00 160.39 ? 611 ILE A CD1 1 
ATOM   4150  N N   . ILE A 1 603 ? 16.352  48.407  -97.313  1.00 159.42 ? 612 ILE A N   1 
ATOM   4151  C CA  . ILE A 1 603 ? 15.087  47.726  -97.570  1.00 158.80 ? 612 ILE A CA  1 
ATOM   4152  C C   . ILE A 1 603 ? 15.145  46.236  -97.239  1.00 156.72 ? 612 ILE A C   1 
ATOM   4153  O O   . ILE A 1 603 ? 14.301  45.728  -96.502  1.00 154.81 ? 612 ILE A O   1 
ATOM   4154  C CB  . ILE A 1 603 ? 14.620  47.917  -99.026  1.00 161.73 ? 612 ILE A CB  1 
ATOM   4155  C CG1 . ILE A 1 603 ? 14.043  49.321  -99.216  1.00 163.73 ? 612 ILE A CG1 1 
ATOM   4156  C CG2 . ILE A 1 603 ? 13.581  46.871  -99.397  1.00 161.29 ? 612 ILE A CG2 1 
ATOM   4157  C CD1 . ILE A 1 603 ? 13.252  49.489  -100.491 1.00 166.63 ? 612 ILE A CD1 1 
ATOM   4158  N N   . ILE A 1 604 ? 16.139  45.540  -97.782  1.00 173.35 ? 613 ILE A N   1 
ATOM   4159  C CA  . ILE A 1 604 ? 16.282  44.110  -97.533  1.00 171.85 ? 613 ILE A CA  1 
ATOM   4160  C C   . ILE A 1 604 ? 16.540  43.832  -96.055  1.00 169.21 ? 613 ILE A C   1 
ATOM   4161  O O   . ILE A 1 604 ? 16.163  42.781  -95.538  1.00 167.62 ? 613 ILE A O   1 
ATOM   4162  C CB  . ILE A 1 604 ? 17.402  43.481  -98.389  1.00 173.44 ? 613 ILE A CB  1 
ATOM   4163  C CG1 . ILE A 1 604 ? 18.758  44.102  -98.048  1.00 173.85 ? 613 ILE A CG1 1 
ATOM   4164  C CG2 . ILE A 1 604 ? 17.091  43.639  -99.870  1.00 176.35 ? 613 ILE A CG2 1 
ATOM   4165  C CD1 . ILE A 1 604 ? 19.908  43.538  -98.856  1.00 175.67 ? 613 ILE A CD1 1 
ATOM   4166  N N   . SER A 1 605 ? 17.180  44.780  -95.379  1.00 161.81 ? 614 SER A N   1 
ATOM   4167  C CA  . SER A 1 605 ? 17.406  44.669  -93.944  1.00 159.74 ? 614 SER A CA  1 
ATOM   4168  C C   . SER A 1 605 ? 16.089  44.835  -93.198  1.00 158.32 ? 614 SER A C   1 
ATOM   4169  O O   . SER A 1 605 ? 15.816  44.124  -92.231  1.00 156.50 ? 614 SER A O   1 
ATOM   4170  C CB  . SER A 1 605 ? 18.415  45.717  -93.474  1.00 160.46 ? 614 SER A CB  1 
ATOM   4171  O OG  . SER A 1 605 ? 19.694  45.479  -94.035  1.00 161.80 ? 614 SER A OG  1 
ATOM   4172  N N   . SER A 1 606 ? 15.274  45.780  -93.658  1.00 157.30 ? 615 SER A N   1 
ATOM   4173  C CA  . SER A 1 606 ? 13.961  46.013  -93.069  1.00 156.42 ? 615 SER A CA  1 
ATOM   4174  C C   . SER A 1 606 ? 13.063  44.799  -93.262  1.00 155.56 ? 615 SER A C   1 
ATOM   4175  O O   . SER A 1 606 ? 12.396  44.356  -92.329  1.00 153.98 ? 615 SER A O   1 
ATOM   4176  C CB  . SER A 1 606 ? 13.306  47.253  -93.679  1.00 158.37 ? 615 SER A CB  1 
ATOM   4177  O OG  . SER A 1 606 ? 14.002  48.432  -93.312  1.00 159.24 ? 615 SER A OG  1 
ATOM   4178  N N   . TYR A 1 607 ? 13.048  44.264  -94.479  1.00 148.81 ? 616 TYR A N   1 
ATOM   4179  C CA  . TYR A 1 607 ? 12.253  43.079  -94.778  1.00 148.47 ? 616 TYR A CA  1 
ATOM   4180  C C   . TYR A 1 607 ? 12.643  41.917  -93.872  1.00 146.54 ? 616 TYR A C   1 
ATOM   4181  O O   . TYR A 1 607 ? 11.781  41.226  -93.330  1.00 145.48 ? 616 TYR A O   1 
ATOM   4182  C CB  . TYR A 1 607 ? 12.414  42.671  -96.243  1.00 150.62 ? 616 TYR A CB  1 
ATOM   4183  C CG  . TYR A 1 607 ? 11.781  41.335  -96.567  1.00 150.58 ? 616 TYR A CG  1 
ATOM   4184  C CD1 . TYR A 1 607 ? 10.466  41.256  -97.006  1.00 151.49 ? 616 TYR A CD1 1 
ATOM   4185  C CD2 . TYR A 1 607 ? 12.498  40.153  -96.425  1.00 149.92 ? 616 TYR A CD2 1 
ATOM   4186  C CE1 . TYR A 1 607 ? 9.884   40.037  -97.298  1.00 151.76 ? 616 TYR A CE1 1 
ATOM   4187  C CE2 . TYR A 1 607 ? 11.923  38.930  -96.715  1.00 150.19 ? 616 TYR A CE2 1 
ATOM   4188  C CZ  . TYR A 1 607 ? 10.616  38.878  -97.151  1.00 151.11 ? 616 TYR A CZ  1 
ATOM   4189  O OH  . TYR A 1 607 ? 10.040  37.662  -97.441  1.00 151.67 ? 616 TYR A OH  1 
ATOM   4190  N N   . THR A 1 608 ? 13.945  41.706  -93.715  1.00 148.41 ? 617 THR A N   1 
ATOM   4191  C CA  . THR A 1 608 ? 14.450  40.619  -92.886  1.00 147.00 ? 617 THR A CA  1 
ATOM   4192  C C   . THR A 1 608 ? 14.052  40.802  -91.425  1.00 145.22 ? 617 THR A C   1 
ATOM   4193  O O   . THR A 1 608 ? 13.538  39.880  -90.792  1.00 144.18 ? 617 THR A O   1 
ATOM   4194  C CB  . THR A 1 608 ? 15.981  40.506  -92.978  1.00 147.55 ? 617 THR A CB  1 
ATOM   4195  O OG1 . THR A 1 608 ? 16.361  40.234  -94.333  1.00 149.44 ? 617 THR A OG1 1 
ATOM   4196  C CG2 . THR A 1 608 ? 16.487  39.389  -92.077  1.00 146.40 ? 617 THR A CG2 1 
ATOM   4197  N N   . ALA A 1 609 ? 14.293  41.998  -90.896  1.00 171.38 ? 618 ALA A N   1 
ATOM   4198  C CA  . ALA A 1 609 ? 13.964  42.304  -89.509  1.00 170.09 ? 618 ALA A CA  1 
ATOM   4199  C C   . ALA A 1 609 ? 12.470  42.146  -89.249  1.00 169.55 ? 618 ALA A C   1 
ATOM   4200  O O   . ALA A 1 609 ? 12.063  41.498  -88.285  1.00 168.43 ? 618 ALA A O   1 
ATOM   4201  C CB  . ALA A 1 609 ? 14.418  43.712  -89.156  1.00 170.69 ? 618 ALA A CB  1 
ATOM   4202  N N   . ASN A 1 610 ? 11.659  42.742  -90.116  1.00 143.67 ? 619 ASN A N   1 
ATOM   4203  C CA  . ASN A 1 610 ? 10.210  42.682  -89.973  1.00 143.58 ? 619 ASN A CA  1 
ATOM   4204  C C   . ASN A 1 610 ? 9.680   41.256  -90.053  1.00 143.08 ? 619 ASN A C   1 
ATOM   4205  O O   . ASN A 1 610 ? 8.783   40.873  -89.301  1.00 142.38 ? 619 ASN A O   1 
ATOM   4206  C CB  . ASN A 1 610 ? 9.533   43.549  -91.034  1.00 145.33 ? 619 ASN A CB  1 
ATOM   4207  C CG  . ASN A 1 610 ? 8.034   43.631  -90.845  1.00 145.57 ? 619 ASN A CG  1 
ATOM   4208  O OD1 . ASN A 1 610 ? 7.280   43.725  -91.812  1.00 147.08 ? 619 ASN A OD1 1 
ATOM   4209  N ND2 . ASN A 1 610 ? 7.592   43.586  -89.594  1.00 144.37 ? 619 ASN A ND2 1 
ATOM   4210  N N   . LEU A 1 611 ? 10.238  40.474  -90.971  1.00 142.69 ? 620 LEU A N   1 
ATOM   4211  C CA  . LEU A 1 611 ? 9.827   39.086  -91.144  1.00 142.63 ? 620 LEU A CA  1 
ATOM   4212  C C   . LEU A 1 611 ? 10.144  38.266  -89.900  1.00 141.18 ? 620 LEU A C   1 
ATOM   4213  O O   . LEU A 1 611 ? 9.482   37.268  -89.616  1.00 141.00 ? 620 LEU A O   1 
ATOM   4214  C CB  . LEU A 1 611 ? 10.512  38.473  -92.366  1.00 143.94 ? 620 LEU A CB  1 
ATOM   4215  C CG  . LEU A 1 611 ? 10.161  37.018  -92.677  1.00 144.38 ? 620 LEU A CG  1 
ATOM   4216  C CD1 . LEU A 1 611 ? 8.665   36.867  -92.904  1.00 145.01 ? 620 LEU A CD1 1 
ATOM   4217  C CD2 . LEU A 1 611 ? 10.942  36.524  -93.884  1.00 146.00 ? 620 LEU A CD2 1 
ATOM   4218  N N   . ALA A 1 612 ? 11.157  38.699  -89.157  1.00 149.70 ? 621 ALA A N   1 
ATOM   4219  C CA  . ALA A 1 612 ? 11.554  38.017  -87.934  1.00 148.67 ? 621 ALA A CA  1 
ATOM   4220  C C   . ALA A 1 612 ? 10.554  38.241  -86.798  1.00 147.91 ? 621 ALA A C   1 
ATOM   4221  O O   . ALA A 1 612 ? 10.292  37.330  -86.017  1.00 147.47 ? 621 ALA A O   1 
ATOM   4222  C CB  . ALA A 1 612 ? 12.949  38.451  -87.509  1.00 148.54 ? 621 ALA A CB  1 
ATOM   4223  N N   . ALA A 1 613 ? 10.003  39.448  -86.685  1.00 185.32 ? 622 ALA A N   1 
ATOM   4224  C CA  . ALA A 1 613 ? 9.059   39.715  -85.603  1.00 184.88 ? 622 ALA A CA  1 
ATOM   4225  C C   . ALA A 1 613 ? 7.791   38.888  -85.777  1.00 185.10 ? 622 ALA A C   1 
ATOM   4226  O O   . ALA A 1 613 ? 7.204   38.420  -84.802  1.00 184.76 ? 622 ALA A O   1 
ATOM   4227  C CB  . ALA A 1 613 ? 8.728   41.196  -85.519  1.00 185.33 ? 622 ALA A CB  1 
ATOM   4228  N N   . PHE A 1 614 ? 7.375   38.707  -87.026  1.00 184.55 ? 623 PHE A N   1 
ATOM   4229  C CA  . PHE A 1 614 ? 6.179   37.928  -87.324  1.00 185.16 ? 623 PHE A CA  1 
ATOM   4230  C C   . PHE A 1 614 ? 6.393   36.443  -87.052  1.00 184.95 ? 623 PHE A C   1 
ATOM   4231  O O   . PHE A 1 614 ? 5.436   35.697  -86.841  1.00 185.36 ? 623 PHE A O   1 
ATOM   4232  C CB  . PHE A 1 614 ? 5.737   38.138  -88.773  1.00 186.57 ? 623 PHE A CB  1 
ATOM   4233  C CG  . PHE A 1 614 ? 5.239   39.525  -89.058  1.00 187.28 ? 623 PHE A CG  1 
ATOM   4234  C CD1 . PHE A 1 614 ? 4.399   40.168  -88.165  1.00 187.12 ? 623 PHE A CD1 1 
ATOM   4235  C CD2 . PHE A 1 614 ? 5.597   40.179  -90.226  1.00 188.45 ? 623 PHE A CD2 1 
ATOM   4236  C CE1 . PHE A 1 614 ? 3.938   41.442  -88.423  1.00 188.10 ? 623 PHE A CE1 1 
ATOM   4237  C CE2 . PHE A 1 614 ? 5.134   41.454  -90.491  1.00 189.45 ? 623 PHE A CE2 1 
ATOM   4238  C CZ  . PHE A 1 614 ? 4.302   42.086  -89.588  1.00 189.28 ? 623 PHE A CZ  1 
ATOM   4239  N N   . LEU A 1 615 ? 7.652   36.021  -87.061  1.00 140.00 ? 624 LEU A N   1 
ATOM   4240  C CA  . LEU A 1 615 ? 7.990   34.630  -86.789  1.00 140.09 ? 624 LEU A CA  1 
ATOM   4241  C C   . LEU A 1 615 ? 8.318   34.434  -85.314  1.00 139.26 ? 624 LEU A C   1 
ATOM   4242  O O   . LEU A 1 615 ? 8.079   33.365  -84.753  1.00 139.52 ? 624 LEU A O   1 
ATOM   4243  C CB  . LEU A 1 615 ? 9.160   34.180  -87.665  1.00 140.62 ? 624 LEU A CB  1 
ATOM   4244  C CG  . LEU A 1 615 ? 8.899   34.219  -89.172  1.00 141.89 ? 624 LEU A CG  1 
ATOM   4245  C CD1 . LEU A 1 615 ? 10.144  33.830  -89.953  1.00 142.60 ? 624 LEU A CD1 1 
ATOM   4246  C CD2 . LEU A 1 615 ? 7.729   33.316  -89.534  1.00 142.91 ? 624 LEU A CD2 1 
ATOM   4247  N N   . THR A 1 616 ? 8.864   35.472  -84.690  1.00 152.40 ? 625 THR A N   1 
ATOM   4248  C CA  . THR A 1 616 ? 9.169   35.434  -83.266  1.00 151.94 ? 625 THR A CA  1 
ATOM   4249  C C   . THR A 1 616 ? 7.882   35.388  -82.453  1.00 152.01 ? 625 THR A C   1 
ATOM   4250  O O   . THR A 1 616 ? 7.751   34.596  -81.521  1.00 152.20 ? 625 THR A O   1 
ATOM   4251  C CB  . THR A 1 616 ? 9.999   36.656  -82.832  1.00 151.57 ? 625 THR A CB  1 
ATOM   4252  O OG1 . THR A 1 616 ? 11.240  36.673  -83.547  1.00 151.74 ? 625 THR A OG1 1 
ATOM   4253  C CG2 . THR A 1 616 ? 10.282  36.602  -81.341  1.00 151.48 ? 625 THR A CG2 1 
ATOM   4254  N N   . VAL A 1 617 ? 6.932   36.243  -82.815  1.00 139.64 ? 626 VAL A N   1 
ATOM   4255  C CA  . VAL A 1 617 ? 5.636   36.268  -82.151  1.00 139.98 ? 626 VAL A CA  1 
ATOM   4256  C C   . VAL A 1 617 ? 4.841   35.003  -82.472  1.00 140.68 ? 626 VAL A C   1 
ATOM   4257  O O   . VAL A 1 617 ? 4.074   34.515  -81.642  1.00 141.11 ? 626 VAL A O   1 
ATOM   4258  C CB  . VAL A 1 617 ? 4.823   37.515  -82.551  1.00 140.31 ? 626 VAL A CB  1 
ATOM   4259  C CG1 . VAL A 1 617 ? 3.430   37.461  -81.946  1.00 140.98 ? 626 VAL A CG1 1 
ATOM   4260  C CG2 . VAL A 1 617 ? 5.549   38.780  -82.119  1.00 139.97 ? 626 VAL A CG2 1 
ATOM   4261  N N   . GLU A 1 618 ? 5.037   34.473  -83.677  1.00 154.56 ? 627 GLU A N   1 
ATOM   4262  C CA  . GLU A 1 618 ? 4.343   33.262  -84.102  1.00 155.57 ? 627 GLU A CA  1 
ATOM   4263  C C   . GLU A 1 618 ? 4.740   32.122  -83.185  1.00 155.69 ? 627 GLU A C   1 
ATOM   4264  O O   . GLU A 1 618 ? 3.991   31.173  -82.980  1.00 156.65 ? 627 GLU A O   1 
ATOM   4265  C CB  . GLU A 1 618 ? 4.696   32.910  -85.548  1.00 156.22 ? 627 GLU A CB  1 
ATOM   4266  N N   . ARG A 1 619 ? 5.933   32.212  -82.626  1.00 151.94 ? 628 ARG A N   1 
ATOM   4267  C CA  . ARG A 1 619 ? 6.350   31.184  -81.700  1.00 152.36 ? 628 ARG A CA  1 
ATOM   4268  C C   . ARG A 1 619 ? 5.932   31.510  -80.286  1.00 152.29 ? 628 ARG A C   1 
ATOM   4269  O O   . ARG A 1 619 ? 5.671   30.609  -79.494  1.00 153.15 ? 628 ARG A O   1 
ATOM   4270  C CB  . ARG A 1 619 ? 7.846   31.024  -81.738  1.00 152.10 ? 628 ARG A CB  1 
ATOM   4271  C CG  . ARG A 1 619 ? 8.390   30.725  -83.084  1.00 152.40 ? 628 ARG A CG  1 
ATOM   4272  C CD  . ARG A 1 619 ? 9.879   30.632  -82.888  1.00 152.32 ? 628 ARG A CD  1 
ATOM   4273  N NE  . ARG A 1 619 ? 10.363  29.303  -82.696  1.00 153.44 ? 628 ARG A NE  1 
ATOM   4274  C CZ  . ARG A 1 619 ? 11.272  28.809  -81.868  1.00 153.94 ? 628 ARG A CZ  1 
ATOM   4275  N NH1 . ARG A 1 619 ? 11.873  29.472  -80.887  1.00 153.45 ? 628 ARG A NH1 1 
ATOM   4276  N NH2 . ARG A 1 619 ? 11.520  27.532  -82.047  1.00 155.34 ? 628 ARG A NH2 1 
ATOM   4277  N N   . MET A 1 620 ? 5.891   32.799  -79.967  1.00 154.41 ? 629 MET A N   1 
ATOM   4278  C CA  . MET A 1 620 ? 5.448   33.245  -78.652  1.00 154.60 ? 629 MET A CA  1 
ATOM   4279  C C   . MET A 1 620 ? 4.085   32.665  -78.280  1.00 155.59 ? 629 MET A C   1 
ATOM   4280  O O   . MET A 1 620 ? 3.854   32.283  -77.132  1.00 156.35 ? 629 MET A O   1 
ATOM   4281  C CB  . MET A 1 620 ? 5.389   34.769  -78.600  1.00 154.01 ? 629 MET A CB  1 
ATOM   4282  C CG  . MET A 1 620 ? 6.739   35.440  -78.504  1.00 153.41 ? 629 MET A CG  1 
ATOM   4283  S SD  . MET A 1 620 ? 6.572   37.217  -78.265  1.00 153.25 ? 629 MET A SD  1 
ATOM   4284  C CE  . MET A 1 620 ? 8.289   37.708  -78.152  1.00 152.93 ? 629 MET A CE  1 
ATOM   4285  N N   . VAL A 1 621 ? 3.181   32.617  -79.253  1.00 157.88 ? 630 VAL A N   1 
ATOM   4286  C CA  . VAL A 1 621 ? 1.853   32.054  -79.039  1.00 159.09 ? 630 VAL A CA  1 
ATOM   4287  C C   . VAL A 1 621 ? 1.961   30.602  -78.587  1.00 160.12 ? 630 VAL A C   1 
ATOM   4288  O O   . VAL A 1 621 ? 2.126   29.697  -79.406  1.00 160.59 ? 630 VAL A O   1 
ATOM   4289  C CB  . VAL A 1 621 ? 1.003   32.124  -80.322  1.00 159.55 ? 630 VAL A CB  1 
ATOM   4290  C CG1 . VAL A 1 621 ? -0.363  31.488  -80.099  1.00 161.11 ? 630 VAL A CG1 1 
ATOM   4291  C CG2 . VAL A 1 621 ? 0.858   33.565  -80.780  1.00 158.92 ? 630 VAL A CG2 1 
ATOM   4292  N N   . SER A 1 622 ? 1.876   30.387  -77.279  1.00 159.21 ? 631 SER A N   1 
ATOM   4293  C CA  . SER A 1 622 ? 1.994   29.047  -76.718  1.00 160.54 ? 631 SER A CA  1 
ATOM   4294  C C   . SER A 1 622 ? 0.628   28.385  -76.586  1.00 162.21 ? 631 SER A C   1 
ATOM   4295  O O   . SER A 1 622 ? -0.300  28.972  -76.028  1.00 162.65 ? 631 SER A O   1 
ATOM   4296  C CB  . SER A 1 622 ? 2.689   29.095  -75.356  1.00 160.83 ? 631 SER A CB  1 
ATOM   4297  O OG  . SER A 1 622 ? 2.848   27.793  -74.821  1.00 162.42 ? 631 SER A OG  1 
ATOM   4298  N N   . PRO A 1 623 ? 0.502   27.156  -77.107  1.00 197.28 ? 632 PRO A N   1 
ATOM   4299  C CA  . PRO A 1 623 ? -0.750  26.394  -77.044  1.00 199.25 ? 632 PRO A CA  1 
ATOM   4300  C C   . PRO A 1 623 ? -1.168  26.134  -75.603  1.00 200.63 ? 632 PRO A C   1 
ATOM   4301  O O   . PRO A 1 623 ? -0.308  25.981  -74.735  1.00 200.62 ? 632 PRO A O   1 
ATOM   4302  C CB  . PRO A 1 623 ? -0.389  25.071  -77.729  1.00 200.40 ? 632 PRO A CB  1 
ATOM   4303  C CG  . PRO A 1 623 ? 0.797   25.386  -78.577  1.00 198.78 ? 632 PRO A CG  1 
ATOM   4304  C CD  . PRO A 1 623 ? 1.562   26.423  -77.818  1.00 197.12 ? 632 PRO A CD  1 
ATOM   4305  N N   . ILE A 1 624 ? -2.473  26.091  -75.354  1.00 152.09 ? 633 ILE A N   1 
ATOM   4306  C CA  . ILE A 1 624 ? -2.983  25.813  -74.017  1.00 153.83 ? 633 ILE A CA  1 
ATOM   4307  C C   . ILE A 1 624 ? -2.554  24.423  -73.562  1.00 155.63 ? 633 ILE A C   1 
ATOM   4308  O O   . ILE A 1 624 ? -3.171  23.422  -73.925  1.00 157.48 ? 633 ILE A O   1 
ATOM   4309  C CB  . ILE A 1 624 ? -4.517  25.911  -73.964  1.00 155.46 ? 633 ILE A CB  1 
ATOM   4310  C CG1 . ILE A 1 624 ? -4.977  27.302  -74.401  1.00 154.06 ? 633 ILE A CG1 1 
ATOM   4311  C CG2 . ILE A 1 624 ? -5.022  25.596  -72.563  1.00 157.56 ? 633 ILE A CG2 1 
ATOM   4312  C CD1 . ILE A 1 624 ? -4.465  28.418  -73.518  1.00 152.88 ? 633 ILE A CD1 1 
ATOM   4313  N N   . GLU A 1 625 ? -1.490  24.369  -72.768  1.00 165.58 ? 634 GLU A N   1 
ATOM   4314  C CA  . GLU A 1 625 ? -0.939  23.100  -72.308  1.00 167.46 ? 634 GLU A CA  1 
ATOM   4315  C C   . GLU A 1 625 ? -1.533  22.653  -70.983  1.00 170.04 ? 634 GLU A C   1 
ATOM   4316  O O   . GLU A 1 625 ? -2.097  21.566  -70.873  1.00 172.51 ? 634 GLU A O   1 
ATOM   4317  C CB  . GLU A 1 625 ? 0.578   23.207  -72.153  1.00 166.30 ? 634 GLU A CB  1 
ATOM   4318  N N   . SER A 1 626 ? -1.340  23.471  -69.958  1.00 165.06 ? 635 SER A N   1 
ATOM   4319  C CA  . SER A 1 626 ? -1.809  23.122  -68.628  1.00 162.83 ? 635 SER A CA  1 
ATOM   4320  C C   . SER A 1 626 ? -2.901  24.077  -68.174  1.00 162.72 ? 635 SER A C   1 
ATOM   4321  O O   . SER A 1 626 ? -3.307  24.972  -68.916  1.00 164.43 ? 635 SER A O   1 
ATOM   4322  C CB  . SER A 1 626 ? -0.650  23.128  -67.630  1.00 162.18 ? 635 SER A CB  1 
ATOM   4323  O OG  . SER A 1 626 ? -0.118  24.431  -67.472  1.00 163.36 ? 635 SER A OG  1 
ATOM   4324  N N   . ALA A 1 627 ? -3.376  23.878  -66.950  1.00 130.32 ? 636 ALA A N   1 
ATOM   4325  C CA  . ALA A 1 627 ? -4.405  24.736  -66.379  1.00 130.36 ? 636 ALA A CA  1 
ATOM   4326  C C   . ALA A 1 627 ? -3.824  26.092  -65.999  1.00 131.62 ? 636 ALA A C   1 
ATOM   4327  O O   . ALA A 1 627 ? -4.510  27.112  -66.064  1.00 132.88 ? 636 ALA A O   1 
ATOM   4328  C CB  . ALA A 1 627 ? -5.035  24.073  -65.170  1.00 128.40 ? 636 ALA A CB  1 
ATOM   4329  N N   . GLU A 1 628 ? -2.556  26.094  -65.601  1.00 140.44 ? 637 GLU A N   1 
ATOM   4330  C CA  . GLU A 1 628 ? -1.871  27.325  -65.230  1.00 141.80 ? 637 GLU A CA  1 
ATOM   4331  C C   . GLU A 1 628 ? -1.796  28.277  -66.418  1.00 144.15 ? 637 GLU A C   1 
ATOM   4332  O O   . GLU A 1 628 ? -1.683  29.491  -66.248  1.00 145.73 ? 637 GLU A O   1 
ATOM   4333  C CB  . GLU A 1 628 ? -0.465  27.020  -64.709  1.00 141.51 ? 637 GLU A CB  1 
ATOM   4334  N N   . ASP A 1 629 ? -1.862  27.718  -67.621  1.00 212.90 ? 638 ASP A N   1 
ATOM   4335  C CA  . ASP A 1 629 ? -1.809  28.514  -68.841  1.00 215.42 ? 638 ASP A CA  1 
ATOM   4336  C C   . ASP A 1 629 ? -3.105  29.289  -69.056  1.00 216.59 ? 638 ASP A C   1 
ATOM   4337  O O   . ASP A 1 629 ? -3.105  30.352  -69.675  1.00 219.04 ? 638 ASP A O   1 
ATOM   4338  C CB  . ASP A 1 629 ? -1.517  27.625  -70.053  1.00 215.92 ? 638 ASP A CB  1 
ATOM   4339  C CG  . ASP A 1 629 ? -0.116  27.042  -70.024  1.00 215.64 ? 638 ASP A CG  1 
ATOM   4340  O OD1 . ASP A 1 629 ? 0.243   26.306  -70.967  1.00 216.31 ? 638 ASP A OD1 1 
ATOM   4341  O OD2 . ASP A 1 629 ? 0.626   27.322  -69.060  1.00 215.01 ? 638 ASP A OD2 1 
ATOM   4342  N N   . LEU A 1 630 ? -4.207  28.753  -68.540  1.00 138.24 ? 639 LEU A N   1 
ATOM   4343  C CA  . LEU A 1 630 ? -5.504  29.409  -68.657  1.00 139.43 ? 639 LEU A CA  1 
ATOM   4344  C C   . LEU A 1 630 ? -5.610  30.606  -67.718  1.00 140.29 ? 639 LEU A C   1 
ATOM   4345  O O   . LEU A 1 630 ? -6.341  31.557  -67.991  1.00 142.43 ? 639 LEU A O   1 
ATOM   4346  C CB  . LEU A 1 630 ? -6.636  28.420  -68.372  1.00 137.68 ? 639 LEU A CB  1 
ATOM   4347  C CG  . LEU A 1 630 ? -6.977  27.432  -69.488  1.00 137.74 ? 639 LEU A CG  1 
ATOM   4348  C CD1 . LEU A 1 630 ? -7.986  26.405  -69.001  1.00 135.83 ? 639 LEU A CD1 1 
ATOM   4349  C CD2 . LEU A 1 630 ? -7.505  28.170  -70.706  1.00 140.70 ? 639 LEU A CD2 1 
ATOM   4350  N N   . SER A 1 631 ? -4.874  30.552  -66.613  1.00 148.77 ? 640 SER A N   1 
ATOM   4351  C CA  . SER A 1 631 ? -4.908  31.618  -65.620  1.00 149.68 ? 640 SER A CA  1 
ATOM   4352  C C   . SER A 1 631 ? -3.939  32.744  -65.968  1.00 152.00 ? 640 SER A C   1 
ATOM   4353  O O   . SER A 1 631 ? -4.191  33.909  -65.658  1.00 154.02 ? 640 SER A O   1 
ATOM   4354  C CB  . SER A 1 631 ? -4.587  31.063  -64.231  1.00 147.51 ? 640 SER A CB  1 
ATOM   4355  O OG  . SER A 1 631 ? -3.321  30.427  -64.217  1.00 146.46 ? 640 SER A OG  1 
ATOM   4356  N N   . LYS A 1 632 ? -2.834  32.389  -66.615  1.00 165.63 ? 641 LYS A N   1 
ATOM   4357  C CA  . LYS A 1 632 ? -1.800  33.360  -66.958  1.00 167.83 ? 641 LYS A CA  1 
ATOM   4358  C C   . LYS A 1 632 ? -2.205  34.247  -68.133  1.00 170.79 ? 641 LYS A C   1 
ATOM   4359  O O   . LYS A 1 632 ? -1.577  35.274  -68.390  1.00 173.17 ? 641 LYS A O   1 
ATOM   4360  C CB  . LYS A 1 632 ? -0.480  32.651  -67.267  1.00 167.04 ? 641 LYS A CB  1 
ATOM   4361  N N   . GLN A 1 633 ? -3.256  33.848  -68.842  1.00 175.91 ? 642 GLN A N   1 
ATOM   4362  C CA  . GLN A 1 633 ? -3.727  34.606  -69.996  1.00 179.00 ? 642 GLN A CA  1 
ATOM   4363  C C   . GLN A 1 633 ? -5.222  34.902  -69.900  1.00 179.81 ? 642 GLN A C   1 
ATOM   4364  O O   . GLN A 1 633 ? -5.917  34.362  -69.039  1.00 177.71 ? 642 GLN A O   1 
ATOM   4365  C CB  . GLN A 1 633 ? -3.404  33.862  -71.295  1.00 179.34 ? 642 GLN A CB  1 
ATOM   4366  C CG  . GLN A 1 633 ? -4.145  32.547  -71.470  1.00 177.18 ? 642 GLN A CG  1 
ATOM   4367  C CD  . GLN A 1 633 ? -5.492  32.722  -72.139  1.00 178.83 ? 642 GLN A CD  1 
ATOM   4368  O OE1 . GLN A 1 633 ? -5.676  33.619  -72.960  1.00 182.02 ? 642 GLN A OE1 1 
ATOM   4369  N NE2 . GLN A 1 633 ? -6.442  31.859  -71.796  1.00 176.90 ? 642 GLN A NE2 1 
ATOM   4370  N N   . THR A 1 634 ? -5.711  35.764  -70.787  1.00 203.21 ? 643 THR A N   1 
ATOM   4371  C CA  . THR A 1 634 ? -7.113  36.166  -70.770  1.00 204.69 ? 643 THR A CA  1 
ATOM   4372  C C   . THR A 1 634 ? -7.725  36.163  -72.168  1.00 207.18 ? 643 THR A C   1 
ATOM   4373  O O   . THR A 1 634 ? -8.946  36.183  -72.319  1.00 208.20 ? 643 THR A O   1 
ATOM   4374  C CB  . THR A 1 634 ? -7.287  37.568  -70.157  1.00 207.26 ? 643 THR A CB  1 
ATOM   4375  O OG1 . THR A 1 634 ? -8.681  37.888  -70.076  1.00 208.78 ? 643 THR A OG1 1 
ATOM   4376  C CG2 . THR A 1 634 ? -6.582  38.610  -71.010  1.00 210.76 ? 643 THR A CG2 1 
ATOM   4377  N N   . GLU A 1 635 ? -6.870  36.142  -73.186  1.00 168.17 ? 644 GLU A N   1 
ATOM   4378  C CA  . GLU A 1 635 ? -7.326  36.149  -74.571  1.00 170.96 ? 644 GLU A CA  1 
ATOM   4379  C C   . GLU A 1 635 ? -8.329  35.029  -74.833  1.00 169.47 ? 644 GLU A C   1 
ATOM   4380  O O   . GLU A 1 635 ? -9.346  35.236  -75.494  1.00 171.90 ? 644 GLU A O   1 
ATOM   4381  C CB  . GLU A 1 635 ? -6.138  36.024  -75.528  1.00 171.96 ? 644 GLU A CB  1 
ATOM   4382  N N   . ILE A 1 636 ? -8.036  33.844  -74.308  1.00 156.66 ? 645 ILE A N   1 
ATOM   4383  C CA  . ILE A 1 636 ? -8.910  32.690  -74.480  1.00 155.07 ? 645 ILE A CA  1 
ATOM   4384  C C   . ILE A 1 636 ? -9.803  32.490  -73.261  1.00 152.90 ? 645 ILE A C   1 
ATOM   4385  O O   . ILE A 1 636 ? -9.334  32.095  -72.194  1.00 149.98 ? 645 ILE A O   1 
ATOM   4386  C CB  . ILE A 1 636 ? -8.102  31.400  -74.714  1.00 152.64 ? 645 ILE A CB  1 
ATOM   4387  C CG1 . ILE A 1 636 ? -7.051  31.616  -75.803  1.00 154.81 ? 645 ILE A CG1 1 
ATOM   4388  C CG2 . ILE A 1 636 ? -9.029  30.249  -75.078  1.00 151.70 ? 645 ILE A CG2 1 
ATOM   4389  C CD1 . ILE A 1 636 ? -6.210  30.391  -76.088  1.00 152.98 ? 645 ILE A CD1 1 
ATOM   4390  N N   . ALA A 1 637 ? -11.092 32.766  -73.427  1.00 156.91 ? 646 ALA A N   1 
ATOM   4391  C CA  . ALA A 1 637 ? -12.054 32.589  -72.348  1.00 155.31 ? 646 ALA A CA  1 
ATOM   4392  C C   . ALA A 1 637 ? -12.237 31.110  -72.034  1.00 151.88 ? 646 ALA A C   1 
ATOM   4393  O O   . ALA A 1 637 ? -11.896 30.249  -72.846  1.00 151.41 ? 646 ALA A O   1 
ATOM   4394  C CB  . ALA A 1 637 ? -13.385 33.225  -72.714  1.00 158.44 ? 646 ALA A CB  1 
ATOM   4395  N N   . TYR A 1 638 ? -12.774 30.820  -70.854  1.00 151.47 ? 647 TYR A N   1 
ATOM   4396  C CA  . TYR A 1 638 ? -13.010 29.443  -70.438  1.00 148.37 ? 647 TYR A CA  1 
ATOM   4397  C C   . TYR A 1 638 ? -14.021 29.375  -69.299  1.00 147.31 ? 647 TYR A C   1 
ATOM   4398  O O   . TYR A 1 638 ? -14.143 30.310  -68.507  1.00 148.10 ? 647 TYR A O   1 
ATOM   4399  C CB  . TYR A 1 638 ? -11.699 28.771  -70.021  1.00 145.70 ? 647 TYR A CB  1 
ATOM   4400  C CG  . TYR A 1 638 ? -10.971 29.485  -68.904  1.00 144.96 ? 647 TYR A CG  1 
ATOM   4401  C CD1 . TYR A 1 638 ? -9.982  30.418  -69.181  1.00 146.52 ? 647 TYR A CD1 1 
ATOM   4402  C CD2 . TYR A 1 638 ? -11.272 29.224  -67.574  1.00 142.96 ? 647 TYR A CD2 1 
ATOM   4403  C CE1 . TYR A 1 638 ? -9.313  31.073  -68.166  1.00 146.10 ? 647 TYR A CE1 1 
ATOM   4404  C CE2 . TYR A 1 638 ? -10.608 29.874  -66.551  1.00 142.61 ? 647 TYR A CE2 1 
ATOM   4405  C CZ  . TYR A 1 638 ? -9.630  30.797  -66.852  1.00 144.18 ? 647 TYR A CZ  1 
ATOM   4406  O OH  . TYR A 1 638 ? -8.966  31.447  -65.838  1.00 144.08 ? 647 TYR A OH  1 
ATOM   4407  N N   . GLY A 1 639 ? -14.745 28.263  -69.221  1.00 141.16 ? 648 GLY A N   1 
ATOM   4408  C CA  . GLY A 1 639 ? -15.743 28.076  -68.185  1.00 140.22 ? 648 GLY A CA  1 
ATOM   4409  C C   . GLY A 1 639 ? -16.101 26.618  -67.972  1.00 137.72 ? 648 GLY A C   1 
ATOM   4410  O O   . GLY A 1 639 ? -15.535 25.728  -68.607  1.00 136.70 ? 648 GLY A O   1 
ATOM   4411  N N   . THR A 1 640 ? -17.046 26.375  -67.069  1.00 138.55 ? 649 THR A N   1 
ATOM   4412  C CA  . THR A 1 640 ? -17.495 25.022  -66.769  1.00 136.40 ? 649 THR A CA  1 
ATOM   4413  C C   . THR A 1 640 ? -19.013 24.935  -66.850  1.00 137.78 ? 649 THR A C   1 
ATOM   4414  O O   . THR A 1 640 ? -19.675 25.876  -67.285  1.00 140.56 ? 649 THR A O   1 
ATOM   4415  C CB  . THR A 1 640 ? -17.052 24.580  -65.362  1.00 133.77 ? 649 THR A CB  1 
ATOM   4416  O OG1 . THR A 1 640 ? -17.746 25.354  -64.376  1.00 134.58 ? 649 THR A OG1 1 
ATOM   4417  C CG2 . THR A 1 640 ? -15.553 24.769  -65.188  1.00 132.75 ? 649 THR A CG2 1 
ATOM   4418  N N   . LEU A 1 641 ? -19.560 23.800  -66.431  1.00 138.52 ? 650 LEU A N   1 
ATOM   4419  C CA  . LEU A 1 641 ? -21.005 23.626  -66.387  1.00 139.71 ? 650 LEU A CA  1 
ATOM   4420  C C   . LEU A 1 641 ? -21.584 24.485  -65.266  1.00 140.44 ? 650 LEU A C   1 
ATOM   4421  O O   . LEU A 1 641 ? -21.002 24.580  -64.186  1.00 138.84 ? 650 LEU A O   1 
ATOM   4422  C CB  . LEU A 1 641 ? -21.361 22.154  -66.173  1.00 137.70 ? 650 LEU A CB  1 
ATOM   4423  C CG  . LEU A 1 641 ? -22.810 21.752  -66.451  1.00 139.11 ? 650 LEU A CG  1 
ATOM   4424  C CD1 . LEU A 1 641 ? -23.205 22.128  -67.871  1.00 142.00 ? 650 LEU A CD1 1 
ATOM   4425  C CD2 . LEU A 1 641 ? -23.005 20.262  -66.214  1.00 137.08 ? 650 LEU A CD2 1 
ATOM   4426  N N   . ASP A 1 642 ? -22.727 25.111  -65.528  1.00 183.08 ? 651 ASP A N   1 
ATOM   4427  C CA  . ASP A 1 642 ? -23.337 26.024  -64.564  1.00 184.49 ? 651 ASP A CA  1 
ATOM   4428  C C   . ASP A 1 642 ? -23.693 25.338  -63.247  1.00 182.46 ? 651 ASP A C   1 
ATOM   4429  O O   . ASP A 1 642 ? -23.854 25.997  -62.219  1.00 183.05 ? 651 ASP A O   1 
ATOM   4430  C CB  . ASP A 1 642 ? -24.573 26.702  -65.165  1.00 188.16 ? 651 ASP A CB  1 
ATOM   4431  C CG  . ASP A 1 642 ? -25.601 25.707  -65.671  1.00 188.35 ? 651 ASP A CG  1 
ATOM   4432  O OD1 . ASP A 1 642 ? -25.462 24.499  -65.386  1.00 185.60 ? 651 ASP A OD1 1 
ATOM   4433  O OD2 . ASP A 1 642 ? -26.552 26.136  -66.359  1.00 191.51 ? 651 ASP A OD2 1 
ATOM   4434  N N   . SER A 1 643 ? -23.815 24.015  -63.282  1.00 158.67 ? 652 SER A N   1 
ATOM   4435  C CA  . SER A 1 643 ? -24.147 23.246  -62.089  1.00 156.84 ? 652 SER A CA  1 
ATOM   4436  C C   . SER A 1 643 ? -23.511 21.861  -62.131  1.00 153.97 ? 652 SER A C   1 
ATOM   4437  O O   . SER A 1 643 ? -23.655 21.132  -63.112  1.00 153.92 ? 652 SER A O   1 
ATOM   4438  C CB  . SER A 1 643 ? -25.664 23.122  -61.935  1.00 158.56 ? 652 SER A CB  1 
ATOM   4439  O OG  . SER A 1 643 ? -26.232 22.422  -63.029  1.00 159.14 ? 652 SER A OG  1 
ATOM   4440  N N   . GLY A 1 644 ? -22.810 21.503  -61.061  1.00 150.01 ? 653 GLY A N   1 
ATOM   4441  C CA  . GLY A 1 644 ? -22.154 20.212  -60.979  1.00 147.57 ? 653 GLY A CA  1 
ATOM   4442  C C   . GLY A 1 644 ? -20.900 20.255  -60.130  1.00 145.92 ? 653 GLY A C   1 
ATOM   4443  O O   . GLY A 1 644 ? -20.468 21.324  -59.699  1.00 146.66 ? 653 GLY A O   1 
ATOM   4444  N N   . SER A 1 645 ? -20.314 19.086  -59.889  1.00 130.81 ? 654 SER A N   1 
ATOM   4445  C CA  . SER A 1 645 ? -19.108 18.985  -59.076  1.00 129.43 ? 654 SER A CA  1 
ATOM   4446  C C   . SER A 1 645 ? -17.947 19.738  -59.714  1.00 129.68 ? 654 SER A C   1 
ATOM   4447  O O   . SER A 1 645 ? -17.048 20.215  -59.021  1.00 129.35 ? 654 SER A O   1 
ATOM   4448  C CB  . SER A 1 645 ? -18.726 17.520  -58.866  1.00 127.73 ? 654 SER A CB  1 
ATOM   4449  O OG  . SER A 1 645 ? -18.330 16.918  -60.086  1.00 127.54 ? 654 SER A OG  1 
ATOM   4450  N N   . THR A 1 646 ? -17.971 19.839  -61.039  1.00 130.02 ? 655 THR A N   1 
ATOM   4451  C CA  . THR A 1 646 ? -16.922 20.537  -61.771  1.00 130.55 ? 655 THR A CA  1 
ATOM   4452  C C   . THR A 1 646 ? -16.858 22.005  -61.367  1.00 131.96 ? 655 THR A C   1 
ATOM   4453  O O   . THR A 1 646 ? -15.791 22.519  -61.028  1.00 131.74 ? 655 THR A O   1 
ATOM   4454  C CB  . THR A 1 646 ? -17.137 20.445  -63.292  1.00 131.73 ? 655 THR A CB  1 
ATOM   4455  O OG1 . THR A 1 646 ? -17.227 19.070  -63.683  1.00 130.73 ? 655 THR A OG1 1 
ATOM   4456  C CG2 . THR A 1 646 ? -15.984 21.106  -64.032  1.00 132.37 ? 655 THR A CG2 1 
ATOM   4457  N N   . LYS A 1 647 ? -18.005 22.675  -61.405  1.00 127.44 ? 656 LYS A N   1 
ATOM   4458  C CA  . LYS A 1 647 ? -18.085 24.083  -61.032  1.00 129.28 ? 656 LYS A CA  1 
ATOM   4459  C C   . LYS A 1 647 ? -17.832 24.270  -59.541  1.00 128.63 ? 656 LYS A C   1 
ATOM   4460  O O   . LYS A 1 647 ? -17.075 25.153  -59.135  1.00 129.25 ? 656 LYS A O   1 
ATOM   4461  C CB  . LYS A 1 647 ? -19.451 24.660  -61.407  1.00 131.62 ? 656 LYS A CB  1 
ATOM   4462  N N   . GLU A 1 648 ? -18.468 23.432  -58.729  1.00 151.98 ? 657 GLU A N   1 
ATOM   4463  C CA  . GLU A 1 648 ? -18.325 23.510  -57.280  1.00 151.62 ? 657 GLU A CA  1 
ATOM   4464  C C   . GLU A 1 648 ? -16.889 23.230  -56.845  1.00 150.13 ? 657 GLU A C   1 
ATOM   4465  O O   . GLU A 1 648 ? -16.479 23.609  -55.748  1.00 150.35 ? 657 GLU A O   1 
ATOM   4466  C CB  . GLU A 1 648 ? -19.285 22.536  -56.593  1.00 150.91 ? 657 GLU A CB  1 
ATOM   4467  N N   . PHE A 1 649 ? -16.131 22.566  -57.710  1.00 126.66 ? 658 PHE A N   1 
ATOM   4468  C CA  . PHE A 1 649 ? -14.738 22.255  -57.416  1.00 125.50 ? 658 PHE A CA  1 
ATOM   4469  C C   . PHE A 1 649 ? -13.899 23.522  -57.314  1.00 126.70 ? 658 PHE A C   1 
ATOM   4470  O O   . PHE A 1 649 ? -13.221 23.747  -56.313  1.00 126.66 ? 658 PHE A O   1 
ATOM   4471  C CB  . PHE A 1 649 ? -14.153 21.325  -58.481  1.00 124.40 ? 658 PHE A CB  1 
ATOM   4472  C CG  . PHE A 1 649 ? -12.659 21.192  -58.411  1.00 123.74 ? 658 PHE A CG  1 
ATOM   4473  C CD1 . PHE A 1 649 ? -12.061 20.465  -57.394  1.00 122.71 ? 658 PHE A CD1 1 
ATOM   4474  C CD2 . PHE A 1 649 ? -11.851 21.791  -59.363  1.00 124.43 ? 658 PHE A CD2 1 
ATOM   4475  C CE1 . PHE A 1 649 ? -10.687 20.341  -57.327  1.00 122.41 ? 658 PHE A CE1 1 
ATOM   4476  C CE2 . PHE A 1 649 ? -10.476 21.669  -59.301  1.00 124.04 ? 658 PHE A CE2 1 
ATOM   4477  C CZ  . PHE A 1 649 ? -9.893  20.943  -58.282  1.00 123.04 ? 658 PHE A CZ  1 
ATOM   4478  N N   . PHE A 1 650 ? -13.951 24.346  -58.355  1.00 130.16 ? 659 PHE A N   1 
ATOM   4479  C CA  . PHE A 1 650 ? -13.191 25.590  -58.387  1.00 131.61 ? 659 PHE A CA  1 
ATOM   4480  C C   . PHE A 1 650 ? -13.631 26.543  -57.282  1.00 133.13 ? 659 PHE A C   1 
ATOM   4481  O O   . PHE A 1 650 ? -12.806 27.222  -56.670  1.00 133.80 ? 659 PHE A O   1 
ATOM   4482  C CB  . PHE A 1 650 ? -13.329 26.269  -59.752  1.00 133.12 ? 659 PHE A CB  1 
ATOM   4483  C CG  . PHE A 1 650 ? -12.709 25.495  -60.877  1.00 132.14 ? 659 PHE A CG  1 
ATOM   4484  C CD1 . PHE A 1 650 ? -11.350 25.582  -61.126  1.00 131.85 ? 659 PHE A CD1 1 
ATOM   4485  C CD2 . PHE A 1 650 ? -13.483 24.679  -61.685  1.00 131.78 ? 659 PHE A CD2 1 
ATOM   4486  C CE1 . PHE A 1 650 ? -10.773 24.872  -62.160  1.00 131.28 ? 659 PHE A CE1 1 
ATOM   4487  C CE2 . PHE A 1 650 ? -12.912 23.966  -62.721  1.00 131.23 ? 659 PHE A CE2 1 
ATOM   4488  C CZ  . PHE A 1 650 ? -11.555 24.062  -62.958  1.00 131.01 ? 659 PHE A CZ  1 
ATOM   4489  N N   . ARG A 1 651 ? -14.935 26.588  -57.032  1.00 129.90 ? 660 ARG A N   1 
ATOM   4490  C CA  . ARG A 1 651 ? -15.491 27.470  -56.013  1.00 131.75 ? 660 ARG A CA  1 
ATOM   4491  C C   . ARG A 1 651 ? -14.914 27.170  -54.633  1.00 130.99 ? 660 ARG A C   1 
ATOM   4492  O O   . ARG A 1 651 ? -14.589 28.083  -53.874  1.00 132.59 ? 660 ARG A O   1 
ATOM   4493  C CB  . ARG A 1 651 ? -17.016 27.353  -55.981  1.00 132.67 ? 660 ARG A CB  1 
ATOM   4494  N N   . ARG A 1 652 ? -14.783 25.885  -54.317  1.00 130.76 ? 661 ARG A N   1 
ATOM   4495  C CA  . ARG A 1 652 ? -14.319 25.463  -53.000  1.00 130.24 ? 661 ARG A CA  1 
ATOM   4496  C C   . ARG A 1 652 ? -12.812 25.216  -52.959  1.00 129.24 ? 661 ARG A C   1 
ATOM   4497  O O   . ARG A 1 652 ? -12.228 25.084  -51.884  1.00 129.33 ? 661 ARG A O   1 
ATOM   4498  C CB  . ARG A 1 652 ? -15.066 24.205  -52.550  1.00 128.89 ? 661 ARG A CB  1 
ATOM   4499  N N   . SER A 1 653 ? -12.189 25.154  -54.131  1.00 147.83 ? 662 SER A N   1 
ATOM   4500  C CA  . SER A 1 653 ? -10.759 24.876  -54.221  1.00 147.05 ? 662 SER A CA  1 
ATOM   4501  C C   . SER A 1 653 ? -9.924  26.001  -53.618  1.00 148.66 ? 662 SER A C   1 
ATOM   4502  O O   . SER A 1 653 ? -10.115 27.173  -53.942  1.00 150.36 ? 662 SER A O   1 
ATOM   4503  C CB  . SER A 1 653 ? -10.345 24.639  -55.675  1.00 146.38 ? 662 SER A CB  1 
ATOM   4504  O OG  . SER A 1 653 ? -8.976  24.287  -55.764  1.00 145.77 ? 662 SER A OG  1 
ATOM   4505  N N   . LYS A 1 654 ? -8.997  25.634  -52.739  1.00 143.32 ? 663 LYS A N   1 
ATOM   4506  C CA  . LYS A 1 654 ? -8.120  26.606  -52.097  1.00 144.97 ? 663 LYS A CA  1 
ATOM   4507  C C   . LYS A 1 654 ? -6.728  26.578  -52.718  1.00 144.65 ? 663 LYS A C   1 
ATOM   4508  O O   . LYS A 1 654 ? -5.787  27.169  -52.186  1.00 145.86 ? 663 LYS A O   1 
ATOM   4509  C CB  . LYS A 1 654 ? -8.032  26.337  -50.593  1.00 145.51 ? 663 LYS A CB  1 
ATOM   4510  N N   . ILE A 1 655 ? -6.603  25.887  -53.847  1.00 128.80 ? 664 ILE A N   1 
ATOM   4511  C CA  . ILE A 1 655 ? -5.328  25.787  -54.548  1.00 128.63 ? 664 ILE A CA  1 
ATOM   4512  C C   . ILE A 1 655 ? -5.034  27.070  -55.321  1.00 130.18 ? 664 ILE A C   1 
ATOM   4513  O O   . ILE A 1 655 ? -5.942  27.702  -55.858  1.00 130.89 ? 664 ILE A O   1 
ATOM   4514  C CB  . ILE A 1 655 ? -5.306  24.582  -55.509  1.00 126.96 ? 664 ILE A CB  1 
ATOM   4515  C CG1 . ILE A 1 655 ? -5.696  23.304  -54.763  1.00 125.65 ? 664 ILE A CG1 1 
ATOM   4516  C CG2 . ILE A 1 655 ? -3.935  24.432  -56.151  1.00 127.08 ? 664 ILE A CG2 1 
ATOM   4517  C CD1 . ILE A 1 655 ? -5.671  22.060  -55.622  1.00 124.29 ? 664 ILE A CD1 1 
ATOM   4518  N N   . ALA A 1 656 ? -3.759  27.445  -55.368  1.00 138.83 ? 665 ALA A N   1 
ATOM   4519  C CA  . ALA A 1 656 ? -3.332  28.691  -56.001  1.00 140.60 ? 665 ALA A CA  1 
ATOM   4520  C C   . ALA A 1 656 ? -3.947  28.906  -57.383  1.00 140.69 ? 665 ALA A C   1 
ATOM   4521  O O   . ALA A 1 656 ? -4.753  29.817  -57.576  1.00 142.05 ? 665 ALA A O   1 
ATOM   4522  C CB  . ALA A 1 656 ? -1.811  28.746  -56.083  1.00 141.12 ? 665 ALA A CB  1 
ATOM   4523  N N   . VAL A 1 657 ? -3.561  28.067  -58.339  1.00 138.58 ? 666 VAL A N   1 
ATOM   4524  C CA  . VAL A 1 657 ? -4.005  28.217  -59.722  1.00 138.96 ? 666 VAL A CA  1 
ATOM   4525  C C   . VAL A 1 657 ? -5.526  28.204  -59.859  1.00 138.83 ? 666 VAL A C   1 
ATOM   4526  O O   . VAL A 1 657 ? -6.113  29.127  -60.423  1.00 140.45 ? 666 VAL A O   1 
ATOM   4527  C CB  . VAL A 1 657 ? -3.415  27.118  -60.625  1.00 137.84 ? 666 VAL A CB  1 
ATOM   4528  C CG1 . VAL A 1 657 ? -3.881  27.308  -62.061  1.00 138.63 ? 666 VAL A CG1 1 
ATOM   4529  C CG2 . VAL A 1 657 ? -1.896  27.125  -60.546  1.00 138.26 ? 666 VAL A CG2 1 
ATOM   4530  N N   . PHE A 1 658 ? -6.157  27.154  -59.342  1.00 133.17 ? 667 PHE A N   1 
ATOM   4531  C CA  . PHE A 1 658 ? -7.601  26.990  -59.467  1.00 133.00 ? 667 PHE A CA  1 
ATOM   4532  C C   . PHE A 1 658 ? -8.370  28.141  -58.824  1.00 134.70 ? 667 PHE A C   1 
ATOM   4533  O O   . PHE A 1 658 ? -9.497  28.441  -59.218  1.00 135.53 ? 667 PHE A O   1 
ATOM   4534  C CB  . PHE A 1 658 ? -8.044  25.655  -58.866  1.00 131.04 ? 667 PHE A CB  1 
ATOM   4535  C CG  . PHE A 1 658 ? -7.328  24.468  -59.440  1.00 129.68 ? 667 PHE A CG  1 
ATOM   4536  C CD1 . PHE A 1 658 ? -7.512  24.105  -60.763  1.00 129.73 ? 667 PHE A CD1 1 
ATOM   4537  C CD2 . PHE A 1 658 ? -6.471  23.713  -58.657  1.00 128.72 ? 667 PHE A CD2 1 
ATOM   4538  C CE1 . PHE A 1 658 ? -6.854  23.014  -61.296  1.00 128.84 ? 667 PHE A CE1 1 
ATOM   4539  C CE2 . PHE A 1 658 ? -5.811  22.619  -59.183  1.00 127.85 ? 667 PHE A CE2 1 
ATOM   4540  C CZ  . PHE A 1 658 ? -6.003  22.269  -60.505  1.00 127.91 ? 667 PHE A CZ  1 
ATOM   4541  N N   . ASP A 1 659 ? -7.756  28.782  -57.834  1.00 150.05 ? 668 ASP A N   1 
ATOM   4542  C CA  . ASP A 1 659 ? -8.374  29.921  -57.166  1.00 152.08 ? 668 ASP A CA  1 
ATOM   4543  C C   . ASP A 1 659 ? -8.592  31.061  -58.153  1.00 154.31 ? 668 ASP A C   1 
ATOM   4544  O O   . ASP A 1 659 ? -9.716  31.529  -58.337  1.00 155.62 ? 668 ASP A O   1 
ATOM   4545  C CB  . ASP A 1 659 ? -7.508  30.391  -55.994  1.00 152.83 ? 668 ASP A CB  1 
ATOM   4546  C CG  . ASP A 1 659 ? -8.163  31.498  -55.186  1.00 155.17 ? 668 ASP A CG  1 
ATOM   4547  O OD1 . ASP A 1 659 ? -8.739  32.426  -55.793  1.00 157.09 ? 668 ASP A OD1 1 
ATOM   4548  O OD2 . ASP A 1 659 ? -8.093  31.444  -53.940  1.00 155.41 ? 668 ASP A OD2 1 
ATOM   4549  N N   . LYS A 1 660 ? -7.509  31.502  -58.785  1.00 146.23 ? 669 LYS A N   1 
ATOM   4550  C CA  . LYS A 1 660 ? -7.573  32.584  -59.760  1.00 148.61 ? 669 LYS A CA  1 
ATOM   4551  C C   . LYS A 1 660 ? -8.570  32.267  -60.870  1.00 148.67 ? 669 LYS A C   1 
ATOM   4552  O O   . LYS A 1 660 ? -9.339  33.132  -61.292  1.00 150.96 ? 669 LYS A O   1 
ATOM   4553  C CB  . LYS A 1 660 ? -6.189  32.850  -60.356  1.00 149.01 ? 669 LYS A CB  1 
ATOM   4554  N N   . MET A 1 661 ? -8.552  31.023  -61.337  1.00 159.26 ? 670 MET A N   1 
ATOM   4555  C CA  . MET A 1 661 ? -9.458  30.586  -62.393  1.00 159.32 ? 670 MET A CA  1 
ATOM   4556  C C   . MET A 1 661 ? -10.911 30.835  -62.006  1.00 160.21 ? 670 MET A C   1 
ATOM   4557  O O   . MET A 1 661 ? -11.689 31.378  -62.791  1.00 162.20 ? 670 MET A O   1 
ATOM   4558  C CB  . MET A 1 661 ? -9.245  29.104  -62.703  1.00 156.79 ? 670 MET A CB  1 
ATOM   4559  C CG  . MET A 1 661 ? -7.843  28.764  -63.177  1.00 156.18 ? 670 MET A CG  1 
ATOM   4560  S SD  . MET A 1 661 ? -7.676  27.035  -63.658  1.00 153.85 ? 670 MET A SD  1 
ATOM   4561  C CE  . MET A 1 661 ? -8.874  26.936  -64.986  1.00 155.02 ? 670 MET A CE  1 
ATOM   4562  N N   . TRP A 1 662 ? -11.271 30.434  -60.792  1.00 135.93 ? 671 TRP A N   1 
ATOM   4563  C CA  . TRP A 1 662 ? -12.630 30.623  -60.301  1.00 136.85 ? 671 TRP A CA  1 
ATOM   4564  C C   . TRP A 1 662 ? -12.975 32.103  -60.193  1.00 140.10 ? 671 TRP A C   1 
ATOM   4565  O O   . TRP A 1 662 ? -14.072 32.519  -60.563  1.00 141.98 ? 671 TRP A O   1 
ATOM   4566  C CB  . TRP A 1 662 ? -12.818 29.936  -58.947  1.00 135.16 ? 671 TRP A CB  1 
ATOM   4567  C CG  . TRP A 1 662 ? -14.126 30.261  -58.293  1.00 136.49 ? 671 TRP A CG  1 
ATOM   4568  C CD1 . TRP A 1 662 ? -14.311 30.916  -57.111  1.00 137.81 ? 671 TRP A CD1 1 
ATOM   4569  C CD2 . TRP A 1 662 ? -15.434 29.956  -58.792  1.00 136.96 ? 671 TRP A CD2 1 
ATOM   4570  N NE1 . TRP A 1 662 ? -15.652 31.033  -56.839  1.00 139.07 ? 671 TRP A NE1 1 
ATOM   4571  C CE2 . TRP A 1 662 ? -16.363 30.452  -57.856  1.00 138.56 ? 671 TRP A CE2 1 
ATOM   4572  C CE3 . TRP A 1 662 ? -15.909 29.311  -59.937  1.00 136.45 ? 671 TRP A CE3 1 
ATOM   4573  C CZ2 . TRP A 1 662 ? -17.739 30.323  -58.030  1.00 139.59 ? 671 TRP A CZ2 1 
ATOM   4574  C CZ3 . TRP A 1 662 ? -17.276 29.183  -60.108  1.00 137.46 ? 671 TRP A CZ3 1 
ATOM   4575  C CH2 . TRP A 1 662 ? -18.174 29.686  -59.160  1.00 138.99 ? 671 TRP A CH2 1 
ATOM   4576  N N   . THR A 1 663 ? -12.035 32.893  -59.685  1.00 140.99 ? 672 THR A N   1 
ATOM   4577  C CA  . THR A 1 663 ? -12.233 34.332  -59.554  1.00 144.37 ? 672 THR A CA  1 
ATOM   4578  C C   . THR A 1 663 ? -12.623 34.943  -60.896  1.00 146.63 ? 672 THR A C   1 
ATOM   4579  O O   . THR A 1 663 ? -13.500 35.803  -60.969  1.00 149.53 ? 672 THR A O   1 
ATOM   4580  C CB  . THR A 1 663 ? -10.967 35.033  -59.026  1.00 145.07 ? 672 THR A CB  1 
ATOM   4581  O OG1 . THR A 1 663 ? -10.633 34.512  -57.733  1.00 143.44 ? 672 THR A OG1 1 
ATOM   4582  C CG2 . THR A 1 663 ? -11.192 36.533  -58.919  1.00 148.91 ? 672 THR A CG2 1 
ATOM   4583  N N   . TYR A 1 664 ? -11.965 34.485  -61.957  1.00 147.17 ? 673 TYR A N   1 
ATOM   4584  C CA  . TYR A 1 664 ? -12.254 34.957  -63.305  1.00 149.37 ? 673 TYR A CA  1 
ATOM   4585  C C   . TYR A 1 664 ? -13.639 34.520  -63.769  1.00 149.79 ? 673 TYR A C   1 
ATOM   4586  O O   . TYR A 1 664 ? -14.453 35.343  -64.185  1.00 152.90 ? 673 TYR A O   1 
ATOM   4587  C CB  . TYR A 1 664 ? -11.189 34.456  -64.284  1.00 148.17 ? 673 TYR A CB  1 
ATOM   4588  C CG  . TYR A 1 664 ? -11.656 34.399  -65.721  1.00 149.66 ? 673 TYR A CG  1 
ATOM   4589  C CD1 . TYR A 1 664 ? -11.700 35.544  -66.505  1.00 153.22 ? 673 TYR A CD1 1 
ATOM   4590  C CD2 . TYR A 1 664 ? -12.051 33.198  -66.294  1.00 147.80 ? 673 TYR A CD2 1 
ATOM   4591  C CE1 . TYR A 1 664 ? -12.127 35.494  -67.820  1.00 154.94 ? 673 TYR A CE1 1 
ATOM   4592  C CE2 . TYR A 1 664 ? -12.479 33.138  -67.607  1.00 149.47 ? 673 TYR A CE2 1 
ATOM   4593  C CZ  . TYR A 1 664 ? -12.515 34.288  -68.365  1.00 153.06 ? 673 TYR A CZ  1 
ATOM   4594  O OH  . TYR A 1 664 ? -12.940 34.231  -69.673  1.00 155.06 ? 673 TYR A OH  1 
ATOM   4595  N N   . MET A 1 665 ? -13.900 33.219  -63.692  1.00 146.97 ? 674 MET A N   1 
ATOM   4596  C CA  . MET A 1 665 ? -15.166 32.659  -64.151  1.00 147.19 ? 674 MET A CA  1 
ATOM   4597  C C   . MET A 1 665 ? -16.352 33.179  -63.344  1.00 148.89 ? 674 MET A C   1 
ATOM   4598  O O   . MET A 1 665 ? -17.471 33.263  -63.852  1.00 150.70 ? 674 MET A O   1 
ATOM   4599  C CB  . MET A 1 665 ? -15.124 31.131  -64.095  1.00 143.75 ? 674 MET A CB  1 
ATOM   4600  C CG  . MET A 1 665 ? -14.056 30.509  -64.979  1.00 142.39 ? 674 MET A CG  1 
ATOM   4601  S SD  . MET A 1 665 ? -14.056 28.708  -64.914  1.00 138.88 ? 674 MET A SD  1 
ATOM   4602  C CE  . MET A 1 665 ? -13.675 28.430  -63.186  1.00 136.66 ? 674 MET A CE  1 
ATOM   4603  N N   . ARG A 1 666 ? -16.100 33.533  -62.088  1.00 147.75 ? 675 ARG A N   1 
ATOM   4604  C CA  . ARG A 1 666 ? -17.160 33.975  -61.188  1.00 149.42 ? 675 ARG A CA  1 
ATOM   4605  C C   . ARG A 1 666 ? -17.764 35.310  -61.611  1.00 153.78 ? 675 ARG A C   1 
ATOM   4606  O O   . ARG A 1 666 ? -18.929 35.587  -61.326  1.00 155.80 ? 675 ARG A O   1 
ATOM   4607  C CB  . ARG A 1 666 ? -16.639 34.070  -59.751  1.00 148.44 ? 675 ARG A CB  1 
ATOM   4608  N N   . SER A 1 667 ? -16.972 36.133  -62.289  1.00 154.44 ? 676 SER A N   1 
ATOM   4609  C CA  . SER A 1 667 ? -17.423 37.462  -62.690  1.00 158.94 ? 676 SER A CA  1 
ATOM   4610  C C   . SER A 1 667 ? -17.214 37.722  -64.179  1.00 160.58 ? 676 SER A C   1 
ATOM   4611  O O   . SER A 1 667 ? -17.335 38.856  -64.642  1.00 164.46 ? 676 SER A O   1 
ATOM   4612  C CB  . SER A 1 667 ? -16.712 38.538  -61.865  1.00 160.65 ? 676 SER A CB  1 
ATOM   4613  O OG  . SER A 1 667 ? -15.306 38.453  -62.021  1.00 158.86 ? 676 SER A OG  1 
ATOM   4614  N N   . ALA A 1 668 ? -16.904 36.668  -64.925  1.00 210.04 ? 677 ALA A N   1 
ATOM   4615  C CA  . ALA A 1 668 ? -16.661 36.793  -66.358  1.00 211.55 ? 677 ALA A CA  1 
ATOM   4616  C C   . ALA A 1 668 ? -17.950 37.089  -67.119  1.00 214.87 ? 677 ALA A C   1 
ATOM   4617  O O   . ALA A 1 668 ? -18.972 36.435  -66.908  1.00 214.18 ? 677 ALA A O   1 
ATOM   4618  C CB  . ALA A 1 668 ? -16.001 35.535  -66.897  1.00 208.03 ? 677 ALA A CB  1 
ATOM   4619  N N   . GLU A 1 669 ? -17.892 38.081  -68.003  1.00 181.94 ? 678 GLU A N   1 
ATOM   4620  C CA  . GLU A 1 669 ? -19.045 38.459  -68.813  1.00 185.78 ? 678 GLU A CA  1 
ATOM   4621  C C   . GLU A 1 669 ? -18.685 38.479  -70.296  1.00 187.48 ? 678 GLU A C   1 
ATOM   4622  O O   . GLU A 1 669 ? -17.647 39.020  -70.677  1.00 188.20 ? 678 GLU A O   1 
ATOM   4623  C CB  . GLU A 1 669 ? -19.578 39.827  -68.381  1.00 190.19 ? 678 GLU A CB  1 
ATOM   4624  N N   . PRO A 1 670 ? -19.545 37.886  -71.140  1.00 204.06 ? 679 PRO A N   1 
ATOM   4625  C CA  . PRO A 1 670 ? -20.786 37.203  -70.756  1.00 203.37 ? 679 PRO A CA  1 
ATOM   4626  C C   . PRO A 1 670 ? -20.527 35.922  -69.967  1.00 198.08 ? 679 PRO A C   1 
ATOM   4627  O O   . PRO A 1 670 ? -19.373 35.564  -69.729  1.00 195.05 ? 679 PRO A O   1 
ATOM   4628  C CB  . PRO A 1 670 ? -21.416 36.856  -72.111  1.00 205.70 ? 679 PRO A CB  1 
ATOM   4629  C CG  . PRO A 1 670 ? -20.250 36.816  -73.053  1.00 205.44 ? 679 PRO A CG  1 
ATOM   4630  C CD  . PRO A 1 670 ? -19.420 37.970  -72.604  1.00 206.65 ? 679 PRO A CD  1 
ATOM   4631  N N   . SER A 1 671 ? -21.598 35.241  -69.573  1.00 181.70 ? 680 SER A N   1 
ATOM   4632  C CA  . SER A 1 671 ? -21.487 34.013  -68.794  1.00 177.10 ? 680 SER A CA  1 
ATOM   4633  C C   . SER A 1 671 ? -20.611 32.976  -69.493  1.00 174.21 ? 680 SER A C   1 
ATOM   4634  O O   . SER A 1 671 ? -20.863 32.604  -70.639  1.00 175.45 ? 680 SER A O   1 
ATOM   4635  C CB  . SER A 1 671 ? -22.875 33.428  -68.517  1.00 177.35 ? 680 SER A CB  1 
ATOM   4636  O OG  . SER A 1 671 ? -22.788 32.260  -67.719  1.00 173.15 ? 680 SER A OG  1 
ATOM   4637  N N   . VAL A 1 672 ? -19.578 32.517  -68.793  1.00 174.33 ? 681 VAL A N   1 
ATOM   4638  C CA  . VAL A 1 672 ? -18.681 31.502  -69.329  1.00 171.62 ? 681 VAL A CA  1 
ATOM   4639  C C   . VAL A 1 672 ? -19.201 30.103  -69.022  1.00 168.74 ? 681 VAL A C   1 
ATOM   4640  O O   . VAL A 1 672 ? -18.621 29.107  -69.452  1.00 166.64 ? 681 VAL A O   1 
ATOM   4641  C CB  . VAL A 1 672 ? -17.259 31.647  -68.758  1.00 169.48 ? 681 VAL A CB  1 
ATOM   4642  C CG1 . VAL A 1 672 ? -16.605 32.914  -69.282  1.00 172.38 ? 681 VAL A CG1 1 
ATOM   4643  C CG2 . VAL A 1 672 ? -17.295 31.645  -67.236  1.00 167.52 ? 681 VAL A CG2 1 
ATOM   4644  N N   . PHE A 1 673 ? -20.299 30.037  -68.276  1.00 152.18 ? 682 PHE A N   1 
ATOM   4645  C CA  . PHE A 1 673 ? -20.906 28.761  -67.920  1.00 149.79 ? 682 PHE A CA  1 
ATOM   4646  C C   . PHE A 1 673 ? -21.995 28.381  -68.917  1.00 151.86 ? 682 PHE A C   1 
ATOM   4647  O O   . PHE A 1 673 ? -22.718 29.242  -69.417  1.00 155.44 ? 682 PHE A O   1 
ATOM   4648  C CB  . PHE A 1 673 ? -21.485 28.819  -66.505  1.00 148.86 ? 682 PHE A CB  1 
ATOM   4649  C CG  . PHE A 1 673 ? -20.514 29.318  -65.473  1.00 147.48 ? 682 PHE A CG  1 
ATOM   4650  C CD1 . PHE A 1 673 ? -19.581 28.465  -64.910  1.00 144.04 ? 682 PHE A CD1 1 
ATOM   4651  C CD2 . PHE A 1 673 ? -20.538 30.641  -65.066  1.00 149.96 ? 682 PHE A CD2 1 
ATOM   4652  C CE1 . PHE A 1 673 ? -18.687 28.923  -63.960  1.00 143.08 ? 682 PHE A CE1 1 
ATOM   4653  C CE2 . PHE A 1 673 ? -19.648 31.104  -64.117  1.00 148.98 ? 682 PHE A CE2 1 
ATOM   4654  C CZ  . PHE A 1 673 ? -18.721 30.244  -63.563  1.00 145.51 ? 682 PHE A CZ  1 
ATOM   4655  N N   . VAL A 1 674 ? -22.108 27.088  -69.201  1.00 159.08 ? 683 VAL A N   1 
ATOM   4656  C CA  . VAL A 1 674 ? -23.105 26.596  -70.143  1.00 161.00 ? 683 VAL A CA  1 
ATOM   4657  C C   . VAL A 1 674 ? -24.192 25.796  -69.432  1.00 159.92 ? 683 VAL A C   1 
ATOM   4658  O O   . VAL A 1 674 ? -24.011 25.357  -68.297  1.00 157.15 ? 683 VAL A O   1 
ATOM   4659  C CB  . VAL A 1 674 ? -22.463 25.723  -71.236  1.00 160.37 ? 683 VAL A CB  1 
ATOM   4660  C CG1 . VAL A 1 674 ? -21.567 26.568  -72.128  1.00 162.30 ? 683 VAL A CG1 1 
ATOM   4661  C CG2 . VAL A 1 674 ? -21.678 24.581  -70.609  1.00 156.34 ? 683 VAL A CG2 1 
ATOM   4662  N N   . ARG A 1 675 ? -25.322 25.611  -70.107  1.00 173.24 ? 684 ARG A N   1 
ATOM   4663  C CA  . ARG A 1 675 ? -26.449 24.881  -69.537  1.00 172.74 ? 684 ARG A CA  1 
ATOM   4664  C C   . ARG A 1 675 ? -26.185 23.378  -69.504  1.00 169.65 ? 684 ARG A C   1 
ATOM   4665  O O   . ARG A 1 675 ? -26.323 22.736  -68.463  1.00 167.19 ? 684 ARG A O   1 
ATOM   4666  C CB  . ARG A 1 675 ? -27.728 25.174  -70.324  1.00 176.72 ? 684 ARG A CB  1 
ATOM   4667  N N   . THR A 1 676 ? -25.807 22.822  -70.651  1.00 173.00 ? 685 THR A N   1 
ATOM   4668  C CA  . THR A 1 676 ? -25.515 21.397  -70.753  1.00 170.60 ? 685 THR A CA  1 
ATOM   4669  C C   . THR A 1 676 ? -24.116 21.164  -71.313  1.00 169.36 ? 685 THR A C   1 
ATOM   4670  O O   . THR A 1 676 ? -23.442 22.104  -71.736  1.00 170.55 ? 685 THR A O   1 
ATOM   4671  C CB  . THR A 1 676 ? -26.542 20.672  -71.643  1.00 172.69 ? 685 THR A CB  1 
ATOM   4672  O OG1 . THR A 1 676 ? -26.438 21.153  -72.989  1.00 175.81 ? 685 THR A OG1 1 
ATOM   4673  C CG2 . THR A 1 676 ? -27.954 20.909  -71.130  1.00 174.27 ? 685 THR A CG2 1 
ATOM   4674  N N   . THR A 1 677 ? -23.684 19.908  -71.311  1.00 143.43 ? 686 THR A N   1 
ATOM   4675  C CA  . THR A 1 677 ? -22.367 19.551  -71.823  1.00 142.39 ? 686 THR A CA  1 
ATOM   4676  C C   . THR A 1 677 ? -22.294 19.756  -73.333  1.00 145.45 ? 686 THR A C   1 
ATOM   4677  O O   . THR A 1 677 ? -21.248 20.123  -73.870  1.00 145.80 ? 686 THR A O   1 
ATOM   4678  C CB  . THR A 1 677 ? -22.009 18.093  -71.486  1.00 139.87 ? 686 THR A CB  1 
ATOM   4679  O OG1 . THR A 1 677 ? -22.055 17.907  -70.066  1.00 137.28 ? 686 THR A OG1 1 
ATOM   4680  C CG2 . THR A 1 677 ? -20.616 17.753  -71.991  1.00 139.11 ? 686 THR A CG2 1 
ATOM   4681  N N   . ALA A 1 678 ? -23.412 19.521  -74.012  1.00 147.09 ? 687 ALA A N   1 
ATOM   4682  C CA  . ALA A 1 678 ? -23.482 19.703  -75.456  1.00 150.54 ? 687 ALA A CA  1 
ATOM   4683  C C   . ALA A 1 678 ? -23.268 21.166  -75.831  1.00 152.92 ? 687 ALA A C   1 
ATOM   4684  O O   . ALA A 1 678 ? -22.602 21.473  -76.821  1.00 154.79 ? 687 ALA A O   1 
ATOM   4685  C CB  . ALA A 1 678 ? -24.816 19.208  -75.989  1.00 152.93 ? 687 ALA A CB  1 
ATOM   4686  N N   . GLU A 1 679 ? -23.836 22.063  -75.032  1.00 157.97 ? 688 GLU A N   1 
ATOM   4687  C CA  . GLU A 1 679 ? -23.697 23.496  -75.262  1.00 160.42 ? 688 GLU A CA  1 
ATOM   4688  C C   . GLU A 1 679 ? -22.243 23.929  -75.116  1.00 158.81 ? 688 GLU A C   1 
ATOM   4689  O O   . GLU A 1 679 ? -21.751 24.757  -75.883  1.00 161.20 ? 688 GLU A O   1 
ATOM   4690  C CB  . GLU A 1 679 ? -24.581 24.282  -74.293  1.00 160.87 ? 688 GLU A CB  1 
ATOM   4691  N N   . GLY A 1 680 ? -21.561 23.363  -74.125  1.00 181.71 ? 689 GLY A N   1 
ATOM   4692  C CA  . GLY A 1 680 ? -20.164 23.672  -73.885  1.00 180.05 ? 689 GLY A CA  1 
ATOM   4693  C C   . GLY A 1 680 ? -19.281 23.277  -75.052  1.00 180.97 ? 689 GLY A C   1 
ATOM   4694  O O   . GLY A 1 680 ? -18.431 24.052  -75.490  1.00 182.14 ? 689 GLY A O   1 
ATOM   4695  N N   . VAL A 1 681 ? -19.485 22.064  -75.556  1.00 155.40 ? 690 VAL A N   1 
ATOM   4696  C CA  . VAL A 1 681 ? -18.724 21.572  -76.698  1.00 156.63 ? 690 VAL A CA  1 
ATOM   4697  C C   . VAL A 1 681 ? -18.989 22.427  -77.932  1.00 160.92 ? 690 VAL A C   1 
ATOM   4698  O O   . VAL A 1 681 ? -18.071 22.744  -78.689  1.00 162.31 ? 690 VAL A O   1 
ATOM   4699  C CB  . VAL A 1 681 ? -19.069 20.105  -77.015  1.00 156.07 ? 690 VAL A CB  1 
ATOM   4700  C CG1 . VAL A 1 681 ? -18.321 19.640  -78.254  1.00 157.95 ? 690 VAL A CG1 1 
ATOM   4701  C CG2 . VAL A 1 681 ? -18.745 19.216  -75.825  1.00 152.13 ? 690 VAL A CG2 1 
ATOM   4702  N N   . ALA A 1 682 ? -20.250 22.799  -78.125  1.00 166.98 ? 691 ALA A N   1 
ATOM   4703  C CA  . ALA A 1 682 ? -20.640 23.633  -79.255  1.00 171.51 ? 691 ALA A CA  1 
ATOM   4704  C C   . ALA A 1 682 ? -19.969 25.000  -79.186  1.00 172.59 ? 691 ALA A C   1 
ATOM   4705  O O   . ALA A 1 682 ? -19.604 25.576  -80.210  1.00 175.80 ? 691 ALA A O   1 
ATOM   4706  C CB  . ALA A 1 682 ? -22.152 23.785  -79.304  1.00 173.79 ? 691 ALA A CB  1 
ATOM   4707  N N   . ARG A 1 683 ? -19.810 25.512  -77.970  1.00 164.16 ? 692 ARG A N   1 
ATOM   4708  C CA  . ARG A 1 683 ? -19.178 26.809  -77.760  1.00 165.08 ? 692 ARG A CA  1 
ATOM   4709  C C   . ARG A 1 683 ? -17.697 26.762  -78.119  1.00 164.21 ? 692 ARG A C   1 
ATOM   4710  O O   . ARG A 1 683 ? -17.129 27.751  -78.582  1.00 166.45 ? 692 ARG A O   1 
ATOM   4711  C CB  . ARG A 1 683 ? -19.354 27.264  -76.310  1.00 162.68 ? 692 ARG A CB  1 
ATOM   4712  N N   . VAL A 1 684 ? -17.076 25.608  -77.903  1.00 185.53 ? 693 VAL A N   1 
ATOM   4713  C CA  . VAL A 1 684 ? -15.663 25.429  -78.213  1.00 184.71 ? 693 VAL A CA  1 
ATOM   4714  C C   . VAL A 1 684 ? -15.455 25.245  -79.713  1.00 188.07 ? 693 VAL A C   1 
ATOM   4715  O O   . VAL A 1 684 ? -14.415 25.618  -80.257  1.00 189.18 ? 693 VAL A O   1 
ATOM   4716  C CB  . VAL A 1 684 ? -15.073 24.217  -77.467  1.00 180.73 ? 693 VAL A CB  1 
ATOM   4717  C CG1 . VAL A 1 684 ? -13.597 24.053  -77.797  1.00 180.25 ? 693 VAL A CG1 1 
ATOM   4718  C CG2 . VAL A 1 684 ? -15.274 24.371  -75.969  1.00 177.66 ? 693 VAL A CG2 1 
ATOM   4719  N N   . ARG A 1 685 ? -16.454 24.673  -80.376  1.00 162.52 ? 694 ARG A N   1 
ATOM   4720  C CA  . ARG A 1 685 ? -16.370 24.399  -81.806  1.00 166.04 ? 694 ARG A CA  1 
ATOM   4721  C C   . ARG A 1 685 ? -16.753 25.609  -82.654  1.00 170.63 ? 694 ARG A C   1 
ATOM   4722  O O   . ARG A 1 685 ? -16.527 25.623  -83.864  1.00 174.08 ? 694 ARG A O   1 
ATOM   4723  C CB  . ARG A 1 685 ? -17.259 23.207  -82.172  1.00 166.35 ? 694 ARG A CB  1 
ATOM   4724  C CG  . ARG A 1 685 ? -16.818 21.889  -81.559  1.00 162.58 ? 694 ARG A CG  1 
ATOM   4725  C CD  . ARG A 1 685 ? -17.801 20.776  -81.887  1.00 163.19 ? 694 ARG A CD  1 
ATOM   4726  N NE  . ARG A 1 685 ? -17.316 19.470  -81.453  1.00 160.24 ? 694 ARG A NE  1 
ATOM   4727  C CZ  . ARG A 1 685 ? -18.002 18.339  -81.578  1.00 160.21 ? 694 ARG A CZ  1 
ATOM   4728  N NH1 . ARG A 1 685 ? -19.210 18.352  -82.124  1.00 162.90 ? 694 ARG A NH1 1 
ATOM   4729  N NH2 . ARG A 1 685 ? -17.482 17.194  -81.156  1.00 157.74 ? 694 ARG A NH2 1 
ATOM   4730  N N   . LYS A 1 686 ? -17.330 26.623  -82.017  1.00 175.63 ? 695 LYS A N   1 
ATOM   4731  C CA  . LYS A 1 686 ? -17.815 27.795  -82.739  1.00 180.29 ? 695 LYS A CA  1 
ATOM   4732  C C   . LYS A 1 686 ? -17.107 29.083  -82.323  1.00 180.61 ? 695 LYS A C   1 
ATOM   4733  O O   . LYS A 1 686 ? -17.480 30.171  -82.764  1.00 184.46 ? 695 LYS A O   1 
ATOM   4734  C CB  . LYS A 1 686 ? -19.327 27.946  -82.554  1.00 181.87 ? 695 LYS A CB  1 
ATOM   4735  N N   . SER A 1 687 ? -16.088 28.959  -81.479  1.00 188.67 ? 696 SER A N   1 
ATOM   4736  C CA  . SER A 1 687 ? -15.346 30.125  -81.008  1.00 188.79 ? 696 SER A CA  1 
ATOM   4737  C C   . SER A 1 687 ? -13.979 30.245  -81.674  1.00 189.52 ? 696 SER A C   1 
ATOM   4738  O O   . SER A 1 687 ? -13.203 31.146  -81.357  1.00 189.67 ? 696 SER A O   1 
ATOM   4739  C CB  . SER A 1 687 ? -15.188 30.088  -79.486  1.00 184.52 ? 696 SER A CB  1 
ATOM   4740  O OG  . SER A 1 687 ? -16.431 30.305  -78.841  1.00 184.61 ? 696 SER A OG  1 
ATOM   4741  N N   . LYS A 1 688 ? -13.692 29.333  -82.598  1.00 201.07 ? 697 LYS A N   1 
ATOM   4742  C CA  . LYS A 1 688 ? -12.427 29.346  -83.327  1.00 202.16 ? 697 LYS A CA  1 
ATOM   4743  C C   . LYS A 1 688 ? -11.226 29.290  -82.386  1.00 198.43 ? 697 LYS A C   1 
ATOM   4744  O O   . LYS A 1 688 ? -10.176 29.866  -82.672  1.00 199.54 ? 697 LYS A O   1 
ATOM   4745  C CB  . LYS A 1 688 ? -12.338 30.582  -84.225  1.00 207.03 ? 697 LYS A CB  1 
ATOM   4746  N N   . GLY A 1 689 ? -11.388 28.594  -81.265  1.00 182.86 ? 698 GLY A N   1 
ATOM   4747  C CA  . GLY A 1 689 ? -10.313 28.431  -80.303  1.00 179.36 ? 698 GLY A CA  1 
ATOM   4748  C C   . GLY A 1 689 ? -10.211 29.574  -79.310  1.00 178.65 ? 698 GLY A C   1 
ATOM   4749  O O   . GLY A 1 689 ? -9.170  29.768  -78.682  1.00 176.87 ? 698 GLY A O   1 
ATOM   4750  N N   . LYS A 1 690 ? -11.294 30.330  -79.164  1.00 162.29 ? 699 LYS A N   1 
ATOM   4751  C CA  . LYS A 1 690 ? -11.318 31.458  -78.240  1.00 162.19 ? 699 LYS A CA  1 
ATOM   4752  C C   . LYS A 1 690 ? -11.974 31.079  -76.917  1.00 158.88 ? 699 LYS A C   1 
ATOM   4753  O O   . LYS A 1 690 ? -11.933 31.844  -75.953  1.00 158.25 ? 699 LYS A O   1 
ATOM   4754  C CB  . LYS A 1 690 ? -12.044 32.651  -78.866  1.00 166.69 ? 699 LYS A CB  1 
ATOM   4755  N N   . TYR A 1 691 ? -12.579 29.896  -76.874  1.00 159.49 ? 700 TYR A N   1 
ATOM   4756  C CA  . TYR A 1 691 ? -13.247 29.426  -75.665  1.00 156.50 ? 700 TYR A CA  1 
ATOM   4757  C C   . TYR A 1 691 ? -12.873 27.988  -75.319  1.00 152.99 ? 700 TYR A C   1 
ATOM   4758  O O   . TYR A 1 691 ? -12.957 27.092  -76.160  1.00 153.40 ? 700 TYR A O   1 
ATOM   4759  C CB  . TYR A 1 691 ? -14.766 29.554  -75.803  1.00 158.32 ? 700 TYR A CB  1 
ATOM   4760  C CG  . TYR A 1 691 ? -15.531 28.974  -74.634  1.00 155.49 ? 700 TYR A CG  1 
ATOM   4761  C CD1 . TYR A 1 691 ? -15.564 29.626  -73.409  1.00 154.34 ? 700 TYR A CD1 1 
ATOM   4762  C CD2 . TYR A 1 691 ? -16.220 27.774  -74.757  1.00 154.23 ? 700 TYR A CD2 1 
ATOM   4763  C CE1 . TYR A 1 691 ? -16.260 29.101  -72.338  1.00 152.03 ? 700 TYR A CE1 1 
ATOM   4764  C CE2 . TYR A 1 691 ? -16.919 27.241  -73.691  1.00 151.83 ? 700 TYR A CE2 1 
ATOM   4765  C CZ  . TYR A 1 691 ? -16.936 27.909  -72.484  1.00 150.75 ? 700 TYR A CZ  1 
ATOM   4766  O OH  . TYR A 1 691 ? -17.630 27.381  -71.419  1.00 148.62 ? 700 TYR A OH  1 
ATOM   4767  N N   . ALA A 1 692 ? -12.460 27.778  -74.074  1.00 148.91 ? 701 ALA A N   1 
ATOM   4768  C CA  . ALA A 1 692 ? -12.123 26.446  -73.588  1.00 145.69 ? 701 ALA A CA  1 
ATOM   4769  C C   . ALA A 1 692 ? -13.185 25.961  -72.609  1.00 143.80 ? 701 ALA A C   1 
ATOM   4770  O O   . ALA A 1 692 ? -13.765 26.754  -71.869  1.00 144.09 ? 701 ALA A O   1 
ATOM   4771  C CB  . ALA A 1 692 ? -10.755 26.451  -72.929  1.00 143.78 ? 701 ALA A CB  1 
ATOM   4772  N N   . TYR A 1 693 ? -13.438 24.656  -72.609  1.00 143.48 ? 702 TYR A N   1 
ATOM   4773  C CA  . TYR A 1 693 ? -14.452 24.079  -71.735  1.00 141.80 ? 702 TYR A CA  1 
ATOM   4774  C C   . TYR A 1 693 ? -13.850 23.044  -70.791  1.00 138.55 ? 702 TYR A C   1 
ATOM   4775  O O   . TYR A 1 693 ? -13.122 22.148  -71.218  1.00 137.85 ? 702 TYR A O   1 
ATOM   4776  C CB  . TYR A 1 693 ? -15.579 23.456  -72.562  1.00 143.24 ? 702 TYR A CB  1 
ATOM   4777  C CG  . TYR A 1 693 ? -16.668 22.809  -71.734  1.00 141.75 ? 702 TYR A CG  1 
ATOM   4778  C CD1 . TYR A 1 693 ? -17.431 23.558  -70.848  1.00 141.85 ? 702 TYR A CD1 1 
ATOM   4779  C CD2 . TYR A 1 693 ? -16.940 21.452  -71.847  1.00 140.53 ? 702 TYR A CD2 1 
ATOM   4780  C CE1 . TYR A 1 693 ? -18.429 22.972  -70.091  1.00 140.71 ? 702 TYR A CE1 1 
ATOM   4781  C CE2 . TYR A 1 693 ? -17.937 20.858  -71.096  1.00 139.33 ? 702 TYR A CE2 1 
ATOM   4782  C CZ  . TYR A 1 693 ? -18.678 21.622  -70.220  1.00 139.40 ? 702 TYR A CZ  1 
ATOM   4783  O OH  . TYR A 1 693 ? -19.670 21.033  -69.470  1.00 138.41 ? 702 TYR A OH  1 
ATOM   4784  N N   . LEU A 1 694 ? -14.157 23.176  -69.505  1.00 134.89 ? 703 LEU A N   1 
ATOM   4785  C CA  . LEU A 1 694 ? -13.640 22.263  -68.493  1.00 132.10 ? 703 LEU A CA  1 
ATOM   4786  C C   . LEU A 1 694 ? -14.684 21.216  -68.122  1.00 131.00 ? 703 LEU A C   1 
ATOM   4787  O O   . LEU A 1 694 ? -15.791 21.553  -67.699  1.00 131.45 ? 703 LEU A O   1 
ATOM   4788  C CB  . LEU A 1 694 ? -13.207 23.041  -67.249  1.00 131.19 ? 703 LEU A CB  1 
ATOM   4789  C CG  . LEU A 1 694 ? -12.235 24.198  -67.485  1.00 132.46 ? 703 LEU A CG  1 
ATOM   4790  C CD1 . LEU A 1 694 ? -12.025 24.997  -66.210  1.00 131.95 ? 703 LEU A CD1 1 
ATOM   4791  C CD2 . LEU A 1 694 ? -10.909 23.686  -68.026  1.00 132.01 ? 703 LEU A CD2 1 
ATOM   4792  N N   . LEU A 1 695 ? -14.326 19.946  -68.280  1.00 128.74 ? 704 LEU A N   1 
ATOM   4793  C CA  . LEU A 1 695 ? -15.249 18.853  -67.996  1.00 127.86 ? 704 LEU A CA  1 
ATOM   4794  C C   . LEU A 1 695 ? -14.510 17.581  -67.596  1.00 126.05 ? 704 LEU A C   1 
ATOM   4795  O O   . LEU A 1 695 ? -13.280 17.541  -67.593  1.00 125.60 ? 704 LEU A O   1 
ATOM   4796  C CB  . LEU A 1 695 ? -16.141 18.576  -69.207  1.00 129.82 ? 704 LEU A CB  1 
ATOM   4797  C CG  . LEU A 1 695 ? -15.500 17.849  -70.392  1.00 130.75 ? 704 LEU A CG  1 
ATOM   4798  C CD1 . LEU A 1 695 ? -16.550 17.504  -71.435  1.00 132.84 ? 704 LEU A CD1 1 
ATOM   4799  C CD2 . LEU A 1 695 ? -14.380 18.672  -71.008  1.00 131.84 ? 704 LEU A CD2 1 
ATOM   4800  N N   . GLU A 1 696 ? -15.271 16.544  -67.259  1.00 126.43 ? 705 GLU A N   1 
ATOM   4801  C CA  . GLU A 1 696 ? -14.695 15.263  -66.868  1.00 125.07 ? 705 GLU A CA  1 
ATOM   4802  C C   . GLU A 1 696 ? -13.880 14.661  -68.007  1.00 126.07 ? 705 GLU A C   1 
ATOM   4803  O O   . GLU A 1 696 ? -14.330 14.619  -69.151  1.00 127.80 ? 705 GLU A O   1 
ATOM   4804  C CB  . GLU A 1 696 ? -15.794 14.289  -66.436  1.00 124.52 ? 705 GLU A CB  1 
ATOM   4805  N N   . SER A 1 697 ? -12.678 14.195  -67.683  1.00 123.66 ? 706 SER A N   1 
ATOM   4806  C CA  . SER A 1 697 ? -11.776 13.631  -68.680  1.00 124.81 ? 706 SER A CA  1 
ATOM   4807  C C   . SER A 1 697 ? -12.435 12.502  -69.466  1.00 125.86 ? 706 SER A C   1 
ATOM   4808  O O   . SER A 1 697 ? -12.267 12.402  -70.680  1.00 127.75 ? 706 SER A O   1 
ATOM   4809  C CB  . SER A 1 697 ? -10.492 13.126  -68.016  1.00 123.85 ? 706 SER A CB  1 
ATOM   4810  O OG  . SER A 1 697 ? -10.756 12.027  -67.162  1.00 122.72 ? 706 SER A OG  1 
ATOM   4811  N N   . THR A 1 698 ? -13.186 11.658  -68.768  1.00 125.51 ? 707 THR A N   1 
ATOM   4812  C CA  . THR A 1 698 ? -13.847 10.518  -69.395  1.00 126.56 ? 707 THR A CA  1 
ATOM   4813  C C   . THR A 1 698 ? -14.719 10.943  -70.572  1.00 128.55 ? 707 THR A C   1 
ATOM   4814  O O   . THR A 1 698 ? -14.570 10.432  -71.682  1.00 130.45 ? 707 THR A O   1 
ATOM   4815  C CB  . THR A 1 698 ? -14.709 9.738   -68.386  1.00 125.27 ? 707 THR A CB  1 
ATOM   4816  O OG1 . THR A 1 698 ? -15.631 10.632  -67.748  1.00 124.50 ? 707 THR A OG1 1 
ATOM   4817  C CG2 . THR A 1 698 ? -13.832 9.087   -67.330  1.00 123.87 ? 707 THR A CG2 1 
ATOM   4818  N N   . MET A 1 699 ? -15.628 11.880  -70.325  1.00 148.09 ? 708 MET A N   1 
ATOM   4819  C CA  . MET A 1 699 ? -16.526 12.363  -71.366  1.00 150.25 ? 708 MET A CA  1 
ATOM   4820  C C   . MET A 1 699 ? -15.755 13.140  -72.428  1.00 152.03 ? 708 MET A C   1 
ATOM   4821  O O   . MET A 1 699 ? -16.109 13.116  -73.606  1.00 154.45 ? 708 MET A O   1 
ATOM   4822  C CB  . MET A 1 699 ? -17.623 13.241  -70.763  1.00 149.94 ? 708 MET A CB  1 
ATOM   4823  C CG  . MET A 1 699 ? -18.741 13.593  -71.732  1.00 152.42 ? 708 MET A CG  1 
ATOM   4824  S SD  . MET A 1 699 ? -19.672 12.146  -72.272  1.00 153.56 ? 708 MET A SD  1 
ATOM   4825  C CE  . MET A 1 699 ? -20.835 12.895  -73.410  1.00 156.88 ? 708 MET A CE  1 
ATOM   4826  N N   . ASN A 1 700 ? -14.701 13.828  -72.002  1.00 133.18 ? 709 ASN A N   1 
ATOM   4827  C CA  . ASN A 1 700 ? -13.869 14.603  -72.914  1.00 134.84 ? 709 ASN A CA  1 
ATOM   4828  C C   . ASN A 1 700 ? -13.159 13.711  -73.926  1.00 136.40 ? 709 ASN A C   1 
ATOM   4829  O O   . ASN A 1 700 ? -13.246 13.934  -75.133  1.00 138.96 ? 709 ASN A O   1 
ATOM   4830  C CB  . ASN A 1 700 ? -12.846 15.430  -72.131  1.00 133.41 ? 709 ASN A CB  1 
ATOM   4831  C CG  . ASN A 1 700 ? -12.028 16.346  -73.022  1.00 135.23 ? 709 ASN A CG  1 
ATOM   4832  O OD1 . ASN A 1 700 ? -12.227 16.394  -74.235  1.00 137.65 ? 709 ASN A OD1 1 
ATOM   4833  N ND2 . ASN A 1 700 ? -11.101 17.081  -72.419  1.00 134.28 ? 709 ASN A ND2 1 
ATOM   4834  N N   . GLU A 1 701 ? -12.460 12.699  -73.424  1.00 153.57 ? 710 GLU A N   1 
ATOM   4835  C CA  . GLU A 1 701 ? -11.743 11.758  -74.275  1.00 155.20 ? 710 GLU A CA  1 
ATOM   4836  C C   . GLU A 1 701 ? -12.667 11.154  -75.324  1.00 157.52 ? 710 GLU A C   1 
ATOM   4837  O O   . GLU A 1 701 ? -12.263 10.920  -76.463  1.00 160.04 ? 710 GLU A O   1 
ATOM   4838  C CB  . GLU A 1 701 ? -11.118 10.646  -73.430  1.00 153.66 ? 710 GLU A CB  1 
ATOM   4839  C CG  . GLU A 1 701 ? -10.060 11.128  -72.451  1.00 151.82 ? 710 GLU A CG  1 
ATOM   4840  C CD  . GLU A 1 701 ? -9.618  10.041  -71.490  1.00 150.46 ? 710 GLU A CD  1 
ATOM   4841  O OE1 . GLU A 1 701 ? -8.637  10.265  -70.749  1.00 149.40 ? 710 GLU A OE1 1 
ATOM   4842  O OE2 . GLU A 1 701 ? -10.251 8.964   -71.474  1.00 150.67 ? 710 GLU A OE2 1 
ATOM   4843  N N   . TYR A 1 702 ? -13.911 10.903  -74.931  1.00 139.02 ? 711 TYR A N   1 
ATOM   4844  C CA  . TYR A 1 702 ? -14.901 10.329  -75.833  1.00 141.27 ? 711 TYR A CA  1 
ATOM   4845  C C   . TYR A 1 702 ? -15.284 11.315  -76.932  1.00 143.88 ? 711 TYR A C   1 
ATOM   4846  O O   . TYR A 1 702 ? -15.388 10.944  -78.100  1.00 146.77 ? 711 TYR A O   1 
ATOM   4847  C CB  . TYR A 1 702 ? -16.143 9.893   -75.053  1.00 139.97 ? 711 TYR A CB  1 
ATOM   4848  C CG  . TYR A 1 702 ? -17.251 9.338   -75.920  1.00 142.38 ? 711 TYR A CG  1 
ATOM   4849  C CD1 . TYR A 1 702 ? -17.198 8.038   -76.401  1.00 143.73 ? 711 TYR A CD1 1 
ATOM   4850  C CD2 . TYR A 1 702 ? -18.354 10.115  -76.252  1.00 143.62 ? 711 TYR A CD2 1 
ATOM   4851  C CE1 . TYR A 1 702 ? -18.210 7.527   -77.193  1.00 146.19 ? 711 TYR A CE1 1 
ATOM   4852  C CE2 . TYR A 1 702 ? -19.371 9.613   -77.043  1.00 146.10 ? 711 TYR A CE2 1 
ATOM   4853  C CZ  . TYR A 1 702 ? -19.294 8.318   -77.510  1.00 147.33 ? 711 TYR A CZ  1 
ATOM   4854  O OH  . TYR A 1 702 ? -20.304 7.813   -78.297  1.00 150.03 ? 711 TYR A OH  1 
ATOM   4855  N N   . ILE A 1 703 ? -15.493 12.571  -76.549  1.00 145.20 ? 712 ILE A N   1 
ATOM   4856  C CA  . ILE A 1 703 ? -15.847 13.617  -77.503  1.00 147.83 ? 712 ILE A CA  1 
ATOM   4857  C C   . ILE A 1 703 ? -14.766 13.776  -78.568  1.00 150.04 ? 712 ILE A C   1 
ATOM   4858  O O   . ILE A 1 703 ? -15.065 14.003  -79.740  1.00 153.28 ? 712 ILE A O   1 
ATOM   4859  C CB  . ILE A 1 703 ? -16.069 14.971  -76.799  1.00 146.72 ? 712 ILE A CB  1 
ATOM   4860  C CG1 . ILE A 1 703 ? -17.290 14.902  -75.880  1.00 145.26 ? 712 ILE A CG1 1 
ATOM   4861  C CG2 . ILE A 1 703 ? -16.238 16.084  -77.820  1.00 149.79 ? 712 ILE A CG2 1 
ATOM   4862  C CD1 . ILE A 1 703 ? -18.583 14.602  -76.607  1.00 147.66 ? 712 ILE A CD1 1 
ATOM   4863  N N   . GLU A 1 704 ? -13.511 13.649  -78.151  1.00 156.64 ? 713 GLU A N   1 
ATOM   4864  C CA  . GLU A 1 704 ? -12.379 13.766  -79.063  1.00 158.67 ? 713 GLU A CA  1 
ATOM   4865  C C   . GLU A 1 704 ? -12.431 12.700  -80.154  1.00 161.45 ? 713 GLU A C   1 
ATOM   4866  O O   . GLU A 1 704 ? -11.853 12.868  -81.228  1.00 164.30 ? 713 GLU A O   1 
ATOM   4867  C CB  . GLU A 1 704 ? -11.061 13.670  -78.291  1.00 156.50 ? 713 GLU A CB  1 
ATOM   4868  C CG  . GLU A 1 704 ? -9.820  13.673  -79.167  1.00 158.63 ? 713 GLU A CG  1 
ATOM   4869  C CD  . GLU A 1 704 ? -8.537  13.714  -78.358  1.00 156.66 ? 713 GLU A CD  1 
ATOM   4870  O OE1 . GLU A 1 704 ? -8.571  14.209  -77.212  1.00 153.95 ? 713 GLU A OE1 1 
ATOM   4871  O OE2 . GLU A 1 704 ? -7.494  13.255  -78.869  1.00 158.09 ? 713 GLU A OE2 1 
ATOM   4872  N N   . GLN A 1 705 ? -13.132 11.607  -79.874  1.00 150.00 ? 714 GLN A N   1 
ATOM   4873  C CA  . GLN A 1 705 ? -13.247 10.507  -80.825  1.00 152.73 ? 714 GLN A CA  1 
ATOM   4874  C C   . GLN A 1 705 ? -14.596 10.529  -81.540  1.00 155.09 ? 714 GLN A C   1 
ATOM   4875  O O   . GLN A 1 705 ? -15.107 9.488   -81.952  1.00 156.63 ? 714 GLN A O   1 
ATOM   4876  C CB  . GLN A 1 705 ? -13.049 9.167   -80.116  1.00 151.07 ? 714 GLN A CB  1 
ATOM   4877  C CG  . GLN A 1 705 ? -11.887 9.152   -79.135  1.00 148.39 ? 714 GLN A CG  1 
ATOM   4878  C CD  . GLN A 1 705 ? -10.569 9.520   -79.784  1.00 149.99 ? 714 GLN A CD  1 
ATOM   4879  O OE1 . GLN A 1 705 ? -10.368 9.296   -80.977  1.00 153.32 ? 714 GLN A OE1 1 
ATOM   4880  N NE2 . GLN A 1 705 ? -9.659  10.084  -78.997  1.00 147.84 ? 714 GLN A NE2 1 
ATOM   4881  N N   . ARG A 1 706 ? -15.166 11.722  -81.681  1.00 198.50 ? 715 ARG A N   1 
ATOM   4882  C CA  . ARG A 1 706 ? -16.443 11.888  -82.367  1.00 201.11 ? 715 ARG A CA  1 
ATOM   4883  C C   . ARG A 1 706 ? -16.341 12.981  -83.427  1.00 204.43 ? 715 ARG A C   1 
ATOM   4884  O O   . ARG A 1 706 ? -15.675 13.995  -83.221  1.00 203.66 ? 715 ARG A O   1 
ATOM   4885  C CB  . ARG A 1 706 ? -17.550 12.232  -81.368  1.00 198.83 ? 715 ARG A CB  1 
ATOM   4886  C CG  . ARG A 1 706 ? -17.616 11.308  -80.162  1.00 195.36 ? 715 ARG A CG  1 
ATOM   4887  C CD  . ARG A 1 706 ? -17.921 9.876   -80.569  1.00 196.66 ? 715 ARG A CD  1 
ATOM   4888  N NE  . ARG A 1 706 ? -19.246 9.746   -81.168  1.00 199.16 ? 715 ARG A NE  1 
ATOM   4889  C CZ  . ARG A 1 706 ? -19.795 8.588   -81.524  1.00 200.66 ? 715 ARG A CZ  1 
ATOM   4890  N NH1 . ARG A 1 706 ? -19.133 7.454   -81.339  1.00 199.96 ? 715 ARG A NH1 1 
ATOM   4891  N NH2 . ARG A 1 706 ? -21.007 8.564   -82.063  1.00 203.12 ? 715 ARG A NH2 1 
ATOM   4892  N N   . LYS A 1 707 ? -17.004 12.768  -84.560  1.00 174.21 ? 716 LYS A N   1 
ATOM   4893  C CA  . LYS A 1 707 ? -16.993 13.738  -85.651  1.00 178.01 ? 716 LYS A CA  1 
ATOM   4894  C C   . LYS A 1 707 ? -17.466 15.107  -85.170  1.00 177.23 ? 716 LYS A C   1 
ATOM   4895  O O   . LYS A 1 707 ? -18.271 15.196  -84.243  1.00 174.87 ? 716 LYS A O   1 
ATOM   4896  C CB  . LYS A 1 707 ? -17.873 13.252  -86.804  1.00 182.42 ? 716 LYS A CB  1 
ATOM   4897  N N   . PRO A 1 708 ? -16.970 16.182  -85.803  1.00 190.43 ? 717 PRO A N   1 
ATOM   4898  C CA  . PRO A 1 708 ? -16.010 16.147  -86.911  1.00 193.52 ? 717 PRO A CA  1 
ATOM   4899  C C   . PRO A 1 708 ? -14.562 16.076  -86.432  1.00 190.96 ? 717 PRO A C   1 
ATOM   4900  O O   . PRO A 1 708 ? -13.666 16.539  -87.139  1.00 193.12 ? 717 PRO A O   1 
ATOM   4901  C CB  . PRO A 1 708 ? -16.246 17.488  -87.625  1.00 196.94 ? 717 PRO A CB  1 
ATOM   4902  C CG  . PRO A 1 708 ? -17.459 18.107  -86.962  1.00 196.00 ? 717 PRO A CG  1 
ATOM   4903  C CD  . PRO A 1 708 ? -17.486 17.540  -85.586  1.00 190.93 ? 717 PRO A CD  1 
ATOM   4904  N N   . CYS A 1 709 ? -14.340 15.511  -85.249  1.00 167.68 ? 718 CYS A N   1 
ATOM   4905  C CA  . CYS A 1 709 ? -12.994 15.382  -84.700  1.00 165.27 ? 718 CYS A CA  1 
ATOM   4906  C C   . CYS A 1 709 ? -12.300 16.737  -84.627  1.00 165.28 ? 718 CYS A C   1 
ATOM   4907  O O   . CYS A 1 709 ? -11.197 16.908  -85.145  1.00 166.63 ? 718 CYS A O   1 
ATOM   4908  C CB  . CYS A 1 709 ? -12.162 14.417  -85.546  1.00 167.48 ? 718 CYS A CB  1 
ATOM   4909  S SG  . CYS A 1 709 ? -12.979 12.849  -85.922  1.00 168.79 ? 718 CYS A SG  1 
ATOM   4910  N N   . ASP A 1 710 ? -12.952 17.698  -83.981  1.00 172.76 ? 719 ASP A N   1 
ATOM   4911  C CA  . ASP A 1 710 ? -12.430 19.057  -83.904  1.00 173.12 ? 719 ASP A CA  1 
ATOM   4912  C C   . ASP A 1 710 ? -12.159 19.492  -82.466  1.00 169.00 ? 719 ASP A C   1 
ATOM   4913  O O   . ASP A 1 710 ? -12.008 20.682  -82.188  1.00 169.05 ? 719 ASP A O   1 
ATOM   4914  C CB  . ASP A 1 710 ? -13.398 20.035  -84.574  1.00 176.44 ? 719 ASP A CB  1 
ATOM   4915  C CG  . ASP A 1 710 ? -14.798 19.959  -83.996  1.00 175.44 ? 719 ASP A CG  1 
ATOM   4916  O OD1 . ASP A 1 710 ? -15.022 19.143  -83.078  1.00 172.11 ? 719 ASP A OD1 1 
ATOM   4917  O OD2 . ASP A 1 710 ? -15.676 20.716  -84.462  1.00 178.22 ? 719 ASP A OD2 1 
ATOM   4918  N N   . THR A 1 711 ? -12.099 18.525  -81.557  1.00 172.20 ? 720 THR A N   1 
ATOM   4919  C CA  . THR A 1 711 ? -11.823 18.813  -80.154  1.00 168.44 ? 720 THR A CA  1 
ATOM   4920  C C   . THR A 1 711 ? -10.743 17.885  -79.611  1.00 166.15 ? 720 THR A C   1 
ATOM   4921  O O   . THR A 1 711 ? -10.627 16.736  -80.039  1.00 166.72 ? 720 THR A O   1 
ATOM   4922  C CB  . THR A 1 711 ? -13.088 18.675  -79.289  1.00 166.60 ? 720 THR A CB  1 
ATOM   4923  O OG1 . THR A 1 711 ? -13.621 17.352  -79.427  1.00 166.36 ? 720 THR A OG1 1 
ATOM   4924  C CG2 . THR A 1 711 ? -14.139 19.687  -79.718  1.00 169.00 ? 720 THR A CG2 1 
ATOM   4925  N N   . MET A 1 712 ? -9.956  18.387  -78.665  1.00 180.94 ? 721 MET A N   1 
ATOM   4926  C CA  . MET A 1 712 ? -8.876  17.603  -78.078  1.00 179.00 ? 721 MET A CA  1 
ATOM   4927  C C   . MET A 1 712 ? -8.632  17.975  -76.620  1.00 175.78 ? 721 MET A C   1 
ATOM   4928  O O   . MET A 1 712 ? -8.770  19.136  -76.233  1.00 175.55 ? 721 MET A O   1 
ATOM   4929  C CB  . MET A 1 712 ? -7.587  17.784  -78.882  1.00 181.01 ? 721 MET A CB  1 
ATOM   4930  C CG  . MET A 1 712 ? -7.063  19.210  -78.898  1.00 181.73 ? 721 MET A CG  1 
ATOM   4931  S SD  . MET A 1 712 ? -5.490  19.361  -79.767  1.00 184.10 ? 721 MET A SD  1 
ATOM   4932  C CE  . MET A 1 712 ? -4.445  18.313  -78.758  1.00 181.35 ? 721 MET A CE  1 
ATOM   4933  N N   . LYS A 1 713 ? -8.270  16.981  -75.816  1.00 155.41 ? 722 LYS A N   1 
ATOM   4934  C CA  . LYS A 1 713 ? -7.939  17.209  -74.416  1.00 152.62 ? 722 LYS A CA  1 
ATOM   4935  C C   . LYS A 1 713 ? -6.472  17.602  -74.285  1.00 152.68 ? 722 LYS A C   1 
ATOM   4936  O O   . LYS A 1 713 ? -5.604  17.015  -74.930  1.00 153.95 ? 722 LYS A O   1 
ATOM   4937  C CB  . LYS A 1 713 ? -8.227  15.959  -73.583  1.00 150.57 ? 722 LYS A CB  1 
ATOM   4938  N N   . VAL A 1 714 ? -6.200  18.599  -73.449  1.00 139.11 ? 723 VAL A N   1 
ATOM   4939  C CA  . VAL A 1 714 ? -4.839  19.088  -73.267  1.00 139.30 ? 723 VAL A CA  1 
ATOM   4940  C C   . VAL A 1 714 ? -4.418  19.060  -71.801  1.00 136.86 ? 723 VAL A C   1 
ATOM   4941  O O   . VAL A 1 714 ? -5.208  19.373  -70.911  1.00 135.37 ? 723 VAL A O   1 
ATOM   4942  C CB  . VAL A 1 714 ? -4.676  20.517  -73.819  1.00 141.12 ? 723 VAL A CB  1 
ATOM   4943  C CG1 . VAL A 1 714 ? -4.792  20.515  -75.336  1.00 144.06 ? 723 VAL A CG1 1 
ATOM   4944  C CG2 . VAL A 1 714 ? -5.707  21.448  -73.199  1.00 140.45 ? 723 VAL A CG2 1 
ATOM   4945  N N   . GLY A 1 715 ? -3.167  18.680  -71.561  1.00 179.68 ? 724 GLY A N   1 
ATOM   4946  C CA  . GLY A 1 715 ? -2.632  18.616  -70.214  1.00 177.84 ? 724 GLY A CA  1 
ATOM   4947  C C   . GLY A 1 715 ? -3.249  17.503  -69.391  1.00 176.03 ? 724 GLY A C   1 
ATOM   4948  O O   . GLY A 1 715 ? -4.205  16.857  -69.820  1.00 176.04 ? 724 GLY A O   1 
ATOM   4949  N N   . GLY A 1 716 ? -2.697  17.277  -68.203  1.00 164.67 ? 725 GLY A N   1 
ATOM   4950  C CA  . GLY A 1 716 ? -3.206  16.253  -67.309  1.00 163.13 ? 725 GLY A CA  1 
ATOM   4951  C C   . GLY A 1 716 ? -4.430  16.723  -66.548  1.00 161.76 ? 725 GLY A C   1 
ATOM   4952  O O   . GLY A 1 716 ? -4.806  17.893  -66.622  1.00 162.05 ? 725 GLY A O   1 
ATOM   4953  N N   . ASN A 1 717 ? -5.055  15.807  -65.816  1.00 131.01 ? 726 ASN A N   1 
ATOM   4954  C CA  . ASN A 1 717 ? -6.240  16.135  -65.034  1.00 129.87 ? 726 ASN A CA  1 
ATOM   4955  C C   . ASN A 1 717 ? -5.930  17.110  -63.902  1.00 129.29 ? 726 ASN A C   1 
ATOM   4956  O O   . ASN A 1 717 ? -4.787  17.215  -63.456  1.00 129.42 ? 726 ASN A O   1 
ATOM   4957  C CB  . ASN A 1 717 ? -6.884  14.864  -64.478  1.00 128.90 ? 726 ASN A CB  1 
ATOM   4958  C CG  . ASN A 1 717 ? -7.394  13.945  -65.571  1.00 129.67 ? 726 ASN A CG  1 
ATOM   4959  O OD1 . ASN A 1 717 ? -7.451  14.324  -66.741  1.00 130.94 ? 726 ASN A OD1 1 
ATOM   4960  N ND2 . ASN A 1 717 ? -7.769  12.729  -65.193  1.00 129.17 ? 726 ASN A ND2 1 
ATOM   4961  N N   . LEU A 1 718 ? -6.953  17.822  -63.443  1.00 120.97 ? 727 LEU A N   1 
ATOM   4962  C CA  . LEU A 1 718 ? -6.784  18.817  -62.390  1.00 120.79 ? 727 LEU A CA  1 
ATOM   4963  C C   . LEU A 1 718 ? -6.914  18.189  -61.007  1.00 119.66 ? 727 LEU A C   1 
ATOM   4964  O O   . LEU A 1 718 ? -6.376  18.705  -60.027  1.00 119.66 ? 727 LEU A O   1 
ATOM   4965  C CB  . LEU A 1 718 ? -7.802  19.946  -62.556  1.00 121.44 ? 727 LEU A CB  1 
ATOM   4966  C CG  . LEU A 1 718 ? -7.831  20.610  -63.934  1.00 122.93 ? 727 LEU A CG  1 
ATOM   4967  C CD1 . LEU A 1 718 ? -8.770  21.806  -63.938  1.00 123.94 ? 727 LEU A CD1 1 
ATOM   4968  C CD2 . LEU A 1 718 ? -6.432  21.022  -64.355  1.00 123.76 ? 727 LEU A CD2 1 
ATOM   4969  N N   . ASP A 1 719 ? -7.632  17.074  -60.935  1.00 134.67 ? 728 ASP A N   1 
ATOM   4970  C CA  . ASP A 1 719 ? -7.815  16.359  -59.679  1.00 133.82 ? 728 ASP A CA  1 
ATOM   4971  C C   . ASP A 1 719 ? -7.921  14.858  -59.920  1.00 133.47 ? 728 ASP A C   1 
ATOM   4972  O O   . ASP A 1 719 ? -8.034  14.410  -61.061  1.00 133.87 ? 728 ASP A O   1 
ATOM   4973  C CB  . ASP A 1 719 ? -9.053  16.871  -58.937  1.00 133.53 ? 728 ASP A CB  1 
ATOM   4974  C CG  . ASP A 1 719 ? -10.327 16.730  -59.753  1.00 133.61 ? 728 ASP A CG  1 
ATOM   4975  O OD1 . ASP A 1 719 ? -10.246 16.296  -60.922  1.00 133.94 ? 728 ASP A OD1 1 
ATOM   4976  O OD2 . ASP A 1 719 ? -11.410 17.056  -59.221  1.00 133.57 ? 728 ASP A OD2 1 
ATOM   4977  N N   . SER A 1 720 ? -7.885  14.085  -58.840  1.00 150.53 ? 729 SER A N   1 
ATOM   4978  C CA  . SER A 1 720 ? -7.955  12.632  -58.938  1.00 150.46 ? 729 SER A CA  1 
ATOM   4979  C C   . SER A 1 720 ? -9.282  12.093  -58.416  1.00 149.88 ? 729 SER A C   1 
ATOM   4980  O O   . SER A 1 720 ? -9.552  12.133  -57.216  1.00 149.58 ? 729 SER A O   1 
ATOM   4981  C CB  . SER A 1 720 ? -6.791  11.986  -58.182  1.00 150.85 ? 729 SER A CB  1 
ATOM   4982  O OG  . SER A 1 720 ? -5.544  12.404  -58.711  1.00 151.60 ? 729 SER A OG  1 
ATOM   4983  N N   . LYS A 1 721 ? -10.108 11.591  -59.328  1.00 138.60 ? 730 LYS A N   1 
ATOM   4984  C CA  . LYS A 1 721 ? -11.382 10.986  -58.963  1.00 138.25 ? 730 LYS A CA  1 
ATOM   4985  C C   . LYS A 1 721 ? -11.389 9.512   -59.353  1.00 138.62 ? 730 LYS A C   1 
ATOM   4986  O O   . LYS A 1 721 ? -10.335 8.923   -59.593  1.00 139.17 ? 730 LYS A O   1 
ATOM   4987  C CB  . LYS A 1 721 ? -12.541 11.719  -59.642  1.00 138.36 ? 730 LYS A CB  1 
ATOM   4988  N N   . GLY A 1 722 ? -12.577 8.919   -59.418  1.00 119.53 ? 731 GLY A N   1 
ATOM   4989  C CA  . GLY A 1 722 ? -12.702 7.524   -59.795  1.00 120.13 ? 731 GLY A CA  1 
ATOM   4990  C C   . GLY A 1 722 ? -14.102 6.971   -59.621  1.00 120.08 ? 731 GLY A C   1 
ATOM   4991  O O   . GLY A 1 722 ? -14.762 7.229   -58.614  1.00 119.54 ? 731 GLY A O   1 
ATOM   4992  N N   . TYR A 1 723 ? -14.556 6.210   -60.611  1.00 124.32 ? 732 TYR A N   1 
ATOM   4993  C CA  . TYR A 1 723 ? -15.853 5.549   -60.538  1.00 124.56 ? 732 TYR A CA  1 
ATOM   4994  C C   . TYR A 1 723 ? -15.712 4.191   -59.862  1.00 124.97 ? 732 TYR A C   1 
ATOM   4995  O O   . TYR A 1 723 ? -14.621 3.627   -59.808  1.00 125.45 ? 732 TYR A O   1 
ATOM   4996  C CB  . TYR A 1 723 ? -16.450 5.368   -61.934  1.00 125.60 ? 732 TYR A CB  1 
ATOM   4997  C CG  . TYR A 1 723 ? -16.581 6.646   -62.731  1.00 125.68 ? 732 TYR A CG  1 
ATOM   4998  C CD1 . TYR A 1 723 ? -17.251 7.746   -62.212  1.00 125.05 ? 732 TYR A CD1 1 
ATOM   4999  C CD2 . TYR A 1 723 ? -16.052 6.746   -64.010  1.00 126.73 ? 732 TYR A CD2 1 
ATOM   5000  C CE1 . TYR A 1 723 ? -17.378 8.914   -62.939  1.00 125.47 ? 732 TYR A CE1 1 
ATOM   5001  C CE2 . TYR A 1 723 ? -16.175 7.908   -64.745  1.00 127.11 ? 732 TYR A CE2 1 
ATOM   5002  C CZ  . TYR A 1 723 ? -16.839 8.989   -64.205  1.00 126.49 ? 732 TYR A CZ  1 
ATOM   5003  O OH  . TYR A 1 723 ? -16.965 10.150  -64.933  1.00 127.19 ? 732 TYR A OH  1 
ATOM   5004  N N   . GLY A 1 724 ? -16.821 3.668   -59.352  1.00 122.70 ? 733 GLY A N   1 
ATOM   5005  C CA  . GLY A 1 724 ? -16.813 2.374   -58.696  1.00 123.35 ? 733 GLY A CA  1 
ATOM   5006  C C   . GLY A 1 724 ? -18.179 1.720   -58.689  1.00 123.86 ? 733 GLY A C   1 
ATOM   5007  O O   . GLY A 1 724 ? -19.197 2.380   -58.899  1.00 123.55 ? 733 GLY A O   1 
ATOM   5008  N N   . ILE A 1 725 ? -18.199 0.413   -58.449  1.00 121.05 ? 734 ILE A N   1 
ATOM   5009  C CA  . ILE A 1 725 ? -19.451 -0.327  -58.366  1.00 121.77 ? 734 ILE A CA  1 
ATOM   5010  C C   . ILE A 1 725 ? -20.075 -0.138  -56.989  1.00 121.19 ? 734 ILE A C   1 
ATOM   5011  O O   . ILE A 1 725 ? -19.460 -0.453  -55.970  1.00 121.24 ? 734 ILE A O   1 
ATOM   5012  C CB  . ILE A 1 725 ? -19.238 -1.828  -58.624  1.00 123.45 ? 734 ILE A CB  1 
ATOM   5013  C CG1 . ILE A 1 725 ? -18.438 -2.043  -59.910  1.00 124.37 ? 734 ILE A CG1 1 
ATOM   5014  C CG2 . ILE A 1 725 ? -20.574 -2.545  -58.699  1.00 124.37 ? 734 ILE A CG2 1 
ATOM   5015  C CD1 . ILE A 1 725 ? -19.134 -1.542  -61.156  1.00 124.59 ? 734 ILE A CD1 1 
ATOM   5016  N N   . ALA A 1 726 ? -21.299 0.379   -56.964  1.00 122.23 ? 735 ALA A N   1 
ATOM   5017  C CA  . ALA A 1 726 ? -21.975 0.680   -55.706  1.00 121.91 ? 735 ALA A CA  1 
ATOM   5018  C C   . ALA A 1 726 ? -22.874 -0.463  -55.246  1.00 123.05 ? 735 ALA A C   1 
ATOM   5019  O O   . ALA A 1 726 ? -23.676 -0.989  -56.018  1.00 123.88 ? 735 ALA A O   1 
ATOM   5020  C CB  . ALA A 1 726 ? -22.774 1.968   -55.830  1.00 121.30 ? 735 ALA A CB  1 
ATOM   5021  N N   . THR A 1 727 ? -22.734 -0.840  -53.981  1.00 132.97 ? 736 THR A N   1 
ATOM   5022  C CA  . THR A 1 727 ? -23.541 -1.906  -53.404  1.00 134.23 ? 736 THR A CA  1 
ATOM   5023  C C   . THR A 1 727 ? -24.067 -1.497  -52.032  1.00 134.24 ? 736 THR A C   1 
ATOM   5024  O O   . THR A 1 727 ? -23.341 -0.897  -51.240  1.00 133.72 ? 736 THR A O   1 
ATOM   5025  C CB  . THR A 1 727 ? -22.736 -3.213  -53.280  1.00 135.44 ? 736 THR A CB  1 
ATOM   5026  O OG1 . THR A 1 727 ? -23.549 -4.222  -52.669  1.00 136.86 ? 736 THR A OG1 1 
ATOM   5027  C CG2 . THR A 1 727 ? -21.486 -2.995  -52.440  1.00 135.17 ? 736 THR A CG2 1 
ATOM   5028  N N   . PRO A 1 728 ? -25.340 -1.819  -51.750  1.00 125.46 ? 737 PRO A N   1 
ATOM   5029  C CA  . PRO A 1 728 ? -25.984 -1.474  -50.478  1.00 125.86 ? 737 PRO A CA  1 
ATOM   5030  C C   . PRO A 1 728 ? -25.107 -1.823  -49.281  1.00 126.36 ? 737 PRO A C   1 
ATOM   5031  O O   . PRO A 1 728 ? -24.485 -2.883  -49.261  1.00 127.19 ? 737 PRO A O   1 
ATOM   5032  C CB  . PRO A 1 728 ? -27.242 -2.342  -50.482  1.00 127.23 ? 737 PRO A CB  1 
ATOM   5033  C CG  . PRO A 1 728 ? -27.567 -2.506  -51.923  1.00 127.13 ? 737 PRO A CG  1 
ATOM   5034  C CD  . PRO A 1 728 ? -26.246 -2.564  -52.642  1.00 126.37 ? 737 PRO A CD  1 
ATOM   5035  N N   . LYS A 1 729 ? -25.062 -0.929  -48.298  1.00 125.89 ? 738 LYS A N   1 
ATOM   5036  C CA  . LYS A 1 729 ? -24.244 -1.130  -47.107  1.00 126.63 ? 738 LYS A CA  1 
ATOM   5037  C C   . LYS A 1 729 ? -24.542 -2.473  -46.452  1.00 128.48 ? 738 LYS A C   1 
ATOM   5038  O O   . LYS A 1 729 ? -25.695 -2.789  -46.159  1.00 129.39 ? 738 LYS A O   1 
ATOM   5039  C CB  . LYS A 1 729 ? -24.467 0.006   -46.106  1.00 126.67 ? 738 LYS A CB  1 
ATOM   5040  N N   . GLY A 1 730 ? -23.497 -3.263  -46.231  1.00 128.87 ? 739 GLY A N   1 
ATOM   5041  C CA  . GLY A 1 730 ? -23.645 -4.566  -45.610  1.00 130.96 ? 739 GLY A CA  1 
ATOM   5042  C C   . GLY A 1 730 ? -24.324 -5.575  -46.516  1.00 131.50 ? 739 GLY A C   1 
ATOM   5043  O O   . GLY A 1 730 ? -25.173 -6.348  -46.072  1.00 133.05 ? 739 GLY A O   1 
ATOM   5044  N N   . SER A 1 731 ? -23.948 -5.566  -47.791  1.00 134.25 ? 740 SER A N   1 
ATOM   5045  C CA  . SER A 1 731 ? -24.514 -6.493  -48.763  1.00 134.96 ? 740 SER A CA  1 
ATOM   5046  C C   . SER A 1 731 ? -23.646 -7.738  -48.898  1.00 136.64 ? 740 SER A C   1 
ATOM   5047  O O   . SER A 1 731 ? -22.488 -7.750  -48.479  1.00 136.91 ? 740 SER A O   1 
ATOM   5048  C CB  . SER A 1 731 ? -24.672 -5.813  -50.124  1.00 133.38 ? 740 SER A CB  1 
ATOM   5049  O OG  . SER A 1 731 ? -25.145 -6.724  -51.101  1.00 134.36 ? 740 SER A OG  1 
ATOM   5050  N N   . SER A 1 732 ? -24.215 -8.786  -49.484  1.00 157.42 ? 741 SER A N   1 
ATOM   5051  C CA  . SER A 1 732 ? -23.491 -10.032 -49.697  1.00 159.46 ? 741 SER A CA  1 
ATOM   5052  C C   . SER A 1 732 ? -22.563 -9.930  -50.904  1.00 158.84 ? 741 SER A C   1 
ATOM   5053  O O   . SER A 1 732 ? -21.496 -10.543 -50.932  1.00 160.14 ? 741 SER A O   1 
ATOM   5054  C CB  . SER A 1 732 ? -24.469 -11.194 -49.878  1.00 161.51 ? 741 SER A CB  1 
ATOM   5055  O OG  . SER A 1 732 ? -25.383 -10.935 -50.930  1.00 160.68 ? 741 SER A OG  1 
ATOM   5056  N N   . LEU A 1 733 ? -22.973 -9.148  -51.897  1.00 139.29 ? 742 LEU A N   1 
ATOM   5057  C CA  . LEU A 1 733 ? -22.180 -8.964  -53.107  1.00 138.80 ? 742 LEU A CA  1 
ATOM   5058  C C   . LEU A 1 733 ? -21.007 -8.021  -52.868  1.00 137.32 ? 742 LEU A C   1 
ATOM   5059  O O   . LEU A 1 733 ? -20.149 -7.855  -53.733  1.00 137.07 ? 742 LEU A O   1 
ATOM   5060  C CB  . LEU A 1 733 ? -23.051 -8.427  -54.245  1.00 137.81 ? 742 LEU A CB  1 
ATOM   5061  C CG  . LEU A 1 733 ? -24.164 -9.342  -54.755  1.00 139.47 ? 742 LEU A CG  1 
ATOM   5062  C CD1 . LEU A 1 733 ? -24.916 -8.679  -55.899  1.00 138.64 ? 742 LEU A CD1 1 
ATOM   5063  C CD2 . LEU A 1 733 ? -23.597 -10.683 -55.189  1.00 141.92 ? 742 LEU A CD2 1 
ATOM   5064  N N   . GLY A 1 734 ? -20.980 -7.405  -51.691  1.00 133.43 ? 743 GLY A N   1 
ATOM   5065  C CA  . GLY A 1 734 ? -19.949 -6.441  -51.351  1.00 132.16 ? 743 GLY A CA  1 
ATOM   5066  C C   . GLY A 1 734 ? -18.542 -6.898  -51.683  1.00 133.12 ? 743 GLY A C   1 
ATOM   5067  O O   . GLY A 1 734 ? -17.974 -6.502  -52.701  1.00 132.37 ? 743 GLY A O   1 
ATOM   5068  N N   . THR A 1 735 ? -17.979 -7.739  -50.821  1.00 132.82 ? 744 THR A N   1 
ATOM   5069  C CA  . THR A 1 735 ? -16.609 -8.217  -50.993  1.00 134.23 ? 744 THR A CA  1 
ATOM   5070  C C   . THR A 1 735 ? -16.347 -8.862  -52.358  1.00 135.13 ? 744 THR A C   1 
ATOM   5071  O O   . THR A 1 735 ? -15.343 -8.556  -53.001  1.00 134.95 ? 744 THR A O   1 
ATOM   5072  C CB  . THR A 1 735 ? -16.206 -9.200  -49.873  1.00 136.85 ? 744 THR A CB  1 
ATOM   5073  O OG1 . THR A 1 735 ? -16.372 -8.569  -48.598  1.00 136.31 ? 744 THR A OG1 1 
ATOM   5074  C CG2 . THR A 1 735 ? -14.757 -9.627  -50.036  1.00 138.56 ? 744 THR A CG2 1 
ATOM   5075  N N   . PRO A 1 736 ? -17.243 -9.759  -52.803  1.00 144.18 ? 745 PRO A N   1 
ATOM   5076  C CA  . PRO A 1 736 ? -17.044 -10.427 -54.094  1.00 145.48 ? 745 PRO A CA  1 
ATOM   5077  C C   . PRO A 1 736 ? -16.815 -9.444  -55.237  1.00 143.60 ? 745 PRO A C   1 
ATOM   5078  O O   . PRO A 1 736 ? -15.826 -9.565  -55.958  1.00 144.44 ? 745 PRO A O   1 
ATOM   5079  C CB  . PRO A 1 736 ? -18.362 -11.176 -54.304  1.00 146.43 ? 745 PRO A CB  1 
ATOM   5080  C CG  . PRO A 1 736 ? -18.855 -11.442 -52.931  1.00 146.90 ? 745 PRO A CG  1 
ATOM   5081  C CD  . PRO A 1 736 ? -18.455 -10.244 -52.117  1.00 144.76 ? 745 PRO A CD  1 
ATOM   5082  N N   . VAL A 1 737 ? -17.723 -8.487  -55.397  1.00 140.82 ? 746 VAL A N   1 
ATOM   5083  C CA  . VAL A 1 737 ? -17.615 -7.498  -56.465  1.00 139.22 ? 746 VAL A CA  1 
ATOM   5084  C C   . VAL A 1 737 ? -16.322 -6.696  -56.354  1.00 138.28 ? 746 VAL A C   1 
ATOM   5085  O O   . VAL A 1 737 ? -15.652 -6.443  -57.354  1.00 138.36 ? 746 VAL A O   1 
ATOM   5086  C CB  . VAL A 1 737 ? -18.817 -6.533  -56.471  1.00 137.25 ? 746 VAL A CB  1 
ATOM   5087  C CG1 . VAL A 1 737 ? -18.564 -5.377  -57.426  1.00 135.72 ? 746 VAL A CG1 1 
ATOM   5088  C CG2 . VAL A 1 737 ? -20.089 -7.276  -56.847  1.00 138.34 ? 746 VAL A CG2 1 
ATOM   5089  N N   . ASN A 1 738 ? -15.979 -6.299  -55.133  1.00 134.99 ? 747 ASN A N   1 
ATOM   5090  C CA  . ASN A 1 738 ? -14.748 -5.556  -54.890  1.00 134.33 ? 747 ASN A CA  1 
ATOM   5091  C C   . ASN A 1 738 ? -13.533 -6.268  -55.474  1.00 136.26 ? 747 ASN A C   1 
ATOM   5092  O O   . ASN A 1 738 ? -12.765 -5.683  -56.237  1.00 135.79 ? 747 ASN A O   1 
ATOM   5093  C CB  . ASN A 1 738 ? -14.547 -5.331  -53.391  1.00 134.21 ? 747 ASN A CB  1 
ATOM   5094  C CG  . ASN A 1 738 ? -13.314 -4.505  -53.087  1.00 133.65 ? 747 ASN A CG  1 
ATOM   5095  O OD1 . ASN A 1 738 ? -13.010 -3.540  -53.789  1.00 132.20 ? 747 ASN A OD1 1 
ATOM   5096  N ND2 . ASN A 1 738 ? -12.599 -4.878  -52.033  1.00 135.03 ? 747 ASN A ND2 1 
ATOM   5097  N N   . LEU A 1 739 ? -13.367 -7.534  -55.108  1.00 137.89 ? 748 LEU A N   1 
ATOM   5098  C CA  . LEU A 1 739 ? -12.263 -8.340  -55.612  1.00 140.32 ? 748 LEU A CA  1 
ATOM   5099  C C   . LEU A 1 739 ? -12.357 -8.505  -57.124  1.00 140.80 ? 748 LEU A C   1 
ATOM   5100  O O   . LEU A 1 739 ? -11.343 -8.504  -57.823  1.00 141.81 ? 748 LEU A O   1 
ATOM   5101  C CB  . LEU A 1 739 ? -12.253 -9.712  -54.938  1.00 143.21 ? 748 LEU A CB  1 
ATOM   5102  C CG  . LEU A 1 739 ? -12.156 -9.722  -53.412  1.00 143.46 ? 748 LEU A CG  1 
ATOM   5103  C CD1 . LEU A 1 739 ? -12.293 -11.138 -52.876  1.00 146.63 ? 748 LEU A CD1 1 
ATOM   5104  C CD2 . LEU A 1 739 ? -10.849 -9.096  -52.953  1.00 143.41 ? 748 LEU A CD2 1 
ATOM   5105  N N   . ALA A 1 740 ? -13.580 -8.646  -57.623  1.00 136.22 ? 749 ALA A N   1 
ATOM   5106  C CA  . ALA A 1 740 ? -13.810 -8.821  -59.052  1.00 136.96 ? 749 ALA A CA  1 
ATOM   5107  C C   . ALA A 1 740 ? -13.249 -7.647  -59.848  1.00 135.38 ? 749 ALA A C   1 
ATOM   5108  O O   . ALA A 1 740 ? -12.618 -7.835  -60.887  1.00 136.79 ? 749 ALA A O   1 
ATOM   5109  C CB  . ALA A 1 740 ? -15.294 -8.996  -59.332  1.00 136.56 ? 749 ALA A CB  1 
ATOM   5110  N N   . VAL A 1 741 ? -13.481 -6.437  -59.350  1.00 136.11 ? 750 VAL A N   1 
ATOM   5111  C CA  . VAL A 1 741 ? -12.977 -5.234  -60.000  1.00 134.61 ? 750 VAL A CA  1 
ATOM   5112  C C   . VAL A 1 741 ? -11.453 -5.236  -60.042  1.00 135.63 ? 750 VAL A C   1 
ATOM   5113  O O   . VAL A 1 741 ? -10.850 -4.917  -61.067  1.00 136.10 ? 750 VAL A O   1 
ATOM   5114  C CB  . VAL A 1 741 ? -13.458 -3.961  -59.283  1.00 131.91 ? 750 VAL A CB  1 
ATOM   5115  C CG1 . VAL A 1 741 ? -12.811 -2.731  -59.899  1.00 130.69 ? 750 VAL A CG1 1 
ATOM   5116  C CG2 . VAL A 1 741 ? -14.974 -3.861  -59.345  1.00 131.09 ? 750 VAL A CG2 1 
ATOM   5117  N N   . LEU A 1 742 ? -10.835 -5.600  -58.923  1.00 134.34 ? 751 LEU A N   1 
ATOM   5118  C CA  . LEU A 1 742 ? -9.381  -5.678  -58.842  1.00 135.68 ? 751 LEU A CA  1 
ATOM   5119  C C   . LEU A 1 742 ? -8.835  -6.733  -59.797  1.00 138.64 ? 751 LEU A C   1 
ATOM   5120  O O   . LEU A 1 742 ? -7.795  -6.537  -60.425  1.00 139.61 ? 751 LEU A O   1 
ATOM   5121  C CB  . LEU A 1 742 ? -8.937  -5.985  -57.411  1.00 136.26 ? 751 LEU A CB  1 
ATOM   5122  C CG  . LEU A 1 742 ? -9.097  -4.855  -56.393  1.00 133.86 ? 751 LEU A CG  1 
ATOM   5123  C CD1 . LEU A 1 742 ? -8.809  -5.355  -54.988  1.00 135.02 ? 751 LEU A CD1 1 
ATOM   5124  C CD2 . LEU A 1 742 ? -8.190  -3.687  -56.748  1.00 132.71 ? 751 LEU A CD2 1 
ATOM   5125  N N   . LYS A 1 743 ? -9.543  -7.851  -59.903  1.00 162.28 ? 752 LYS A N   1 
ATOM   5126  C CA  . LYS A 1 743 ? -9.132  -8.934  -60.786  1.00 165.51 ? 752 LYS A CA  1 
ATOM   5127  C C   . LYS A 1 743 ? -9.201  -8.498  -62.245  1.00 165.47 ? 752 LYS A C   1 
ATOM   5128  O O   . LYS A 1 743 ? -8.294  -8.775  -63.029  1.00 167.63 ? 752 LYS A O   1 
ATOM   5129  C CB  . LYS A 1 743 ? -10.008 -10.168 -60.562  1.00 167.31 ? 752 LYS A CB  1 
ATOM   5130  C CG  . LYS A 1 743 ? -9.528  -11.411 -61.290  1.00 171.25 ? 752 LYS A CG  1 
ATOM   5131  C CD  . LYS A 1 743 ? -10.398 -12.613 -60.961  1.00 173.15 ? 752 LYS A CD  1 
ATOM   5132  C CE  . LYS A 1 743 ? -9.870  -13.878 -61.620  1.00 177.52 ? 752 LYS A CE  1 
ATOM   5133  N NZ  . LYS A 1 743 ? -8.493  -14.211 -61.160  1.00 179.74 ? 752 LYS A NZ  1 
ATOM   5134  N N   . LEU A 1 744 ? -10.280 -7.809  -62.602  1.00 139.90 ? 753 LEU A N   1 
ATOM   5135  C CA  . LEU A 1 744 ? -10.475 -7.347  -63.971  1.00 140.00 ? 753 LEU A CA  1 
ATOM   5136  C C   . LEU A 1 744 ? -9.397  -6.356  -64.397  1.00 139.34 ? 753 LEU A C   1 
ATOM   5137  O O   . LEU A 1 744 ? -8.914  -6.401  -65.528  1.00 141.05 ? 753 LEU A O   1 
ATOM   5138  C CB  . LEU A 1 744 ? -11.861 -6.720  -64.135  1.00 137.88 ? 753 LEU A CB  1 
ATOM   5139  C CG  . LEU A 1 744 ? -13.057 -7.663  -63.996  1.00 138.80 ? 753 LEU A CG  1 
ATOM   5140  C CD1 . LEU A 1 744 ? -14.363 -6.902  -64.167  1.00 136.78 ? 753 LEU A CD1 1 
ATOM   5141  C CD2 . LEU A 1 744 ? -12.962 -8.798  -65.000  1.00 142.23 ? 753 LEU A CD2 1 
ATOM   5142  N N   . SER A 1 745 ? -9.020  -5.463  -63.487  1.00 138.06 ? 754 SER A N   1 
ATOM   5143  C CA  . SER A 1 745 ? -8.019  -4.446  -63.789  1.00 137.34 ? 754 SER A CA  1 
ATOM   5144  C C   . SER A 1 745 ? -6.638  -5.060  -63.990  1.00 140.02 ? 754 SER A C   1 
ATOM   5145  O O   . SER A 1 745 ? -5.893  -4.654  -64.882  1.00 140.88 ? 754 SER A O   1 
ATOM   5146  C CB  . SER A 1 745 ? -7.965  -3.396  -62.678  1.00 134.61 ? 754 SER A CB  1 
ATOM   5147  O OG  . SER A 1 745 ? -7.394  -3.931  -61.498  1.00 135.24 ? 754 SER A OG  1 
ATOM   5148  N N   . GLU A 1 746 ? -6.301  -6.038  -63.157  1.00 172.63 ? 755 GLU A N   1 
ATOM   5149  C CA  . GLU A 1 746 ? -5.002  -6.696  -63.239  1.00 175.60 ? 755 GLU A CA  1 
ATOM   5150  C C   . GLU A 1 746 ? -4.882  -7.545  -64.500  1.00 178.73 ? 755 GLU A C   1 
ATOM   5151  O O   . GLU A 1 746 ? -3.789  -7.721  -65.039  1.00 181.09 ? 755 GLU A O   1 
ATOM   5152  C CB  . GLU A 1 746 ? -4.746  -7.547  -61.994  1.00 176.85 ? 755 GLU A CB  1 
ATOM   5153  C CG  . GLU A 1 746 ? -4.632  -6.739  -60.714  1.00 174.45 ? 755 GLU A CG  1 
ATOM   5154  C CD  . GLU A 1 746 ? -4.247  -7.587  -59.519  1.00 176.27 ? 755 GLU A CD  1 
ATOM   5155  O OE1 . GLU A 1 746 ? -4.184  -8.826  -59.662  1.00 179.29 ? 755 GLU A OE1 1 
ATOM   5156  O OE2 . GLU A 1 746 ? -4.006  -7.012  -58.436  1.00 174.96 ? 755 GLU A OE2 1 
ATOM   5157  N N   . GLN A 1 747 ? -6.011  -8.069  -64.967  1.00 181.40 ? 756 GLN A N   1 
ATOM   5158  C CA  . GLN A 1 747 ? -6.037  -8.838  -66.204  1.00 184.50 ? 756 GLN A CA  1 
ATOM   5159  C C   . GLN A 1 747 ? -6.078  -7.902  -67.406  1.00 183.78 ? 756 GLN A C   1 
ATOM   5160  O O   . GLN A 1 747 ? -6.173  -8.346  -68.550  1.00 186.25 ? 756 GLN A O   1 
ATOM   5161  C CB  . GLN A 1 747 ? -7.239  -9.782  -66.229  1.00 185.38 ? 756 GLN A CB  1 
ATOM   5162  C CG  . GLN A 1 747 ? -7.191  -10.876 -65.176  1.00 186.94 ? 756 GLN A CG  1 
ATOM   5163  C CD  . GLN A 1 747 ? -8.373  -11.820 -65.263  1.00 188.07 ? 756 GLN A CD  1 
ATOM   5164  O OE1 . GLN A 1 747 ? -9.235  -11.676 -66.131  1.00 187.77 ? 756 GLN A OE1 1 
ATOM   5165  N NE2 . GLN A 1 747 ? -8.420  -12.794 -64.362  1.00 189.62 ? 756 GLN A NE2 1 
ATOM   5166  N N   . GLY A 1 748 ? -6.005  -6.603  -67.135  1.00 173.81 ? 757 GLY A N   1 
ATOM   5167  C CA  . GLY A 1 748 ? -6.043  -5.598  -68.182  1.00 173.07 ? 757 GLY A CA  1 
ATOM   5168  C C   . GLY A 1 748 ? -7.371  -5.576  -68.910  1.00 172.72 ? 757 GLY A C   1 
ATOM   5169  O O   . GLY A 1 748 ? -7.494  -4.981  -69.980  1.00 173.08 ? 757 GLY A O   1 
ATOM   5170  N N   . LEU A 1 749 ? -8.371  -6.226  -68.325  1.00 152.51 ? 758 LEU A N   1 
ATOM   5171  C CA  . LEU A 1 749 ? -9.690  -6.315  -68.938  1.00 152.47 ? 758 LEU A CA  1 
ATOM   5172  C C   . LEU A 1 749 ? -10.398 -4.963  -68.916  1.00 149.35 ? 758 LEU A C   1 
ATOM   5173  O O   . LEU A 1 749 ? -11.125 -4.620  -69.849  1.00 149.72 ? 758 LEU A O   1 
ATOM   5174  C CB  . LEU A 1 749 ? -10.536 -7.378  -68.233  1.00 152.92 ? 758 LEU A CB  1 
ATOM   5175  C CG  . LEU A 1 749 ? -11.739 -7.937  -68.998  1.00 154.33 ? 758 LEU A CG  1 
ATOM   5176  C CD1 . LEU A 1 749 ? -12.132 -9.304  -68.455  1.00 156.16 ? 758 LEU A CD1 1 
ATOM   5177  C CD2 . LEU A 1 749 ? -12.920 -6.975  -68.956  1.00 151.61 ? 758 LEU A CD2 1 
ATOM   5178  N N   . LEU A 1 750 ? -10.181 -4.199  -67.851  1.00 156.40 ? 759 LEU A N   1 
ATOM   5179  C CA  . LEU A 1 750 ? -10.770 -2.869  -67.736  1.00 153.66 ? 759 LEU A CA  1 
ATOM   5180  C C   . LEU A 1 750 ? -10.202 -1.930  -68.795  1.00 154.06 ? 759 LEU A C   1 
ATOM   5181  O O   . LEU A 1 750 ? -10.949 -1.258  -69.507  1.00 153.74 ? 759 LEU A O   1 
ATOM   5182  C CB  . LEU A 1 750 ? -10.541 -2.290  -66.338  1.00 151.11 ? 759 LEU A CB  1 
ATOM   5183  C CG  . LEU A 1 750 ? -11.273 -2.985  -65.188  1.00 150.42 ? 759 LEU A CG  1 
ATOM   5184  C CD1 . LEU A 1 750 ? -11.032 -2.252  -63.881  1.00 148.13 ? 759 LEU A CD1 1 
ATOM   5185  C CD2 . LEU A 1 750 ? -12.762 -3.079  -65.480  1.00 150.10 ? 759 LEU A CD2 1 
ATOM   5186  N N   . ASP A 1 751 ? -8.877  -1.887  -68.894  1.00 148.02 ? 760 ASP A N   1 
ATOM   5187  C CA  . ASP A 1 751 ? -8.210  -1.071  -69.901  1.00 148.79 ? 760 ASP A CA  1 
ATOM   5188  C C   . ASP A 1 751 ? -8.663  -1.478  -71.298  1.00 151.39 ? 760 ASP A C   1 
ATOM   5189  O O   . ASP A 1 751 ? -8.848  -0.634  -72.175  1.00 151.58 ? 760 ASP A O   1 
ATOM   5190  C CB  . ASP A 1 751 ? -6.690  -1.207  -69.785  1.00 150.00 ? 760 ASP A CB  1 
ATOM   5191  C CG  . ASP A 1 751 ? -6.151  -0.646  -68.484  1.00 147.70 ? 760 ASP A CG  1 
ATOM   5192  O OD1 . ASP A 1 751 ? -6.932  -0.030  -67.730  1.00 145.13 ? 760 ASP A OD1 1 
ATOM   5193  O OD2 . ASP A 1 751 ? -4.944  -0.819  -68.216  1.00 148.73 ? 760 ASP A OD2 1 
ATOM   5194  N N   . LYS A 1 752 ? -8.840  -2.780  -71.493  1.00 144.28 ? 761 LYS A N   1 
ATOM   5195  C CA  . LYS A 1 752 ? -9.288  -3.313  -72.772  1.00 147.21 ? 761 LYS A CA  1 
ATOM   5196  C C   . LYS A 1 752 ? -10.676 -2.790  -73.128  1.00 146.18 ? 761 LYS A C   1 
ATOM   5197  O O   . LYS A 1 752 ? -10.911 -2.340  -74.249  1.00 147.62 ? 761 LYS A O   1 
ATOM   5198  C CB  . LYS A 1 752 ? -9.297  -4.842  -72.734  1.00 149.84 ? 761 LYS A CB  1 
ATOM   5199  C CG  . LYS A 1 752 ? -9.803  -5.495  -74.009  1.00 153.24 ? 761 LYS A CG  1 
ATOM   5200  C CD  . LYS A 1 752 ? -9.942  -6.998  -73.835  1.00 155.77 ? 761 LYS A CD  1 
ATOM   5201  C CE  . LYS A 1 752 ? -10.570 -7.639  -75.061  1.00 159.26 ? 761 LYS A CE  1 
ATOM   5202  N NZ  . LYS A 1 752 ? -10.822 -9.092  -74.854  1.00 161.79 ? 761 LYS A NZ  1 
ATOM   5203  N N   . LEU A 1 753 ? -11.590 -2.850  -72.165  1.00 153.84 ? 762 LEU A N   1 
ATOM   5204  C CA  . LEU A 1 753 ? -12.955 -2.382  -72.376  1.00 152.94 ? 762 LEU A CA  1 
ATOM   5205  C C   . LEU A 1 753 ? -12.995 -0.910  -72.774  1.00 151.64 ? 762 LEU A C   1 
ATOM   5206  O O   . LEU A 1 753 ? -13.715 -0.528  -73.696  1.00 152.79 ? 762 LEU A O   1 
ATOM   5207  C CB  . LEU A 1 753 ? -13.807 -2.612  -71.126  1.00 150.70 ? 762 LEU A CB  1 
ATOM   5208  C CG  . LEU A 1 753 ? -14.287 -4.044  -70.887  1.00 152.31 ? 762 LEU A CG  1 
ATOM   5209  C CD1 . LEU A 1 753 ? -15.087 -4.130  -69.598  1.00 150.02 ? 762 LEU A CD1 1 
ATOM   5210  C CD2 . LEU A 1 753 ? -15.114 -4.531  -72.066  1.00 155.00 ? 762 LEU A CD2 1 
ATOM   5211  N N   . LYS A 1 754 ? -12.219 -0.087  -72.075  1.00 142.05 ? 763 LYS A N   1 
ATOM   5212  C CA  . LYS A 1 754 ? -12.168 1.340   -72.370  1.00 140.92 ? 763 LYS A CA  1 
ATOM   5213  C C   . LYS A 1 754 ? -11.693 1.577   -73.799  1.00 143.59 ? 763 LYS A C   1 
ATOM   5214  O O   . LYS A 1 754 ? -12.302 2.343   -74.545  1.00 144.15 ? 763 LYS A O   1 
ATOM   5215  C CB  . LYS A 1 754 ? -11.255 2.070   -71.383  1.00 138.63 ? 763 LYS A CB  1 
ATOM   5216  C CG  . LYS A 1 754 ? -11.265 3.581   -71.549  1.00 137.43 ? 763 LYS A CG  1 
ATOM   5217  C CD  . LYS A 1 754 ? -10.309 4.261   -70.584  1.00 135.50 ? 763 LYS A CD  1 
ATOM   5218  C CE  . LYS A 1 754 ? -10.342 5.772   -70.759  1.00 134.59 ? 763 LYS A CE  1 
ATOM   5219  N NZ  . LYS A 1 754 ? -9.333  6.458   -69.905  1.00 133.09 ? 763 LYS A NZ  1 
ATOM   5220  N N   . ASN A 1 755 ? -10.604 0.914   -74.174  1.00 144.42 ? 764 ASN A N   1 
ATOM   5221  C CA  . ASN A 1 755 ? -10.080 1.011   -75.531  1.00 147.42 ? 764 ASN A CA  1 
ATOM   5222  C C   . ASN A 1 755 ? -11.120 0.599   -76.565  1.00 149.86 ? 764 ASN A C   1 
ATOM   5223  O O   . ASN A 1 755 ? -11.146 1.124   -77.677  1.00 151.87 ? 764 ASN A O   1 
ATOM   5224  C CB  . ASN A 1 755 ? -8.823  0.152   -75.686  1.00 149.51 ? 764 ASN A CB  1 
ATOM   5225  C CG  . ASN A 1 755 ? -7.640  0.703   -74.914  1.00 147.81 ? 764 ASN A CG  1 
ATOM   5226  O OD1 . ASN A 1 755 ? -7.735  1.749   -74.274  1.00 145.07 ? 764 ASN A OD1 1 
ATOM   5227  N ND2 . ASN A 1 755 ? -6.515  -0.001  -74.974  1.00 149.71 ? 764 ASN A ND2 1 
ATOM   5228  N N   . LYS A 1 756 ? -11.979 -0.343  -76.187  1.00 150.72 ? 765 LYS A N   1 
ATOM   5229  C CA  . LYS A 1 756 ? -13.000 -0.858  -77.091  1.00 153.24 ? 765 LYS A CA  1 
ATOM   5230  C C   . LYS A 1 756 ? -14.073 0.179   -77.408  1.00 152.50 ? 765 LYS A C   1 
ATOM   5231  O O   . LYS A 1 756 ? -14.543 0.266   -78.541  1.00 155.21 ? 765 LYS A O   1 
ATOM   5232  C CB  . LYS A 1 756 ? -13.653 -2.111  -76.506  1.00 153.41 ? 765 LYS A CB  1 
ATOM   5233  C CG  . LYS A 1 756 ? -14.829 -2.628  -77.320  1.00 155.88 ? 765 LYS A CG  1 
ATOM   5234  C CD  . LYS A 1 756 ? -15.534 -3.776  -76.619  1.00 155.78 ? 765 LYS A CD  1 
ATOM   5235  C CE  . LYS A 1 756 ? -16.749 -4.238  -77.408  1.00 158.30 ? 765 LYS A CE  1 
ATOM   5236  N NZ  . LYS A 1 756 ? -17.476 -5.340  -76.718  1.00 158.30 ? 765 LYS A NZ  1 
ATOM   5237  N N   . TRP A 1 757 ? -14.457 0.963   -76.406  1.00 149.68 ? 766 TRP A N   1 
ATOM   5238  C CA  . TRP A 1 757 ? -15.567 1.899   -76.556  1.00 149.04 ? 766 TRP A CA  1 
ATOM   5239  C C   . TRP A 1 757 ? -15.119 3.335   -76.810  1.00 148.35 ? 766 TRP A C   1 
ATOM   5240  O O   . TRP A 1 757 ? -15.881 4.146   -77.337  1.00 149.08 ? 766 TRP A O   1 
ATOM   5241  C CB  . TRP A 1 757 ? -16.480 1.837   -75.329  1.00 146.33 ? 766 TRP A CB  1 
ATOM   5242  C CG  . TRP A 1 757 ? -17.115 0.496   -75.136  1.00 147.28 ? 766 TRP A CG  1 
ATOM   5243  C CD1 . TRP A 1 757 ? -16.680 -0.508  -74.321  1.00 146.57 ? 766 TRP A CD1 1 
ATOM   5244  C CD2 . TRP A 1 757 ? -18.297 0.006   -75.779  1.00 149.42 ? 766 TRP A CD2 1 
ATOM   5245  N NE1 . TRP A 1 757 ? -17.521 -1.591  -74.414  1.00 148.10 ? 766 TRP A NE1 1 
ATOM   5246  C CE2 . TRP A 1 757 ? -18.521 -1.300  -75.303  1.00 149.82 ? 766 TRP A CE2 1 
ATOM   5247  C CE3 . TRP A 1 757 ? -19.189 0.548   -76.710  1.00 151.29 ? 766 TRP A CE3 1 
ATOM   5248  C CZ2 . TRP A 1 757 ? -19.600 -2.073  -75.725  1.00 151.93 ? 766 TRP A CZ2 1 
ATOM   5249  C CZ3 . TRP A 1 757 ? -20.259 -0.221  -77.128  1.00 153.42 ? 766 TRP A CZ3 1 
ATOM   5250  C CH2 . TRP A 1 757 ? -20.455 -1.517  -76.636  1.00 153.67 ? 766 TRP A CH2 1 
ATOM   5251  N N   . TRP A 1 758 ? -13.883 3.649   -76.437  1.00 152.65 ? 767 TRP A N   1 
ATOM   5252  C CA  . TRP A 1 758 ? -13.360 4.999   -76.614  1.00 152.04 ? 767 TRP A CA  1 
ATOM   5253  C C   . TRP A 1 758 ? -12.605 5.175   -77.930  1.00 155.12 ? 767 TRP A C   1 
ATOM   5254  O O   . TRP A 1 758 ? -12.935 6.051   -78.729  1.00 156.53 ? 767 TRP A O   1 
ATOM   5255  C CB  . TRP A 1 758 ? -12.467 5.395   -75.434  1.00 149.14 ? 767 TRP A CB  1 
ATOM   5256  C CG  . TRP A 1 758 ? -13.201 6.098   -74.333  1.00 146.27 ? 767 TRP A CG  1 
ATOM   5257  C CD1 . TRP A 1 758 ? -13.232 7.442   -74.097  1.00 145.08 ? 767 TRP A CD1 1 
ATOM   5258  C CD2 . TRP A 1 758 ? -14.014 5.494   -73.319  1.00 144.57 ? 767 TRP A CD2 1 
ATOM   5259  N NE1 . TRP A 1 758 ? -14.011 7.712   -72.998  1.00 142.81 ? 767 TRP A NE1 1 
ATOM   5260  C CE2 . TRP A 1 758 ? -14.503 6.534   -72.502  1.00 142.42 ? 767 TRP A CE2 1 
ATOM   5261  C CE3 . TRP A 1 758 ? -14.375 4.177   -73.021  1.00 144.88 ? 767 TRP A CE3 1 
ATOM   5262  C CZ2 . TRP A 1 758 ? -15.334 6.296   -71.409  1.00 140.61 ? 767 TRP A CZ2 1 
ATOM   5263  C CZ3 . TRP A 1 758 ? -15.200 3.943   -71.936  1.00 143.00 ? 767 TRP A CZ3 1 
ATOM   5264  C CH2 . TRP A 1 758 ? -15.670 4.997   -71.143  1.00 140.88 ? 767 TRP A CH2 1 
ATOM   5265  N N   . TYR A 1 759 ? -11.597 4.338   -78.156  1.00 154.57 ? 768 TYR A N   1 
ATOM   5266  C CA  . TYR A 1 759 ? -10.720 4.503   -79.311  1.00 157.56 ? 768 TYR A CA  1 
ATOM   5267  C C   . TYR A 1 759 ? -11.043 3.545   -80.457  1.00 161.44 ? 768 TYR A C   1 
ATOM   5268  O O   . TYR A 1 759 ? -11.171 3.967   -81.607  1.00 164.25 ? 768 TYR A O   1 
ATOM   5269  C CB  . TYR A 1 759 ? -9.254  4.367   -78.889  1.00 157.02 ? 768 TYR A CB  1 
ATOM   5270  C CG  . TYR A 1 759 ? -8.870  5.296   -77.759  1.00 153.52 ? 768 TYR A CG  1 
ATOM   5271  C CD1 . TYR A 1 759 ? -8.704  6.656   -77.980  1.00 153.07 ? 768 TYR A CD1 1 
ATOM   5272  C CD2 . TYR A 1 759 ? -8.680  4.813   -76.471  1.00 150.99 ? 768 TYR A CD2 1 
ATOM   5273  C CE1 . TYR A 1 759 ? -8.357  7.511   -76.950  1.00 150.16 ? 768 TYR A CE1 1 
ATOM   5274  C CE2 . TYR A 1 759 ? -8.333  5.659   -75.434  1.00 148.11 ? 768 TYR A CE2 1 
ATOM   5275  C CZ  . TYR A 1 759 ? -8.172  7.007   -75.679  1.00 147.71 ? 768 TYR A CZ  1 
ATOM   5276  O OH  . TYR A 1 759 ? -7.826  7.853   -74.650  1.00 145.12 ? 768 TYR A OH  1 
ATOM   5277  N N   . ASP A 1 760 ? -11.173 2.260   -80.145  1.00 178.08 ? 769 ASP A N   1 
ATOM   5278  C CA  . ASP A 1 760 ? -11.484 1.258   -81.160  1.00 181.97 ? 769 ASP A CA  1 
ATOM   5279  C C   . ASP A 1 760 ? -12.817 1.552   -81.840  1.00 183.33 ? 769 ASP A C   1 
ATOM   5280  O O   . ASP A 1 760 ? -12.900 1.601   -83.067  1.00 186.95 ? 769 ASP A O   1 
ATOM   5281  C CB  . ASP A 1 760 ? -11.508 -0.145  -80.551  1.00 182.01 ? 769 ASP A CB  1 
ATOM   5282  C CG  . ASP A 1 760 ? -10.124 -0.651  -80.196  1.00 182.25 ? 769 ASP A CG  1 
ATOM   5283  O OD1 . ASP A 1 760 ? -9.151  0.117   -80.345  1.00 182.03 ? 769 ASP A OD1 1 
ATOM   5284  O OD2 . ASP A 1 760 ? -10.011 -1.819  -79.769  1.00 182.88 ? 769 ASP A OD2 1 
ATOM   5285  N N   . LYS A 1 761 ? -13.855 1.750   -81.035  1.00 188.69 ? 770 LYS A N   1 
ATOM   5286  C CA  . LYS A 1 761 ? -15.187 2.032   -81.555  1.00 189.91 ? 770 LYS A CA  1 
ATOM   5287  C C   . LYS A 1 761 ? -15.286 3.493   -81.981  1.00 189.85 ? 770 LYS A C   1 
ATOM   5288  O O   . LYS A 1 761 ? -16.306 3.927   -82.518  1.00 191.31 ? 770 LYS A O   1 
ATOM   5289  C CB  . LYS A 1 761 ? -16.246 1.726   -80.494  1.00 187.26 ? 770 LYS A CB  1 
ATOM   5290  C CG  . LYS A 1 761 ? -17.586 1.271   -81.050  1.00 189.53 ? 770 LYS A CG  1 
ATOM   5291  C CD  . LYS A 1 761 ? -17.533 -0.185  -81.485  1.00 192.32 ? 770 LYS A CD  1 
ATOM   5292  C CE  . LYS A 1 761 ? -18.911 -0.699  -81.869  1.00 194.36 ? 770 LYS A CE  1 
ATOM   5293  N NZ  . LYS A 1 761 ? -18.883 -2.141  -82.242  1.00 197.23 ? 770 LYS A NZ  1 
ATOM   5294  N N   . GLY A 1 762 ? -14.218 4.246   -81.735  1.00 217.23 ? 771 GLY A N   1 
ATOM   5295  C CA  . GLY A 1 762 ? -14.187 5.663   -82.049  1.00 217.14 ? 771 GLY A CA  1 
ATOM   5296  C C   . GLY A 1 762 ? -14.227 5.946   -83.537  1.00 221.48 ? 771 GLY A C   1 
ATOM   5297  O O   . GLY A 1 762 ? -13.991 5.058   -84.356  1.00 224.64 ? 771 GLY A O   1 
ATOM   5298  N N   . GLU A 1 763 ? -14.523 7.193   -83.886  1.00 188.64 ? 772 GLU A N   1 
ATOM   5299  C CA  . GLU A 1 763 ? -14.623 7.596   -85.283  1.00 192.99 ? 772 GLU A CA  1 
ATOM   5300  C C   . GLU A 1 763 ? -13.456 8.490   -85.682  1.00 193.69 ? 772 GLU A C   1 
ATOM   5301  O O   . GLU A 1 763 ? -13.389 8.967   -86.815  1.00 197.35 ? 772 GLU A O   1 
ATOM   5302  C CB  . GLU A 1 763 ? -15.937 8.340   -85.527  1.00 193.94 ? 772 GLU A CB  1 
ATOM   5303  C CG  . GLU A 1 763 ? -17.180 7.577   -85.104  1.00 193.30 ? 772 GLU A CG  1 
ATOM   5304  C CD  . GLU A 1 763 ? -18.428 8.437   -85.145  1.00 193.83 ? 772 GLU A CD  1 
ATOM   5305  O OE1 . GLU A 1 763 ? -18.298 9.666   -85.328  1.00 194.17 ? 772 GLU A OE1 1 
ATOM   5306  O OE2 . GLU A 1 763 ? -19.538 7.885   -84.992  1.00 194.13 ? 772 GLU A OE2 1 
ATOM   5307  N N   . CYS A 1 764 ? -12.536 8.715   -84.749  1.00 338.92 ? 773 CYS A N   1 
ATOM   5308  C CA  . CYS A 1 764 ? -11.449 9.658   -84.979  1.00 339.21 ? 773 CYS A CA  1 
ATOM   5309  C C   . CYS A 1 764 ? -10.076 9.099   -84.622  1.00 338.28 ? 773 CYS A C   1 
ATOM   5310  O O   . CYS A 1 764 ? -9.588  9.284   -83.507  1.00 334.77 ? 773 CYS A O   1 
ATOM   5311  C CB  . CYS A 1 764 ? -11.696 10.952  -84.201  1.00 336.43 ? 773 CYS A CB  1 
ATOM   5312  S SG  . CYS A 1 764 ? -13.371 11.603  -84.370  1.00 337.21 ? 773 CYS A SG  1 
ATOM   5313  N N   . GLY A 1 765 ? -9.461  8.422   -85.586  1.00 191.47 ? 774 GLY A N   1 
ATOM   5314  C CA  . GLY A 1 765 ? -8.082  7.987   -85.468  1.00 191.47 ? 774 GLY A CA  1 
ATOM   5315  C C   . GLY A 1 765 ? -7.260  8.671   -86.542  1.00 191.47 ? 774 GLY A C   1 
ATOM   5316  O O   . GLY A 1 765 ? -6.045  8.489   -86.633  1.00 191.47 ? 774 GLY A O   1 
ATOM   5317  N N   . ALA A 1 766 ? -7.944  9.466   -87.360  1.00 254.45 ? 775 ALA A N   1 
ATOM   5318  C CA  . ALA A 1 766 ? -7.325  10.205  -88.454  1.00 254.45 ? 775 ALA A CA  1 
ATOM   5319  C C   . ALA A 1 766 ? -6.893  11.599  -88.008  1.00 254.45 ? 775 ALA A C   1 
ATOM   5320  O O   . ALA A 1 766 ? -5.765  12.022  -88.265  1.00 254.45 ? 775 ALA A O   1 
ATOM   5321  C CB  . ALA A 1 766 ? -8.287  10.301  -89.631  1.00 254.45 ? 775 ALA A CB  1 
ATOM   5322  N N   . LYS A 1 767 ? -7.798  12.312  -87.344  1.00 257.17 ? 776 LYS A N   1 
ATOM   5323  C CA  . LYS A 1 767 ? -7.496  13.642  -86.828  1.00 257.17 ? 776 LYS A CA  1 
ATOM   5324  C C   . LYS A 1 767 ? -6.600  13.548  -85.599  1.00 257.17 ? 776 LYS A C   1 
ATOM   5325  O O   . LYS A 1 767 ? -6.057  14.551  -85.134  1.00 257.17 ? 776 LYS A O   1 
ATOM   5326  C CB  . LYS A 1 767 ? -8.785  14.391  -86.485  1.00 257.17 ? 776 LYS A CB  1 
ATOM   5327  N N   . ASP A 1 768 ? -6.451  12.335  -85.077  1.00 221.65 ? 777 ASP A N   1 
ATOM   5328  C CA  . ASP A 1 768 ? -5.602  12.091  -83.917  1.00 221.65 ? 777 ASP A CA  1 
ATOM   5329  C C   . ASP A 1 768 ? -4.199  11.676  -84.349  1.00 221.65 ? 777 ASP A C   1 
ATOM   5330  O O   . ASP A 1 768 ? -3.227  11.894  -83.626  1.00 221.65 ? 777 ASP A O   1 
ATOM   5331  C CB  . ASP A 1 768 ? -6.218  11.016  -83.020  1.00 221.65 ? 777 ASP A CB  1 
ATOM   5332  N N   . SER A 1 769 ? -4.104  11.076  -85.531  1.00 261.54 ? 778 SER A N   1 
ATOM   5333  C CA  . SER A 1 769 ? -2.820  10.664  -86.085  1.00 261.54 ? 778 SER A CA  1 
ATOM   5334  C C   . SER A 1 769 ? -2.075  11.868  -86.649  1.00 261.54 ? 778 SER A C   1 
ATOM   5335  O O   . SER A 1 769 ? -0.848  11.860  -86.754  1.00 261.54 ? 778 SER A O   1 
ATOM   5336  C CB  . SER A 1 769 ? -3.017  9.608   -87.173  1.00 261.54 ? 778 SER A CB  1 
ATOM   5337  N N   . GLY A 1 770 ? -2.829  12.899  -87.016  1.00 244.88 ? 779 GLY A N   1 
ATOM   5338  C CA  . GLY A 1 770 ? -2.248  14.137  -87.500  1.00 244.88 ? 779 GLY A CA  1 
ATOM   5339  C C   . GLY A 1 770 ? -1.951  15.079  -86.350  1.00 244.88 ? 779 GLY A C   1 
ATOM   5340  O O   . GLY A 1 770 ? -1.136  15.994  -86.475  1.00 244.88 ? 779 GLY A O   1 
ATOM   5341  N N   . SER A 1 771 ? -2.619  14.849  -85.224  1.00 268.19 ? 780 SER A N   1 
ATOM   5342  C CA  . SER A 1 771 ? -2.400  15.644  -84.023  1.00 268.19 ? 780 SER A CA  1 
ATOM   5343  C C   . SER A 1 771 ? -1.218  15.097  -83.228  1.00 268.19 ? 780 SER A C   1 
ATOM   5344  O O   . SER A 1 771 ? -0.859  15.633  -82.180  1.00 268.19 ? 780 SER A O   1 
ATOM   5345  C CB  . SER A 1 771 ? -3.663  15.678  -83.161  1.00 268.19 ? 780 SER A CB  1 
ATOM   5346  N N   . LYS A 1 772 ? -0.599  14.042  -83.749  1.00 298.74 ? 781 LYS A N   1 
ATOM   5347  C CA  . LYS A 1 772 ? 0.596   13.471  -83.137  1.00 298.74 ? 781 LYS A CA  1 
ATOM   5348  C C   . LYS A 1 772 ? 1.807   14.376  -83.353  1.00 298.74 ? 781 LYS A C   1 
ATOM   5349  O O   . LYS A 1 772 ? 2.948   13.913  -83.344  1.00 298.74 ? 781 LYS A O   1 
ATOM   5350  C CB  . LYS A 1 772 ? 0.874   12.077  -83.703  1.00 298.74 ? 781 LYS A CB  1 
ATOM   5351  N N   . GLU A 1 773 ? 1.546   15.665  -83.548  1.00 304.80 ? 782 GLU A N   1 
ATOM   5352  C CA  . GLU A 1 773 ? 2.598   16.658  -83.748  1.00 304.80 ? 782 GLU A CA  1 
ATOM   5353  C C   . GLU A 1 773 ? 3.407   16.392  -85.016  1.00 304.80 ? 782 GLU A C   1 
ATOM   5354  O O   . GLU A 1 773 ? 4.444   15.730  -84.975  1.00 304.80 ? 782 GLU A O   1 
ATOM   5355  C CB  . GLU A 1 773 ? 3.522   16.720  -82.529  1.00 304.80 ? 782 GLU A CB  1 
ATOM   5356  N N   . LYS A 1 774 ? 2.926   16.916  -86.139  1.00 255.41 ? 783 LYS A N   1 
ATOM   5357  C CA  . LYS A 1 774 ? 3.612   16.760  -87.417  1.00 255.41 ? 783 LYS A CA  1 
ATOM   5358  C C   . LYS A 1 774 ? 3.931   18.116  -88.040  1.00 255.41 ? 783 LYS A C   1 
ATOM   5359  O O   . LYS A 1 774 ? 4.446   18.193  -89.156  1.00 255.41 ? 783 LYS A O   1 
ATOM   5360  C CB  . LYS A 1 774 ? 2.770   15.922  -88.381  1.00 255.41 ? 783 LYS A CB  1 
ATOM   5361  N N   . THR A 1 775 ? 3.619   19.184  -87.311  1.00 245.33 ? 784 THR A N   1 
ATOM   5362  C CA  . THR A 1 775 ? 3.890   20.540  -87.775  1.00 245.33 ? 784 THR A CA  1 
ATOM   5363  C C   . THR A 1 775 ? 4.614   21.338  -86.697  1.00 245.33 ? 784 THR A C   1 
ATOM   5364  O O   . THR A 1 775 ? 4.090   21.527  -85.598  1.00 245.33 ? 784 THR A O   1 
ATOM   5365  C CB  . THR A 1 775 ? 2.592   21.273  -88.161  1.00 245.33 ? 784 THR A CB  1 
ATOM   5366  N N   . SER A 1 776 ? 5.817   21.807  -87.013  1.00 189.71 ? 785 SER A N   1 
ATOM   5367  C CA  . SER A 1 776 ? 6.629   22.524  -86.036  1.00 189.71 ? 785 SER A CA  1 
ATOM   5368  C C   . SER A 1 776 ? 7.497   23.610  -86.667  1.00 189.71 ? 785 SER A C   1 
ATOM   5369  O O   . SER A 1 776 ? 7.446   24.771  -86.261  1.00 189.71 ? 785 SER A O   1 
ATOM   5370  C CB  . SER A 1 776 ? 7.509   21.544  -85.255  1.00 189.71 ? 785 SER A CB  1 
ATOM   5371  N N   . ALA A 1 777 ? 8.294   23.228  -87.659  1.00 218.40 ? 786 ALA A N   1 
ATOM   5372  C CA  . ALA A 1 777 ? 9.253   24.145  -88.268  1.00 218.40 ? 786 ALA A CA  1 
ATOM   5373  C C   . ALA A 1 777 ? 8.606   25.116  -89.254  1.00 218.40 ? 786 ALA A C   1 
ATOM   5374  O O   . ALA A 1 777 ? 7.406   25.385  -89.183  1.00 218.40 ? 786 ALA A O   1 
ATOM   5375  C CB  . ALA A 1 777 ? 10.370  23.366  -88.944  1.00 218.40 ? 786 ALA A CB  1 
ATOM   5376  N N   . LEU A 1 778 ? 9.415   25.640  -90.171  1.00 162.17 ? 787 LEU A N   1 
ATOM   5377  C CA  . LEU A 1 778 ? 8.946   26.607  -91.161  1.00 162.17 ? 787 LEU A CA  1 
ATOM   5378  C C   . LEU A 1 778 ? 8.164   25.936  -92.288  1.00 162.17 ? 787 LEU A C   1 
ATOM   5379  O O   . LEU A 1 778 ? 8.476   24.814  -92.688  1.00 162.17 ? 787 LEU A O   1 
ATOM   5380  C CB  . LEU A 1 778 ? 10.126  27.393  -91.737  1.00 162.17 ? 787 LEU A CB  1 
ATOM   5381  C CG  . LEU A 1 778 ? 9.824   28.393  -92.855  1.00 162.17 ? 787 LEU A CG  1 
ATOM   5382  C CD1 . LEU A 1 778 ? 8.899   29.497  -92.367  1.00 162.17 ? 787 LEU A CD1 1 
ATOM   5383  C CD2 . LEU A 1 778 ? 11.114  28.979  -93.407  1.00 162.17 ? 787 LEU A CD2 1 
ATOM   5384  N N   . SER A 1 779 ? 7.150   26.632  -92.798  1.00 211.13 ? 788 SER A N   1 
ATOM   5385  C CA  . SER A 1 779 ? 6.286   26.091  -93.843  1.00 213.64 ? 788 SER A CA  1 
ATOM   5386  C C   . SER A 1 779 ? 6.863   26.326  -95.235  1.00 215.26 ? 788 SER A C   1 
ATOM   5387  O O   . SER A 1 779 ? 7.830   27.069  -95.401  1.00 214.26 ? 788 SER A O   1 
ATOM   5388  C CB  . SER A 1 779 ? 4.886   26.705  -93.750  1.00 213.51 ? 788 SER A CB  1 
ATOM   5389  O OG  . SER A 1 779 ? 4.021   26.171  -94.740  1.00 216.25 ? 788 SER A OG  1 
ATOM   5390  N N   . LEU A 1 780 ? 6.257   25.687  -96.230  1.00 159.77 ? 789 LEU A N   1 
ATOM   5391  C CA  . LEU A 1 780 ? 6.682   25.822  -97.618  1.00 161.94 ? 789 LEU A CA  1 
ATOM   5392  C C   . LEU A 1 780 ? 5.840   26.864  -98.345  1.00 162.54 ? 789 LEU A C   1 
ATOM   5393  O O   . LEU A 1 780 ? 6.272   27.439  -99.343  1.00 163.72 ? 789 LEU A O   1 
ATOM   5394  C CB  . LEU A 1 780 ? 6.576   24.473  -98.334  1.00 165.22 ? 789 LEU A CB  1 
ATOM   5395  C CG  . LEU A 1 780 ? 6.784   24.460  -99.850  1.00 168.31 ? 789 LEU A CG  1 
ATOM   5396  C CD1 . LEU A 1 780 ? 8.163   24.988  -100.216 1.00 167.76 ? 789 LEU A CD1 1 
ATOM   5397  C CD2 . LEU A 1 780 ? 6.580   23.058  -100.404 1.00 171.74 ? 789 LEU A CD2 1 
ATOM   5398  N N   . SER A 1 781 ? 4.639   27.103  -97.830  1.00 187.95 ? 790 SER A N   1 
ATOM   5399  C CA  . SER A 1 781 ? 3.690   28.027  -98.444  1.00 188.88 ? 790 SER A CA  1 
ATOM   5400  C C   . SER A 1 781 ? 4.329   29.338  -98.898  1.00 188.09 ? 790 SER A C   1 
ATOM   5401  O O   . SER A 1 781 ? 4.365   29.639  -100.091 1.00 190.40 ? 790 SER A O   1 
ATOM   5402  C CB  . SER A 1 781 ? 2.540   28.317  -97.481  1.00 187.59 ? 790 SER A CB  1 
ATOM   5403  O OG  . SER A 1 781 ? 3.017   28.857  -96.260  1.00 184.36 ? 790 SER A OG  1 
ATOM   5404  N N   . ASN A 1 782 ? 4.823   30.118  -97.942  1.00 269.39 ? 791 ASN A N   1 
ATOM   5405  C CA  . ASN A 1 782 ? 5.430   31.410  -98.244  1.00 268.65 ? 791 ASN A CA  1 
ATOM   5406  C C   . ASN A 1 782 ? 6.573   31.294  -99.248  1.00 270.14 ? 791 ASN A C   1 
ATOM   5407  O O   . ASN A 1 782 ? 6.636   32.045  -100.222 1.00 271.75 ? 791 ASN A O   1 
ATOM   5408  C CB  . ASN A 1 782 ? 5.921   32.084  -96.959  1.00 265.44 ? 791 ASN A CB  1 
ATOM   5409  C CG  . ASN A 1 782 ? 6.439   33.491  -97.196  1.00 264.88 ? 791 ASN A CG  1 
ATOM   5410  O OD1 . ASN A 1 782 ? 6.447   33.982  -98.325  1.00 266.87 ? 791 ASN A OD1 1 
ATOM   5411  N ND2 . ASN A 1 782 ? 6.876   34.147  -96.128  1.00 262.45 ? 791 ASN A ND2 1 
ATOM   5412  N N   . VAL A 1 783 ? 7.473   30.346  -99.003  1.00 176.42 ? 792 VAL A N   1 
ATOM   5413  C CA  . VAL A 1 783 ? 8.623   30.135  -99.873  1.00 177.97 ? 792 VAL A CA  1 
ATOM   5414  C C   . VAL A 1 783 ? 8.188   29.751  -101.286 1.00 181.64 ? 792 VAL A C   1 
ATOM   5415  O O   . VAL A 1 783 ? 8.873   30.059  -102.262 1.00 183.45 ? 792 VAL A O   1 
ATOM   5416  C CB  . VAL A 1 783 ? 9.556   29.043  -99.314  1.00 177.45 ? 792 VAL A CB  1 
ATOM   5417  C CG1 . VAL A 1 783 ? 10.809  28.925  -100.167 1.00 179.12 ? 792 VAL A CG1 1 
ATOM   5418  C CG2 . VAL A 1 783 ? 9.920   29.347  -97.870  1.00 174.21 ? 792 VAL A CG2 1 
ATOM   5419  N N   . ALA A 1 784 ? 7.043   29.082  -101.387 1.00 219.61 ? 793 ALA A N   1 
ATOM   5420  C CA  . ALA A 1 784 ? 6.523   28.633  -102.674 1.00 223.46 ? 793 ALA A CA  1 
ATOM   5421  C C   . ALA A 1 784 ? 6.221   29.806  -103.603 1.00 224.98 ? 793 ALA A C   1 
ATOM   5422  O O   . ALA A 1 784 ? 6.514   29.752  -104.797 1.00 228.07 ? 793 ALA A O   1 
ATOM   5423  C CB  . ALA A 1 784 ? 5.280   27.777  -102.476 1.00 224.61 ? 793 ALA A CB  1 
ATOM   5424  N N   . GLY A 1 785 ? 5.635   30.862  -103.048 1.00 171.19 ? 794 GLY A N   1 
ATOM   5425  C CA  . GLY A 1 785 ? 5.299   32.042  -103.825 1.00 172.69 ? 794 GLY A CA  1 
ATOM   5426  C C   . GLY A 1 785 ? 6.500   32.634  -104.538 1.00 173.50 ? 794 GLY A C   1 
ATOM   5427  O O   . GLY A 1 785 ? 6.368   33.240  -105.602 1.00 176.27 ? 794 GLY A O   1 
ATOM   5428  N N   . VAL A 1 786 ? 7.678   32.456  -103.947 1.00 209.70 ? 795 VAL A N   1 
ATOM   5429  C CA  . VAL A 1 786 ? 8.913   32.973  -104.523 1.00 210.42 ? 795 VAL A CA  1 
ATOM   5430  C C   . VAL A 1 786 ? 9.449   32.027  -105.594 1.00 213.70 ? 795 VAL A C   1 
ATOM   5431  O O   . VAL A 1 786 ? 10.250  32.421  -106.443 1.00 215.64 ? 795 VAL A O   1 
ATOM   5432  C CB  . VAL A 1 786 ? 9.987   33.195  -103.440 1.00 207.09 ? 795 VAL A CB  1 
ATOM   5433  C CG1 . VAL A 1 786 ? 11.203  33.891  -104.029 1.00 208.01 ? 795 VAL A CG1 1 
ATOM   5434  C CG2 . VAL A 1 786 ? 9.414   34.008  -102.291 1.00 204.03 ? 795 VAL A CG2 1 
ATOM   5435  N N   . PHE A 1 787 ? 9.001   30.776  -105.551 1.00 174.62 ? 796 PHE A N   1 
ATOM   5436  C CA  . PHE A 1 787 ? 9.391   29.792  -106.554 1.00 178.14 ? 796 PHE A CA  1 
ATOM   5437  C C   . PHE A 1 787 ? 8.651   30.017  -107.868 1.00 182.23 ? 796 PHE A C   1 
ATOM   5438  O O   . PHE A 1 787 ? 9.228   29.880  -108.947 1.00 185.50 ? 796 PHE A O   1 
ATOM   5439  C CB  . PHE A 1 787 ? 9.141   28.370  -106.047 1.00 178.06 ? 796 PHE A CB  1 
ATOM   5440  C CG  . PHE A 1 787 ? 10.291  27.792  -105.272 1.00 176.10 ? 796 PHE A CG  1 
ATOM   5441  C CD1 . PHE A 1 787 ? 10.426  28.038  -103.917 1.00 172.16 ? 796 PHE A CD1 1 
ATOM   5442  C CD2 . PHE A 1 787 ? 11.236  26.998  -105.901 1.00 178.53 ? 796 PHE A CD2 1 
ATOM   5443  C CE1 . PHE A 1 787 ? 11.483  27.506  -103.203 1.00 170.71 ? 796 PHE A CE1 1 
ATOM   5444  C CE2 . PHE A 1 787 ? 12.296  26.463  -105.193 1.00 177.05 ? 796 PHE A CE2 1 
ATOM   5445  C CZ  . PHE A 1 787 ? 12.419  26.717  -103.842 1.00 173.15 ? 796 PHE A CZ  1 
ATOM   5446  N N   . TYR A 1 788 ? 7.372   30.365  -107.770 1.00 194.00 ? 797 TYR A N   1 
ATOM   5447  C CA  . TYR A 1 788 ? 6.555   30.611  -108.953 1.00 198.08 ? 797 TYR A CA  1 
ATOM   5448  C C   . TYR A 1 788 ? 7.014   31.857  -109.706 1.00 199.43 ? 797 TYR A C   1 
ATOM   5449  O O   . TYR A 1 788 ? 6.997   31.888  -110.936 1.00 203.62 ? 797 TYR A O   1 
ATOM   5450  C CB  . TYR A 1 788 ? 5.078   30.733  -108.572 1.00 197.83 ? 797 TYR A CB  1 
ATOM   5451  C CG  . TYR A 1 788 ? 4.453   29.427  -108.134 1.00 197.97 ? 797 TYR A CG  1 
ATOM   5452  C CD1 . TYR A 1 788 ? 4.454   29.048  -106.799 1.00 194.16 ? 797 TYR A CD1 1 
ATOM   5453  C CD2 . TYR A 1 788 ? 3.865   28.573  -109.058 1.00 202.26 ? 797 TYR A CD2 1 
ATOM   5454  C CE1 . TYR A 1 788 ? 3.885   27.855  -106.394 1.00 194.57 ? 797 TYR A CE1 1 
ATOM   5455  C CE2 . TYR A 1 788 ? 3.293   27.378  -108.663 1.00 202.70 ? 797 TYR A CE2 1 
ATOM   5456  C CZ  . TYR A 1 788 ? 3.306   27.024  -107.331 1.00 198.84 ? 797 TYR A CZ  1 
ATOM   5457  O OH  . TYR A 1 788 ? 2.739   25.835  -106.933 1.00 199.56 ? 797 TYR A OH  1 
ATOM   5458  N N   . ILE A 1 789 ? 7.425   32.880  -108.962 1.00 185.64 ? 798 ILE A N   1 
ATOM   5459  C CA  . ILE A 1 789 ? 7.917   34.110  -109.571 1.00 186.83 ? 798 ILE A CA  1 
ATOM   5460  C C   . ILE A 1 789 ? 9.276   33.873  -110.226 1.00 188.42 ? 798 ILE A C   1 
ATOM   5461  O O   . ILE A 1 789 ? 9.680   34.611  -111.124 1.00 191.07 ? 798 ILE A O   1 
ATOM   5462  C CB  . ILE A 1 789 ? 8.024   35.255  -108.542 1.00 183.08 ? 798 ILE A CB  1 
ATOM   5463  C CG1 . ILE A 1 789 ? 8.223   36.597  -109.251 1.00 185.05 ? 798 ILE A CG1 1 
ATOM   5464  C CG2 . ILE A 1 789 ? 9.154   34.993  -107.560 1.00 179.52 ? 798 ILE A CG2 1 
ATOM   5465  C CD1 . ILE A 1 789 ? 8.345   37.774  -108.307 1.00 181.91 ? 798 ILE A CD1 1 
ATOM   5466  N N   . LEU A 1 790 ? 9.973   32.835  -109.772 1.00 185.78 ? 799 LEU A N   1 
ATOM   5467  C CA  . LEU A 1 790 ? 11.256  32.459  -110.355 1.00 187.52 ? 799 LEU A CA  1 
ATOM   5468  C C   . LEU A 1 790 ? 11.053  31.779  -111.703 1.00 192.61 ? 799 LEU A C   1 
ATOM   5469  O O   . LEU A 1 790 ? 11.611  32.205  -112.714 1.00 195.82 ? 799 LEU A O   1 
ATOM   5470  C CB  . LEU A 1 790 ? 12.025  31.529  -109.416 1.00 184.81 ? 799 LEU A CB  1 
ATOM   5471  C CG  . LEU A 1 790 ? 13.295  30.902  -109.996 1.00 186.98 ? 799 LEU A CG  1 
ATOM   5472  C CD1 . LEU A 1 790 ? 14.316  31.975  -110.346 1.00 187.38 ? 799 LEU A CD1 1 
ATOM   5473  C CD2 . LEU A 1 790 ? 13.888  29.890  -109.029 1.00 184.63 ? 799 LEU A CD2 1 
ATOM   5474  N N   . VAL A 1 791 ? 10.254  30.717  -111.708 1.00 194.03 ? 800 VAL A N   1 
ATOM   5475  C CA  . VAL A 1 791 ? 9.946   29.993  -112.935 1.00 199.13 ? 800 VAL A CA  1 
ATOM   5476  C C   . VAL A 1 791 ? 9.315   30.927  -113.962 1.00 202.55 ? 800 VAL A C   1 
ATOM   5477  O O   . VAL A 1 791 ? 9.536   30.785  -115.165 1.00 207.21 ? 800 VAL A O   1 
ATOM   5478  C CB  . VAL A 1 791 ? 9.000   28.807  -112.667 1.00 199.61 ? 800 VAL A CB  1 
ATOM   5479  C CG1 . VAL A 1 791 ? 8.630   28.113  -113.969 1.00 205.34 ? 800 VAL A CG1 1 
ATOM   5480  C CG2 . VAL A 1 791 ? 9.644   27.826  -111.699 1.00 196.81 ? 800 VAL A CG2 1 
ATOM   5481  N N   . GLY A 1 792 ? 8.530   31.886  -113.477 1.00 231.47 ? 801 GLY A N   1 
ATOM   5482  C CA  . GLY A 1 792 ? 7.926   32.884  -114.339 1.00 234.58 ? 801 GLY A CA  1 
ATOM   5483  C C   . GLY A 1 792 ? 8.980   33.749  -115.001 1.00 236.17 ? 801 GLY A C   1 
ATOM   5484  O O   . GLY A 1 792 ? 8.848   34.126  -116.165 1.00 240.77 ? 801 GLY A O   1 
ATOM   5485  N N   . GLY A 1 793 ? 10.032  34.063  -114.251 1.00 253.75 ? 802 GLY A N   1 
ATOM   5486  C CA  . GLY A 1 793 ? 11.140  34.837  -114.777 1.00 255.10 ? 802 GLY A CA  1 
ATOM   5487  C C   . GLY A 1 793 ? 11.950  34.036  -115.778 1.00 259.05 ? 802 GLY A C   1 
ATOM   5488  O O   . GLY A 1 793 ? 12.423  34.571  -116.781 1.00 262.80 ? 802 GLY A O   1 
ATOM   5489  N N   . LEU A 1 794 ? 12.109  32.746  -115.501 1.00 205.98 ? 803 LEU A N   1 
ATOM   5490  C CA  . LEU A 1 794 ? 12.816  31.850  -116.407 1.00 209.94 ? 803 LEU A CA  1 
ATOM   5491  C C   . LEU A 1 794 ? 12.064  31.731  -117.727 1.00 215.66 ? 803 LEU A C   1 
ATOM   5492  O O   . LEU A 1 794 ? 12.665  31.756  -118.800 1.00 220.07 ? 803 LEU A O   1 
ATOM   5493  C CB  . LEU A 1 794 ? 12.986  30.468  -115.774 1.00 208.33 ? 803 LEU A CB  1 
ATOM   5494  C CG  . LEU A 1 794 ? 13.853  30.391  -114.515 1.00 203.38 ? 803 LEU A CG  1 
ATOM   5495  C CD1 . LEU A 1 794 ? 13.819  28.990  -113.925 1.00 202.36 ? 803 LEU A CD1 1 
ATOM   5496  C CD2 . LEU A 1 794 ? 15.281  30.815  -114.817 1.00 204.19 ? 803 LEU A CD2 1 
ATOM   5497  N N   . GLY A 1 795 ? 10.744  31.603  -117.637 1.00 233.81 ? 804 GLY A N   1 
ATOM   5498  C CA  . GLY A 1 795 ? 9.903   31.511  -118.815 1.00 239.31 ? 804 GLY A CA  1 
ATOM   5499  C C   . GLY A 1 795 ? 9.941   32.785  -119.635 1.00 242.19 ? 804 GLY A C   1 
ATOM   5500  O O   . GLY A 1 795 ? 9.975   32.742  -120.865 1.00 247.78 ? 804 GLY A O   1 
ATOM   5501  N N   . LEU A 1 796 ? 9.936   33.923  -118.949 1.00 249.54 ? 805 LEU A N   1 
ATOM   5502  C CA  . LEU A 1 796 ? 10.024  35.217  -119.614 1.00 252.05 ? 805 LEU A CA  1 
ATOM   5503  C C   . LEU A 1 796 ? 11.334  35.329  -120.383 1.00 254.90 ? 805 LEU A C   1 
ATOM   5504  O O   . LEU A 1 796 ? 11.377  35.886  -121.480 1.00 259.82 ? 805 LEU A O   1 
ATOM   5505  C CB  . LEU A 1 796 ? 9.914   36.354  -118.596 1.00 247.43 ? 805 LEU A CB  1 
ATOM   5506  C CG  . LEU A 1 796 ? 10.059  37.774  -119.148 1.00 249.74 ? 805 LEU A CG  1 
ATOM   5507  C CD1 . LEU A 1 796 ? 9.004   38.050  -120.208 1.00 255.11 ? 805 LEU A CD1 1 
ATOM   5508  C CD2 . LEU A 1 796 ? 9.979   38.799  -118.028 1.00 245.01 ? 805 LEU A CD2 1 
ATOM   5509  N N   . ALA A 1 797 ? 12.401  34.791  -119.801 1.00 233.96 ? 806 ALA A N   1 
ATOM   5510  C CA  . ALA A 1 797 ? 13.713  34.806  -120.434 1.00 236.48 ? 806 ALA A CA  1 
ATOM   5511  C C   . ALA A 1 797 ? 13.753  33.858  -121.626 1.00 242.25 ? 806 ALA A C   1 
ATOM   5512  O O   . ALA A 1 797 ? 14.317  34.184  -122.671 1.00 246.95 ? 806 ALA A O   1 
ATOM   5513  C CB  . ALA A 1 797 ? 14.788  34.440  -119.431 1.00 231.99 ? 806 ALA A CB  1 
ATOM   5514  N N   . MET A 1 798 ? 13.155  32.683  -121.461 1.00 245.67 ? 807 MET A N   1 
ATOM   5515  C CA  . MET A 1 798 ? 13.077  31.706  -122.539 1.00 251.32 ? 807 MET A CA  1 
ATOM   5516  C C   . MET A 1 798 ? 12.292  32.274  -123.715 1.00 256.92 ? 807 MET A C   1 
ATOM   5517  O O   . MET A 1 798 ? 12.432  31.817  -124.849 1.00 262.78 ? 807 MET A O   1 
ATOM   5518  C CB  . MET A 1 798 ? 12.427  30.411  -122.047 1.00 250.06 ? 807 MET A CB  1 
ATOM   5519  C CG  . MET A 1 798 ? 13.241  29.663  -121.004 1.00 245.61 ? 807 MET A CG  1 
ATOM   5520  S SD  . MET A 1 798 ? 14.844  29.122  -121.629 1.00 248.72 ? 807 MET A SD  1 
ATOM   5521  C CE  . MET A 1 798 ? 14.340  28.046  -122.970 1.00 256.13 ? 807 MET A CE  1 
ATOM   5522  N N   . LEU A 1 799 ? 11.464  33.276  -123.434 1.00 240.94 ? 808 LEU A N   1 
ATOM   5523  C CA  . LEU A 1 799 ? 10.681  33.941  -124.467 1.00 246.16 ? 808 LEU A CA  1 
ATOM   5524  C C   . LEU A 1 799 ? 11.500  35.041  -125.133 1.00 248.81 ? 808 LEU A C   1 
ATOM   5525  O O   . LEU A 1 799 ? 11.458  35.209  -126.352 1.00 255.08 ? 808 LEU A O   1 
ATOM   5526  C CB  . LEU A 1 799 ? 9.399   34.525  -123.871 1.00 243.72 ? 808 LEU A CB  1 
ATOM   5527  C CG  . LEU A 1 799 ? 8.434   35.196  -124.851 1.00 249.13 ? 808 LEU A CG  1 
ATOM   5528  C CD1 . LEU A 1 799 ? 8.007   34.219  -125.935 1.00 255.32 ? 808 LEU A CD1 1 
ATOM   5529  C CD2 . LEU A 1 799 ? 7.224   35.751  -124.117 1.00 246.25 ? 808 LEU A CD2 1 
ATOM   5530  N N   . VAL A 1 800 ? 12.245  35.788  -124.324 1.00 246.24 ? 809 VAL A N   1 
ATOM   5531  C CA  . VAL A 1 800 ? 13.104  36.851  -124.832 1.00 248.38 ? 809 VAL A CA  1 
ATOM   5532  C C   . VAL A 1 800 ? 14.262  36.266  -125.634 1.00 252.20 ? 809 VAL A C   1 
ATOM   5533  O O   . VAL A 1 800 ? 14.776  36.900  -126.555 1.00 256.81 ? 809 VAL A O   1 
ATOM   5534  C CB  . VAL A 1 800 ? 13.659  37.723  -123.689 1.00 242.53 ? 809 VAL A CB  1 
ATOM   5535  C CG1 . VAL A 1 800 ? 14.633  38.759  -124.231 1.00 245.10 ? 809 VAL A CG1 1 
ATOM   5536  C CG2 . VAL A 1 800 ? 12.522  38.399  -122.939 1.00 239.27 ? 809 VAL A CG2 1 
ATOM   5537  N N   . ALA A 1 801 ? 14.665  35.050  -125.280 1.00 263.17 ? 810 ALA A N   1 
ATOM   5538  C CA  . ALA A 1 801 ? 15.742  34.366  -125.985 1.00 266.84 ? 810 ALA A CA  1 
ATOM   5539  C C   . ALA A 1 801 ? 15.320  34.008  -127.405 1.00 274.43 ? 810 ALA A C   1 
ATOM   5540  O O   . ALA A 1 801 ? 16.027  34.308  -128.367 1.00 279.40 ? 810 ALA A O   1 
ATOM   5541  C CB  . ALA A 1 801 ? 16.159  33.116  -125.229 1.00 263.48 ? 810 ALA A CB  1 
ATOM   5542  N N   . LEU A 1 802 ? 14.161  33.367  -127.526 1.00 279.11 ? 811 LEU A N   1 
ATOM   5543  C CA  . LEU A 1 802 ? 13.652  32.930  -128.821 1.00 286.46 ? 811 LEU A CA  1 
ATOM   5544  C C   . LEU A 1 802 ? 13.536  34.082  -129.814 1.00 291.54 ? 811 LEU A C   1 
ATOM   5545  O O   . LEU A 1 802 ? 13.938  33.957  -130.970 1.00 298.02 ? 811 LEU A O   1 
ATOM   5546  C CB  . LEU A 1 802 ? 12.296  32.238  -128.660 1.00 286.42 ? 811 LEU A CB  1 
ATOM   5547  C CG  . LEU A 1 802 ? 12.295  30.904  -127.912 1.00 283.17 ? 811 LEU A CG  1 
ATOM   5548  C CD1 . LEU A 1 802 ? 10.876  30.380  -127.751 1.00 283.34 ? 811 LEU A CD1 1 
ATOM   5549  C CD2 . LEU A 1 802 ? 13.169  29.885  -128.628 1.00 287.52 ? 811 LEU A CD2 1 
ATOM   5550  N N   . ILE A 1 803 ? 12.985  35.203  -129.359 1.00 285.03 ? 812 ILE A N   1 
ATOM   5551  C CA  . ILE A 1 803 ? 12.789  36.357  -130.230 1.00 289.82 ? 812 ILE A CA  1 
ATOM   5552  C C   . ILE A 1 803 ? 14.117  36.935  -130.716 1.00 292.08 ? 812 ILE A C   1 
ATOM   5553  O O   . ILE A 1 803 ? 14.225  37.376  -131.859 1.00 298.65 ? 812 ILE A O   1 
ATOM   5554  C CB  . ILE A 1 803 ? 11.951  37.462  -129.546 1.00 286.29 ? 812 ILE A CB  1 
ATOM   5555  C CG1 . ILE A 1 803 ? 12.715  38.078  -128.373 1.00 279.49 ? 812 ILE A CG1 1 
ATOM   5556  C CG2 . ILE A 1 803 ? 10.611  36.905  -129.084 1.00 284.42 ? 812 ILE A CG2 1 
ATOM   5557  C CD1 . ILE A 1 803 ? 11.965  39.189  -127.671 1.00 276.17 ? 812 ILE A CD1 1 
ATOM   5558  N N   . GLU A 1 804 ? 15.126  36.920  -129.849 1.00 314.10 ? 813 GLU A N   1 
ATOM   5559  C CA  . GLU A 1 804 ? 16.445  37.439  -130.203 1.00 315.90 ? 813 GLU A CA  1 
ATOM   5560  C C   . GLU A 1 804 ? 17.062  36.657  -131.359 1.00 322.47 ? 813 GLU A C   1 
ATOM   5561  O O   . GLU A 1 804 ? 17.606  37.244  -132.295 1.00 327.87 ? 813 GLU A O   1 
ATOM   5562  C CB  . GLU A 1 804 ? 17.380  37.418  -128.991 1.00 309.14 ? 813 GLU A CB  1 
ATOM   5563  C CG  . GLU A 1 804 ? 17.030  38.438  -127.918 1.00 303.39 ? 813 GLU A CG  1 
ATOM   5564  C CD  . GLU A 1 804 ? 17.986  38.399  -126.740 1.00 297.22 ? 813 GLU A CD  1 
ATOM   5565  O OE1 . GLU A 1 804 ? 19.021  37.708  -126.835 1.00 297.82 ? 813 GLU A OE1 1 
ATOM   5566  O OE2 . GLU A 1 804 ? 17.702  39.061  -125.719 1.00 292.03 ? 813 GLU A OE2 1 
ATOM   5567  N N   . PHE A 1 805 ? 16.976  35.332  -131.289 1.00 333.33 ? 814 PHE A N   1 
ATOM   5568  C CA  . PHE A 1 805 ? 17.503  34.475  -132.346 1.00 339.68 ? 814 PHE A CA  1 
ATOM   5569  C C   . PHE A 1 805 ? 16.718  34.654  -133.642 1.00 347.36 ? 814 PHE A C   1 
ATOM   5570  O O   . PHE A 1 805 ? 17.248  34.442  -134.733 1.00 354.03 ? 814 PHE A O   1 
ATOM   5571  C CB  . PHE A 1 805 ? 17.482  33.007  -131.914 1.00 337.75 ? 814 PHE A CB  1 
ATOM   5572  C CG  . PHE A 1 805 ? 18.474  32.677  -130.834 1.00 331.78 ? 814 PHE A CG  1 
ATOM   5573  C CD1 . PHE A 1 805 ? 18.065  32.542  -129.517 1.00 324.44 ? 814 PHE A CD1 1 
ATOM   5574  C CD2 . PHE A 1 805 ? 19.815  32.502  -131.136 1.00 333.81 ? 814 PHE A CD2 1 
ATOM   5575  C CE1 . PHE A 1 805 ? 18.975  32.238  -128.521 1.00 319.31 ? 814 PHE A CE1 1 
ATOM   5576  C CE2 . PHE A 1 805 ? 20.730  32.199  -130.144 1.00 328.67 ? 814 PHE A CE2 1 
ATOM   5577  C CZ  . PHE A 1 805 ? 20.309  32.067  -128.836 1.00 321.44 ? 814 PHE A CZ  1 
ATOM   5578  N N   . CYS A 1 806 ? 15.454  35.045  -133.514 1.00 293.95 ? 815 CYS A N   1 
ATOM   5579  C CA  . CYS A 1 806 ? 14.598  35.261  -134.674 1.00 301.20 ? 815 CYS A CA  1 
ATOM   5580  C C   . CYS A 1 806 ? 14.981  36.529  -135.432 1.00 305.61 ? 815 CYS A C   1 
ATOM   5581  O O   . CYS A 1 806 ? 15.102  36.514  -136.657 1.00 313.33 ? 815 CYS A O   1 
ATOM   5582  C CB  . CYS A 1 806 ? 13.126  35.317  -134.258 1.00 299.16 ? 815 CYS A CB  1 
ATOM   5583  S SG  . CYS A 1 806 ? 12.431  33.723  -133.766 1.00 296.93 ? 815 CYS A SG  1 
ATOM   5584  N N   . TYR A 1 807 ? 15.171  37.623  -134.700 1.00 325.35 ? 816 TYR A N   1 
ATOM   5585  C CA  . TYR A 1 807 ? 15.560  38.888  -135.314 1.00 329.20 ? 816 TYR A CA  1 
ATOM   5586  C C   . TYR A 1 807 ? 16.916  38.768  -136.000 1.00 333.24 ? 816 TYR A C   1 
ATOM   5587  O O   . TYR A 1 807 ? 17.127  39.320  -137.080 1.00 340.20 ? 816 TYR A O   1 
ATOM   5588  C CB  . TYR A 1 807 ? 15.592  40.012  -134.275 1.00 323.04 ? 816 TYR A CB  1 
ATOM   5589  C CG  . TYR A 1 807 ? 14.243  40.334  -133.672 1.00 319.84 ? 816 TYR A CG  1 
ATOM   5590  C CD1 . TYR A 1 807 ? 14.018  40.191  -132.309 1.00 311.71 ? 816 TYR A CD1 1 
ATOM   5591  C CD2 . TYR A 1 807 ? 13.194  40.777  -134.466 1.00 325.27 ? 816 TYR A CD2 1 
ATOM   5592  C CE1 . TYR A 1 807 ? 12.787  40.483  -131.753 1.00 309.01 ? 816 TYR A CE1 1 
ATOM   5593  C CE2 . TYR A 1 807 ? 11.958  41.072  -133.919 1.00 322.64 ? 816 TYR A CE2 1 
ATOM   5594  C CZ  . TYR A 1 807 ? 11.761  40.922  -132.562 1.00 314.48 ? 816 TYR A CZ  1 
ATOM   5595  O OH  . TYR A 1 807 ? 10.533  41.214  -132.012 1.00 312.07 ? 816 TYR A OH  1 
ATOM   5596  N N   . LYS A 1 808 ? 17.832  38.043  -135.366 1.00 304.50 ? 817 LYS A N   1 
ATOM   5597  C CA  . LYS A 1 808 ? 19.168  37.843  -135.916 1.00 307.96 ? 817 LYS A CA  1 
ATOM   5598  C C   . LYS A 1 808 ? 19.125  36.962  -137.161 1.00 315.84 ? 817 LYS A C   1 
ATOM   5599  O O   . LYS A 1 808 ? 19.010  37.459  -138.282 1.00 323.08 ? 817 LYS A O   1 
ATOM   5600  C CB  . LYS A 1 808 ? 20.092  37.222  -134.866 1.00 301.58 ? 817 LYS A CB  1 
ATOM   5601  N N   . ASN B 1 1   ? -89.603 19.199  -3.239   1.00 219.18 ? 10  ASN B N   1 
ATOM   5602  C CA  . ASN B 1 1   ? -88.918 18.598  -4.376   1.00 214.28 ? 10  ASN B CA  1 
ATOM   5603  C C   . ASN B 1 1   ? -87.533 18.084  -3.997   1.00 210.90 ? 10  ASN B C   1 
ATOM   5604  O O   . ASN B 1 1   ? -86.580 18.857  -3.895   1.00 209.16 ? 10  ASN B O   1 
ATOM   5605  C CB  . ASN B 1 1   ? -88.811 19.598  -5.529   1.00 212.61 ? 10  ASN B CB  1 
ATOM   5606  C CG  . ASN B 1 1   ? -90.167 20.008  -6.078   1.00 215.98 ? 10  ASN B CG  1 
ATOM   5607  O OD1 . ASN B 1 1   ? -90.262 20.555  -7.177   1.00 215.06 ? 10  ASN B OD1 1 
ATOM   5608  N ND2 . ASN B 1 1   ? -91.223 19.745  -5.316   1.00 220.26 ? 10  ASN B ND2 1 
ATOM   5609  N N   . SER B 1 2   ? -87.429 16.775  -3.787   1.00 255.54 ? 11  SER B N   1 
ATOM   5610  C CA  . SER B 1 2   ? -86.165 16.159  -3.400   1.00 252.90 ? 11  SER B CA  1 
ATOM   5611  C C   . SER B 1 2   ? -85.600 15.289  -4.518   1.00 248.82 ? 11  SER B C   1 
ATOM   5612  O O   . SER B 1 2   ? -86.134 14.220  -4.817   1.00 249.31 ? 11  SER B O   1 
ATOM   5613  C CB  . SER B 1 2   ? -86.343 15.328  -2.127   1.00 256.10 ? 11  SER B CB  1 
ATOM   5614  O OG  . SER B 1 2   ? -85.119 14.737  -1.728   1.00 254.04 ? 11  SER B OG  1 
ATOM   5615  N N   . ILE B 1 3   ? -84.516 15.754  -5.131   1.00 175.26 ? 12  ILE B N   1 
ATOM   5616  C CA  . ILE B 1 3   ? -83.871 15.019  -6.214   1.00 171.57 ? 12  ILE B CA  1 
ATOM   5617  C C   . ILE B 1 3   ? -82.620 14.298  -5.723   1.00 169.65 ? 12  ILE B C   1 
ATOM   5618  O O   . ILE B 1 3   ? -81.597 14.925  -5.450   1.00 168.06 ? 12  ILE B O   1 
ATOM   5619  C CB  . ILE B 1 3   ? -83.488 15.951  -7.378   1.00 168.95 ? 12  ILE B CB  1 
ATOM   5620  C CG1 . ILE B 1 3   ? -84.710 16.734  -7.860   1.00 171.36 ? 12  ILE B CG1 1 
ATOM   5621  C CG2 . ILE B 1 3   ? -82.876 15.153  -8.521   1.00 165.69 ? 12  ILE B CG2 1 
ATOM   5622  C CD1 . ILE B 1 3   ? -84.412 17.688  -8.994   1.00 169.55 ? 12  ILE B CD1 1 
ATOM   5623  N N   . GLN B 1 4   ? -82.710 12.977  -5.614   1.00 147.85 ? 13  GLN B N   1 
ATOM   5624  C CA  . GLN B 1 4   ? -81.594 12.171  -5.135   1.00 146.70 ? 13  GLN B CA  1 
ATOM   5625  C C   . GLN B 1 4   ? -80.586 11.890  -6.248   1.00 142.71 ? 13  GLN B C   1 
ATOM   5626  O O   . GLN B 1 4   ? -80.953 11.441  -7.335   1.00 141.69 ? 13  GLN B O   1 
ATOM   5627  C CB  . GLN B 1 4   ? -82.102 10.857  -4.536   1.00 149.47 ? 13  GLN B CB  1 
ATOM   5628  N N   . ILE B 1 5   ? -79.315 12.160  -5.968   1.00 134.67 ? 14  ILE B N   1 
ATOM   5629  C CA  . ILE B 1 5   ? -78.244 11.901  -6.925   1.00 131.19 ? 14  ILE B CA  1 
ATOM   5630  C C   . ILE B 1 5   ? -77.100 11.132  -6.272   1.00 130.89 ? 14  ILE B C   1 
ATOM   5631  O O   . ILE B 1 5   ? -76.957 11.136  -5.049   1.00 133.07 ? 14  ILE B O   1 
ATOM   5632  C CB  . ILE B 1 5   ? -77.689 13.207  -7.526   1.00 128.79 ? 14  ILE B CB  1 
ATOM   5633  C CG1 . ILE B 1 5   ? -77.091 14.088  -6.428   1.00 129.49 ? 14  ILE B CG1 1 
ATOM   5634  C CG2 . ILE B 1 5   ? -78.778 13.954  -8.281   1.00 129.38 ? 14  ILE B CG2 1 
ATOM   5635  C CD1 . ILE B 1 5   ? -76.531 15.396  -6.935   1.00 127.57 ? 14  ILE B CD1 1 
ATOM   5636  N N   . GLY B 1 6   ? -76.289 10.475  -7.093   1.00 130.69 ? 15  GLY B N   1 
ATOM   5637  C CA  . GLY B 1 6   ? -75.164 9.704   -6.597   1.00 130.56 ? 15  GLY B CA  1 
ATOM   5638  C C   . GLY B 1 6   ? -73.860 10.472  -6.683   1.00 128.10 ? 15  GLY B C   1 
ATOM   5639  O O   . GLY B 1 6   ? -73.683 11.317  -7.560   1.00 125.76 ? 15  GLY B O   1 
ATOM   5640  N N   . GLY B 1 7   ? -72.944 10.178  -5.766   1.00 144.56 ? 16  GLY B N   1 
ATOM   5641  C CA  . GLY B 1 7   ? -71.650 10.833  -5.743   1.00 142.62 ? 16  GLY B CA  1 
ATOM   5642  C C   . GLY B 1 7   ? -70.510 9.858   -5.521   1.00 142.78 ? 16  GLY B C   1 
ATOM   5643  O O   . GLY B 1 7   ? -70.316 9.358   -4.413   1.00 145.47 ? 16  GLY B O   1 
ATOM   5644  N N   . LEU B 1 8   ? -69.753 9.588   -6.580   1.00 131.43 ? 17  LEU B N   1 
ATOM   5645  C CA  . LEU B 1 8   ? -68.625 8.666   -6.503   1.00 131.67 ? 17  LEU B CA  1 
ATOM   5646  C C   . LEU B 1 8   ? -67.300 9.417   -6.415   1.00 130.06 ? 17  LEU B C   1 
ATOM   5647  O O   . LEU B 1 8   ? -66.719 9.793   -7.433   1.00 127.43 ? 17  LEU B O   1 
ATOM   5648  C CB  . LEU B 1 8   ? -68.615 7.717   -7.705   1.00 130.68 ? 17  LEU B CB  1 
ATOM   5649  C CG  . LEU B 1 8   ? -69.600 6.545   -7.679   1.00 133.06 ? 17  LEU B CG  1 
ATOM   5650  C CD1 . LEU B 1 8   ? -71.040 7.032   -7.642   1.00 133.67 ? 17  LEU B CD1 1 
ATOM   5651  C CD2 . LEU B 1 8   ? -69.374 5.630   -8.873   1.00 132.35 ? 17  LEU B CD2 1 
ATOM   5652  N N   . PHE B 1 9   ? -66.826 9.629   -5.192   1.00 138.10 ? 18  PHE B N   1 
ATOM   5653  C CA  . PHE B 1 9   ? -65.579 10.349  -4.966   1.00 137.11 ? 18  PHE B CA  1 
ATOM   5654  C C   . PHE B 1 9   ? -64.457 9.408   -4.544   1.00 138.60 ? 18  PHE B C   1 
ATOM   5655  O O   . PHE B 1 9   ? -64.566 8.721   -3.528   1.00 141.89 ? 18  PHE B O   1 
ATOM   5656  C CB  . PHE B 1 9   ? -65.773 11.435  -3.907   1.00 138.55 ? 18  PHE B CB  1 
ATOM   5657  C CG  . PHE B 1 9   ? -66.582 12.606  -4.380   1.00 137.03 ? 18  PHE B CG  1 
ATOM   5658  C CD1 . PHE B 1 9   ? -65.964 13.799  -4.718   1.00 135.13 ? 18  PHE B CD1 1 
ATOM   5659  C CD2 . PHE B 1 9   ? -67.959 12.515  -4.492   1.00 137.84 ? 18  PHE B CD2 1 
ATOM   5660  C CE1 . PHE B 1 9   ? -66.705 14.880  -5.155   1.00 134.21 ? 18  PHE B CE1 1 
ATOM   5661  C CE2 . PHE B 1 9   ? -68.706 13.592  -4.929   1.00 136.89 ? 18  PHE B CE2 1 
ATOM   5662  C CZ  . PHE B 1 9   ? -68.078 14.776  -5.260   1.00 135.15 ? 18  PHE B CZ  1 
ATOM   5663  N N   . PRO B 1 10  ? -63.372 9.374   -5.332   1.00 125.16 ? 19  PRO B N   1 
ATOM   5664  C CA  . PRO B 1 10  ? -62.193 8.561   -5.018   1.00 126.64 ? 19  PRO B CA  1 
ATOM   5665  C C   . PRO B 1 10  ? -61.544 9.022   -3.720   1.00 128.91 ? 19  PRO B C   1 
ATOM   5666  O O   . PRO B 1 10  ? -61.409 10.226  -3.500   1.00 127.90 ? 19  PRO B O   1 
ATOM   5667  C CB  . PRO B 1 10  ? -61.252 8.838   -6.195   1.00 123.67 ? 19  PRO B CB  1 
ATOM   5668  C CG  . PRO B 1 10  ? -62.133 9.337   -7.290   1.00 121.07 ? 19  PRO B CG  1 
ATOM   5669  C CD  . PRO B 1 10  ? -63.223 10.095  -6.606   1.00 121.70 ? 19  PRO B CD  1 
ATOM   5670  N N   . ARG B 1 11  ? -61.153 8.076   -2.873   1.00 180.73 ? 20  ARG B N   1 
ATOM   5671  C CA  . ARG B 1 11  ? -60.505 8.403   -1.609   1.00 183.62 ? 20  ARG B CA  1 
ATOM   5672  C C   . ARG B 1 11  ? -59.298 9.309   -1.835   1.00 181.75 ? 20  ARG B C   1 
ATOM   5673  O O   . ARG B 1 11  ? -58.333 8.922   -2.495   1.00 180.65 ? 20  ARG B O   1 
ATOM   5674  C CB  . ARG B 1 11  ? -60.081 7.129   -0.876   1.00 187.77 ? 20  ARG B CB  1 
ATOM   5675  N N   . GLY B 1 12  ? -59.360 10.518  -1.287   1.00 153.45 ? 21  GLY B N   1 
ATOM   5676  C CA  . GLY B 1 12  ? -58.287 11.482  -1.444   1.00 151.96 ? 21  GLY B CA  1 
ATOM   5677  C C   . GLY B 1 12  ? -58.744 12.744  -2.148   1.00 148.69 ? 21  GLY B C   1 
ATOM   5678  O O   . GLY B 1 12  ? -58.025 13.742  -2.181   1.00 147.76 ? 21  GLY B O   1 
ATOM   5679  N N   . ALA B 1 13  ? -59.946 12.698  -2.714   1.00 138.36 ? 22  ALA B N   1 
ATOM   5680  C CA  . ALA B 1 13  ? -60.513 13.852  -3.402   1.00 135.77 ? 22  ALA B CA  1 
ATOM   5681  C C   . ALA B 1 13  ? -61.111 14.837  -2.404   1.00 137.77 ? 22  ALA B C   1 
ATOM   5682  O O   . ALA B 1 13  ? -62.314 15.100  -2.418   1.00 137.96 ? 22  ALA B O   1 
ATOM   5683  C CB  . ALA B 1 13  ? -61.564 13.406  -4.406   1.00 133.94 ? 22  ALA B CB  1 
ATOM   5684  N N   . ASP B 1 14  ? -60.259 15.381  -1.542   1.00 153.45 ? 23  ASP B N   1 
ATOM   5685  C CA  . ASP B 1 14  ? -60.699 16.307  -0.507   1.00 156.06 ? 23  ASP B CA  1 
ATOM   5686  C C   . ASP B 1 14  ? -61.188 17.627  -1.094   1.00 154.13 ? 23  ASP B C   1 
ATOM   5687  O O   . ASP B 1 14  ? -62.333 18.021  -0.881   1.00 155.10 ? 23  ASP B O   1 
ATOM   5688  C CB  . ASP B 1 14  ? -59.575 16.560  0.499    1.00 158.78 ? 23  ASP B CB  1 
ATOM   5689  C CG  . ASP B 1 14  ? -59.156 15.300  1.233    1.00 161.69 ? 23  ASP B CG  1 
ATOM   5690  O OD1 . ASP B 1 14  ? -59.835 14.263  1.072    1.00 161.90 ? 23  ASP B OD1 1 
ATOM   5691  O OD2 . ASP B 1 14  ? -58.149 15.345  1.971    1.00 164.10 ? 23  ASP B OD2 1 
ATOM   5692  N N   . GLN B 1 15  ? -60.317 18.307  -1.832   1.00 135.48 ? 24  GLN B N   1 
ATOM   5693  C CA  . GLN B 1 15  ? -60.666 19.594  -2.422   1.00 134.02 ? 24  GLN B CA  1 
ATOM   5694  C C   . GLN B 1 15  ? -61.812 19.455  -3.417   1.00 131.99 ? 24  GLN B C   1 
ATOM   5695  O O   . GLN B 1 15  ? -62.641 20.355  -3.552   1.00 132.25 ? 24  GLN B O   1 
ATOM   5696  C CB  . GLN B 1 15  ? -59.453 20.230  -3.104   1.00 132.01 ? 24  GLN B CB  1 
ATOM   5697  C CG  . GLN B 1 15  ? -59.687 21.664  -3.552   1.00 131.36 ? 24  GLN B CG  1 
ATOM   5698  C CD  . GLN B 1 15  ? -58.512 22.240  -4.317   1.00 129.48 ? 24  GLN B CD  1 
ATOM   5699  O OE1 . GLN B 1 15  ? -57.814 21.525  -5.035   1.00 127.53 ? 24  GLN B OE1 1 
ATOM   5700  N NE2 . GLN B 1 15  ? -58.291 23.542  -4.171   1.00 130.39 ? 24  GLN B NE2 1 
ATOM   5701  N N   . GLU B 1 16  ? -61.853 18.324  -4.113   1.00 135.89 ? 25  GLU B N   1 
ATOM   5702  C CA  . GLU B 1 16  ? -62.921 18.057  -5.068   1.00 134.31 ? 25  GLU B CA  1 
ATOM   5703  C C   . GLU B 1 16  ? -64.272 17.983  -4.365   1.00 136.60 ? 25  GLU B C   1 
ATOM   5704  O O   . GLU B 1 16  ? -65.255 18.556  -4.833   1.00 136.27 ? 25  GLU B O   1 
ATOM   5705  C CB  . GLU B 1 16  ? -62.656 16.759  -5.834   1.00 132.79 ? 25  GLU B CB  1 
ATOM   5706  C CG  . GLU B 1 16  ? -61.554 16.856  -6.878   1.00 130.33 ? 25  GLU B CG  1 
ATOM   5707  C CD  . GLU B 1 16  ? -60.163 16.788  -6.278   1.00 131.04 ? 25  GLU B CD  1 
ATOM   5708  O OE1 . GLU B 1 16  ? -60.047 16.604  -5.048   1.00 133.57 ? 25  GLU B OE1 1 
ATOM   5709  O OE2 . GLU B 1 16  ? -59.181 16.913  -7.040   1.00 129.39 ? 25  GLU B OE2 1 
ATOM   5710  N N   . TYR B 1 17  ? -64.313 17.276  -3.241   1.00 123.10 ? 26  TYR B N   1 
ATOM   5711  C CA  . TYR B 1 17  ? -65.543 17.148  -2.468   1.00 125.83 ? 26  TYR B CA  1 
ATOM   5712  C C   . TYR B 1 17  ? -65.896 18.467  -1.789   1.00 127.83 ? 26  TYR B C   1 
ATOM   5713  O O   . TYR B 1 17  ? -67.066 18.836  -1.704   1.00 129.06 ? 26  TYR B O   1 
ATOM   5714  C CB  . TYR B 1 17  ? -65.422 16.031  -1.430   1.00 128.71 ? 26  TYR B CB  1 
ATOM   5715  C CG  . TYR B 1 17  ? -66.706 15.768  -0.676   1.00 131.79 ? 26  TYR B CG  1 
ATOM   5716  C CD1 . TYR B 1 17  ? -67.778 15.138  -1.292   1.00 131.10 ? 26  TYR B CD1 1 
ATOM   5717  C CD2 . TYR B 1 17  ? -66.847 16.149  0.652    1.00 135.75 ? 26  TYR B CD2 1 
ATOM   5718  C CE1 . TYR B 1 17  ? -68.954 14.897  -0.610   1.00 134.13 ? 26  TYR B CE1 1 
ATOM   5719  C CE2 . TYR B 1 17  ? -68.020 15.912  1.343    1.00 138.93 ? 26  TYR B CE2 1 
ATOM   5720  C CZ  . TYR B 1 17  ? -69.071 15.286  0.707    1.00 138.03 ? 26  TYR B CZ  1 
ATOM   5721  O OH  . TYR B 1 17  ? -70.242 15.046  1.391    1.00 141.40 ? 26  TYR B OH  1 
ATOM   5722  N N   . SER B 1 18  ? -64.878 19.172  -1.306   1.00 131.55 ? 27  SER B N   1 
ATOM   5723  C CA  . SER B 1 18  ? -65.081 20.477  -0.691   1.00 133.71 ? 27  SER B CA  1 
ATOM   5724  C C   . SER B 1 18  ? -65.729 21.428  -1.687   1.00 131.88 ? 27  SER B C   1 
ATOM   5725  O O   . SER B 1 18  ? -66.643 22.178  -1.342   1.00 134.02 ? 27  SER B O   1 
ATOM   5726  C CB  . SER B 1 18  ? -63.754 21.052  -0.199   1.00 134.40 ? 27  SER B CB  1 
ATOM   5727  O OG  . SER B 1 18  ? -63.205 20.253  0.834    1.00 136.95 ? 27  SER B OG  1 
ATOM   5728  N N   . ALA B 1 19  ? -65.250 21.391  -2.925   1.00 137.66 ? 28  ALA B N   1 
ATOM   5729  C CA  . ALA B 1 19  ? -65.822 22.202  -3.990   1.00 136.09 ? 28  ALA B CA  1 
ATOM   5730  C C   . ALA B 1 19  ? -67.221 21.704  -4.334   1.00 136.35 ? 28  ALA B C   1 
ATOM   5731  O O   . ALA B 1 19  ? -68.086 22.481  -4.738   1.00 136.90 ? 28  ALA B O   1 
ATOM   5732  C CB  . ALA B 1 19  ? -64.928 22.172  -5.217   1.00 132.69 ? 28  ALA B CB  1 
ATOM   5733  N N   . PHE B 1 20  ? -67.435 20.403  -4.169   1.00 122.19 ? 29  PHE B N   1 
ATOM   5734  C CA  . PHE B 1 20  ? -68.737 19.800  -4.421   1.00 122.73 ? 29  PHE B CA  1 
ATOM   5735  C C   . PHE B 1 20  ? -69.754 20.291  -3.398   1.00 126.38 ? 29  PHE B C   1 
ATOM   5736  O O   . PHE B 1 20  ? -70.923 20.505  -3.723   1.00 127.17 ? 29  PHE B O   1 
ATOM   5737  C CB  . PHE B 1 20  ? -68.635 18.274  -4.376   1.00 122.32 ? 29  PHE B CB  1 
ATOM   5738  C CG  . PHE B 1 20  ? -69.930 17.569  -4.661   1.00 123.00 ? 29  PHE B CG  1 
ATOM   5739  C CD1 . PHE B 1 20  ? -70.692 17.049  -3.629   1.00 126.12 ? 29  PHE B CD1 1 
ATOM   5740  C CD2 . PHE B 1 20  ? -70.383 17.422  -5.962   1.00 120.87 ? 29  PHE B CD2 1 
ATOM   5741  C CE1 . PHE B 1 20  ? -71.884 16.398  -3.889   1.00 126.95 ? 29  PHE B CE1 1 
ATOM   5742  C CE2 . PHE B 1 20  ? -71.573 16.771  -6.228   1.00 121.75 ? 29  PHE B CE2 1 
ATOM   5743  C CZ  . PHE B 1 20  ? -72.324 16.259  -5.190   1.00 124.71 ? 29  PHE B CZ  1 
ATOM   5744  N N   . ARG B 1 21  ? -69.299 20.470  -2.162   1.00 130.96 ? 30  ARG B N   1 
ATOM   5745  C CA  . ARG B 1 21  ? -70.155 20.961  -1.090   1.00 135.03 ? 30  ARG B CA  1 
ATOM   5746  C C   . ARG B 1 21  ? -70.510 22.427  -1.302   1.00 135.87 ? 30  ARG B C   1 
ATOM   5747  O O   . ARG B 1 21  ? -71.675 22.814  -1.206   1.00 138.00 ? 30  ARG B O   1 
ATOM   5748  C CB  . ARG B 1 21  ? -69.473 20.782  0.267    1.00 138.00 ? 30  ARG B CB  1 
ATOM   5749  C CG  . ARG B 1 21  ? -69.263 19.334  0.675    1.00 138.44 ? 30  ARG B CG  1 
ATOM   5750  C CD  . ARG B 1 21  ? -68.476 19.243  1.971    1.00 141.71 ? 30  ARG B CD  1 
ATOM   5751  N NE  . ARG B 1 21  ? -69.089 20.032  3.036    1.00 146.15 ? 30  ARG B NE  1 
ATOM   5752  C CZ  . ARG B 1 21  ? -68.579 20.162  4.256    1.00 150.02 ? 30  ARG B CZ  1 
ATOM   5753  N NH1 . ARG B 1 21  ? -67.442 19.555  4.566    1.00 149.91 ? 30  ARG B NH1 1 
ATOM   5754  N NH2 . ARG B 1 21  ? -69.204 20.900  5.165    1.00 154.37 ? 30  ARG B NH2 1 
ATOM   5755  N N   . VAL B 1 22  ? -69.498 23.239  -1.589   1.00 139.73 ? 31  VAL B N   1 
ATOM   5756  C CA  . VAL B 1 22  ? -69.700 24.664  -1.821   1.00 140.74 ? 31  VAL B CA  1 
ATOM   5757  C C   . VAL B 1 22  ? -70.701 24.894  -2.949   1.00 139.54 ? 31  VAL B C   1 
ATOM   5758  O O   . VAL B 1 22  ? -71.505 25.825  -2.900   1.00 141.94 ? 31  VAL B O   1 
ATOM   5759  C CB  . VAL B 1 22  ? -68.375 25.373  -2.158   1.00 139.01 ? 31  VAL B CB  1 
ATOM   5760  C CG1 . VAL B 1 22  ? -68.622 26.841  -2.469   1.00 140.34 ? 31  VAL B CG1 1 
ATOM   5761  C CG2 . VAL B 1 22  ? -67.391 25.225  -1.009   1.00 140.74 ? 31  VAL B CG2 1 
ATOM   5762  N N   . GLY B 1 23  ? -70.648 24.037  -3.962   1.00 131.26 ? 32  GLY B N   1 
ATOM   5763  C CA  . GLY B 1 23  ? -71.573 24.120  -5.077   1.00 130.31 ? 32  GLY B CA  1 
ATOM   5764  C C   . GLY B 1 23  ? -73.000 23.845  -4.645   1.00 133.05 ? 32  GLY B C   1 
ATOM   5765  O O   . GLY B 1 23  ? -73.936 24.498  -5.106   1.00 134.37 ? 32  GLY B O   1 
ATOM   5766  N N   . MET B 1 24  ? -73.164 22.873  -3.754   1.00 134.40 ? 33  MET B N   1 
ATOM   5767  C CA  . MET B 1 24  ? -74.477 22.528  -3.225   1.00 137.38 ? 33  MET B CA  1 
ATOM   5768  C C   . MET B 1 24  ? -75.100 23.722  -2.510   1.00 141.33 ? 33  MET B C   1 
ATOM   5769  O O   . MET B 1 24  ? -76.317 23.904  -2.526   1.00 143.67 ? 33  MET B O   1 
ATOM   5770  C CB  . MET B 1 24  ? -74.369 21.345  -2.260   1.00 138.55 ? 33  MET B CB  1 
ATOM   5771  C CG  . MET B 1 24  ? -73.872 20.057  -2.899   1.00 135.39 ? 33  MET B CG  1 
ATOM   5772  S SD  . MET B 1 24  ? -74.999 19.422  -4.154   1.00 133.95 ? 33  MET B SD  1 
ATOM   5773  C CE  . MET B 1 24  ? -76.528 19.351  -3.225   1.00 138.56 ? 33  MET B CE  1 
ATOM   5774  N N   . VAL B 1 25  ? -74.252 24.534  -1.887   1.00 144.16 ? 34  VAL B N   1 
ATOM   5775  C CA  . VAL B 1 25  ? -74.710 25.691  -1.128   1.00 148.37 ? 34  VAL B CA  1 
ATOM   5776  C C   . VAL B 1 25  ? -74.998 26.886  -2.032   1.00 148.28 ? 34  VAL B C   1 
ATOM   5777  O O   . VAL B 1 25  ? -76.008 27.570  -1.869   1.00 151.66 ? 34  VAL B O   1 
ATOM   5778  C CB  . VAL B 1 25  ? -73.678 26.105  -0.063   1.00 150.09 ? 34  VAL B CB  1 
ATOM   5779  C CG1 . VAL B 1 25  ? -74.138 27.358  0.666    1.00 154.81 ? 34  VAL B CG1 1 
ATOM   5780  C CG2 . VAL B 1 25  ? -73.442 24.965  0.917    1.00 151.12 ? 34  VAL B CG2 1 
ATOM   5781  N N   . GLN B 1 26  ? -74.106 27.133  -2.986   1.00 143.80 ? 35  GLN B N   1 
ATOM   5782  C CA  . GLN B 1 26  ? -74.231 28.285  -3.872   1.00 143.91 ? 35  GLN B CA  1 
ATOM   5783  C C   . GLN B 1 26  ? -75.380 28.133  -4.865   1.00 143.73 ? 35  GLN B C   1 
ATOM   5784  O O   . GLN B 1 26  ? -75.947 29.124  -5.326   1.00 145.74 ? 35  GLN B O   1 
ATOM   5785  C CB  . GLN B 1 26  ? -72.917 28.532  -4.619   1.00 140.46 ? 35  GLN B CB  1 
ATOM   5786  C CG  . GLN B 1 26  ? -72.970 29.688  -5.609   1.00 140.71 ? 35  GLN B CG  1 
ATOM   5787  C CD  . GLN B 1 26  ? -73.295 31.013  -4.944   1.00 145.18 ? 35  GLN B CD  1 
ATOM   5788  O OE1 . GLN B 1 26  ? -73.170 31.159  -3.728   1.00 147.77 ? 35  GLN B OE1 1 
ATOM   5789  N NE2 . GLN B 1 26  ? -73.711 31.989  -5.744   1.00 146.55 ? 35  GLN B NE2 1 
ATOM   5790  N N   . PHE B 1 27  ? -75.724 26.892  -5.190   1.00 149.47 ? 36  PHE B N   1 
ATOM   5791  C CA  . PHE B 1 27  ? -76.775 26.631  -6.167   1.00 149.31 ? 36  PHE B CA  1 
ATOM   5792  C C   . PHE B 1 27  ? -77.986 25.939  -5.546   1.00 151.83 ? 36  PHE B C   1 
ATOM   5793  O O   . PHE B 1 27  ? -78.681 25.170  -6.211   1.00 150.95 ? 36  PHE B O   1 
ATOM   5794  C CB  . PHE B 1 27  ? -76.228 25.808  -7.336   1.00 145.04 ? 36  PHE B CB  1 
ATOM   5795  C CG  . PHE B 1 27  ? -75.064 26.451  -8.033   1.00 142.75 ? 36  PHE B CG  1 
ATOM   5796  C CD1 . PHE B 1 27  ? -75.257 27.526  -8.885   1.00 143.66 ? 36  PHE B CD1 1 
ATOM   5797  C CD2 . PHE B 1 27  ? -73.776 25.984  -7.834   1.00 140.06 ? 36  PHE B CD2 1 
ATOM   5798  C CE1 . PHE B 1 27  ? -74.188 28.122  -9.525   1.00 141.89 ? 36  PHE B CE1 1 
ATOM   5799  C CE2 . PHE B 1 27  ? -72.703 26.575  -8.472   1.00 138.18 ? 36  PHE B CE2 1 
ATOM   5800  C CZ  . PHE B 1 27  ? -72.909 27.645  -9.319   1.00 139.08 ? 36  PHE B CZ  1 
ATOM   5801  N N   . SER B 1 28  ? -78.234 26.219  -4.271   1.00 149.73 ? 37  SER B N   1 
ATOM   5802  C CA  . SER B 1 28  ? -79.391 25.666  -3.578   1.00 152.84 ? 37  SER B CA  1 
ATOM   5803  C C   . SER B 1 28  ? -80.584 26.610  -3.686   1.00 156.78 ? 37  SER B C   1 
ATOM   5804  O O   . SER B 1 28  ? -80.486 27.792  -3.353   1.00 159.35 ? 37  SER B O   1 
ATOM   5805  C CB  . SER B 1 28  ? -79.063 25.400  -2.107   1.00 155.16 ? 37  SER B CB  1 
ATOM   5806  O OG  . SER B 1 28  ? -78.782 26.607  -1.419   1.00 158.12 ? 37  SER B OG  1 
ATOM   5807  N N   . THR B 1 29  ? -81.711 26.083  -4.152   1.00 212.31 ? 38  THR B N   1 
ATOM   5808  C CA  . THR B 1 29  ? -82.915 26.886  -4.324   1.00 216.30 ? 38  THR B CA  1 
ATOM   5809  C C   . THR B 1 29  ? -84.103 26.267  -3.594   1.00 219.79 ? 38  THR B C   1 
ATOM   5810  O O   . THR B 1 29  ? -84.058 25.106  -3.187   1.00 218.66 ? 38  THR B O   1 
ATOM   5811  C CB  . THR B 1 29  ? -83.266 27.063  -5.814   1.00 214.68 ? 38  THR B CB  1 
ATOM   5812  O OG1 . THR B 1 29  ? -84.394 27.937  -5.944   1.00 219.09 ? 38  THR B OG1 1 
ATOM   5813  C CG2 . THR B 1 29  ? -83.593 25.719  -6.447   1.00 212.08 ? 38  THR B CG2 1 
ATOM   5814  N N   . SER B 1 30  ? -85.164 27.050  -3.433   1.00 190.51 ? 39  SER B N   1 
ATOM   5815  C CA  . SER B 1 30  ? -86.366 26.586  -2.750   1.00 194.50 ? 39  SER B CA  1 
ATOM   5816  C C   . SER B 1 30  ? -87.221 25.711  -3.661   1.00 193.35 ? 39  SER B C   1 
ATOM   5817  O O   . SER B 1 30  ? -88.002 24.885  -3.189   1.00 195.24 ? 39  SER B O   1 
ATOM   5818  C CB  . SER B 1 30  ? -87.184 27.776  -2.247   1.00 200.30 ? 39  SER B CB  1 
ATOM   5819  O OG  . SER B 1 30  ? -86.406 28.604  -1.400   1.00 201.82 ? 39  SER B OG  1 
ATOM   5820  N N   . GLU B 1 31  ? -87.068 25.898  -4.968   1.00 258.88 ? 40  GLU B N   1 
ATOM   5821  C CA  . GLU B 1 31  ? -87.826 25.129  -5.948   1.00 257.95 ? 40  GLU B CA  1 
ATOM   5822  C C   . GLU B 1 31  ? -87.554 23.635  -5.808   1.00 255.04 ? 40  GLU B C   1 
ATOM   5823  O O   . GLU B 1 31  ? -88.459 22.813  -5.953   1.00 256.21 ? 40  GLU B O   1 
ATOM   5824  C CB  . GLU B 1 31  ? -87.493 25.593  -7.368   1.00 255.50 ? 40  GLU B CB  1 
ATOM   5825  N N   . PHE B 1 32  ? -86.302 23.291  -5.523   1.00 243.08 ? 41  PHE B N   1 
ATOM   5826  C CA  . PHE B 1 32  ? -85.909 21.897  -5.345   1.00 240.56 ? 41  PHE B CA  1 
ATOM   5827  C C   . PHE B 1 32  ? -84.527 21.785  -4.707   1.00 238.10 ? 41  PHE B C   1 
ATOM   5828  O O   . PHE B 1 32  ? -83.677 22.658  -4.884   1.00 236.64 ? 41  PHE B O   1 
ATOM   5829  C CB  . PHE B 1 32  ? -85.934 21.155  -6.684   1.00 237.42 ? 41  PHE B CB  1 
ATOM   5830  C CG  . PHE B 1 32  ? -85.066 21.776  -7.740   1.00 234.21 ? 41  PHE B CG  1 
ATOM   5831  C CD1 . PHE B 1 32  ? -83.742 21.395  -7.879   1.00 230.23 ? 41  PHE B CD1 1 
ATOM   5832  C CD2 . PHE B 1 32  ? -85.574 22.740  -8.594   1.00 235.55 ? 41  PHE B CD2 1 
ATOM   5833  C CE1 . PHE B 1 32  ? -82.941 21.964  -8.851   1.00 227.58 ? 41  PHE B CE1 1 
ATOM   5834  C CE2 . PHE B 1 32  ? -84.778 23.313  -9.568   1.00 233.02 ? 41  PHE B CE2 1 
ATOM   5835  C CZ  . PHE B 1 32  ? -83.460 22.924  -9.696   1.00 228.99 ? 41  PHE B CZ  1 
ATOM   5836  N N   . ARG B 1 33  ? -84.312 20.704  -3.964   1.00 244.26 ? 42  ARG B N   1 
ATOM   5837  C CA  . ARG B 1 33  ? -83.034 20.472  -3.300   1.00 242.43 ? 42  ARG B CA  1 
ATOM   5838  C C   . ARG B 1 33  ? -82.410 19.157  -3.754   1.00 238.96 ? 42  ARG B C   1 
ATOM   5839  O O   . ARG B 1 33  ? -83.109 18.160  -3.944   1.00 239.51 ? 42  ARG B O   1 
ATOM   5840  C CB  . ARG B 1 33  ? -83.212 20.472  -1.780   1.00 246.49 ? 42  ARG B CB  1 
ATOM   5841  N N   . LEU B 1 34  ? -81.093 19.162  -3.928   1.00 177.28 ? 43  LEU B N   1 
ATOM   5842  C CA  . LEU B 1 34  ? -80.370 17.969  -4.356   1.00 174.19 ? 43  LEU B CA  1 
ATOM   5843  C C   . LEU B 1 34  ? -79.863 17.173  -3.158   1.00 175.53 ? 43  LEU B C   1 
ATOM   5844  O O   . LEU B 1 34  ? -79.253 17.730  -2.244   1.00 176.74 ? 43  LEU B O   1 
ATOM   5845  C CB  . LEU B 1 34  ? -79.202 18.345  -5.272   1.00 170.17 ? 43  LEU B CB  1 
ATOM   5846  C CG  . LEU B 1 34  ? -79.522 18.698  -6.728   1.00 168.32 ? 43  LEU B CG  1 
ATOM   5847  C CD1 . LEU B 1 34  ? -80.522 19.843  -6.816   1.00 170.98 ? 43  LEU B CD1 1 
ATOM   5848  C CD2 . LEU B 1 34  ? -78.249 19.039  -7.486   1.00 164.78 ? 43  LEU B CD2 1 
ATOM   5849  N N   . THR B 1 35  ? -80.118 15.868  -3.169   1.00 227.68 ? 44  THR B N   1 
ATOM   5850  C CA  . THR B 1 35  ? -79.707 14.993  -2.076   1.00 229.49 ? 44  THR B CA  1 
ATOM   5851  C C   . THR B 1 35  ? -78.582 14.059  -2.513   1.00 226.42 ? 44  THR B C   1 
ATOM   5852  O O   . THR B 1 35  ? -78.835 12.998  -3.082   1.00 225.72 ? 44  THR B O   1 
ATOM   5853  C CB  . THR B 1 35  ? -80.887 14.152  -1.555   1.00 233.13 ? 44  THR B CB  1 
ATOM   5854  O OG1 . THR B 1 35  ? -81.967 15.017  -1.182   1.00 236.28 ? 44  THR B OG1 1 
ATOM   5855  C CG2 . THR B 1 35  ? -80.463 13.329  -0.348   1.00 235.74 ? 44  THR B CG2 1 
ATOM   5856  N N   . PRO B 1 36  ? -77.330 14.460  -2.248   1.00 158.79 ? 45  PRO B N   1 
ATOM   5857  C CA  . PRO B 1 36  ? -76.144 13.687  -2.630   1.00 156.10 ? 45  PRO B CA  1 
ATOM   5858  C C   . PRO B 1 36  ? -75.920 12.475  -1.732   1.00 158.52 ? 45  PRO B C   1 
ATOM   5859  O O   . PRO B 1 36  ? -75.869 12.614  -0.510   1.00 161.74 ? 45  PRO B O   1 
ATOM   5860  C CB  . PRO B 1 36  ? -74.993 14.686  -2.438   1.00 154.64 ? 45  PRO B CB  1 
ATOM   5861  C CG  . PRO B 1 36  ? -75.642 16.031  -2.283   1.00 155.91 ? 45  PRO B CG  1 
ATOM   5862  C CD  . PRO B 1 36  ? -76.967 15.757  -1.659   1.00 159.63 ? 45  PRO B CD  1 
ATOM   5863  N N   . HIS B 1 37  ? -75.789 11.300  -2.338   1.00 163.97 ? 46  HIS B N   1 
ATOM   5864  C CA  . HIS B 1 37  ? -75.433 10.093  -1.602   1.00 166.27 ? 46  HIS B CA  1 
ATOM   5865  C C   . HIS B 1 37  ? -73.984 9.733   -1.908   1.00 163.90 ? 46  HIS B C   1 
ATOM   5866  O O   . HIS B 1 37  ? -73.689 9.115   -2.931   1.00 161.51 ? 46  HIS B O   1 
ATOM   5867  C CB  . HIS B 1 37  ? -76.364 8.937   -1.969   1.00 167.58 ? 46  HIS B CB  1 
ATOM   5868  C CG  . HIS B 1 37  ? -76.237 7.748   -1.066   1.00 171.08 ? 46  HIS B CG  1 
ATOM   5869  N ND1 . HIS B 1 37  ? -75.428 6.674   -1.359   1.00 170.51 ? 46  HIS B ND1 1 
ATOM   5870  C CD2 . HIS B 1 37  ? -76.818 7.470   0.125    1.00 175.64 ? 46  HIS B CD2 1 
ATOM   5871  C CE1 . HIS B 1 37  ? -75.515 5.781   -0.388   1.00 174.59 ? 46  HIS B CE1 1 
ATOM   5872  N NE2 . HIS B 1 37  ? -76.352 6.240   0.524    1.00 177.75 ? 46  HIS B NE2 1 
ATOM   5873  N N   . ILE B 1 38  ? -73.082 10.127  -1.015   1.00 143.79 ? 47  ILE B N   1 
ATOM   5874  C CA  . ILE B 1 38  ? -71.649 9.996   -1.255   1.00 141.69 ? 47  ILE B CA  1 
ATOM   5875  C C   . ILE B 1 38  ? -71.123 8.587   -0.998   1.00 143.38 ? 47  ILE B C   1 
ATOM   5876  O O   . ILE B 1 38  ? -71.447 7.963   0.012    1.00 147.38 ? 47  ILE B O   1 
ATOM   5877  C CB  . ILE B 1 38  ? -70.847 10.993  -0.397   1.00 142.46 ? 47  ILE B CB  1 
ATOM   5878  C CG1 . ILE B 1 38  ? -71.430 12.401  -0.534   1.00 141.63 ? 47  ILE B CG1 1 
ATOM   5879  C CG2 . ILE B 1 38  ? -69.377 10.971  -0.787   1.00 140.02 ? 47  ILE B CG2 1 
ATOM   5880  C CD1 . ILE B 1 38  ? -71.520 12.887  -1.965   1.00 137.51 ? 47  ILE B CD1 1 
ATOM   5881  N N   . ASP B 1 39  ? -70.302 8.099   -1.924   1.00 183.75 ? 48  ASP B N   1 
ATOM   5882  C CA  . ASP B 1 39  ? -69.667 6.793   -1.793   1.00 185.35 ? 48  ASP B CA  1 
ATOM   5883  C C   . ASP B 1 39  ? -68.175 6.890   -2.095   1.00 183.37 ? 48  ASP B C   1 
ATOM   5884  O O   . ASP B 1 39  ? -67.777 7.055   -3.247   1.00 179.92 ? 48  ASP B O   1 
ATOM   5885  C CB  . ASP B 1 39  ? -70.324 5.778   -2.732   1.00 184.89 ? 48  ASP B CB  1 
ATOM   5886  C CG  . ASP B 1 39  ? -71.725 5.399   -2.295   1.00 187.79 ? 48  ASP B CG  1 
ATOM   5887  O OD1 . ASP B 1 39  ? -72.019 5.496   -1.085   1.00 191.21 ? 48  ASP B OD1 1 
ATOM   5888  O OD2 . ASP B 1 39  ? -72.531 5.000   -3.162   1.00 186.95 ? 48  ASP B OD2 1 
ATOM   5889  N N   . ASN B 1 40  ? -67.355 6.791   -1.054   1.00 148.65 ? 49  ASN B N   1 
ATOM   5890  C CA  . ASN B 1 40  ? -65.907 6.864   -1.210   1.00 147.40 ? 49  ASN B CA  1 
ATOM   5891  C C   . ASN B 1 40  ? -65.286 5.497   -1.477   1.00 148.68 ? 49  ASN B C   1 
ATOM   5892  O O   . ASN B 1 40  ? -65.100 4.700   -0.557   1.00 152.74 ? 49  ASN B O   1 
ATOM   5893  C CB  . ASN B 1 40  ? -65.265 7.500   0.025    1.00 149.83 ? 49  ASN B CB  1 
ATOM   5894  C CG  . ASN B 1 40  ? -65.602 8.972   0.166    1.00 148.36 ? 49  ASN B CG  1 
ATOM   5895  O OD1 . ASN B 1 40  ? -66.179 9.577   -0.736   1.00 145.21 ? 49  ASN B OD1 1 
ATOM   5896  N ND2 . ASN B 1 40  ? -65.238 9.556   1.302    1.00 151.07 ? 49  ASN B ND2 1 
ATOM   5897  N N   . LEU B 1 41  ? -64.968 5.231   -2.740   1.00 187.62 ? 50  LEU B N   1 
ATOM   5898  C CA  . LEU B 1 41  ? -64.368 3.959   -3.126   1.00 188.88 ? 50  LEU B CA  1 
ATOM   5899  C C   . LEU B 1 41  ? -63.116 4.162   -3.972   1.00 186.19 ? 50  LEU B C   1 
ATOM   5900  O O   . LEU B 1 41  ? -62.903 5.237   -4.534   1.00 182.78 ? 50  LEU B O   1 
ATOM   5901  C CB  . LEU B 1 41  ? -65.373 3.095   -3.893   1.00 188.97 ? 50  LEU B CB  1 
ATOM   5902  C CG  . LEU B 1 41  ? -66.479 2.397   -3.096   1.00 192.76 ? 50  LEU B CG  1 
ATOM   5903  C CD1 . LEU B 1 41  ? -67.521 3.392   -2.605   1.00 192.40 ? 50  LEU B CD1 1 
ATOM   5904  C CD2 . LEU B 1 41  ? -67.135 1.315   -3.940   1.00 193.29 ? 50  LEU B CD2 1 
ATOM   5905  N N   . GLU B 1 42  ? -62.290 3.124   -4.053   1.00 166.13 ? 51  GLU B N   1 
ATOM   5906  C CA  . GLU B 1 42  ? -61.101 3.153   -4.896   1.00 164.15 ? 51  GLU B CA  1 
ATOM   5907  C C   . GLU B 1 42  ? -61.512 3.181   -6.362   1.00 160.93 ? 51  GLU B C   1 
ATOM   5908  O O   . GLU B 1 42  ? -61.863 2.151   -6.937   1.00 162.07 ? 51  GLU B O   1 
ATOM   5909  C CB  . GLU B 1 42  ? -60.213 1.939   -4.618   1.00 167.69 ? 51  GLU B CB  1 
ATOM   5910  N N   . VAL B 1 43  ? -61.467 4.367   -6.958   1.00 126.90 ? 52  VAL B N   1 
ATOM   5911  C CA  . VAL B 1 43  ? -61.936 4.568   -8.324   1.00 124.09 ? 52  VAL B CA  1 
ATOM   5912  C C   . VAL B 1 43  ? -61.281 3.608   -9.316   1.00 124.45 ? 52  VAL B C   1 
ATOM   5913  O O   . VAL B 1 43  ? -61.888 3.232   -10.319  1.00 123.82 ? 52  VAL B O   1 
ATOM   5914  C CB  . VAL B 1 43  ? -61.711 6.023   -8.784   1.00 120.67 ? 52  VAL B CB  1 
ATOM   5915  C CG1 . VAL B 1 43  ? -60.225 6.351   -8.817   1.00 120.03 ? 52  VAL B CG1 1 
ATOM   5916  C CG2 . VAL B 1 43  ? -62.348 6.257   -10.141  1.00 118.38 ? 52  VAL B CG2 1 
ATOM   5917  N N   . ALA B 1 44  ? -60.047 3.208   -9.028   1.00 129.23 ? 53  ALA B N   1 
ATOM   5918  C CA  . ALA B 1 44  ? -59.303 2.318   -9.913   1.00 130.06 ? 53  ALA B CA  1 
ATOM   5919  C C   . ALA B 1 44  ? -59.944 0.936   -10.000  1.00 133.11 ? 53  ALA B C   1 
ATOM   5920  O O   . ALA B 1 44  ? -60.053 0.357   -11.081  1.00 133.12 ? 53  ALA B O   1 
ATOM   5921  C CB  . ALA B 1 44  ? -57.857 2.206   -9.455   1.00 131.44 ? 53  ALA B CB  1 
ATOM   5922  N N   . ASN B 1 45  ? -60.364 0.410   -8.853   1.00 133.10 ? 54  ASN B N   1 
ATOM   5923  C CA  . ASN B 1 45  ? -60.975 -0.912  -8.793   1.00 136.56 ? 54  ASN B CA  1 
ATOM   5924  C C   . ASN B 1 45  ? -62.291 -0.970  -9.563   1.00 135.34 ? 54  ASN B C   1 
ATOM   5925  O O   . ASN B 1 45  ? -63.277 -0.345  -9.172   1.00 134.25 ? 54  ASN B O   1 
ATOM   5926  C CB  . ASN B 1 45  ? -61.193 -1.330  -7.338   1.00 140.21 ? 54  ASN B CB  1 
ATOM   5927  C CG  . ASN B 1 45  ? -61.577 -2.789  -7.200   1.00 144.60 ? 54  ASN B CG  1 
ATOM   5928  O OD1 . ASN B 1 45  ? -61.941 -3.443  -8.176   1.00 144.72 ? 54  ASN B OD1 1 
ATOM   5929  N ND2 . ASN B 1 45  ? -61.497 -3.308  -5.980   1.00 148.65 ? 54  ASN B ND2 1 
ATOM   5930  N N   . SER B 1 46  ? -62.299 -1.726  -10.657  1.00 136.52 ? 55  SER B N   1 
ATOM   5931  C CA  . SER B 1 46  ? -63.481 -1.838  -11.505  1.00 135.74 ? 55  SER B CA  1 
ATOM   5932  C C   . SER B 1 46  ? -64.650 -2.491  -10.772  1.00 138.50 ? 55  SER B C   1 
ATOM   5933  O O   . SER B 1 46  ? -65.797 -2.073  -10.921  1.00 137.32 ? 55  SER B O   1 
ATOM   5934  C CB  . SER B 1 46  ? -63.155 -2.621  -12.779  1.00 136.63 ? 55  SER B CB  1 
ATOM   5935  O OG  . SER B 1 46  ? -62.187 -1.943  -13.560  1.00 134.10 ? 55  SER B OG  1 
ATOM   5936  N N   . PHE B 1 47  ? -64.352 -3.517  -9.982   1.00 140.94 ? 56  PHE B N   1 
ATOM   5937  C CA  . PHE B 1 47  ? -65.381 -4.221  -9.224   1.00 144.24 ? 56  PHE B CA  1 
ATOM   5938  C C   . PHE B 1 47  ? -66.113 -3.282  -8.274   1.00 143.08 ? 56  PHE B C   1 
ATOM   5939  O O   . PHE B 1 47  ? -67.341 -3.205  -8.285   1.00 143.12 ? 56  PHE B O   1 
ATOM   5940  C CB  . PHE B 1 47  ? -64.769 -5.382  -8.439   1.00 149.13 ? 56  PHE B CB  1 
ATOM   5941  C CG  . PHE B 1 47  ? -65.721 -6.032  -7.478   1.00 152.99 ? 56  PHE B CG  1 
ATOM   5942  C CD1 . PHE B 1 47  ? -66.586 -7.025  -7.904   1.00 155.62 ? 56  PHE B CD1 1 
ATOM   5943  C CD2 . PHE B 1 47  ? -65.748 -5.650  -6.146   1.00 154.37 ? 56  PHE B CD2 1 
ATOM   5944  C CE1 . PHE B 1 47  ? -67.463 -7.625  -7.020   1.00 159.45 ? 56  PHE B CE1 1 
ATOM   5945  C CE2 . PHE B 1 47  ? -66.624 -6.247  -5.258   1.00 158.33 ? 56  PHE B CE2 1 
ATOM   5946  C CZ  . PHE B 1 47  ? -67.482 -7.236  -5.696   1.00 160.83 ? 56  PHE B CZ  1 
ATOM   5947  N N   . ALA B 1 48  ? -65.349 -2.571  -7.450   1.00 158.09 ? 57  ALA B N   1 
ATOM   5948  C CA  . ALA B 1 48  ? -65.918 -1.643  -6.481   1.00 157.47 ? 57  ALA B CA  1 
ATOM   5949  C C   . ALA B 1 48  ? -66.802 -0.605  -7.163   1.00 153.67 ? 57  ALA B C   1 
ATOM   5950  O O   . ALA B 1 48  ? -67.889 -0.289  -6.680   1.00 154.19 ? 57  ALA B O   1 
ATOM   5951  C CB  . ALA B 1 48  ? -64.813 -0.964  -5.687   1.00 157.13 ? 57  ALA B CB  1 
ATOM   5952  N N   . VAL B 1 49  ? -66.329 -0.080  -8.288   1.00 139.12 ? 58  VAL B N   1 
ATOM   5953  C CA  . VAL B 1 49  ? -67.082 0.911   -9.047   1.00 135.82 ? 58  VAL B CA  1 
ATOM   5954  C C   . VAL B 1 49  ? -68.419 0.344   -9.517   1.00 137.02 ? 58  VAL B C   1 
ATOM   5955  O O   . VAL B 1 49  ? -69.421 1.057   -9.573   1.00 135.88 ? 58  VAL B O   1 
ATOM   5956  C CB  . VAL B 1 49  ? -66.282 1.419   -10.262  1.00 132.65 ? 58  VAL B CB  1 
ATOM   5957  C CG1 . VAL B 1 49  ? -67.148 2.313   -11.134  1.00 130.00 ? 58  VAL B CG1 1 
ATOM   5958  C CG2 . VAL B 1 49  ? -65.038 2.161   -9.801   1.00 131.27 ? 58  VAL B CG2 1 
ATOM   5959  N N   . THR B 1 50  ? -68.429 -0.943  -9.846   1.00 134.92 ? 59  THR B N   1 
ATOM   5960  C CA  . THR B 1 50  ? -69.650 -1.607  -10.288  1.00 136.62 ? 59  THR B CA  1 
ATOM   5961  C C   . THR B 1 50  ? -70.680 -1.656  -9.162   1.00 138.93 ? 59  THR B C   1 
ATOM   5962  O O   . THR B 1 50  ? -71.864 -1.400  -9.381   1.00 138.79 ? 59  THR B O   1 
ATOM   5963  C CB  . THR B 1 50  ? -69.369 -3.037  -10.783  1.00 139.63 ? 59  THR B CB  1 
ATOM   5964  O OG1 . THR B 1 50  ? -68.300 -3.014  -11.736  1.00 137.99 ? 59  THR B OG1 1 
ATOM   5965  C CG2 . THR B 1 50  ? -70.610 -3.629  -11.433  1.00 141.17 ? 59  THR B CG2 1 
ATOM   5966  N N   . ASN B 1 51  ? -70.222 -1.985  -7.958   1.00 142.83 ? 60  ASN B N   1 
ATOM   5967  C CA  . ASN B 1 51  ? -71.096 -2.020  -6.792   1.00 145.57 ? 60  ASN B CA  1 
ATOM   5968  C C   . ASN B 1 51  ? -71.631 -0.639  -6.436   1.00 143.19 ? 60  ASN B C   1 
ATOM   5969  O O   . ASN B 1 51  ? -72.825 -0.470  -6.197   1.00 144.19 ? 60  ASN B O   1 
ATOM   5970  C CB  . ASN B 1 51  ? -70.372 -2.625  -5.586   1.00 149.17 ? 60  ASN B CB  1 
ATOM   5971  C CG  . ASN B 1 51  ? -70.300 -4.137  -5.648   1.00 153.26 ? 60  ASN B CG  1 
ATOM   5972  O OD1 . ASN B 1 51  ? -70.282 -4.726  -6.728   1.00 152.79 ? 60  ASN B OD1 1 
ATOM   5973  N ND2 . ASN B 1 51  ? -70.259 -4.776  -4.483   1.00 157.74 ? 60  ASN B ND2 1 
ATOM   5974  N N   . ALA B 1 52  ? -70.738 0.345   -6.402   1.00 141.51 ? 61  ALA B N   1 
ATOM   5975  C CA  . ALA B 1 52  ? -71.119 1.712   -6.069   1.00 139.47 ? 61  ALA B CA  1 
ATOM   5976  C C   . ALA B 1 52  ? -72.152 2.254   -7.050   1.00 137.33 ? 61  ALA B C   1 
ATOM   5977  O O   . ALA B 1 52  ? -72.983 3.089   -6.692   1.00 137.17 ? 61  ALA B O   1 
ATOM   5978  C CB  . ALA B 1 52  ? -69.894 2.611   -6.036   1.00 136.84 ? 61  ALA B CB  1 
ATOM   5979  N N   . PHE B 1 53  ? -72.097 1.773   -8.287   1.00 138.60 ? 62  PHE B N   1 
ATOM   5980  C CA  . PHE B 1 53  ? -73.040 2.199   -9.313   1.00 137.05 ? 62  PHE B CA  1 
ATOM   5981  C C   . PHE B 1 53  ? -74.396 1.528   -9.127   1.00 139.99 ? 62  PHE B C   1 
ATOM   5982  O O   . PHE B 1 53  ? -75.435 2.186   -9.162   1.00 139.83 ? 62  PHE B O   1 
ATOM   5983  C CB  . PHE B 1 53  ? -72.489 1.895   -10.707  1.00 135.30 ? 62  PHE B CB  1 
ATOM   5984  C CG  . PHE B 1 53  ? -73.451 2.203   -11.817  1.00 134.41 ? 62  PHE B CG  1 
ATOM   5985  C CD1 . PHE B 1 53  ? -73.524 3.476   -12.356  1.00 131.69 ? 62  PHE B CD1 1 
ATOM   5986  C CD2 . PHE B 1 53  ? -74.285 1.219   -12.322  1.00 136.71 ? 62  PHE B CD2 1 
ATOM   5987  C CE1 . PHE B 1 53  ? -74.409 3.762   -13.378  1.00 131.38 ? 62  PHE B CE1 1 
ATOM   5988  C CE2 . PHE B 1 53  ? -75.172 1.499   -13.343  1.00 136.31 ? 62  PHE B CE2 1 
ATOM   5989  C CZ  . PHE B 1 53  ? -75.234 2.772   -13.872  1.00 133.69 ? 62  PHE B CZ  1 
ATOM   5990  N N   . CYS B 1 54  ? -74.378 0.214   -8.931   1.00 169.14 ? 63  CYS B N   1 
ATOM   5991  C CA  . CYS B 1 54  ? -75.605 -0.548  -8.738   1.00 172.40 ? 63  CYS B CA  1 
ATOM   5992  C C   . CYS B 1 54  ? -76.262 -0.195  -7.409   1.00 174.55 ? 63  CYS B C   1 
ATOM   5993  O O   . CYS B 1 54  ? -77.483 -0.272  -7.270   1.00 176.43 ? 63  CYS B O   1 
ATOM   5994  C CB  . CYS B 1 54  ? -75.321 -2.050  -8.806   1.00 175.52 ? 63  CYS B CB  1 
ATOM   5995  S SG  . CYS B 1 54  ? -74.584 -2.594  -10.364  1.00 173.96 ? 63  CYS B SG  1 
ATOM   5996  N N   . SER B 1 55  ? -75.445 0.193   -6.435   1.00 148.45 ? 64  SER B N   1 
ATOM   5997  C CA  . SER B 1 55  ? -75.947 0.599   -5.128   1.00 150.80 ? 64  SER B CA  1 
ATOM   5998  C C   . SER B 1 55  ? -76.711 1.911   -5.240   1.00 148.86 ? 64  SER B C   1 
ATOM   5999  O O   . SER B 1 55  ? -77.821 2.042   -4.724   1.00 151.16 ? 64  SER B O   1 
ATOM   6000  C CB  . SER B 1 55  ? -74.796 0.745   -4.132   1.00 151.47 ? 64  SER B CB  1 
ATOM   6001  O OG  . SER B 1 55  ? -75.264 1.190   -2.871   1.00 154.11 ? 64  SER B OG  1 
ATOM   6002  N N   . GLN B 1 56  ? -76.107 2.880   -5.921   1.00 140.32 ? 65  GLN B N   1 
ATOM   6003  C CA  . GLN B 1 56  ? -76.739 4.174   -6.136   1.00 138.55 ? 65  GLN B CA  1 
ATOM   6004  C C   . GLN B 1 56  ? -77.923 4.045   -7.089   1.00 138.61 ? 65  GLN B C   1 
ATOM   6005  O O   . GLN B 1 56  ? -78.816 4.890   -7.103   1.00 138.67 ? 65  GLN B O   1 
ATOM   6006  C CB  . GLN B 1 56  ? -75.727 5.182   -6.682   1.00 134.70 ? 65  GLN B CB  1 
ATOM   6007  N N   . PHE B 1 57  ? -77.928 2.979   -7.882   1.00 143.27 ? 66  PHE B N   1 
ATOM   6008  C CA  . PHE B 1 57  ? -79.009 2.737   -8.829   1.00 143.77 ? 66  PHE B CA  1 
ATOM   6009  C C   . PHE B 1 57  ? -80.219 2.113   -8.141   1.00 147.74 ? 66  PHE B C   1 
ATOM   6010  O O   . PHE B 1 57  ? -81.362 2.420   -8.477   1.00 148.57 ? 66  PHE B O   1 
ATOM   6011  C CB  . PHE B 1 57  ? -78.530 1.843   -9.973   1.00 143.05 ? 66  PHE B CB  1 
ATOM   6012  C CG  . PHE B 1 57  ? -79.591 1.541   -10.991  1.00 143.96 ? 66  PHE B CG  1 
ATOM   6013  C CD1 . PHE B 1 57  ? -80.052 2.529   -11.844  1.00 142.10 ? 66  PHE B CD1 1 
ATOM   6014  C CD2 . PHE B 1 57  ? -80.122 0.267   -11.099  1.00 147.06 ? 66  PHE B CD2 1 
ATOM   6015  C CE1 . PHE B 1 57  ? -81.028 2.252   -12.784  1.00 143.35 ? 66  PHE B CE1 1 
ATOM   6016  C CE2 . PHE B 1 57  ? -81.096 -0.016  -12.037  1.00 148.21 ? 66  PHE B CE2 1 
ATOM   6017  C CZ  . PHE B 1 57  ? -81.550 0.978   -12.880  1.00 146.36 ? 66  PHE B CZ  1 
ATOM   6018  N N   . SER B 1 58  ? -79.961 1.233   -7.178   1.00 145.77 ? 67  SER B N   1 
ATOM   6019  C CA  . SER B 1 58  ? -81.031 0.609   -6.410   1.00 150.03 ? 67  SER B CA  1 
ATOM   6020  C C   . SER B 1 58  ? -81.672 1.628   -5.476   1.00 151.02 ? 67  SER B C   1 
ATOM   6021  O O   . SER B 1 58  ? -82.868 1.557   -5.191   1.00 153.79 ? 67  SER B O   1 
ATOM   6022  C CB  . SER B 1 58  ? -80.500 -0.582  -5.611   1.00 153.19 ? 67  SER B CB  1 
ATOM   6023  O OG  . SER B 1 58  ? -80.047 -1.614  -6.471   1.00 153.09 ? 67  SER B OG  1 
ATOM   6024  N N   . ARG B 1 59  ? -80.868 2.576   -5.005   1.00 150.43 ? 68  ARG B N   1 
ATOM   6025  C CA  . ARG B 1 59  ? -81.366 3.655   -4.161   1.00 151.38 ? 68  ARG B CA  1 
ATOM   6026  C C   . ARG B 1 59  ? -82.237 4.604   -4.978   1.00 149.77 ? 68  ARG B C   1 
ATOM   6027  O O   . ARG B 1 59  ? -82.837 5.534   -4.438   1.00 150.85 ? 68  ARG B O   1 
ATOM   6028  C CB  . ARG B 1 59  ? -80.204 4.418   -3.524   1.00 149.80 ? 68  ARG B CB  1 
ATOM   6029  N N   . GLY B 1 60  ? -82.296 4.363   -6.284   1.00 163.58 ? 69  GLY B N   1 
ATOM   6030  C CA  . GLY B 1 60  ? -83.131 5.147   -7.175   1.00 162.53 ? 69  GLY B CA  1 
ATOM   6031  C C   . GLY B 1 60  ? -82.688 6.589   -7.323   1.00 159.79 ? 69  GLY B C   1 
ATOM   6032  O O   . GLY B 1 60  ? -83.357 7.503   -6.842   1.00 161.05 ? 69  GLY B O   1 
ATOM   6033  N N   . VAL B 1 61  ? -81.558 6.798   -7.990   1.00 138.91 ? 70  VAL B N   1 
ATOM   6034  C CA  . VAL B 1 61  ? -81.071 8.147   -8.254   1.00 136.33 ? 70  VAL B CA  1 
ATOM   6035  C C   . VAL B 1 61  ? -81.459 8.593   -9.659   1.00 134.74 ? 70  VAL B C   1 
ATOM   6036  O O   . VAL B 1 61  ? -81.757 7.767   -10.523  1.00 134.96 ? 70  VAL B O   1 
ATOM   6037  C CB  . VAL B 1 61  ? -79.542 8.247   -8.097   1.00 133.78 ? 70  VAL B CB  1 
ATOM   6038  C CG1 . VAL B 1 61  ? -79.136 7.974   -6.658   1.00 135.77 ? 70  VAL B CG1 1 
ATOM   6039  C CG2 . VAL B 1 61  ? -78.845 7.289   -9.052   1.00 132.15 ? 70  VAL B CG2 1 
ATOM   6040  N N   . TYR B 1 62  ? -81.454 9.903   -9.881   1.00 181.85 ? 71  TYR B N   1 
ATOM   6041  C CA  . TYR B 1 62  ? -81.817 10.461  -11.178  1.00 180.83 ? 71  TYR B CA  1 
ATOM   6042  C C   . TYR B 1 62  ? -80.576 10.740  -12.020  1.00 177.52 ? 71  TYR B C   1 
ATOM   6043  O O   . TYR B 1 62  ? -80.642 10.784  -13.248  1.00 176.72 ? 71  TYR B O   1 
ATOM   6044  C CB  . TYR B 1 62  ? -82.637 11.740  -10.997  1.00 182.18 ? 71  TYR B CB  1 
ATOM   6045  C CG  . TYR B 1 62  ? -83.904 11.542  -10.194  1.00 185.81 ? 71  TYR B CG  1 
ATOM   6046  C CD1 . TYR B 1 62  ? -85.108 11.246  -10.821  1.00 187.93 ? 71  TYR B CD1 1 
ATOM   6047  C CD2 . TYR B 1 62  ? -83.895 11.647  -8.810   1.00 187.50 ? 71  TYR B CD2 1 
ATOM   6048  C CE1 . TYR B 1 62  ? -86.268 11.062  -10.091  1.00 191.49 ? 71  TYR B CE1 1 
ATOM   6049  C CE2 . TYR B 1 62  ? -85.050 11.465  -8.072   1.00 191.19 ? 71  TYR B CE2 1 
ATOM   6050  C CZ  . TYR B 1 62  ? -86.233 11.173  -8.717   1.00 193.10 ? 71  TYR B CZ  1 
ATOM   6051  O OH  . TYR B 1 62  ? -87.385 10.991  -7.987   1.00 196.99 ? 71  TYR B OH  1 
ATOM   6052  N N   . ALA B 1 63  ? -79.446 10.926  -11.347  1.00 148.37 ? 72  ALA B N   1 
ATOM   6053  C CA  . ALA B 1 63  ? -78.180 11.184  -12.022  1.00 145.42 ? 72  ALA B CA  1 
ATOM   6054  C C   . ALA B 1 63  ? -77.010 10.865  -11.099  1.00 144.55 ? 72  ALA B C   1 
ATOM   6055  O O   . ALA B 1 63  ? -77.158 10.850  -9.878   1.00 146.17 ? 72  ALA B O   1 
ATOM   6056  C CB  . ALA B 1 63  ? -78.112 12.628  -12.490  1.00 144.36 ? 72  ALA B CB  1 
ATOM   6057  N N   . ILE B 1 64  ? -75.846 10.611  -11.688  1.00 122.26 ? 73  ILE B N   1 
ATOM   6058  C CA  . ILE B 1 64  ? -74.664 10.256  -10.913  1.00 121.62 ? 73  ILE B CA  1 
ATOM   6059  C C   . ILE B 1 64  ? -73.470 11.132  -11.268  1.00 119.07 ? 73  ILE B C   1 
ATOM   6060  O O   . ILE B 1 64  ? -73.118 11.273  -12.438  1.00 117.47 ? 73  ILE B O   1 
ATOM   6061  C CB  . ILE B 1 64  ? -74.268 8.783   -11.131  1.00 122.11 ? 73  ILE B CB  1 
ATOM   6062  C CG1 . ILE B 1 64  ? -75.446 7.857   -10.825  1.00 124.91 ? 73  ILE B CG1 1 
ATOM   6063  C CG2 . ILE B 1 64  ? -73.062 8.422   -10.277  1.00 121.98 ? 73  ILE B CG2 1 
ATOM   6064  C CD1 . ILE B 1 64  ? -75.140 6.391   -11.047  1.00 125.96 ? 73  ILE B CD1 1 
ATOM   6065  N N   . PHE B 1 65  ? -72.852 11.721  -10.250  1.00 120.25 ? 74  PHE B N   1 
ATOM   6066  C CA  . PHE B 1 65  ? -71.625 12.484  -10.438  1.00 118.14 ? 74  PHE B CA  1 
ATOM   6067  C C   . PHE B 1 65  ? -70.460 11.786  -9.751   1.00 118.14 ? 74  PHE B C   1 
ATOM   6068  O O   . PHE B 1 65  ? -70.520 11.493  -8.557   1.00 120.07 ? 74  PHE B O   1 
ATOM   6069  C CB  . PHE B 1 65  ? -71.774 13.904  -9.890   1.00 118.38 ? 74  PHE B CB  1 
ATOM   6070  C CG  . PHE B 1 65  ? -70.472 14.650  -9.789   1.00 116.79 ? 74  PHE B CG  1 
ATOM   6071  C CD1 . PHE B 1 65  ? -69.992 15.382  -10.862  1.00 114.85 ? 74  PHE B CD1 1 
ATOM   6072  C CD2 . PHE B 1 65  ? -69.726 14.613  -8.622   1.00 117.60 ? 74  PHE B CD2 1 
ATOM   6073  C CE1 . PHE B 1 65  ? -68.795 16.066  -10.770  1.00 113.61 ? 74  PHE B CE1 1 
ATOM   6074  C CE2 . PHE B 1 65  ? -68.528 15.295  -8.527   1.00 116.38 ? 74  PHE B CE2 1 
ATOM   6075  C CZ  . PHE B 1 65  ? -68.063 16.023  -9.601   1.00 114.30 ? 74  PHE B CZ  1 
ATOM   6076  N N   . GLY B 1 66  ? -69.399 11.523  -10.506  1.00 136.28 ? 75  GLY B N   1 
ATOM   6077  C CA  . GLY B 1 66  ? -68.235 10.854  -9.958   1.00 136.48 ? 75  GLY B CA  1 
ATOM   6078  C C   . GLY B 1 66  ? -67.009 10.944  -10.844  1.00 134.41 ? 75  GLY B C   1 
ATOM   6079  O O   . GLY B 1 66  ? -66.911 11.815  -11.708  1.00 132.73 ? 75  GLY B O   1 
ATOM   6080  N N   . PHE B 1 67  ? -66.066 10.035  -10.621  1.00 114.09 ? 76  PHE B N   1 
ATOM   6081  C CA  . PHE B 1 67  ? -64.832 9.995   -11.392  1.00 112.61 ? 76  PHE B CA  1 
ATOM   6082  C C   . PHE B 1 67  ? -64.549 8.569   -11.844  1.00 113.68 ? 76  PHE B C   1 
ATOM   6083  O O   . PHE B 1 67  ? -65.085 7.614   -11.284  1.00 115.76 ? 76  PHE B O   1 
ATOM   6084  C CB  . PHE B 1 67  ? -63.661 10.505  -10.550  1.00 112.52 ? 76  PHE B CB  1 
ATOM   6085  C CG  . PHE B 1 67  ? -63.853 11.896  -10.016  1.00 111.97 ? 76  PHE B CG  1 
ATOM   6086  C CD1 . PHE B 1 67  ? -64.626 12.120  -8.889   1.00 113.71 ? 76  PHE B CD1 1 
ATOM   6087  C CD2 . PHE B 1 67  ? -63.252 12.978  -10.635  1.00 110.11 ? 76  PHE B CD2 1 
ATOM   6088  C CE1 . PHE B 1 67  ? -64.802 13.400  -8.394   1.00 113.66 ? 76  PHE B CE1 1 
ATOM   6089  C CE2 . PHE B 1 67  ? -63.422 14.259  -10.144  1.00 110.00 ? 76  PHE B CE2 1 
ATOM   6090  C CZ  . PHE B 1 67  ? -64.198 14.470  -9.023   1.00 111.80 ? 76  PHE B CZ  1 
ATOM   6091  N N   . TYR B 1 68  ? -63.707 8.428   -12.863  1.00 119.57 ? 77  TYR B N   1 
ATOM   6092  C CA  . TYR B 1 68  ? -63.275 7.108   -13.308  1.00 120.94 ? 77  TYR B CA  1 
ATOM   6093  C C   . TYR B 1 68  ? -61.808 7.102   -13.722  1.00 120.34 ? 77  TYR B C   1 
ATOM   6094  O O   . TYR B 1 68  ? -61.235 8.145   -14.036  1.00 118.51 ? 77  TYR B O   1 
ATOM   6095  C CB  . TYR B 1 68  ? -64.159 6.582   -14.444  1.00 121.25 ? 77  TYR B CB  1 
ATOM   6096  C CG  . TYR B 1 68  ? -64.351 7.542   -15.597  1.00 119.39 ? 77  TYR B CG  1 
ATOM   6097  C CD1 . TYR B 1 68  ? -63.296 7.875   -16.435  1.00 118.32 ? 77  TYR B CD1 1 
ATOM   6098  C CD2 . TYR B 1 68  ? -65.593 8.100   -15.859  1.00 119.13 ? 77  TYR B CD2 1 
ATOM   6099  C CE1 . TYR B 1 68  ? -63.473 8.747   -17.493  1.00 117.12 ? 77  TYR B CE1 1 
ATOM   6100  C CE2 . TYR B 1 68  ? -65.779 8.970   -16.914  1.00 117.97 ? 77  TYR B CE2 1 
ATOM   6101  C CZ  . TYR B 1 68  ? -64.716 9.291   -17.728  1.00 117.02 ? 77  TYR B CZ  1 
ATOM   6102  O OH  . TYR B 1 68  ? -64.899 10.158  -18.780  1.00 116.33 ? 77  TYR B OH  1 
ATOM   6103  N N   . ASP B 1 69  ? -61.209 5.917   -13.710  1.00 147.18 ? 78  ASP B N   1 
ATOM   6104  C CA  . ASP B 1 69  ? -59.813 5.756   -14.093  1.00 147.21 ? 78  ASP B CA  1 
ATOM   6105  C C   . ASP B 1 69  ? -59.730 5.128   -15.479  1.00 147.61 ? 78  ASP B C   1 
ATOM   6106  O O   . ASP B 1 69  ? -60.747 4.745   -16.055  1.00 148.07 ? 78  ASP B O   1 
ATOM   6107  C CB  . ASP B 1 69  ? -59.083 4.882   -13.072  1.00 149.69 ? 78  ASP B CB  1 
ATOM   6108  C CG  . ASP B 1 69  ? -57.574 4.952   -13.214  1.00 149.78 ? 78  ASP B CG  1 
ATOM   6109  O OD1 . ASP B 1 69  ? -57.077 5.917   -13.834  1.00 147.61 ? 78  ASP B OD1 1 
ATOM   6110  O OD2 . ASP B 1 69  ? -56.885 4.045   -12.701  1.00 152.33 ? 78  ASP B OD2 1 
ATOM   6111  N N   . LYS B 1 70  ? -58.517 5.023   -16.012  1.00 115.05 ? 79  LYS B N   1 
ATOM   6112  C CA  . LYS B 1 70  ? -58.310 4.416   -17.320  1.00 115.97 ? 79  LYS B CA  1 
ATOM   6113  C C   . LYS B 1 70  ? -58.762 2.959   -17.325  1.00 118.91 ? 79  LYS B C   1 
ATOM   6114  O O   . LYS B 1 70  ? -58.879 2.340   -18.381  1.00 120.22 ? 79  LYS B O   1 
ATOM   6115  C CB  . LYS B 1 70  ? -56.839 4.511   -17.729  1.00 116.16 ? 79  LYS B CB  1 
ATOM   6116  N N   . LYS B 1 71  ? -59.021 2.420   -16.138  1.00 121.88 ? 80  LYS B N   1 
ATOM   6117  C CA  . LYS B 1 71  ? -59.411 1.022   -16.000  1.00 125.12 ? 80  LYS B CA  1 
ATOM   6118  C C   . LYS B 1 71  ? -60.914 0.860   -15.784  1.00 125.34 ? 80  LYS B C   1 
ATOM   6119  O O   . LYS B 1 71  ? -61.531 -0.053  -16.332  1.00 127.35 ? 80  LYS B O   1 
ATOM   6120  C CB  . LYS B 1 71  ? -58.643 0.366   -14.849  1.00 127.53 ? 80  LYS B CB  1 
ATOM   6121  N N   . SER B 1 72  ? -61.498 1.750   -14.988  1.00 125.17 ? 81  SER B N   1 
ATOM   6122  C CA  . SER B 1 72  ? -62.909 1.645   -14.634  1.00 125.64 ? 81  SER B CA  1 
ATOM   6123  C C   . SER B 1 72  ? -63.810 2.449   -15.566  1.00 123.54 ? 81  SER B C   1 
ATOM   6124  O O   . SER B 1 72  ? -65.034 2.334   -15.506  1.00 124.11 ? 81  SER B O   1 
ATOM   6125  C CB  . SER B 1 72  ? -63.127 2.089   -13.186  1.00 125.68 ? 81  SER B CB  1 
ATOM   6126  O OG  . SER B 1 72  ? -62.715 3.432   -13.000  1.00 122.94 ? 81  SER B OG  1 
ATOM   6127  N N   . VAL B 1 73  ? -63.204 3.259   -16.428  1.00 118.88 ? 82  VAL B N   1 
ATOM   6128  C CA  . VAL B 1 73  ? -63.961 4.118   -17.334  1.00 117.23 ? 82  VAL B CA  1 
ATOM   6129  C C   . VAL B 1 73  ? -64.942 3.327   -18.196  1.00 119.02 ? 82  VAL B C   1 
ATOM   6130  O O   . VAL B 1 73  ? -66.069 3.765   -18.425  1.00 118.66 ? 82  VAL B O   1 
ATOM   6131  C CB  . VAL B 1 73  ? -63.030 4.942   -18.246  1.00 115.50 ? 82  VAL B CB  1 
ATOM   6132  C CG1 . VAL B 1 73  ? -62.052 4.030   -18.974  1.00 117.12 ? 82  VAL B CG1 1 
ATOM   6133  C CG2 . VAL B 1 73  ? -63.843 5.769   -19.233  1.00 114.48 ? 82  VAL B CG2 1 
ATOM   6134  N N   . ASN B 1 74  ? -64.512 2.162   -18.667  1.00 141.53 ? 83  ASN B N   1 
ATOM   6135  C CA  . ASN B 1 74  ? -65.356 1.327   -19.513  1.00 143.75 ? 83  ASN B CA  1 
ATOM   6136  C C   . ASN B 1 74  ? -66.589 0.806   -18.782  1.00 145.20 ? 83  ASN B C   1 
ATOM   6137  O O   . ASN B 1 74  ? -67.653 0.645   -19.379  1.00 146.17 ? 83  ASN B O   1 
ATOM   6138  C CB  . ASN B 1 74  ? -64.548 0.164   -20.090  1.00 146.38 ? 83  ASN B CB  1 
ATOM   6139  C CG  . ASN B 1 74  ? -63.548 0.616   -21.134  1.00 145.60 ? 83  ASN B CG  1 
ATOM   6140  O OD1 . ASN B 1 74  ? -63.867 1.421   -22.009  1.00 144.38 ? 83  ASN B OD1 1 
ATOM   6141  N ND2 . ASN B 1 74  ? -62.328 0.099   -21.048  1.00 146.69 ? 83  ASN B ND2 1 
ATOM   6142  N N   . THR B 1 75  ? -66.440 0.545   -17.488  1.00 125.83 ? 84  THR B N   1 
ATOM   6143  C CA  . THR B 1 75  ? -67.556 0.084   -16.670  1.00 127.48 ? 84  THR B CA  1 
ATOM   6144  C C   . THR B 1 75  ? -68.653 1.140   -16.613  1.00 125.70 ? 84  THR B C   1 
ATOM   6145  O O   . THR B 1 75  ? -69.825 0.846   -16.850  1.00 127.03 ? 84  THR B O   1 
ATOM   6146  C CB  . THR B 1 75  ? -67.105 -0.249  -15.236  1.00 128.55 ? 84  THR B CB  1 
ATOM   6147  O OG1 . THR B 1 75  ? -66.086 -1.256  -15.273  1.00 130.68 ? 84  THR B OG1 1 
ATOM   6148  C CG2 . THR B 1 75  ? -68.279 -0.751  -14.410  1.00 130.72 ? 84  THR B CG2 1 
ATOM   6149  N N   . ILE B 1 76  ? -68.263 2.371   -16.300  1.00 126.85 ? 85  ILE B N   1 
ATOM   6150  C CA  . ILE B 1 76  ? -69.206 3.479   -16.204  1.00 125.38 ? 85  ILE B CA  1 
ATOM   6151  C C   . ILE B 1 76  ? -69.918 3.737   -17.528  1.00 125.28 ? 85  ILE B C   1 
ATOM   6152  O O   . ILE B 1 76  ? -71.146 3.708   -17.597  1.00 126.35 ? 85  ILE B O   1 
ATOM   6153  C CB  . ILE B 1 76  ? -68.507 4.772   -15.750  1.00 122.80 ? 85  ILE B CB  1 
ATOM   6154  C CG1 . ILE B 1 76  ? -67.976 4.614   -14.324  1.00 123.35 ? 85  ILE B CG1 1 
ATOM   6155  C CG2 . ILE B 1 76  ? -69.462 5.950   -15.835  1.00 121.64 ? 85  ILE B CG2 1 
ATOM   6156  C CD1 . ILE B 1 76  ? -69.059 4.373   -13.295  1.00 125.16 ? 85  ILE B CD1 1 
ATOM   6157  N N   . THR B 1 77  ? -69.141 3.988   -18.577  1.00 120.86 ? 86  THR B N   1 
ATOM   6158  C CA  . THR B 1 77  ? -69.700 4.288   -19.890  1.00 121.15 ? 86  THR B CA  1 
ATOM   6159  C C   . THR B 1 77  ? -70.669 3.207   -20.358  1.00 124.00 ? 86  THR B C   1 
ATOM   6160  O O   . THR B 1 77  ? -71.648 3.494   -21.045  1.00 124.75 ? 86  THR B O   1 
ATOM   6161  C CB  . THR B 1 77  ? -68.595 4.457   -20.952  1.00 120.55 ? 86  THR B CB  1 
ATOM   6162  O OG1 . THR B 1 77  ? -67.879 3.225   -21.105  1.00 122.32 ? 86  THR B OG1 1 
ATOM   6163  C CG2 . THR B 1 77  ? -67.626 5.557   -20.542  1.00 117.92 ? 86  THR B CG2 1 
ATOM   6164  N N   . SER B 1 78  ? -70.391 1.963   -19.980  1.00 126.15 ? 87  SER B N   1 
ATOM   6165  C CA  . SER B 1 78  ? -71.205 0.835   -20.415  1.00 129.28 ? 87  SER B CA  1 
ATOM   6166  C C   . SER B 1 78  ? -72.529 0.764   -19.660  1.00 130.28 ? 87  SER B C   1 
ATOM   6167  O O   . SER B 1 78  ? -73.599 0.741   -20.268  1.00 131.63 ? 87  SER B O   1 
ATOM   6168  C CB  . SER B 1 78  ? -70.433 -0.475  -20.252  1.00 131.47 ? 87  SER B CB  1 
ATOM   6169  O OG  . SER B 1 78  ? -71.139 -1.556  -20.833  1.00 134.81 ? 87  SER B OG  1 
ATOM   6170  N N   . PHE B 1 79  ? -72.451 0.727   -18.334  1.00 129.15 ? 88  PHE B N   1 
ATOM   6171  C CA  . PHE B 1 79  ? -73.644 0.650   -17.498  1.00 130.42 ? 88  PHE B CA  1 
ATOM   6172  C C   . PHE B 1 79  ? -74.562 1.851   -17.702  1.00 129.05 ? 88  PHE B C   1 
ATOM   6173  O O   . PHE B 1 79  ? -75.770 1.696   -17.876  1.00 130.79 ? 88  PHE B O   1 
ATOM   6174  C CB  . PHE B 1 79  ? -73.262 0.524   -16.021  1.00 130.52 ? 88  PHE B CB  1 
ATOM   6175  C CG  . PHE B 1 79  ? -72.975 -0.884  -15.586  1.00 133.50 ? 88  PHE B CG  1 
ATOM   6176  C CD1 . PHE B 1 79  ? -73.927 -1.616  -14.896  1.00 136.39 ? 88  PHE B CD1 1 
ATOM   6177  C CD2 . PHE B 1 79  ? -71.756 -1.477  -15.868  1.00 133.78 ? 88  PHE B CD2 1 
ATOM   6178  C CE1 . PHE B 1 79  ? -73.667 -2.913  -14.494  1.00 139.58 ? 88  PHE B CE1 1 
ATOM   6179  C CE2 . PHE B 1 79  ? -71.491 -2.773  -15.468  1.00 137.00 ? 88  PHE B CE2 1 
ATOM   6180  C CZ  . PHE B 1 79  ? -72.448 -3.492  -14.781  1.00 139.94 ? 88  PHE B CZ  1 
ATOM   6181  N N   . CYS B 1 80  ? -73.983 3.047   -17.679  1.00 126.12 ? 89  CYS B N   1 
ATOM   6182  C CA  . CYS B 1 80  ? -74.752 4.274   -17.854  1.00 125.06 ? 89  CYS B CA  1 
ATOM   6183  C C   . CYS B 1 80  ? -75.453 4.307   -19.208  1.00 126.16 ? 89  CYS B C   1 
ATOM   6184  O O   . CYS B 1 80  ? -76.497 4.940   -19.361  1.00 126.72 ? 89  CYS B O   1 
ATOM   6185  C CB  . CYS B 1 80  ? -73.851 5.499   -17.697  1.00 122.19 ? 89  CYS B CB  1 
ATOM   6186  S SG  . CYS B 1 80  ? -73.188 5.716   -16.031  1.00 121.28 ? 89  CYS B SG  1 
ATOM   6187  N N   . GLY B 1 81  ? -74.873 3.621   -20.188  1.00 130.38 ? 90  GLY B N   1 
ATOM   6188  C CA  . GLY B 1 81  ? -75.455 3.553   -21.516  1.00 132.01 ? 90  GLY B CA  1 
ATOM   6189  C C   . GLY B 1 81  ? -76.572 2.534   -21.603  1.00 135.20 ? 90  GLY B C   1 
ATOM   6190  O O   . GLY B 1 81  ? -77.546 2.721   -22.324  1.00 136.84 ? 90  GLY B O   1 
ATOM   6191  N N   . THR B 1 82  ? -76.429 1.447   -20.855  1.00 132.29 ? 91  THR B N   1 
ATOM   6192  C CA  . THR B 1 82  ? -77.423 0.383   -20.846  1.00 135.63 ? 91  THR B CA  1 
ATOM   6193  C C   . THR B 1 82  ? -78.622 0.744   -19.976  1.00 136.19 ? 91  THR B C   1 
ATOM   6194  O O   . THR B 1 82  ? -79.771 0.535   -20.368  1.00 138.52 ? 91  THR B O   1 
ATOM   6195  C CB  . THR B 1 82  ? -76.825 -0.945  -20.339  1.00 137.31 ? 91  THR B CB  1 
ATOM   6196  O OG1 . THR B 1 82  ? -75.790 -1.385  -21.228  1.00 137.51 ? 91  THR B OG1 1 
ATOM   6197  C CG2 . THR B 1 82  ? -77.902 -2.020  -20.258  1.00 141.06 ? 91  THR B CG2 1 
ATOM   6198  N N   . LEU B 1 83  ? -78.347 1.298   -18.800  1.00 135.83 ? 92  LEU B N   1 
ATOM   6199  C CA  . LEU B 1 83  ? -79.399 1.645   -17.852  1.00 136.64 ? 92  LEU B CA  1 
ATOM   6200  C C   . LEU B 1 83  ? -79.901 3.072   -18.056  1.00 135.13 ? 92  LEU B C   1 
ATOM   6201  O O   . LEU B 1 83  ? -80.698 3.577   -17.264  1.00 135.66 ? 92  LEU B O   1 
ATOM   6202  C CB  . LEU B 1 83  ? -78.907 1.458   -16.414  1.00 136.28 ? 92  LEU B CB  1 
ATOM   6203  C CG  . LEU B 1 83  ? -78.369 0.068   -16.070  1.00 138.21 ? 92  LEU B CG  1 
ATOM   6204  C CD1 . LEU B 1 83  ? -77.957 -0.002  -14.609  1.00 138.32 ? 92  LEU B CD1 1 
ATOM   6205  C CD2 . LEU B 1 83  ? -79.402 -1.002  -16.389  1.00 141.84 ? 92  LEU B CD2 1 
ATOM   6206  N N   . HIS B 1 84  ? -79.427 3.718   -19.116  1.00 137.11 ? 93  HIS B N   1 
ATOM   6207  C CA  . HIS B 1 84  ? -79.859 5.075   -19.447  1.00 136.13 ? 93  HIS B CA  1 
ATOM   6208  C C   . HIS B 1 84  ? -79.666 6.046   -18.285  1.00 134.31 ? 93  HIS B C   1 
ATOM   6209  O O   . HIS B 1 84  ? -80.412 7.013   -18.141  1.00 134.59 ? 93  HIS B O   1 
ATOM   6210  C CB  . HIS B 1 84  ? -81.320 5.074   -19.904  1.00 138.92 ? 93  HIS B CB  1 
ATOM   6211  C CG  . HIS B 1 84  ? -81.513 4.602   -21.311  1.00 140.71 ? 93  HIS B CG  1 
ATOM   6212  N ND1 . HIS B 1 84  ? -80.976 3.422   -21.782  1.00 141.66 ? 93  HIS B ND1 1 
ATOM   6213  C CD2 . HIS B 1 84  ? -82.189 5.145   -22.350  1.00 142.19 ? 93  HIS B CD2 1 
ATOM   6214  C CE1 . HIS B 1 84  ? -81.308 3.263   -23.049  1.00 143.63 ? 93  HIS B CE1 1 
ATOM   6215  N NE2 . HIS B 1 84  ? -82.045 4.295   -23.419  1.00 144.00 ? 93  HIS B NE2 1 
ATOM   6216  N N   . VAL B 1 85  ? -78.660 5.779   -17.459  1.00 127.83 ? 94  VAL B N   1 
ATOM   6217  C CA  . VAL B 1 85  ? -78.340 6.651   -16.336  1.00 126.37 ? 94  VAL B CA  1 
ATOM   6218  C C   . VAL B 1 85  ? -77.313 7.700   -16.747  1.00 123.63 ? 94  VAL B C   1 
ATOM   6219  O O   . VAL B 1 85  ? -76.312 7.382   -17.390  1.00 122.44 ? 94  VAL B O   1 
ATOM   6220  C CB  . VAL B 1 85  ? -77.794 5.851   -15.141  1.00 126.74 ? 94  VAL B CB  1 
ATOM   6221  C CG1 . VAL B 1 85  ? -77.415 6.787   -14.005  1.00 125.59 ? 94  VAL B CG1 1 
ATOM   6222  C CG2 . VAL B 1 85  ? -78.815 4.825   -14.681  1.00 129.83 ? 94  VAL B CG2 1 
ATOM   6223  N N   . SER B 1 86  ? -77.566 8.952   -16.379  1.00 123.82 ? 95  SER B N   1 
ATOM   6224  C CA  . SER B 1 86  ? -76.658 10.045  -16.711  1.00 121.56 ? 95  SER B CA  1 
ATOM   6225  C C   . SER B 1 86  ? -75.487 10.102  -15.734  1.00 119.90 ? 95  SER B C   1 
ATOM   6226  O O   . SER B 1 86  ? -75.672 9.988   -14.522  1.00 120.67 ? 95  SER B O   1 
ATOM   6227  C CB  . SER B 1 86  ? -77.405 11.380  -16.719  1.00 122.02 ? 95  SER B CB  1 
ATOM   6228  O OG  . SER B 1 86  ? -78.453 11.369  -17.673  1.00 123.85 ? 95  SER B OG  1 
ATOM   6229  N N   . PHE B 1 87  ? -74.282 10.279  -16.268  1.00 118.06 ? 96  PHE B N   1 
ATOM   6230  C CA  . PHE B 1 87  ? -73.075 10.313  -15.448  1.00 116.65 ? 96  PHE B CA  1 
ATOM   6231  C C   . PHE B 1 87  ? -72.240 11.556  -15.739  1.00 114.72 ? 96  PHE B C   1 
ATOM   6232  O O   . PHE B 1 87  ? -71.648 11.680  -16.809  1.00 113.78 ? 96  PHE B O   1 
ATOM   6233  C CB  . PHE B 1 87  ? -72.236 9.057   -15.683  1.00 116.64 ? 96  PHE B CB  1 
ATOM   6234  C CG  . PHE B 1 87  ? -71.072 8.916   -14.742  1.00 115.87 ? 96  PHE B CG  1 
ATOM   6235  C CD1 . PHE B 1 87  ? -71.229 8.297   -13.513  1.00 117.36 ? 96  PHE B CD1 1 
ATOM   6236  C CD2 . PHE B 1 87  ? -69.817 9.393   -15.089  1.00 114.03 ? 96  PHE B CD2 1 
ATOM   6237  C CE1 . PHE B 1 87  ? -70.160 8.160   -12.645  1.00 117.14 ? 96  PHE B CE1 1 
ATOM   6238  C CE2 . PHE B 1 87  ? -68.744 9.259   -14.225  1.00 113.64 ? 96  PHE B CE2 1 
ATOM   6239  C CZ  . PHE B 1 87  ? -68.916 8.643   -13.002  1.00 115.24 ? 96  PHE B CZ  1 
ATOM   6240  N N   . ILE B 1 88  ? -72.199 12.474  -14.779  1.00 115.00 ? 97  ILE B N   1 
ATOM   6241  C CA  . ILE B 1 88  ? -71.404 13.689  -14.908  1.00 113.50 ? 97  ILE B CA  1 
ATOM   6242  C C   . ILE B 1 88  ? -70.051 13.504  -14.231  1.00 112.35 ? 97  ILE B C   1 
ATOM   6243  O O   . ILE B 1 88  ? -69.981 13.088  -13.075  1.00 113.15 ? 97  ILE B O   1 
ATOM   6244  C CB  . ILE B 1 88  ? -72.115 14.906  -14.285  1.00 114.37 ? 97  ILE B CB  1 
ATOM   6245  C CG1 . ILE B 1 88  ? -73.473 15.140  -14.951  1.00 115.91 ? 97  ILE B CG1 1 
ATOM   6246  C CG2 . ILE B 1 88  ? -71.243 16.148  -14.395  1.00 113.14 ? 97  ILE B CG2 1 
ATOM   6247  C CD1 . ILE B 1 88  ? -74.588 14.273  -14.402  1.00 117.84 ? 97  ILE B CD1 1 
ATOM   6248  N N   . THR B 1 89  ? -68.978 13.815  -14.951  1.00 111.68 ? 98  THR B N   1 
ATOM   6249  C CA  . THR B 1 89  ? -67.631 13.611  -14.428  1.00 110.75 ? 98  THR B CA  1 
ATOM   6250  C C   . THR B 1 89  ? -66.644 14.661  -14.925  1.00 109.30 ? 98  THR B C   1 
ATOM   6251  O O   . THR B 1 89  ? -66.671 15.045  -16.094  1.00 108.86 ? 98  THR B O   1 
ATOM   6252  C CB  . THR B 1 89  ? -67.092 12.217  -14.794  1.00 110.92 ? 98  THR B CB  1 
ATOM   6253  O OG1 . THR B 1 89  ? -65.775 12.055  -14.255  1.00 110.36 ? 98  THR B OG1 1 
ATOM   6254  C CG2 . THR B 1 89  ? -67.044 12.044  -16.303  1.00 110.53 ? 98  THR B CG2 1 
ATOM   6255  N N   . PRO B 1 90  ? -65.771 15.133  -14.024  1.00 117.03 ? 99  PRO B N   1 
ATOM   6256  C CA  . PRO B 1 90  ? -64.695 16.073  -14.350  1.00 115.87 ? 99  PRO B CA  1 
ATOM   6257  C C   . PRO B 1 90  ? -63.481 15.351  -14.921  1.00 115.06 ? 99  PRO B C   1 
ATOM   6258  O O   . PRO B 1 90  ? -62.568 15.998  -15.433  1.00 114.20 ? 99  PRO B O   1 
ATOM   6259  C CB  . PRO B 1 90  ? -64.335 16.685  -12.988  1.00 116.38 ? 99  PRO B CB  1 
ATOM   6260  C CG  . PRO B 1 90  ? -65.421 16.240  -12.039  1.00 117.96 ? 99  PRO B CG  1 
ATOM   6261  C CD  . PRO B 1 90  ? -65.890 14.932  -12.574  1.00 118.17 ? 99  PRO B CD  1 
ATOM   6262  N N   . SER B 1 91  ? -63.474 14.024  -14.830  1.00 129.71 ? 100 SER B N   1 
ATOM   6263  C CA  . SER B 1 91  ? -62.347 13.224  -15.302  1.00 129.49 ? 100 SER B CA  1 
ATOM   6264  C C   . SER B 1 91  ? -62.085 13.415  -16.793  1.00 128.90 ? 100 SER B C   1 
ATOM   6265  O O   . SER B 1 91  ? -62.825 14.118  -17.481  1.00 128.78 ? 100 SER B O   1 
ATOM   6266  C CB  . SER B 1 91  ? -62.573 11.742  -14.996  1.00 130.82 ? 100 SER B CB  1 
ATOM   6267  O OG  . SER B 1 91  ? -62.552 11.497  -13.601  1.00 131.81 ? 100 SER B OG  1 
ATOM   6268  N N   . PHE B 1 92  ? -61.027 12.779  -17.284  1.00 127.25 ? 101 PHE B N   1 
ATOM   6269  C CA  . PHE B 1 92  ? -60.644 12.890  -18.687  1.00 127.18 ? 101 PHE B CA  1 
ATOM   6270  C C   . PHE B 1 92  ? -61.777 12.462  -19.613  1.00 128.09 ? 101 PHE B C   1 
ATOM   6271  O O   . PHE B 1 92  ? -62.516 11.527  -19.306  1.00 129.00 ? 101 PHE B O   1 
ATOM   6272  C CB  . PHE B 1 92  ? -59.392 12.056  -18.972  1.00 127.68 ? 101 PHE B CB  1 
ATOM   6273  C CG  . PHE B 1 92  ? -59.584 10.581  -18.763  1.00 129.10 ? 101 PHE B CG  1 
ATOM   6274  C CD1 . PHE B 1 92  ? -60.015 9.771   -19.800  1.00 130.34 ? 101 PHE B CD1 1 
ATOM   6275  C CD2 . PHE B 1 92  ? -59.328 10.003  -17.530  1.00 129.65 ? 101 PHE B CD2 1 
ATOM   6276  C CE1 . PHE B 1 92  ? -60.190 8.413   -19.610  1.00 132.01 ? 101 PHE B CE1 1 
ATOM   6277  C CE2 . PHE B 1 92  ? -59.500 8.646   -17.335  1.00 131.39 ? 101 PHE B CE2 1 
ATOM   6278  C CZ  . PHE B 1 92  ? -59.932 7.850   -18.376  1.00 132.53 ? 101 PHE B CZ  1 
ATOM   6279  N N   . PRO B 1 93  ? -61.915 13.152  -20.755  1.00 107.56 ? 102 PRO B N   1 
ATOM   6280  C CA  . PRO B 1 93  ? -62.947 12.846  -21.751  1.00 108.84 ? 102 PRO B CA  1 
ATOM   6281  C C   . PRO B 1 93  ? -62.815 11.423  -22.283  1.00 110.25 ? 102 PRO B C   1 
ATOM   6282  O O   . PRO B 1 93  ? -61.701 10.914  -22.414  1.00 110.41 ? 102 PRO B O   1 
ATOM   6283  C CB  . PRO B 1 93  ? -62.659 13.850  -22.872  1.00 109.08 ? 102 PRO B CB  1 
ATOM   6284  C CG  . PRO B 1 93  ? -61.917 14.962  -22.210  1.00 107.66 ? 102 PRO B CG  1 
ATOM   6285  C CD  . PRO B 1 93  ? -61.092 14.309  -21.148  1.00 106.84 ? 102 PRO B CD  1 
ATOM   6286  N N   . THR B 1 94  ? -63.945 10.791  -22.585  1.00 114.39 ? 103 THR B N   1 
ATOM   6287  C CA  . THR B 1 94  ? -63.941 9.434   -23.118  1.00 116.21 ? 103 THR B CA  1 
ATOM   6288  C C   . THR B 1 94  ? -63.451 9.416   -24.562  1.00 117.58 ? 103 THR B C   1 
ATOM   6289  O O   . THR B 1 94  ? -63.774 10.307  -25.349  1.00 117.83 ? 103 THR B O   1 
ATOM   6290  C CB  . THR B 1 94  ? -65.343 8.793   -23.055  1.00 117.58 ? 103 THR B CB  1 
ATOM   6291  O OG1 . THR B 1 94  ? -66.251 9.534   -23.880  1.00 118.21 ? 103 THR B OG1 1 
ATOM   6292  C CG2 . THR B 1 94  ? -65.860 8.774   -21.624  1.00 116.72 ? 103 THR B CG2 1 
ATOM   6293  N N   . ASP B 1 95  ? -62.671 8.396   -24.904  1.00 183.48 ? 104 ASP B N   1 
ATOM   6294  C CA  . ASP B 1 95  ? -62.145 8.257   -26.256  1.00 185.34 ? 104 ASP B CA  1 
ATOM   6295  C C   . ASP B 1 95  ? -63.198 7.683   -27.196  1.00 187.91 ? 104 ASP B C   1 
ATOM   6296  O O   . ASP B 1 95  ? -63.129 6.516   -27.582  1.00 190.16 ? 104 ASP B O   1 
ATOM   6297  C CB  . ASP B 1 95  ? -60.897 7.371   -26.258  1.00 186.26 ? 104 ASP B CB  1 
ATOM   6298  C CG  . ASP B 1 95  ? -59.773 7.946   -25.418  1.00 184.16 ? 104 ASP B CG  1 
ATOM   6299  O OD1 . ASP B 1 95  ? -59.903 9.099   -24.956  1.00 182.06 ? 104 ASP B OD1 1 
ATOM   6300  O OD2 . ASP B 1 95  ? -58.758 7.245   -25.222  1.00 184.91 ? 104 ASP B OD2 1 
ATOM   6301  N N   . GLY B 1 96  ? -64.174 8.509   -27.559  1.00 162.63 ? 105 GLY B N   1 
ATOM   6302  C CA  . GLY B 1 96  ? -65.242 8.084   -28.444  1.00 165.29 ? 105 GLY B CA  1 
ATOM   6303  C C   . GLY B 1 96  ? -66.537 8.830   -28.191  1.00 164.81 ? 105 GLY B C   1 
ATOM   6304  O O   . GLY B 1 96  ? -66.532 9.945   -27.670  1.00 162.78 ? 105 GLY B O   1 
ATOM   6305  N N   . THR B 1 97  ? -67.653 8.209   -28.561  1.00 123.67 ? 106 THR B N   1 
ATOM   6306  C CA  . THR B 1 97  ? -68.964 8.823   -28.389  1.00 123.83 ? 106 THR B CA  1 
ATOM   6307  C C   . THR B 1 97  ? -69.862 7.968   -27.499  1.00 123.93 ? 106 THR B C   1 
ATOM   6308  O O   . THR B 1 97  ? -70.709 7.221   -27.988  1.00 126.48 ? 106 THR B O   1 
ATOM   6309  C CB  . THR B 1 97  ? -69.658 9.055   -29.745  1.00 127.02 ? 106 THR B CB  1 
ATOM   6310  O OG1 . THR B 1 97  ? -69.903 7.795   -30.382  1.00 129.91 ? 106 THR B OG1 1 
ATOM   6311  C CG2 . THR B 1 97  ? -68.786 9.912   -30.651  1.00 127.45 ? 106 THR B CG2 1 
ATOM   6312  N N   . HIS B 1 98  ? -69.672 8.083   -26.189  1.00 166.55 ? 107 HIS B N   1 
ATOM   6313  C CA  . HIS B 1 98  ? -70.458 7.313   -25.232  1.00 166.80 ? 107 HIS B CA  1 
ATOM   6314  C C   . HIS B 1 98  ? -71.617 8.133   -24.672  1.00 166.39 ? 107 HIS B C   1 
ATOM   6315  O O   . HIS B 1 98  ? -71.402 9.112   -23.958  1.00 164.35 ? 107 HIS B O   1 
ATOM   6316  C CB  . HIS B 1 98  ? -69.572 6.806   -24.093  1.00 165.16 ? 107 HIS B CB  1 
ATOM   6317  C CG  . HIS B 1 98  ? -68.421 5.966   -24.553  1.00 165.88 ? 107 HIS B CG  1 
ATOM   6318  N ND1 . HIS B 1 98  ? -67.181 6.496   -24.835  1.00 164.60 ? 107 HIS B ND1 1 
ATOM   6319  C CD2 . HIS B 1 98  ? -68.324 4.635   -24.781  1.00 168.10 ? 107 HIS B CD2 1 
ATOM   6320  C CE1 . HIS B 1 98  ? -66.367 5.525   -25.216  1.00 166.00 ? 107 HIS B CE1 1 
ATOM   6321  N NE2 . HIS B 1 98  ? -67.036 4.389   -25.193  1.00 168.18 ? 107 HIS B NE2 1 
ATOM   6322  N N   . PRO B 1 99  ? -72.854 7.730   -25.001  1.00 127.45 ? 108 PRO B N   1 
ATOM   6323  C CA  . PRO B 1 99  ? -74.071 8.417   -24.556  1.00 127.75 ? 108 PRO B CA  1 
ATOM   6324  C C   . PRO B 1 99  ? -74.251 8.358   -23.043  1.00 126.32 ? 108 PRO B C   1 
ATOM   6325  O O   . PRO B 1 99  ? -73.633 7.524   -22.379  1.00 125.72 ? 108 PRO B O   1 
ATOM   6326  C CB  . PRO B 1 99  ? -75.191 7.626   -25.243  1.00 130.94 ? 108 PRO B CB  1 
ATOM   6327  C CG  . PRO B 1 99  ? -74.530 6.927   -26.384  1.00 132.45 ? 108 PRO B CG  1 
ATOM   6328  C CD  . PRO B 1 99  ? -73.156 6.602   -25.896  1.00 130.32 ? 108 PRO B CD  1 
ATOM   6329  N N   . PHE B 1 100 ? -75.094 9.239   -22.513  1.00 133.05 ? 109 PHE B N   1 
ATOM   6330  C CA  . PHE B 1 100 ? -75.385 9.279   -21.082  1.00 132.28 ? 109 PHE B CA  1 
ATOM   6331  C C   . PHE B 1 100 ? -74.145 9.559   -20.238  1.00 129.82 ? 109 PHE B C   1 
ATOM   6332  O O   . PHE B 1 100 ? -74.019 9.063   -19.119  1.00 129.58 ? 109 PHE B O   1 
ATOM   6333  C CB  . PHE B 1 100 ? -76.059 7.981   -20.629  1.00 134.09 ? 109 PHE B CB  1 
ATOM   6334  C CG  . PHE B 1 100 ? -77.458 7.816   -21.146  1.00 136.71 ? 109 PHE B CG  1 
ATOM   6335  C CD1 . PHE B 1 100 ? -78.526 8.406   -20.491  1.00 137.54 ? 109 PHE B CD1 1 
ATOM   6336  C CD2 . PHE B 1 100 ? -77.706 7.074   -22.289  1.00 138.73 ? 109 PHE B CD2 1 
ATOM   6337  C CE1 . PHE B 1 100 ? -79.814 8.258   -20.964  1.00 140.22 ? 109 PHE B CE1 1 
ATOM   6338  C CE2 . PHE B 1 100 ? -78.992 6.922   -22.767  1.00 141.45 ? 109 PHE B CE2 1 
ATOM   6339  C CZ  . PHE B 1 100 ? -80.048 7.515   -22.103  1.00 142.15 ? 109 PHE B CZ  1 
ATOM   6340  N N   . VAL B 1 101 ? -73.234 10.359  -20.782  1.00 121.68 ? 110 VAL B N   1 
ATOM   6341  C CA  . VAL B 1 101 ? -72.036 10.759  -20.055  1.00 119.51 ? 110 VAL B CA  1 
ATOM   6342  C C   . VAL B 1 101 ? -71.737 12.234  -20.291  1.00 118.42 ? 110 VAL B C   1 
ATOM   6343  O O   . VAL B 1 101 ? -71.548 12.664  -21.428  1.00 118.73 ? 110 VAL B O   1 
ATOM   6344  C CB  . VAL B 1 101 ? -70.810 9.924   -20.471  1.00 118.96 ? 110 VAL B CB  1 
ATOM   6345  C CG1 . VAL B 1 101 ? -69.565 10.420  -19.752  1.00 116.95 ? 110 VAL B CG1 1 
ATOM   6346  C CG2 . VAL B 1 101 ? -71.045 8.449   -20.184  1.00 120.43 ? 110 VAL B CG2 1 
ATOM   6347  N N   . ILE B 1 102 ? -71.700 13.005  -19.209  1.00 113.71 ? 111 ILE B N   1 
ATOM   6348  C CA  . ILE B 1 102 ? -71.396 14.428  -19.289  1.00 112.97 ? 111 ILE B CA  1 
ATOM   6349  C C   . ILE B 1 102 ? -69.985 14.701  -18.777  1.00 111.07 ? 111 ILE B C   1 
ATOM   6350  O O   . ILE B 1 102 ? -69.674 14.437  -17.616  1.00 110.57 ? 111 ILE B O   1 
ATOM   6351  C CB  . ILE B 1 102 ? -72.405 15.264  -18.485  1.00 113.92 ? 111 ILE B CB  1 
ATOM   6352  C CG1 . ILE B 1 102 ? -73.834 14.933  -18.922  1.00 116.08 ? 111 ILE B CG1 1 
ATOM   6353  C CG2 . ILE B 1 102 ? -72.123 16.747  -18.654  1.00 113.67 ? 111 ILE B CG2 1 
ATOM   6354  C CD1 . ILE B 1 102 ? -74.084 15.143  -20.400  1.00 117.15 ? 111 ILE B CD1 1 
ATOM   6355  N N   . GLN B 1 103 ? -69.135 15.233  -19.649  1.00 130.12 ? 112 GLN B N   1 
ATOM   6356  C CA  . GLN B 1 103 ? -67.729 15.439  -19.322  1.00 128.54 ? 112 GLN B CA  1 
ATOM   6357  C C   . GLN B 1 103 ? -67.398 16.913  -19.108  1.00 128.06 ? 112 GLN B C   1 
ATOM   6358  O O   . GLN B 1 103 ? -67.553 17.733  -20.012  1.00 128.68 ? 112 GLN B O   1 
ATOM   6359  C CB  . GLN B 1 103 ? -66.847 14.847  -20.422  1.00 128.37 ? 112 GLN B CB  1 
ATOM   6360  C CG  . GLN B 1 103 ? -67.110 13.371  -20.675  1.00 129.26 ? 112 GLN B CG  1 
ATOM   6361  C CD  . GLN B 1 103 ? -66.607 12.905  -22.027  1.00 130.02 ? 112 GLN B CD  1 
ATOM   6362  O OE1 . GLN B 1 103 ? -66.763 11.739  -22.391  1.00 131.15 ? 112 GLN B OE1 1 
ATOM   6363  N NE2 . GLN B 1 103 ? -66.004 13.817  -22.782  1.00 129.79 ? 112 GLN B NE2 1 
ATOM   6364  N N   . MET B 1 104 ? -66.936 17.238  -17.904  1.00 116.29 ? 113 MET B N   1 
ATOM   6365  C CA  . MET B 1 104 ? -66.625 18.617  -17.540  1.00 116.17 ? 113 MET B CA  1 
ATOM   6366  C C   . MET B 1 104 ? -65.288 19.080  -18.111  1.00 115.18 ? 113 MET B C   1 
ATOM   6367  O O   . MET B 1 104 ? -65.083 20.270  -18.349  1.00 115.48 ? 113 MET B O   1 
ATOM   6368  C CB  . MET B 1 104 ? -66.618 18.779  -16.018  1.00 116.28 ? 113 MET B CB  1 
ATOM   6369  C CG  . MET B 1 104 ? -67.951 18.491  -15.337  1.00 117.68 ? 113 MET B CG  1 
ATOM   6370  S SD  . MET B 1 104 ? -69.213 19.742  -15.644  1.00 119.45 ? 113 MET B SD  1 
ATOM   6371  C CE  . MET B 1 104 ? -69.920 19.150  -17.177  1.00 119.91 ? 113 MET B CE  1 
ATOM   6372  N N   . ARG B 1 105 ? -64.378 18.136  -18.326  1.00 106.61 ? 114 ARG B N   1 
ATOM   6373  C CA  . ARG B 1 105 ? -63.046 18.460  -18.824  1.00 105.86 ? 114 ARG B CA  1 
ATOM   6374  C C   . ARG B 1 105 ? -63.029 18.583  -20.343  1.00 106.49 ? 114 ARG B C   1 
ATOM   6375  O O   . ARG B 1 105 ? -63.368 17.635  -21.051  1.00 107.05 ? 114 ARG B O   1 
ATOM   6376  C CB  . ARG B 1 105 ? -62.031 17.406  -18.372  1.00 105.15 ? 114 ARG B CB  1 
ATOM   6377  N N   . PRO B 1 106 ? -62.641 19.763  -20.847  1.00 109.68 ? 115 PRO B N   1 
ATOM   6378  C CA  . PRO B 1 106 ? -62.503 20.004  -22.287  1.00 110.77 ? 115 PRO B CA  1 
ATOM   6379  C C   . PRO B 1 106 ? -61.315 19.240  -22.862  1.00 110.39 ? 115 PRO B C   1 
ATOM   6380  O O   . PRO B 1 106 ? -60.383 18.910  -22.128  1.00 109.23 ? 115 PRO B O   1 
ATOM   6381  C CB  . PRO B 1 106 ? -62.244 21.515  -22.368  1.00 111.36 ? 115 PRO B CB  1 
ATOM   6382  C CG  . PRO B 1 106 ? -62.683 22.066  -21.045  1.00 110.93 ? 115 PRO B CG  1 
ATOM   6383  C CD  . PRO B 1 106 ? -62.407 20.982  -20.059  1.00 109.55 ? 115 PRO B CD  1 
ATOM   6384  N N   . ASP B 1 107 ? -61.351 18.966  -24.161  1.00 153.54 ? 116 ASP B N   1 
ATOM   6385  C CA  . ASP B 1 107 ? -60.276 18.228  -24.812  1.00 153.75 ? 116 ASP B CA  1 
ATOM   6386  C C   . ASP B 1 107 ? -59.046 19.111  -25.004  1.00 153.63 ? 116 ASP B C   1 
ATOM   6387  O O   . ASP B 1 107 ? -59.107 20.137  -25.682  1.00 154.82 ? 116 ASP B O   1 
ATOM   6388  C CB  . ASP B 1 107 ? -60.745 17.669  -26.156  1.00 155.84 ? 116 ASP B CB  1 
ATOM   6389  C CG  . ASP B 1 107 ? -59.808 16.614  -26.708  1.00 156.43 ? 116 ASP B CG  1 
ATOM   6390  O OD1 . ASP B 1 107 ? -58.912 16.165  -25.962  1.00 155.11 ? 116 ASP B OD1 1 
ATOM   6391  O OD2 . ASP B 1 107 ? -59.968 16.231  -27.885  1.00 158.57 ? 116 ASP B OD2 1 
ATOM   6392  N N   . LEU B 1 108 ? -57.932 18.707  -24.403  1.00 106.75 ? 117 LEU B N   1 
ATOM   6393  C CA  . LEU B 1 108 ? -56.693 19.473  -24.480  1.00 106.69 ? 117 LEU B CA  1 
ATOM   6394  C C   . LEU B 1 108 ? -55.891 19.117  -25.726  1.00 108.23 ? 117 LEU B C   1 
ATOM   6395  O O   . LEU B 1 108 ? -55.025 19.879  -26.157  1.00 108.91 ? 117 LEU B O   1 
ATOM   6396  C CB  . LEU B 1 108 ? -55.843 19.239  -23.229  1.00 105.19 ? 117 LEU B CB  1 
ATOM   6397  C CG  . LEU B 1 108 ? -54.532 20.021  -23.137  1.00 105.17 ? 117 LEU B CG  1 
ATOM   6398  C CD1 . LEU B 1 108 ? -54.800 21.517  -23.166  1.00 105.54 ? 117 LEU B CD1 1 
ATOM   6399  C CD2 . LEU B 1 108 ? -53.761 19.637  -21.885  1.00 104.12 ? 117 LEU B CD2 1 
ATOM   6400  N N   . LYS B 1 109 ? -56.189 17.954  -26.299  1.00 108.66 ? 118 LYS B N   1 
ATOM   6401  C CA  . LYS B 1 109 ? -55.482 17.460  -27.476  1.00 110.62 ? 118 LYS B CA  1 
ATOM   6402  C C   . LYS B 1 109 ? -55.286 18.547  -28.531  1.00 112.43 ? 118 LYS B C   1 
ATOM   6403  O O   . LYS B 1 109 ? -54.203 18.683  -29.100  1.00 113.57 ? 118 LYS B O   1 
ATOM   6404  C CB  . LYS B 1 109 ? -56.226 16.267  -28.081  1.00 111.99 ? 118 LYS B CB  1 
ATOM   6405  N N   . GLY B 1 110 ? -56.338 19.317  -28.787  1.00 115.91 ? 119 GLY B N   1 
ATOM   6406  C CA  . GLY B 1 110 ? -56.279 20.374  -29.779  1.00 118.15 ? 119 GLY B CA  1 
ATOM   6407  C C   . GLY B 1 110 ? -55.359 21.511  -29.380  1.00 117.57 ? 119 GLY B C   1 
ATOM   6408  O O   . GLY B 1 110 ? -54.514 21.942  -30.165  1.00 119.37 ? 119 GLY B O   1 
ATOM   6409  N N   . ALA B 1 111 ? -55.522 21.996  -28.153  1.00 134.69 ? 120 ALA B N   1 
ATOM   6410  C CA  . ALA B 1 111 ? -54.732 23.118  -27.660  1.00 134.29 ? 120 ALA B CA  1 
ATOM   6411  C C   . ALA B 1 111 ? -53.241 22.795  -27.626  1.00 134.02 ? 120 ALA B C   1 
ATOM   6412  O O   . ALA B 1 111 ? -52.405 23.672  -27.841  1.00 134.95 ? 120 ALA B O   1 
ATOM   6413  C CB  . ALA B 1 111 ? -55.217 23.542  -26.283  1.00 132.30 ? 120 ALA B CB  1 
ATOM   6414  N N   . LEU B 1 112 ? -52.913 21.536  -27.355  1.00 112.48 ? 121 LEU B N   1 
ATOM   6415  C CA  . LEU B 1 112 ? -51.521 21.108  -27.284  1.00 112.51 ? 121 LEU B CA  1 
ATOM   6416  C C   . LEU B 1 112 ? -50.868 21.171  -28.661  1.00 115.19 ? 121 LEU B C   1 
ATOM   6417  O O   . LEU B 1 112 ? -49.825 21.802  -28.835  1.00 116.03 ? 121 LEU B O   1 
ATOM   6418  C CB  . LEU B 1 112 ? -51.422 19.688  -26.718  1.00 111.45 ? 121 LEU B CB  1 
ATOM   6419  C CG  . LEU B 1 112 ? -50.121 19.292  -26.011  1.00 110.88 ? 121 LEU B CG  1 
ATOM   6420  C CD1 . LEU B 1 112 ? -50.196 17.850  -25.533  1.00 110.45 ? 121 LEU B CD1 1 
ATOM   6421  C CD2 . LEU B 1 112 ? -48.908 19.492  -26.905  1.00 112.81 ? 121 LEU B CD2 1 
ATOM   6422  N N   . LEU B 1 113 ? -51.488 20.511  -29.634  1.00 116.38 ? 122 LEU B N   1 
ATOM   6423  C CA  . LEU B 1 113 ? -50.960 20.467  -30.993  1.00 119.53 ? 122 LEU B CA  1 
ATOM   6424  C C   . LEU B 1 113 ? -50.750 21.866  -31.564  1.00 121.27 ? 122 LEU B C   1 
ATOM   6425  O O   . LEU B 1 113 ? -49.786 22.110  -32.290  1.00 123.46 ? 122 LEU B O   1 
ATOM   6426  C CB  . LEU B 1 113 ? -51.887 19.663  -31.907  1.00 121.40 ? 122 LEU B CB  1 
ATOM   6427  C CG  . LEU B 1 113 ? -52.075 18.186  -31.556  1.00 120.55 ? 122 LEU B CG  1 
ATOM   6428  C CD1 . LEU B 1 113 ? -52.963 17.502  -32.583  1.00 123.04 ? 122 LEU B CD1 1 
ATOM   6429  C CD2 . LEU B 1 113 ? -50.730 17.485  -31.456  1.00 120.91 ? 122 LEU B CD2 1 
ATOM   6430  N N   . SER B 1 114 ? -51.655 22.780  -31.234  1.00 131.25 ? 123 SER B N   1 
ATOM   6431  C CA  . SER B 1 114 ? -51.560 24.153  -31.715  1.00 133.23 ? 123 SER B CA  1 
ATOM   6432  C C   . SER B 1 114 ? -50.358 24.865  -31.106  1.00 132.46 ? 123 SER B C   1 
ATOM   6433  O O   . SER B 1 114 ? -49.673 25.634  -31.780  1.00 134.86 ? 123 SER B O   1 
ATOM   6434  C CB  . SER B 1 114 ? -52.844 24.922  -31.401  1.00 132.95 ? 123 SER B CB  1 
ATOM   6435  O OG  . SER B 1 114 ? -53.953 24.357  -32.079  1.00 134.25 ? 123 SER B OG  1 
ATOM   6436  N N   . LEU B 1 115 ? -50.106 24.603  -29.828  1.00 117.18 ? 124 LEU B N   1 
ATOM   6437  C CA  . LEU B 1 115 ? -48.996 25.233  -29.124  1.00 116.48 ? 124 LEU B CA  1 
ATOM   6438  C C   . LEU B 1 115 ? -47.656 24.779  -29.690  1.00 117.88 ? 124 LEU B C   1 
ATOM   6439  O O   . LEU B 1 115 ? -46.719 25.569  -29.801  1.00 119.11 ? 124 LEU B O   1 
ATOM   6440  C CB  . LEU B 1 115 ? -49.066 24.928  -27.626  1.00 113.41 ? 124 LEU B CB  1 
ATOM   6441  C CG  . LEU B 1 115 ? -48.099 25.721  -26.746  1.00 112.86 ? 124 LEU B CG  1 
ATOM   6442  C CD1 . LEU B 1 115 ? -48.410 27.206  -26.816  1.00 114.14 ? 124 LEU B CD1 1 
ATOM   6443  C CD2 . LEU B 1 115 ? -48.150 25.231  -25.311  1.00 110.36 ? 124 LEU B CD2 1 
ATOM   6444  N N   . ILE B 1 116 ? -47.572 23.501  -30.049  1.00 119.04 ? 125 ILE B N   1 
ATOM   6445  C CA  . ILE B 1 116 ? -46.347 22.947  -30.614  1.00 120.76 ? 125 ILE B CA  1 
ATOM   6446  C C   . ILE B 1 116 ? -45.959 23.672  -31.898  1.00 124.32 ? 125 ILE B C   1 
ATOM   6447  O O   . ILE B 1 116 ? -44.797 24.025  -32.094  1.00 125.75 ? 125 ILE B O   1 
ATOM   6448  C CB  . ILE B 1 116 ? -46.485 21.440  -30.901  1.00 120.95 ? 125 ILE B CB  1 
ATOM   6449  C CG1 . ILE B 1 116 ? -46.653 20.662  -29.595  1.00 117.94 ? 125 ILE B CG1 1 
ATOM   6450  C CG2 . ILE B 1 116 ? -45.276 20.931  -31.666  1.00 123.57 ? 125 ILE B CG2 1 
ATOM   6451  C CD1 . ILE B 1 116 ? -46.676 19.162  -29.778  1.00 118.42 ? 125 ILE B CD1 1 
ATOM   6452  N N   . GLU B 1 117 ? -46.939 23.896  -32.768  1.00 151.24 ? 126 GLU B N   1 
ATOM   6453  C CA  . GLU B 1 117 ? -46.697 24.597  -34.023  1.00 155.20 ? 126 GLU B CA  1 
ATOM   6454  C C   . GLU B 1 117 ? -46.326 26.057  -33.786  1.00 155.76 ? 126 GLU B C   1 
ATOM   6455  O O   . GLU B 1 117 ? -45.536 26.633  -34.533  1.00 158.82 ? 126 GLU B O   1 
ATOM   6456  C CB  . GLU B 1 117 ? -47.917 24.504  -34.941  1.00 157.27 ? 126 GLU B CB  1 
ATOM   6457  C CG  . GLU B 1 117 ? -48.158 23.119  -35.516  1.00 158.16 ? 126 GLU B CG  1 
ATOM   6458  C CD  . GLU B 1 117 ? -49.195 23.119  -36.624  1.00 161.32 ? 126 GLU B CD  1 
ATOM   6459  O OE1 . GLU B 1 117 ? -49.843 24.167  -36.834  1.00 162.45 ? 126 GLU B OE1 1 
ATOM   6460  O OE2 . GLU B 1 117 ? -49.361 22.072  -37.285  1.00 163.04 ? 126 GLU B OE2 1 
ATOM   6461  N N   . TYR B 1 118 ? -46.900 26.653  -32.745  1.00 127.92 ? 127 TYR B N   1 
ATOM   6462  C CA  . TYR B 1 118 ? -46.608 28.042  -32.408  1.00 128.54 ? 127 TYR B CA  1 
ATOM   6463  C C   . TYR B 1 118 ? -45.125 28.233  -32.114  1.00 128.74 ? 127 TYR B C   1 
ATOM   6464  O O   . TYR B 1 118 ? -44.491 29.144  -32.646  1.00 131.49 ? 127 TYR B O   1 
ATOM   6465  C CB  . TYR B 1 118 ? -47.448 28.499  -31.214  1.00 125.72 ? 127 TYR B CB  1 
ATOM   6466  C CG  . TYR B 1 118 ? -47.016 29.828  -30.636  1.00 126.17 ? 127 TYR B CG  1 
ATOM   6467  C CD1 . TYR B 1 118 ? -46.394 29.897  -29.396  1.00 123.78 ? 127 TYR B CD1 1 
ATOM   6468  C CD2 . TYR B 1 118 ? -47.224 31.011  -31.332  1.00 129.43 ? 127 TYR B CD2 1 
ATOM   6469  C CE1 . TYR B 1 118 ? -45.997 31.108  -28.863  1.00 124.53 ? 127 TYR B CE1 1 
ATOM   6470  C CE2 . TYR B 1 118 ? -46.829 32.227  -30.808  1.00 130.21 ? 127 TYR B CE2 1 
ATOM   6471  C CZ  . TYR B 1 118 ? -46.216 32.270  -29.572  1.00 127.71 ? 127 TYR B CZ  1 
ATOM   6472  O OH  . TYR B 1 118 ? -45.821 33.478  -29.045  1.00 128.82 ? 127 TYR B OH  1 
ATOM   6473  N N   . TYR B 1 119 ? -44.575 27.367  -31.268  1.00 126.49 ? 128 TYR B N   1 
ATOM   6474  C CA  . TYR B 1 119 ? -43.155 27.416  -30.944  1.00 126.78 ? 128 TYR B CA  1 
ATOM   6475  C C   . TYR B 1 119 ? -42.323 26.813  -32.070  1.00 129.67 ? 128 TYR B C   1 
ATOM   6476  O O   . TYR B 1 119 ? -41.094 26.824  -32.020  1.00 130.68 ? 128 TYR B O   1 
ATOM   6477  C CB  . TYR B 1 119 ? -42.872 26.682  -29.633  1.00 123.52 ? 128 TYR B CB  1 
ATOM   6478  C CG  . TYR B 1 119 ? -43.485 27.332  -28.414  1.00 121.14 ? 128 TYR B CG  1 
ATOM   6479  C CD1 . TYR B 1 119 ? -44.489 26.699  -27.697  1.00 118.58 ? 128 TYR B CD1 1 
ATOM   6480  C CD2 . TYR B 1 119 ? -43.057 28.579  -27.980  1.00 121.83 ? 128 TYR B CD2 1 
ATOM   6481  C CE1 . TYR B 1 119 ? -45.049 27.289  -26.582  1.00 116.84 ? 128 TYR B CE1 1 
ATOM   6482  C CE2 . TYR B 1 119 ? -43.614 29.177  -26.866  1.00 120.13 ? 128 TYR B CE2 1 
ATOM   6483  C CZ  . TYR B 1 119 ? -44.610 28.527  -26.172  1.00 117.67 ? 128 TYR B CZ  1 
ATOM   6484  O OH  . TYR B 1 119 ? -45.168 29.117  -25.063  1.00 116.40 ? 128 TYR B OH  1 
ATOM   6485  N N   . GLN B 1 120 ? -43.005 26.283  -33.081  1.00 133.58 ? 129 GLN B N   1 
ATOM   6486  C CA  . GLN B 1 120 ? -42.343 25.693  -34.240  1.00 136.95 ? 129 GLN B CA  1 
ATOM   6487  C C   . GLN B 1 120 ? -41.380 24.579  -33.835  1.00 136.10 ? 129 GLN B C   1 
ATOM   6488  O O   . GLN B 1 120 ? -40.183 24.644  -34.115  1.00 138.17 ? 129 GLN B O   1 
ATOM   6489  C CB  . GLN B 1 120 ? -41.615 26.770  -35.047  1.00 140.73 ? 129 GLN B CB  1 
ATOM   6490  C CG  . GLN B 1 120 ? -42.538 27.842  -35.604  1.00 142.59 ? 129 GLN B CG  1 
ATOM   6491  C CD  . GLN B 1 120 ? -41.785 28.976  -36.270  1.00 146.47 ? 129 GLN B CD  1 
ATOM   6492  O OE1 . GLN B 1 120 ? -40.556 29.038  -36.218  1.00 147.43 ? 129 GLN B OE1 1 
ATOM   6493  N NE2 . GLN B 1 120 ? -42.520 29.885  -36.900  1.00 149.05 ? 129 GLN B NE2 1 
ATOM   6494  N N   . TRP B 1 121 ? -41.919 23.559  -33.174  1.00 131.13 ? 130 TRP B N   1 
ATOM   6495  C CA  . TRP B 1 121 ? -41.132 22.415  -32.735  1.00 130.53 ? 130 TRP B CA  1 
ATOM   6496  C C   . TRP B 1 121 ? -41.134 21.321  -33.795  1.00 133.29 ? 130 TRP B C   1 
ATOM   6497  O O   . TRP B 1 121 ? -42.173 21.009  -34.376  1.00 133.81 ? 130 TRP B O   1 
ATOM   6498  C CB  . TRP B 1 121 ? -41.687 21.869  -31.418  1.00 126.64 ? 130 TRP B CB  1 
ATOM   6499  C CG  . TRP B 1 121 ? -41.331 22.699  -30.224  1.00 124.43 ? 130 TRP B CG  1 
ATOM   6500  C CD1 . TRP B 1 121 ? -40.919 23.999  -30.223  1.00 125.18 ? 130 TRP B CD1 1 
ATOM   6501  C CD2 . TRP B 1 121 ? -41.378 22.291  -28.850  1.00 121.55 ? 130 TRP B CD2 1 
ATOM   6502  N NE1 . TRP B 1 121 ? -40.693 24.423  -28.935  1.00 122.95 ? 130 TRP B NE1 1 
ATOM   6503  C CE2 . TRP B 1 121 ? -40.970 23.394  -28.073  1.00 120.74 ? 130 TRP B CE2 1 
ATOM   6504  C CE3 . TRP B 1 121 ? -41.722 21.100  -28.203  1.00 119.96 ? 130 TRP B CE3 1 
ATOM   6505  C CZ2 . TRP B 1 121 ? -40.895 23.340  -26.682  1.00 118.51 ? 130 TRP B CZ2 1 
ATOM   6506  C CZ3 . TRP B 1 121 ? -41.647 21.049  -26.822  1.00 117.75 ? 130 TRP B CZ3 1 
ATOM   6507  C CH2 . TRP B 1 121 ? -41.237 22.161  -26.077  1.00 117.08 ? 130 TRP B CH2 1 
ATOM   6508  N N   . ASP B 1 122 ? -39.964 20.743  -34.043  1.00 138.42 ? 131 ASP B N   1 
ATOM   6509  C CA  . ASP B 1 122 ? -39.834 19.658  -35.008  1.00 141.56 ? 131 ASP B CA  1 
ATOM   6510  C C   . ASP B 1 122 ? -39.274 18.399  -34.353  1.00 140.88 ? 131 ASP B C   1 
ATOM   6511  O O   . ASP B 1 122 ? -39.489 17.288  -34.836  1.00 142.58 ? 131 ASP B O   1 
ATOM   6512  C CB  . ASP B 1 122 ? -38.960 20.086  -36.190  1.00 146.18 ? 131 ASP B CB  1 
ATOM   6513  C CG  . ASP B 1 122 ? -37.604 20.615  -35.757  1.00 146.59 ? 131 ASP B CG  1 
ATOM   6514  O OD1 . ASP B 1 122 ? -36.757 20.866  -36.642  1.00 150.56 ? 131 ASP B OD1 1 
ATOM   6515  O OD2 . ASP B 1 122 ? -37.385 20.780  -34.537  1.00 143.27 ? 131 ASP B OD2 1 
ATOM   6516  N N   . LYS B 1 123 ? -38.557 18.583  -33.250  1.00 135.41 ? 132 LYS B N   1 
ATOM   6517  C CA  . LYS B 1 123 ? -38.001 17.465  -32.498  1.00 134.95 ? 132 LYS B CA  1 
ATOM   6518  C C   . LYS B 1 123 ? -38.124 17.724  -31.002  1.00 131.09 ? 132 LYS B C   1 
ATOM   6519  O O   . LYS B 1 123 ? -37.509 18.649  -30.472  1.00 130.33 ? 132 LYS B O   1 
ATOM   6520  C CB  . LYS B 1 123 ? -36.536 17.239  -32.873  1.00 138.36 ? 132 LYS B CB  1 
ATOM   6521  N N   . PHE B 1 124 ? -38.922 16.904  -30.326  1.00 128.68 ? 133 PHE B N   1 
ATOM   6522  C CA  . PHE B 1 124 ? -39.162 17.082  -28.898  1.00 125.38 ? 133 PHE B CA  1 
ATOM   6523  C C   . PHE B 1 124 ? -39.405 15.755  -28.188  1.00 124.81 ? 133 PHE B C   1 
ATOM   6524  O O   . PHE B 1 124 ? -39.781 14.763  -28.811  1.00 126.31 ? 133 PHE B O   1 
ATOM   6525  C CB  . PHE B 1 124 ? -40.351 18.018  -28.672  1.00 122.74 ? 133 PHE B CB  1 
ATOM   6526  C CG  . PHE B 1 124 ? -41.609 17.577  -29.364  1.00 122.70 ? 133 PHE B CG  1 
ATOM   6527  C CD1 . PHE B 1 124 ? -42.477 16.687  -28.754  1.00 121.04 ? 133 PHE B CD1 1 
ATOM   6528  C CD2 . PHE B 1 124 ? -41.926 18.054  -30.626  1.00 124.69 ? 133 PHE B CD2 1 
ATOM   6529  C CE1 . PHE B 1 124 ? -43.636 16.280  -29.388  1.00 121.23 ? 133 PHE B CE1 1 
ATOM   6530  C CE2 . PHE B 1 124 ? -43.085 17.651  -31.266  1.00 125.02 ? 133 PHE B CE2 1 
ATOM   6531  C CZ  . PHE B 1 124 ? -43.941 16.763  -30.646  1.00 123.21 ? 133 PHE B CZ  1 
ATOM   6532  N N   . ALA B 1 125 ? -39.186 15.749  -26.877  1.00 122.94 ? 134 ALA B N   1 
ATOM   6533  C CA  . ALA B 1 125 ? -39.440 14.570  -26.061  1.00 122.56 ? 134 ALA B CA  1 
ATOM   6534  C C   . ALA B 1 125 ? -40.835 14.648  -25.453  1.00 119.66 ? 134 ALA B C   1 
ATOM   6535  O O   . ALA B 1 125 ? -41.267 15.711  -25.007  1.00 117.52 ? 134 ALA B O   1 
ATOM   6536  C CB  . ALA B 1 125 ? -38.391 14.443  -24.970  1.00 122.98 ? 134 ALA B CB  1 
ATOM   6537  N N   . TYR B 1 126 ? -41.539 13.521  -25.438  1.00 131.95 ? 135 TYR B N   1 
ATOM   6538  C CA  . TYR B 1 126 ? -42.903 13.485  -24.925  1.00 129.58 ? 135 TYR B CA  1 
ATOM   6539  C C   . TYR B 1 126 ? -43.045 12.493  -23.777  1.00 129.37 ? 135 TYR B C   1 
ATOM   6540  O O   . TYR B 1 126 ? -43.319 11.313  -23.994  1.00 130.82 ? 135 TYR B O   1 
ATOM   6541  C CB  . TYR B 1 126 ? -43.884 13.140  -26.048  1.00 130.20 ? 135 TYR B CB  1 
ATOM   6542  C CG  . TYR B 1 126 ? -45.339 13.178  -25.638  1.00 128.01 ? 135 TYR B CG  1 
ATOM   6543  C CD1 . TYR B 1 126 ? -46.034 12.009  -25.363  1.00 128.30 ? 135 TYR B CD1 1 
ATOM   6544  C CD2 . TYR B 1 126 ? -46.019 14.384  -25.530  1.00 125.99 ? 135 TYR B CD2 1 
ATOM   6545  C CE1 . TYR B 1 126 ? -47.365 12.039  -24.992  1.00 126.53 ? 135 TYR B CE1 1 
ATOM   6546  C CE2 . TYR B 1 126 ? -47.348 14.425  -25.159  1.00 124.30 ? 135 TYR B CE2 1 
ATOM   6547  C CZ  . TYR B 1 126 ? -48.016 13.251  -24.890  1.00 124.52 ? 135 TYR B CZ  1 
ATOM   6548  O OH  . TYR B 1 126 ? -49.341 13.287  -24.519  1.00 123.05 ? 135 TYR B OH  1 
ATOM   6549  N N   . LEU B 1 127 ? -42.851 12.979  -22.555  1.00 119.90 ? 136 LEU B N   1 
ATOM   6550  C CA  . LEU B 1 127 ? -43.003 12.147  -21.368  1.00 120.00 ? 136 LEU B CA  1 
ATOM   6551  C C   . LEU B 1 127 ? -44.473 12.074  -20.974  1.00 118.07 ? 136 LEU B C   1 
ATOM   6552  O O   . LEU B 1 127 ? -45.071 13.079  -20.591  1.00 115.97 ? 136 LEU B O   1 
ATOM   6553  C CB  . LEU B 1 127 ? -42.172 12.707  -20.213  1.00 119.87 ? 136 LEU B CB  1 
ATOM   6554  C CG  . LEU B 1 127 ? -40.714 13.024  -20.546  1.00 121.67 ? 136 LEU B CG  1 
ATOM   6555  C CD1 . LEU B 1 127 ? -39.958 13.451  -19.298  1.00 121.92 ? 136 LEU B CD1 1 
ATOM   6556  C CD2 . LEU B 1 127 ? -40.043 11.825  -21.198  1.00 124.63 ? 136 LEU B CD2 1 
ATOM   6557  N N   . TYR B 1 128 ? -45.053 10.882  -21.070  1.00 115.29 ? 137 TYR B N   1 
ATOM   6558  C CA  . TYR B 1 128 ? -46.483 10.717  -20.838  1.00 113.84 ? 137 TYR B CA  1 
ATOM   6559  C C   . TYR B 1 128 ? -46.794 9.796   -19.662  1.00 114.48 ? 137 TYR B C   1 
ATOM   6560  O O   . TYR B 1 128 ? -45.940 9.035   -19.206  1.00 116.57 ? 137 TYR B O   1 
ATOM   6561  C CB  . TYR B 1 128 ? -47.170 10.199  -22.104  1.00 114.62 ? 137 TYR B CB  1 
ATOM   6562  C CG  . TYR B 1 128 ? -46.684 8.841   -22.554  1.00 117.59 ? 137 TYR B CG  1 
ATOM   6563  C CD1 . TYR B 1 128 ? -45.583 8.718   -23.387  1.00 119.71 ? 137 TYR B CD1 1 
ATOM   6564  C CD2 . TYR B 1 128 ? -47.329 7.681   -22.147  1.00 118.64 ? 137 TYR B CD2 1 
ATOM   6565  C CE1 . TYR B 1 128 ? -45.136 7.478   -23.801  1.00 122.87 ? 137 TYR B CE1 1 
ATOM   6566  C CE2 . TYR B 1 128 ? -46.890 6.437   -22.556  1.00 121.80 ? 137 TYR B CE2 1 
ATOM   6567  C CZ  . TYR B 1 128 ? -45.792 6.341   -23.383  1.00 123.94 ? 137 TYR B CZ  1 
ATOM   6568  O OH  . TYR B 1 128 ? -45.349 5.104   -23.793  1.00 127.51 ? 137 TYR B OH  1 
ATOM   6569  N N   . ASP B 1 129 ? -48.030 9.878   -19.180  1.00 171.14 ? 138 ASP B N   1 
ATOM   6570  C CA  . ASP B 1 129 ? -48.504 9.019   -18.105  1.00 171.96 ? 138 ASP B CA  1 
ATOM   6571  C C   . ASP B 1 129 ? -49.782 8.322   -18.558  1.00 171.99 ? 138 ASP B C   1 
ATOM   6572  O O   . ASP B 1 129 ? -50.734 8.973   -18.989  1.00 170.22 ? 138 ASP B O   1 
ATOM   6573  C CB  . ASP B 1 129 ? -48.760 9.839   -16.840  1.00 170.58 ? 138 ASP B CB  1 
ATOM   6574  C CG  . ASP B 1 129 ? -48.768 8.989   -15.585  1.00 172.34 ? 138 ASP B CG  1 
ATOM   6575  O OD1 . ASP B 1 129 ? -48.922 9.558   -14.483  1.00 171.88 ? 138 ASP B OD1 1 
ATOM   6576  O OD2 . ASP B 1 129 ? -48.616 7.754   -15.699  1.00 174.59 ? 138 ASP B OD2 1 
ATOM   6577  N N   . SER B 1 130 ? -49.797 6.997   -18.462  1.00 224.94 ? 139 SER B N   1 
ATOM   6578  C CA  . SER B 1 130 ? -50.907 6.200   -18.976  1.00 225.57 ? 139 SER B CA  1 
ATOM   6579  C C   . SER B 1 130 ? -52.161 6.283   -18.107  1.00 224.42 ? 139 SER B C   1 
ATOM   6580  O O   . SER B 1 130 ? -53.105 5.515   -18.296  1.00 225.28 ? 139 SER B O   1 
ATOM   6581  C CB  . SER B 1 130 ? -50.480 4.739   -19.138  1.00 228.96 ? 139 SER B CB  1 
ATOM   6582  O OG  . SER B 1 130 ? -49.958 4.225   -17.925  1.00 230.54 ? 139 SER B OG  1 
ATOM   6583  N N   . ASP B 1 131 ? -52.172 7.217   -17.162  1.00 251.25 ? 140 ASP B N   1 
ATOM   6584  C CA  . ASP B 1 131 ? -53.295 7.352   -16.240  1.00 250.53 ? 140 ASP B CA  1 
ATOM   6585  C C   . ASP B 1 131 ? -54.549 7.910   -16.911  1.00 248.78 ? 140 ASP B C   1 
ATOM   6586  O O   . ASP B 1 131 ? -55.660 7.451   -16.643  1.00 249.13 ? 140 ASP B O   1 
ATOM   6587  C CB  . ASP B 1 131 ? -52.907 8.220   -15.041  1.00 249.79 ? 140 ASP B CB  1 
ATOM   6588  C CG  . ASP B 1 131 ? -51.974 7.505   -14.084  1.00 252.21 ? 140 ASP B CG  1 
ATOM   6589  O OD1 . ASP B 1 131 ? -51.561 6.368   -14.395  1.00 254.42 ? 140 ASP B OD1 1 
ATOM   6590  O OD2 . ASP B 1 131 ? -51.657 8.080   -13.021  1.00 252.27 ? 140 ASP B OD2 1 
ATOM   6591  N N   . ARG B 1 132 ? -54.368 8.898   -17.781  1.00 204.78 ? 141 ARG B N   1 
ATOM   6592  C CA  . ARG B 1 132 ? -55.496 9.541   -18.450  1.00 203.47 ? 141 ARG B CA  1 
ATOM   6593  C C   . ARG B 1 132 ? -55.663 9.050   -19.884  1.00 204.41 ? 141 ARG B C   1 
ATOM   6594  O O   . ARG B 1 132 ? -56.222 9.750   -20.729  1.00 203.68 ? 141 ARG B O   1 
ATOM   6595  C CB  . ARG B 1 132 ? -55.334 11.062  -18.429  1.00 201.62 ? 141 ARG B CB  1 
ATOM   6596  C CG  . ARG B 1 132 ? -55.235 11.654  -17.033  1.00 201.01 ? 141 ARG B CG  1 
ATOM   6597  C CD  . ARG B 1 132 ? -54.741 13.088  -17.081  1.00 199.73 ? 141 ARG B CD  1 
ATOM   6598  N NE  . ARG B 1 132 ? -53.584 13.226  -17.960  1.00 199.94 ? 141 ARG B NE  1 
ATOM   6599  C CZ  . ARG B 1 132 ? -52.360 12.812  -17.653  1.00 200.86 ? 141 ARG B CZ  1 
ATOM   6600  N NH1 . ARG B 1 132 ? -52.127 12.228  -16.485  1.00 201.75 ? 141 ARG B NH1 1 
ATOM   6601  N NH2 . ARG B 1 132 ? -51.367 12.978  -18.516  1.00 201.25 ? 141 ARG B NH2 1 
ATOM   6602  N N   . GLY B 1 133 ? -55.178 7.843   -20.152  1.00 269.66 ? 142 GLY B N   1 
ATOM   6603  C CA  . GLY B 1 133 ? -55.287 7.256   -21.475  1.00 271.22 ? 142 GLY B CA  1 
ATOM   6604  C C   . GLY B 1 133 ? -54.291 7.837   -22.458  1.00 271.35 ? 142 GLY B C   1 
ATOM   6605  O O   . GLY B 1 133 ? -53.903 9.001   -22.351  1.00 269.67 ? 142 GLY B O   1 
ATOM   6606  N N   . LEU B 1 134 ? -53.878 7.022   -23.423  1.00 246.44 ? 143 LEU B N   1 
ATOM   6607  C CA  . LEU B 1 134 ? -52.920 7.453   -24.434  1.00 247.24 ? 143 LEU B CA  1 
ATOM   6608  C C   . LEU B 1 134 ? -53.617 8.198   -25.568  1.00 247.05 ? 143 LEU B C   1 
ATOM   6609  O O   . LEU B 1 134 ? -53.163 8.171   -26.711  1.00 248.92 ? 143 LEU B O   1 
ATOM   6610  C CB  . LEU B 1 134 ? -52.147 6.255   -24.993  1.00 250.46 ? 143 LEU B CB  1 
ATOM   6611  C CG  . LEU B 1 134 ? -51.312 5.427   -24.012  1.00 251.58 ? 143 LEU B CG  1 
ATOM   6612  C CD1 . LEU B 1 134 ? -50.486 6.336   -23.114  1.00 249.62 ? 143 LEU B CD1 1 
ATOM   6613  C CD2 . LEU B 1 134 ? -52.193 4.506   -23.180  1.00 252.06 ? 143 LEU B CD2 1 
ATOM   6614  N N   . SER B 1 135 ? -54.723 8.861   -25.243  1.00 165.25 ? 144 SER B N   1 
ATOM   6615  C CA  . SER B 1 135 ? -55.487 9.608   -26.235  1.00 165.35 ? 144 SER B CA  1 
ATOM   6616  C C   . SER B 1 135 ? -54.675 10.765  -26.809  1.00 165.03 ? 144 SER B C   1 
ATOM   6617  O O   . SER B 1 135 ? -54.705 11.020  -28.013  1.00 166.73 ? 144 SER B O   1 
ATOM   6618  C CB  . SER B 1 135 ? -56.789 10.131  -25.626  1.00 163.61 ? 144 SER B CB  1 
ATOM   6619  O OG  . SER B 1 135 ? -57.550 10.845  -26.585  1.00 164.14 ? 144 SER B OG  1 
ATOM   6620  N N   . THR B 1 136 ? -53.950 11.463  -25.940  1.00 132.20 ? 145 THR B N   1 
ATOM   6621  C CA  . THR B 1 136 ? -53.119 12.585  -26.361  1.00 131.98 ? 145 THR B CA  1 
ATOM   6622  C C   . THR B 1 136 ? -51.806 12.103  -26.972  1.00 133.95 ? 145 THR B C   1 
ATOM   6623  O O   . THR B 1 136 ? -51.229 12.770  -27.831  1.00 134.99 ? 145 THR B O   1 
ATOM   6624  C CB  . THR B 1 136 ? -52.820 13.541  -25.193  1.00 129.64 ? 145 THR B CB  1 
ATOM   6625  O OG1 . THR B 1 136 ? -52.247 12.804  -24.106  1.00 129.25 ? 145 THR B OG1 1 
ATOM   6626  C CG2 . THR B 1 136 ? -54.095 14.221  -24.722  1.00 128.14 ? 145 THR B CG2 1 
ATOM   6627  N N   . LEU B 1 137 ? -51.339 10.941  -26.525  1.00 119.38 ? 146 LEU B N   1 
ATOM   6628  C CA  . LEU B 1 137 ? -50.126 10.347  -27.075  1.00 121.74 ? 146 LEU B CA  1 
ATOM   6629  C C   . LEU B 1 137 ? -50.328 9.997   -28.545  1.00 124.56 ? 146 LEU B C   1 
ATOM   6630  O O   . LEU B 1 137 ? -49.491 10.314  -29.387  1.00 126.31 ? 146 LEU B O   1 
ATOM   6631  C CB  . LEU B 1 137 ? -49.729 9.099   -26.286  1.00 122.64 ? 146 LEU B CB  1 
ATOM   6632  C CG  . LEU B 1 137 ? -48.549 8.300   -26.842  1.00 125.71 ? 146 LEU B CG  1 
ATOM   6633  C CD1 . LEU B 1 137 ? -47.318 9.179   -26.964  1.00 125.63 ? 146 LEU B CD1 1 
ATOM   6634  C CD2 . LEU B 1 137 ? -48.262 7.088   -25.969  1.00 126.88 ? 146 LEU B CD2 1 
ATOM   6635  N N   . GLN B 1 138 ? -51.445 9.342   -28.844  1.00 171.06 ? 147 GLN B N   1 
ATOM   6636  C CA  . GLN B 1 138 ? -51.787 9.009   -30.220  1.00 174.07 ? 147 GLN B CA  1 
ATOM   6637  C C   . GLN B 1 138 ? -51.925 10.279  -31.050  1.00 174.09 ? 147 GLN B C   1 
ATOM   6638  O O   . GLN B 1 138 ? -51.590 10.299  -32.233  1.00 177.04 ? 147 GLN B O   1 
ATOM   6639  C CB  . GLN B 1 138 ? -53.090 8.210   -30.276  1.00 174.69 ? 147 GLN B CB  1 
ATOM   6640  C CG  . GLN B 1 138 ? -53.025 6.853   -29.595  1.00 175.51 ? 147 GLN B CG  1 
ATOM   6641  C CD  . GLN B 1 138 ? -54.323 6.076   -29.723  1.00 176.50 ? 147 GLN B CD  1 
ATOM   6642  O OE1 . GLN B 1 138 ? -55.272 6.529   -30.363  1.00 176.68 ? 147 GLN B OE1 1 
ATOM   6643  N NE2 . GLN B 1 138 ? -54.368 4.898   -29.111  1.00 177.48 ? 147 GLN B NE2 1 
ATOM   6644  N N   . ALA B 1 139 ? -52.417 11.340  -30.418  1.00 121.12 ? 148 ALA B N   1 
ATOM   6645  C CA  . ALA B 1 139 ? -52.614 12.613  -31.098  1.00 121.27 ? 148 ALA B CA  1 
ATOM   6646  C C   . ALA B 1 139 ? -51.300 13.167  -31.639  1.00 122.61 ? 148 ALA B C   1 
ATOM   6647  O O   . ALA B 1 139 ? -51.203 13.521  -32.814  1.00 125.28 ? 148 ALA B O   1 
ATOM   6648  C CB  . ALA B 1 139 ? -53.268 13.616  -30.163  1.00 118.14 ? 148 ALA B CB  1 
ATOM   6649  N N   . VAL B 1 140 ? -50.290 13.239  -30.778  1.00 121.14 ? 149 VAL B N   1 
ATOM   6650  C CA  . VAL B 1 140 ? -48.996 13.788  -31.167  1.00 122.34 ? 149 VAL B CA  1 
ATOM   6651  C C   . VAL B 1 140 ? -48.237 12.848  -32.100  1.00 125.95 ? 149 VAL B C   1 
ATOM   6652  O O   . VAL B 1 140 ? -47.477 13.296  -32.957  1.00 128.26 ? 149 VAL B O   1 
ATOM   6653  C CB  . VAL B 1 140 ? -48.119 14.119  -29.940  1.00 120.00 ? 149 VAL B CB  1 
ATOM   6654  C CG1 . VAL B 1 140 ? -48.830 15.110  -29.034  1.00 116.93 ? 149 VAL B CG1 1 
ATOM   6655  C CG2 . VAL B 1 140 ? -47.766 12.855  -29.177  1.00 119.93 ? 149 VAL B CG2 1 
ATOM   6656  N N   . LEU B 1 141 ? -48.448 11.546  -31.933  1.00 131.04 ? 150 LEU B N   1 
ATOM   6657  C CA  . LEU B 1 141 ? -47.791 10.555  -32.777  1.00 134.90 ? 150 LEU B CA  1 
ATOM   6658  C C   . LEU B 1 141 ? -48.351 10.582  -34.195  1.00 138.17 ? 150 LEU B C   1 
ATOM   6659  O O   . LEU B 1 141 ? -47.600 10.527  -35.168  1.00 141.66 ? 150 LEU B O   1 
ATOM   6660  C CB  . LEU B 1 141 ? -47.928 9.153   -32.181  1.00 135.30 ? 150 LEU B CB  1 
ATOM   6661  C CG  . LEU B 1 141 ? -47.099 8.859   -30.930  1.00 133.65 ? 150 LEU B CG  1 
ATOM   6662  C CD1 . LEU B 1 141 ? -47.245 7.402   -30.522  1.00 135.10 ? 150 LEU B CD1 1 
ATOM   6663  C CD2 . LEU B 1 141 ? -45.640 9.205   -31.164  1.00 135.13 ? 150 LEU B CD2 1 
ATOM   6664  N N   . ASP B 1 142 ? -49.673 10.667  -34.306  1.00 173.51 ? 151 ASP B N   1 
ATOM   6665  C CA  . ASP B 1 142 ? -50.328 10.723  -35.607  1.00 176.83 ? 151 ASP B CA  1 
ATOM   6666  C C   . ASP B 1 142 ? -49.977 12.019  -36.330  1.00 177.84 ? 151 ASP B C   1 
ATOM   6667  O O   . ASP B 1 142 ? -49.763 12.026  -37.542  1.00 181.94 ? 151 ASP B O   1 
ATOM   6668  C CB  . ASP B 1 142 ? -51.845 10.601  -35.452  1.00 175.67 ? 151 ASP B CB  1 
ATOM   6669  C CG  . ASP B 1 142 ? -52.266 9.268   -34.860  1.00 175.40 ? 151 ASP B CG  1 
ATOM   6670  O OD1 . ASP B 1 142 ? -51.398 8.383   -34.703  1.00 176.68 ? 151 ASP B OD1 1 
ATOM   6671  O OD2 . ASP B 1 142 ? -53.466 9.106   -34.552  1.00 174.20 ? 151 ASP B OD2 1 
ATOM   6672  N N   . SER B 1 143 ? -49.922 13.113  -35.578  1.00 154.29 ? 152 SER B N   1 
ATOM   6673  C CA  . SER B 1 143 ? -49.575 14.411  -36.142  1.00 155.20 ? 152 SER B CA  1 
ATOM   6674  C C   . SER B 1 143 ? -48.092 14.473  -36.489  1.00 157.19 ? 152 SER B C   1 
ATOM   6675  O O   . SER B 1 143 ? -47.677 15.262  -37.337  1.00 159.72 ? 152 SER B O   1 
ATOM   6676  C CB  . SER B 1 143 ? -49.937 15.534  -35.169  1.00 151.31 ? 152 SER B CB  1 
ATOM   6677  O OG  . SER B 1 143 ? -51.336 15.588  -34.953  1.00 150.01 ? 152 SER B OG  1 
ATOM   6678  N N   . ALA B 1 144 ? -47.299 13.637  -35.826  1.00 136.77 ? 153 ALA B N   1 
ATOM   6679  C CA  . ALA B 1 144 ? -45.866 13.574  -36.088  1.00 138.86 ? 153 ALA B CA  1 
ATOM   6680  C C   . ALA B 1 144 ? -45.601 13.023  -37.483  1.00 144.16 ? 153 ALA B C   1 
ATOM   6681  O O   . ALA B 1 144 ? -44.554 13.278  -38.076  1.00 146.95 ? 153 ALA B O   1 
ATOM   6682  C CB  . ALA B 1 144 ? -45.172 12.721  -35.040  1.00 137.22 ? 153 ALA B CB  1 
ATOM   6683  N N   . ALA B 1 145 ? -46.559 12.264  -38.002  1.00 146.14 ? 154 ALA B N   1 
ATOM   6684  C CA  . ALA B 1 145 ? -46.450 11.710  -39.343  1.00 151.64 ? 154 ALA B CA  1 
ATOM   6685  C C   . ALA B 1 145 ? -46.728 12.785  -40.387  1.00 154.18 ? 154 ALA B C   1 
ATOM   6686  O O   . ALA B 1 145 ? -46.004 12.907  -41.375  1.00 158.58 ? 154 ALA B O   1 
ATOM   6687  C CB  . ALA B 1 145 ? -47.409 10.542  -39.513  1.00 152.85 ? 154 ALA B CB  1 
ATOM   6688  N N   . GLU B 1 146 ? -47.779 13.566  -40.158  1.00 151.79 ? 155 GLU B N   1 
ATOM   6689  C CA  . GLU B 1 146 ? -48.171 14.622  -41.085  1.00 154.35 ? 155 GLU B CA  1 
ATOM   6690  C C   . GLU B 1 146 ? -47.228 15.818  -41.003  1.00 153.92 ? 155 GLU B C   1 
ATOM   6691  O O   . GLU B 1 146 ? -46.614 16.204  -41.996  1.00 158.21 ? 155 GLU B O   1 
ATOM   6692  C CB  . GLU B 1 146 ? -49.609 15.069  -40.808  1.00 152.13 ? 155 GLU B CB  1 
ATOM   6693  N N   . LYS B 1 147 ? -47.119 16.400  -39.813  1.00 160.13 ? 156 LYS B N   1 
ATOM   6694  C CA  . LYS B 1 147 ? -46.282 17.576  -39.605  1.00 159.46 ? 156 LYS B CA  1 
ATOM   6695  C C   . LYS B 1 147 ? -44.798 17.220  -39.615  1.00 160.83 ? 156 LYS B C   1 
ATOM   6696  O O   . LYS B 1 147 ? -43.939 18.098  -39.529  1.00 160.95 ? 156 LYS B O   1 
ATOM   6697  C CB  . LYS B 1 147 ? -46.649 18.268  -38.290  1.00 154.20 ? 156 LYS B CB  1 
ATOM   6698  N N   . LYS B 1 148 ? -44.505 15.928  -39.719  1.00 180.09 ? 157 LYS B N   1 
ATOM   6699  C CA  . LYS B 1 148 ? -43.127 15.449  -39.764  1.00 181.97 ? 157 LYS B CA  1 
ATOM   6700  C C   . LYS B 1 148 ? -42.337 15.862  -38.524  1.00 178.03 ? 157 LYS B C   1 
ATOM   6701  O O   . LYS B 1 148 ? -41.471 16.733  -38.590  1.00 178.70 ? 157 LYS B O   1 
ATOM   6702  C CB  . LYS B 1 148 ? -42.423 15.950  -41.028  1.00 187.27 ? 157 LYS B CB  1 
ATOM   6703  N N   . TRP B 1 149 ? -42.642 15.232  -37.394  1.00 158.42 ? 158 TRP B N   1 
ATOM   6704  C CA  . TRP B 1 149 ? -41.911 15.485  -36.158  1.00 155.08 ? 158 TRP B CA  1 
ATOM   6705  C C   . TRP B 1 149 ? -41.113 14.259  -35.732  1.00 155.87 ? 158 TRP B C   1 
ATOM   6706  O O   . TRP B 1 149 ? -41.468 13.128  -36.064  1.00 157.62 ? 158 TRP B O   1 
ATOM   6707  C CB  . TRP B 1 149 ? -42.862 15.881  -35.026  1.00 150.26 ? 158 TRP B CB  1 
ATOM   6708  C CG  . TRP B 1 149 ? -43.591 17.169  -35.249  1.00 149.35 ? 158 TRP B CG  1 
ATOM   6709  C CD1 . TRP B 1 149 ? -43.156 18.247  -35.962  1.00 151.50 ? 158 TRP B CD1 1 
ATOM   6710  C CD2 . TRP B 1 149 ? -44.876 17.527  -34.724  1.00 146.41 ? 158 TRP B CD2 1 
ATOM   6711  N NE1 . TRP B 1 149 ? -44.097 19.248  -35.929  1.00 150.21 ? 158 TRP B NE1 1 
ATOM   6712  C CE2 . TRP B 1 149 ? -45.162 18.831  -35.174  1.00 147.06 ? 158 TRP B CE2 1 
ATOM   6713  C CE3 . TRP B 1 149 ? -45.815 16.868  -33.925  1.00 143.63 ? 158 TRP B CE3 1 
ATOM   6714  C CZ2 . TRP B 1 149 ? -46.347 19.488  -34.850  1.00 145.08 ? 158 TRP B CZ2 1 
ATOM   6715  C CZ3 . TRP B 1 149 ? -46.990 17.522  -33.605  1.00 141.56 ? 158 TRP B CZ3 1 
ATOM   6716  C CH2 . TRP B 1 149 ? -47.246 18.818  -34.067  1.00 142.31 ? 158 TRP B CH2 1 
ATOM   6717  N N   . GLN B 1 150 ? -40.033 14.491  -34.993  1.00 140.89 ? 159 GLN B N   1 
ATOM   6718  C CA  . GLN B 1 150 ? -39.253 13.405  -34.415  1.00 141.56 ? 159 GLN B CA  1 
ATOM   6719  C C   . GLN B 1 150 ? -39.528 13.315  -32.919  1.00 137.28 ? 159 GLN B C   1 
ATOM   6720  O O   . GLN B 1 150 ? -38.744 13.798  -32.101  1.00 135.90 ? 159 GLN B O   1 
ATOM   6721  C CB  . GLN B 1 150 ? -37.758 13.611  -34.672  1.00 144.39 ? 159 GLN B CB  1 
ATOM   6722  C CG  . GLN B 1 150 ? -37.347 13.438  -36.126  1.00 149.56 ? 159 GLN B CG  1 
ATOM   6723  C CD  . GLN B 1 150 ? -35.848 13.547  -36.324  1.00 152.63 ? 159 GLN B CD  1 
ATOM   6724  O OE1 . GLN B 1 150 ? -35.102 13.790  -35.375  1.00 150.84 ? 159 GLN B OE1 1 
ATOM   6725  N NE2 . GLN B 1 150 ? -35.398 13.366  -37.560  1.00 157.63 ? 159 GLN B NE2 1 
ATOM   6726  N N   . VAL B 1 151 ? -40.649 12.694  -32.571  1.00 134.91 ? 160 VAL B N   1 
ATOM   6727  C CA  . VAL B 1 151 ? -41.081 12.607  -31.181  1.00 131.15 ? 160 VAL B CA  1 
ATOM   6728  C C   . VAL B 1 151 ? -40.420 11.444  -30.450  1.00 132.09 ? 160 VAL B C   1 
ATOM   6729  O O   . VAL B 1 151 ? -40.342 10.332  -30.972  1.00 135.01 ? 160 VAL B O   1 
ATOM   6730  C CB  . VAL B 1 151 ? -42.612 12.458  -31.076  1.00 129.06 ? 160 VAL B CB  1 
ATOM   6731  C CG1 . VAL B 1 151 ? -43.044 12.409  -29.619  1.00 125.52 ? 160 VAL B CG1 1 
ATOM   6732  C CG2 . VAL B 1 151 ? -43.308 13.598  -31.804  1.00 128.58 ? 160 VAL B CG2 1 
ATOM   6733  N N   . THR B 1 152 ? -39.946 11.711  -29.238  1.00 131.64 ? 161 THR B N   1 
ATOM   6734  C CA  . THR B 1 152 ? -39.362 10.675  -28.397  1.00 132.62 ? 161 THR B CA  1 
ATOM   6735  C C   . THR B 1 152 ? -40.285 10.379  -27.221  1.00 129.72 ? 161 THR B C   1 
ATOM   6736  O O   . THR B 1 152 ? -40.103 10.912  -26.126  1.00 127.59 ? 161 THR B O   1 
ATOM   6737  C CB  . THR B 1 152 ? -37.978 11.091  -27.866  1.00 133.40 ? 161 THR B CB  1 
ATOM   6738  O OG1 . THR B 1 152 ? -37.135 11.465  -28.962  1.00 136.18 ? 161 THR B OG1 1 
ATOM   6739  C CG2 . THR B 1 152 ? -37.334 9.943   -27.104  1.00 135.29 ? 161 THR B CG2 1 
ATOM   6740  N N   . ALA B 1 153 ? -41.280 9.529   -27.458  1.00 131.83 ? 162 ALA B N   1 
ATOM   6741  C CA  . ALA B 1 153 ? -42.264 9.193   -26.435  1.00 129.46 ? 162 ALA B CA  1 
ATOM   6742  C C   . ALA B 1 153 ? -41.687 8.244   -25.390  1.00 130.68 ? 162 ALA B C   1 
ATOM   6743  O O   . ALA B 1 153 ? -41.090 7.221   -25.728  1.00 134.03 ? 162 ALA B O   1 
ATOM   6744  C CB  . ALA B 1 153 ? -43.508 8.590   -27.073  1.00 129.72 ? 162 ALA B CB  1 
ATOM   6745  N N   . ILE B 1 154 ? -41.873 8.588   -24.120  1.00 127.50 ? 163 ILE B N   1 
ATOM   6746  C CA  . ILE B 1 154 ? -41.377 7.765   -23.024  1.00 128.87 ? 163 ILE B CA  1 
ATOM   6747  C C   . ILE B 1 154 ? -42.400 7.667   -21.898  1.00 126.73 ? 163 ILE B C   1 
ATOM   6748  O O   . ILE B 1 154 ? -42.783 8.675   -21.305  1.00 123.92 ? 163 ILE B O   1 
ATOM   6749  C CB  . ILE B 1 154 ? -40.061 8.321   -22.456  1.00 129.50 ? 163 ILE B CB  1 
ATOM   6750  C CG1 . ILE B 1 154 ? -38.988 8.364   -23.544  1.00 132.09 ? 163 ILE B CG1 1 
ATOM   6751  C CG2 . ILE B 1 154 ? -39.595 7.479   -21.280  1.00 131.32 ? 163 ILE B CG2 1 
ATOM   6752  C CD1 . ILE B 1 154 ? -37.684 8.973   -23.089  1.00 132.89 ? 163 ILE B CD1 1 
ATOM   6753  N N   . ASN B 1 155 ? -42.838 6.446   -21.608  1.00 165.40 ? 164 ASN B N   1 
ATOM   6754  C CA  . ASN B 1 155 ? -43.800 6.214   -20.537  1.00 164.03 ? 164 ASN B CA  1 
ATOM   6755  C C   . ASN B 1 155 ? -43.169 6.416   -19.164  1.00 164.18 ? 164 ASN B C   1 
ATOM   6756  O O   . ASN B 1 155 ? -42.505 5.524   -18.636  1.00 167.15 ? 164 ASN B O   1 
ATOM   6757  C CB  . ASN B 1 155 ? -44.399 4.809   -20.646  1.00 166.36 ? 164 ASN B CB  1 
ATOM   6758  C CG  . ASN B 1 155 ? -45.558 4.591   -19.691  1.00 165.02 ? 164 ASN B CG  1 
ATOM   6759  O OD1 . ASN B 1 155 ? -45.984 5.510   -18.991  1.00 162.28 ? 164 ASN B OD1 1 
ATOM   6760  N ND2 . ASN B 1 155 ? -46.078 3.369   -19.661  1.00 167.27 ? 164 ASN B ND2 1 
ATOM   6761  N N   . VAL B 1 156 ? -43.382 7.597   -18.593  1.00 143.57 ? 165 VAL B N   1 
ATOM   6762  C CA  . VAL B 1 156 ? -42.824 7.940   -17.290  1.00 143.82 ? 165 VAL B CA  1 
ATOM   6763  C C   . VAL B 1 156 ? -43.777 7.525   -16.169  1.00 143.60 ? 165 VAL B C   1 
ATOM   6764  O O   . VAL B 1 156 ? -43.661 7.987   -15.034  1.00 143.40 ? 165 VAL B O   1 
ATOM   6765  C CB  . VAL B 1 156 ? -42.532 9.454   -17.199  1.00 141.44 ? 165 VAL B CB  1 
ATOM   6766  C CG1 . VAL B 1 156 ? -43.832 10.245  -17.142  1.00 138.32 ? 165 VAL B CG1 1 
ATOM   6767  C CG2 . VAL B 1 156 ? -41.650 9.768   -15.998  1.00 142.59 ? 165 VAL B CG2 1 
ATOM   6768  N N   . GLY B 1 157 ? -44.714 6.641   -16.496  1.00 183.86 ? 166 GLY B N   1 
ATOM   6769  C CA  . GLY B 1 157 ? -45.730 6.221   -15.549  1.00 183.80 ? 166 GLY B CA  1 
ATOM   6770  C C   . GLY B 1 157 ? -45.370 4.991   -14.735  1.00 187.48 ? 166 GLY B C   1 
ATOM   6771  O O   . GLY B 1 157 ? -45.474 5.000   -13.508  1.00 188.25 ? 166 GLY B O   1 
ATOM   6772  N N   . ASN B 1 158 ? -44.947 3.930   -15.415  1.00 248.09 ? 167 ASN B N   1 
ATOM   6773  C CA  . ASN B 1 158 ? -44.654 2.660   -14.754  1.00 252.18 ? 167 ASN B CA  1 
ATOM   6774  C C   . ASN B 1 158 ? -43.400 2.685   -13.890  1.00 254.70 ? 167 ASN B C   1 
ATOM   6775  O O   . ASN B 1 158 ? -42.867 1.635   -13.527  1.00 258.82 ? 167 ASN B O   1 
ATOM   6776  C CB  . ASN B 1 158 ? -44.542 1.532   -15.779  1.00 254.84 ? 167 ASN B CB  1 
ATOM   6777  C CG  . ASN B 1 158 ? -45.860 1.222   -16.447  1.00 253.48 ? 167 ASN B CG  1 
ATOM   6778  O OD1 . ASN B 1 158 ? -46.793 2.023   -16.409  1.00 250.02 ? 167 ASN B OD1 1 
ATOM   6779  N ND2 . ASN B 1 158 ? -45.946 0.052   -17.067  1.00 256.54 ? 167 ASN B ND2 1 
ATOM   6780  N N   . ILE B 1 159 ? -42.933 3.884   -13.564  1.00 241.65 ? 168 ILE B N   1 
ATOM   6781  C CA  . ILE B 1 159 ? -41.742 4.034   -12.738  1.00 244.04 ? 168 ILE B CA  1 
ATOM   6782  C C   . ILE B 1 159 ? -42.050 3.749   -11.269  1.00 245.95 ? 168 ILE B C   1 
ATOM   6783  O O   . ILE B 1 159 ? -42.754 4.520   -10.617  1.00 243.67 ? 168 ILE B O   1 
ATOM   6784  C CB  . ILE B 1 159 ? -41.152 5.450   -12.853  1.00 241.42 ? 168 ILE B CB  1 
ATOM   6785  C CG1 . ILE B 1 159 ? -40.812 5.766   -14.308  1.00 239.98 ? 168 ILE B CG1 1 
ATOM   6786  C CG2 . ILE B 1 159 ? -39.923 5.587   -11.976  1.00 244.22 ? 168 ILE B CG2 1 
ATOM   6787  C CD1 . ILE B 1 159 ? -40.043 7.054   -14.487  1.00 238.27 ? 168 ILE B CD1 1 
ATOM   6788  N N   . ASN B 1 160 ? -41.513 2.647   -10.749  1.00 250.05 ? 169 ASN B N   1 
ATOM   6789  C CA  . ASN B 1 160 ? -41.693 2.297   -9.339   1.00 252.84 ? 169 ASN B CA  1 
ATOM   6790  C C   . ASN B 1 160 ? -41.103 3.358   -8.410   1.00 252.54 ? 169 ASN B C   1 
ATOM   6791  O O   . ASN B 1 160 ? -39.919 3.668   -8.484   1.00 253.78 ? 169 ASN B O   1 
ATOM   6792  C CB  . ASN B 1 160 ? -41.118 0.905   -9.029   1.00 258.53 ? 169 ASN B CB  1 
ATOM   6793  C CG  . ASN B 1 160 ? -39.644 0.773   -9.398   1.00 261.21 ? 169 ASN B CG  1 
ATOM   6794  O OD1 . ASN B 1 160 ? -39.090 1.604   -10.121  1.00 258.64 ? 169 ASN B OD1 1 
ATOM   6795  N ND2 . ASN B 1 160 ? -39.006 -0.284  -8.906   1.00 266.75 ? 169 ASN B ND2 1 
ATOM   6796  N N   . ASN B 1 161 ? -41.934 3.901   -7.526   1.00 240.13 ? 170 ASN B N   1 
ATOM   6797  C CA  . ASN B 1 161 ? -41.558 5.066   -6.723   1.00 239.41 ? 170 ASN B CA  1 
ATOM   6798  C C   . ASN B 1 161 ? -40.624 4.826   -5.516   1.00 244.31 ? 170 ASN B C   1 
ATOM   6799  O O   . ASN B 1 161 ? -40.127 5.791   -4.930   1.00 244.18 ? 170 ASN B O   1 
ATOM   6800  C CB  . ASN B 1 161 ? -42.822 5.807   -6.255   1.00 236.48 ? 170 ASN B CB  1 
ATOM   6801  C CG  . ASN B 1 161 ? -43.433 6.692   -7.337   1.00 231.32 ? 170 ASN B CG  1 
ATOM   6802  O OD1 . ASN B 1 161 ? -42.910 6.796   -8.446   1.00 229.86 ? 170 ASN B OD1 1 
ATOM   6803  N ND2 . ASN B 1 161 ? -44.548 7.343   -7.006   1.00 228.94 ? 170 ASN B ND2 1 
ATOM   6804  N N   . ASP B 1 162 ? -40.417 3.558   -5.143   1.00 262.37 ? 171 ASP B N   1 
ATOM   6805  C CA  . ASP B 1 162 ? -39.574 3.165   -3.995   1.00 267.93 ? 171 ASP B CA  1 
ATOM   6806  C C   . ASP B 1 162 ? -38.113 2.915   -4.399   1.00 270.63 ? 171 ASP B C   1 
ATOM   6807  O O   . ASP B 1 162 ? -37.439 2.056   -3.833   1.00 276.10 ? 171 ASP B O   1 
ATOM   6808  C CB  . ASP B 1 162 ? -40.140 1.924   -3.297   1.00 272.25 ? 171 ASP B CB  1 
ATOM   6809  C CG  . ASP B 1 162 ? -41.539 2.147   -2.777   1.00 270.32 ? 171 ASP B CG  1 
ATOM   6810  O OD1 . ASP B 1 162 ? -42.507 1.932   -3.542   1.00 267.13 ? 171 ASP B OD1 1 
ATOM   6811  O OD2 . ASP B 1 162 ? -41.673 2.555   -1.601   1.00 272.27 ? 171 ASP B OD2 1 
ATOM   6812  N N   . LYS B 1 163 ? -37.630 3.680   -5.375   1.00 227.78 ? 172 LYS B N   1 
ATOM   6813  C CA  . LYS B 1 163 ? -36.294 3.507   -5.950   1.00 229.90 ? 172 LYS B CA  1 
ATOM   6814  C C   . LYS B 1 163 ? -36.250 4.247   -7.284   1.00 225.08 ? 172 LYS B C   1 
ATOM   6815  O O   . LYS B 1 163 ? -35.466 3.919   -8.157   1.00 226.08 ? 172 LYS B O   1 
ATOM   6816  C CB  . LYS B 1 163 ? -35.962 2.017   -6.143   1.00 234.66 ? 172 LYS B CB  1 
ATOM   6817  N N   . LYS B 1 164 ? -37.124 5.235   -7.449   1.00 230.64 ? 173 LYS B N   1 
ATOM   6818  C CA  . LYS B 1 164 ? -37.218 5.956   -8.723   1.00 226.26 ? 173 LYS B CA  1 
ATOM   6819  C C   . LYS B 1 164 ? -36.189 7.080   -8.844   1.00 225.52 ? 173 LYS B C   1 
ATOM   6820  O O   . LYS B 1 164 ? -36.526 8.257   -8.723   1.00 222.35 ? 173 LYS B O   1 
ATOM   6821  C CB  . LYS B 1 164 ? -38.622 6.528   -8.943   1.00 221.68 ? 173 LYS B CB  1 
ATOM   6822  N N   . ASP B 1 165 ? -34.939 6.717   -9.101   1.00 254.55 ? 174 ASP B N   1 
ATOM   6823  C CA  . ASP B 1 165 ? -33.865 7.696   -9.209   1.00 254.50 ? 174 ASP B CA  1 
ATOM   6824  C C   . ASP B 1 165 ? -32.863 7.244   -10.264  1.00 256.29 ? 174 ASP B C   1 
ATOM   6825  O O   . ASP B 1 165 ? -32.440 8.033   -11.114  1.00 254.24 ? 174 ASP B O   1 
ATOM   6826  C CB  . ASP B 1 165 ? -33.174 7.869   -7.856   1.00 258.14 ? 174 ASP B CB  1 
ATOM   6827  C CG  . ASP B 1 165 ? -32.695 9.288   -7.622   1.00 256.54 ? 174 ASP B CG  1 
ATOM   6828  O OD1 . ASP B 1 165 ? -33.332 10.219  -8.157   1.00 252.11 ? 174 ASP B OD1 1 
ATOM   6829  O OD2 . ASP B 1 165 ? -31.690 9.476   -6.900   1.00 260.02 ? 174 ASP B OD2 1 
ATOM   6830  N N   . GLU B 1 166 ? -32.488 5.968   -10.200  1.00 244.61 ? 175 GLU B N   1 
ATOM   6831  C CA  . GLU B 1 166 ? -31.635 5.368   -11.217  1.00 246.91 ? 175 GLU B CA  1 
ATOM   6832  C C   . GLU B 1 166 ? -32.415 5.231   -12.518  1.00 243.70 ? 175 GLU B C   1 
ATOM   6833  O O   . GLU B 1 166 ? -31.859 4.869   -13.557  1.00 245.02 ? 175 GLU B O   1 
ATOM   6834  C CB  . GLU B 1 166 ? -31.133 4.000   -10.758  1.00 252.71 ? 175 GLU B CB  1 
ATOM   6835  N N   . THR B 1 167 ? -33.712 5.512   -12.445  1.00 279.18 ? 176 THR B N   1 
ATOM   6836  C CA  . THR B 1 167 ? -34.580 5.468   -13.614  1.00 276.08 ? 176 THR B CA  1 
ATOM   6837  C C   . THR B 1 167 ? -34.618 6.825   -14.309  1.00 272.03 ? 176 THR B C   1 
ATOM   6838  O O   . THR B 1 167 ? -34.599 6.908   -15.535  1.00 271.05 ? 176 THR B O   1 
ATOM   6839  C CB  . THR B 1 167 ? -36.014 5.059   -13.232  1.00 274.28 ? 176 THR B CB  1 
ATOM   6840  O OG1 . THR B 1 167 ? -36.537 5.977   -12.262  1.00 271.85 ? 176 THR B OG1 1 
ATOM   6841  C CG2 . THR B 1 167 ? -36.032 3.651   -12.651  1.00 278.64 ? 176 THR B CG2 1 
ATOM   6842  N N   . TYR B 1 168 ? -34.676 7.889   -13.516  1.00 183.27 ? 177 TYR B N   1 
ATOM   6843  C CA  . TYR B 1 168 ? -34.658 9.247   -14.052  1.00 179.93 ? 177 TYR B CA  1 
ATOM   6844  C C   . TYR B 1 168 ? -33.292 9.598   -14.630  1.00 181.82 ? 177 TYR B C   1 
ATOM   6845  O O   . TYR B 1 168 ? -33.198 10.282  -15.650  1.00 180.04 ? 177 TYR B O   1 
ATOM   6846  C CB  . TYR B 1 168 ? -35.053 10.265  -12.977  1.00 178.04 ? 177 TYR B CB  1 
ATOM   6847  C CG  . TYR B 1 168 ? -36.545 10.395  -12.774  1.00 174.93 ? 177 TYR B CG  1 
ATOM   6848  C CD1 . TYR B 1 168 ? -37.191 9.705   -11.758  1.00 176.08 ? 177 TYR B CD1 1 
ATOM   6849  C CD2 . TYR B 1 168 ? -37.310 11.201  -13.608  1.00 171.25 ? 177 TYR B CD2 1 
ATOM   6850  C CE1 . TYR B 1 168 ? -38.561 9.821   -11.573  1.00 173.48 ? 177 TYR B CE1 1 
ATOM   6851  C CE2 . TYR B 1 168 ? -38.674 11.322  -13.432  1.00 168.71 ? 177 TYR B CE2 1 
ATOM   6852  C CZ  . TYR B 1 168 ? -39.295 10.631  -12.415  1.00 169.76 ? 177 TYR B CZ  1 
ATOM   6853  O OH  . TYR B 1 168 ? -40.654 10.753  -12.241  1.00 167.46 ? 177 TYR B OH  1 
ATOM   6854  N N   . ARG B 1 169 ? -32.237 9.120   -13.978  1.00 235.81 ? 178 ARG B N   1 
ATOM   6855  C CA  . ARG B 1 169 ? -30.882 9.330   -14.467  1.00 238.28 ? 178 ARG B CA  1 
ATOM   6856  C C   . ARG B 1 169 ? -30.692 8.617   -15.800  1.00 239.47 ? 178 ARG B C   1 
ATOM   6857  O O   . ARG B 1 169 ? -29.987 9.105   -16.685  1.00 239.78 ? 178 ARG B O   1 
ATOM   6858  C CB  . ARG B 1 169 ? -29.858 8.827   -13.449  1.00 242.88 ? 178 ARG B CB  1 
ATOM   6859  N N   . SER B 1 170 ? -31.327 7.457   -15.935  1.00 255.47 ? 179 SER B N   1 
ATOM   6860  C CA  . SER B 1 170 ? -31.270 6.688   -17.171  1.00 256.98 ? 179 SER B CA  1 
ATOM   6861  C C   . SER B 1 170 ? -32.303 7.203   -18.167  1.00 252.95 ? 179 SER B C   1 
ATOM   6862  O O   . SER B 1 170 ? -32.297 6.824   -19.338  1.00 253.85 ? 179 SER B O   1 
ATOM   6863  C CB  . SER B 1 170 ? -31.505 5.202   -16.891  1.00 260.31 ? 179 SER B CB  1 
ATOM   6864  O OG  . SER B 1 170 ? -31.415 4.437   -18.080  1.00 262.32 ? 179 SER B OG  1 
ATOM   6865  N N   . LEU B 1 171 ? -33.191 8.071   -17.691  1.00 187.71 ? 180 LEU B N   1 
ATOM   6866  C CA  . LEU B 1 171 ? -34.214 8.667   -18.541  1.00 184.00 ? 180 LEU B CA  1 
ATOM   6867  C C   . LEU B 1 171 ? -33.650 9.845   -19.325  1.00 182.88 ? 180 LEU B C   1 
ATOM   6868  O O   . LEU B 1 171 ? -33.831 9.939   -20.539  1.00 182.56 ? 180 LEU B O   1 
ATOM   6869  C CB  . LEU B 1 171 ? -35.410 9.123   -17.704  1.00 180.58 ? 180 LEU B CB  1 
ATOM   6870  C CG  . LEU B 1 171 ? -36.476 9.923   -18.455  1.00 176.80 ? 180 LEU B CG  1 
ATOM   6871  C CD1 . LEU B 1 171 ? -37.011 9.124   -19.629  1.00 177.37 ? 180 LEU B CD1 1 
ATOM   6872  C CD2 . LEU B 1 171 ? -37.603 10.327  -17.519  1.00 174.00 ? 180 LEU B CD2 1 
ATOM   6873  N N   . PHE B 1 172 ? -32.968 10.743  -18.622  1.00 179.54 ? 181 PHE B N   1 
ATOM   6874  C CA  . PHE B 1 172 ? -32.357 11.906  -19.255  1.00 178.88 ? 181 PHE B CA  1 
ATOM   6875  C C   . PHE B 1 172 ? -31.027 11.542  -19.909  1.00 182.71 ? 181 PHE B C   1 
ATOM   6876  O O   . PHE B 1 172 ? -30.368 12.388  -20.515  1.00 182.97 ? 181 PHE B O   1 
ATOM   6877  C CB  . PHE B 1 172 ? -32.172 13.036  -18.241  1.00 177.43 ? 181 PHE B CB  1 
ATOM   6878  C CG  . PHE B 1 172 ? -33.465 13.627  -17.756  1.00 173.76 ? 181 PHE B CG  1 
ATOM   6879  C CD1 . PHE B 1 172 ? -34.040 14.701  -18.414  1.00 171.06 ? 181 PHE B CD1 1 
ATOM   6880  C CD2 . PHE B 1 172 ? -34.110 13.104  -16.647  1.00 173.43 ? 181 PHE B CD2 1 
ATOM   6881  C CE1 . PHE B 1 172 ? -35.231 15.245  -17.974  1.00 168.06 ? 181 PHE B CE1 1 
ATOM   6882  C CE2 . PHE B 1 172 ? -35.302 13.644  -16.202  1.00 170.39 ? 181 PHE B CE2 1 
ATOM   6883  C CZ  . PHE B 1 172 ? -35.863 14.716  -16.867  1.00 167.68 ? 181 PHE B CZ  1 
ATOM   6884  N N   . GLN B 1 173 ? -30.641 10.277  -19.779  1.00 185.99 ? 182 GLN B N   1 
ATOM   6885  C CA  . GLN B 1 173 ? -29.458 9.764   -20.455  1.00 190.16 ? 182 GLN B CA  1 
ATOM   6886  C C   . GLN B 1 173 ? -29.806 9.471   -21.909  1.00 190.46 ? 182 GLN B C   1 
ATOM   6887  O O   . GLN B 1 173 ? -28.979 9.641   -22.805  1.00 192.77 ? 182 GLN B O   1 
ATOM   6888  C CB  . GLN B 1 173 ? -28.952 8.496   -19.766  1.00 194.11 ? 182 GLN B CB  1 
ATOM   6889  N N   . ASP B 1 174 ? -31.040 9.030   -22.132  1.00 213.55 ? 183 ASP B N   1 
ATOM   6890  C CA  . ASP B 1 174 ? -31.540 8.788   -23.480  1.00 213.77 ? 183 ASP B CA  1 
ATOM   6891  C C   . ASP B 1 174 ? -31.973 10.102  -24.119  1.00 210.64 ? 183 ASP B C   1 
ATOM   6892  O O   . ASP B 1 174 ? -31.949 10.250  -25.342  1.00 211.67 ? 183 ASP B O   1 
ATOM   6893  C CB  . ASP B 1 174 ? -32.714 7.807   -23.449  1.00 213.12 ? 183 ASP B CB  1 
ATOM   6894  C CG  . ASP B 1 174 ? -32.319 6.442   -22.919  1.00 216.85 ? 183 ASP B CG  1 
ATOM   6895  O OD1 . ASP B 1 174 ? -31.106 6.196   -22.749  1.00 220.33 ? 183 ASP B OD1 1 
ATOM   6896  O OD2 . ASP B 1 174 ? -33.222 5.614   -22.674  1.00 216.60 ? 183 ASP B OD2 1 
ATOM   6897  N N   . LEU B 1 175 ? -32.366 11.054  -23.279  1.00 178.64 ? 184 LEU B N   1 
ATOM   6898  C CA  . LEU B 1 175 ? -32.767 12.375  -23.747  1.00 175.90 ? 184 LEU B CA  1 
ATOM   6899  C C   . LEU B 1 175 ? -31.545 13.257  -23.969  1.00 177.45 ? 184 LEU B C   1 
ATOM   6900  O O   . LEU B 1 175 ? -31.663 14.470  -24.138  1.00 175.63 ? 184 LEU B O   1 
ATOM   6901  C CB  . LEU B 1 175 ? -33.715 13.034  -22.744  1.00 172.06 ? 184 LEU B CB  1 
ATOM   6902  C CG  . LEU B 1 175 ? -35.025 12.297  -22.465  1.00 170.30 ? 184 LEU B CG  1 
ATOM   6903  C CD1 . LEU B 1 175 ? -35.830 13.021  -21.397  1.00 167.02 ? 184 LEU B CD1 1 
ATOM   6904  C CD2 . LEU B 1 175 ? -35.837 12.139  -23.741  1.00 169.96 ? 184 LEU B CD2 1 
ATOM   6905  N N   . GLU B 1 176 ? -30.369 12.637  -23.964  1.00 213.64 ? 185 GLU B N   1 
ATOM   6906  C CA  . GLU B 1 176 ? -29.125 13.357  -24.194  1.00 215.72 ? 185 GLU B CA  1 
ATOM   6907  C C   . GLU B 1 176 ? -28.414 12.821  -25.433  1.00 219.67 ? 185 GLU B C   1 
ATOM   6908  O O   . GLU B 1 176 ? -27.530 13.477  -25.987  1.00 221.54 ? 185 GLU B O   1 
ATOM   6909  C CB  . GLU B 1 176 ? -28.213 13.262  -22.969  1.00 217.14 ? 185 GLU B CB  1 
ATOM   6910  C CG  . GLU B 1 176 ? -27.076 14.269  -22.969  1.00 218.53 ? 185 GLU B CG  1 
ATOM   6911  C CD  . GLU B 1 176 ? -27.569 15.704  -23.000  1.00 215.27 ? 185 GLU B CD  1 
ATOM   6912  O OE1 . GLU B 1 176 ? -26.802 16.586  -23.440  1.00 216.49 ? 185 GLU B OE1 1 
ATOM   6913  O OE2 . GLU B 1 176 ? -28.723 15.949  -22.587  1.00 211.79 ? 185 GLU B OE2 1 
ATOM   6914  N N   . LEU B 1 177 ? -28.805 11.625  -25.863  1.00 267.68 ? 186 LEU B N   1 
ATOM   6915  C CA  . LEU B 1 177 ? -28.266 11.039  -27.084  1.00 271.76 ? 186 LEU B CA  1 
ATOM   6916  C C   . LEU B 1 177 ? -28.599 11.932  -28.273  1.00 271.11 ? 186 LEU B C   1 
ATOM   6917  O O   . LEU B 1 177 ? -27.791 12.095  -29.188  1.00 274.46 ? 186 LEU B O   1 
ATOM   6918  C CB  . LEU B 1 177 ? -28.835 9.636   -27.306  1.00 273.38 ? 186 LEU B CB  1 
ATOM   6919  C CG  . LEU B 1 177 ? -28.456 8.567   -26.280  1.00 275.28 ? 186 LEU B CG  1 
ATOM   6920  C CD1 . LEU B 1 177 ? -29.215 7.275   -26.544  1.00 276.60 ? 186 LEU B CD1 1 
ATOM   6921  C CD2 . LEU B 1 177 ? -26.955 8.322   -26.288  1.00 279.94 ? 186 LEU B CD2 1 
ATOM   6922  N N   . LYS B 1 178 ? -29.797 12.506  -28.249  1.00 269.60 ? 187 LYS B N   1 
ATOM   6923  C CA  . LYS B 1 178 ? -30.234 13.427  -29.290  1.00 268.95 ? 187 LYS B CA  1 
ATOM   6924  C C   . LYS B 1 178 ? -30.246 14.858  -28.761  1.00 266.00 ? 187 LYS B C   1 
ATOM   6925  O O   . LYS B 1 178 ? -30.779 15.764  -29.403  1.00 264.86 ? 187 LYS B O   1 
ATOM   6926  C CB  . LYS B 1 178 ? -31.623 13.039  -29.802  1.00 267.32 ? 187 LYS B CB  1 
ATOM   6927  N N   . LYS B 1 179 ? -29.655 15.048  -27.586  1.00 175.14 ? 188 LYS B N   1 
ATOM   6928  C CA  . LYS B 1 179 ? -29.573 16.365  -26.962  1.00 172.83 ? 188 LYS B CA  1 
ATOM   6929  C C   . LYS B 1 179 ? -30.936 17.047  -26.902  1.00 168.96 ? 188 LYS B C   1 
ATOM   6930  O O   . LYS B 1 179 ? -31.073 18.213  -27.275  1.00 168.19 ? 188 LYS B O   1 
ATOM   6931  C CB  . LYS B 1 179 ? -28.571 17.250  -27.708  1.00 175.38 ? 188 LYS B CB  1 
ATOM   6932  N N   . GLU B 1 180 ? -31.940 16.315  -26.429  1.00 156.07 ? 189 GLU B N   1 
ATOM   6933  C CA  . GLU B 1 180 ? -33.291 16.851  -26.311  1.00 152.60 ? 189 GLU B CA  1 
ATOM   6934  C C   . GLU B 1 180 ? -33.336 18.020  -25.334  1.00 150.25 ? 189 GLU B C   1 
ATOM   6935  O O   . GLU B 1 180 ? -32.957 17.885  -24.171  1.00 149.82 ? 189 GLU B O   1 
ATOM   6936  C CB  . GLU B 1 180 ? -34.267 15.758  -25.868  1.00 151.18 ? 189 GLU B CB  1 
ATOM   6937  C CG  . GLU B 1 180 ? -34.520 14.685  -26.915  1.00 153.34 ? 189 GLU B CG  1 
ATOM   6938  C CD  . GLU B 1 180 ? -35.329 15.196  -28.092  1.00 153.08 ? 189 GLU B CD  1 
ATOM   6939  O OE1 . GLU B 1 180 ? -35.908 16.298  -27.985  1.00 150.75 ? 189 GLU B OE1 1 
ATOM   6940  O OE2 . GLU B 1 180 ? -35.388 14.492  -29.123  1.00 155.58 ? 189 GLU B OE2 1 
ATOM   6941  N N   . ARG B 1 181 ? -33.801 19.168  -25.814  1.00 151.62 ? 190 ARG B N   1 
ATOM   6942  C CA  . ARG B 1 181 ? -33.902 20.363  -24.986  1.00 149.79 ? 190 ARG B CA  1 
ATOM   6943  C C   . ARG B 1 181 ? -35.353 20.812  -24.847  1.00 146.90 ? 190 ARG B C   1 
ATOM   6944  O O   . ARG B 1 181 ? -35.656 21.748  -24.110  1.00 145.34 ? 190 ARG B O   1 
ATOM   6945  C CB  . ARG B 1 181 ? -33.059 21.495  -25.576  1.00 151.67 ? 190 ARG B CB  1 
ATOM   6946  C CG  . ARG B 1 181 ? -31.560 21.247  -25.523  1.00 154.60 ? 190 ARG B CG  1 
ATOM   6947  C CD  . ARG B 1 181 ? -31.045 21.282  -24.093  1.00 154.02 ? 190 ARG B CD  1 
ATOM   6948  N NE  . ARG B 1 181 ? -29.612 21.012  -24.018  1.00 157.12 ? 190 ARG B NE  1 
ATOM   6949  C CZ  . ARG B 1 181 ? -29.088 19.809  -23.809  1.00 158.78 ? 190 ARG B CZ  1 
ATOM   6950  N NH1 . ARG B 1 181 ? -29.880 18.757  -23.650  1.00 157.61 ? 190 ARG B NH1 1 
ATOM   6951  N NH2 . ARG B 1 181 ? -27.772 19.656  -23.755  1.00 161.93 ? 190 ARG B NH2 1 
ATOM   6952  N N   . ARG B 1 182 ? -36.247 20.137  -25.561  1.00 126.72 ? 191 ARG B N   1 
ATOM   6953  C CA  . ARG B 1 182 ? -37.663 20.484  -25.537  1.00 124.35 ? 191 ARG B CA  1 
ATOM   6954  C C   . ARG B 1 182 ? -38.513 19.297  -25.096  1.00 122.99 ? 191 ARG B C   1 
ATOM   6955  O O   . ARG B 1 182 ? -38.668 18.324  -25.833  1.00 124.19 ? 191 ARG B O   1 
ATOM   6956  C CB  . ARG B 1 182 ? -38.109 20.988  -26.910  1.00 125.51 ? 191 ARG B CB  1 
ATOM   6957  C CG  . ARG B 1 182 ? -37.388 22.253  -27.348  1.00 127.09 ? 191 ARG B CG  1 
ATOM   6958  C CD  . ARG B 1 182 ? -37.710 22.630  -28.783  1.00 129.13 ? 191 ARG B CD  1 
ATOM   6959  N NE  . ARG B 1 182 ? -37.078 23.892  -29.159  1.00 130.87 ? 191 ARG B NE  1 
ATOM   6960  C CZ  . ARG B 1 182 ? -37.150 24.435  -30.369  1.00 133.38 ? 191 ARG B CZ  1 
ATOM   6961  N NH1 . ARG B 1 182 ? -37.828 23.826  -31.333  1.00 134.46 ? 191 ARG B NH1 1 
ATOM   6962  N NH2 . ARG B 1 182 ? -36.542 25.588  -30.617  1.00 135.17 ? 191 ARG B NH2 1 
ATOM   6963  N N   . VAL B 1 183 ? -39.062 19.388  -23.889  1.00 117.30 ? 192 VAL B N   1 
ATOM   6964  C CA  . VAL B 1 183 ? -39.816 18.287  -23.302  1.00 116.22 ? 192 VAL B CA  1 
ATOM   6965  C C   . VAL B 1 183 ? -41.276 18.657  -23.056  1.00 113.88 ? 192 VAL B C   1 
ATOM   6966  O O   . VAL B 1 183 ? -41.583 19.777  -22.648  1.00 112.73 ? 192 VAL B O   1 
ATOM   6967  C CB  . VAL B 1 183 ? -39.190 17.836  -21.968  1.00 116.34 ? 192 VAL B CB  1 
ATOM   6968  C CG1 . VAL B 1 183 ? -39.936 16.636  -21.408  1.00 115.79 ? 192 VAL B CG1 1 
ATOM   6969  C CG2 . VAL B 1 183 ? -37.717 17.516  -22.155  1.00 118.96 ? 192 VAL B CG2 1 
ATOM   6970  N N   . ILE B 1 184 ? -42.172 17.708  -23.309  1.00 117.56 ? 193 ILE B N   1 
ATOM   6971  C CA  . ILE B 1 184 ? -43.591 17.892  -23.028  1.00 115.60 ? 193 ILE B CA  1 
ATOM   6972  C C   . ILE B 1 184 ? -44.027 16.948  -21.916  1.00 114.81 ? 193 ILE B C   1 
ATOM   6973  O O   . ILE B 1 184 ? -43.992 15.729  -22.078  1.00 115.83 ? 193 ILE B O   1 
ATOM   6974  C CB  . ILE B 1 184 ? -44.456 17.630  -24.273  1.00 116.07 ? 193 ILE B CB  1 
ATOM   6975  C CG1 . ILE B 1 184 ? -44.059 18.572  -25.409  1.00 117.40 ? 193 ILE B CG1 1 
ATOM   6976  C CG2 . ILE B 1 184 ? -45.930 17.796  -23.941  1.00 114.26 ? 193 ILE B CG2 1 
ATOM   6977  C CD1 . ILE B 1 184 ? -44.911 18.418  -26.649  1.00 118.39 ? 193 ILE B CD1 1 
ATOM   6978  N N   . LEU B 1 185 ? -44.433 17.515  -20.784  1.00 108.63 ? 194 LEU B N   1 
ATOM   6979  C CA  . LEU B 1 185 ? -44.855 16.715  -19.642  1.00 108.23 ? 194 LEU B CA  1 
ATOM   6980  C C   . LEU B 1 185 ? -46.366 16.508  -19.623  1.00 106.92 ? 194 LEU B C   1 
ATOM   6981  O O   . LEU B 1 185 ? -47.122 17.399  -19.236  1.00 105.67 ? 194 LEU B O   1 
ATOM   6982  C CB  . LEU B 1 185 ? -44.394 17.360  -18.334  1.00 108.08 ? 194 LEU B CB  1 
ATOM   6983  C CG  . LEU B 1 185 ? -42.882 17.449  -18.128  1.00 109.70 ? 194 LEU B CG  1 
ATOM   6984  C CD1 . LEU B 1 185 ? -42.555 17.957  -16.734  1.00 109.92 ? 194 LEU B CD1 1 
ATOM   6985  C CD2 . LEU B 1 185 ? -42.230 16.099  -18.379  1.00 111.49 ? 194 LEU B CD2 1 
ATOM   6986  N N   . ASP B 1 186 ? -46.799 15.325  -20.046  1.00 121.51 ? 195 ASP B N   1 
ATOM   6987  C CA  . ASP B 1 186 ? -48.212 14.972  -20.021  1.00 120.61 ? 195 ASP B CA  1 
ATOM   6988  C C   . ASP B 1 186 ? -48.506 14.098  -18.810  1.00 120.82 ? 195 ASP B C   1 
ATOM   6989  O O   . ASP B 1 186 ? -48.611 12.878  -18.926  1.00 121.98 ? 195 ASP B O   1 
ATOM   6990  C CB  . ASP B 1 186 ? -48.599 14.235  -21.303  1.00 121.53 ? 195 ASP B CB  1 
ATOM   6991  C CG  . ASP B 1 186 ? -50.087 13.966  -21.395  1.00 120.80 ? 195 ASP B CG  1 
ATOM   6992  O OD1 . ASP B 1 186 ? -50.869 14.723  -20.780  1.00 119.38 ? 195 ASP B OD1 1 
ATOM   6993  O OD2 . ASP B 1 186 ? -50.476 12.999  -22.084  1.00 121.91 ? 195 ASP B OD2 1 
ATOM   6994  N N   . CYS B 1 187 ? -48.636 14.728  -17.647  1.00 136.96 ? 196 CYS B N   1 
ATOM   6995  C CA  . CYS B 1 187 ? -48.841 13.996  -16.404  1.00 137.65 ? 196 CYS B CA  1 
ATOM   6996  C C   . CYS B 1 187 ? -49.837 14.702  -15.490  1.00 136.62 ? 196 CYS B C   1 
ATOM   6997  O O   . CYS B 1 187 ? -50.335 15.783  -15.808  1.00 135.39 ? 196 CYS B O   1 
ATOM   6998  C CB  . CYS B 1 187 ? -47.511 13.821  -15.672  1.00 139.18 ? 196 CYS B CB  1 
ATOM   6999  S SG  . CYS B 1 187 ? -46.174 13.213  -16.713  1.00 140.78 ? 196 CYS B SG  1 
ATOM   7000  N N   . GLU B 1 188 ? -50.123 14.078  -14.352  1.00 134.67 ? 197 GLU B N   1 
ATOM   7001  C CA  . GLU B 1 188 ? -50.996 14.674  -13.350  1.00 134.31 ? 197 GLU B CA  1 
ATOM   7002  C C   . GLU B 1 188 ? -50.233 15.728  -12.558  1.00 134.64 ? 197 GLU B C   1 
ATOM   7003  O O   . GLU B 1 188 ? -49.012 15.830  -12.668  1.00 135.30 ? 197 GLU B O   1 
ATOM   7004  C CB  . GLU B 1 188 ? -51.543 13.599  -12.410  1.00 135.74 ? 197 GLU B CB  1 
ATOM   7005  N N   . ARG B 1 189 ? -50.954 16.507  -11.760  1.00 108.76 ? 198 ARG B N   1 
ATOM   7006  C CA  . ARG B 1 189 ? -50.342 17.574  -10.975  1.00 109.43 ? 198 ARG B CA  1 
ATOM   7007  C C   . ARG B 1 189 ? -49.252 17.049  -10.043  1.00 111.55 ? 198 ARG B C   1 
ATOM   7008  O O   . ARG B 1 189 ? -48.375 17.798  -9.616   1.00 112.38 ? 198 ARG B O   1 
ATOM   7009  C CB  . ARG B 1 189 ? -51.405 18.324  -10.168  1.00 109.60 ? 198 ARG B CB  1 
ATOM   7010  N N   . ASP B 1 190 ? -49.312 15.758  -9.731   1.00 145.30 ? 199 ASP B N   1 
ATOM   7011  C CA  . ASP B 1 190 ? -48.350 15.145  -8.823   1.00 147.89 ? 199 ASP B CA  1 
ATOM   7012  C C   . ASP B 1 190 ? -47.103 14.659  -9.557   1.00 148.33 ? 199 ASP B C   1 
ATOM   7013  O O   . ASP B 1 190 ? -45.983 15.023  -9.198   1.00 149.63 ? 199 ASP B O   1 
ATOM   7014  C CB  . ASP B 1 190 ? -48.996 13.988  -8.059   1.00 149.69 ? 199 ASP B CB  1 
ATOM   7015  C CG  . ASP B 1 190 ? -50.099 14.449  -7.128   1.00 150.07 ? 199 ASP B CG  1 
ATOM   7016  O OD1 . ASP B 1 190 ? -50.379 15.666  -7.093   1.00 148.95 ? 199 ASP B OD1 1 
ATOM   7017  O OD2 . ASP B 1 190 ? -50.686 13.595  -6.431   1.00 151.84 ? 199 ASP B OD2 1 
ATOM   7018  N N   . LYS B 1 191 ? -47.303 13.837  -10.582  1.00 145.63 ? 200 LYS B N   1 
ATOM   7019  C CA  . LYS B 1 191 ? -46.193 13.298  -11.360  1.00 146.39 ? 200 LYS B CA  1 
ATOM   7020  C C   . LYS B 1 191 ? -45.370 14.413  -11.998  1.00 145.35 ? 200 LYS B C   1 
ATOM   7021  O O   . LYS B 1 191 ? -44.207 14.214  -12.347  1.00 146.53 ? 200 LYS B O   1 
ATOM   7022  C CB  . LYS B 1 191 ? -46.707 12.339  -12.437  1.00 145.86 ? 200 LYS B CB  1 
ATOM   7023  N N   . VAL B 1 192 ? -45.981 15.584  -12.149  1.00 111.36 ? 201 VAL B N   1 
ATOM   7024  C CA  . VAL B 1 192 ? -45.294 16.737  -12.720  1.00 110.63 ? 201 VAL B CA  1 
ATOM   7025  C C   . VAL B 1 192 ? -44.284 17.319  -11.737  1.00 112.29 ? 201 VAL B C   1 
ATOM   7026  O O   . VAL B 1 192 ? -43.143 17.594  -12.101  1.00 113.04 ? 201 VAL B O   1 
ATOM   7027  C CB  . VAL B 1 192 ? -46.283 17.836  -13.149  1.00 108.64 ? 201 VAL B CB  1 
ATOM   7028  C CG1 . VAL B 1 192 ? -45.550 19.143  -13.408  1.00 108.55 ? 201 VAL B CG1 1 
ATOM   7029  C CG2 . VAL B 1 192 ? -47.055 17.400  -14.383  1.00 107.32 ? 201 VAL B CG2 1 
ATOM   7030  N N   . ASN B 1 193 ? -44.708 17.503  -10.492  1.00 134.08 ? 202 ASN B N   1 
ATOM   7031  C CA  . ASN B 1 193 ? -43.820 18.021  -9.459   1.00 136.18 ? 202 ASN B CA  1 
ATOM   7032  C C   . ASN B 1 193 ? -42.615 17.117  -9.232   1.00 138.57 ? 202 ASN B C   1 
ATOM   7033  O O   . ASN B 1 193 ? -41.510 17.595  -8.979   1.00 140.07 ? 202 ASN B O   1 
ATOM   7034  C CB  . ASN B 1 193 ? -44.579 18.231  -8.148   1.00 137.29 ? 202 ASN B CB  1 
ATOM   7035  C CG  . ASN B 1 193 ? -45.457 19.468  -8.176   1.00 135.80 ? 202 ASN B CG  1 
ATOM   7036  O OD1 . ASN B 1 193 ? -45.449 20.227  -9.146   1.00 134.05 ? 202 ASN B OD1 1 
ATOM   7037  N ND2 . ASN B 1 193 ? -46.218 19.678  -7.108   1.00 136.91 ? 202 ASN B ND2 1 
ATOM   7038  N N   . ASP B 1 194 ? -42.835 15.809  -9.322   1.00 157.28 ? 203 ASP B N   1 
ATOM   7039  C CA  . ASP B 1 194 ? -41.753 14.843  -9.182   1.00 159.94 ? 203 ASP B CA  1 
ATOM   7040  C C   . ASP B 1 194 ? -40.713 15.046  -10.278  1.00 159.62 ? 203 ASP B C   1 
ATOM   7041  O O   . ASP B 1 194 ? -39.511 15.074  -10.011  1.00 161.82 ? 203 ASP B O   1 
ATOM   7042  C CB  . ASP B 1 194 ? -42.297 13.413  -9.232   1.00 160.78 ? 203 ASP B CB  1 
ATOM   7043  C CG  . ASP B 1 194 ? -43.189 13.086  -8.050   1.00 161.93 ? 203 ASP B CG  1 
ATOM   7044  O OD1 . ASP B 1 194 ? -43.389 13.969  -7.189   1.00 162.14 ? 203 ASP B OD1 1 
ATOM   7045  O OD2 . ASP B 1 194 ? -43.689 11.943  -7.982   1.00 162.95 ? 203 ASP B OD2 1 
ATOM   7046  N N   . ILE B 1 195 ? -41.185 15.189  -11.512  1.00 118.26 ? 204 ILE B N   1 
ATOM   7047  C CA  . ILE B 1 195 ? -40.304 15.421  -12.649  1.00 118.12 ? 204 ILE B CA  1 
ATOM   7048  C C   . ILE B 1 195 ? -39.603 16.770  -12.529  1.00 118.02 ? 204 ILE B C   1 
ATOM   7049  O O   . ILE B 1 195 ? -38.388 16.864  -12.700  1.00 119.69 ? 204 ILE B O   1 
ATOM   7050  C CB  . ILE B 1 195 ? -41.073 15.363  -13.981  1.00 115.92 ? 204 ILE B CB  1 
ATOM   7051  C CG1 . ILE B 1 195 ? -41.636 13.961  -14.210  1.00 116.49 ? 204 ILE B CG1 1 
ATOM   7052  C CG2 . ILE B 1 195 ? -40.172 15.763  -15.136  1.00 116.11 ? 204 ILE B CG2 1 
ATOM   7053  C CD1 . ILE B 1 195 ? -42.377 13.807  -15.518  1.00 114.88 ? 204 ILE B CD1 1 
ATOM   7054  N N   . VAL B 1 196 ? -40.373 17.811  -12.230  1.00 120.44 ? 205 VAL B N   1 
ATOM   7055  C CA  . VAL B 1 196 ? -39.824 19.152  -12.073  1.00 120.57 ? 205 VAL B CA  1 
ATOM   7056  C C   . VAL B 1 196 ? -38.712 19.177  -11.030  1.00 123.39 ? 205 VAL B C   1 
ATOM   7057  O O   . VAL B 1 196 ? -37.686 19.827  -11.222  1.00 124.43 ? 205 VAL B O   1 
ATOM   7058  C CB  . VAL B 1 196 ? -40.913 20.168  -11.686  1.00 119.03 ? 205 VAL B CB  1 
ATOM   7059  C CG1 . VAL B 1 196 ? -40.286 21.477  -11.241  1.00 120.00 ? 205 VAL B CG1 1 
ATOM   7060  C CG2 . VAL B 1 196 ? -41.861 20.395  -12.852  1.00 116.61 ? 205 VAL B CG2 1 
ATOM   7061  N N   . ASP B 1 197 ? -38.919 18.462  -9.928   1.00 130.13 ? 206 ASP B N   1 
ATOM   7062  C CA  . ASP B 1 197 ? -37.914 18.379  -8.874   1.00 133.39 ? 206 ASP B CA  1 
ATOM   7063  C C   . ASP B 1 197 ? -36.645 17.698  -9.375   1.00 135.31 ? 206 ASP B C   1 
ATOM   7064  O O   . ASP B 1 197 ? -35.538 18.164  -9.113   1.00 137.35 ? 206 ASP B O   1 
ATOM   7065  C CB  . ASP B 1 197 ? -38.469 17.638  -7.656   1.00 135.14 ? 206 ASP B CB  1 
ATOM   7066  C CG  . ASP B 1 197 ? -39.424 18.488  -6.842   1.00 134.53 ? 206 ASP B CG  1 
ATOM   7067  O OD1 . ASP B 1 197 ? -39.464 19.717  -7.067   1.00 133.32 ? 206 ASP B OD1 1 
ATOM   7068  O OD2 . ASP B 1 197 ? -40.132 17.931  -5.976   1.00 135.61 ? 206 ASP B OD2 1 
ATOM   7069  N N   . GLN B 1 198 ? -36.814 16.594  -10.096  1.00 153.91 ? 207 GLN B N   1 
ATOM   7070  C CA  . GLN B 1 198 ? -35.682 15.877  -10.669  1.00 155.97 ? 207 GLN B CA  1 
ATOM   7071  C C   . GLN B 1 198 ? -34.943 16.754  -11.673  1.00 155.21 ? 207 GLN B C   1 
ATOM   7072  O O   . GLN B 1 198 ? -33.714 16.766  -11.715  1.00 157.60 ? 207 GLN B O   1 
ATOM   7073  C CB  . GLN B 1 198 ? -36.153 14.587  -11.344  1.00 155.75 ? 207 GLN B CB  1 
ATOM   7074  C CG  . GLN B 1 198 ? -36.639 13.522  -10.376  1.00 157.54 ? 207 GLN B CG  1 
ATOM   7075  C CD  . GLN B 1 198 ? -35.514 12.928  -9.551   1.00 161.84 ? 207 GLN B CD  1 
ATOM   7076  O OE1 . GLN B 1 198 ? -34.340 13.058  -9.898   1.00 163.54 ? 207 GLN B OE1 1 
ATOM   7077  N NE2 . GLN B 1 198 ? -35.869 12.268  -8.455   1.00 163.98 ? 207 GLN B NE2 1 
ATOM   7078  N N   . VAL B 1 199 ? -35.705 17.488  -12.478  1.00 128.09 ? 208 VAL B N   1 
ATOM   7079  C CA  . VAL B 1 199 ? -35.139 18.375  -13.486  1.00 127.48 ? 208 VAL B CA  1 
ATOM   7080  C C   . VAL B 1 199 ? -34.208 19.405  -12.857  1.00 129.07 ? 208 VAL B C   1 
ATOM   7081  O O   . VAL B 1 199 ? -33.128 19.680  -13.380  1.00 130.54 ? 208 VAL B O   1 
ATOM   7082  C CB  . VAL B 1 199 ? -36.242 19.103  -14.279  1.00 124.39 ? 208 VAL B CB  1 
ATOM   7083  C CG1 . VAL B 1 199 ? -35.656 20.262  -15.066  1.00 124.30 ? 208 VAL B CG1 1 
ATOM   7084  C CG2 . VAL B 1 199 ? -36.959 18.130  -15.203  1.00 123.26 ? 208 VAL B CG2 1 
ATOM   7085  N N   . ILE B 1 200 ? -34.630 19.968  -11.731  1.00 129.09 ? 209 ILE B N   1 
ATOM   7086  C CA  . ILE B 1 200 ? -33.830 20.966  -11.034  1.00 130.91 ? 209 ILE B CA  1 
ATOM   7087  C C   . ILE B 1 200 ? -32.578 20.341  -10.433  1.00 134.51 ? 209 ILE B C   1 
ATOM   7088  O O   . ILE B 1 200 ? -31.509 20.952  -10.426  1.00 136.41 ? 209 ILE B O   1 
ATOM   7089  C CB  . ILE B 1 200 ? -34.632 21.645  -9.912   1.00 130.63 ? 209 ILE B CB  1 
ATOM   7090  C CG1 . ILE B 1 200 ? -35.953 22.188  -10.455  1.00 127.40 ? 209 ILE B CG1 1 
ATOM   7091  C CG2 . ILE B 1 200 ? -33.818 22.760  -9.277   1.00 132.76 ? 209 ILE B CG2 1 
ATOM   7092  C CD1 . ILE B 1 200 ? -36.847 22.773  -9.392   1.00 127.30 ? 209 ILE B CD1 1 
ATOM   7093  N N   . THR B 1 201 ? -32.717 19.120  -9.926   1.00 155.19 ? 210 THR B N   1 
ATOM   7094  C CA  . THR B 1 201 ? -31.598 18.415  -9.313   1.00 159.10 ? 210 THR B CA  1 
ATOM   7095  C C   . THR B 1 201 ? -30.470 18.188  -10.315  1.00 160.35 ? 210 THR B C   1 
ATOM   7096  O O   . THR B 1 201 ? -29.309 18.485  -10.033  1.00 163.20 ? 210 THR B O   1 
ATOM   7097  C CB  . THR B 1 201 ? -32.037 17.061  -8.728   1.00 160.42 ? 210 THR B CB  1 
ATOM   7098  O OG1 . THR B 1 201 ? -33.039 17.274  -7.727   1.00 159.80 ? 210 THR B OG1 1 
ATOM   7099  C CG2 . THR B 1 201 ? -30.853 16.340  -8.106   1.00 165.03 ? 210 THR B CG2 1 
ATOM   7100  N N   . ILE B 1 202 ? -30.817 17.660  -11.485  1.00 139.11 ? 211 ILE B N   1 
ATOM   7101  C CA  . ILE B 1 202 ? -29.833 17.401  -12.529  1.00 140.49 ? 211 ILE B CA  1 
ATOM   7102  C C   . ILE B 1 202 ? -29.443 18.686  -13.254  1.00 139.45 ? 211 ILE B C   1 
ATOM   7103  O O   . ILE B 1 202 ? -28.516 18.697  -14.063  1.00 140.98 ? 211 ILE B O   1 
ATOM   7104  C CB  . ILE B 1 202 ? -30.345 16.365  -13.547  1.00 139.48 ? 211 ILE B CB  1 
ATOM   7105  C CG1 . ILE B 1 202 ? -31.659 16.833  -14.173  1.00 135.46 ? 211 ILE B CG1 1 
ATOM   7106  C CG2 . ILE B 1 202 ? -30.526 15.011  -12.880  1.00 141.41 ? 211 ILE B CG2 1 
ATOM   7107  C CD1 . ILE B 1 202 ? -32.285 15.817  -15.105  1.00 134.61 ? 211 ILE B CD1 1 
ATOM   7108  N N   . GLY B 1 203 ? -30.160 19.766  -12.960  1.00 137.19 ? 212 GLY B N   1 
ATOM   7109  C CA  . GLY B 1 203 ? -29.831 21.073  -13.498  1.00 136.63 ? 212 GLY B CA  1 
ATOM   7110  C C   . GLY B 1 203 ? -30.293 21.306  -14.923  1.00 134.46 ? 212 GLY B C   1 
ATOM   7111  O O   . GLY B 1 203 ? -29.774 22.184  -15.610  1.00 134.86 ? 212 GLY B O   1 
ATOM   7112  N N   . LYS B 1 204 ? -31.270 20.524  -15.370  1.00 128.52 ? 213 LYS B N   1 
ATOM   7113  C CA  . LYS B 1 204 ? -31.818 20.689  -16.712  1.00 126.76 ? 213 LYS B CA  1 
ATOM   7114  C C   . LYS B 1 204 ? -32.988 21.668  -16.722  1.00 124.00 ? 213 LYS B C   1 
ATOM   7115  O O   . LYS B 1 204 ? -33.945 21.502  -17.478  1.00 122.10 ? 213 LYS B O   1 
ATOM   7116  C CB  . LYS B 1 204 ? -32.248 19.341  -17.295  1.00 126.55 ? 213 LYS B CB  1 
ATOM   7117  C CG  . LYS B 1 204 ? -31.089 18.431  -17.663  1.00 129.65 ? 213 LYS B CG  1 
ATOM   7118  C CD  . LYS B 1 204 ? -31.560 17.245  -18.491  1.00 129.66 ? 213 LYS B CD  1 
ATOM   7119  C CE  . LYS B 1 204 ? -30.400 16.331  -18.861  1.00 133.25 ? 213 LYS B CE  1 
ATOM   7120  N NZ  . LYS B 1 204 ? -29.348 17.043  -19.641  1.00 135.01 ? 213 LYS B NZ  1 
ATOM   7121  N N   . HIS B 1 205 ? -32.899 22.693  -15.881  1.00 128.15 ? 214 HIS B N   1 
ATOM   7122  C CA  . HIS B 1 205 ? -33.942 23.706  -15.792  1.00 126.13 ? 214 HIS B CA  1 
ATOM   7123  C C   . HIS B 1 205 ? -33.375 25.085  -16.102  1.00 127.10 ? 214 HIS B C   1 
ATOM   7124  O O   . HIS B 1 205 ? -34.015 26.104  -15.842  1.00 126.29 ? 214 HIS B O   1 
ATOM   7125  C CB  . HIS B 1 205 ? -34.565 23.703  -14.397  1.00 125.74 ? 214 HIS B CB  1 
ATOM   7126  C CG  . HIS B 1 205 ? -33.629 24.150  -13.319  1.00 128.19 ? 214 HIS B CG  1 
ATOM   7127  N ND1 . HIS B 1 205 ? -33.743 25.374  -12.694  1.00 128.63 ? 214 HIS B ND1 1 
ATOM   7128  C CD2 . HIS B 1 205 ? -32.559 23.542  -12.757  1.00 130.74 ? 214 HIS B CD2 1 
ATOM   7129  C CE1 . HIS B 1 205 ? -32.787 25.497  -11.792  1.00 131.30 ? 214 HIS B CE1 1 
ATOM   7130  N NE2 . HIS B 1 205 ? -32.054 24.399  -11.810  1.00 132.62 ? 214 HIS B NE2 1 
ATOM   7131  N N   . VAL B 1 206 ? -32.167 25.109  -16.656  1.00 146.89 ? 215 VAL B N   1 
ATOM   7132  C CA  . VAL B 1 206 ? -31.504 26.360  -17.000  1.00 148.32 ? 215 VAL B CA  1 
ATOM   7133  C C   . VAL B 1 206 ? -31.860 26.787  -18.417  1.00 147.70 ? 215 VAL B C   1 
ATOM   7134  O O   . VAL B 1 206 ? -32.546 26.063  -19.139  1.00 146.30 ? 215 VAL B O   1 
ATOM   7135  C CB  . VAL B 1 206 ? -29.974 26.237  -16.883  1.00 151.36 ? 215 VAL B CB  1 
ATOM   7136  C CG1 . VAL B 1 206 ? -29.577 25.906  -15.454  1.00 152.62 ? 215 VAL B CG1 1 
ATOM   7137  C CG2 . VAL B 1 206 ? -29.452 25.181  -17.845  1.00 152.19 ? 215 VAL B CG2 1 
ATOM   7138  N N   . LYS B 1 207 ? -31.389 27.966  -18.812  1.00 152.19 ? 216 LYS B N   1 
ATOM   7139  C CA  . LYS B 1 207 ? -31.662 28.490  -20.144  1.00 152.33 ? 216 LYS B CA  1 
ATOM   7140  C C   . LYS B 1 207 ? -31.241 27.499  -21.221  1.00 153.09 ? 216 LYS B C   1 
ATOM   7141  O O   . LYS B 1 207 ? -30.133 26.967  -21.189  1.00 155.01 ? 216 LYS B O   1 
ATOM   7142  C CB  . LYS B 1 207 ? -30.946 29.824  -20.353  1.00 154.63 ? 216 LYS B CB  1 
ATOM   7143  C CG  . LYS B 1 207 ? -31.152 30.419  -21.734  1.00 155.49 ? 216 LYS B CG  1 
ATOM   7144  C CD  . LYS B 1 207 ? -30.465 31.765  -21.861  1.00 158.10 ? 216 LYS B CD  1 
ATOM   7145  C CE  . LYS B 1 207 ? -30.716 32.379  -23.227  1.00 159.43 ? 216 LYS B CE  1 
ATOM   7146  N NZ  . LYS B 1 207 ? -30.106 33.731  -23.342  1.00 162.28 ? 216 LYS B NZ  1 
ATOM   7147  N N   . GLY B 1 208 ? -32.134 27.255  -22.174  1.00 127.77 ? 217 GLY B N   1 
ATOM   7148  C CA  . GLY B 1 208 ? -31.863 26.314  -23.244  1.00 128.77 ? 217 GLY B CA  1 
ATOM   7149  C C   . GLY B 1 208 ? -32.917 25.229  -23.309  1.00 126.63 ? 217 GLY B C   1 
ATOM   7150  O O   . GLY B 1 208 ? -33.181 24.669  -24.373  1.00 127.13 ? 217 GLY B O   1 
ATOM   7151  N N   . TYR B 1 209 ? -33.521 24.932  -22.162  1.00 127.37 ? 218 TYR B N   1 
ATOM   7152  C CA  . TYR B 1 209 ? -34.574 23.926  -22.085  1.00 125.38 ? 218 TYR B CA  1 
ATOM   7153  C C   . TYR B 1 209 ? -35.955 24.567  -22.164  1.00 123.28 ? 218 TYR B C   1 
ATOM   7154  O O   . TYR B 1 209 ? -36.147 25.705  -21.739  1.00 123.01 ? 218 TYR B O   1 
ATOM   7155  C CB  . TYR B 1 209 ? -34.446 23.109  -20.798  1.00 124.85 ? 218 TYR B CB  1 
ATOM   7156  C CG  . TYR B 1 209 ? -33.205 22.248  -20.740  1.00 127.19 ? 218 TYR B CG  1 
ATOM   7157  C CD1 . TYR B 1 209 ? -32.002 22.761  -20.276  1.00 129.20 ? 218 TYR B CD1 1 
ATOM   7158  C CD2 . TYR B 1 209 ? -33.236 20.921  -21.150  1.00 127.74 ? 218 TYR B CD2 1 
ATOM   7159  C CE1 . TYR B 1 209 ? -30.865 21.977  -20.221  1.00 131.69 ? 218 TYR B CE1 1 
ATOM   7160  C CE2 . TYR B 1 209 ? -32.104 20.129  -21.098  1.00 130.32 ? 218 TYR B CE2 1 
ATOM   7161  C CZ  . TYR B 1 209 ? -30.921 20.663  -20.633  1.00 132.28 ? 218 TYR B CZ  1 
ATOM   7162  O OH  . TYR B 1 209 ? -29.789 19.883  -20.578  1.00 135.19 ? 218 TYR B OH  1 
ATOM   7163  N N   . HIS B 1 210 ? -36.914 23.828  -22.712  1.00 143.52 ? 219 HIS B N   1 
ATOM   7164  C CA  . HIS B 1 210 ? -38.278 24.321  -22.841  1.00 141.78 ? 219 HIS B CA  1 
ATOM   7165  C C   . HIS B 1 210 ? -39.271 23.223  -22.482  1.00 139.98 ? 219 HIS B C   1 
ATOM   7166  O O   . HIS B 1 210 ? -39.355 22.204  -23.167  1.00 140.42 ? 219 HIS B O   1 
ATOM   7167  C CB  . HIS B 1 210 ? -38.536 24.810  -24.267  1.00 142.98 ? 219 HIS B CB  1 
ATOM   7168  C CG  . HIS B 1 210 ? -39.723 25.713  -24.391  1.00 142.02 ? 219 HIS B CG  1 
ATOM   7169  N ND1 . HIS B 1 210 ? -41.014 25.285  -24.162  1.00 140.11 ? 219 HIS B ND1 1 
ATOM   7170  C CD2 . HIS B 1 210 ? -39.817 27.022  -24.726  1.00 143.06 ? 219 HIS B CD2 1 
ATOM   7171  C CE1 . HIS B 1 210 ? -41.849 26.291  -24.346  1.00 140.02 ? 219 HIS B CE1 1 
ATOM   7172  N NE2 . HIS B 1 210 ? -41.148 27.357  -24.690  1.00 141.85 ? 219 HIS B NE2 1 
ATOM   7173  N N   . TYR B 1 211 ? -40.022 23.433  -21.406  1.00 117.52 ? 220 TYR B N   1 
ATOM   7174  C CA  . TYR B 1 211 ? -40.986 22.440  -20.948  1.00 116.01 ? 220 TYR B CA  1 
ATOM   7175  C C   . TYR B 1 211 ? -42.422 22.885  -21.200  1.00 114.60 ? 220 TYR B C   1 
ATOM   7176  O O   . TYR B 1 211 ? -42.737 24.073  -21.131  1.00 114.51 ? 220 TYR B O   1 
ATOM   7177  C CB  . TYR B 1 211 ? -40.783 22.141  -19.462  1.00 115.65 ? 220 TYR B CB  1 
ATOM   7178  C CG  . TYR B 1 211 ? -39.451 21.506  -19.142  1.00 117.34 ? 220 TYR B CG  1 
ATOM   7179  C CD1 . TYR B 1 211 ? -39.252 20.144  -19.312  1.00 117.99 ? 220 TYR B CD1 1 
ATOM   7180  C CD2 . TYR B 1 211 ? -38.394 22.268  -18.666  1.00 118.64 ? 220 TYR B CD2 1 
ATOM   7181  C CE1 . TYR B 1 211 ? -38.037 19.559  -19.020  1.00 119.97 ? 220 TYR B CE1 1 
ATOM   7182  C CE2 . TYR B 1 211 ? -37.175 21.691  -18.370  1.00 120.51 ? 220 TYR B CE2 1 
ATOM   7183  C CZ  . TYR B 1 211 ? -37.002 20.336  -18.549  1.00 121.20 ? 220 TYR B CZ  1 
ATOM   7184  O OH  . TYR B 1 211 ? -35.790 19.754  -18.258  1.00 123.48 ? 220 TYR B OH  1 
ATOM   7185  N N   . ILE B 1 212 ? -43.286 21.919  -21.495  1.00 113.81 ? 221 ILE B N   1 
ATOM   7186  C CA  . ILE B 1 212 ? -44.703 22.188  -21.699  1.00 112.66 ? 221 ILE B CA  1 
ATOM   7187  C C   . ILE B 1 212 ? -45.543 21.260  -20.832  1.00 111.37 ? 221 ILE B C   1 
ATOM   7188  O O   . ILE B 1 212 ? -45.569 20.050  -21.053  1.00 111.56 ? 221 ILE B O   1 
ATOM   7189  C CB  . ILE B 1 212 ? -45.111 22.005  -23.171  1.00 113.50 ? 221 ILE B CB  1 
ATOM   7190  C CG1 . ILE B 1 212 ? -44.331 22.969  -24.065  1.00 115.23 ? 221 ILE B CG1 1 
ATOM   7191  C CG2 . ILE B 1 212 ? -46.607 22.218  -23.338  1.00 112.58 ? 221 ILE B CG2 1 
ATOM   7192  C CD1 . ILE B 1 212 ? -44.699 22.870  -25.527  1.00 116.70 ? 221 ILE B CD1 1 
ATOM   7193  N N   . ILE B 1 213 ? -46.220 21.830  -19.841  1.00 106.55 ? 222 ILE B N   1 
ATOM   7194  C CA  . ILE B 1 213 ? -47.069 21.050  -18.952  1.00 105.63 ? 222 ILE B CA  1 
ATOM   7195  C C   . ILE B 1 213 ? -48.410 20.769  -19.621  1.00 104.95 ? 222 ILE B C   1 
ATOM   7196  O O   . ILE B 1 213 ? -49.260 21.652  -19.725  1.00 104.62 ? 222 ILE B O   1 
ATOM   7197  C CB  . ILE B 1 213 ? -47.300 21.775  -17.614  1.00 105.38 ? 222 ILE B CB  1 
ATOM   7198  C CG1 . ILE B 1 213 ? -45.973 22.286  -17.049  1.00 106.43 ? 222 ILE B CG1 1 
ATOM   7199  C CG2 . ILE B 1 213 ? -47.985 20.852  -16.619  1.00 104.98 ? 222 ILE B CG2 1 
ATOM   7200  C CD1 . ILE B 1 213 ? -44.966 21.191  -16.777  1.00 107.26 ? 222 ILE B CD1 1 
ATOM   7201  N N   . ALA B 1 214 ? -48.591 19.532  -20.074  1.00 106.03 ? 223 ALA B N   1 
ATOM   7202  C CA  . ALA B 1 214 ? -49.787 19.150  -20.817  1.00 105.78 ? 223 ALA B CA  1 
ATOM   7203  C C   . ALA B 1 214 ? -50.972 18.825  -19.910  1.00 104.86 ? 223 ALA B C   1 
ATOM   7204  O O   . ALA B 1 214 ? -51.433 17.684  -19.859  1.00 104.94 ? 223 ALA B O   1 
ATOM   7205  C CB  . ALA B 1 214 ? -49.484 17.978  -21.740  1.00 106.80 ? 223 ALA B CB  1 
ATOM   7206  N N   . ASN B 1 215 ? -51.462 19.835  -19.199  1.00 105.63 ? 224 ASN B N   1 
ATOM   7207  C CA  . ASN B 1 215 ? -52.664 19.694  -18.384  1.00 105.10 ? 224 ASN B CA  1 
ATOM   7208  C C   . ASN B 1 215 ? -53.411 21.019  -18.268  1.00 105.05 ? 224 ASN B C   1 
ATOM   7209  O O   . ASN B 1 215 ? -52.881 22.071  -18.618  1.00 105.46 ? 224 ASN B O   1 
ATOM   7210  C CB  . ASN B 1 215 ? -52.331 19.137  -16.997  1.00 105.20 ? 224 ASN B CB  1 
ATOM   7211  C CG  . ASN B 1 215 ? -51.453 20.070  -16.185  1.00 105.57 ? 224 ASN B CG  1 
ATOM   7212  O OD1 . ASN B 1 215 ? -51.161 21.189  -16.604  1.00 105.66 ? 224 ASN B OD1 1 
ATOM   7213  N ND2 . ASN B 1 215 ? -51.029 19.611  -15.013  1.00 106.17 ? 224 ASN B ND2 1 
ATOM   7214  N N   . LEU B 1 216 ? -54.643 20.962  -17.776  1.00 107.49 ? 225 LEU B N   1 
ATOM   7215  C CA  . LEU B 1 216 ? -55.480 22.151  -17.677  1.00 107.86 ? 225 LEU B CA  1 
ATOM   7216  C C   . LEU B 1 216 ? -55.207 22.923  -16.390  1.00 108.26 ? 225 LEU B C   1 
ATOM   7217  O O   . LEU B 1 216 ? -55.880 23.910  -16.095  1.00 108.94 ? 225 LEU B O   1 
ATOM   7218  C CB  . LEU B 1 216 ? -56.959 21.768  -17.767  1.00 107.90 ? 225 LEU B CB  1 
ATOM   7219  C CG  . LEU B 1 216 ? -57.374 21.016  -19.034  1.00 107.96 ? 225 LEU B CG  1 
ATOM   7220  C CD1 . LEU B 1 216 ? -58.817 20.543  -18.936  1.00 108.16 ? 225 LEU B CD1 1 
ATOM   7221  C CD2 . LEU B 1 216 ? -57.174 21.884  -20.265  1.00 108.74 ? 225 LEU B CD2 1 
ATOM   7222  N N   . GLY B 1 217 ? -54.214 22.473  -15.630  1.00 104.86 ? 226 GLY B N   1 
ATOM   7223  C CA  . GLY B 1 217 ? -53.858 23.125  -14.382  1.00 105.67 ? 226 GLY B CA  1 
ATOM   7224  C C   . GLY B 1 217 ? -52.404 23.550  -14.337  1.00 106.08 ? 226 GLY B C   1 
ATOM   7225  O O   . GLY B 1 217 ? -51.592 22.940  -13.641  1.00 106.42 ? 226 GLY B O   1 
ATOM   7226  N N   . PHE B 1 218 ? -52.075 24.604  -15.078  1.00 131.98 ? 227 PHE B N   1 
ATOM   7227  C CA  . PHE B 1 218 ? -50.703 25.095  -15.147  1.00 132.58 ? 227 PHE B CA  1 
ATOM   7228  C C   . PHE B 1 218 ? -50.275 25.763  -13.845  1.00 133.82 ? 227 PHE B C   1 
ATOM   7229  O O   . PHE B 1 218 ? -49.141 25.594  -13.394  1.00 134.41 ? 227 PHE B O   1 
ATOM   7230  C CB  . PHE B 1 218 ? -50.541 26.068  -16.318  1.00 133.00 ? 227 PHE B CB  1 
ATOM   7231  C CG  . PHE B 1 218 ? -49.154 26.633  -16.452  1.00 133.87 ? 227 PHE B CG  1 
ATOM   7232  C CD1 . PHE B 1 218 ? -48.118 25.855  -16.941  1.00 133.66 ? 227 PHE B CD1 1 
ATOM   7233  C CD2 . PHE B 1 218 ? -48.887 27.945  -16.096  1.00 135.24 ? 227 PHE B CD2 1 
ATOM   7234  C CE1 . PHE B 1 218 ? -46.842 26.373  -17.070  1.00 134.68 ? 227 PHE B CE1 1 
ATOM   7235  C CE2 . PHE B 1 218 ? -47.613 28.468  -16.223  1.00 136.26 ? 227 PHE B CE2 1 
ATOM   7236  C CZ  . PHE B 1 218 ? -46.591 27.680  -16.710  1.00 135.93 ? 227 PHE B CZ  1 
ATOM   7237  N N   . THR B 1 219 ? -51.185 26.524  -13.246  1.00 109.60 ? 228 THR B N   1 
ATOM   7238  C CA  . THR B 1 219 ? -50.889 27.234  -12.008  1.00 111.30 ? 228 THR B CA  1 
ATOM   7239  C C   . THR B 1 219 ? -51.256 26.398  -10.786  1.00 111.73 ? 228 THR B C   1 
ATOM   7240  O O   . THR B 1 219 ? -51.109 26.848  -9.649   1.00 113.54 ? 228 THR B O   1 
ATOM   7241  C CB  . THR B 1 219 ? -51.628 28.582  -11.940  1.00 112.63 ? 228 THR B CB  1 
ATOM   7242  O OG1 . THR B 1 219 ? -53.041 28.360  -12.024  1.00 112.22 ? 228 THR B OG1 1 
ATOM   7243  C CG2 . THR B 1 219 ? -51.193 29.487  -13.083  1.00 112.85 ? 228 THR B CG2 1 
ATOM   7244  N N   . ASP B 1 220 ? -51.731 25.181  -11.027  1.00 128.71 ? 229 ASP B N   1 
ATOM   7245  C CA  . ASP B 1 220 ? -52.130 24.286  -9.946   1.00 129.37 ? 229 ASP B CA  1 
ATOM   7246  C C   . ASP B 1 220 ? -50.921 23.712  -9.215   1.00 130.42 ? 229 ASP B C   1 
ATOM   7247  O O   . ASP B 1 220 ? -51.005 23.363  -8.037   1.00 132.06 ? 229 ASP B O   1 
ATOM   7248  C CB  . ASP B 1 220 ? -53.008 23.153  -10.480  1.00 128.00 ? 229 ASP B CB  1 
ATOM   7249  C CG  . ASP B 1 220 ? -54.365 23.638  -10.950  1.00 127.55 ? 229 ASP B CG  1 
ATOM   7250  O OD1 . ASP B 1 220 ? -55.171 22.801  -11.409  1.00 126.65 ? 229 ASP B OD1 1 
ATOM   7251  O OD2 . ASP B 1 220 ? -54.628 24.856  -10.858  1.00 128.40 ? 229 ASP B OD2 1 
ATOM   7252  N N   . GLY B 1 221 ? -49.799 23.614  -9.919   1.00 202.50 ? 230 GLY B N   1 
ATOM   7253  C CA  . GLY B 1 221 ? -48.582 23.077  -9.339   1.00 203.73 ? 230 GLY B CA  1 
ATOM   7254  C C   . GLY B 1 221 ? -47.617 24.161  -8.905   1.00 205.29 ? 230 GLY B C   1 
ATOM   7255  O O   . GLY B 1 221 ? -47.799 25.335  -9.229   1.00 205.26 ? 230 GLY B O   1 
ATOM   7256  N N   . ASP B 1 222 ? -46.586 23.767  -8.164   1.00 160.00 ? 231 ASP B N   1 
ATOM   7257  C CA  . ASP B 1 222 ? -45.567 24.705  -7.712   1.00 161.85 ? 231 ASP B CA  1 
ATOM   7258  C C   . ASP B 1 222 ? -44.598 25.026  -8.846   1.00 160.96 ? 231 ASP B C   1 
ATOM   7259  O O   . ASP B 1 222 ? -43.931 24.137  -9.374   1.00 160.47 ? 231 ASP B O   1 
ATOM   7260  C CB  . ASP B 1 222 ? -44.807 24.133  -6.514   1.00 164.49 ? 231 ASP B CB  1 
ATOM   7261  C CG  . ASP B 1 222 ? -43.797 25.110  -5.943   1.00 166.86 ? 231 ASP B CG  1 
ATOM   7262  O OD1 . ASP B 1 222 ? -43.830 26.297  -6.330   1.00 166.61 ? 231 ASP B OD1 1 
ATOM   7263  O OD2 . ASP B 1 222 ? -42.972 24.691  -5.104   1.00 169.31 ? 231 ASP B OD2 1 
ATOM   7264  N N   . LEU B 1 223 ? -44.529 26.300  -9.218   1.00 115.01 ? 232 LEU B N   1 
ATOM   7265  C CA  . LEU B 1 223 ? -43.656 26.734  -10.303  1.00 114.55 ? 232 LEU B CA  1 
ATOM   7266  C C   . LEU B 1 223 ? -42.514 27.610  -9.800   1.00 116.86 ? 232 LEU B C   1 
ATOM   7267  O O   . LEU B 1 223 ? -41.562 27.881  -10.532  1.00 117.06 ? 232 LEU B O   1 
ATOM   7268  C CB  . LEU B 1 223 ? -44.454 27.478  -11.376  1.00 113.16 ? 232 LEU B CB  1 
ATOM   7269  C CG  . LEU B 1 223 ? -45.095 26.638  -12.484  1.00 110.99 ? 232 LEU B CG  1 
ATOM   7270  C CD1 . LEU B 1 223 ? -45.890 25.476  -11.914  1.00 110.22 ? 232 LEU B CD1 1 
ATOM   7271  C CD2 . LEU B 1 223 ? -45.973 27.508  -13.366  1.00 110.34 ? 232 LEU B CD2 1 
ATOM   7272  N N   . LEU B 1 224 ? -42.610 28.047  -8.549   1.00 140.07 ? 233 LEU B N   1 
ATOM   7273  C CA  . LEU B 1 224 ? -41.590 28.906  -7.956   1.00 142.73 ? 233 LEU B CA  1 
ATOM   7274  C C   . LEU B 1 224 ? -40.201 28.280  -8.017   1.00 143.65 ? 233 LEU B C   1 
ATOM   7275  O O   . LEU B 1 224 ? -39.193 28.980  -7.922   1.00 145.54 ? 233 LEU B O   1 
ATOM   7276  C CB  . LEU B 1 224 ? -41.947 29.240  -6.506   1.00 145.26 ? 233 LEU B CB  1 
ATOM   7277  C CG  . LEU B 1 224 ? -43.082 30.242  -6.295   1.00 145.61 ? 233 LEU B CG  1 
ATOM   7278  C CD1 . LEU B 1 224 ? -43.459 30.326  -4.824   1.00 148.40 ? 233 LEU B CD1 1 
ATOM   7279  C CD2 . LEU B 1 224 ? -42.691 31.611  -6.830   1.00 146.53 ? 233 LEU B CD2 1 
ATOM   7280  N N   . LYS B 1 225 ? -40.152 26.962  -8.177   1.00 121.27 ? 234 LYS B N   1 
ATOM   7281  C CA  . LYS B 1 225 ? -38.880 26.249  -8.201   1.00 122.50 ? 234 LYS B CA  1 
ATOM   7282  C C   . LYS B 1 225 ? -38.175 26.339  -9.556   1.00 121.41 ? 234 LYS B C   1 
ATOM   7283  O O   . LYS B 1 225 ? -36.993 26.676  -9.623   1.00 123.15 ? 234 LYS B O   1 
ATOM   7284  C CB  . LYS B 1 225 ? -39.072 24.792  -7.774   1.00 122.53 ? 234 LYS B CB  1 
ATOM   7285  C CG  . LYS B 1 225 ? -40.365 24.157  -8.262   1.00 119.88 ? 234 LYS B CG  1 
ATOM   7286  C CD  . LYS B 1 225 ? -40.623 22.834  -7.556   1.00 120.67 ? 234 LYS B CD  1 
ATOM   7287  C CE  . LYS B 1 225 ? -41.951 22.226  -7.981   1.00 118.32 ? 234 LYS B CE  1 
ATOM   7288  N NZ  . LYS B 1 225 ? -42.252 20.969  -7.238   1.00 119.47 ? 234 LYS B NZ  1 
ATOM   7289  N N   . ILE B 1 226 ? -38.900 26.043  -10.632  1.00 118.60 ? 235 ILE B N   1 
ATOM   7290  C CA  . ILE B 1 226 ? -38.340 26.154  -11.977  1.00 117.88 ? 235 ILE B CA  1 
ATOM   7291  C C   . ILE B 1 226 ? -38.691 27.494  -12.614  1.00 117.50 ? 235 ILE B C   1 
ATOM   7292  O O   . ILE B 1 226 ? -38.749 27.614  -13.837  1.00 116.54 ? 235 ILE B O   1 
ATOM   7293  C CB  . ILE B 1 226 ? -38.804 25.004  -12.903  1.00 116.00 ? 235 ILE B CB  1 
ATOM   7294  C CG1 . ILE B 1 226 ? -40.291 24.713  -12.705  1.00 114.18 ? 235 ILE B CG1 1 
ATOM   7295  C CG2 . ILE B 1 226 ? -37.990 23.749  -12.652  1.00 117.16 ? 235 ILE B CG2 1 
ATOM   7296  C CD1 . ILE B 1 226 ? -41.204 25.674  -13.424  1.00 112.87 ? 235 ILE B CD1 1 
ATOM   7297  N N   . GLN B 1 227 ? -38.920 28.499  -11.776  1.00 121.27 ? 236 GLN B N   1 
ATOM   7298  C CA  . GLN B 1 227 ? -39.304 29.821  -12.254  1.00 121.47 ? 236 GLN B CA  1 
ATOM   7299  C C   . GLN B 1 227 ? -38.084 30.693  -12.524  1.00 123.56 ? 236 GLN B C   1 
ATOM   7300  O O   . GLN B 1 227 ? -38.065 31.469  -13.479  1.00 123.67 ? 236 GLN B O   1 
ATOM   7301  C CB  . GLN B 1 227 ? -40.228 30.505  -11.244  1.00 122.14 ? 236 GLN B CB  1 
ATOM   7302  C CG  . GLN B 1 227 ? -40.716 31.878  -11.673  1.00 122.80 ? 236 GLN B CG  1 
ATOM   7303  C CD  . GLN B 1 227 ? -41.750 32.447  -10.723  1.00 123.62 ? 236 GLN B CD  1 
ATOM   7304  O OE1 . GLN B 1 227 ? -42.379 31.712  -9.962   1.00 123.02 ? 236 GLN B OE1 1 
ATOM   7305  N NE2 . GLN B 1 227 ? -41.933 33.762  -10.763  1.00 125.36 ? 236 GLN B NE2 1 
ATOM   7306  N N   . PHE B 1 228 ? -37.066 30.558  -11.681  1.00 153.79 ? 237 PHE B N   1 
ATOM   7307  C CA  . PHE B 1 228 ? -35.860 31.370  -11.804  1.00 156.16 ? 237 PHE B CA  1 
ATOM   7308  C C   . PHE B 1 228 ? -34.706 30.576  -12.406  1.00 156.50 ? 237 PHE B C   1 
ATOM   7309  O O   . PHE B 1 228 ? -33.590 31.081  -12.525  1.00 158.63 ? 237 PHE B O   1 
ATOM   7310  C CB  . PHE B 1 228 ? -35.453 31.931  -10.440  1.00 158.90 ? 237 PHE B CB  1 
ATOM   7311  C CG  . PHE B 1 228 ? -36.556 32.666  -9.733   1.00 159.15 ? 237 PHE B CG  1 
ATOM   7312  C CD1 . PHE B 1 228 ? -36.806 33.999  -10.008  1.00 160.25 ? 237 PHE B CD1 1 
ATOM   7313  C CD2 . PHE B 1 228 ? -37.340 32.022  -8.790   1.00 158.70 ? 237 PHE B CD2 1 
ATOM   7314  C CE1 . PHE B 1 228 ? -37.819 34.677  -9.358   1.00 160.91 ? 237 PHE B CE1 1 
ATOM   7315  C CE2 . PHE B 1 228 ? -38.354 32.695  -8.137   1.00 159.30 ? 237 PHE B CE2 1 
ATOM   7316  C CZ  . PHE B 1 228 ? -38.594 34.024  -8.421   1.00 160.41 ? 237 PHE B CZ  1 
ATOM   7317  N N   . GLY B 1 229 ? -34.983 29.332  -12.785  1.00 134.05 ? 238 GLY B N   1 
ATOM   7318  C CA  . GLY B 1 229 ? -33.971 28.469  -13.366  1.00 134.61 ? 238 GLY B CA  1 
ATOM   7319  C C   . GLY B 1 229 ? -33.423 29.000  -14.677  1.00 135.00 ? 238 GLY B C   1 
ATOM   7320  O O   . GLY B 1 229 ? -32.215 28.966  -14.914  1.00 136.95 ? 238 GLY B O   1 
ATOM   7321  N N   . GLY B 1 230 ? -34.313 29.491  -15.532  1.00 126.82 ? 239 GLY B N   1 
ATOM   7322  C CA  . GLY B 1 230 ? -33.916 30.022  -16.822  1.00 127.53 ? 239 GLY B CA  1 
ATOM   7323  C C   . GLY B 1 230 ? -34.647 29.353  -17.968  1.00 125.75 ? 239 GLY B C   1 
ATOM   7324  O O   . GLY B 1 230 ? -34.951 29.986  -18.980  1.00 125.94 ? 239 GLY B O   1 
ATOM   7325  N N   . ALA B 1 231 ? -34.932 28.064  -17.809  1.00 121.07 ? 240 ALA B N   1 
ATOM   7326  C CA  . ALA B 1 231 ? -35.647 27.310  -18.830  1.00 119.62 ? 240 ALA B CA  1 
ATOM   7327  C C   . ALA B 1 231 ? -37.081 27.807  -18.959  1.00 117.87 ? 240 ALA B C   1 
ATOM   7328  O O   . ALA B 1 231 ? -37.768 28.008  -17.959  1.00 116.96 ? 240 ALA B O   1 
ATOM   7329  C CB  . ALA B 1 231 ? -35.628 25.826  -18.505  1.00 118.95 ? 240 ALA B CB  1 
ATOM   7330  N N   . GLU B 1 232 ? -37.526 28.004  -20.195  1.00 143.61 ? 241 GLU B N   1 
ATOM   7331  C CA  . GLU B 1 232 ? -38.883 28.469  -20.450  1.00 142.38 ? 241 GLU B CA  1 
ATOM   7332  C C   . GLU B 1 232 ? -39.902 27.367  -20.191  1.00 140.25 ? 241 GLU B C   1 
ATOM   7333  O O   . GLU B 1 232 ? -39.738 26.237  -20.649  1.00 139.97 ? 241 GLU B O   1 
ATOM   7334  C CB  . GLU B 1 232 ? -39.017 28.983  -21.884  1.00 143.53 ? 241 GLU B CB  1 
ATOM   7335  C CG  . GLU B 1 232 ? -38.200 30.231  -22.172  1.00 145.92 ? 241 GLU B CG  1 
ATOM   7336  C CD  . GLU B 1 232 ? -38.412 30.753  -23.579  1.00 147.53 ? 241 GLU B CD  1 
ATOM   7337  O OE1 . GLU B 1 232 ? -39.175 30.123  -24.341  1.00 146.82 ? 241 GLU B OE1 1 
ATOM   7338  O OE2 . GLU B 1 232 ? -37.814 31.795  -23.923  1.00 149.85 ? 241 GLU B OE2 1 
ATOM   7339  N N   . VAL B 1 233 ? -40.953 27.704  -19.451  1.00 113.55 ? 242 VAL B N   1 
ATOM   7340  C CA  . VAL B 1 233 ? -42.009 26.747  -19.140  1.00 111.72 ? 242 VAL B CA  1 
ATOM   7341  C C   . VAL B 1 233 ? -43.367 27.263  -19.600  1.00 111.00 ? 242 VAL B C   1 
ATOM   7342  O O   . VAL B 1 233 ? -43.765 28.377  -19.259  1.00 111.52 ? 242 VAL B O   1 
ATOM   7343  C CB  . VAL B 1 233 ? -42.070 26.443  -17.631  1.00 111.27 ? 242 VAL B CB  1 
ATOM   7344  C CG1 . VAL B 1 233 ? -43.239 25.520  -17.324  1.00 109.66 ? 242 VAL B CG1 1 
ATOM   7345  C CG2 . VAL B 1 233 ? -40.762 25.829  -17.162  1.00 112.35 ? 242 VAL B CG2 1 
ATOM   7346  N N   . SER B 1 234 ? -44.072 26.450  -20.379  1.00 112.06 ? 243 SER B N   1 
ATOM   7347  C CA  . SER B 1 234 ? -45.395 26.813  -20.867  1.00 111.63 ? 243 SER B CA  1 
ATOM   7348  C C   . SER B 1 234 ? -46.419 25.780  -20.417  1.00 109.99 ? 243 SER B C   1 
ATOM   7349  O O   . SER B 1 234 ? -46.059 24.685  -19.987  1.00 109.39 ? 243 SER B O   1 
ATOM   7350  C CB  . SER B 1 234 ? -45.389 26.924  -22.392  1.00 112.81 ? 243 SER B CB  1 
ATOM   7351  O OG  . SER B 1 234 ? -44.371 27.806  -22.834  1.00 114.64 ? 243 SER B OG  1 
ATOM   7352  N N   . GLY B 1 235 ? -47.697 26.131  -20.514  1.00 129.84 ? 244 GLY B N   1 
ATOM   7353  C CA  . GLY B 1 235 ? -48.757 25.229  -20.107  1.00 128.53 ? 244 GLY B CA  1 
ATOM   7354  C C   . GLY B 1 235 ? -50.141 25.737  -20.459  1.00 128.58 ? 244 GLY B C   1 
ATOM   7355  O O   . GLY B 1 235 ? -50.294 26.630  -21.291  1.00 129.80 ? 244 GLY B O   1 
ATOM   7356  N N   . PHE B 1 236 ? -51.154 25.164  -19.817  1.00 117.03 ? 245 PHE B N   1 
ATOM   7357  C CA  . PHE B 1 236 ? -52.538 25.525  -20.096  1.00 117.23 ? 245 PHE B CA  1 
ATOM   7358  C C   . PHE B 1 236 ? -53.317 25.785  -18.809  1.00 116.93 ? 245 PHE B C   1 
ATOM   7359  O O   . PHE B 1 236 ? -53.155 25.074  -17.818  1.00 116.18 ? 245 PHE B O   1 
ATOM   7360  C CB  . PHE B 1 236 ? -53.220 24.421  -20.907  1.00 116.82 ? 245 PHE B CB  1 
ATOM   7361  C CG  . PHE B 1 236 ? -52.460 24.015  -22.136  1.00 117.51 ? 245 PHE B CG  1 
ATOM   7362  C CD1 . PHE B 1 236 ? -52.721 24.613  -23.357  1.00 119.02 ? 245 PHE B CD1 1 
ATOM   7363  C CD2 . PHE B 1 236 ? -51.484 23.037  -22.071  1.00 117.11 ? 245 PHE B CD2 1 
ATOM   7364  C CE1 . PHE B 1 236 ? -52.023 24.242  -24.490  1.00 120.13 ? 245 PHE B CE1 1 
ATOM   7365  C CE2 . PHE B 1 236 ? -50.782 22.661  -23.199  1.00 118.15 ? 245 PHE B CE2 1 
ATOM   7366  C CZ  . PHE B 1 236 ? -51.052 23.264  -24.411  1.00 119.67 ? 245 PHE B CZ  1 
ATOM   7367  N N   . GLN B 1 237 ? -54.163 26.809  -18.833  1.00 133.05 ? 246 GLN B N   1 
ATOM   7368  C CA  . GLN B 1 237 ? -54.987 27.148  -17.680  1.00 133.30 ? 246 GLN B CA  1 
ATOM   7369  C C   . GLN B 1 237 ? -56.453 27.252  -18.082  1.00 133.82 ? 246 GLN B C   1 
ATOM   7370  O O   . GLN B 1 237 ? -56.801 27.989  -19.005  1.00 135.07 ? 246 GLN B O   1 
ATOM   7371  C CB  . GLN B 1 237 ? -54.517 28.462  -17.054  1.00 134.73 ? 246 GLN B CB  1 
ATOM   7372  C CG  . GLN B 1 237 ? -55.185 28.793  -15.732  1.00 135.43 ? 246 GLN B CG  1 
ATOM   7373  C CD  . GLN B 1 237 ? -54.870 27.776  -14.653  1.00 134.47 ? 246 GLN B CD  1 
ATOM   7374  O OE1 . GLN B 1 237 ? -53.851 27.087  -14.711  1.00 133.59 ? 246 GLN B OE1 1 
ATOM   7375  N NE2 . GLN B 1 237 ? -55.744 27.680  -13.657  1.00 135.04 ? 246 GLN B NE2 1 
ATOM   7376  N N   . ILE B 1 238 ? -57.307 26.505  -17.390  1.00 107.38 ? 247 ILE B N   1 
ATOM   7377  C CA  . ILE B 1 238 ? -58.736 26.499  -17.688  1.00 107.99 ? 247 ILE B CA  1 
ATOM   7378  C C   . ILE B 1 238 ? -59.501 27.404  -16.726  1.00 109.42 ? 247 ILE B C   1 
ATOM   7379  O O   . ILE B 1 238 ? -60.565 27.925  -17.061  1.00 110.77 ? 247 ILE B O   1 
ATOM   7380  C CB  . ILE B 1 238 ? -59.321 25.071  -17.634  1.00 106.82 ? 247 ILE B CB  1 
ATOM   7381  C CG1 . ILE B 1 238 ? -60.728 25.046  -18.234  1.00 107.66 ? 247 ILE B CG1 1 
ATOM   7382  C CG2 . ILE B 1 238 ? -59.327 24.546  -16.206  1.00 106.39 ? 247 ILE B CG2 1 
ATOM   7383  C CD1 . ILE B 1 238 ? -60.779 25.486  -19.679  1.00 108.63 ? 247 ILE B CD1 1 
ATOM   7384  N N   . VAL B 1 239 ? -58.950 27.591  -15.532  1.00 111.43 ? 248 VAL B N   1 
ATOM   7385  C CA  . VAL B 1 239 ? -59.566 28.455  -14.533  1.00 113.24 ? 248 VAL B CA  1 
ATOM   7386  C C   . VAL B 1 239 ? -58.950 29.846  -14.579  1.00 114.90 ? 248 VAL B C   1 
ATOM   7387  O O   . VAL B 1 239 ? -57.917 30.097  -13.959  1.00 115.02 ? 248 VAL B O   1 
ATOM   7388  C CB  . VAL B 1 239 ? -59.398 27.886  -13.115  1.00 113.14 ? 248 VAL B CB  1 
ATOM   7389  C CG1 . VAL B 1 239 ? -60.167 28.731  -12.113  1.00 115.48 ? 248 VAL B CG1 1 
ATOM   7390  C CG2 . VAL B 1 239 ? -59.861 26.441  -13.066  1.00 111.70 ? 248 VAL B CG2 1 
ATOM   7391  N N   . ASP B 1 240 ? -59.586 30.748  -15.317  1.00 116.82 ? 249 ASP B N   1 
ATOM   7392  C CA  . ASP B 1 240 ? -59.086 32.111  -15.447  1.00 118.91 ? 249 ASP B CA  1 
ATOM   7393  C C   . ASP B 1 240 ? -59.379 32.917  -14.188  1.00 121.09 ? 249 ASP B C   1 
ATOM   7394  O O   . ASP B 1 240 ? -60.526 33.272  -13.919  1.00 122.80 ? 249 ASP B O   1 
ATOM   7395  C CB  . ASP B 1 240 ? -59.701 32.796  -16.669  1.00 120.54 ? 249 ASP B CB  1 
ATOM   7396  C CG  . ASP B 1 240 ? -58.998 34.092  -17.025  1.00 122.74 ? 249 ASP B CG  1 
ATOM   7397  O OD1 . ASP B 1 240 ? -59.394 34.728  -18.024  1.00 124.61 ? 249 ASP B OD1 1 
ATOM   7398  O OD2 . ASP B 1 240 ? -58.048 34.472  -16.308  1.00 122.92 ? 249 ASP B OD2 1 
ATOM   7399  N N   . TYR B 1 241 ? -58.335 33.204  -13.417  1.00 124.98 ? 250 TYR B N   1 
ATOM   7400  C CA  . TYR B 1 241 ? -58.485 33.951  -12.174  1.00 127.45 ? 250 TYR B CA  1 
ATOM   7401  C C   . TYR B 1 241 ? -58.659 35.446  -12.431  1.00 130.67 ? 250 TYR B C   1 
ATOM   7402  O O   . TYR B 1 241 ? -58.711 36.244  -11.495  1.00 133.35 ? 250 TYR B O   1 
ATOM   7403  C CB  . TYR B 1 241 ? -57.291 33.701  -11.250  1.00 127.03 ? 250 TYR B CB  1 
ATOM   7404  C CG  . TYR B 1 241 ? -57.163 32.263  -10.798  1.00 124.66 ? 250 TYR B CG  1 
ATOM   7405  C CD1 . TYR B 1 241 ? -57.836 31.807  -9.673   1.00 125.45 ? 250 TYR B CD1 1 
ATOM   7406  C CD2 . TYR B 1 241 ? -56.372 31.362  -11.499  1.00 122.06 ? 250 TYR B CD2 1 
ATOM   7407  C CE1 . TYR B 1 241 ? -57.724 30.494  -9.256   1.00 123.74 ? 250 TYR B CE1 1 
ATOM   7408  C CE2 . TYR B 1 241 ? -56.253 30.046  -11.089  1.00 120.35 ? 250 TYR B CE2 1 
ATOM   7409  C CZ  . TYR B 1 241 ? -56.932 29.618  -9.967   1.00 121.20 ? 250 TYR B CZ  1 
ATOM   7410  O OH  . TYR B 1 241 ? -56.817 28.310  -9.555   1.00 119.93 ? 250 TYR B OH  1 
ATOM   7411  N N   . ASP B 1 242 ? -58.753 35.817  -13.704  1.00 147.79 ? 251 ASP B N   1 
ATOM   7412  C CA  . ASP B 1 242 ? -58.961 37.211  -14.080  1.00 151.24 ? 251 ASP B CA  1 
ATOM   7413  C C   . ASP B 1 242 ? -60.440 37.519  -14.297  1.00 153.25 ? 251 ASP B C   1 
ATOM   7414  O O   . ASP B 1 242 ? -60.833 38.683  -14.388  1.00 156.81 ? 251 ASP B O   1 
ATOM   7415  C CB  . ASP B 1 242 ? -58.151 37.564  -15.330  1.00 151.14 ? 251 ASP B CB  1 
ATOM   7416  C CG  . ASP B 1 242 ? -56.679 37.770  -15.031  1.00 150.74 ? 251 ASP B CG  1 
ATOM   7417  O OD1 . ASP B 1 242 ? -56.313 37.808  -13.836  1.00 151.07 ? 251 ASP B OD1 1 
ATOM   7418  O OD2 . ASP B 1 242 ? -55.887 37.899  -15.989  1.00 150.43 ? 251 ASP B OD2 1 
ATOM   7419  N N   . ASP B 1 243 ? -61.255 36.472  -14.382  1.00 181.21 ? 252 ASP B N   1 
ATOM   7420  C CA  . ASP B 1 243 ? -62.698 36.639  -14.496  1.00 183.11 ? 252 ASP B CA  1 
ATOM   7421  C C   . ASP B 1 243 ? -63.281 37.090  -13.165  1.00 185.56 ? 252 ASP B C   1 
ATOM   7422  O O   . ASP B 1 243 ? -62.978 36.515  -12.120  1.00 184.37 ? 252 ASP B O   1 
ATOM   7423  C CB  . ASP B 1 243 ? -63.364 35.335  -14.941  1.00 180.41 ? 252 ASP B CB  1 
ATOM   7424  C CG  . ASP B 1 243 ? -63.269 35.111  -16.437  1.00 179.56 ? 252 ASP B CG  1 
ATOM   7425  O OD1 . ASP B 1 243 ? -62.895 36.059  -17.160  1.00 181.55 ? 252 ASP B OD1 1 
ATOM   7426  O OD2 . ASP B 1 243 ? -63.574 33.988  -16.892  1.00 177.26 ? 252 ASP B OD2 1 
ATOM   7427  N N   . SER B 1 244 ? -64.116 38.122  -13.206  1.00 150.57 ? 253 SER B N   1 
ATOM   7428  C CA  . SER B 1 244 ? -64.769 38.620  -12.003  1.00 153.62 ? 253 SER B CA  1 
ATOM   7429  C C   . SER B 1 244 ? -65.596 37.516  -11.353  1.00 152.08 ? 253 SER B C   1 
ATOM   7430  O O   . SER B 1 244 ? -65.825 37.526  -10.144  1.00 153.58 ? 253 SER B O   1 
ATOM   7431  C CB  . SER B 1 244 ? -65.651 39.826  -12.331  1.00 158.29 ? 253 SER B CB  1 
ATOM   7432  O OG  . SER B 1 244 ? -66.581 39.515  -13.354  1.00 158.12 ? 253 SER B OG  1 
ATOM   7433  N N   . LEU B 1 245 ? -66.039 36.564  -12.168  1.00 135.92 ? 254 LEU B N   1 
ATOM   7434  C CA  . LEU B 1 245 ? -66.808 35.428  -11.678  1.00 134.39 ? 254 LEU B CA  1 
ATOM   7435  C C   . LEU B 1 245 ? -65.930 34.542  -10.802  1.00 131.78 ? 254 LEU B C   1 
ATOM   7436  O O   . LEU B 1 245 ? -66.298 34.203  -9.677   1.00 132.65 ? 254 LEU B O   1 
ATOM   7437  C CB  . LEU B 1 245 ? -67.374 34.625  -12.851  1.00 132.37 ? 254 LEU B CB  1 
ATOM   7438  C CG  . LEU B 1 245 ? -68.490 33.614  -12.567  1.00 131.76 ? 254 LEU B CG  1 
ATOM   7439  C CD1 . LEU B 1 245 ? -69.174 33.201  -13.862  1.00 131.16 ? 254 LEU B CD1 1 
ATOM   7440  C CD2 . LEU B 1 245 ? -67.965 32.393  -11.825  1.00 128.77 ? 254 LEU B CD2 1 
ATOM   7441  N N   . VAL B 1 246 ? -64.767 34.169  -11.325  1.00 130.05 ? 255 VAL B N   1 
ATOM   7442  C CA  . VAL B 1 246 ? -63.829 33.332  -10.588  1.00 127.81 ? 255 VAL B CA  1 
ATOM   7443  C C   . VAL B 1 246 ? -63.216 34.105  -9.426   1.00 130.16 ? 255 VAL B C   1 
ATOM   7444  O O   . VAL B 1 246 ? -63.032 33.564  -8.336   1.00 130.23 ? 255 VAL B O   1 
ATOM   7445  C CB  . VAL B 1 246 ? -62.704 32.809  -11.501  1.00 124.67 ? 255 VAL B CB  1 
ATOM   7446  C CG1 . VAL B 1 246 ? -61.725 31.961  -10.704  1.00 122.85 ? 255 VAL B CG1 1 
ATOM   7447  C CG2 . VAL B 1 246 ? -63.287 32.013  -12.658  1.00 122.74 ? 255 VAL B CG2 1 
ATOM   7448  N N   . SER B 1 247 ? -62.906 35.375  -9.668   1.00 133.45 ? 256 SER B N   1 
ATOM   7449  C CA  . SER B 1 247 ? -62.317 36.232  -8.648   1.00 136.23 ? 256 SER B CA  1 
ATOM   7450  C C   . SER B 1 247 ? -63.214 36.321  -7.419   1.00 139.19 ? 256 SER B C   1 
ATOM   7451  O O   . SER B 1 247 ? -62.731 36.354  -6.287   1.00 140.63 ? 256 SER B O   1 
ATOM   7452  C CB  . SER B 1 247 ? -62.058 37.630  -9.211   1.00 138.87 ? 256 SER B CB  1 
ATOM   7453  O OG  . SER B 1 247 ? -61.474 38.473  -8.233   1.00 141.88 ? 256 SER B OG  1 
ATOM   7454  N N   . LYS B 1 248 ? -64.523 36.361  -7.649   1.00 151.57 ? 257 LYS B N   1 
ATOM   7455  C CA  . LYS B 1 248 ? -65.490 36.423  -6.560   1.00 154.69 ? 257 LYS B CA  1 
ATOM   7456  C C   . LYS B 1 248 ? -65.558 35.093  -5.817   1.00 152.74 ? 257 LYS B C   1 
ATOM   7457  O O   . LYS B 1 248 ? -65.737 35.060  -4.600   1.00 155.23 ? 257 LYS B O   1 
ATOM   7458  C CB  . LYS B 1 248 ? -66.874 36.803  -7.092   1.00 156.72 ? 257 LYS B CB  1 
ATOM   7459  N N   . PHE B 1 249 ? -65.413 33.999  -6.558   1.00 147.58 ? 258 PHE B N   1 
ATOM   7460  C CA  . PHE B 1 249 ? -65.432 32.666  -5.968   1.00 145.75 ? 258 PHE B CA  1 
ATOM   7461  C C   . PHE B 1 249 ? -64.275 32.489  -4.993   1.00 145.95 ? 258 PHE B C   1 
ATOM   7462  O O   . PHE B 1 249 ? -64.455 31.983  -3.886   1.00 147.46 ? 258 PHE B O   1 
ATOM   7463  C CB  . PHE B 1 249 ? -65.368 31.595  -7.059   1.00 141.63 ? 258 PHE B CB  1 
ATOM   7464  C CG  . PHE B 1 249 ? -65.271 30.193  -6.527   1.00 139.85 ? 258 PHE B CG  1 
ATOM   7465  C CD1 . PHE B 1 249 ? -66.414 29.475  -6.214   1.00 140.48 ? 258 PHE B CD1 1 
ATOM   7466  C CD2 . PHE B 1 249 ? -64.037 29.591  -6.342   1.00 137.90 ? 258 PHE B CD2 1 
ATOM   7467  C CE1 . PHE B 1 249 ? -66.328 28.186  -5.725   1.00 139.25 ? 258 PHE B CE1 1 
ATOM   7468  C CE2 . PHE B 1 249 ? -63.945 28.303  -5.853   1.00 136.76 ? 258 PHE B CE2 1 
ATOM   7469  C CZ  . PHE B 1 249 ? -65.092 27.599  -5.544   1.00 137.46 ? 258 PHE B CZ  1 
ATOM   7470  N N   . ILE B 1 250 ? -63.086 32.908  -5.414   1.00 166.62 ? 259 ILE B N   1 
ATOM   7471  C CA  . ILE B 1 250 ? -61.893 32.804  -4.580   1.00 166.99 ? 259 ILE B CA  1 
ATOM   7472  C C   . ILE B 1 250 ? -62.020 33.648  -3.315   1.00 171.59 ? 259 ILE B C   1 
ATOM   7473  O O   . ILE B 1 250 ? -61.556 33.253  -2.246   1.00 172.94 ? 259 ILE B O   1 
ATOM   7474  C CB  . ILE B 1 250 ? -60.624 33.213  -5.357   1.00 165.21 ? 259 ILE B CB  1 
ATOM   7475  C CG1 . ILE B 1 250 ? -60.075 32.023  -6.145   1.00 161.03 ? 259 ILE B CG1 1 
ATOM   7476  C CG2 . ILE B 1 250 ? -59.557 33.733  -4.409   1.00 167.42 ? 259 ILE B CG2 1 
ATOM   7477  C CD1 . ILE B 1 250 ? -61.046 31.446  -7.149   1.00 158.94 ? 259 ILE B CD1 1 
ATOM   7478  N N   . GLU B 1 251 ? -62.658 34.807  -3.442   1.00 140.16 ? 260 GLU B N   1 
ATOM   7479  C CA  . GLU B 1 251 ? -62.857 35.700  -2.305   1.00 145.12 ? 260 GLU B CA  1 
ATOM   7480  C C   . GLU B 1 251 ? -63.528 34.977  -1.141   1.00 147.07 ? 260 GLU B C   1 
ATOM   7481  O O   . GLU B 1 251 ? -63.234 35.249  0.022    1.00 150.60 ? 260 GLU B O   1 
ATOM   7482  C CB  . GLU B 1 251 ? -63.688 36.917  -2.718   1.00 148.05 ? 260 GLU B CB  1 
ATOM   7483  N N   . ARG B 1 252 ? -64.430 34.054  -1.463   1.00 144.72 ? 261 ARG B N   1 
ATOM   7484  C CA  . ARG B 1 252 ? -65.148 33.295  -0.445   1.00 146.61 ? 261 ARG B CA  1 
ATOM   7485  C C   . ARG B 1 252 ? -64.478 31.951  -0.179   1.00 143.93 ? 261 ARG B C   1 
ATOM   7486  O O   . ARG B 1 252 ? -64.549 31.420  0.928    1.00 146.26 ? 261 ARG B O   1 
ATOM   7487  C CB  . ARG B 1 252 ? -66.605 33.081  -0.864   1.00 146.75 ? 261 ARG B CB  1 
ATOM   7488  N N   . TRP B 1 253 ? -63.830 31.407  -1.204   1.00 148.95 ? 262 TRP B N   1 
ATOM   7489  C CA  . TRP B 1 253 ? -63.153 30.120  -1.092   1.00 146.42 ? 262 TRP B CA  1 
ATOM   7490  C C   . TRP B 1 253 ? -61.924 30.218  -0.193   1.00 148.08 ? 262 TRP B C   1 
ATOM   7491  O O   . TRP B 1 253 ? -61.730 29.393  0.699    1.00 149.31 ? 262 TRP B O   1 
ATOM   7492  C CB  . TRP B 1 253 ? -62.758 29.608  -2.480   1.00 141.69 ? 262 TRP B CB  1 
ATOM   7493  C CG  . TRP B 1 253 ? -61.955 28.338  -2.465   1.00 139.27 ? 262 TRP B CG  1 
ATOM   7494  C CD1 . TRP B 1 253 ? -60.595 28.229  -2.429   1.00 138.33 ? 262 TRP B CD1 1 
ATOM   7495  C CD2 . TRP B 1 253 ? -62.463 26.998  -2.497   1.00 137.87 ? 262 TRP B CD2 1 
ATOM   7496  N NE1 . TRP B 1 253 ? -60.226 26.905  -2.431   1.00 136.54 ? 262 TRP B NE1 1 
ATOM   7497  C CE2 . TRP B 1 253 ? -61.354 26.129  -2.473   1.00 136.25 ? 262 TRP B CE2 1 
ATOM   7498  C CE3 . TRP B 1 253 ? -63.749 26.449  -2.539   1.00 138.13 ? 262 TRP B CE3 1 
ATOM   7499  C CZ2 . TRP B 1 253 ? -61.491 24.742  -2.491   1.00 135.00 ? 262 TRP B CZ2 1 
ATOM   7500  C CZ3 . TRP B 1 253 ? -63.882 25.072  -2.557   1.00 136.76 ? 262 TRP B CZ3 1 
ATOM   7501  C CH2 . TRP B 1 253 ? -62.759 24.234  -2.533   1.00 135.27 ? 262 TRP B CH2 1 
ATOM   7502  N N   . SER B 1 254 ? -61.104 31.237  -0.428   1.00 149.88 ? 263 SER B N   1 
ATOM   7503  C CA  . SER B 1 254 ? -59.858 31.415  0.313    1.00 151.50 ? 263 SER B CA  1 
ATOM   7504  C C   . SER B 1 254 ? -60.088 31.665  1.801    1.00 156.65 ? 263 SER B C   1 
ATOM   7505  O O   . SER B 1 254 ? -59.170 31.522  2.608    1.00 158.53 ? 263 SER B O   1 
ATOM   7506  C CB  . SER B 1 254 ? -59.043 32.564  -0.285   1.00 151.31 ? 263 SER B CB  1 
ATOM   7507  O OG  . SER B 1 254 ? -59.735 33.795  -0.172   1.00 154.43 ? 263 SER B OG  1 
ATOM   7508  N N   . THR B 1 255 ? -61.312 32.037  2.160    1.00 163.78 ? 264 THR B N   1 
ATOM   7509  C CA  . THR B 1 255 ? -61.631 32.365  3.546    1.00 169.30 ? 264 THR B CA  1 
ATOM   7510  C C   . THR B 1 255 ? -62.250 31.188  4.297    1.00 170.37 ? 264 THR B C   1 
ATOM   7511  O O   . THR B 1 255 ? -62.190 31.128  5.525    1.00 174.81 ? 264 THR B O   1 
ATOM   7512  C CB  . THR B 1 255 ? -62.580 33.574  3.636    1.00 172.76 ? 264 THR B CB  1 
ATOM   7513  O OG1 . THR B 1 255 ? -63.818 33.262  2.986    1.00 171.05 ? 264 THR B OG1 1 
ATOM   7514  C CG2 . THR B 1 255 ? -61.954 34.790  2.971    1.00 172.51 ? 264 THR B CG2 1 
ATOM   7515  N N   . LEU B 1 256 ? -62.843 30.258  3.555    1.00 151.91 ? 265 LEU B N   1 
ATOM   7516  C CA  . LEU B 1 256 ? -63.494 29.097  4.155    1.00 152.82 ? 265 LEU B CA  1 
ATOM   7517  C C   . LEU B 1 256 ? -62.581 28.380  5.144    1.00 154.79 ? 265 LEU B C   1 
ATOM   7518  O O   . LEU B 1 256 ? -61.366 28.328  4.958    1.00 153.20 ? 265 LEU B O   1 
ATOM   7519  C CB  . LEU B 1 256 ? -63.963 28.121  3.074    1.00 148.05 ? 265 LEU B CB  1 
ATOM   7520  C CG  . LEU B 1 256 ? -65.095 28.603  2.165    1.00 146.71 ? 265 LEU B CG  1 
ATOM   7521  C CD1 . LEU B 1 256 ? -65.399 27.566  1.096    1.00 142.18 ? 265 LEU B CD1 1 
ATOM   7522  C CD2 . LEU B 1 256 ? -66.340 28.922  2.977    1.00 151.16 ? 265 LEU B CD2 1 
ATOM   7523  N N   . GLU B 1 257 ? -63.177 27.831  6.198    1.00 194.91 ? 266 GLU B N   1 
ATOM   7524  C CA  . GLU B 1 257 ? -62.426 27.112  7.219    1.00 197.69 ? 266 GLU B CA  1 
ATOM   7525  C C   . GLU B 1 257 ? -61.845 25.822  6.651    1.00 193.68 ? 266 GLU B C   1 
ATOM   7526  O O   . GLU B 1 257 ? -62.572 24.988  6.111    1.00 191.21 ? 266 GLU B O   1 
ATOM   7527  C CB  . GLU B 1 257 ? -63.322 26.802  8.420    1.00 203.10 ? 266 GLU B CB  1 
ATOM   7528  C CG  . GLU B 1 257 ? -62.599 26.151  9.588    1.00 207.18 ? 266 GLU B CG  1 
ATOM   7529  C CD  . GLU B 1 257 ? -63.518 25.882  10.763   1.00 213.04 ? 266 GLU B CD  1 
ATOM   7530  O OE1 . GLU B 1 257 ? -63.010 25.537  11.851   1.00 217.69 ? 266 GLU B OE1 1 
ATOM   7531  O OE2 . GLU B 1 257 ? -64.749 26.017  10.600   1.00 213.31 ? 266 GLU B OE2 1 
ATOM   7532  N N   . GLU B 1 258 ? -60.531 25.663  6.777    1.00 183.52 ? 267 GLU B N   1 
ATOM   7533  C CA  . GLU B 1 258 ? -59.847 24.493  6.235    1.00 180.14 ? 267 GLU B CA  1 
ATOM   7534  C C   . GLU B 1 258 ? -60.181 23.232  7.027    1.00 182.76 ? 267 GLU B C   1 
ATOM   7535  O O   . GLU B 1 258 ? -59.933 22.117  6.569    1.00 180.31 ? 267 GLU B O   1 
ATOM   7536  C CB  . GLU B 1 258 ? -58.334 24.720  6.208    1.00 179.73 ? 267 GLU B CB  1 
ATOM   7537  C CG  . GLU B 1 258 ? -57.564 23.669  5.422    1.00 175.85 ? 267 GLU B CG  1 
ATOM   7538  C CD  . GLU B 1 258 ? -56.087 23.993  5.303    1.00 175.42 ? 267 GLU B CD  1 
ATOM   7539  O OE1 . GLU B 1 258 ? -55.377 23.269  4.573    1.00 172.31 ? 267 GLU B OE1 1 
ATOM   7540  O OE2 . GLU B 1 258 ? -55.637 24.971  5.936    1.00 178.47 ? 267 GLU B OE2 1 
ATOM   7541  N N   . LYS B 1 259 ? -60.746 23.415  8.216    1.00 160.62 ? 268 LYS B N   1 
ATOM   7542  C CA  . LYS B 1 259 ? -61.132 22.288  9.056    1.00 163.99 ? 268 LYS B CA  1 
ATOM   7543  C C   . LYS B 1 259 ? -62.333 21.554  8.466    1.00 161.61 ? 268 LYS B C   1 
ATOM   7544  O O   . LYS B 1 259 ? -62.290 20.341  8.259    1.00 160.39 ? 268 LYS B O   1 
ATOM   7545  C CB  . LYS B 1 259 ? -61.449 22.759  10.477   1.00 170.93 ? 268 LYS B CB  1 
ATOM   7546  N N   . GLU B 1 260 ? -63.400 22.298  8.194    1.00 199.48 ? 269 GLU B N   1 
ATOM   7547  C CA  . GLU B 1 260 ? -64.611 21.723  7.619    1.00 197.53 ? 269 GLU B CA  1 
ATOM   7548  C C   . GLU B 1 260 ? -64.446 21.480  6.123    1.00 191.12 ? 269 GLU B C   1 
ATOM   7549  O O   . GLU B 1 260 ? -64.959 20.501  5.582    1.00 189.00 ? 269 GLU B O   1 
ATOM   7550  C CB  . GLU B 1 260 ? -65.811 22.636  7.875    1.00 199.98 ? 269 GLU B CB  1 
ATOM   7551  N N   . TYR B 1 261 ? -63.727 22.380  5.460    1.00 175.24 ? 270 TYR B N   1 
ATOM   7552  C CA  . TYR B 1 261 ? -63.467 22.254  4.031    1.00 169.63 ? 270 TYR B CA  1 
ATOM   7553  C C   . TYR B 1 261 ? -61.984 22.005  3.773    1.00 167.75 ? 270 TYR B C   1 
ATOM   7554  O O   . TYR B 1 261 ? -61.211 22.949  3.605    1.00 167.22 ? 270 TYR B O   1 
ATOM   7555  C CB  . TYR B 1 261 ? -63.928 23.511  3.290    1.00 168.02 ? 270 TYR B CB  1 
ATOM   7556  C CG  . TYR B 1 261 ? -65.410 23.788  3.408    1.00 169.79 ? 270 TYR B CG  1 
ATOM   7557  C CD1 . TYR B 1 261 ? -66.305 23.295  2.467    1.00 166.98 ? 270 TYR B CD1 1 
ATOM   7558  C CD2 . TYR B 1 261 ? -65.913 24.544  4.458    1.00 174.63 ? 270 TYR B CD2 1 
ATOM   7559  C CE1 . TYR B 1 261 ? -67.660 23.548  2.570    1.00 168.85 ? 270 TYR B CE1 1 
ATOM   7560  C CE2 . TYR B 1 261 ? -67.266 24.801  4.571    1.00 176.59 ? 270 TYR B CE2 1 
ATOM   7561  C CZ  . TYR B 1 261 ? -68.135 24.301  3.624    1.00 173.63 ? 270 TYR B CZ  1 
ATOM   7562  O OH  . TYR B 1 261 ? -69.484 24.554  3.733    1.00 175.83 ? 270 TYR B OH  1 
ATOM   7563  N N   . PRO B 1 262 ? -61.583 20.725  3.743    1.00 144.59 ? 271 PRO B N   1 
ATOM   7564  C CA  . PRO B 1 262 ? -60.191 20.309  3.539    1.00 143.29 ? 271 PRO B CA  1 
ATOM   7565  C C   . PRO B 1 262 ? -59.581 20.904  2.272    1.00 138.80 ? 271 PRO B C   1 
ATOM   7566  O O   . PRO B 1 262 ? -60.219 20.899  1.219    1.00 135.53 ? 271 PRO B O   1 
ATOM   7567  C CB  . PRO B 1 262 ? -60.305 18.782  3.404    1.00 142.81 ? 271 PRO B CB  1 
ATOM   7568  C CG  . PRO B 1 262 ? -61.763 18.533  3.097    1.00 142.19 ? 271 PRO B CG  1 
ATOM   7569  C CD  . PRO B 1 262 ? -62.459 19.557  3.922    1.00 145.44 ? 271 PRO B CD  1 
ATOM   7570  N N   . GLY B 1 263 ? -58.354 21.407  2.384    1.00 148.27 ? 272 GLY B N   1 
ATOM   7571  C CA  . GLY B 1 263 ? -57.649 21.982  1.252    1.00 144.58 ? 272 GLY B CA  1 
ATOM   7572  C C   . GLY B 1 263 ? -58.470 23.008  0.495    1.00 142.75 ? 272 GLY B C   1 
ATOM   7573  O O   . GLY B 1 263 ? -58.543 22.974  -0.733   1.00 139.12 ? 272 GLY B O   1 
ATOM   7574  N N   . ALA B 1 264 ? -59.087 23.927  1.231    1.00 169.51 ? 273 ALA B N   1 
ATOM   7575  C CA  . ALA B 1 264 ? -59.935 24.942  0.620    1.00 168.62 ? 273 ALA B CA  1 
ATOM   7576  C C   . ALA B 1 264 ? -59.565 26.347  1.082    1.00 171.13 ? 273 ALA B C   1 
ATOM   7577  O O   . ALA B 1 264 ? -60.242 27.316  0.742    1.00 171.40 ? 273 ALA B O   1 
ATOM   7578  C CB  . ALA B 1 264 ? -61.399 24.654  0.915    1.00 170.00 ? 273 ALA B CB  1 
ATOM   7579  N N   . HIS B 1 265 ? -58.490 26.456  1.856    1.00 153.81 ? 274 HIS B N   1 
ATOM   7580  C CA  . HIS B 1 265 ? -58.058 27.750  2.371    1.00 156.70 ? 274 HIS B CA  1 
ATOM   7581  C C   . HIS B 1 265 ? -56.896 28.312  1.556    1.00 154.33 ? 274 HIS B C   1 
ATOM   7582  O O   . HIS B 1 265 ? -55.871 28.708  2.110    1.00 156.39 ? 274 HIS B O   1 
ATOM   7583  C CB  . HIS B 1 265 ? -57.666 27.636  3.847    1.00 161.60 ? 274 HIS B CB  1 
ATOM   7584  C CG  . HIS B 1 265 ? -57.636 28.948  4.568    1.00 165.75 ? 274 HIS B CG  1 
ATOM   7585  N ND1 . HIS B 1 265 ? -58.723 29.444  5.256    1.00 169.39 ? 274 HIS B ND1 1 
ATOM   7586  C CD2 . HIS B 1 265 ? -56.651 29.866  4.710    1.00 167.20 ? 274 HIS B CD2 1 
ATOM   7587  C CE1 . HIS B 1 265 ? -58.409 30.611  5.789    1.00 172.98 ? 274 HIS B CE1 1 
ATOM   7588  N NE2 . HIS B 1 265 ? -57.158 30.890  5.473    1.00 171.70 ? 274 HIS B NE2 1 
ATOM   7589  N N   . THR B 1 266 ? -57.063 28.342  0.237    1.00 172.95 ? 275 THR B N   1 
ATOM   7590  C CA  . THR B 1 266 ? -56.033 28.860  -0.657   1.00 170.73 ? 275 THR B CA  1 
ATOM   7591  C C   . THR B 1 266 ? -56.617 29.847  -1.662   1.00 169.41 ? 275 THR B C   1 
ATOM   7592  O O   . THR B 1 266 ? -57.834 29.944  -1.815   1.00 169.57 ? 275 THR B O   1 
ATOM   7593  C CB  . THR B 1 266 ? -55.324 27.725  -1.420   1.00 167.21 ? 275 THR B CB  1 
ATOM   7594  O OG1 . THR B 1 266 ? -56.290 26.966  -2.157   1.00 164.63 ? 275 THR B OG1 1 
ATOM   7595  C CG2 . THR B 1 266 ? -54.594 26.805  -0.453   1.00 168.99 ? 275 THR B CG2 1 
ATOM   7596  N N   . ALA B 1 267 ? -55.742 30.575  -2.347   1.00 146.70 ? 276 ALA B N   1 
ATOM   7597  C CA  . ALA B 1 267 ? -56.169 31.560  -3.333   1.00 145.94 ? 276 ALA B CA  1 
ATOM   7598  C C   . ALA B 1 267 ? -56.366 30.926  -4.706   1.00 141.94 ? 276 ALA B C   1 
ATOM   7599  O O   . ALA B 1 267 ? -56.870 31.566  -5.629   1.00 141.27 ? 276 ALA B O   1 
ATOM   7600  C CB  . ALA B 1 267 ? -55.167 32.700  -3.412   1.00 147.41 ? 276 ALA B CB  1 
ATOM   7601  N N   . THR B 1 268 ? -55.965 29.665  -4.835   1.00 124.56 ? 277 THR B N   1 
ATOM   7602  C CA  . THR B 1 268 ? -56.103 28.943  -6.094   1.00 121.13 ? 277 THR B CA  1 
ATOM   7603  C C   . THR B 1 268 ? -56.930 27.676  -5.914   1.00 120.16 ? 277 THR B C   1 
ATOM   7604  O O   . THR B 1 268 ? -57.305 27.322  -4.797   1.00 122.13 ? 277 THR B O   1 
ATOM   7605  C CB  . THR B 1 268 ? -54.733 28.568  -6.682   1.00 119.33 ? 277 THR B CB  1 
ATOM   7606  O OG1 . THR B 1 268 ? -54.043 27.698  -5.777   1.00 120.01 ? 277 THR B OG1 1 
ATOM   7607  C CG2 . THR B 1 268 ? -53.896 29.815  -6.918   1.00 120.41 ? 277 THR B CG2 1 
ATOM   7608  N N   . ILE B 1 269 ? -57.209 26.996  -7.021   1.00 126.55 ? 278 ILE B N   1 
ATOM   7609  C CA  . ILE B 1 269 ? -58.004 25.775  -6.989   1.00 125.66 ? 278 ILE B CA  1 
ATOM   7610  C C   . ILE B 1 269 ? -57.668 24.861  -8.165   1.00 122.85 ? 278 ILE B C   1 
ATOM   7611  O O   . ILE B 1 269 ? -57.557 25.314  -9.305   1.00 121.53 ? 278 ILE B O   1 
ATOM   7612  C CB  . ILE B 1 269 ? -59.514 26.089  -6.994   1.00 126.54 ? 278 ILE B CB  1 
ATOM   7613  C CG1 . ILE B 1 269 ? -60.332 24.796  -7.026   1.00 125.70 ? 278 ILE B CG1 1 
ATOM   7614  C CG2 . ILE B 1 269 ? -59.871 26.980  -8.176   1.00 125.75 ? 278 ILE B CG2 1 
ATOM   7615  C CD1 . ILE B 1 269 ? -61.828 25.021  -7.033   1.00 126.74 ? 278 ILE B CD1 1 
ATOM   7616  N N   . LYS B 1 270 ? -57.502 23.573  -7.879   1.00 138.47 ? 279 LYS B N   1 
ATOM   7617  C CA  . LYS B 1 270 ? -57.215 22.589  -8.915   1.00 136.32 ? 279 LYS B CA  1 
ATOM   7618  C C   . LYS B 1 270 ? -58.344 22.555  -9.938   1.00 135.17 ? 279 LYS B C   1 
ATOM   7619  O O   . LYS B 1 270 ? -59.517 22.674  -9.583   1.00 136.08 ? 279 LYS B O   1 
ATOM   7620  C CB  . LYS B 1 270 ? -57.014 21.203  -8.300   1.00 136.73 ? 279 LYS B CB  1 
ATOM   7621  N N   . TYR B 1 271 ? -57.988 22.394  -11.209  1.00 129.41 ? 280 TYR B N   1 
ATOM   7622  C CA  . TYR B 1 271 ? -58.979 22.407  -12.280  1.00 128.70 ? 280 TYR B CA  1 
ATOM   7623  C C   . TYR B 1 271 ? -60.003 21.286  -12.114  1.00 128.73 ? 280 TYR B C   1 
ATOM   7624  O O   . TYR B 1 271 ? -61.157 21.422  -12.521  1.00 128.96 ? 280 TYR B O   1 
ATOM   7625  C CB  . TYR B 1 271 ? -58.306 22.335  -13.655  1.00 127.44 ? 280 TYR B CB  1 
ATOM   7626  C CG  . TYR B 1 271 ? -57.749 20.977  -14.019  1.00 126.57 ? 280 TYR B CG  1 
ATOM   7627  C CD1 . TYR B 1 271 ? -58.482 20.092  -14.799  1.00 126.14 ? 280 TYR B CD1 1 
ATOM   7628  C CD2 . TYR B 1 271 ? -56.489 20.582  -13.591  1.00 126.56 ? 280 TYR B CD2 1 
ATOM   7629  C CE1 . TYR B 1 271 ? -57.978 18.851  -15.139  1.00 125.78 ? 280 TYR B CE1 1 
ATOM   7630  C CE2 . TYR B 1 271 ? -55.975 19.342  -13.926  1.00 126.22 ? 280 TYR B CE2 1 
ATOM   7631  C CZ  . TYR B 1 271 ? -56.725 18.481  -14.700  1.00 125.85 ? 280 TYR B CZ  1 
ATOM   7632  O OH  . TYR B 1 271 ? -56.220 17.246  -15.037  1.00 125.93 ? 280 TYR B OH  1 
ATOM   7633  N N   . THR B 1 272 ? -59.578 20.183  -11.508  1.00 116.28 ? 281 THR B N   1 
ATOM   7634  C CA  . THR B 1 272 ? -60.476 19.068  -11.235  1.00 116.72 ? 281 THR B CA  1 
ATOM   7635  C C   . THR B 1 272 ? -61.552 19.481  -10.235  1.00 118.34 ? 281 THR B C   1 
ATOM   7636  O O   . THR B 1 272 ? -62.719 19.114  -10.374  1.00 118.73 ? 281 THR B O   1 
ATOM   7637  C CB  . THR B 1 272 ? -59.714 17.850  -10.682  1.00 117.12 ? 281 THR B CB  1 
ATOM   7638  O OG1 . THR B 1 272 ? -59.003 18.227  -9.496   1.00 118.41 ? 281 THR B OG1 1 
ATOM   7639  C CG2 . THR B 1 272 ? -58.725 17.331  -11.711  1.00 115.89 ? 281 THR B CG2 1 
ATOM   7640  N N   . SER B 1 273 ? -61.150 20.249  -9.227   1.00 110.99 ? 282 SER B N   1 
ATOM   7641  C CA  . SER B 1 273 ? -62.081 20.736  -8.217   1.00 113.07 ? 282 SER B CA  1 
ATOM   7642  C C   . SER B 1 273 ? -63.007 21.800  -8.798   1.00 113.21 ? 282 SER B C   1 
ATOM   7643  O O   . SER B 1 273 ? -64.202 21.825  -8.505   1.00 114.49 ? 282 SER B O   1 
ATOM   7644  C CB  . SER B 1 273 ? -61.321 21.300  -7.015   1.00 114.87 ? 282 SER B CB  1 
ATOM   7645  O OG  . SER B 1 273 ? -60.524 20.303  -6.403   1.00 115.34 ? 282 SER B OG  1 
ATOM   7646  N N   . ALA B 1 274 ? -62.445 22.676  -9.625   1.00 114.82 ? 283 ALA B N   1 
ATOM   7647  C CA  . ALA B 1 274 ? -63.214 23.745  -10.250  1.00 115.34 ? 283 ALA B CA  1 
ATOM   7648  C C   . ALA B 1 274 ? -64.305 23.180  -11.151  1.00 114.78 ? 283 ALA B C   1 
ATOM   7649  O O   . ALA B 1 274 ? -65.399 23.737  -11.242  1.00 116.12 ? 283 ALA B O   1 
ATOM   7650  C CB  . ALA B 1 274 ? -62.299 24.667  -11.035  1.00 114.61 ? 283 ALA B CB  1 
ATOM   7651  N N   . LEU B 1 275 ? -64.001 22.071  -11.817  1.00 112.87 ? 284 LEU B N   1 
ATOM   7652  C CA  . LEU B 1 275 ? -64.973 21.411  -12.681  1.00 112.57 ? 284 LEU B CA  1 
ATOM   7653  C C   . LEU B 1 275 ? -66.077 20.762  -11.855  1.00 113.88 ? 284 LEU B C   1 
ATOM   7654  O O   . LEU B 1 275 ? -67.231 20.708  -12.279  1.00 114.61 ? 284 LEU B O   1 
ATOM   7655  C CB  . LEU B 1 275 ? -64.291 20.369  -13.568  1.00 110.93 ? 284 LEU B CB  1 
ATOM   7656  C CG  . LEU B 1 275 ? -63.396 20.916  -14.681  1.00 109.94 ? 284 LEU B CG  1 
ATOM   7657  C CD1 . LEU B 1 275 ? -62.752 19.778  -15.454  1.00 108.83 ? 284 LEU B CD1 1 
ATOM   7658  C CD2 . LEU B 1 275 ? -64.188 21.821  -15.611  1.00 110.70 ? 284 LEU B CD2 1 
ATOM   7659  N N   . THR B 1 276 ? -65.717 20.269  -10.675  1.00 111.75 ? 285 THR B N   1 
ATOM   7660  C CA  . THR B 1 276 ? -66.691 19.677  -9.765   1.00 113.47 ? 285 THR B CA  1 
ATOM   7661  C C   . THR B 1 276 ? -67.733 20.713  -9.359   1.00 115.45 ? 285 THR B C   1 
ATOM   7662  O O   . THR B 1 276 ? -68.932 20.436  -9.355   1.00 116.63 ? 285 THR B O   1 
ATOM   7663  C CB  . THR B 1 276 ? -66.012 19.118  -8.503   1.00 114.45 ? 285 THR B CB  1 
ATOM   7664  O OG1 . THR B 1 276 ? -65.075 18.099  -8.873   1.00 113.03 ? 285 THR B OG1 1 
ATOM   7665  C CG2 . THR B 1 276 ? -67.047 18.531  -7.556   1.00 116.72 ? 285 THR B CG2 1 
ATOM   7666  N N   . TYR B 1 277 ? -67.263 21.909  -9.019   1.00 116.18 ? 286 TYR B N   1 
ATOM   7667  C CA  . TYR B 1 277 ? -68.142 23.012  -8.659   1.00 118.46 ? 286 TYR B CA  1 
ATOM   7668  C C   . TYR B 1 277 ? -69.051 23.380  -9.826   1.00 118.34 ? 286 TYR B C   1 
ATOM   7669  O O   . TYR B 1 277 ? -70.246 23.612  -9.646   1.00 120.33 ? 286 TYR B O   1 
ATOM   7670  C CB  . TYR B 1 277 ? -67.317 24.226  -8.230   1.00 119.25 ? 286 TYR B CB  1 
ATOM   7671  C CG  . TYR B 1 277 ? -68.123 25.488  -8.011   1.00 121.86 ? 286 TYR B CG  1 
ATOM   7672  C CD1 . TYR B 1 277 ? -68.328 26.392  -9.046   1.00 121.78 ? 286 TYR B CD1 1 
ATOM   7673  C CD2 . TYR B 1 277 ? -68.672 25.780  -6.769   1.00 124.89 ? 286 TYR B CD2 1 
ATOM   7674  C CE1 . TYR B 1 277 ? -69.059 27.546  -8.853   1.00 124.62 ? 286 TYR B CE1 1 
ATOM   7675  C CE2 . TYR B 1 277 ? -69.406 26.934  -6.566   1.00 127.72 ? 286 TYR B CE2 1 
ATOM   7676  C CZ  . TYR B 1 277 ? -69.595 27.813  -7.612   1.00 127.55 ? 286 TYR B CZ  1 
ATOM   7677  O OH  . TYR B 1 277 ? -70.323 28.962  -7.418   1.00 130.79 ? 286 TYR B OH  1 
ATOM   7678  N N   . ASP B 1 278 ? -68.477 23.430  -11.023  1.00 122.00 ? 287 ASP B N   1 
ATOM   7679  C CA  . ASP B 1 278 ? -69.241 23.750  -12.224  1.00 122.19 ? 287 ASP B CA  1 
ATOM   7680  C C   . ASP B 1 278 ? -70.206 22.624  -12.580  1.00 122.14 ? 287 ASP B C   1 
ATOM   7681  O O   . ASP B 1 278 ? -71.214 22.847  -13.250  1.00 123.30 ? 287 ASP B O   1 
ATOM   7682  C CB  . ASP B 1 278 ? -68.303 24.037  -13.398  1.00 120.50 ? 287 ASP B CB  1 
ATOM   7683  C CG  . ASP B 1 278 ? -67.571 25.357  -13.249  1.00 121.16 ? 287 ASP B CG  1 
ATOM   7684  O OD1 . ASP B 1 278 ? -68.066 26.232  -12.508  1.00 123.34 ? 287 ASP B OD1 1 
ATOM   7685  O OD2 . ASP B 1 278 ? -66.503 25.520  -13.876  1.00 119.77 ? 287 ASP B OD2 1 
ATOM   7686  N N   . ALA B 1 279 ? -69.891 21.415  -12.126  1.00 117.43 ? 288 ALA B N   1 
ATOM   7687  C CA  . ALA B 1 279 ? -70.747 20.261  -12.371  1.00 117.63 ? 288 ALA B CA  1 
ATOM   7688  C C   . ALA B 1 279 ? -72.068 20.409  -11.628  1.00 120.15 ? 288 ALA B C   1 
ATOM   7689  O O   . ALA B 1 279 ? -73.133 20.118  -12.171  1.00 121.08 ? 288 ALA B O   1 
ATOM   7690  C CB  . ALA B 1 279 ? -70.043 18.980  -11.956  1.00 116.50 ? 288 ALA B CB  1 
ATOM   7691  N N   . VAL B 1 280 ? -71.991 20.864  -10.381  1.00 117.70 ? 289 VAL B N   1 
ATOM   7692  C CA  . VAL B 1 280 ? -73.179 21.087  -9.570   1.00 120.56 ? 289 VAL B CA  1 
ATOM   7693  C C   . VAL B 1 280 ? -74.112 22.082  -10.250  1.00 122.05 ? 289 VAL B C   1 
ATOM   7694  O O   . VAL B 1 280 ? -75.327 21.889  -10.283  1.00 123.91 ? 289 VAL B O   1 
ATOM   7695  C CB  . VAL B 1 280 ? -72.813 21.610  -8.170   1.00 122.29 ? 289 VAL B CB  1 
ATOM   7696  C CG1 . VAL B 1 280 ? -74.070 21.904  -7.368   1.00 125.73 ? 289 VAL B CG1 1 
ATOM   7697  C CG2 . VAL B 1 280 ? -71.933 20.606  -7.442   1.00 121.45 ? 289 VAL B CG2 1 
ATOM   7698  N N   . GLN B 1 281 ? -73.534 23.145  -10.798  1.00 126.19 ? 290 GLN B N   1 
ATOM   7699  C CA  . GLN B 1 281 ? -74.310 24.176  -11.475  1.00 128.02 ? 290 GLN B CA  1 
ATOM   7700  C C   . GLN B 1 281 ? -75.025 23.620  -12.703  1.00 127.68 ? 290 GLN B C   1 
ATOM   7701  O O   . GLN B 1 281 ? -76.159 23.999  -12.997  1.00 130.05 ? 290 GLN B O   1 
ATOM   7702  C CB  . GLN B 1 281 ? -73.412 25.347  -11.876  1.00 127.63 ? 290 GLN B CB  1 
ATOM   7703  C CG  . GLN B 1 281 ? -74.141 26.466  -12.602  1.00 129.98 ? 290 GLN B CG  1 
ATOM   7704  C CD  . GLN B 1 281 ? -73.235 27.638  -12.925  1.00 130.03 ? 290 GLN B CD  1 
ATOM   7705  O OE1 . GLN B 1 281 ? -72.034 27.602  -12.657  1.00 128.10 ? 290 GLN B OE1 1 
ATOM   7706  N NE2 . GLN B 1 281 ? -73.809 28.686  -13.504  1.00 132.58 ? 290 GLN B NE2 1 
ATOM   7707  N N   . VAL B 1 282 ? -74.356 22.721  -13.417  1.00 121.70 ? 291 VAL B N   1 
ATOM   7708  C CA  . VAL B 1 282 ? -74.934 22.107  -14.606  1.00 121.57 ? 291 VAL B CA  1 
ATOM   7709  C C   . VAL B 1 282 ? -76.112 21.209  -14.242  1.00 123.00 ? 291 VAL B C   1 
ATOM   7710  O O   . VAL B 1 282 ? -77.138 21.209  -14.922  1.00 124.69 ? 291 VAL B O   1 
ATOM   7711  C CB  . VAL B 1 282 ? -73.890 21.284  -15.383  1.00 118.85 ? 291 VAL B CB  1 
ATOM   7712  C CG1 . VAL B 1 282 ? -74.544 20.562  -16.551  1.00 119.23 ? 291 VAL B CG1 1 
ATOM   7713  C CG2 . VAL B 1 282 ? -72.764 22.182  -15.869  1.00 117.73 ? 291 VAL B CG2 1 
ATOM   7714  N N   . MET B 1 283 ? -75.959 20.447  -13.164  1.00 121.10 ? 292 MET B N   1 
ATOM   7715  C CA  . MET B 1 283 ? -77.004 19.537  -12.712  1.00 122.66 ? 292 MET B CA  1 
ATOM   7716  C C   . MET B 1 283 ? -78.214 20.304  -12.188  1.00 125.89 ? 292 MET B C   1 
ATOM   7717  O O   . MET B 1 283 ? -79.352 19.848  -12.311  1.00 127.74 ? 292 MET B O   1 
ATOM   7718  C CB  . MET B 1 283 ? -76.465 18.599  -11.631  1.00 121.99 ? 292 MET B CB  1 
ATOM   7719  C CG  . MET B 1 283 ? -75.236 17.811  -12.055  1.00 119.22 ? 292 MET B CG  1 
ATOM   7720  S SD  . MET B 1 283 ? -74.600 16.752  -10.741  1.00 119.17 ? 292 MET B SD  1 
ATOM   7721  C CE  . MET B 1 283 ? -75.957 15.598  -10.556  1.00 121.39 ? 292 MET B CE  1 
ATOM   7722  N N   . THR B 1 284 ? -77.961 21.470  -11.604  1.00 128.14 ? 293 THR B N   1 
ATOM   7723  C CA  . THR B 1 284 ? -79.030 22.317  -11.093  1.00 131.63 ? 293 THR B CA  1 
ATOM   7724  C C   . THR B 1 284 ? -79.845 22.909  -12.237  1.00 133.11 ? 293 THR B C   1 
ATOM   7725  O O   . THR B 1 284 ? -81.071 22.802  -12.260  1.00 135.72 ? 293 THR B O   1 
ATOM   7726  C CB  . THR B 1 284 ? -78.477 23.457  -10.220  1.00 132.65 ? 293 THR B CB  1 
ATOM   7727  O OG1 . THR B 1 284 ? -77.849 22.908  -9.056   1.00 132.10 ? 293 THR B OG1 1 
ATOM   7728  C CG2 . THR B 1 284 ? -79.597 24.390  -9.792   1.00 136.73 ? 293 THR B CG2 1 
ATOM   7729  N N   . GLU B 1 285 ? -79.156 23.531  -13.187  1.00 135.55 ? 294 GLU B N   1 
ATOM   7730  C CA  . GLU B 1 285 ? -79.809 24.144  -14.338  1.00 137.29 ? 294 GLU B CA  1 
ATOM   7731  C C   . GLU B 1 285 ? -80.550 23.104  -15.173  1.00 137.36 ? 294 GLU B C   1 
ATOM   7732  O O   . GLU B 1 285 ? -81.539 23.415  -15.837  1.00 139.98 ? 294 GLU B O   1 
ATOM   7733  C CB  . GLU B 1 285 ? -78.782 24.877  -15.203  1.00 135.83 ? 294 GLU B CB  1 
ATOM   7734  C CG  . GLU B 1 285 ? -79.369 25.585  -16.413  1.00 138.11 ? 294 GLU B CG  1 
ATOM   7735  C CD  . GLU B 1 285 ? -80.178 26.811  -16.038  1.00 142.05 ? 294 GLU B CD  1 
ATOM   7736  O OE1 . GLU B 1 285 ? -80.168 27.191  -14.848  1.00 142.86 ? 294 GLU B OE1 1 
ATOM   7737  O OE2 . GLU B 1 285 ? -80.821 27.396  -16.936  1.00 144.72 ? 294 GLU B OE2 1 
ATOM   7738  N N   . ALA B 1 286 ? -80.067 21.867  -15.133  1.00 135.98 ? 295 ALA B N   1 
ATOM   7739  C CA  . ALA B 1 286 ? -80.677 20.784  -15.896  1.00 136.11 ? 295 ALA B CA  1 
ATOM   7740  C C   . ALA B 1 286 ? -82.003 20.348  -15.282  1.00 138.81 ? 295 ALA B C   1 
ATOM   7741  O O   . ALA B 1 286 ? -83.011 20.226  -15.978  1.00 140.99 ? 295 ALA B O   1 
ATOM   7742  C CB  . ALA B 1 286 ? -79.724 19.606  -16.000  1.00 133.03 ? 295 ALA B CB  1 
ATOM   7743  N N   . PHE B 1 287 ? -81.993 20.113  -13.974  1.00 133.81 ? 296 PHE B N   1 
ATOM   7744  C CA  . PHE B 1 287 ? -83.193 19.691  -13.265  1.00 136.61 ? 296 PHE B CA  1 
ATOM   7745  C C   . PHE B 1 287 ? -84.196 20.837  -13.187  1.00 140.21 ? 296 PHE B C   1 
ATOM   7746  O O   . PHE B 1 287 ? -85.389 20.613  -12.962  1.00 143.16 ? 296 PHE B O   1 
ATOM   7747  C CB  . PHE B 1 287 ? -82.844 19.201  -11.858  1.00 136.32 ? 296 PHE B CB  1 
ATOM   7748  N N   . ARG B 1 288 ? -83.706 22.062  -13.376  1.00 141.78 ? 297 ARG B N   1 
ATOM   7749  C CA  . ARG B 1 288 ? -84.560 23.245  -13.346  1.00 145.52 ? 297 ARG B CA  1 
ATOM   7750  C C   . ARG B 1 288 ? -85.274 23.428  -14.681  1.00 147.19 ? 297 ARG B C   1 
ATOM   7751  O O   . ARG B 1 288 ? -86.430 23.847  -14.724  1.00 150.99 ? 297 ARG B O   1 
ATOM   7752  C CB  . ARG B 1 288 ? -83.744 24.494  -13.006  1.00 145.40 ? 297 ARG B CB  1 
ATOM   7753  N N   . ASN B 1 289 ? -84.579 23.106  -15.767  1.00 143.71 ? 298 ASN B N   1 
ATOM   7754  C CA  . ASN B 1 289 ? -85.159 23.204  -17.101  1.00 145.46 ? 298 ASN B CA  1 
ATOM   7755  C C   . ASN B 1 289 ? -86.188 22.109  -17.354  1.00 146.81 ? 298 ASN B C   1 
ATOM   7756  O O   . ASN B 1 289 ? -86.925 22.153  -18.339  1.00 149.22 ? 298 ASN B O   1 
ATOM   7757  C CB  . ASN B 1 289 ? -84.065 23.164  -18.170  1.00 142.77 ? 298 ASN B CB  1 
ATOM   7758  C CG  . ASN B 1 289 ? -83.238 24.435  -18.206  1.00 142.52 ? 298 ASN B CG  1 
ATOM   7759  O OD1 . ASN B 1 289 ? -83.595 25.440  -17.589  1.00 144.90 ? 298 ASN B OD1 1 
ATOM   7760  N ND2 . ASN B 1 289 ? -82.127 24.399  -18.934  1.00 139.96 ? 298 ASN B ND2 1 
ATOM   7761  N N   . LEU B 1 290 ? -86.229 21.125  -16.461  1.00 147.39 ? 299 LEU B N   1 
ATOM   7762  C CA  . LEU B 1 290 ? -87.208 20.048  -16.548  1.00 148.90 ? 299 LEU B CA  1 
ATOM   7763  C C   . LEU B 1 290 ? -88.496 20.410  -15.817  1.00 152.96 ? 299 LEU B C   1 
ATOM   7764  O O   . LEU B 1 290 ? -89.582 19.977  -16.201  1.00 155.66 ? 299 LEU B O   1 
ATOM   7765  C CB  . LEU B 1 290 ? -86.629 18.746  -15.990  1.00 146.08 ? 299 LEU B CB  1 
ATOM   7766  C CG  . LEU B 1 290 ? -86.032 17.787  -17.021  1.00 143.78 ? 299 LEU B CG  1 
ATOM   7767  C CD1 . LEU B 1 290 ? -85.469 18.552  -18.207  1.00 143.15 ? 299 LEU B CD1 1 
ATOM   7768  C CD2 . LEU B 1 290 ? -84.975 16.890  -16.388  1.00 140.50 ? 299 LEU B CD2 1 
ATOM   7769  N N   . ARG B 1 291 ? -88.365 21.205  -14.760  1.00 151.36 ? 300 ARG B N   1 
ATOM   7770  C CA  . ARG B 1 291 ? -89.522 21.667  -14.005  1.00 155.60 ? 300 ARG B CA  1 
ATOM   7771  C C   . ARG B 1 291 ? -90.281 22.725  -14.797  1.00 159.20 ? 300 ARG B C   1 
ATOM   7772  O O   . ARG B 1 291 ? -91.510 22.707  -14.859  1.00 163.07 ? 300 ARG B O   1 
ATOM   7773  C CB  . ARG B 1 291 ? -89.088 22.231  -12.651  1.00 155.69 ? 300 ARG B CB  1 
ATOM   7774  N N   . LYS B 1 292 ? -89.538 23.641  -15.410  1.00 167.70 ? 301 LYS B N   1 
ATOM   7775  C CA  . LYS B 1 292 ? -90.134 24.713  -16.199  1.00 171.37 ? 301 LYS B CA  1 
ATOM   7776  C C   . LYS B 1 292 ? -90.652 24.202  -17.540  1.00 172.35 ? 301 LYS B C   1 
ATOM   7777  O O   . LYS B 1 292 ? -91.414 24.888  -18.223  1.00 176.31 ? 301 LYS B O   1 
ATOM   7778  C CB  . LYS B 1 292 ? -89.123 25.839  -16.421  1.00 170.29 ? 301 LYS B CB  1 
ATOM   7779  N N   . GLN B 1 293 ? -90.233 22.997  -17.915  1.00 204.86 ? 302 GLN B N   1 
ATOM   7780  C CA  . GLN B 1 293 ? -90.664 22.395  -19.171  1.00 205.86 ? 302 GLN B CA  1 
ATOM   7781  C C   . GLN B 1 293 ? -91.847 21.457  -18.955  1.00 208.18 ? 302 GLN B C   1 
ATOM   7782  O O   . GLN B 1 293 ? -92.322 20.816  -19.894  1.00 209.41 ? 302 GLN B O   1 
ATOM   7783  C CB  . GLN B 1 293 ? -89.508 21.641  -19.832  1.00 201.58 ? 302 GLN B CB  1 
ATOM   7784  N N   . ARG B 1 294 ? -92.316 21.383  -17.713  1.00 181.87 ? 303 ARG B N   1 
ATOM   7785  C CA  . ARG B 1 294 ? -93.452 20.537  -17.363  1.00 184.40 ? 303 ARG B CA  1 
ATOM   7786  C C   . ARG B 1 294 ? -93.207 19.079  -17.742  1.00 181.93 ? 303 ARG B C   1 
ATOM   7787  O O   . ARG B 1 294 ? -94.040 18.450  -18.395  1.00 184.24 ? 303 ARG B O   1 
ATOM   7788  C CB  . ARG B 1 294 ? -94.729 21.049  -18.035  1.00 189.67 ? 303 ARG B CB  1 
ATOM   7789  N N   . ILE B 1 295 ? -92.060 18.549  -17.329  1.00 173.05 ? 304 ILE B N   1 
ATOM   7790  C CA  . ILE B 1 295 ? -91.705 17.166  -17.629  1.00 170.77 ? 304 ILE B CA  1 
ATOM   7791  C C   . ILE B 1 295 ? -91.608 16.325  -16.360  1.00 169.69 ? 304 ILE B C   1 
ATOM   7792  O O   . ILE B 1 295 ? -90.728 16.541  -15.527  1.00 167.21 ? 304 ILE B O   1 
ATOM   7793  C CB  . ILE B 1 295 ? -90.371 17.076  -18.394  1.00 166.89 ? 304 ILE B CB  1 
ATOM   7794  C CG1 . ILE B 1 295 ? -90.459 17.846  -19.713  1.00 168.42 ? 304 ILE B CG1 1 
ATOM   7795  C CG2 . ILE B 1 295 ? -90.000 15.621  -18.647  1.00 164.96 ? 304 ILE B CG2 1 
ATOM   7796  C CD1 . ILE B 1 295 ? -89.188 17.803  -20.532  1.00 165.17 ? 304 ILE B CD1 1 
ATOM   7797  N N   . GLU B 1 296 ? -92.518 15.367  -16.220  1.00 272.29 ? 305 GLU B N   1 
ATOM   7798  C CA  . GLU B 1 296 ? -92.523 14.479  -15.064  1.00 272.00 ? 305 GLU B CA  1 
ATOM   7799  C C   . GLU B 1 296 ? -91.545 13.325  -15.260  1.00 268.64 ? 305 GLU B C   1 
ATOM   7800  O O   . GLU B 1 296 ? -91.603 12.613  -16.263  1.00 268.57 ? 305 GLU B O   1 
ATOM   7801  C CB  . GLU B 1 296 ? -93.931 13.940  -14.810  1.00 276.24 ? 305 GLU B CB  1 
ATOM   7802  N N   . ILE B 1 297 ? -90.648 13.146  -14.297  1.00 263.44 ? 306 ILE B N   1 
ATOM   7803  C CA  . ILE B 1 297 ? -89.629 12.106  -14.380  1.00 260.47 ? 306 ILE B CA  1 
ATOM   7804  C C   . ILE B 1 297 ? -89.468 11.385  -13.049  1.00 260.71 ? 306 ILE B C   1 
ATOM   7805  O O   . ILE B 1 297 ? -88.716 10.415  -12.945  1.00 258.98 ? 306 ILE B O   1 
ATOM   7806  C CB  . ILE B 1 297 ? -88.258 12.697  -14.755  1.00 256.66 ? 306 ILE B CB  1 
ATOM   7807  C CG1 . ILE B 1 297 ? -87.789 13.672  -13.672  1.00 255.95 ? 306 ILE B CG1 1 
ATOM   7808  C CG2 . ILE B 1 297 ? -88.320 13.382  -16.110  1.00 256.64 ? 306 ILE B CG2 1 
ATOM   7809  C CD1 . ILE B 1 297 ? -86.433 14.279  -13.944  1.00 252.44 ? 306 ILE B CD1 1 
ATOM   7810  N N   . SER B 1 298 ? -90.156 11.887  -12.029  1.00 190.82 ? 307 SER B N   1 
ATOM   7811  C CA  . SER B 1 298 ? -89.979 11.401  -10.663  1.00 191.59 ? 307 SER B CA  1 
ATOM   7812  C C   . SER B 1 298 ? -90.288 9.914   -10.506  1.00 192.92 ? 307 SER B C   1 
ATOM   7813  O O   . SER B 1 298 ? -91.117 9.358   -11.225  1.00 194.67 ? 307 SER B O   1 
ATOM   7814  C CB  . SER B 1 298 ? -90.828 12.222  -9.688   1.00 194.96 ? 307 SER B CB  1 
ATOM   7815  O OG  . SER B 1 298 ? -90.431 13.583  -9.686   1.00 193.98 ? 307 SER B OG  1 
ATOM   7816  N N   . ARG B 1 299 ? -89.609 9.281   -9.555   1.00 282.80 ? 308 ARG B N   1 
ATOM   7817  C CA  . ARG B 1 299 ? -89.817 7.869   -9.258   1.00 284.47 ? 308 ARG B CA  1 
ATOM   7818  C C   . ARG B 1 299 ? -89.513 7.587   -7.790   1.00 285.94 ? 308 ARG B C   1 
ATOM   7819  O O   . ARG B 1 299 ? -89.492 8.502   -6.966   1.00 286.64 ? 308 ARG B O   1 
ATOM   7820  C CB  . ARG B 1 299 ? -88.940 6.994   -10.156  1.00 281.75 ? 308 ARG B CB  1 
ATOM   7821  N N   . ARG B 1 300 ? -89.276 6.320   -7.469   1.00 275.27 ? 309 ARG B N   1 
ATOM   7822  C CA  . ARG B 1 300 ? -88.971 5.924   -6.099   1.00 277.25 ? 309 ARG B CA  1 
ATOM   7823  C C   . ARG B 1 300 ? -87.671 5.129   -6.030   1.00 275.10 ? 309 ARG B C   1 
ATOM   7824  O O   . ARG B 1 300 ? -86.995 4.937   -7.041   1.00 271.96 ? 309 ARG B O   1 
ATOM   7825  C CB  . ARG B 1 300 ? -90.119 5.103   -5.509   1.00 282.04 ? 309 ARG B CB  1 
ATOM   7826  N N   . GLY B 1 301 ? -87.328 4.670   -4.831   1.00 260.17 ? 310 GLY B N   1 
ATOM   7827  C CA  . GLY B 1 301 ? -86.122 3.888   -4.630   1.00 258.94 ? 310 GLY B CA  1 
ATOM   7828  C C   . GLY B 1 301 ? -86.348 2.408   -4.865   1.00 261.04 ? 310 GLY B C   1 
ATOM   7829  O O   . GLY B 1 301 ? -85.973 1.574   -4.040   1.00 263.40 ? 310 GLY B O   1 
ATOM   7830  N N   . ASN B 1 302 ? -86.966 2.081   -5.996   1.00 256.87 ? 311 ASN B N   1 
ATOM   7831  C CA  . ASN B 1 302 ? -87.240 0.692   -6.348   1.00 259.07 ? 311 ASN B CA  1 
ATOM   7832  C C   . ASN B 1 302 ? -86.971 0.389   -7.819   1.00 256.48 ? 311 ASN B C   1 
ATOM   7833  O O   . ASN B 1 302 ? -87.670 -0.417  -8.436   1.00 258.48 ? 311 ASN B O   1 
ATOM   7834  C CB  . ASN B 1 302 ? -88.674 0.311   -5.976   1.00 263.59 ? 311 ASN B CB  1 
ATOM   7835  C CG  . ASN B 1 302 ? -88.841 0.052   -4.492   1.00 267.46 ? 311 ASN B CG  1 
ATOM   7836  O OD1 . ASN B 1 302 ? -87.899 -0.357  -3.813   1.00 267.66 ? 311 ASN B OD1 1 
ATOM   7837  N ND2 . ASN B 1 302 ? -90.045 0.284   -3.982   1.00 270.95 ? 311 ASN B ND2 1 
ATOM   7838  N N   . ALA B 1 303 ? -85.959 1.049   -8.371   1.00 240.26 ? 312 ALA B N   1 
ATOM   7839  C CA  . ALA B 1 303 ? -85.489 0.770   -9.723   1.00 237.90 ? 312 ALA B CA  1 
ATOM   7840  C C   . ALA B 1 303 ? -85.131 -0.706  -9.871   1.00 239.74 ? 312 ALA B C   1 
ATOM   7841  O O   . ALA B 1 303 ? -85.109 -1.242  -10.980  1.00 239.46 ? 312 ALA B O   1 
ATOM   7842  C CB  . ALA B 1 303 ? -84.287 1.644   -10.052  1.00 233.62 ? 312 ALA B CB  1 
ATOM   7843  N N   . GLY B 1 304 ? -84.850 -1.357  -8.746   1.00 194.85 ? 313 GLY B N   1 
ATOM   7844  C CA  . GLY B 1 304 ? -84.506 -2.766  -8.742   1.00 197.29 ? 313 GLY B CA  1 
ATOM   7845  C C   . GLY B 1 304 ? -83.018 -3.003  -8.911   1.00 194.99 ? 313 GLY B C   1 
ATOM   7846  O O   . GLY B 1 304 ? -82.232 -2.058  -8.980   1.00 191.42 ? 313 GLY B O   1 
ATOM   7847  N N   . ASP B 1 305 ? -82.631 -4.273  -8.977   1.00 213.47 ? 314 ASP B N   1 
ATOM   7848  C CA  . ASP B 1 305 ? -81.230 -4.637  -9.148   1.00 212.01 ? 314 ASP B CA  1 
ATOM   7849  C C   . ASP B 1 305 ? -80.759 -4.281  -10.554  1.00 208.51 ? 314 ASP B C   1 
ATOM   7850  O O   . ASP B 1 305 ? -81.457 -4.538  -11.534  1.00 209.11 ? 314 ASP B O   1 
ATOM   7851  C CB  . ASP B 1 305 ? -81.032 -6.131  -8.880   1.00 216.22 ? 314 ASP B CB  1 
ATOM   7852  C CG  . ASP B 1 305 ? -79.581 -6.490  -8.623   1.00 215.72 ? 314 ASP B CG  1 
ATOM   7853  O OD1 . ASP B 1 305 ? -79.293 -7.687  -8.411   1.00 219.34 ? 314 ASP B OD1 1 
ATOM   7854  O OD2 . ASP B 1 305 ? -78.729 -5.576  -8.629   1.00 212.00 ? 314 ASP B OD2 1 
ATOM   7855  N N   . CYS B 1 306 ? -79.574 -3.686  -10.646  1.00 167.30 ? 315 CYS B N   1 
ATOM   7856  C CA  . CYS B 1 306 ? -79.027 -3.257  -11.930  1.00 164.09 ? 315 CYS B CA  1 
ATOM   7857  C C   . CYS B 1 306 ? -78.694 -4.442  -12.833  1.00 165.88 ? 315 CYS B C   1 
ATOM   7858  O O   . CYS B 1 306 ? -78.653 -4.307  -14.056  1.00 164.58 ? 315 CYS B O   1 
ATOM   7859  C CB  . CYS B 1 306 ? -77.784 -2.391  -11.718  1.00 160.57 ? 315 CYS B CB  1 
ATOM   7860  S SG  . CYS B 1 306 ? -76.501 -3.168  -10.711  1.00 162.10 ? 315 CYS B SG  1 
ATOM   7861  N N   . LEU B 1 307 ? -78.458 -5.600  -12.227  1.00 154.47 ? 316 LEU B N   1 
ATOM   7862  C CA  . LEU B 1 307 ? -78.141 -6.806  -12.983  1.00 156.94 ? 316 LEU B CA  1 
ATOM   7863  C C   . LEU B 1 307 ? -79.404 -7.483  -13.504  1.00 160.11 ? 316 LEU B C   1 
ATOM   7864  O O   . LEU B 1 307 ? -79.342 -8.574  -14.072  1.00 163.05 ? 316 LEU B O   1 
ATOM   7865  C CB  . LEU B 1 307 ? -77.340 -7.787  -12.126  1.00 159.86 ? 316 LEU B CB  1 
ATOM   7866  C CG  . LEU B 1 307 ? -75.977 -7.315  -11.619  1.00 157.53 ? 316 LEU B CG  1 
ATOM   7867  C CD1 . LEU B 1 307 ? -75.283 -8.432  -10.856  1.00 161.41 ? 316 LEU B CD1 1 
ATOM   7868  C CD2 . LEU B 1 307 ? -75.113 -6.834  -12.772  1.00 154.10 ? 316 LEU B CD2 1 
ATOM   7869  N N   . ALA B 1 308 ? -80.547 -6.833  -13.305  1.00 209.89 ? 317 ALA B N   1 
ATOM   7870  C CA  . ALA B 1 308 ? -81.827 -7.373  -13.752  1.00 212.98 ? 317 ALA B CA  1 
ATOM   7871  C C   . ALA B 1 308 ? -81.771 -7.772  -15.221  1.00 213.29 ? 317 ALA B C   1 
ATOM   7872  O O   . ALA B 1 308 ? -81.340 -6.992  -16.071  1.00 210.05 ? 317 ALA B O   1 
ATOM   7873  C CB  . ALA B 1 308 ? -82.941 -6.365  -13.516  1.00 211.96 ? 317 ALA B CB  1 
ATOM   7874  N N   . ASN B 1 309 ? -82.206 -8.993  -15.512  1.00 222.55 ? 318 ASN B N   1 
ATOM   7875  C CA  . ASN B 1 309 ? -82.189 -9.509  -16.875  1.00 223.81 ? 318 ASN B CA  1 
ATOM   7876  C C   . ASN B 1 309 ? -83.551 -10.070 -17.273  1.00 227.65 ? 318 ASN B C   1 
ATOM   7877  O O   . ASN B 1 309 ? -84.080 -10.957 -16.602  1.00 231.51 ? 318 ASN B O   1 
ATOM   7878  C CB  . ASN B 1 309 ? -81.105 -10.580 -17.022  1.00 225.83 ? 318 ASN B CB  1 
ATOM   7879  C CG  . ASN B 1 309 ? -80.784 -10.895 -18.471  1.00 226.47 ? 318 ASN B CG  1 
ATOM   7880  O OD1 . ASN B 1 309 ? -81.660 -10.874 -19.334  1.00 227.73 ? 318 ASN B OD1 1 
ATOM   7881  N ND2 . ASN B 1 309 ? -79.519 -11.197 -18.743  1.00 225.97 ? 318 ASN B ND2 1 
ATOM   7882  N N   . PRO B 1 310 ? -84.126 -9.551  -18.369  1.00 198.97 ? 319 PRO B N   1 
ATOM   7883  C CA  . PRO B 1 310 ? -83.546 -8.494  -19.207  1.00 194.92 ? 319 PRO B CA  1 
ATOM   7884  C C   . PRO B 1 310 ? -83.524 -7.138  -18.508  1.00 190.75 ? 319 PRO B C   1 
ATOM   7885  O O   . PRO B 1 310 ? -84.417 -6.837  -17.715  1.00 191.34 ? 319 PRO B O   1 
ATOM   7886  C CB  . PRO B 1 310 ? -84.494 -8.440  -20.413  1.00 196.80 ? 319 PRO B CB  1 
ATOM   7887  C CG  . PRO B 1 310 ? -85.261 -9.723  -20.375  1.00 202.04 ? 319 PRO B CG  1 
ATOM   7888  C CD  . PRO B 1 310 ? -85.390 -10.056 -18.927  1.00 202.81 ? 319 PRO B CD  1 
ATOM   7889  N N   . ALA B 1 311 ? -82.509 -6.334  -18.806  1.00 158.19 ? 320 ALA B N   1 
ATOM   7890  C CA  . ALA B 1 311 ? -82.389 -5.002  -18.224  1.00 154.34 ? 320 ALA B CA  1 
ATOM   7891  C C   . ALA B 1 311 ? -83.236 -3.995  -18.992  1.00 153.40 ? 320 ALA B C   1 
ATOM   7892  O O   . ALA B 1 311 ? -83.019 -3.767  -20.182  1.00 152.92 ? 320 ALA B O   1 
ATOM   7893  C CB  . ALA B 1 311 ? -80.933 -4.564  -18.199  1.00 150.94 ? 320 ALA B CB  1 
ATOM   7894  N N   . VAL B 1 312 ? -84.204 -3.397  -18.305  1.00 172.88 ? 321 VAL B N   1 
ATOM   7895  C CA  . VAL B 1 312 ? -85.092 -2.422  -18.928  1.00 172.53 ? 321 VAL B CA  1 
ATOM   7896  C C   . VAL B 1 312 ? -84.770 -0.997  -18.483  1.00 168.88 ? 321 VAL B C   1 
ATOM   7897  O O   . VAL B 1 312 ? -84.862 -0.671  -17.299  1.00 168.30 ? 321 VAL B O   1 
ATOM   7898  C CB  . VAL B 1 312 ? -86.575 -2.736  -18.638  1.00 176.09 ? 321 VAL B CB  1 
ATOM   7899  C CG1 . VAL B 1 312 ? -86.795 -2.963  -17.148  1.00 176.87 ? 321 VAL B CG1 1 
ATOM   7900  C CG2 . VAL B 1 312 ? -87.466 -1.616  -19.157  1.00 175.84 ? 321 VAL B CG2 1 
ATOM   7901  N N   . PRO B 1 313 ? -84.378 -0.145  -19.441  1.00 171.05 ? 322 PRO B N   1 
ATOM   7902  C CA  . PRO B 1 313 ? -84.052 1.260   -19.182  1.00 167.87 ? 322 PRO B CA  1 
ATOM   7903  C C   . PRO B 1 313 ? -85.307 2.084   -18.923  1.00 169.03 ? 322 PRO B C   1 
ATOM   7904  O O   . PRO B 1 313 ? -86.244 2.032   -19.719  1.00 171.42 ? 322 PRO B O   1 
ATOM   7905  C CB  . PRO B 1 313 ? -83.399 1.718   -20.494  1.00 166.46 ? 322 PRO B CB  1 
ATOM   7906  C CG  . PRO B 1 313 ? -83.077 0.460   -21.248  1.00 168.45 ? 322 PRO B CG  1 
ATOM   7907  C CD  . PRO B 1 313 ? -84.126 -0.517  -20.841  1.00 171.95 ? 322 PRO B CD  1 
ATOM   7908  N N   . TRP B 1 314 ? -85.323 2.834   -17.825  1.00 173.99 ? 323 TRP B N   1 
ATOM   7909  C CA  . TRP B 1 314 ? -86.463 3.687   -17.510  1.00 175.30 ? 323 TRP B CA  1 
ATOM   7910  C C   . TRP B 1 314 ? -86.483 4.920   -18.411  1.00 174.07 ? 323 TRP B C   1 
ATOM   7911  O O   . TRP B 1 314 ? -85.537 5.707   -18.426  1.00 171.13 ? 323 TRP B O   1 
ATOM   7912  C CB  . TRP B 1 314 ? -86.463 4.080   -16.028  1.00 174.87 ? 323 TRP B CB  1 
ATOM   7913  C CG  . TRP B 1 314 ? -85.273 4.881   -15.598  1.00 171.40 ? 323 TRP B CG  1 
ATOM   7914  C CD1 . TRP B 1 314 ? -83.959 4.590   -15.829  1.00 168.94 ? 323 TRP B CD1 1 
ATOM   7915  C CD2 . TRP B 1 314 ? -85.287 6.096   -14.838  1.00 170.38 ? 323 TRP B CD2 1 
ATOM   7916  N NE1 . TRP B 1 314 ? -83.156 5.556   -15.272  1.00 166.35 ? 323 TRP B NE1 1 
ATOM   7917  C CE2 . TRP B 1 314 ? -83.946 6.491   -14.657  1.00 167.21 ? 323 TRP B CE2 1 
ATOM   7918  C CE3 . TRP B 1 314 ? -86.304 6.891   -14.298  1.00 172.16 ? 323 TRP B CE3 1 
ATOM   7919  C CZ2 . TRP B 1 314 ? -83.595 7.646   -13.959  1.00 165.78 ? 323 TRP B CZ2 1 
ATOM   7920  C CZ3 . TRP B 1 314 ? -85.953 8.037   -13.606  1.00 170.82 ? 323 TRP B CZ3 1 
ATOM   7921  C CH2 . TRP B 1 314 ? -84.610 8.404   -13.443  1.00 167.66 ? 323 TRP B CH2 1 
ATOM   7922  N N   . GLY B 1 315 ? -87.568 5.072   -19.165  1.00 179.75 ? 324 GLY B N   1 
ATOM   7923  C CA  . GLY B 1 315 ? -87.681 6.120   -20.164  1.00 179.54 ? 324 GLY B CA  1 
ATOM   7924  C C   . GLY B 1 315 ? -87.431 7.527   -19.656  1.00 177.58 ? 324 GLY B C   1 
ATOM   7925  O O   . GLY B 1 315 ? -87.068 8.415   -20.428  1.00 176.59 ? 324 GLY B O   1 
ATOM   7926  N N   . GLN B 1 316 ? -87.627 7.735   -18.358  1.00 147.39 ? 325 GLN B N   1 
ATOM   7927  C CA  . GLN B 1 316 ? -87.437 9.054   -17.763  1.00 146.05 ? 325 GLN B CA  1 
ATOM   7928  C C   . GLN B 1 316 ? -85.978 9.501   -17.833  1.00 142.32 ? 325 GLN B C   1 
ATOM   7929  O O   . GLN B 1 316 ? -85.672 10.681  -17.656  1.00 141.12 ? 325 GLN B O   1 
ATOM   7930  C CB  . GLN B 1 316 ? -87.927 9.064   -16.313  1.00 147.18 ? 325 GLN B CB  1 
ATOM   7931  N N   . GLY B 1 317 ? -85.081 8.555   -18.096  1.00 137.86 ? 326 GLY B N   1 
ATOM   7932  C CA  . GLY B 1 317 ? -83.663 8.850   -18.178  1.00 134.58 ? 326 GLY B CA  1 
ATOM   7933  C C   . GLY B 1 317 ? -83.285 9.572   -19.457  1.00 133.80 ? 326 GLY B C   1 
ATOM   7934  O O   . GLY B 1 317 ? -82.356 10.380  -19.473  1.00 131.46 ? 326 GLY B O   1 
ATOM   7935  N N   . VAL B 1 318 ? -84.008 9.277   -20.532  1.00 140.10 ? 327 VAL B N   1 
ATOM   7936  C CA  . VAL B 1 318 ? -83.747 9.898   -21.826  1.00 140.21 ? 327 VAL B CA  1 
ATOM   7937  C C   . VAL B 1 318 ? -83.926 11.411  -21.753  1.00 140.06 ? 327 VAL B C   1 
ATOM   7938  O O   . VAL B 1 318 ? -83.217 12.163  -22.422  1.00 138.96 ? 327 VAL B O   1 
ATOM   7939  C CB  . VAL B 1 318 ? -84.673 9.331   -22.920  1.00 143.60 ? 327 VAL B CB  1 
ATOM   7940  C CG1 . VAL B 1 318 ? -84.365 9.975   -24.264  1.00 144.21 ? 327 VAL B CG1 1 
ATOM   7941  C CG2 . VAL B 1 318 ? -84.534 7.817   -23.002  1.00 144.26 ? 327 VAL B CG2 1 
ATOM   7942  N N   . GLU B 1 319 ? -84.876 11.850  -20.933  1.00 149.14 ? 328 GLU B N   1 
ATOM   7943  C CA  . GLU B 1 319 ? -85.157 13.273  -20.777  1.00 149.66 ? 328 GLU B CA  1 
ATOM   7944  C C   . GLU B 1 319 ? -84.110 13.959  -19.906  1.00 146.67 ? 328 GLU B C   1 
ATOM   7945  O O   . GLU B 1 319 ? -83.753 15.112  -20.143  1.00 146.21 ? 328 GLU B O   1 
ATOM   7946  C CB  . GLU B 1 319 ? -86.554 13.481  -20.188  1.00 152.76 ? 328 GLU B CB  1 
ATOM   7947  C CG  . GLU B 1 319 ? -87.688 13.086  -21.122  1.00 156.33 ? 328 GLU B CG  1 
ATOM   7948  C CD  . GLU B 1 319 ? -87.798 14.002  -22.328  1.00 157.90 ? 328 GLU B CD  1 
ATOM   7949  O OE1 . GLU B 1 319 ? -88.471 13.619  -23.309  1.00 160.71 ? 328 GLU B OE1 1 
ATOM   7950  O OE2 . GLU B 1 319 ? -87.211 15.104  -22.295  1.00 156.66 ? 328 GLU B OE2 1 
ATOM   7951  N N   . ILE B 1 320 ? -83.623 13.244  -18.898  1.00 145.02 ? 329 ILE B N   1 
ATOM   7952  C CA  . ILE B 1 320 ? -82.603 13.781  -18.005  1.00 142.47 ? 329 ILE B CA  1 
ATOM   7953  C C   . ILE B 1 320 ? -81.314 14.065  -18.769  1.00 139.94 ? 329 ILE B C   1 
ATOM   7954  O O   . ILE B 1 320 ? -80.576 14.994  -18.441  1.00 138.40 ? 329 ILE B O   1 
ATOM   7955  C CB  . ILE B 1 320 ? -82.310 12.818  -16.840  1.00 141.72 ? 329 ILE B CB  1 
ATOM   7956  C CG1 . ILE B 1 320 ? -83.600 12.480  -16.091  1.00 144.61 ? 329 ILE B CG1 1 
ATOM   7957  C CG2 . ILE B 1 320 ? -81.290 13.424  -15.890  1.00 139.59 ? 329 ILE B CG2 1 
ATOM   7958  C CD1 . ILE B 1 320 ? -83.397 11.553  -14.914  1.00 144.58 ? 329 ILE B CD1 1 
ATOM   7959  N N   . GLU B 1 321 ? -81.052 13.260  -19.794  1.00 137.32 ? 330 GLU B N   1 
ATOM   7960  C CA  . GLU B 1 321 ? -79.879 13.451  -20.638  1.00 135.45 ? 330 GLU B CA  1 
ATOM   7961  C C   . GLU B 1 321 ? -80.035 14.691  -21.509  1.00 136.45 ? 330 GLU B C   1 
ATOM   7962  O O   . GLU B 1 321 ? -79.138 15.531  -21.579  1.00 134.86 ? 330 GLU B O   1 
ATOM   7963  C CB  . GLU B 1 321 ? -79.649 12.223  -21.520  1.00 135.83 ? 330 GLU B CB  1 
ATOM   7964  C CG  . GLU B 1 321 ? -78.486 12.368  -22.486  1.00 134.48 ? 330 GLU B CG  1 
ATOM   7965  C CD  . GLU B 1 321 ? -78.410 11.228  -23.482  1.00 135.75 ? 330 GLU B CD  1 
ATOM   7966  O OE1 . GLU B 1 321 ? -77.377 11.108  -24.174  1.00 134.81 ? 330 GLU B OE1 1 
ATOM   7967  O OE2 . GLU B 1 321 ? -79.385 10.452  -23.574  1.00 137.96 ? 330 GLU B OE2 1 
ATOM   7968  N N   . ARG B 1 322 ? -81.183 14.800  -22.171  1.00 173.48 ? 331 ARG B N   1 
ATOM   7969  C CA  . ARG B 1 322 ? -81.463 15.933  -23.046  1.00 175.30 ? 331 ARG B CA  1 
ATOM   7970  C C   . ARG B 1 322 ? -81.501 17.241  -22.264  1.00 175.14 ? 331 ARG B C   1 
ATOM   7971  O O   . ARG B 1 322 ? -81.463 18.325  -22.845  1.00 176.32 ? 331 ARG B O   1 
ATOM   7972  C CB  . ARG B 1 322 ? -82.787 15.723  -23.785  1.00 179.08 ? 331 ARG B CB  1 
ATOM   7973  N N   . ALA B 1 323 ? -81.578 17.131  -20.942  1.00 133.62 ? 332 ALA B N   1 
ATOM   7974  C CA  . ALA B 1 323 ? -81.596 18.302  -20.073  1.00 133.75 ? 332 ALA B CA  1 
ATOM   7975  C C   . ALA B 1 323 ? -80.179 18.782  -19.785  1.00 130.78 ? 332 ALA B C   1 
ATOM   7976  O O   . ALA B 1 323 ? -79.841 19.938  -20.034  1.00 131.08 ? 332 ALA B O   1 
ATOM   7977  C CB  . ALA B 1 323 ? -82.316 17.983  -18.778  1.00 134.53 ? 332 ALA B CB  1 
ATOM   7978  N N   . LEU B 1 324 ? -79.358 17.882  -19.255  1.00 130.49 ? 333 LEU B N   1 
ATOM   7979  C CA  . LEU B 1 324 ? -77.973 18.197  -18.927  1.00 127.77 ? 333 LEU B CA  1 
ATOM   7980  C C   . LEU B 1 324 ? -77.203 18.663  -20.157  1.00 127.17 ? 333 LEU B C   1 
ATOM   7981  O O   . LEU B 1 324 ? -76.441 19.628  -20.095  1.00 126.33 ? 333 LEU B O   1 
ATOM   7982  C CB  . LEU B 1 324 ? -77.286 16.976  -18.313  1.00 125.74 ? 333 LEU B CB  1 
ATOM   7983  C CG  . LEU B 1 324 ? -77.762 16.546  -16.924  1.00 126.27 ? 333 LEU B CG  1 
ATOM   7984  C CD1 . LEU B 1 324 ? -77.418 15.088  -16.662  1.00 125.39 ? 333 LEU B CD1 1 
ATOM   7985  C CD2 . LEU B 1 324 ? -77.168 17.444  -15.852  1.00 125.53 ? 333 LEU B CD2 1 
ATOM   7986  N N   . LYS B 1 325 ? -77.410 17.973  -21.273  1.00 126.06 ? 334 LYS B N   1 
ATOM   7987  C CA  . LYS B 1 325 ? -76.709 18.289  -22.513  1.00 126.04 ? 334 LYS B CA  1 
ATOM   7988  C C   . LYS B 1 325 ? -77.183 19.609  -23.117  1.00 128.42 ? 334 LYS B C   1 
ATOM   7989  O O   . LYS B 1 325 ? -76.494 20.205  -23.944  1.00 128.55 ? 334 LYS B O   1 
ATOM   7990  C CB  . LYS B 1 325 ? -76.880 17.155  -23.527  1.00 126.93 ? 334 LYS B CB  1 
ATOM   7991  N N   . GLN B 1 326 ? -78.361 20.062  -22.700  1.00 129.40 ? 335 GLN B N   1 
ATOM   7992  C CA  . GLN B 1 326 ? -78.926 21.306  -23.212  1.00 132.32 ? 335 GLN B CA  1 
ATOM   7993  C C   . GLN B 1 326 ? -78.512 22.500  -22.356  1.00 131.81 ? 335 GLN B C   1 
ATOM   7994  O O   . GLN B 1 326 ? -78.673 23.652  -22.760  1.00 134.05 ? 335 GLN B O   1 
ATOM   7995  C CB  . GLN B 1 326 ? -80.452 21.213  -23.279  1.00 135.66 ? 335 GLN B CB  1 
ATOM   7996  N N   . VAL B 1 327 ? -77.977 22.214  -21.173  1.00 129.14 ? 336 VAL B N   1 
ATOM   7997  C CA  . VAL B 1 327 ? -77.553 23.257  -20.246  1.00 128.80 ? 336 VAL B CA  1 
ATOM   7998  C C   . VAL B 1 327 ? -76.472 24.140  -20.857  1.00 128.19 ? 336 VAL B C   1 
ATOM   7999  O O   . VAL B 1 327 ? -75.619 23.664  -21.606  1.00 126.53 ? 336 VAL B O   1 
ATOM   8000  C CB  . VAL B 1 327 ? -77.021 22.655  -18.930  1.00 126.31 ? 336 VAL B CB  1 
ATOM   8001  C CG1 . VAL B 1 327 ? -76.490 23.750  -18.016  1.00 126.25 ? 336 VAL B CG1 1 
ATOM   8002  C CG2 . VAL B 1 327 ? -78.112 21.859  -18.235  1.00 127.39 ? 336 VAL B CG2 1 
ATOM   8003  N N   . GLN B 1 328 ? -76.516 25.429  -20.535  1.00 130.40 ? 337 GLN B N   1 
ATOM   8004  C CA  . GLN B 1 328 ? -75.502 26.368  -20.997  1.00 130.19 ? 337 GLN B CA  1 
ATOM   8005  C C   . GLN B 1 328 ? -75.408 27.576  -20.070  1.00 131.38 ? 337 GLN B C   1 
ATOM   8006  O O   . GLN B 1 328 ? -76.135 28.557  -20.233  1.00 134.80 ? 337 GLN B O   1 
ATOM   8007  C CB  . GLN B 1 328 ? -75.790 26.818  -22.430  1.00 132.84 ? 337 GLN B CB  1 
ATOM   8008  C CG  . GLN B 1 328 ? -74.714 27.713  -23.022  1.00 132.92 ? 337 GLN B CG  1 
ATOM   8009  C CD  . GLN B 1 328 ? -74.959 28.035  -24.483  1.00 135.88 ? 337 GLN B CD  1 
ATOM   8010  O OE1 . GLN B 1 328 ? -75.835 27.453  -25.121  1.00 137.52 ? 337 GLN B OE1 1 
ATOM   8011  N NE2 . GLN B 1 328 ? -74.181 28.968  -25.021  1.00 136.91 ? 337 GLN B NE2 1 
ATOM   8012  N N   . VAL B 1 329 ? -74.506 27.494  -19.098  1.00 127.96 ? 338 VAL B N   1 
ATOM   8013  C CA  . VAL B 1 329 ? -74.306 28.574  -18.141  1.00 129.15 ? 338 VAL B CA  1 
ATOM   8014  C C   . VAL B 1 329 ? -72.844 29.002  -18.094  1.00 127.22 ? 338 VAL B C   1 
ATOM   8015  O O   . VAL B 1 329 ? -72.004 28.453  -18.806  1.00 124.99 ? 338 VAL B O   1 
ATOM   8016  C CB  . VAL B 1 329 ? -74.754 28.163  -16.727  1.00 128.98 ? 338 VAL B CB  1 
ATOM   8017  C CG1 . VAL B 1 329 ? -76.263 27.987  -16.681  1.00 131.66 ? 338 VAL B CG1 1 
ATOM   8018  C CG2 . VAL B 1 329 ? -74.046 26.885  -16.298  1.00 125.45 ? 338 VAL B CG2 1 
ATOM   8019  N N   . GLU B 1 330 ? -72.547 29.985  -17.252  1.00 163.04 ? 339 GLU B N   1 
ATOM   8020  C CA  . GLU B 1 330 ? -71.185 30.480  -17.107  1.00 161.64 ? 339 GLU B CA  1 
ATOM   8021  C C   . GLU B 1 330 ? -70.592 30.015  -15.781  1.00 159.72 ? 339 GLU B C   1 
ATOM   8022  O O   . GLU B 1 330 ? -71.181 30.226  -14.721  1.00 161.31 ? 339 GLU B O   1 
ATOM   8023  C CB  . GLU B 1 330 ? -71.162 32.008  -17.186  1.00 164.89 ? 339 GLU B CB  1 
ATOM   8024  C CG  . GLU B 1 330 ? -69.803 32.591  -17.532  1.00 163.98 ? 339 GLU B CG  1 
ATOM   8025  C CD  . GLU B 1 330 ? -69.426 32.364  -18.983  1.00 163.34 ? 339 GLU B CD  1 
ATOM   8026  O OE1 . GLU B 1 330 ? -68.266 32.647  -19.349  1.00 162.35 ? 339 GLU B OE1 1 
ATOM   8027  O OE2 . GLU B 1 330 ? -70.292 31.903  -19.757  1.00 164.13 ? 339 GLU B OE2 1 
ATOM   8028  N N   . GLY B 1 331 ? -69.425 29.381  -15.845  1.00 147.87 ? 340 GLY B N   1 
ATOM   8029  C CA  . GLY B 1 331 ? -68.781 28.859  -14.654  1.00 146.27 ? 340 GLY B CA  1 
ATOM   8030  C C   . GLY B 1 331 ? -67.321 29.253  -14.540  1.00 145.01 ? 340 GLY B C   1 
ATOM   8031  O O   . GLY B 1 331 ? -66.837 30.105  -15.284  1.00 145.69 ? 340 GLY B O   1 
ATOM   8032  N N   . LEU B 1 332 ? -66.619 28.627  -13.601  1.00 118.16 ? 341 LEU B N   1 
ATOM   8033  C CA  . LEU B 1 332 ? -65.206 28.910  -13.379  1.00 117.11 ? 341 LEU B CA  1 
ATOM   8034  C C   . LEU B 1 332 ? -64.364 28.544  -14.597  1.00 115.08 ? 341 LEU B C   1 
ATOM   8035  O O   . LEU B 1 332 ? -63.343 29.176  -14.870  1.00 114.98 ? 341 LEU B O   1 
ATOM   8036  C CB  . LEU B 1 332 ? -64.697 28.155  -12.150  1.00 116.24 ? 341 LEU B CB  1 
ATOM   8037  C CG  . LEU B 1 332 ? -65.395 28.450  -10.822  1.00 118.61 ? 341 LEU B CG  1 
ATOM   8038  C CD1 . LEU B 1 332 ? -64.832 27.571  -9.717   1.00 117.98 ? 341 LEU B CD1 1 
ATOM   8039  C CD2 . LEU B 1 332 ? -65.263 29.921  -10.462  1.00 121.24 ? 341 LEU B CD2 1 
ATOM   8040  N N   . SER B 1 333 ? -64.799 27.520  -15.324  1.00 113.91 ? 342 SER B N   1 
ATOM   8041  C CA  . SER B 1 333 ? -64.072 27.049  -16.498  1.00 112.37 ? 342 SER B CA  1 
ATOM   8042  C C   . SER B 1 333 ? -64.626 27.657  -17.783  1.00 113.85 ? 342 SER B C   1 
ATOM   8043  O O   . SER B 1 333 ? -64.782 26.967  -18.791  1.00 113.32 ? 342 SER B O   1 
ATOM   8044  C CB  . SER B 1 333 ? -64.114 25.521  -16.577  1.00 110.53 ? 342 SER B CB  1 
ATOM   8045  O OG  . SER B 1 333 ? -65.448 25.048  -16.608  1.00 111.29 ? 342 SER B OG  1 
ATOM   8046  N N   . GLY B 1 334 ? -64.921 28.953  -17.741  1.00 129.13 ? 343 GLY B N   1 
ATOM   8047  C CA  . GLY B 1 334 ? -65.413 29.664  -18.906  1.00 131.24 ? 343 GLY B CA  1 
ATOM   8048  C C   . GLY B 1 334 ? -66.810 29.243  -19.316  1.00 132.39 ? 343 GLY B C   1 
ATOM   8049  O O   . GLY B 1 334 ? -67.547 28.653  -18.526  1.00 132.02 ? 343 GLY B O   1 
ATOM   8050  N N   . ASN B 1 335 ? -67.175 29.548  -20.557  1.00 123.61 ? 344 ASN B N   1 
ATOM   8051  C CA  . ASN B 1 335 ? -68.495 29.210  -21.074  1.00 125.21 ? 344 ASN B CA  1 
ATOM   8052  C C   . ASN B 1 335 ? -68.702 27.702  -21.174  1.00 123.02 ? 344 ASN B C   1 
ATOM   8053  O O   . ASN B 1 335 ? -67.927 27.002  -21.825  1.00 121.42 ? 344 ASN B O   1 
ATOM   8054  C CB  . ASN B 1 335 ? -68.721 29.861  -22.439  1.00 128.00 ? 344 ASN B CB  1 
ATOM   8055  C CG  . ASN B 1 335 ? -70.128 29.645  -22.961  1.00 130.33 ? 344 ASN B CG  1 
ATOM   8056  O OD1 . ASN B 1 335 ? -71.052 29.379  -22.193  1.00 130.52 ? 344 ASN B OD1 1 
ATOM   8057  N ND2 . ASN B 1 335 ? -70.298 29.761  -24.272  1.00 132.47 ? 344 ASN B ND2 1 
ATOM   8058  N N   . ILE B 1 336 ? -69.753 27.209  -20.528  1.00 124.01 ? 345 ILE B N   1 
ATOM   8059  C CA  . ILE B 1 336 ? -70.045 25.781  -20.522  1.00 122.35 ? 345 ILE B CA  1 
ATOM   8060  C C   . ILE B 1 336 ? -71.148 25.419  -21.512  1.00 124.29 ? 345 ILE B C   1 
ATOM   8061  O O   . ILE B 1 336 ? -72.286 25.870  -21.383  1.00 126.66 ? 345 ILE B O   1 
ATOM   8062  C CB  . ILE B 1 336 ? -70.453 25.298  -19.119  1.00 121.53 ? 345 ILE B CB  1 
ATOM   8063  C CG1 . ILE B 1 336 ? -69.387 25.685  -18.093  1.00 120.15 ? 345 ILE B CG1 1 
ATOM   8064  C CG2 . ILE B 1 336 ? -70.677 23.796  -19.118  1.00 120.05 ? 345 ILE B CG2 1 
ATOM   8065  C CD1 . ILE B 1 336 ? -69.711 25.246  -16.683  1.00 119.85 ? 345 ILE B CD1 1 
ATOM   8066  N N   . LYS B 1 337 ? -70.801 24.602  -22.501  1.00 126.69 ? 346 LYS B N   1 
ATOM   8067  C CA  . LYS B 1 337 ? -71.766 24.130  -23.487  1.00 128.70 ? 346 LYS B CA  1 
ATOM   8068  C C   . LYS B 1 337 ? -71.459 22.687  -23.869  1.00 127.08 ? 346 LYS B C   1 
ATOM   8069  O O   . LYS B 1 337 ? -70.326 22.231  -23.729  1.00 124.81 ? 346 LYS B O   1 
ATOM   8070  C CB  . LYS B 1 337 ? -71.748 25.022  -24.730  1.00 131.43 ? 346 LYS B CB  1 
ATOM   8071  N N   . PHE B 1 338 ? -72.468 21.972  -24.354  1.00 123.17 ? 347 PHE B N   1 
ATOM   8072  C CA  . PHE B 1 338 ? -72.300 20.564  -24.696  1.00 122.19 ? 347 PHE B CA  1 
ATOM   8073  C C   . PHE B 1 338 ? -72.885 20.232  -26.063  1.00 124.90 ? 347 PHE B C   1 
ATOM   8074  O O   . PHE B 1 338 ? -73.708 20.975  -26.598  1.00 127.73 ? 347 PHE B O   1 
ATOM   8075  C CB  . PHE B 1 338 ? -72.955 19.677  -23.636  1.00 121.24 ? 347 PHE B CB  1 
ATOM   8076  C CG  . PHE B 1 338 ? -72.510 19.976  -22.237  1.00 119.25 ? 347 PHE B CG  1 
ATOM   8077  C CD1 . PHE B 1 338 ? -73.148 20.949  -21.487  1.00 120.28 ? 347 PHE B CD1 1 
ATOM   8078  C CD2 . PHE B 1 338 ? -71.457 19.282  -21.669  1.00 116.79 ? 347 PHE B CD2 1 
ATOM   8079  C CE1 . PHE B 1 338 ? -72.740 21.226  -20.199  1.00 118.93 ? 347 PHE B CE1 1 
ATOM   8080  C CE2 . PHE B 1 338 ? -71.046 19.556  -20.380  1.00 115.43 ? 347 PHE B CE2 1 
ATOM   8081  C CZ  . PHE B 1 338 ? -71.689 20.529  -19.644  1.00 116.52 ? 347 PHE B CZ  1 
ATOM   8082  N N   . ASP B 1 339 ? -72.450 19.108  -26.622  1.00 151.14 ? 348 ASP B N   1 
ATOM   8083  C CA  . ASP B 1 339 ? -73.023 18.596  -27.859  1.00 153.99 ? 348 ASP B CA  1 
ATOM   8084  C C   . ASP B 1 339 ? -73.922 17.404  -27.556  1.00 154.32 ? 348 ASP B C   1 
ATOM   8085  O O   . ASP B 1 339 ? -74.184 17.097  -26.393  1.00 152.59 ? 348 ASP B O   1 
ATOM   8086  C CB  . ASP B 1 339 ? -71.923 18.207  -28.851  1.00 154.11 ? 348 ASP B CB  1 
ATOM   8087  C CG  . ASP B 1 339 ? -70.940 17.206  -28.273  1.00 151.22 ? 348 ASP B CG  1 
ATOM   8088  O OD1 . ASP B 1 339 ? -71.156 16.744  -27.132  1.00 149.28 ? 348 ASP B OD1 1 
ATOM   8089  O OD2 . ASP B 1 339 ? -69.948 16.881  -28.963  1.00 151.25 ? 348 ASP B OD2 1 
ATOM   8090  N N   . GLN B 1 340 ? -74.392 16.731  -28.600  1.00 151.67 ? 349 GLN B N   1 
ATOM   8091  C CA  . GLN B 1 340 ? -75.315 15.615  -28.432  1.00 152.60 ? 349 GLN B CA  1 
ATOM   8092  C C   . GLN B 1 340 ? -74.687 14.452  -27.668  1.00 150.01 ? 349 GLN B C   1 
ATOM   8093  O O   . GLN B 1 340 ? -75.395 13.613  -27.109  1.00 150.19 ? 349 GLN B O   1 
ATOM   8094  C CB  . GLN B 1 340 ? -75.826 15.134  -29.790  1.00 156.28 ? 349 GLN B CB  1 
ATOM   8095  N N   . ASN B 1 341 ? -73.359 14.406  -27.642  1.00 149.19 ? 350 ASN B N   1 
ATOM   8096  C CA  . ASN B 1 341 ? -72.648 13.314  -26.986  1.00 147.18 ? 350 ASN B CA  1 
ATOM   8097  C C   . ASN B 1 341 ? -72.346 13.587  -25.516  1.00 144.36 ? 350 ASN B C   1 
ATOM   8098  O O   . ASN B 1 341 ? -72.570 12.732  -24.659  1.00 143.72 ? 350 ASN B O   1 
ATOM   8099  C CB  . ASN B 1 341 ? -71.356 12.991  -27.737  1.00 146.91 ? 350 ASN B CB  1 
ATOM   8100  C CG  . ASN B 1 341 ? -71.613 12.493  -29.144  1.00 150.16 ? 350 ASN B CG  1 
ATOM   8101  O OD1 . ASN B 1 341 ? -72.727 12.091  -29.479  1.00 152.48 ? 350 ASN B OD1 1 
ATOM   8102  N ND2 . ASN B 1 341 ? -70.579 12.516  -29.977  1.00 150.67 ? 350 ASN B ND2 1 
ATOM   8103  N N   . GLY B 1 342 ? -71.837 14.780  -25.229  1.00 119.52 ? 351 GLY B N   1 
ATOM   8104  C CA  . GLY B 1 342 ? -71.507 15.155  -23.867  1.00 117.28 ? 351 GLY B CA  1 
ATOM   8105  C C   . GLY B 1 342 ? -70.189 15.896  -23.771  1.00 115.50 ? 351 GLY B C   1 
ATOM   8106  O O   . GLY B 1 342 ? -69.860 16.465  -22.730  1.00 114.02 ? 351 GLY B O   1 
ATOM   8107  N N   . LYS B 1 343 ? -69.429 15.885  -24.861  1.00 117.35 ? 352 LYS B N   1 
ATOM   8108  C CA  . LYS B 1 343 ? -68.161 16.601  -24.911  1.00 116.04 ? 352 LYS B CA  1 
ATOM   8109  C C   . LYS B 1 343 ? -68.405 18.105  -24.962  1.00 116.64 ? 352 LYS B C   1 
ATOM   8110  O O   . LYS B 1 343 ? -69.263 18.577  -25.707  1.00 118.88 ? 352 LYS B O   1 
ATOM   8111  C CB  . LYS B 1 343 ? -67.343 16.156  -26.124  1.00 116.96 ? 352 LYS B CB  1 
ATOM   8112  N N   . ARG B 1 344 ? -67.652 18.854  -24.163  1.00 116.80 ? 353 ARG B N   1 
ATOM   8113  C CA  . ARG B 1 344 ? -67.814 20.303  -24.103  1.00 117.58 ? 353 ARG B CA  1 
ATOM   8114  C C   . ARG B 1 344 ? -67.424 20.978  -25.412  1.00 119.32 ? 353 ARG B C   1 
ATOM   8115  O O   . ARG B 1 344 ? -66.505 20.537  -26.102  1.00 119.11 ? 353 ARG B O   1 
ATOM   8116  C CB  . ARG B 1 344 ? -67.006 20.892  -22.946  1.00 115.71 ? 353 ARG B CB  1 
ATOM   8117  C CG  . ARG B 1 344 ? -67.569 20.573  -21.573  1.00 114.87 ? 353 ARG B CG  1 
ATOM   8118  C CD  . ARG B 1 344 ? -66.895 21.407  -20.500  1.00 113.89 ? 353 ARG B CD  1 
ATOM   8119  N NE  . ARG B 1 344 ? -67.032 22.837  -20.756  1.00 115.31 ? 353 ARG B NE  1 
ATOM   8120  C CZ  . ARG B 1 344 ? -66.532 23.785  -19.971  1.00 115.15 ? 353 ARG B CZ  1 
ATOM   8121  N NH1 . ARG B 1 344 ? -65.860 23.455  -18.877  1.00 113.64 ? 353 ARG B NH1 1 
ATOM   8122  N NH2 . ARG B 1 344 ? -66.704 25.063  -20.279  1.00 116.89 ? 353 ARG B NH2 1 
ATOM   8123  N N   . ILE B 1 345 ? -68.133 22.051  -25.746  1.00 121.46 ? 354 ILE B N   1 
ATOM   8124  C CA  . ILE B 1 345 ? -67.864 22.805  -26.963  1.00 123.80 ? 354 ILE B CA  1 
ATOM   8125  C C   . ILE B 1 345 ? -67.901 24.303  -26.685  1.00 124.93 ? 354 ILE B C   1 
ATOM   8126  O O   . ILE B 1 345 ? -68.331 24.734  -25.616  1.00 124.25 ? 354 ILE B O   1 
ATOM   8127  C CB  . ILE B 1 345 ? -68.878 22.470  -28.072  1.00 126.84 ? 354 ILE B CB  1 
ATOM   8128  C CG1 . ILE B 1 345 ? -70.306 22.726  -27.585  1.00 128.13 ? 354 ILE B CG1 1 
ATOM   8129  C CG2 . ILE B 1 345 ? -68.716 21.028  -28.525  1.00 126.34 ? 354 ILE B CG2 1 
ATOM   8130  C CD1 . ILE B 1 345 ? -71.370 22.387  -28.607  1.00 131.40 ? 354 ILE B CD1 1 
ATOM   8131  N N   . ASN B 1 346 ? -67.449 25.090  -27.656  1.00 126.18 ? 355 ASN B N   1 
ATOM   8132  C CA  . ASN B 1 346 ? -67.408 26.540  -27.520  1.00 127.83 ? 355 ASN B CA  1 
ATOM   8133  C C   . ASN B 1 346 ? -66.738 26.971  -26.218  1.00 125.30 ? 355 ASN B C   1 
ATOM   8134  O O   . ASN B 1 346 ? -67.235 27.848  -25.513  1.00 126.17 ? 355 ASN B O   1 
ATOM   8135  C CB  . ASN B 1 346 ? -68.816 27.128  -27.614  1.00 130.84 ? 355 ASN B CB  1 
ATOM   8136  C CG  . ASN B 1 346 ? -68.809 28.621  -27.883  1.00 133.86 ? 355 ASN B CG  1 
ATOM   8137  O OD1 . ASN B 1 346 ? -67.755 29.220  -28.091  1.00 133.82 ? 355 ASN B OD1 1 
ATOM   8138  N ND2 . ASN B 1 346 ? -69.991 29.229  -27.881  1.00 136.82 ? 355 ASN B ND2 1 
ATOM   8139  N N   . TYR B 1 347 ? -65.607 26.347  -25.906  1.00 130.44 ? 356 TYR B N   1 
ATOM   8140  C CA  . TYR B 1 347 ? -64.866 26.662  -24.689  1.00 128.26 ? 356 TYR B CA  1 
ATOM   8141  C C   . TYR B 1 347 ? -63.578 27.411  -25.007  1.00 128.43 ? 356 TYR B C   1 
ATOM   8142  O O   . TYR B 1 347 ? -63.226 27.590  -26.172  1.00 130.13 ? 356 TYR B O   1 
ATOM   8143  C CB  . TYR B 1 347 ? -64.555 25.388  -23.901  1.00 125.29 ? 356 TYR B CB  1 
ATOM   8144  C CG  . TYR B 1 347 ? -63.798 24.345  -24.692  1.00 124.44 ? 356 TYR B CG  1 
ATOM   8145  C CD1 . TYR B 1 347 ? -62.410 24.310  -24.682  1.00 123.22 ? 356 TYR B CD1 1 
ATOM   8146  C CD2 . TYR B 1 347 ? -64.471 23.394  -25.448  1.00 125.22 ? 356 TYR B CD2 1 
ATOM   8147  C CE1 . TYR B 1 347 ? -61.713 23.358  -25.403  1.00 122.86 ? 356 TYR B CE1 1 
ATOM   8148  C CE2 . TYR B 1 347 ? -63.783 22.439  -26.172  1.00 124.91 ? 356 TYR B CE2 1 
ATOM   8149  C CZ  . TYR B 1 347 ? -62.405 22.426  -26.146  1.00 123.76 ? 356 TYR B CZ  1 
ATOM   8150  O OH  . TYR B 1 347 ? -61.717 21.476  -26.865  1.00 123.85 ? 356 TYR B OH  1 
ATOM   8151  N N   . THR B 1 348 ? -62.880 27.848  -23.964  1.00 124.00 ? 357 THR B N   1 
ATOM   8152  C CA  . THR B 1 348 ? -61.652 28.613  -24.136  1.00 124.28 ? 357 THR B CA  1 
ATOM   8153  C C   . THR B 1 348 ? -60.562 28.147  -23.177  1.00 121.60 ? 357 THR B C   1 
ATOM   8154  O O   . THR B 1 348 ? -60.777 28.070  -21.968  1.00 120.45 ? 357 THR B O   1 
ATOM   8155  C CB  . THR B 1 348 ? -61.896 30.117  -23.921  1.00 126.71 ? 357 THR B CB  1 
ATOM   8156  O OG1 . THR B 1 348 ? -62.776 30.610  -24.939  1.00 129.81 ? 357 THR B OG1 1 
ATOM   8157  C CG2 . THR B 1 348 ? -60.585 30.883  -23.978  1.00 127.02 ? 357 THR B CG2 1 
ATOM   8158  N N   . ILE B 1 349 ? -59.393 27.839  -23.727  1.00 113.61 ? 358 ILE B N   1 
ATOM   8159  C CA  . ILE B 1 349 ? -58.250 27.425  -22.922  1.00 111.53 ? 358 ILE B CA  1 
ATOM   8160  C C   . ILE B 1 349 ? -57.102 28.417  -23.073  1.00 112.46 ? 358 ILE B C   1 
ATOM   8161  O O   . ILE B 1 349 ? -56.523 28.551  -24.150  1.00 113.65 ? 358 ILE B O   1 
ATOM   8162  C CB  . ILE B 1 349 ? -57.757 26.024  -23.321  1.00 110.10 ? 358 ILE B CB  1 
ATOM   8163  C CG1 . ILE B 1 349 ? -58.913 25.022  -23.294  1.00 109.59 ? 358 ILE B CG1 1 
ATOM   8164  C CG2 . ILE B 1 349 ? -56.632 25.576  -22.402  1.00 108.33 ? 358 ILE B CG2 1 
ATOM   8165  C CD1 . ILE B 1 349 ? -58.523 23.629  -23.740  1.00 108.72 ? 358 ILE B CD1 1 
ATOM   8166  N N   . ASN B 1 350 ? -56.779 29.111  -21.988  1.00 132.80 ? 359 ASN B N   1 
ATOM   8167  C CA  . ASN B 1 350 ? -55.715 30.108  -22.007  1.00 133.90 ? 359 ASN B CA  1 
ATOM   8168  C C   . ASN B 1 350 ? -54.325 29.484  -22.064  1.00 132.63 ? 359 ASN B C   1 
ATOM   8169  O O   . ASN B 1 350 ? -53.995 28.605  -21.269  1.00 130.74 ? 359 ASN B O   1 
ATOM   8170  C CB  . ASN B 1 350 ? -55.820 31.032  -20.791  1.00 134.50 ? 359 ASN B CB  1 
ATOM   8171  C CG  . ASN B 1 350 ? -57.069 31.889  -20.816  1.00 136.58 ? 359 ASN B CG  1 
ATOM   8172  O OD1 . ASN B 1 350 ? -58.051 31.557  -21.479  1.00 137.02 ? 359 ASN B OD1 1 
ATOM   8173  N ND2 . ASN B 1 350 ? -57.038 32.999  -20.088  1.00 138.23 ? 359 ASN B ND2 1 
ATOM   8174  N N   . ILE B 1 351 ? -53.513 29.945  -23.011  1.00 112.28 ? 360 ILE B N   1 
ATOM   8175  C CA  . ILE B 1 351 ? -52.131 29.494  -23.119  1.00 111.62 ? 360 ILE B CA  1 
ATOM   8176  C C   . ILE B 1 351 ? -51.245 30.312  -22.187  1.00 111.89 ? 360 ILE B C   1 
ATOM   8177  O O   . ILE B 1 351 ? -51.256 31.542  -22.227  1.00 113.82 ? 360 ILE B O   1 
ATOM   8178  C CB  . ILE B 1 351 ? -51.603 29.605  -24.560  1.00 113.45 ? 360 ILE B CB  1 
ATOM   8179  C CG1 . ILE B 1 351 ? -52.175 28.482  -25.428  1.00 113.15 ? 360 ILE B CG1 1 
ATOM   8180  C CG2 . ILE B 1 351 ? -50.087 29.541  -24.573  1.00 113.49 ? 360 ILE B CG2 1 
ATOM   8181  C CD1 . ILE B 1 351 ? -53.642 28.632  -25.746  1.00 113.93 ? 360 ILE B CD1 1 
ATOM   8182  N N   . MET B 1 352 ? -50.479 29.622  -21.349  1.00 129.45 ? 361 MET B N   1 
ATOM   8183  C CA  . MET B 1 352 ? -49.682 30.285  -20.325  1.00 129.83 ? 361 MET B CA  1 
ATOM   8184  C C   . MET B 1 352 ? -48.183 30.109  -20.539  1.00 130.09 ? 361 MET B C   1 
ATOM   8185  O O   . MET B 1 352 ? -47.729 29.069  -21.016  1.00 129.24 ? 361 MET B O   1 
ATOM   8186  C CB  . MET B 1 352 ? -50.065 29.760  -18.940  1.00 128.46 ? 361 MET B CB  1 
ATOM   8187  C CG  . MET B 1 352 ? -51.548 29.854  -18.626  1.00 128.34 ? 361 MET B CG  1 
ATOM   8188  S SD  . MET B 1 352 ? -52.087 31.547  -18.333  1.00 130.80 ? 361 MET B SD  1 
ATOM   8189  C CE  . MET B 1 352 ? -51.126 31.957  -16.879  1.00 131.32 ? 361 MET B CE  1 
ATOM   8190  N N   . GLU B 1 353 ? -47.422 31.139  -20.182  1.00 114.51 ? 362 GLU B N   1 
ATOM   8191  C CA  . GLU B 1 353 ? -45.967 31.067  -20.176  1.00 115.02 ? 362 GLU B CA  1 
ATOM   8192  C C   . GLU B 1 353 ? -45.444 31.538  -18.825  1.00 115.43 ? 362 GLU B C   1 
ATOM   8193  O O   . GLU B 1 353 ? -46.005 32.451  -18.221  1.00 116.39 ? 362 GLU B O   1 
ATOM   8194  C CB  . GLU B 1 353 ? -45.369 31.921  -21.296  1.00 117.22 ? 362 GLU B CB  1 
ATOM   8195  C CG  . GLU B 1 353 ? -45.437 31.290  -22.677  1.00 117.39 ? 362 GLU B CG  1 
ATOM   8196  C CD  . GLU B 1 353 ? -44.655 32.077  -23.713  1.00 120.02 ? 362 GLU B CD  1 
ATOM   8197  O OE1 . GLU B 1 353 ? -44.528 31.597  -24.860  1.00 120.76 ? 362 GLU B OE1 1 
ATOM   8198  O OE2 . GLU B 1 353 ? -44.165 33.177  -23.380  1.00 121.67 ? 362 GLU B OE2 1 
ATOM   8199  N N   . LEU B 1 354 ? -44.372 30.913  -18.350  1.00 114.01 ? 363 LEU B N   1 
ATOM   8200  C CA  . LEU B 1 354 ? -43.802 31.264  -17.056  1.00 114.78 ? 363 LEU B CA  1 
ATOM   8201  C C   . LEU B 1 354 ? -42.636 32.233  -17.204  1.00 116.96 ? 363 LEU B C   1 
ATOM   8202  O O   . LEU B 1 354 ? -41.567 31.864  -17.690  1.00 117.32 ? 363 LEU B O   1 
ATOM   8203  C CB  . LEU B 1 354 ? -43.349 30.009  -16.309  1.00 113.67 ? 363 LEU B CB  1 
ATOM   8204  C CG  . LEU B 1 354 ? -42.774 30.244  -14.912  1.00 114.84 ? 363 LEU B CG  1 
ATOM   8205  C CD1 . LEU B 1 354 ? -43.781 30.969  -14.039  1.00 115.36 ? 363 LEU B CD1 1 
ATOM   8206  C CD2 . LEU B 1 354 ? -42.360 28.929  -14.274  1.00 114.16 ? 363 LEU B CD2 1 
ATOM   8207  N N   . LYS B 1 355 ? -42.850 33.474  -16.781  1.00 119.76 ? 364 LYS B N   1 
ATOM   8208  C CA  . LYS B 1 355 ? -41.809 34.492  -16.844  1.00 122.22 ? 364 LYS B CA  1 
ATOM   8209  C C   . LYS B 1 355 ? -41.156 34.684  -15.479  1.00 123.34 ? 364 LYS B C   1 
ATOM   8210  O O   . LYS B 1 355 ? -41.394 33.909  -14.554  1.00 122.23 ? 364 LYS B O   1 
ATOM   8211  C CB  . LYS B 1 355 ? -42.383 35.818  -17.348  1.00 124.20 ? 364 LYS B CB  1 
ATOM   8212  N N   . THR B 1 356 ? -40.335 35.722  -15.360  1.00 137.05 ? 365 THR B N   1 
ATOM   8213  C CA  . THR B 1 356 ? -39.634 36.007  -14.114  1.00 138.76 ? 365 THR B CA  1 
ATOM   8214  C C   . THR B 1 356 ? -40.593 36.475  -13.023  1.00 139.49 ? 365 THR B C   1 
ATOM   8215  O O   . THR B 1 356 ? -40.466 36.084  -11.862  1.00 139.83 ? 365 THR B O   1 
ATOM   8216  C CB  . THR B 1 356 ? -38.539 37.071  -14.315  1.00 141.74 ? 365 THR B CB  1 
ATOM   8217  O OG1 . THR B 1 356 ? -37.601 36.615  -15.297  1.00 141.41 ? 365 THR B OG1 1 
ATOM   8218  C CG2 . THR B 1 356 ? -37.808 37.339  -13.008  1.00 143.84 ? 365 THR B CG2 1 
ATOM   8219  N N   . ASN B 1 357 ? -41.554 37.312  -13.401  1.00 167.57 ? 366 ASN B N   1 
ATOM   8220  C CA  . ASN B 1 357 ? -42.527 37.838  -12.450  1.00 168.71 ? 366 ASN B CA  1 
ATOM   8221  C C   . ASN B 1 357 ? -43.639 36.841  -12.135  1.00 166.19 ? 366 ASN B C   1 
ATOM   8222  O O   . ASN B 1 357 ? -44.487 37.092  -11.280  1.00 167.06 ? 366 ASN B O   1 
ATOM   8223  C CB  . ASN B 1 357 ? -43.127 39.150  -12.962  1.00 170.95 ? 366 ASN B CB  1 
ATOM   8224  C CG  . ASN B 1 357 ? -43.900 38.974  -14.255  1.00 169.37 ? 366 ASN B CG  1 
ATOM   8225  O OD1 . ASN B 1 357 ? -43.743 37.974  -14.956  1.00 166.84 ? 366 ASN B OD1 1 
ATOM   8226  N ND2 . ASN B 1 357 ? -44.740 39.949  -14.579  1.00 171.28 ? 366 ASN B ND2 1 
ATOM   8227  N N   . GLY B 1 358 ? -43.627 35.709  -12.831  1.00 169.96 ? 367 GLY B N   1 
ATOM   8228  C CA  . GLY B 1 358 ? -44.630 34.680  -12.628  1.00 167.64 ? 367 GLY B CA  1 
ATOM   8229  C C   . GLY B 1 358 ? -45.369 34.337  -13.906  1.00 165.78 ? 367 GLY B C   1 
ATOM   8230  O O   . GLY B 1 358 ? -45.064 34.883  -14.967  1.00 166.42 ? 367 GLY B O   1 
ATOM   8231  N N   . PRO B 1 359 ? -46.348 33.424  -13.812  1.00 121.28 ? 368 PRO B N   1 
ATOM   8232  C CA  . PRO B 1 359 ? -47.165 32.997  -14.952  1.00 119.70 ? 368 PRO B CA  1 
ATOM   8233  C C   . PRO B 1 359 ? -47.828 34.183  -15.644  1.00 121.35 ? 368 PRO B C   1 
ATOM   8234  O O   . PRO B 1 359 ? -48.109 35.192  -14.997  1.00 123.41 ? 368 PRO B O   1 
ATOM   8235  C CB  . PRO B 1 359 ? -48.228 32.101  -14.299  1.00 118.20 ? 368 PRO B CB  1 
ATOM   8236  C CG  . PRO B 1 359 ? -48.175 32.454  -12.828  1.00 119.69 ? 368 PRO B CG  1 
ATOM   8237  C CD  . PRO B 1 359 ? -46.729 32.700  -12.590  1.00 120.79 ? 368 PRO B CD  1 
ATOM   8238  N N   . ARG B 1 360 ? -48.067 34.059  -16.945  1.00 116.68 ? 369 ARG B N   1 
ATOM   8239  C CA  . ARG B 1 360 ? -48.676 35.134  -17.718  1.00 118.67 ? 369 ARG B CA  1 
ATOM   8240  C C   . ARG B 1 360 ? -49.360 34.599  -18.972  1.00 117.82 ? 369 ARG B C   1 
ATOM   8241  O O   . ARG B 1 360 ? -48.752 33.873  -19.758  1.00 116.82 ? 369 ARG B O   1 
ATOM   8242  C CB  . ARG B 1 360 ? -47.626 36.180  -18.098  1.00 121.09 ? 369 ARG B CB  1 
ATOM   8243  N N   . LYS B 1 361 ? -50.626 34.963  -19.150  1.00 123.68 ? 370 LYS B N   1 
ATOM   8244  C CA  . LYS B 1 361 ? -51.391 34.533  -20.314  1.00 123.42 ? 370 LYS B CA  1 
ATOM   8245  C C   . LYS B 1 361 ? -50.903 35.233  -21.576  1.00 125.71 ? 370 LYS B C   1 
ATOM   8246  O O   . LYS B 1 361 ? -50.890 36.462  -21.650  1.00 128.49 ? 370 LYS B O   1 
ATOM   8247  C CB  . LYS B 1 361 ? -52.881 34.808  -20.105  1.00 124.11 ? 370 LYS B CB  1 
ATOM   8248  N N   . ILE B 1 362 ? -50.501 34.445  -22.568  1.00 133.49 ? 371 ILE B N   1 
ATOM   8249  C CA  . ILE B 1 362 ? -50.008 34.993  -23.826  1.00 135.96 ? 371 ILE B CA  1 
ATOM   8250  C C   . ILE B 1 362 ? -51.045 34.848  -24.933  1.00 137.14 ? 371 ILE B C   1 
ATOM   8251  O O   . ILE B 1 362 ? -50.825 35.282  -26.063  1.00 139.73 ? 371 ILE B O   1 
ATOM   8252  C CB  . ILE B 1 362 ? -48.703 34.307  -24.271  1.00 135.20 ? 371 ILE B CB  1 
ATOM   8253  C CG1 . ILE B 1 362 ? -48.990 32.900  -24.798  1.00 133.22 ? 371 ILE B CG1 1 
ATOM   8254  C CG2 . ILE B 1 362 ? -47.704 34.264  -23.124  1.00 133.97 ? 371 ILE B CG2 1 
ATOM   8255  C CD1 . ILE B 1 362 ? -47.770 32.200  -25.362  1.00 133.05 ? 371 ILE B CD1 1 
ATOM   8256  N N   . GLY B 1 363 ? -52.176 34.235  -24.601  1.00 128.12 ? 372 GLY B N   1 
ATOM   8257  C CA  . GLY B 1 363 ? -53.243 34.031  -25.563  1.00 129.31 ? 372 GLY B CA  1 
ATOM   8258  C C   . GLY B 1 363 ? -54.204 32.942  -25.130  1.00 126.79 ? 372 GLY B C   1 
ATOM   8259  O O   . GLY B 1 363 ? -54.119 32.438  -24.011  1.00 124.33 ? 372 GLY B O   1 
ATOM   8260  N N   . TYR B 1 364 ? -55.122 32.578  -26.019  1.00 131.14 ? 373 TYR B N   1 
ATOM   8261  C CA  . TYR B 1 364 ? -56.101 31.539  -25.724  1.00 129.17 ? 373 TYR B CA  1 
ATOM   8262  C C   . TYR B 1 364 ? -56.272 30.595  -26.908  1.00 129.54 ? 373 TYR B C   1 
ATOM   8263  O O   . TYR B 1 364 ? -55.716 30.825  -27.982  1.00 131.64 ? 373 TYR B O   1 
ATOM   8264  C CB  . TYR B 1 364 ? -57.449 32.159  -25.349  1.00 130.46 ? 373 TYR B CB  1 
ATOM   8265  C CG  . TYR B 1 364 ? -58.161 32.829  -26.504  1.00 134.07 ? 373 TYR B CG  1 
ATOM   8266  C CD1 . TYR B 1 364 ? -59.053 32.121  -27.300  1.00 134.68 ? 373 TYR B CD1 1 
ATOM   8267  C CD2 . TYR B 1 364 ? -57.943 34.168  -26.798  1.00 137.29 ? 373 TYR B CD2 1 
ATOM   8268  C CE1 . TYR B 1 364 ? -59.707 32.728  -28.356  1.00 138.46 ? 373 TYR B CE1 1 
ATOM   8269  C CE2 . TYR B 1 364 ? -58.592 34.784  -27.852  1.00 141.12 ? 373 TYR B CE2 1 
ATOM   8270  C CZ  . TYR B 1 364 ? -59.473 34.059  -28.628  1.00 141.72 ? 373 TYR B CZ  1 
ATOM   8271  O OH  . TYR B 1 364 ? -60.122 34.666  -29.678  1.00 146.00 ? 373 TYR B OH  1 
ATOM   8272  N N   . TRP B 1 365 ? -57.047 29.535  -26.707  1.00 123.63 ? 374 TRP B N   1 
ATOM   8273  C CA  . TRP B 1 365 ? -57.303 28.566  -27.765  1.00 124.20 ? 374 TRP B CA  1 
ATOM   8274  C C   . TRP B 1 365 ? -58.789 28.252  -27.876  1.00 124.76 ? 374 TRP B C   1 
ATOM   8275  O O   . TRP B 1 365 ? -59.402 27.766  -26.927  1.00 122.74 ? 374 TRP B O   1 
ATOM   8276  C CB  . TRP B 1 365 ? -56.516 27.279  -27.518  1.00 121.69 ? 374 TRP B CB  1 
ATOM   8277  C CG  . TRP B 1 365 ? -56.617 26.294  -28.643  1.00 122.72 ? 374 TRP B CG  1 
ATOM   8278  C CD1 . TRP B 1 365 ? -55.767 26.171  -29.703  1.00 124.53 ? 374 TRP B CD1 1 
ATOM   8279  C CD2 . TRP B 1 365 ? -57.628 25.294  -28.822  1.00 122.43 ? 374 TRP B CD2 1 
ATOM   8280  N NE1 . TRP B 1 365 ? -56.185 25.156  -30.530  1.00 125.49 ? 374 TRP B NE1 1 
ATOM   8281  C CE2 . TRP B 1 365 ? -57.324 24.601  -30.011  1.00 124.18 ? 374 TRP B CE2 1 
ATOM   8282  C CE3 . TRP B 1 365 ? -58.759 24.917  -28.092  1.00 121.14 ? 374 TRP B CE3 1 
ATOM   8283  C CZ2 . TRP B 1 365 ? -58.110 23.554  -30.486  1.00 124.70 ? 374 TRP B CZ2 1 
ATOM   8284  C CZ3 . TRP B 1 365 ? -59.538 23.876  -28.565  1.00 121.53 ? 374 TRP B CZ3 1 
ATOM   8285  C CH2 . TRP B 1 365 ? -59.210 23.207  -29.751  1.00 123.29 ? 374 TRP B CH2 1 
ATOM   8286  N N   . SER B 1 366 ? -59.362 28.535  -29.040  1.00 123.69 ? 375 SER B N   1 
ATOM   8287  C CA  . SER B 1 366 ? -60.762 28.228  -29.301  1.00 124.80 ? 375 SER B CA  1 
ATOM   8288  C C   . SER B 1 366 ? -60.869 27.047  -30.256  1.00 125.34 ? 375 SER B C   1 
ATOM   8289  O O   . SER B 1 366 ? -60.041 26.888  -31.151  1.00 126.66 ? 375 SER B O   1 
ATOM   8290  C CB  . SER B 1 366 ? -61.477 29.446  -29.887  1.00 128.65 ? 375 SER B CB  1 
ATOM   8291  O OG  . SER B 1 366 ? -62.846 29.169  -30.122  1.00 130.01 ? 375 SER B OG  1 
ATOM   8292  N N   . GLU B 1 367 ? -61.890 26.220  -30.062  1.00 165.46 ? 376 GLU B N   1 
ATOM   8293  C CA  . GLU B 1 367 ? -62.094 25.053  -30.912  1.00 166.24 ? 376 GLU B CA  1 
ATOM   8294  C C   . GLU B 1 367 ? -62.384 25.462  -32.351  1.00 170.62 ? 376 GLU B C   1 
ATOM   8295  O O   . GLU B 1 367 ? -62.337 24.637  -33.261  1.00 172.15 ? 376 GLU B O   1 
ATOM   8296  C CB  . GLU B 1 367 ? -63.240 24.192  -30.379  1.00 165.04 ? 376 GLU B CB  1 
ATOM   8297  C CG  . GLU B 1 367 ? -64.599 24.873  -30.419  1.00 167.18 ? 376 GLU B CG  1 
ATOM   8298  C CD  . GLU B 1 367 ? -65.740 23.918  -30.129  1.00 166.67 ? 376 GLU B CD  1 
ATOM   8299  O OE1 . GLU B 1 367 ? -66.908 24.295  -30.365  1.00 168.99 ? 376 GLU B OE1 1 
ATOM   8300  O OE2 . GLU B 1 367 ? -65.467 22.789  -29.670  1.00 164.25 ? 376 GLU B OE2 1 
ATOM   8301  N N   . VAL B 1 368 ? -62.679 26.742  -32.552  1.00 132.03 ? 377 VAL B N   1 
ATOM   8302  C CA  . VAL B 1 368 ? -63.049 27.244  -33.871  1.00 136.85 ? 377 VAL B CA  1 
ATOM   8303  C C   . VAL B 1 368 ? -62.053 28.269  -34.403  1.00 139.05 ? 377 VAL B C   1 
ATOM   8304  O O   . VAL B 1 368 ? -62.007 28.534  -35.605  1.00 143.23 ? 377 VAL B O   1 
ATOM   8305  C CB  . VAL B 1 368 ? -64.458 27.876  -33.859  1.00 139.28 ? 377 VAL B CB  1 
ATOM   8306  C CG1 . VAL B 1 368 ? -65.504 26.831  -33.503  1.00 137.83 ? 377 VAL B CG1 1 
ATOM   8307  C CG2 . VAL B 1 368 ? -64.507 29.044  -32.884  1.00 138.47 ? 377 VAL B CG2 1 
ATOM   8308  N N   . ASP B 1 369 ? -61.257 28.844  -33.508  1.00 148.99 ? 378 ASP B N   1 
ATOM   8309  C CA  . ASP B 1 369 ? -60.302 29.877  -33.892  1.00 151.05 ? 378 ASP B CA  1 
ATOM   8310  C C   . ASP B 1 369 ? -58.859 29.444  -33.656  1.00 148.53 ? 378 ASP B C   1 
ATOM   8311  O O   . ASP B 1 369 ? -57.929 30.221  -33.873  1.00 149.87 ? 378 ASP B O   1 
ATOM   8312  C CB  . ASP B 1 369 ? -60.581 31.172  -33.126  1.00 151.46 ? 378 ASP B CB  1 
ATOM   8313  C CG  . ASP B 1 369 ? -61.965 31.726  -33.401  1.00 154.68 ? 378 ASP B CG  1 
ATOM   8314  O OD1 . ASP B 1 369 ? -62.579 31.323  -34.412  1.00 157.52 ? 378 ASP B OD1 1 
ATOM   8315  O OD2 . ASP B 1 369 ? -62.437 32.566  -32.607  1.00 154.71 ? 378 ASP B OD2 1 
ATOM   8316  N N   . LYS B 1 370 ? -58.678 28.204  -33.213  1.00 134.87 ? 379 LYS B N   1 
ATOM   8317  C CA  . LYS B 1 370 ? -57.351 27.702  -32.873  1.00 132.47 ? 379 LYS B CA  1 
ATOM   8318  C C   . LYS B 1 370 ? -56.687 28.620  -31.851  1.00 130.72 ? 379 LYS B C   1 
ATOM   8319  O O   . LYS B 1 370 ? -57.342 29.120  -30.939  1.00 129.51 ? 379 LYS B O   1 
ATOM   8320  C CB  . LYS B 1 370 ? -56.480 27.581  -34.125  1.00 135.48 ? 379 LYS B CB  1 
ATOM   8321  N N   . MET B 1 371 ? -55.387 28.846  -32.010  1.00 128.08 ? 380 MET B N   1 
ATOM   8322  C CA  . MET B 1 371 ? -54.653 29.710  -31.093  1.00 126.82 ? 380 MET B CA  1 
ATOM   8323  C C   . MET B 1 371 ? -54.716 31.175  -31.511  1.00 130.29 ? 380 MET B C   1 
ATOM   8324  O O   . MET B 1 371 ? -54.551 31.502  -32.686  1.00 133.90 ? 380 MET B O   1 
ATOM   8325  C CB  . MET B 1 371 ? -53.196 29.260  -30.973  1.00 125.52 ? 380 MET B CB  1 
ATOM   8326  C CG  . MET B 1 371 ? -52.350 30.159  -30.088  1.00 124.67 ? 380 MET B CG  1 
ATOM   8327  S SD  . MET B 1 371 ? -50.794 29.395  -29.607  1.00 122.46 ? 380 MET B SD  1 
ATOM   8328  C CE  . MET B 1 371 ? -51.393 27.880  -28.866  1.00 118.96 ? 380 MET B CE  1 
ATOM   8329  N N   . VAL B 1 372 ? -54.956 32.050  -30.539  1.00 156.84 ? 381 VAL B N   1 
ATOM   8330  C CA  . VAL B 1 372 ? -55.005 33.487  -30.783  1.00 160.29 ? 381 VAL B CA  1 
ATOM   8331  C C   . VAL B 1 372 ? -54.269 34.236  -29.677  1.00 158.99 ? 381 VAL B C   1 
ATOM   8332  O O   . VAL B 1 372 ? -54.680 34.203  -28.517  1.00 156.62 ? 381 VAL B O   1 
ATOM   8333  C CB  . VAL B 1 372 ? -56.458 33.999  -30.875  1.00 162.36 ? 381 VAL B CB  1 
ATOM   8334  C CG1 . VAL B 1 372 ? -56.481 35.514  -31.002  1.00 166.17 ? 381 VAL B CG1 1 
ATOM   8335  C CG2 . VAL B 1 372 ? -57.177 33.348  -32.050  1.00 164.39 ? 381 VAL B CG2 1 
ATOM   8336  N N   . LEU B 1 373 ? -53.178 34.903  -30.040  1.00 151.11 ? 382 LEU B N   1 
ATOM   8337  C CA  . LEU B 1 373 ? -52.363 35.617  -29.063  1.00 151.11 ? 382 LEU B CA  1 
ATOM   8338  C C   . LEU B 1 373 ? -52.973 36.955  -28.661  1.00 151.11 ? 382 LEU B C   1 
ATOM   8339  O O   . LEU B 1 373 ? -53.548 37.661  -29.489  1.00 151.11 ? 382 LEU B O   1 
ATOM   8340  C CB  . LEU B 1 373 ? -50.941 35.829  -29.590  1.00 151.11 ? 382 LEU B CB  1 
ATOM   8341  C CG  . LEU B 1 373 ? -49.957 34.669  -29.418  1.00 151.11 ? 382 LEU B CG  1 
ATOM   8342  C CD1 . LEU B 1 373 ? -50.476 33.411  -30.095  1.00 151.11 ? 382 LEU B CD1 1 
ATOM   8343  C CD2 . LEU B 1 373 ? -48.587 35.048  -29.958  1.00 151.11 ? 382 LEU B CD2 1 
ATOM   8344  N N   . THR B 1 374 ? -52.844 37.293  -27.382  1.00 178.43 ? 383 THR B N   1 
ATOM   8345  C CA  . THR B 1 374 ? -53.299 38.579  -26.873  1.00 178.43 ? 383 THR B CA  1 
ATOM   8346  C C   . THR B 1 374 ? -52.092 39.473  -26.615  1.00 178.43 ? 383 THR B C   1 
ATOM   8347  O O   . THR B 1 374 ? -51.301 39.212  -25.708  1.00 178.43 ? 383 THR B O   1 
ATOM   8348  C CB  . THR B 1 374 ? -54.104 38.421  -25.571  1.00 178.43 ? 383 THR B CB  1 
ATOM   8349  O OG1 . THR B 1 374 ? -55.255 37.601  -25.814  1.00 178.43 ? 383 THR B OG1 1 
ATOM   8350  C CG2 . THR B 1 374 ? -54.555 39.779  -25.054  1.00 178.43 ? 383 THR B CG2 1 
ATOM   8351  N N   . GLU B 1 375 ? -51.953 40.520  -27.422  1.00 242.24 ? 384 GLU B N   1 
ATOM   8352  C CA  . GLU B 1 375 ? -50.803 41.414  -27.337  1.00 242.24 ? 384 GLU B CA  1 
ATOM   8353  C C   . GLU B 1 375 ? -50.749 42.165  -26.010  1.00 242.24 ? 384 GLU B C   1 
ATOM   8354  O O   . GLU B 1 375 ? -51.189 43.311  -25.915  1.00 242.24 ? 384 GLU B O   1 
ATOM   8355  C CB  . GLU B 1 375 ? -50.808 42.406  -28.502  1.00 242.24 ? 384 GLU B CB  1 
ATOM   8356  N N   . ASP B 1 376 ? -50.205 41.511  -24.989  1.00 258.82 ? 385 ASP B N   1 
ATOM   8357  C CA  . ASP B 1 376 ? -50.030 42.134  -23.684  1.00 258.82 ? 385 ASP B CA  1 
ATOM   8358  C C   . ASP B 1 376 ? -48.551 42.397  -23.428  1.00 258.82 ? 385 ASP B C   1 
ATOM   8359  O O   . ASP B 1 376 ? -48.089 42.351  -22.288  1.00 258.82 ? 385 ASP B O   1 
ATOM   8360  C CB  . ASP B 1 376 ? -50.605 41.243  -22.582  1.00 258.82 ? 385 ASP B CB  1 
ATOM   8361  N N   . ASP B 1 377 ? -47.814 42.673  -24.500  1.00 307.64 ? 386 ASP B N   1 
ATOM   8362  C CA  . ASP B 1 377 ? -46.377 42.896  -24.407  1.00 307.64 ? 386 ASP B CA  1 
ATOM   8363  C C   . ASP B 1 377 ? -45.968 44.220  -25.045  1.00 307.64 ? 386 ASP B C   1 
ATOM   8364  O O   . ASP B 1 377 ? -46.718 44.803  -25.828  1.00 307.64 ? 386 ASP B O   1 
ATOM   8365  C CB  . ASP B 1 377 ? -45.617 41.744  -25.069  1.00 307.64 ? 386 ASP B CB  1 
ATOM   8366  N N   . THR B 1 378 ? -44.773 44.688  -24.700  1.00 295.03 ? 387 THR B N   1 
ATOM   8367  C CA  . THR B 1 378 ? -44.225 45.905  -25.284  1.00 295.03 ? 387 THR B CA  1 
ATOM   8368  C C   . THR B 1 378 ? -43.259 45.552  -26.409  1.00 295.03 ? 387 THR B C   1 
ATOM   8369  O O   . THR B 1 378 ? -42.047 45.726  -26.277  1.00 295.03 ? 387 THR B O   1 
ATOM   8370  C CB  . THR B 1 378 ? -43.491 46.756  -24.232  1.00 295.03 ? 387 THR B CB  1 
ATOM   8371  N N   . SER B 1 379 ? -43.805 45.053  -27.513  1.00 310.97 ? 388 SER B N   1 
ATOM   8372  C CA  . SER B 1 379 ? -42.997 44.609  -28.645  1.00 310.97 ? 388 SER B CA  1 
ATOM   8373  C C   . SER B 1 379 ? -42.182 45.744  -29.260  1.00 310.97 ? 388 SER B C   1 
ATOM   8374  O O   . SER B 1 379 ? -42.216 46.880  -28.783  1.00 310.97 ? 388 SER B O   1 
ATOM   8375  C CB  . SER B 1 379 ? -43.883 43.963  -29.713  1.00 310.97 ? 388 SER B CB  1 
ATOM   8376  N N   . GLY B 1 380 ? -41.451 45.427  -30.324  1.00 261.44 ? 389 GLY B N   1 
ATOM   8377  C CA  . GLY B 1 380 ? -40.610 46.404  -30.990  1.00 261.44 ? 389 GLY B CA  1 
ATOM   8378  C C   . GLY B 1 380 ? -39.391 46.758  -30.162  1.00 261.44 ? 389 GLY B C   1 
ATOM   8379  O O   . GLY B 1 380 ? -38.910 47.891  -30.199  1.00 261.44 ? 389 GLY B O   1 
ATOM   8380  N N   . LEU B 1 381 ? -38.892 45.783  -29.409  1.00 219.37 ? 390 LEU B N   1 
ATOM   8381  C CA  . LEU B 1 381 ? -37.733 45.994  -28.549  1.00 219.37 ? 390 LEU B CA  1 
ATOM   8382  C C   . LEU B 1 381 ? -36.439 45.579  -29.242  1.00 219.37 ? 390 LEU B C   1 
ATOM   8383  O O   . LEU B 1 381 ? -36.285 44.428  -29.653  1.00 219.37 ? 390 LEU B O   1 
ATOM   8384  C CB  . LEU B 1 381 ? -37.896 45.226  -27.235  1.00 219.37 ? 390 LEU B CB  1 
ATOM   8385  N N   . GLU B 1 382 ? -35.514 46.526  -29.368  1.00 282.80 ? 391 GLU B N   1 
ATOM   8386  C CA  . GLU B 1 382 ? -34.220 46.270  -29.992  1.00 282.80 ? 391 GLU B CA  1 
ATOM   8387  C C   . GLU B 1 382 ? -34.370 45.742  -31.416  1.00 282.80 ? 391 GLU B C   1 
ATOM   8388  O O   . GLU B 1 382 ? -33.566 44.930  -31.876  1.00 282.80 ? 391 GLU B O   1 
ATOM   8389  C CB  . GLU B 1 382 ? -33.400 45.290  -29.149  1.00 282.80 ? 391 GLU B CB  1 
ATOM   8390  N N   . GLN B 1 383 ? -35.403 46.210  -32.110  1.00 294.95 ? 392 GLN B N   1 
ATOM   8391  C CA  . GLN B 1 383 ? -35.656 45.791  -33.483  1.00 294.95 ? 392 GLN B CA  1 
ATOM   8392  C C   . GLN B 1 383 ? -35.489 46.957  -34.452  1.00 294.95 ? 392 GLN B C   1 
ATOM   8393  O O   . GLN B 1 383 ? -35.371 46.758  -35.661  1.00 294.95 ? 392 GLN B O   1 
ATOM   8394  C CB  . GLN B 1 383 ? -37.060 45.196  -33.613  1.00 294.95 ? 392 GLN B CB  1 
ATOM   8395  N N   . LYS B 1 384 ? -35.482 48.172  -33.911  1.00 176.79 ? 393 LYS B N   1 
ATOM   8396  C CA  . LYS B 1 384 ? -35.316 49.373  -34.721  1.00 176.79 ? 393 LYS B CA  1 
ATOM   8397  C C   . LYS B 1 384 ? -34.048 49.286  -35.562  1.00 176.79 ? 393 LYS B C   1 
ATOM   8398  O O   . LYS B 1 384 ? -32.941 49.473  -35.057  1.00 176.79 ? 393 LYS B O   1 
ATOM   8399  C CB  . LYS B 1 384 ? -35.278 50.619  -33.835  1.00 176.79 ? 393 LYS B CB  1 
ATOM   8400  N N   . THR B 1 385 ? -34.218 48.998  -36.847  1.00 147.06 ? 394 THR B N   1 
ATOM   8401  C CA  . THR B 1 385 ? -33.090 48.848  -37.757  1.00 147.06 ? 394 THR B CA  1 
ATOM   8402  C C   . THR B 1 385 ? -32.351 50.168  -37.962  1.00 147.06 ? 394 THR B C   1 
ATOM   8403  O O   . THR B 1 385 ? -32.969 51.227  -38.072  1.00 147.06 ? 394 THR B O   1 
ATOM   8404  C CB  . THR B 1 385 ? -33.542 48.305  -39.127  1.00 147.06 ? 394 THR B CB  1 
ATOM   8405  O OG1 . THR B 1 385 ? -34.481 49.212  -39.717  1.00 147.06 ? 394 THR B OG1 1 
ATOM   8406  C CG2 . THR B 1 385 ? -34.193 46.939  -38.969  1.00 147.06 ? 394 THR B CG2 1 
ATOM   8407  N N   . VAL B 1 386 ? -31.025 50.096  -38.015  1.00 140.28 ? 395 VAL B N   1 
ATOM   8408  C CA  . VAL B 1 386 ? -30.201 51.277  -38.236  1.00 140.28 ? 395 VAL B CA  1 
ATOM   8409  C C   . VAL B 1 386 ? -30.355 51.792  -39.664  1.00 140.28 ? 395 VAL B C   1 
ATOM   8410  O O   . VAL B 1 386 ? -30.188 51.044  -40.628  1.00 140.28 ? 395 VAL B O   1 
ATOM   8411  C CB  . VAL B 1 386 ? -28.714 50.987  -37.956  1.00 140.28 ? 395 VAL B CB  1 
ATOM   8412  C CG1 . VAL B 1 386 ? -27.862 52.203  -38.283  1.00 140.28 ? 395 VAL B CG1 1 
ATOM   8413  C CG2 . VAL B 1 386 ? -28.517 50.567  -36.507  1.00 140.28 ? 395 VAL B CG2 1 
ATOM   8414  N N   . VAL B 1 387 ? -30.676 53.075  -39.791  1.00 134.12 ? 396 VAL B N   1 
ATOM   8415  C CA  . VAL B 1 387 ? -30.853 53.697  -41.097  1.00 134.61 ? 396 VAL B CA  1 
ATOM   8416  C C   . VAL B 1 387 ? -29.509 54.102  -41.695  1.00 132.95 ? 396 VAL B C   1 
ATOM   8417  O O   . VAL B 1 387 ? -28.869 55.042  -41.225  1.00 131.85 ? 396 VAL B O   1 
ATOM   8418  C CB  . VAL B 1 387 ? -31.763 54.934  -41.007  1.00 135.65 ? 396 VAL B CB  1 
ATOM   8419  C CG1 . VAL B 1 387 ? -31.954 55.557  -42.381  1.00 136.52 ? 396 VAL B CG1 1 
ATOM   8420  C CG2 . VAL B 1 387 ? -33.103 54.562  -40.395  1.00 137.49 ? 396 VAL B CG2 1 
ATOM   8421  N N   . VAL B 1 388 ? -29.086 53.384  -42.730  1.00 131.48 ? 397 VAL B N   1 
ATOM   8422  C CA  . VAL B 1 388 ? -27.814 53.664  -43.383  1.00 130.16 ? 397 VAL B CA  1 
ATOM   8423  C C   . VAL B 1 388 ? -28.018 54.463  -44.663  1.00 130.97 ? 397 VAL B C   1 
ATOM   8424  O O   . VAL B 1 388 ? -28.608 53.972  -45.625  1.00 132.42 ? 397 VAL B O   1 
ATOM   8425  C CB  . VAL B 1 388 ? -27.059 52.367  -43.722  1.00 129.83 ? 397 VAL B CB  1 
ATOM   8426  C CG1 . VAL B 1 388 ? -25.743 52.685  -44.414  1.00 128.64 ? 397 VAL B CG1 1 
ATOM   8427  C CG2 . VAL B 1 388 ? -26.822 51.550  -42.464  1.00 129.33 ? 397 VAL B CG2 1 
ATOM   8428  N N   . THR B 1 389 ? -27.527 55.698  -44.670  1.00 132.35 ? 398 THR B N   1 
ATOM   8429  C CA  . THR B 1 389 ? -27.624 56.545  -45.851  1.00 133.28 ? 398 THR B CA  1 
ATOM   8430  C C   . THR B 1 389 ? -26.385 56.397  -46.730  1.00 132.45 ? 398 THR B C   1 
ATOM   8431  O O   . THR B 1 389 ? -25.268 56.258  -46.230  1.00 130.89 ? 398 THR B O   1 
ATOM   8432  C CB  . THR B 1 389 ? -27.814 58.027  -45.476  1.00 133.54 ? 398 THR B CB  1 
ATOM   8433  O OG1 . THR B 1 389 ? -27.981 58.806  -46.667  1.00 134.86 ? 398 THR B OG1 1 
ATOM   8434  C CG2 . THR B 1 389 ? -26.610 58.543  -44.702  1.00 131.83 ? 398 THR B CG2 1 
ATOM   8435  N N   . THR B 1 390 ? -26.591 56.422  -48.042  1.00 131.43 ? 399 THR B N   1 
ATOM   8436  C CA  . THR B 1 390 ? -25.494 56.287  -48.992  1.00 131.00 ? 399 THR B CA  1 
ATOM   8437  C C   . THR B 1 390 ? -25.862 56.900  -50.339  1.00 132.80 ? 399 THR B C   1 
ATOM   8438  O O   . THR B 1 390 ? -27.038 57.100  -50.640  1.00 134.59 ? 399 THR B O   1 
ATOM   8439  C CB  . THR B 1 390 ? -25.101 54.811  -49.191  1.00 130.71 ? 399 THR B CB  1 
ATOM   8440  O OG1 . THR B 1 390 ? -23.963 54.728  -50.057  1.00 130.33 ? 399 THR B OG1 1 
ATOM   8441  C CG2 . THR B 1 390 ? -26.255 54.029  -49.796  1.00 132.68 ? 399 THR B CG2 1 
ATOM   8442  N N   . ILE B 1 391 ? -24.848 57.198  -51.145  1.00 145.29 ? 400 ILE B N   1 
ATOM   8443  C CA  . ILE B 1 391 ? -25.064 57.813  -52.448  1.00 147.15 ? 400 ILE B CA  1 
ATOM   8444  C C   . ILE B 1 391 ? -24.828 56.811  -53.576  1.00 148.01 ? 400 ILE B C   1 
ATOM   8445  O O   . ILE B 1 391 ? -24.041 55.876  -53.433  1.00 146.83 ? 400 ILE B O   1 
ATOM   8446  C CB  . ILE B 1 391 ? -24.146 59.035  -52.651  1.00 146.82 ? 400 ILE B CB  1 
ATOM   8447  C CG1 . ILE B 1 391 ? -24.562 59.819  -53.897  1.00 149.19 ? 400 ILE B CG1 1 
ATOM   8448  C CG2 . ILE B 1 391 ? -22.688 58.601  -52.741  1.00 145.30 ? 400 ILE B CG2 1 
ATOM   8449  C CD1 . ILE B 1 391 ? -23.678 61.009  -54.191  1.00 149.32 ? 400 ILE B CD1 1 
ATOM   8450  N N   . LEU B 1 392 ? -25.520 57.010  -54.693  1.00 134.83 ? 401 LEU B N   1 
ATOM   8451  C CA  . LEU B 1 392 ? -25.351 56.153  -55.861  1.00 136.12 ? 401 LEU B CA  1 
ATOM   8452  C C   . LEU B 1 392 ? -24.116 56.558  -56.659  1.00 135.87 ? 401 LEU B C   1 
ATOM   8453  O O   . LEU B 1 392 ? -24.181 57.440  -57.515  1.00 137.46 ? 401 LEU B O   1 
ATOM   8454  C CB  . LEU B 1 392 ? -26.592 56.208  -56.753  1.00 139.11 ? 401 LEU B CB  1 
ATOM   8455  C CG  . LEU B 1 392 ? -27.853 55.535  -56.210  1.00 140.02 ? 401 LEU B CG  1 
ATOM   8456  C CD1 . LEU B 1 392 ? -29.046 55.828  -57.105  1.00 143.30 ? 401 LEU B CD1 1 
ATOM   8457  C CD2 . LEU B 1 392 ? -27.639 54.036  -56.070  1.00 139.56 ? 401 LEU B CD2 1 
ATOM   8458  N N   . GLU B 1 393 ? -22.993 55.908  -56.373  1.00 168.14 ? 402 GLU B N   1 
ATOM   8459  C CA  . GLU B 1 393 ? -21.739 56.208  -57.052  1.00 167.90 ? 402 GLU B CA  1 
ATOM   8460  C C   . GLU B 1 393 ? -20.954 54.928  -57.313  1.00 167.43 ? 402 GLU B C   1 
ATOM   8461  O O   . GLU B 1 393 ? -20.529 54.251  -56.378  1.00 165.74 ? 402 GLU B O   1 
ATOM   8462  C CB  . GLU B 1 393 ? -20.898 57.174  -56.216  1.00 166.13 ? 402 GLU B CB  1 
ATOM   8463  C CG  . GLU B 1 393 ? -19.737 57.805  -56.969  1.00 166.42 ? 402 GLU B CG  1 
ATOM   8464  C CD  . GLU B 1 393 ? -20.180 58.927  -57.888  1.00 168.58 ? 402 GLU B CD  1 
ATOM   8465  O OE1 . GLU B 1 393 ? -19.493 59.173  -58.902  1.00 169.70 ? 402 GLU B OE1 1 
ATOM   8466  O OE2 . GLU B 1 393 ? -21.214 59.564  -57.596  1.00 169.36 ? 402 GLU B OE2 1 
ATOM   8467  N N   . SER B 1 394 ? -20.765 54.601  -58.586  1.00 137.14 ? 403 SER B N   1 
ATOM   8468  C CA  . SER B 1 394 ? -20.035 53.398  -58.968  1.00 137.16 ? 403 SER B CA  1 
ATOM   8469  C C   . SER B 1 394 ? -18.547 53.538  -58.658  1.00 135.45 ? 403 SER B C   1 
ATOM   8470  O O   . SER B 1 394 ? -17.971 54.611  -58.838  1.00 135.25 ? 403 SER B O   1 
ATOM   8471  C CB  . SER B 1 394 ? -20.234 53.104  -60.455  1.00 139.82 ? 403 SER B CB  1 
ATOM   8472  O OG  . SER B 1 394 ? -21.611 53.051  -60.783  1.00 141.78 ? 403 SER B OG  1 
ATOM   8473  N N   . PRO B 1 395 ? -17.918 52.447  -58.193  1.00 135.86 ? 404 PRO B N   1 
ATOM   8474  C CA  . PRO B 1 395 ? -18.553 51.152  -57.952  1.00 136.37 ? 404 PRO B CA  1 
ATOM   8475  C C   . PRO B 1 395 ? -18.852 50.928  -56.473  1.00 134.63 ? 404 PRO B C   1 
ATOM   8476  O O   . PRO B 1 395 ? -18.832 49.787  -56.010  1.00 134.56 ? 404 PRO B O   1 
ATOM   8477  C CB  . PRO B 1 395 ? -17.466 50.188  -58.404  1.00 136.68 ? 404 PRO B CB  1 
ATOM   8478  C CG  . PRO B 1 395 ? -16.207 50.854  -57.897  1.00 134.90 ? 404 PRO B CG  1 
ATOM   8479  C CD  . PRO B 1 395 ? -16.463 52.363  -57.967  1.00 134.65 ? 404 PRO B CD  1 
ATOM   8480  N N   . TYR B 1 396 ? -19.122 52.005  -55.743  1.00 131.18 ? 405 TYR B N   1 
ATOM   8481  C CA  . TYR B 1 396 ? -19.392 51.912  -54.312  1.00 129.65 ? 405 TYR B CA  1 
ATOM   8482  C C   . TYR B 1 396 ? -20.811 51.424  -54.040  1.00 130.62 ? 405 TYR B C   1 
ATOM   8483  O O   . TYR B 1 396 ? -21.017 50.476  -53.282  1.00 130.33 ? 405 TYR B O   1 
ATOM   8484  C CB  . TYR B 1 396 ? -19.158 53.262  -53.635  1.00 128.38 ? 405 TYR B CB  1 
ATOM   8485  C CG  . TYR B 1 396 ? -17.745 53.777  -53.780  1.00 127.59 ? 405 TYR B CG  1 
ATOM   8486  C CD1 . TYR B 1 396 ? -16.777 53.482  -52.829  1.00 126.13 ? 405 TYR B CD1 1 
ATOM   8487  C CD2 . TYR B 1 396 ? -17.377 54.557  -54.868  1.00 128.58 ? 405 TYR B CD2 1 
ATOM   8488  C CE1 . TYR B 1 396 ? -15.483 53.951  -52.957  1.00 125.69 ? 405 TYR B CE1 1 
ATOM   8489  C CE2 . TYR B 1 396 ? -16.086 55.030  -55.005  1.00 128.11 ? 405 TYR B CE2 1 
ATOM   8490  C CZ  . TYR B 1 396 ? -15.143 54.724  -54.046  1.00 126.67 ? 405 TYR B CZ  1 
ATOM   8491  O OH  . TYR B 1 396 ? -13.857 55.193  -54.177  1.00 126.46 ? 405 TYR B OH  1 
ATOM   8492  N N   . VAL B 1 397 ? -21.787 52.081  -54.657  1.00 131.13 ? 406 VAL B N   1 
ATOM   8493  C CA  . VAL B 1 397 ? -23.183 51.678  -54.532  1.00 132.50 ? 406 VAL B CA  1 
ATOM   8494  C C   . VAL B 1 397 ? -23.900 51.788  -55.873  1.00 135.06 ? 406 VAL B C   1 
ATOM   8495  O O   . VAL B 1 397 ? -24.097 52.886  -56.395  1.00 135.71 ? 406 VAL B O   1 
ATOM   8496  C CB  . VAL B 1 397 ? -23.930 52.523  -53.484  1.00 131.73 ? 406 VAL B CB  1 
ATOM   8497  C CG1 . VAL B 1 397 ? -25.411 52.174  -53.484  1.00 133.55 ? 406 VAL B CG1 1 
ATOM   8498  C CG2 . VAL B 1 397 ? -23.327 52.312  -52.104  1.00 129.56 ? 406 VAL B CG2 1 
ATOM   8499  N N   . MET B 1 398 ? -24.287 50.644  -56.426  1.00 140.55 ? 407 MET B N   1 
ATOM   8500  C CA  . MET B 1 398 ? -24.938 50.605  -57.729  1.00 143.36 ? 407 MET B CA  1 
ATOM   8501  C C   . MET B 1 398 ? -26.212 49.774  -57.676  1.00 145.45 ? 407 MET B C   1 
ATOM   8502  O O   . MET B 1 398 ? -26.377 48.930  -56.795  1.00 144.84 ? 407 MET B O   1 
ATOM   8503  C CB  . MET B 1 398 ? -23.989 50.023  -58.777  1.00 144.14 ? 407 MET B CB  1 
ATOM   8504  C CG  . MET B 1 398 ? -22.630 50.700  -58.833  1.00 142.29 ? 407 MET B CG  1 
ATOM   8505  S SD  . MET B 1 398 ? -21.438 49.768  -59.814  1.00 143.07 ? 407 MET B SD  1 
ATOM   8506  C CE  . MET B 1 398 ? -21.378 48.228  -58.902  1.00 142.51 ? 407 MET B CE  1 
ATOM   8507  N N   . MET B 1 399 ? -27.110 50.016  -58.624  1.00 174.25 ? 408 MET B N   1 
ATOM   8508  C CA  . MET B 1 399 ? -28.340 49.243  -58.724  1.00 176.82 ? 408 MET B CA  1 
ATOM   8509  C C   . MET B 1 399 ? -28.060 47.888  -59.362  1.00 178.47 ? 408 MET B C   1 
ATOM   8510  O O   . MET B 1 399 ? -27.560 47.814  -60.484  1.00 179.75 ? 408 MET B O   1 
ATOM   8511  C CB  . MET B 1 399 ? -29.385 50.003  -59.543  1.00 179.56 ? 408 MET B CB  1 
ATOM   8512  C CG  . MET B 1 399 ? -29.795 51.336  -58.942  1.00 178.51 ? 408 MET B CG  1 
ATOM   8513  S SD  . MET B 1 399 ? -30.645 51.157  -57.361  1.00 177.33 ? 408 MET B SD  1 
ATOM   8514  C CE  . MET B 1 399 ? -32.123 50.279  -57.865  1.00 181.39 ? 408 MET B CE  1 
ATOM   8515  N N   . LYS B 1 400 ? -28.381 46.818  -58.641  1.00 153.98 ? 409 LYS B N   1 
ATOM   8516  C CA  . LYS B 1 400 ? -28.175 45.466  -59.147  1.00 155.87 ? 409 LYS B CA  1 
ATOM   8517  C C   . LYS B 1 400 ? -28.905 45.269  -60.472  1.00 159.71 ? 409 LYS B C   1 
ATOM   8518  O O   . LYS B 1 400 ? -29.850 45.995  -60.782  1.00 161.22 ? 409 LYS B O   1 
ATOM   8519  C CB  . LYS B 1 400 ? -28.649 44.431  -58.125  1.00 156.07 ? 409 LYS B CB  1 
ATOM   8520  N N   . ALA B 1 401 ? -28.458 44.288  -61.250  1.00 160.80 ? 410 ALA B N   1 
ATOM   8521  C CA  . ALA B 1 401 ? -29.054 44.004  -62.551  1.00 164.78 ? 410 ALA B CA  1 
ATOM   8522  C C   . ALA B 1 401 ? -30.576 43.934  -62.467  1.00 167.54 ? 410 ALA B C   1 
ATOM   8523  O O   . ALA B 1 401 ? -31.277 44.819  -62.958  1.00 168.89 ? 410 ALA B O   1 
ATOM   8524  C CB  . ALA B 1 401 ? -28.492 42.711  -63.121  1.00 166.62 ? 410 ALA B CB  1 
ATOM   8525  N N   . ASN B 1 402 ? -31.080 42.876  -61.842  1.00 195.94 ? 411 ASN B N   1 
ATOM   8526  C CA  . ASN B 1 402 ? -32.516 42.700  -61.670  1.00 198.75 ? 411 ASN B CA  1 
ATOM   8527  C C   . ASN B 1 402 ? -33.022 43.347  -60.384  1.00 196.36 ? 411 ASN B C   1 
ATOM   8528  O O   . ASN B 1 402 ? -33.650 42.691  -59.553  1.00 196.99 ? 411 ASN B O   1 
ATOM   8529  C CB  . ASN B 1 402 ? -32.882 41.214  -61.698  1.00 201.78 ? 411 ASN B CB  1 
ATOM   8530  C CG  . ASN B 1 402 ? -32.068 40.391  -60.716  1.00 199.43 ? 411 ASN B CG  1 
ATOM   8531  O OD1 . ASN B 1 402 ? -31.229 40.921  -59.987  1.00 195.50 ? 411 ASN B OD1 1 
ATOM   8532  N ND2 . ASN B 1 402 ? -32.313 39.086  -60.693  1.00 202.14 ? 411 ASN B ND2 1 
ATOM   8533  N N   . HIS B 1 403 ? -32.745 44.638  -60.229  1.00 195.92 ? 412 HIS B N   1 
ATOM   8534  C CA  . HIS B 1 403 ? -33.145 45.371  -59.032  1.00 193.63 ? 412 HIS B CA  1 
ATOM   8535  C C   . HIS B 1 403 ? -34.660 45.531  -58.956  1.00 196.54 ? 412 HIS B C   1 
ATOM   8536  O O   . HIS B 1 403 ? -35.218 45.734  -57.877  1.00 195.55 ? 412 HIS B O   1 
ATOM   8537  C CB  . HIS B 1 403 ? -32.471 46.744  -58.993  1.00 190.77 ? 412 HIS B CB  1 
ATOM   8538  C CG  . HIS B 1 403 ? -32.979 47.696  -60.031  1.00 192.91 ? 412 HIS B CG  1 
ATOM   8539  N ND1 . HIS B 1 403 ? -34.068 48.514  -59.822  1.00 194.13 ? 412 HIS B ND1 1 
ATOM   8540  C CD2 . HIS B 1 403 ? -32.545 47.960  -61.287  1.00 194.30 ? 412 HIS B CD2 1 
ATOM   8541  C CE1 . HIS B 1 403 ? -34.284 49.242  -60.904  1.00 196.24 ? 412 HIS B CE1 1 
ATOM   8542  N NE2 . HIS B 1 403 ? -33.375 48.925  -61.807  1.00 196.37 ? 412 HIS B NE2 1 
ATOM   8543  N N   . ALA B 1 404 ? -35.319 45.443  -60.106  1.00 167.41 ? 413 ALA B N   1 
ATOM   8544  C CA  . ALA B 1 404 ? -36.770 45.575  -60.168  1.00 170.79 ? 413 ALA B CA  1 
ATOM   8545  C C   . ALA B 1 404 ? -37.458 44.345  -59.587  1.00 172.74 ? 413 ALA B C   1 
ATOM   8546  O O   . ALA B 1 404 ? -38.600 44.417  -59.132  1.00 174.60 ? 413 ALA B O   1 
ATOM   8547  C CB  . ALA B 1 404 ? -37.220 45.810  -61.602  1.00 174.64 ? 413 ALA B CB  1 
ATOM   8548  N N   . ALA B 1 405 ? -36.756 43.217  -59.606  1.00 212.79 ? 414 ALA B N   1 
ATOM   8549  C CA  . ALA B 1 405 ? -37.294 41.968  -59.079  1.00 214.86 ? 414 ALA B CA  1 
ATOM   8550  C C   . ALA B 1 405 ? -36.813 41.722  -57.653  1.00 211.39 ? 414 ALA B C   1 
ATOM   8551  O O   . ALA B 1 405 ? -37.050 40.657  -57.083  1.00 212.64 ? 414 ALA B O   1 
ATOM   8552  C CB  . ALA B 1 405 ? -36.911 40.804  -59.977  1.00 217.54 ? 414 ALA B CB  1 
ATOM   8553  N N   . LEU B 1 406 ? -36.136 42.713  -57.084  1.00 169.53 ? 415 LEU B N   1 
ATOM   8554  C CA  . LEU B 1 406 ? -35.614 42.602  -55.727  1.00 166.20 ? 415 LEU B CA  1 
ATOM   8555  C C   . LEU B 1 406 ? -36.132 43.727  -54.840  1.00 164.37 ? 415 LEU B C   1 
ATOM   8556  O O   . LEU B 1 406 ? -36.714 44.697  -55.326  1.00 165.23 ? 415 LEU B O   1 
ATOM   8557  C CB  . LEU B 1 406 ? -34.085 42.605  -55.740  1.00 162.92 ? 415 LEU B CB  1 
ATOM   8558  C CG  . LEU B 1 406 ? -33.409 41.398  -56.392  1.00 164.39 ? 415 LEU B CG  1 
ATOM   8559  C CD1 . LEU B 1 406 ? -31.906 41.609  -56.484  1.00 161.23 ? 415 LEU B CD1 1 
ATOM   8560  C CD2 . LEU B 1 406 ? -33.731 40.124  -55.625  1.00 165.91 ? 415 LEU B CD2 1 
ATOM   8561  N N   . ALA B 1 407 ? -35.913 43.590  -53.537  1.00 182.99 ? 416 ALA B N   1 
ATOM   8562  C CA  . ALA B 1 407 ? -36.347 44.595  -52.575  1.00 181.25 ? 416 ALA B CA  1 
ATOM   8563  C C   . ALA B 1 407 ? -35.376 44.685  -51.403  1.00 177.48 ? 416 ALA B C   1 
ATOM   8564  O O   . ALA B 1 407 ? -34.506 43.830  -51.236  1.00 176.58 ? 416 ALA B O   1 
ATOM   8565  C CB  . ALA B 1 407 ? -37.751 44.285  -52.081  1.00 184.11 ? 416 ALA B CB  1 
ATOM   8566  N N   . GLY B 1 408 ? -35.530 45.729  -50.594  1.00 162.01 ? 417 GLY B N   1 
ATOM   8567  C CA  . GLY B 1 408 ? -34.688 45.920  -49.429  1.00 158.73 ? 417 GLY B CA  1 
ATOM   8568  C C   . GLY B 1 408 ? -33.252 46.250  -49.785  1.00 156.03 ? 417 GLY B C   1 
ATOM   8569  O O   . GLY B 1 408 ? -32.993 47.069  -50.666  1.00 155.74 ? 417 GLY B O   1 
ATOM   8570  N N   . ASN B 1 409 ? -32.315 45.606  -49.097  1.00 153.19 ? 418 ASN B N   1 
ATOM   8571  C CA  . ASN B 1 409 ? -30.895 45.853  -49.317  1.00 150.74 ? 418 ASN B CA  1 
ATOM   8572  C C   . ASN B 1 409 ? -30.335 45.037  -50.477  1.00 151.96 ? 418 ASN B C   1 
ATOM   8573  O O   . ASN B 1 409 ? -29.246 45.318  -50.977  1.00 150.47 ? 418 ASN B O   1 
ATOM   8574  C CB  . ASN B 1 409 ? -30.100 45.565  -48.042  1.00 148.57 ? 418 ASN B CB  1 
ATOM   8575  C CG  . ASN B 1 409 ? -30.583 46.379  -46.857  1.00 147.43 ? 418 ASN B CG  1 
ATOM   8576  O OD1 . ASN B 1 409 ? -31.434 47.257  -46.996  1.00 148.03 ? 418 ASN B OD1 1 
ATOM   8577  N ND2 . ASN B 1 409 ? -30.039 46.090  -45.680  1.00 146.02 ? 418 ASN B ND2 1 
ATOM   8578  N N   . GLU B 1 410 ? -31.087 44.026  -50.901  1.00 161.12 ? 419 GLU B N   1 
ATOM   8579  C CA  . GLU B 1 410 ? -30.659 43.158  -51.993  1.00 162.83 ? 419 GLU B CA  1 
ATOM   8580  C C   . GLU B 1 410 ? -30.657 43.899  -53.327  1.00 163.55 ? 419 GLU B C   1 
ATOM   8581  O O   . GLU B 1 410 ? -30.069 43.436  -54.304  1.00 164.48 ? 419 GLU B O   1 
ATOM   8582  C CB  . GLU B 1 410 ? -31.559 41.924  -52.077  1.00 166.28 ? 419 GLU B CB  1 
ATOM   8583  N N   . ARG B 1 411 ? -31.317 45.052  -53.357  1.00 152.09 ? 420 ARG B N   1 
ATOM   8584  C CA  . ARG B 1 411 ? -31.415 45.851  -54.572  1.00 153.08 ? 420 ARG B CA  1 
ATOM   8585  C C   . ARG B 1 411 ? -30.068 46.441  -54.972  1.00 150.70 ? 420 ARG B C   1 
ATOM   8586  O O   . ARG B 1 411 ? -29.806 46.668  -56.153  1.00 151.81 ? 420 ARG B O   1 
ATOM   8587  C CB  . ARG B 1 411 ? -32.432 46.980  -54.389  1.00 153.56 ? 420 ARG B CB  1 
ATOM   8588  C CG  . ARG B 1 411 ? -33.847 46.510  -54.109  1.00 156.36 ? 420 ARG B CG  1 
ATOM   8589  C CD  . ARG B 1 411 ? -34.778 47.689  -53.875  1.00 156.79 ? 420 ARG B CD  1 
ATOM   8590  N NE  . ARG B 1 411 ? -34.358 48.498  -52.735  1.00 153.62 ? 420 ARG B NE  1 
ATOM   8591  C CZ  . ARG B 1 411 ? -34.968 49.612  -52.342  1.00 153.49 ? 420 ARG B CZ  1 
ATOM   8592  N NH1 . ARG B 1 411 ? -36.032 50.055  -52.998  1.00 156.35 ? 420 ARG B NH1 1 
ATOM   8593  N NH2 . ARG B 1 411 ? -34.515 50.284  -51.292  1.00 150.75 ? 420 ARG B NH2 1 
ATOM   8594  N N   . TYR B 1 412 ? -29.214 46.688  -53.984  1.00 148.48 ? 421 TYR B N   1 
ATOM   8595  C CA  . TYR B 1 412 ? -27.954 47.380  -54.228  1.00 146.22 ? 421 TYR B CA  1 
ATOM   8596  C C   . TYR B 1 412 ? -26.740 46.459  -54.144  1.00 145.21 ? 421 TYR B C   1 
ATOM   8597  O O   . TYR B 1 412 ? -26.781 45.410  -53.501  1.00 145.52 ? 421 TYR B O   1 
ATOM   8598  C CB  . TYR B 1 412 ? -27.792 48.545  -53.250  1.00 143.75 ? 421 TYR B CB  1 
ATOM   8599  C CG  . TYR B 1 412 ? -29.006 49.439  -53.163  1.00 144.83 ? 421 TYR B CG  1 
ATOM   8600  C CD1 . TYR B 1 412 ? -29.181 50.493  -54.050  1.00 145.66 ? 421 TYR B CD1 1 
ATOM   8601  C CD2 . TYR B 1 412 ? -29.980 49.228  -52.196  1.00 145.28 ? 421 TYR B CD2 1 
ATOM   8602  C CE1 . TYR B 1 412 ? -30.291 51.312  -53.975  1.00 146.95 ? 421 TYR B CE1 1 
ATOM   8603  C CE2 . TYR B 1 412 ? -31.093 50.042  -52.114  1.00 146.49 ? 421 TYR B CE2 1 
ATOM   8604  C CZ  . TYR B 1 412 ? -31.243 51.082  -53.006  1.00 147.34 ? 421 TYR B CZ  1 
ATOM   8605  O OH  . TYR B 1 412 ? -32.350 51.897  -52.929  1.00 148.83 ? 421 TYR B OH  1 
ATOM   8606  N N   . GLU B 1 413 ? -25.661 46.869  -54.804  1.00 142.28 ? 422 GLU B N   1 
ATOM   8607  C CA  . GLU B 1 413 ? -24.405 46.132  -54.780  1.00 141.37 ? 422 GLU B CA  1 
ATOM   8608  C C   . GLU B 1 413 ? -23.242 47.092  -54.995  1.00 139.41 ? 422 GLU B C   1 
ATOM   8609  O O   . GLU B 1 413 ? -23.366 48.070  -55.730  1.00 139.73 ? 422 GLU B O   1 
ATOM   8610  C CB  . GLU B 1 413 ? -24.396 45.052  -55.862  1.00 143.95 ? 422 GLU B CB  1 
ATOM   8611  C CG  . GLU B 1 413 ? -24.589 45.586  -57.272  1.00 145.67 ? 422 GLU B CG  1 
ATOM   8612  C CD  . GLU B 1 413 ? -24.311 44.541  -58.337  1.00 148.11 ? 422 GLU B CD  1 
ATOM   8613  O OE1 . GLU B 1 413 ? -24.716 44.752  -59.500  1.00 150.32 ? 422 GLU B OE1 1 
ATOM   8614  O OE2 . GLU B 1 413 ? -23.687 43.508  -58.011  1.00 148.06 ? 422 GLU B OE2 1 
ATOM   8615  N N   . GLY B 1 414 ? -22.113 46.814  -54.350  1.00 134.33 ? 423 GLY B N   1 
ATOM   8616  C CA  . GLY B 1 414 ? -20.938 47.652  -54.498  1.00 132.69 ? 423 GLY B CA  1 
ATOM   8617  C C   . GLY B 1 414 ? -19.994 47.588  -53.314  1.00 130.59 ? 423 GLY B C   1 
ATOM   8618  O O   . GLY B 1 414 ? -20.222 46.841  -52.363  1.00 130.40 ? 423 GLY B O   1 
ATOM   8619  N N   . TYR B 1 415 ? -18.929 48.381  -53.376  1.00 129.96 ? 424 TYR B N   1 
ATOM   8620  C CA  . TYR B 1 415 ? -17.921 48.409  -52.322  1.00 128.23 ? 424 TYR B CA  1 
ATOM   8621  C C   . TYR B 1 415 ? -18.527 48.782  -50.973  1.00 127.09 ? 424 TYR B C   1 
ATOM   8622  O O   . TYR B 1 415 ? -18.317 48.093  -49.976  1.00 126.64 ? 424 TYR B O   1 
ATOM   8623  C CB  . TYR B 1 415 ? -16.800 49.389  -52.680  1.00 127.35 ? 424 TYR B CB  1 
ATOM   8624  C CG  . TYR B 1 415 ? -15.723 49.506  -51.625  1.00 125.86 ? 424 TYR B CG  1 
ATOM   8625  C CD1 . TYR B 1 415 ? -15.822 50.441  -50.603  1.00 124.57 ? 424 TYR B CD1 1 
ATOM   8626  C CD2 . TYR B 1 415 ? -14.606 48.683  -51.651  1.00 126.04 ? 424 TYR B CD2 1 
ATOM   8627  C CE1 . TYR B 1 415 ? -14.840 50.551  -49.637  1.00 123.53 ? 424 TYR B CE1 1 
ATOM   8628  C CE2 . TYR B 1 415 ? -13.618 48.786  -50.689  1.00 125.01 ? 424 TYR B CE2 1 
ATOM   8629  C CZ  . TYR B 1 415 ? -13.740 49.722  -49.685  1.00 123.77 ? 424 TYR B CZ  1 
ATOM   8630  O OH  . TYR B 1 415 ? -12.760 49.830  -48.726  1.00 123.05 ? 424 TYR B OH  1 
ATOM   8631  N N   . CYS B 1 416 ? -19.278 49.878  -50.948  1.00 135.66 ? 425 CYS B N   1 
ATOM   8632  C CA  . CYS B 1 416 ? -19.895 50.351  -49.714  1.00 134.77 ? 425 CYS B CA  1 
ATOM   8633  C C   . CYS B 1 416 ? -21.018 49.431  -49.250  1.00 135.72 ? 425 CYS B C   1 
ATOM   8634  O O   . CYS B 1 416 ? -21.264 49.300  -48.052  1.00 135.10 ? 425 CYS B O   1 
ATOM   8635  C CB  . CYS B 1 416 ? -20.414 51.779  -49.883  1.00 134.64 ? 425 CYS B CB  1 
ATOM   8636  S SG  . CYS B 1 416 ? -19.111 53.025  -50.014  1.00 133.55 ? 425 CYS B SG  1 
ATOM   8637  N N   . VAL B 1 417 ? -21.698 48.799  -50.200  1.00 138.26 ? 426 VAL B N   1 
ATOM   8638  C CA  . VAL B 1 417 ? -22.765 47.861  -49.871  1.00 139.62 ? 426 VAL B CA  1 
ATOM   8639  C C   . VAL B 1 417 ? -22.204 46.681  -49.085  1.00 139.48 ? 426 VAL B C   1 
ATOM   8640  O O   . VAL B 1 417 ? -22.814 46.218  -48.121  1.00 139.74 ? 426 VAL B O   1 
ATOM   8641  C CB  . VAL B 1 417 ? -23.480 47.344  -51.132  1.00 141.94 ? 426 VAL B CB  1 
ATOM   8642  C CG1 . VAL B 1 417 ? -24.546 46.325  -50.758  1.00 143.66 ? 426 VAL B CG1 1 
ATOM   8643  C CG2 . VAL B 1 417 ? -24.092 48.501  -51.906  1.00 142.47 ? 426 VAL B CG2 1 
ATOM   8644  N N   . ASP B 1 418 ? -21.037 46.201  -49.503  1.00 131.11 ? 427 ASP B N   1 
ATOM   8645  C CA  . ASP B 1 418 ? -20.358 45.121  -48.800  1.00 131.19 ? 427 ASP B CA  1 
ATOM   8646  C C   . ASP B 1 418 ? -19.747 45.638  -47.504  1.00 129.36 ? 427 ASP B C   1 
ATOM   8647  O O   . ASP B 1 418 ? -19.768 44.955  -46.481  1.00 129.54 ? 427 ASP B O   1 
ATOM   8648  C CB  . ASP B 1 418 ? -19.272 44.499  -49.680  1.00 131.80 ? 427 ASP B CB  1 
ATOM   8649  C CG  . ASP B 1 418 ? -19.842 43.710  -50.844  1.00 134.10 ? 427 ASP B CG  1 
ATOM   8650  O OD1 . ASP B 1 418 ? -19.055 43.059  -51.565  1.00 135.01 ? 427 ASP B OD1 1 
ATOM   8651  O OD2 . ASP B 1 418 ? -21.076 43.737  -51.035  1.00 135.21 ? 427 ASP B OD2 1 
ATOM   8652  N N   . LEU B 1 419 ? -19.204 46.850  -47.556  1.00 133.77 ? 428 LEU B N   1 
ATOM   8653  C CA  . LEU B 1 419 ? -18.598 47.467  -46.383  1.00 132.26 ? 428 LEU B CA  1 
ATOM   8654  C C   . LEU B 1 419 ? -19.634 47.670  -45.285  1.00 132.13 ? 428 LEU B C   1 
ATOM   8655  O O   . LEU B 1 419 ? -19.313 47.620  -44.098  1.00 131.56 ? 428 LEU B O   1 
ATOM   8656  C CB  . LEU B 1 419 ? -17.952 48.802  -46.752  1.00 131.13 ? 428 LEU B CB  1 
ATOM   8657  C CG  . LEU B 1 419 ? -17.256 49.550  -45.613  1.00 129.85 ? 428 LEU B CG  1 
ATOM   8658  C CD1 . LEU B 1 419 ? -16.247 48.651  -44.917  1.00 129.87 ? 428 LEU B CD1 1 
ATOM   8659  C CD2 . LEU B 1 419 ? -16.588 50.815  -46.131  1.00 129.18 ? 428 LEU B CD2 1 
ATOM   8660  N N   . ALA B 1 420 ? -20.880 47.896  -45.690  1.00 125.38 ? 429 ALA B N   1 
ATOM   8661  C CA  . ALA B 1 420 ? -21.974 48.074  -44.744  1.00 125.57 ? 429 ALA B CA  1 
ATOM   8662  C C   . ALA B 1 420 ? -22.230 46.786  -43.972  1.00 126.57 ? 429 ALA B C   1 
ATOM   8663  O O   . ALA B 1 420 ? -22.311 46.792  -42.745  1.00 126.21 ? 429 ALA B O   1 
ATOM   8664  C CB  . ALA B 1 420 ? -23.234 48.520  -45.467  1.00 126.60 ? 429 ALA B CB  1 
ATOM   8665  N N   . ALA B 1 421 ? -22.353 45.682  -44.702  1.00 129.50 ? 430 ALA B N   1 
ATOM   8666  C CA  . ALA B 1 421 ? -22.595 44.381  -44.090  1.00 130.92 ? 430 ALA B CA  1 
ATOM   8667  C C   . ALA B 1 421 ? -21.477 44.010  -43.122  1.00 130.22 ? 430 ALA B C   1 
ATOM   8668  O O   . ALA B 1 421 ? -21.727 43.437  -42.063  1.00 130.87 ? 430 ALA B O   1 
ATOM   8669  C CB  . ALA B 1 421 ? -22.749 43.313  -45.160  1.00 132.87 ? 430 ALA B CB  1 
ATOM   8670  N N   . GLU B 1 422 ? -20.244 44.339  -43.493  1.00 135.31 ? 431 GLU B N   1 
ATOM   8671  C CA  . GLU B 1 422 ? -19.090 44.048  -42.651  1.00 134.85 ? 431 GLU B CA  1 
ATOM   8672  C C   . GLU B 1 422 ? -19.132 44.856  -41.358  1.00 133.72 ? 431 GLU B C   1 
ATOM   8673  O O   . GLU B 1 422 ? -18.935 44.315  -40.270  1.00 134.23 ? 431 GLU B O   1 
ATOM   8674  C CB  . GLU B 1 422 ? -17.788 44.324  -43.407  1.00 134.11 ? 431 GLU B CB  1 
ATOM   8675  C CG  . GLU B 1 422 ? -17.500 43.337  -44.528  1.00 135.52 ? 431 GLU B CG  1 
ATOM   8676  C CD  . GLU B 1 422 ? -17.203 41.940  -44.015  1.00 137.19 ? 431 GLU B CD  1 
ATOM   8677  O OE1 . GLU B 1 422 ? -16.996 41.783  -42.792  1.00 137.11 ? 431 GLU B OE1 1 
ATOM   8678  O OE2 . GLU B 1 422 ? -17.173 40.998  -44.837  1.00 138.82 ? 431 GLU B OE2 1 
ATOM   8679  N N   . ILE B 1 423 ? -19.392 46.153  -41.483  1.00 131.91 ? 432 ILE B N   1 
ATOM   8680  C CA  . ILE B 1 423 ? -19.493 47.026  -40.320  1.00 131.04 ? 432 ILE B CA  1 
ATOM   8681  C C   . ILE B 1 423 ? -20.620 46.570  -39.401  1.00 132.01 ? 432 ILE B C   1 
ATOM   8682  O O   . ILE B 1 423 ? -20.468 46.540  -38.179  1.00 132.06 ? 432 ILE B O   1 
ATOM   8683  C CB  . ILE B 1 423 ? -19.740 48.489  -40.730  1.00 129.95 ? 432 ILE B CB  1 
ATOM   8684  C CG1 . ILE B 1 423 ? -18.521 49.051  -41.464  1.00 129.11 ? 432 ILE B CG1 1 
ATOM   8685  C CG2 . ILE B 1 423 ? -20.059 49.338  -39.512  1.00 129.47 ? 432 ILE B CG2 1 
ATOM   8686  C CD1 . ILE B 1 423 ? -17.263 49.079  -40.623  1.00 128.67 ? 432 ILE B CD1 1 
ATOM   8687  N N   . ALA B 1 424 ? -21.749 46.208  -40.000  1.00 128.81 ? 433 ALA B N   1 
ATOM   8688  C CA  . ALA B 1 424 ? -22.916 45.773  -39.241  1.00 130.02 ? 433 ALA B CA  1 
ATOM   8689  C C   . ALA B 1 424 ? -22.656 44.459  -38.514  1.00 131.37 ? 433 ALA B C   1 
ATOM   8690  O O   . ALA B 1 424 ? -23.246 44.194  -37.468  1.00 132.21 ? 433 ALA B O   1 
ATOM   8691  C CB  . ALA B 1 424 ? -24.122 45.643  -40.157  1.00 131.16 ? 433 ALA B CB  1 
ATOM   8692  N N   . LYS B 1 425 ? -21.773 43.638  -39.073  1.00 138.32 ? 434 LYS B N   1 
ATOM   8693  C CA  . LYS B 1 425 ? -21.454 42.343  -38.483  1.00 139.95 ? 434 LYS B CA  1 
ATOM   8694  C C   . LYS B 1 425 ? -20.565 42.493  -37.252  1.00 139.46 ? 434 LYS B C   1 
ATOM   8695  O O   . LYS B 1 425 ? -20.731 41.776  -36.265  1.00 140.85 ? 434 LYS B O   1 
ATOM   8696  C CB  . LYS B 1 425 ? -20.778 41.435  -39.513  1.00 140.86 ? 434 LYS B CB  1 
ATOM   8697  N N   . HIS B 1 426 ? -19.624 43.429  -37.317  1.00 144.40 ? 435 HIS B N   1 
ATOM   8698  C CA  . HIS B 1 426 ? -18.690 43.652  -36.219  1.00 144.10 ? 435 HIS B CA  1 
ATOM   8699  C C   . HIS B 1 426 ? -19.282 44.550  -35.137  1.00 143.56 ? 435 HIS B C   1 
ATOM   8700  O O   . HIS B 1 426 ? -18.818 44.549  -33.997  1.00 143.97 ? 435 HIS B O   1 
ATOM   8701  C CB  . HIS B 1 426 ? -17.379 44.244  -36.741  1.00 142.87 ? 435 HIS B CB  1 
ATOM   8702  C CG  . HIS B 1 426 ? -16.563 43.281  -37.546  1.00 143.71 ? 435 HIS B CG  1 
ATOM   8703  N ND1 . HIS B 1 426 ? -15.548 42.528  -36.997  1.00 144.83 ? 435 HIS B ND1 1 
ATOM   8704  C CD2 . HIS B 1 426 ? -16.617 42.944  -38.856  1.00 143.87 ? 435 HIS B CD2 1 
ATOM   8705  C CE1 . HIS B 1 426 ? -15.008 41.769  -37.936  1.00 145.59 ? 435 HIS B CE1 1 
ATOM   8706  N NE2 . HIS B 1 426 ? -15.639 42.003  -39.073  1.00 145.01 ? 435 HIS B NE2 1 
ATOM   8707  N N   . CYS B 1 427 ? -20.307 45.314  -35.497  1.00 152.66 ? 436 CYS B N   1 
ATOM   8708  C CA  . CYS B 1 427 ? -20.973 46.191  -34.540  1.00 152.36 ? 436 CYS B CA  1 
ATOM   8709  C C   . CYS B 1 427 ? -22.274 45.572  -34.041  1.00 153.86 ? 436 CYS B C   1 
ATOM   8710  O O   . CYS B 1 427 ? -22.848 46.024  -33.050  1.00 154.14 ? 436 CYS B O   1 
ATOM   8711  C CB  . CYS B 1 427 ? -21.237 47.564  -35.160  1.00 150.92 ? 436 CYS B CB  1 
ATOM   8712  S SG  . CYS B 1 427 ? -19.744 48.521  -35.513  1.00 149.41 ? 436 CYS B SG  1 
ATOM   8713  N N   . GLY B 1 428 ? -22.732 44.537  -34.737  1.00 130.91 ? 437 GLY B N   1 
ATOM   8714  C CA  . GLY B 1 428 ? -23.934 43.821  -34.350  1.00 132.75 ? 437 GLY B CA  1 
ATOM   8715  C C   . GLY B 1 428 ? -25.197 44.658  -34.426  1.00 132.60 ? 437 GLY B C   1 
ATOM   8716  O O   . GLY B 1 428 ? -25.683 45.155  -33.410  1.00 132.76 ? 437 GLY B O   1 
ATOM   8717  N N   . PHE B 1 429 ? -25.732 44.813  -35.633  1.00 133.57 ? 438 PHE B N   1 
ATOM   8718  C CA  . PHE B 1 429 ? -26.980 45.542  -35.827  1.00 133.84 ? 438 PHE B CA  1 
ATOM   8719  C C   . PHE B 1 429 ? -27.554 45.315  -37.221  1.00 134.53 ? 438 PHE B C   1 
ATOM   8720  O O   . PHE B 1 429 ? -26.815 45.108  -38.184  1.00 133.99 ? 438 PHE B O   1 
ATOM   8721  C CB  . PHE B 1 429 ? -26.780 47.042  -35.580  1.00 132.10 ? 438 PHE B CB  1 
ATOM   8722  C CG  . PHE B 1 429 ? -25.884 47.712  -36.585  1.00 130.49 ? 438 PHE B CG  1 
ATOM   8723  C CD1 . PHE B 1 429 ? -26.380 48.125  -37.812  1.00 130.50 ? 438 PHE B CD1 1 
ATOM   8724  C CD2 . PHE B 1 429 ? -24.548 47.937  -36.301  1.00 129.22 ? 438 PHE B CD2 1 
ATOM   8725  C CE1 . PHE B 1 429 ? -25.559 48.741  -38.736  1.00 129.25 ? 438 PHE B CE1 1 
ATOM   8726  C CE2 . PHE B 1 429 ? -23.723 48.555  -37.221  1.00 127.96 ? 438 PHE B CE2 1 
ATOM   8727  C CZ  . PHE B 1 429 ? -24.230 48.958  -38.440  1.00 127.95 ? 438 PHE B CZ  1 
ATOM   8728  N N   . LYS B 1 430 ? -28.879 45.352  -37.317  1.00 133.65 ? 439 LYS B N   1 
ATOM   8729  C CA  . LYS B 1 430 ? -29.558 45.269  -38.603  1.00 134.65 ? 439 LYS B CA  1 
ATOM   8730  C C   . LYS B 1 430 ? -29.641 46.663  -39.212  1.00 133.31 ? 439 LYS B C   1 
ATOM   8731  O O   . LYS B 1 430 ? -29.670 47.659  -38.491  1.00 132.28 ? 439 LYS B O   1 
ATOM   8732  C CB  . LYS B 1 430 ? -30.959 44.678  -38.432  1.00 137.22 ? 439 LYS B CB  1 
ATOM   8733  N N   . TYR B 1 431 ? -29.675 46.738  -40.537  1.00 134.21 ? 440 TYR B N   1 
ATOM   8734  C CA  . TYR B 1 431 ? -29.694 48.033  -41.206  1.00 133.23 ? 440 TYR B CA  1 
ATOM   8735  C C   . TYR B 1 431 ? -30.561 48.044  -42.460  1.00 134.92 ? 440 TYR B C   1 
ATOM   8736  O O   . TYR B 1 431 ? -30.888 46.996  -43.015  1.00 136.63 ? 440 TYR B O   1 
ATOM   8737  C CB  . TYR B 1 431 ? -28.270 48.479  -41.547  1.00 131.16 ? 440 TYR B CB  1 
ATOM   8738  C CG  . TYR B 1 431 ? -27.555 47.576  -42.526  1.00 131.43 ? 440 TYR B CG  1 
ATOM   8739  C CD1 . TYR B 1 431 ? -26.849 46.463  -42.088  1.00 131.52 ? 440 TYR B CD1 1 
ATOM   8740  C CD2 . TYR B 1 431 ? -27.581 47.840  -43.889  1.00 131.84 ? 440 TYR B CD2 1 
ATOM   8741  C CE1 . TYR B 1 431 ? -26.192 45.637  -42.980  1.00 132.00 ? 440 TYR B CE1 1 
ATOM   8742  C CE2 . TYR B 1 431 ? -26.927 47.019  -44.789  1.00 132.28 ? 440 TYR B CE2 1 
ATOM   8743  C CZ  . TYR B 1 431 ? -26.234 45.919  -44.329  1.00 132.34 ? 440 TYR B CZ  1 
ATOM   8744  O OH  . TYR B 1 431 ? -25.581 45.099  -45.221  1.00 133.00 ? 440 TYR B OH  1 
ATOM   8745  N N   . LYS B 1 432 ? -30.929 49.245  -42.894  1.00 135.65 ? 441 LYS B N   1 
ATOM   8746  C CA  . LYS B 1 432 ? -31.711 49.424  -44.109  1.00 137.40 ? 441 LYS B CA  1 
ATOM   8747  C C   . LYS B 1 432 ? -31.035 50.440  -45.023  1.00 136.30 ? 441 LYS B C   1 
ATOM   8748  O O   . LYS B 1 432 ? -31.030 51.637  -44.738  1.00 135.47 ? 441 LYS B O   1 
ATOM   8749  C CB  . LYS B 1 432 ? -33.130 49.882  -43.771  1.00 139.18 ? 441 LYS B CB  1 
ATOM   8750  N N   . LEU B 1 433 ? -30.459 49.956  -46.118  1.00 152.82 ? 442 LEU B N   1 
ATOM   8751  C CA  . LEU B 1 433 ? -29.774 50.824  -47.069  1.00 152.06 ? 442 LEU B CA  1 
ATOM   8752  C C   . LEU B 1 433 ? -30.746 51.789  -47.738  1.00 153.64 ? 442 LEU B C   1 
ATOM   8753  O O   . LEU B 1 433 ? -31.737 51.372  -48.339  1.00 155.98 ? 442 LEU B O   1 
ATOM   8754  C CB  . LEU B 1 433 ? -29.042 49.996  -48.127  1.00 152.38 ? 442 LEU B CB  1 
ATOM   8755  C CG  . LEU B 1 433 ? -27.879 49.137  -47.628  1.00 150.93 ? 442 LEU B CG  1 
ATOM   8756  C CD1 . LEU B 1 433 ? -27.259 48.356  -48.776  1.00 151.68 ? 442 LEU B CD1 1 
ATOM   8757  C CD2 . LEU B 1 433 ? -26.836 50.001  -46.938  1.00 148.50 ? 442 LEU B CD2 1 
ATOM   8758  N N   . THR B 1 434 ? -30.455 53.081  -47.630  1.00 148.42 ? 443 THR B N   1 
ATOM   8759  C CA  . THR B 1 434 ? -31.296 54.109  -48.229  1.00 150.05 ? 443 THR B CA  1 
ATOM   8760  C C   . THR B 1 434 ? -30.457 55.117  -49.005  1.00 149.39 ? 443 THR B C   1 
ATOM   8761  O O   . THR B 1 434 ? -29.392 55.533  -48.548  1.00 147.35 ? 443 THR B O   1 
ATOM   8762  C CB  . THR B 1 434 ? -32.113 54.860  -47.163  1.00 150.27 ? 443 THR B CB  1 
ATOM   8763  O OG1 . THR B 1 434 ? -31.222 55.525  -46.259  1.00 148.04 ? 443 THR B OG1 1 
ATOM   8764  C CG2 . THR B 1 434 ? -32.991 53.894  -46.384  1.00 151.20 ? 443 THR B CG2 1 
ATOM   8765  N N   . ILE B 1 435 ? -30.941 55.506  -50.179  1.00 139.88 ? 444 ILE B N   1 
ATOM   8766  C CA  . ILE B 1 435 ? -30.248 56.489  -51.001  1.00 139.78 ? 444 ILE B CA  1 
ATOM   8767  C C   . ILE B 1 435 ? -30.654 57.906  -50.609  1.00 140.22 ? 444 ILE B C   1 
ATOM   8768  O O   . ILE B 1 435 ? -31.839 58.202  -50.454  1.00 142.05 ? 444 ILE B O   1 
ATOM   8769  C CB  . ILE B 1 435 ? -30.531 56.273  -52.498  1.00 142.07 ? 444 ILE B CB  1 
ATOM   8770  C CG1 . ILE B 1 435 ? -30.150 54.850  -52.910  1.00 141.99 ? 444 ILE B CG1 1 
ATOM   8771  C CG2 . ILE B 1 435 ? -29.779 57.296  -53.337  1.00 142.15 ? 444 ILE B CG2 1 
ATOM   8772  C CD1 . ILE B 1 435 ? -28.712 54.493  -52.604  1.00 139.40 ? 444 ILE B CD1 1 
ATOM   8773  N N   . VAL B 1 436 ? -29.663 58.777  -50.447  1.00 158.48 ? 445 VAL B N   1 
ATOM   8774  C CA  . VAL B 1 436 ? -29.914 60.164  -50.075  1.00 159.04 ? 445 VAL B CA  1 
ATOM   8775  C C   . VAL B 1 436 ? -30.821 60.851  -51.094  1.00 162.00 ? 445 VAL B C   1 
ATOM   8776  O O   . VAL B 1 436 ? -30.697 60.630  -52.299  1.00 163.20 ? 445 VAL B O   1 
ATOM   8777  C CB  . VAL B 1 436 ? -28.599 60.956  -49.931  1.00 157.46 ? 445 VAL B CB  1 
ATOM   8778  C CG1 . VAL B 1 436 ? -27.764 60.835  -51.197  1.00 157.67 ? 445 VAL B CG1 1 
ATOM   8779  C CG2 . VAL B 1 436 ? -28.885 62.413  -49.607  1.00 158.51 ? 445 VAL B CG2 1 
ATOM   8780  N N   . GLY B 1 437 ? -31.734 61.681  -50.599  1.00 140.89 ? 446 GLY B N   1 
ATOM   8781  C CA  . GLY B 1 437 ? -32.700 62.357  -51.445  1.00 144.06 ? 446 GLY B CA  1 
ATOM   8782  C C   . GLY B 1 437 ? -32.085 63.177  -52.563  1.00 145.14 ? 446 GLY B C   1 
ATOM   8783  O O   . GLY B 1 437 ? -32.136 62.787  -53.729  1.00 146.57 ? 446 GLY B O   1 
ATOM   8784  N N   . ASP B 1 438 ? -31.502 64.317  -52.206  1.00 187.16 ? 447 ASP B N   1 
ATOM   8785  C CA  . ASP B 1 438 ? -30.940 65.236  -53.193  1.00 188.54 ? 447 ASP B CA  1 
ATOM   8786  C C   . ASP B 1 438 ? -29.762 64.634  -53.959  1.00 187.14 ? 447 ASP B C   1 
ATOM   8787  O O   . ASP B 1 438 ? -29.342 65.168  -54.985  1.00 188.57 ? 447 ASP B O   1 
ATOM   8788  C CB  . ASP B 1 438 ? -30.530 66.554  -52.530  1.00 188.50 ? 447 ASP B CB  1 
ATOM   8789  C CG  . ASP B 1 438 ? -29.586 66.352  -51.360  1.00 185.32 ? 447 ASP B CG  1 
ATOM   8790  O OD1 . ASP B 1 438 ? -29.251 67.350  -50.688  1.00 185.30 ? 447 ASP B OD1 1 
ATOM   8791  O OD2 . ASP B 1 438 ? -29.180 65.198  -51.110  1.00 183.12 ? 447 ASP B OD2 1 
ATOM   8792  N N   . GLY B 1 439 ? -29.234 63.523  -53.456  1.00 143.40 ? 448 GLY B N   1 
ATOM   8793  C CA  . GLY B 1 439 ? -28.149 62.828  -54.124  1.00 142.15 ? 448 GLY B CA  1 
ATOM   8794  C C   . GLY B 1 439 ? -26.821 63.554  -54.036  1.00 140.88 ? 448 GLY B C   1 
ATOM   8795  O O   . GLY B 1 439 ? -25.962 63.399  -54.903  1.00 140.86 ? 448 GLY B O   1 
ATOM   8796  N N   . LYS B 1 440 ? -26.652 64.352  -52.988  1.00 140.62 ? 449 LYS B N   1 
ATOM   8797  C CA  . LYS B 1 440 ? -25.403 65.071  -52.767  1.00 139.61 ? 449 LYS B CA  1 
ATOM   8798  C C   . LYS B 1 440 ? -24.611 64.429  -51.632  1.00 136.73 ? 449 LYS B C   1 
ATOM   8799  O O   . LYS B 1 440 ? -25.126 63.579  -50.907  1.00 135.65 ? 449 LYS B O   1 
ATOM   8800  C CB  . LYS B 1 440 ? -25.674 66.544  -52.454  1.00 141.26 ? 449 LYS B CB  1 
ATOM   8801  N N   . TYR B 1 441 ? -23.354 64.834  -51.483  1.00 153.03 ? 450 TYR B N   1 
ATOM   8802  C CA  . TYR B 1 441 ? -22.495 64.283  -50.439  1.00 150.62 ? 450 TYR B CA  1 
ATOM   8803  C C   . TYR B 1 441 ? -22.683 65.005  -49.109  1.00 150.30 ? 450 TYR B C   1 
ATOM   8804  O O   . TYR B 1 441 ? -23.314 64.477  -48.193  1.00 149.49 ? 450 TYR B O   1 
ATOM   8805  C CB  . TYR B 1 441 ? -21.026 64.321  -50.867  1.00 149.95 ? 450 TYR B CB  1 
ATOM   8806  C CG  . TYR B 1 441 ? -20.670 63.279  -51.902  1.00 149.73 ? 450 TYR B CG  1 
ATOM   8807  C CD1 . TYR B 1 441 ? -20.614 63.601  -53.251  1.00 151.48 ? 450 TYR B CD1 1 
ATOM   8808  C CD2 . TYR B 1 441 ? -20.395 61.970  -51.529  1.00 148.04 ? 450 TYR B CD2 1 
ATOM   8809  C CE1 . TYR B 1 441 ? -20.290 62.650  -54.200  1.00 151.51 ? 450 TYR B CE1 1 
ATOM   8810  C CE2 . TYR B 1 441 ? -20.071 61.012  -52.470  1.00 148.10 ? 450 TYR B CE2 1 
ATOM   8811  C CZ  . TYR B 1 441 ? -20.020 61.357  -53.804  1.00 149.81 ? 450 TYR B CZ  1 
ATOM   8812  O OH  . TYR B 1 441 ? -19.697 60.406  -54.746  1.00 150.09 ? 450 TYR B OH  1 
ATOM   8813  N N   . GLY B 1 442 ? -22.132 66.210  -49.005  1.00 156.93 ? 451 GLY B N   1 
ATOM   8814  C CA  . GLY B 1 442 ? -22.241 66.985  -47.783  1.00 157.00 ? 451 GLY B CA  1 
ATOM   8815  C C   . GLY B 1 442 ? -21.626 68.367  -47.883  1.00 158.56 ? 451 GLY B C   1 
ATOM   8816  O O   . GLY B 1 442 ? -20.447 68.557  -47.586  1.00 157.90 ? 451 GLY B O   1 
ATOM   8817  N N   . ALA B 1 443 ? -22.432 69.337  -48.300  1.00 148.33 ? 452 ALA B N   1 
ATOM   8818  C CA  . ALA B 1 443 ? -21.980 70.720  -48.398  1.00 150.36 ? 452 ALA B CA  1 
ATOM   8819  C C   . ALA B 1 443 ? -22.823 71.619  -47.501  1.00 151.84 ? 452 ALA B C   1 
ATOM   8820  O O   . ALA B 1 443 ? -23.797 71.168  -46.898  1.00 151.33 ? 452 ALA B O   1 
ATOM   8821  C CB  . ALA B 1 443 ? -22.038 71.198  -49.840  1.00 152.52 ? 452 ALA B CB  1 
ATOM   8822  N N   . ARG B 1 444 ? -22.446 72.891  -47.415  1.00 144.61 ? 453 ARG B N   1 
ATOM   8823  C CA  . ARG B 1 444 ? -23.166 73.835  -46.570  1.00 146.40 ? 453 ARG B CA  1 
ATOM   8824  C C   . ARG B 1 444 ? -23.438 75.151  -47.289  1.00 149.94 ? 453 ARG B C   1 
ATOM   8825  O O   . ARG B 1 444 ? -22.534 75.966  -47.475  1.00 151.27 ? 453 ARG B O   1 
ATOM   8826  C CB  . ARG B 1 444 ? -22.393 74.096  -45.277  1.00 145.56 ? 453 ARG B CB  1 
ATOM   8827  C CG  . ARG B 1 444 ? -23.182 74.871  -44.240  1.00 147.14 ? 453 ARG B CG  1 
ATOM   8828  C CD  . ARG B 1 444 ? -22.440 74.939  -42.920  1.00 146.20 ? 453 ARG B CD  1 
ATOM   8829  N NE  . ARG B 1 444 ? -23.354 75.203  -41.816  1.00 146.92 ? 453 ARG B NE  1 
ATOM   8830  C CZ  . ARG B 1 444 ? -22.998 75.222  -40.537  1.00 146.38 ? 453 ARG B CZ  1 
ATOM   8831  N NH1 . ARG B 1 444 ? -21.738 74.993  -40.189  1.00 145.17 ? 453 ARG B NH1 1 
ATOM   8832  N NH2 . ARG B 1 444 ? -23.910 75.465  -39.608  1.00 147.27 ? 453 ARG B NH2 1 
ATOM   8833  N N   . ASP B 1 445 ? -24.689 75.352  -47.690  1.00 192.05 ? 454 ASP B N   1 
ATOM   8834  C CA  . ASP B 1 445 ? -25.098 76.592  -48.337  1.00 195.83 ? 454 ASP B CA  1 
ATOM   8835  C C   . ASP B 1 445 ? -24.784 77.778  -47.430  1.00 197.62 ? 454 ASP B C   1 
ATOM   8836  O O   . ASP B 1 445 ? -25.264 77.847  -46.299  1.00 197.31 ? 454 ASP B O   1 
ATOM   8837  C CB  . ASP B 1 445 ? -26.592 76.551  -48.665  1.00 197.53 ? 454 ASP B CB  1 
ATOM   8838  C CG  . ASP B 1 445 ? -27.031 77.710  -49.539  1.00 201.69 ? 454 ASP B CG  1 
ATOM   8839  O OD1 . ASP B 1 445 ? -26.310 78.729  -49.595  1.00 203.55 ? 454 ASP B OD1 1 
ATOM   8840  O OD2 . ASP B 1 445 ? -28.103 77.601  -50.172  1.00 203.37 ? 454 ASP B OD2 1 
ATOM   8841  N N   . ALA B 1 446 ? -23.973 78.705  -47.931  1.00 218.44 ? 455 ALA B N   1 
ATOM   8842  C CA  . ALA B 1 446 ? -23.540 79.857  -47.146  1.00 220.52 ? 455 ALA B CA  1 
ATOM   8843  C C   . ALA B 1 446 ? -24.713 80.657  -46.581  1.00 223.21 ? 455 ALA B C   1 
ATOM   8844  O O   . ALA B 1 446 ? -24.722 81.014  -45.403  1.00 223.36 ? 455 ALA B O   1 
ATOM   8845  C CB  . ALA B 1 446 ? -22.636 80.756  -47.981  1.00 223.06 ? 455 ALA B CB  1 
ATOM   8846  N N   . ASP B 1 447 ? -25.700 80.932  -47.428  1.00 336.88 ? 456 ASP B N   1 
ATOM   8847  C CA  . ASP B 1 447 ? -26.845 81.748  -47.033  1.00 339.99 ? 456 ASP B CA  1 
ATOM   8848  C C   . ASP B 1 447 ? -27.715 81.066  -45.980  1.00 338.06 ? 456 ASP B C   1 
ATOM   8849  O O   . ASP B 1 447 ? -27.748 81.487  -44.823  1.00 338.42 ? 456 ASP B O   1 
ATOM   8850  C CB  . ASP B 1 447 ? -27.689 82.115  -48.257  1.00 343.10 ? 456 ASP B CB  1 
ATOM   8851  C CG  . ASP B 1 447 ? -26.948 83.017  -49.224  1.00 346.00 ? 456 ASP B CG  1 
ATOM   8852  O OD1 . ASP B 1 447 ? -25.862 83.516  -48.862  1.00 346.07 ? 456 ASP B OD1 1 
ATOM   8853  O OD2 . ASP B 1 447 ? -27.453 83.229  -50.346  1.00 348.45 ? 456 ASP B OD2 1 
ATOM   8854  N N   . THR B 1 448 ? -28.417 80.012  -46.385  1.00 164.13 ? 457 THR B N   1 
ATOM   8855  C CA  . THR B 1 448 ? -29.341 79.315  -45.496  1.00 162.62 ? 457 THR B CA  1 
ATOM   8856  C C   . THR B 1 448 ? -28.619 78.585  -44.367  1.00 159.06 ? 457 THR B C   1 
ATOM   8857  O O   . THR B 1 448 ? -29.233 78.217  -43.365  1.00 158.18 ? 457 THR B O   1 
ATOM   8858  C CB  . THR B 1 448 ? -30.212 78.306  -46.267  1.00 161.78 ? 457 THR B CB  1 
ATOM   8859  O OG1 . THR B 1 448 ? -29.374 77.316  -46.877  1.00 158.81 ? 457 THR B OG1 1 
ATOM   8860  C CG2 . THR B 1 448 ? -31.020 79.014  -47.343  1.00 165.68 ? 457 THR B CG2 1 
ATOM   8861  N N   . LYS B 1 449 ? -27.317 78.378  -44.537  1.00 159.81 ? 458 LYS B N   1 
ATOM   8862  C CA  . LYS B 1 449 ? -26.513 77.676  -43.542  1.00 156.67 ? 458 LYS B CA  1 
ATOM   8863  C C   . LYS B 1 449 ? -27.062 76.276  -43.284  1.00 153.73 ? 458 LYS B C   1 
ATOM   8864  O O   . LYS B 1 449 ? -26.996 75.766  -42.165  1.00 151.95 ? 458 LYS B O   1 
ATOM   8865  C CB  . LYS B 1 449 ? -26.457 78.474  -42.241  1.00 157.94 ? 458 LYS B CB  1 
ATOM   8866  N N   . ILE B 1 450 ? -27.603 75.661  -44.331  1.00 166.28 ? 459 ILE B N   1 
ATOM   8867  C CA  . ILE B 1 450 ? -28.196 74.334  -44.224  1.00 164.00 ? 459 ILE B CA  1 
ATOM   8868  C C   . ILE B 1 450 ? -27.310 73.271  -44.865  1.00 161.32 ? 459 ILE B C   1 
ATOM   8869  O O   . ILE B 1 450 ? -26.765 73.474  -45.951  1.00 161.92 ? 459 ILE B O   1 
ATOM   8870  C CB  . ILE B 1 450 ? -29.583 74.286  -44.891  1.00 166.00 ? 459 ILE B CB  1 
ATOM   8871  C CG1 . ILE B 1 450 ? -30.527 75.297  -44.236  1.00 168.87 ? 459 ILE B CG1 1 
ATOM   8872  C CG2 . ILE B 1 450 ? -30.164 72.882  -44.820  1.00 163.90 ? 459 ILE B CG2 1 
ATOM   8873  C CD1 . ILE B 1 450 ? -31.899 75.352  -44.873  1.00 171.35 ? 459 ILE B CD1 1 
ATOM   8874  N N   . TRP B 1 451 ? -27.170 72.137  -44.186  1.00 142.66 ? 460 TRP B N   1 
ATOM   8875  C CA  . TRP B 1 451 ? -26.413 71.014  -44.722  1.00 140.23 ? 460 TRP B CA  1 
ATOM   8876  C C   . TRP B 1 451 ? -27.277 70.195  -45.671  1.00 140.41 ? 460 TRP B C   1 
ATOM   8877  O O   . TRP B 1 451 ? -28.471 70.013  -45.437  1.00 141.31 ? 460 TRP B O   1 
ATOM   8878  C CB  . TRP B 1 451 ? -25.893 70.125  -43.591  1.00 137.60 ? 460 TRP B CB  1 
ATOM   8879  C CG  . TRP B 1 451 ? -24.809 70.757  -42.778  1.00 137.32 ? 460 TRP B CG  1 
ATOM   8880  C CD1 . TRP B 1 451 ? -24.960 71.489  -41.637  1.00 138.26 ? 460 TRP B CD1 1 
ATOM   8881  C CD2 . TRP B 1 451 ? -23.401 70.712  -43.042  1.00 136.30 ? 460 TRP B CD2 1 
ATOM   8882  N NE1 . TRP B 1 451 ? -23.735 71.903  -41.174  1.00 137.96 ? 460 TRP B NE1 1 
ATOM   8883  C CE2 . TRP B 1 451 ? -22.761 71.439  -42.019  1.00 136.77 ? 460 TRP B CE2 1 
ATOM   8884  C CE3 . TRP B 1 451 ? -22.620 70.128  -44.045  1.00 135.26 ? 460 TRP B CE3 1 
ATOM   8885  C CZ2 . TRP B 1 451 ? -21.378 71.599  -41.970  1.00 136.28 ? 460 TRP B CZ2 1 
ATOM   8886  C CZ3 . TRP B 1 451 ? -21.247 70.287  -43.993  1.00 134.69 ? 460 TRP B CZ3 1 
ATOM   8887  C CH2 . TRP B 1 451 ? -20.640 71.015  -42.963  1.00 135.22 ? 460 TRP B CH2 1 
ATOM   8888  N N   . ASN B 1 452 ? -26.666 69.706  -46.744  1.00 152.01 ? 461 ASN B N   1 
ATOM   8889  C CA  . ASN B 1 452 ? -27.372 68.884  -47.718  1.00 152.36 ? 461 ASN B CA  1 
ATOM   8890  C C   . ASN B 1 452 ? -26.691 67.536  -47.921  1.00 149.86 ? 461 ASN B C   1 
ATOM   8891  O O   . ASN B 1 452 ? -25.569 67.322  -47.463  1.00 147.99 ? 461 ASN B O   1 
ATOM   8892  C CB  . ASN B 1 452 ? -27.498 69.619  -49.054  1.00 154.89 ? 461 ASN B CB  1 
ATOM   8893  C CG  . ASN B 1 452 ? -26.151 69.971  -49.656  1.00 154.53 ? 461 ASN B CG  1 
ATOM   8894  O OD1 . ASN B 1 452 ? -25.111 69.808  -49.020  1.00 152.56 ? 461 ASN B OD1 1 
ATOM   8895  N ND2 . ASN B 1 452 ? -26.165 70.460  -50.891  1.00 156.68 ? 461 ASN B ND2 1 
ATOM   8896  N N   . GLY B 1 453 ? -27.375 66.628  -48.608  1.00 145.01 ? 462 GLY B N   1 
ATOM   8897  C CA  . GLY B 1 453 ? -26.832 65.309  -48.872  1.00 143.08 ? 462 GLY B CA  1 
ATOM   8898  C C   . GLY B 1 453 ? -26.824 64.424  -47.641  1.00 141.03 ? 462 GLY B C   1 
ATOM   8899  O O   . GLY B 1 453 ? -27.635 64.601  -46.731  1.00 141.39 ? 462 GLY B O   1 
ATOM   8900  N N   . MET B 1 454 ? -25.902 63.467  -47.615  1.00 134.82 ? 463 MET B N   1 
ATOM   8901  C CA  . MET B 1 454 ? -25.800 62.525  -46.507  1.00 133.06 ? 463 MET B CA  1 
ATOM   8902  C C   . MET B 1 454 ? -25.440 63.226  -45.203  1.00 132.40 ? 463 MET B C   1 
ATOM   8903  O O   . MET B 1 454 ? -26.067 62.998  -44.173  1.00 132.22 ? 463 MET B O   1 
ATOM   8904  C CB  . MET B 1 454 ? -24.771 61.439  -46.825  1.00 131.48 ? 463 MET B CB  1 
ATOM   8905  C CG  . MET B 1 454 ? -25.117 60.609  -48.045  1.00 132.25 ? 463 MET B CG  1 
ATOM   8906  S SD  . MET B 1 454 ? -23.805 59.461  -48.503  1.00 130.75 ? 463 MET B SD  1 
ATOM   8907  C CE  . MET B 1 454 ? -22.444 60.593  -48.775  1.00 130.40 ? 463 MET B CE  1 
ATOM   8908  N N   . VAL B 1 455 ? -24.424 64.078  -45.254  1.00 131.57 ? 464 VAL B N   1 
ATOM   8909  C CA  . VAL B 1 455 ? -24.004 64.830  -44.080  1.00 131.33 ? 464 VAL B CA  1 
ATOM   8910  C C   . VAL B 1 455 ? -25.190 65.569  -43.474  1.00 132.83 ? 464 VAL B C   1 
ATOM   8911  O O   . VAL B 1 455 ? -25.288 65.713  -42.258  1.00 132.55 ? 464 VAL B O   1 
ATOM   8912  C CB  . VAL B 1 455 ? -22.889 65.839  -44.420  1.00 131.77 ? 464 VAL B CB  1 
ATOM   8913  C CG1 . VAL B 1 455 ? -22.584 66.720  -43.219  1.00 132.09 ? 464 VAL B CG1 1 
ATOM   8914  C CG2 . VAL B 1 455 ? -21.642 65.112  -44.880  1.00 130.36 ? 464 VAL B CG2 1 
ATOM   8915  N N   . GLY B 1 456 ? -26.093 66.028  -44.333  1.00 133.39 ? 465 GLY B N   1 
ATOM   8916  C CA  . GLY B 1 456 ? -27.290 66.712  -43.884  1.00 135.18 ? 465 GLY B CA  1 
ATOM   8917  C C   . GLY B 1 456 ? -28.246 65.779  -43.166  1.00 134.74 ? 465 GLY B C   1 
ATOM   8918  O O   . GLY B 1 456 ? -28.683 66.062  -42.051  1.00 135.02 ? 465 GLY B O   1 
ATOM   8919  N N   . GLU B 1 457 ? -28.563 64.657  -43.804  1.00 152.88 ? 466 GLU B N   1 
ATOM   8920  C CA  . GLU B 1 457 ? -29.488 63.683  -43.234  1.00 152.77 ? 466 GLU B CA  1 
ATOM   8921  C C   . GLU B 1 457 ? -28.998 63.142  -41.893  1.00 151.05 ? 466 GLU B C   1 
ATOM   8922  O O   . GLU B 1 457 ? -29.771 62.564  -41.131  1.00 151.22 ? 466 GLU B O   1 
ATOM   8923  C CB  . GLU B 1 457 ? -29.733 62.532  -44.213  1.00 152.73 ? 466 GLU B CB  1 
ATOM   8924  C CG  . GLU B 1 457 ? -30.470 62.943  -45.477  1.00 154.94 ? 466 GLU B CG  1 
ATOM   8925  C CD  . GLU B 1 457 ? -30.908 61.754  -46.312  1.00 155.36 ? 466 GLU B CD  1 
ATOM   8926  O OE1 . GLU B 1 457 ? -30.691 60.604  -45.873  1.00 153.99 ? 466 GLU B OE1 1 
ATOM   8927  O OE2 . GLU B 1 457 ? -31.472 61.970  -47.406  1.00 157.33 ? 466 GLU B OE2 1 
ATOM   8928  N N   . LEU B 1 458 ? -27.714 63.329  -41.610  1.00 129.29 ? 467 LEU B N   1 
ATOM   8929  C CA  . LEU B 1 458 ? -27.144 62.899  -40.339  1.00 127.94 ? 467 LEU B CA  1 
ATOM   8930  C C   . LEU B 1 458 ? -27.394 63.934  -39.250  1.00 128.82 ? 467 LEU B C   1 
ATOM   8931  O O   . LEU B 1 458 ? -27.785 63.594  -38.134  1.00 128.75 ? 467 LEU B O   1 
ATOM   8932  C CB  . LEU B 1 458 ? -25.643 62.646  -40.479  1.00 126.37 ? 467 LEU B CB  1 
ATOM   8933  C CG  . LEU B 1 458 ? -25.223 61.394  -41.247  1.00 125.32 ? 467 LEU B CG  1 
ATOM   8934  C CD1 . LEU B 1 458 ? -23.713 61.349  -41.392  1.00 124.12 ? 467 LEU B CD1 1 
ATOM   8935  C CD2 . LEU B 1 458 ? -25.735 60.145  -40.550  1.00 124.87 ? 467 LEU B CD2 1 
ATOM   8936  N N   . VAL B 1 459 ? -27.166 65.200  -39.585  1.00 132.31 ? 468 VAL B N   1 
ATOM   8937  C CA  . VAL B 1 459 ? -27.307 66.291  -38.627  1.00 133.48 ? 468 VAL B CA  1 
ATOM   8938  C C   . VAL B 1 459 ? -28.765 66.532  -38.248  1.00 135.18 ? 468 VAL B C   1 
ATOM   8939  O O   . VAL B 1 459 ? -29.060 66.984  -37.142  1.00 135.92 ? 468 VAL B O   1 
ATOM   8940  C CB  . VAL B 1 459 ? -26.701 67.599  -39.177  1.00 134.63 ? 468 VAL B CB  1 
ATOM   8941  C CG1 . VAL B 1 459 ? -26.846 68.722  -38.163  1.00 136.16 ? 468 VAL B CG1 1 
ATOM   8942  C CG2 . VAL B 1 459 ? -25.240 67.393  -39.543  1.00 133.19 ? 468 VAL B CG2 1 
ATOM   8943  N N   . TYR B 1 460 ? -29.675 66.221  -39.165  1.00 138.11 ? 469 TYR B N   1 
ATOM   8944  C CA  . TYR B 1 460 ? -31.094 66.478  -38.940  1.00 140.09 ? 469 TYR B CA  1 
ATOM   8945  C C   . TYR B 1 460 ? -31.871 65.215  -38.565  1.00 139.65 ? 469 TYR B C   1 
ATOM   8946  O O   . TYR B 1 460 ? -33.102 65.197  -38.607  1.00 141.37 ? 469 TYR B O   1 
ATOM   8947  C CB  . TYR B 1 460 ? -31.714 67.164  -40.160  1.00 142.12 ? 469 TYR B CB  1 
ATOM   8948  C CG  . TYR B 1 460 ? -30.936 68.377  -40.621  1.00 142.86 ? 469 TYR B CG  1 
ATOM   8949  C CD1 . TYR B 1 460 ? -30.735 69.460  -39.774  1.00 143.86 ? 469 TYR B CD1 1 
ATOM   8950  C CD2 . TYR B 1 460 ? -30.401 68.439  -41.901  1.00 142.82 ? 469 TYR B CD2 1 
ATOM   8951  C CE1 . TYR B 1 460 ? -30.022 70.571  -40.190  1.00 144.86 ? 469 TYR B CE1 1 
ATOM   8952  C CE2 . TYR B 1 460 ? -29.688 69.545  -42.326  1.00 143.76 ? 469 TYR B CE2 1 
ATOM   8953  C CZ  . TYR B 1 460 ? -29.501 70.608  -41.466  1.00 144.81 ? 469 TYR B CZ  1 
ATOM   8954  O OH  . TYR B 1 460 ? -28.793 71.711  -41.883  1.00 146.06 ? 469 TYR B OH  1 
ATOM   8955  N N   . GLY B 1 461 ? -31.143 64.164  -38.202  1.00 154.90 ? 470 GLY B N   1 
ATOM   8956  C CA  . GLY B 1 461 ? -31.745 62.955  -37.667  1.00 154.59 ? 470 GLY B CA  1 
ATOM   8957  C C   . GLY B 1 461 ? -32.490 62.088  -38.665  1.00 155.20 ? 470 GLY B C   1 
ATOM   8958  O O   . GLY B 1 461 ? -33.301 61.247  -38.275  1.00 155.76 ? 470 GLY B O   1 
ATOM   8959  N N   . LYS B 1 462 ? -32.217 62.284  -39.950  1.00 139.71 ? 471 LYS B N   1 
ATOM   8960  C CA  . LYS B 1 462 ? -32.856 61.487  -40.992  1.00 140.54 ? 471 LYS B CA  1 
ATOM   8961  C C   . LYS B 1 462 ? -32.252 60.086  -41.066  1.00 138.93 ? 471 LYS B C   1 
ATOM   8962  O O   . LYS B 1 462 ? -32.946 59.117  -41.372  1.00 139.72 ? 471 LYS B O   1 
ATOM   8963  C CB  . LYS B 1 462 ? -32.745 62.185  -42.349  1.00 141.51 ? 471 LYS B CB  1 
ATOM   8964  N N   . ALA B 1 463 ? -30.957 59.987  -40.783  1.00 134.24 ? 472 ALA B N   1 
ATOM   8965  C CA  . ALA B 1 463 ? -30.260 58.706  -40.817  1.00 132.83 ? 472 ALA B CA  1 
ATOM   8966  C C   . ALA B 1 463 ? -29.408 58.508  -39.568  1.00 131.33 ? 472 ALA B C   1 
ATOM   8967  O O   . ALA B 1 463 ? -29.118 59.462  -38.846  1.00 131.17 ? 472 ALA B O   1 
ATOM   8968  C CB  . ALA B 1 463 ? -29.401 58.605  -42.067  1.00 132.20 ? 472 ALA B CB  1 
ATOM   8969  N N   . ASP B 1 464 ? -29.007 57.265  -39.321  1.00 134.02 ? 473 ASP B N   1 
ATOM   8970  C CA  . ASP B 1 464 ? -28.217 56.934  -38.140  1.00 132.92 ? 473 ASP B CA  1 
ATOM   8971  C C   . ASP B 1 464 ? -26.728 56.854  -38.454  1.00 131.42 ? 473 ASP B C   1 
ATOM   8972  O O   . ASP B 1 464 ? -25.891 57.016  -37.567  1.00 130.65 ? 473 ASP B O   1 
ATOM   8973  C CB  . ASP B 1 464 ? -28.683 55.605  -37.543  1.00 133.32 ? 473 ASP B CB  1 
ATOM   8974  C CG  . ASP B 1 464 ? -30.099 55.669  -37.011  1.00 134.95 ? 473 ASP B CG  1 
ATOM   8975  O OD1 . ASP B 1 464 ? -30.603 56.790  -36.782  1.00 135.59 ? 473 ASP B OD1 1 
ATOM   8976  O OD2 . ASP B 1 464 ? -30.708 54.596  -36.818  1.00 135.81 ? 473 ASP B OD2 1 
ATOM   8977  N N   . ILE B 1 465 ? -26.404 56.600  -39.718  1.00 126.78 ? 474 ILE B N   1 
ATOM   8978  C CA  . ILE B 1 465 ? -25.017 56.420  -40.127  1.00 125.58 ? 474 ILE B CA  1 
ATOM   8979  C C   . ILE B 1 465 ? -24.865 56.590  -41.635  1.00 125.82 ? 474 ILE B C   1 
ATOM   8980  O O   . ILE B 1 465 ? -25.801 56.341  -42.394  1.00 126.91 ? 474 ILE B O   1 
ATOM   8981  C CB  . ILE B 1 465 ? -24.492 55.032  -39.711  1.00 125.07 ? 474 ILE B CB  1 
ATOM   8982  C CG1 . ILE B 1 465 ? -22.971 54.962  -39.850  1.00 123.96 ? 474 ILE B CG1 1 
ATOM   8983  C CG2 . ILE B 1 465 ? -25.165 53.939  -40.527  1.00 125.90 ? 474 ILE B CG2 1 
ATOM   8984  C CD1 . ILE B 1 465 ? -22.382 53.645  -39.394  1.00 123.72 ? 474 ILE B CD1 1 
ATOM   8985  N N   . ALA B 1 466 ? -23.682 57.018  -42.062  1.00 124.32 ? 475 ALA B N   1 
ATOM   8986  C CA  . ALA B 1 466 ? -23.409 57.237  -43.478  1.00 124.65 ? 475 ALA B CA  1 
ATOM   8987  C C   . ALA B 1 466 ? -22.249 56.377  -43.964  1.00 123.85 ? 475 ALA B C   1 
ATOM   8988  O O   . ALA B 1 466 ? -21.095 56.613  -43.607  1.00 123.00 ? 475 ALA B O   1 
ATOM   8989  C CB  . ALA B 1 466 ? -23.126 58.709  -43.742  1.00 124.97 ? 475 ALA B CB  1 
ATOM   8990  N N   . ILE B 1 467 ? -22.563 55.377  -44.781  1.00 123.32 ? 476 ILE B N   1 
ATOM   8991  C CA  . ILE B 1 467 ? -21.544 54.508  -45.355  1.00 122.90 ? 476 ILE B CA  1 
ATOM   8992  C C   . ILE B 1 467 ? -21.421 54.755  -46.854  1.00 123.65 ? 476 ILE B C   1 
ATOM   8993  O O   . ILE B 1 467 ? -22.155 54.175  -47.654  1.00 124.78 ? 476 ILE B O   1 
ATOM   8994  C CB  . ILE B 1 467 ? -21.854 53.024  -45.097  1.00 123.23 ? 476 ILE B CB  1 
ATOM   8995  C CG1 . ILE B 1 467 ? -22.018 52.771  -43.597  1.00 122.77 ? 476 ILE B CG1 1 
ATOM   8996  C CG2 . ILE B 1 467 ? -20.755 52.143  -45.671  1.00 123.03 ? 476 ILE B CG2 1 
ATOM   8997  C CD1 . ILE B 1 467 ? -22.327 51.332  -43.249  1.00 123.39 ? 476 ILE B CD1 1 
ATOM   8998  N N   . ALA B 1 468 ? -20.487 55.624  -47.223  1.00 124.05 ? 477 ALA B N   1 
ATOM   8999  C CA  . ALA B 1 468 ? -20.291 56.008  -48.614  1.00 124.92 ? 477 ALA B CA  1 
ATOM   9000  C C   . ALA B 1 468 ? -18.913 56.642  -48.780  1.00 124.33 ? 477 ALA B C   1 
ATOM   9001  O O   . ALA B 1 468 ? -18.197 56.829  -47.796  1.00 123.35 ? 477 ALA B O   1 
ATOM   9002  C CB  . ALA B 1 468 ? -21.383 56.974  -49.048  1.00 126.17 ? 477 ALA B CB  1 
ATOM   9003  N N   . PRO B 1 469 ? -18.527 56.962  -50.027  1.00 126.00 ? 478 PRO B N   1 
ATOM   9004  C CA  . PRO B 1 469 ? -17.243 57.636  -50.252  1.00 125.77 ? 478 PRO B CA  1 
ATOM   9005  C C   . PRO B 1 469 ? -17.269 59.077  -49.758  1.00 125.95 ? 478 PRO B C   1 
ATOM   9006  O O   . PRO B 1 469 ? -17.017 59.993  -50.538  1.00 126.96 ? 478 PRO B O   1 
ATOM   9007  C CB  . PRO B 1 469 ? -17.099 57.622  -51.779  1.00 127.04 ? 478 PRO B CB  1 
ATOM   9008  C CG  . PRO B 1 469 ? -18.061 56.591  -52.260  1.00 127.70 ? 478 PRO B CG  1 
ATOM   9009  C CD  . PRO B 1 469 ? -19.191 56.612  -51.292  1.00 127.42 ? 478 PRO B CD  1 
ATOM   9010  N N   . LEU B 1 470 ? -17.571 59.272  -48.479  1.00 126.85 ? 479 LEU B N   1 
ATOM   9011  C CA  . LEU B 1 470 ? -17.645 60.611  -47.910  1.00 127.24 ? 479 LEU B CA  1 
ATOM   9012  C C   . LEU B 1 470 ? -16.266 61.091  -47.473  1.00 126.87 ? 479 LEU B C   1 
ATOM   9013  O O   . LEU B 1 470 ? -15.637 60.494  -46.599  1.00 125.89 ? 479 LEU B O   1 
ATOM   9014  C CB  . LEU B 1 470 ? -18.612 60.638  -46.725  1.00 126.92 ? 479 LEU B CB  1 
ATOM   9015  C CG  . LEU B 1 470 ? -19.014 62.022  -46.213  1.00 127.78 ? 479 LEU B CG  1 
ATOM   9016  C CD1 . LEU B 1 470 ? -19.651 62.838  -47.326  1.00 129.42 ? 479 LEU B CD1 1 
ATOM   9017  C CD2 . LEU B 1 470 ? -19.958 61.899  -45.030  1.00 127.53 ? 479 LEU B CD2 1 
ATOM   9018  N N   . THR B 1 471 ? -15.801 62.172  -48.090  1.00 127.13 ? 480 THR B N   1 
ATOM   9019  C CA  . THR B 1 471 ? -14.489 62.727  -47.783  1.00 127.23 ? 480 THR B CA  1 
ATOM   9020  C C   . THR B 1 471 ? -14.445 63.283  -46.364  1.00 127.01 ? 480 THR B C   1 
ATOM   9021  O O   . THR B 1 471 ? -15.387 63.932  -45.912  1.00 127.51 ? 480 THR B O   1 
ATOM   9022  C CB  . THR B 1 471 ? -14.107 63.840  -48.774  1.00 128.86 ? 480 THR B CB  1 
ATOM   9023  O OG1 . THR B 1 471 ? -14.255 63.359  -50.116  1.00 129.33 ? 480 THR B OG1 1 
ATOM   9024  C CG2 . THR B 1 471 ? -12.668 64.283  -48.553  1.00 129.18 ? 480 THR B CG2 1 
ATOM   9025  N N   . ILE B 1 472 ? -13.348 63.020  -45.662  1.00 125.46 ? 481 ILE B N   1 
ATOM   9026  C CA  . ILE B 1 472 ? -13.167 63.534  -44.311  1.00 125.54 ? 481 ILE B CA  1 
ATOM   9027  C C   . ILE B 1 472 ? -12.599 64.947  -44.353  1.00 127.12 ? 481 ILE B C   1 
ATOM   9028  O O   . ILE B 1 472 ? -11.390 65.137  -44.483  1.00 127.64 ? 481 ILE B O   1 
ATOM   9029  C CB  . ILE B 1 472 ? -12.231 62.636  -43.483  1.00 124.69 ? 481 ILE B CB  1 
ATOM   9030  C CG1 . ILE B 1 472 ? -12.769 61.206  -43.437  1.00 123.45 ? 481 ILE B CG1 1 
ATOM   9031  C CG2 . ILE B 1 472 ? -12.068 63.189  -42.076  1.00 125.08 ? 481 ILE B CG2 1 
ATOM   9032  C CD1 . ILE B 1 472 ? -11.927 60.263  -42.609  1.00 122.90 ? 481 ILE B CD1 1 
ATOM   9033  N N   . THR B 1 473 ? -13.481 65.935  -44.249  1.00 127.27 ? 482 THR B N   1 
ATOM   9034  C CA  . THR B 1 473 ? -13.074 67.334  -44.296  1.00 129.17 ? 482 THR B CA  1 
ATOM   9035  C C   . THR B 1 473 ? -13.274 68.017  -42.947  1.00 129.82 ? 482 THR B C   1 
ATOM   9036  O O   . THR B 1 473 ? -14.100 67.591  -42.141  1.00 128.98 ? 482 THR B O   1 
ATOM   9037  C CB  . THR B 1 473 ? -13.851 68.110  -45.375  1.00 130.55 ? 482 THR B CB  1 
ATOM   9038  O OG1 . THR B 1 473 ? -15.243 68.136  -45.038  1.00 130.45 ? 482 THR B OG1 1 
ATOM   9039  C CG2 . THR B 1 473 ? -13.678 67.449  -46.733  1.00 130.19 ? 482 THR B CG2 1 
ATOM   9040  N N   . LEU B 1 474 ? -12.510 69.078  -42.709  1.00 132.54 ? 483 LEU B N   1 
ATOM   9041  C CA  . LEU B 1 474 ? -12.594 69.827  -41.461  1.00 133.63 ? 483 LEU B CA  1 
ATOM   9042  C C   . LEU B 1 474 ? -13.987 70.410  -41.249  1.00 134.30 ? 483 LEU B C   1 
ATOM   9043  O O   . LEU B 1 474 ? -14.520 70.382  -40.140  1.00 134.15 ? 483 LEU B O   1 
ATOM   9044  C CB  . LEU B 1 474 ? -11.552 70.946  -41.441  1.00 135.89 ? 483 LEU B CB  1 
ATOM   9045  C CG  . LEU B 1 474 ? -11.615 71.918  -40.261  1.00 137.70 ? 483 LEU B CG  1 
ATOM   9046  C CD1 . LEU B 1 474 ? -11.527 71.174  -38.938  1.00 136.53 ? 483 LEU B CD1 1 
ATOM   9047  C CD2 . LEU B 1 474 ? -10.510 72.958  -40.369  1.00 140.22 ? 483 LEU B CD2 1 
ATOM   9048  N N   . VAL B 1 475 ? -14.571 70.938  -42.320  1.00 145.11 ? 484 VAL B N   1 
ATOM   9049  C CA  . VAL B 1 475 ? -15.887 71.562  -42.248  1.00 146.17 ? 484 VAL B CA  1 
ATOM   9050  C C   . VAL B 1 475 ? -16.963 70.576  -41.801  1.00 144.41 ? 484 VAL B C   1 
ATOM   9051  O O   . VAL B 1 475 ? -17.976 70.971  -41.227  1.00 145.14 ? 484 VAL B O   1 
ATOM   9052  C CB  . VAL B 1 475 ? -16.295 72.176  -43.602  1.00 147.67 ? 484 VAL B CB  1 
ATOM   9053  C CG1 . VAL B 1 475 ? -15.321 73.275  -44.000  1.00 149.92 ? 484 VAL B CG1 1 
ATOM   9054  C CG2 . VAL B 1 475 ? -16.358 71.102  -44.678  1.00 146.07 ? 484 VAL B CG2 1 
ATOM   9055  N N   . ARG B 1 476 ? -16.737 69.293  -42.066  1.00 130.25 ? 485 ARG B N   1 
ATOM   9056  C CA  . ARG B 1 476 ? -17.699 68.257  -41.710  1.00 128.75 ? 485 ARG B CA  1 
ATOM   9057  C C   . ARG B 1 476 ? -17.390 67.653  -40.347  1.00 127.70 ? 485 ARG B C   1 
ATOM   9058  O O   . ARG B 1 476 ? -18.298 67.312  -39.591  1.00 127.35 ? 485 ARG B O   1 
ATOM   9059  C CB  . ARG B 1 476 ? -17.717 67.155  -42.770  1.00 127.45 ? 485 ARG B CB  1 
ATOM   9060  C CG  . ARG B 1 476 ? -18.220 67.601  -44.131  1.00 128.61 ? 485 ARG B CG  1 
ATOM   9061  C CD  . ARG B 1 476 ? -17.984 66.521  -45.171  1.00 127.53 ? 485 ARG B CD  1 
ATOM   9062  N NE  . ARG B 1 476 ? -18.450 66.917  -46.495  1.00 128.88 ? 485 ARG B NE  1 
ATOM   9063  C CZ  . ARG B 1 476 ? -18.175 66.250  -47.610  1.00 128.61 ? 485 ARG B CZ  1 
ATOM   9064  N NH1 . ARG B 1 476 ? -17.429 65.155  -47.560  1.00 127.01 ? 485 ARG B NH1 1 
ATOM   9065  N NH2 . ARG B 1 476 ? -18.639 66.678  -48.776  1.00 130.17 ? 485 ARG B NH2 1 
ATOM   9066  N N   . GLU B 1 477 ? -16.104 67.519  -40.039  1.00 135.43 ? 486 GLU B N   1 
ATOM   9067  C CA  . GLU B 1 477 ? -15.677 66.940  -38.771  1.00 134.74 ? 486 GLU B CA  1 
ATOM   9068  C C   . GLU B 1 477 ? -16.197 67.759  -37.593  1.00 136.01 ? 486 GLU B C   1 
ATOM   9069  O O   . GLU B 1 477 ? -16.239 67.280  -36.459  1.00 135.64 ? 486 GLU B O   1 
ATOM   9070  C CB  . GLU B 1 477 ? -14.150 66.850  -38.715  1.00 134.82 ? 486 GLU B CB  1 
ATOM   9071  C CG  . GLU B 1 477 ? -13.603 66.100  -37.508  1.00 134.25 ? 486 GLU B CG  1 
ATOM   9072  C CD  . GLU B 1 477 ? -13.711 64.593  -37.651  1.00 132.47 ? 486 GLU B CD  1 
ATOM   9073  O OE1 . GLU B 1 477 ? -14.684 64.118  -38.274  1.00 131.66 ? 486 GLU B OE1 1 
ATOM   9074  O OE2 . GLU B 1 477 ? -12.820 63.883  -37.138  1.00 132.15 ? 486 GLU B OE2 1 
ATOM   9075  N N   . GLU B 1 478 ? -16.597 68.996  -37.873  1.00 129.81 ? 487 GLU B N   1 
ATOM   9076  C CA  . GLU B 1 478 ? -17.102 69.895  -36.843  1.00 131.43 ? 487 GLU B CA  1 
ATOM   9077  C C   . GLU B 1 478 ? -18.548 69.578  -36.471  1.00 131.10 ? 487 GLU B C   1 
ATOM   9078  O O   . GLU B 1 478 ? -18.957 69.767  -35.326  1.00 131.76 ? 487 GLU B O   1 
ATOM   9079  C CB  . GLU B 1 478 ? -16.995 71.349  -37.306  1.00 133.81 ? 487 GLU B CB  1 
ATOM   9080  C CG  . GLU B 1 478 ? -15.572 71.837  -37.506  1.00 134.75 ? 487 GLU B CG  1 
ATOM   9081  C CD  . GLU B 1 478 ? -15.517 73.240  -38.078  1.00 137.35 ? 487 GLU B CD  1 
ATOM   9082  O OE1 . GLU B 1 478 ? -14.445 73.877  -37.994  1.00 138.86 ? 487 GLU B OE1 1 
ATOM   9083  O OE2 . GLU B 1 478 ? -16.547 73.706  -38.610  1.00 138.16 ? 487 GLU B OE2 1 
ATOM   9084  N N   . VAL B 1 479 ? -19.318 69.096  -37.441  1.00 130.95 ? 488 VAL B N   1 
ATOM   9085  C CA  . VAL B 1 479 ? -20.736 68.828  -37.223  1.00 130.96 ? 488 VAL B CA  1 
ATOM   9086  C C   . VAL B 1 479 ? -21.027 67.346  -36.992  1.00 129.02 ? 488 VAL B C   1 
ATOM   9087  O O   . VAL B 1 479 ? -21.955 66.996  -36.262  1.00 129.05 ? 488 VAL B O   1 
ATOM   9088  C CB  . VAL B 1 479 ? -21.595 69.344  -38.395  1.00 132.00 ? 488 VAL B CB  1 
ATOM   9089  C CG1 . VAL B 1 479 ? -21.489 70.857  -38.501  1.00 134.41 ? 488 VAL B CG1 1 
ATOM   9090  C CG2 . VAL B 1 479 ? -21.171 68.683  -39.697  1.00 130.88 ? 488 VAL B CG2 1 
ATOM   9091  N N   . ILE B 1 480 ? -20.235 66.478  -37.612  1.00 130.30 ? 489 ILE B N   1 
ATOM   9092  C CA  . ILE B 1 480 ? -20.417 65.039  -37.460  1.00 128.73 ? 489 ILE B CA  1 
ATOM   9093  C C   . ILE B 1 480 ? -19.119 64.356  -37.044  1.00 127.73 ? 489 ILE B C   1 
ATOM   9094  O O   . ILE B 1 480 ? -18.092 65.009  -36.865  1.00 128.27 ? 489 ILE B O   1 
ATOM   9095  C CB  . ILE B 1 480 ? -20.939 64.391  -38.758  1.00 128.18 ? 489 ILE B CB  1 
ATOM   9096  C CG1 . ILE B 1 480 ? -19.911 64.539  -39.880  1.00 127.96 ? 489 ILE B CG1 1 
ATOM   9097  C CG2 . ILE B 1 480 ? -22.272 65.004  -39.163  1.00 129.45 ? 489 ILE B CG2 1 
ATOM   9098  C CD1 . ILE B 1 480 ? -20.362 63.949  -41.199  1.00 127.71 ? 489 ILE B CD1 1 
ATOM   9099  N N   . ASP B 1 481 ? -19.173 63.037  -36.890  1.00 132.45 ? 490 ASP B N   1 
ATOM   9100  C CA  . ASP B 1 481 ? -18.000 62.262  -36.506  1.00 131.71 ? 490 ASP B CA  1 
ATOM   9101  C C   . ASP B 1 481 ? -17.546 61.346  -37.636  1.00 130.73 ? 490 ASP B C   1 
ATOM   9102  O O   . ASP B 1 481 ? -18.349 60.624  -38.224  1.00 130.31 ? 490 ASP B O   1 
ATOM   9103  C CB  . ASP B 1 481 ? -18.284 61.439  -35.248  1.00 131.54 ? 490 ASP B CB  1 
ATOM   9104  C CG  . ASP B 1 481 ? -18.380 62.294  -34.001  1.00 132.68 ? 490 ASP B CG  1 
ATOM   9105  O OD1 . ASP B 1 481 ? -18.037 63.494  -34.072  1.00 133.62 ? 490 ASP B OD1 1 
ATOM   9106  O OD2 . ASP B 1 481 ? -18.796 61.765  -32.948  1.00 132.87 ? 490 ASP B OD2 1 
ATOM   9107  N N   . PHE B 1 482 ? -16.252 61.381  -37.934  1.00 129.56 ? 491 PHE B N   1 
ATOM   9108  C CA  . PHE B 1 482 ? -15.682 60.525  -38.966  1.00 128.84 ? 491 PHE B CA  1 
ATOM   9109  C C   . PHE B 1 482 ? -14.807 59.435  -38.364  1.00 128.40 ? 491 PHE B C   1 
ATOM   9110  O O   . PHE B 1 482 ? -13.886 59.718  -37.598  1.00 128.86 ? 491 PHE B O   1 
ATOM   9111  C CB  . PHE B 1 482 ? -14.860 61.348  -39.959  1.00 129.31 ? 491 PHE B CB  1 
ATOM   9112  C CG  . PHE B 1 482 ? -15.679 61.982  -41.046  1.00 129.75 ? 491 PHE B CG  1 
ATOM   9113  C CD1 . PHE B 1 482 ? -16.121 61.234  -42.123  1.00 129.34 ? 491 PHE B CD1 1 
ATOM   9114  C CD2 . PHE B 1 482 ? -15.999 63.328  -40.995  1.00 130.90 ? 491 PHE B CD2 1 
ATOM   9115  C CE1 . PHE B 1 482 ? -16.872 61.814  -43.128  1.00 130.05 ? 491 PHE B CE1 1 
ATOM   9116  C CE2 . PHE B 1 482 ? -16.750 63.914  -41.996  1.00 131.63 ? 491 PHE B CE2 1 
ATOM   9117  C CZ  . PHE B 1 482 ? -17.187 63.155  -43.064  1.00 131.20 ? 491 PHE B CZ  1 
ATOM   9118  N N   . SER B 1 483 ? -15.100 58.187  -38.711  1.00 123.60 ? 492 SER B N   1 
ATOM   9119  C CA  . SER B 1 483 ? -14.245 57.078  -38.321  1.00 123.44 ? 492 SER B CA  1 
ATOM   9120  C C   . SER B 1 483 ? -12.937 57.188  -39.090  1.00 123.53 ? 492 SER B C   1 
ATOM   9121  O O   . SER B 1 483 ? -12.829 57.975  -40.029  1.00 123.64 ? 492 SER B O   1 
ATOM   9122  C CB  . SER B 1 483 ? -14.920 55.744  -38.632  1.00 123.11 ? 492 SER B CB  1 
ATOM   9123  O OG  . SER B 1 483 ? -15.062 55.564  -40.030  1.00 122.91 ? 492 SER B OG  1 
ATOM   9124  N N   . LYS B 1 484 ? -11.942 56.404  -38.691  1.00 134.83 ? 493 LYS B N   1 
ATOM   9125  C CA  . LYS B 1 484 ? -10.673 56.381  -39.407  1.00 135.11 ? 493 LYS B CA  1 
ATOM   9126  C C   . LYS B 1 484 ? -10.915 56.043  -40.874  1.00 134.72 ? 493 LYS B C   1 
ATOM   9127  O O   . LYS B 1 484 ? -11.874 55.345  -41.203  1.00 134.34 ? 493 LYS B O   1 
ATOM   9128  C CB  . LYS B 1 484 ? -9.712  55.375  -38.772  1.00 135.59 ? 493 LYS B CB  1 
ATOM   9129  C CG  . LYS B 1 484 ? -9.225  55.780  -37.392  1.00 136.40 ? 493 LYS B CG  1 
ATOM   9130  C CD  . LYS B 1 484 ? -8.457  57.091  -37.447  1.00 137.08 ? 493 LYS B CD  1 
ATOM   9131  C CE  . LYS B 1 484 ? -8.072  57.567  -36.055  1.00 138.17 ? 493 LYS B CE  1 
ATOM   9132  N NZ  . LYS B 1 484 ? -9.269  57.883  -35.227  1.00 137.94 ? 493 LYS B NZ  1 
ATOM   9133  N N   . PRO B 1 485 ? -10.048 56.547  -41.764  1.00 131.23 ? 494 PRO B N   1 
ATOM   9134  C CA  . PRO B 1 485 ? -10.221 56.351  -43.206  1.00 131.15 ? 494 PRO B CA  1 
ATOM   9135  C C   . PRO B 1 485 ? -10.249 54.876  -43.587  1.00 131.01 ? 494 PRO B C   1 
ATOM   9136  O O   . PRO B 1 485 ? -9.375  54.118  -43.166  1.00 131.32 ? 494 PRO B O   1 
ATOM   9137  C CB  . PRO B 1 485 ? -8.977  57.019  -43.802  1.00 131.85 ? 494 PRO B CB  1 
ATOM   9138  C CG  . PRO B 1 485 ? -8.525  57.986  -42.763  1.00 132.34 ? 494 PRO B CG  1 
ATOM   9139  C CD  . PRO B 1 485 ? -8.844  57.336  -41.454  1.00 132.02 ? 494 PRO B CD  1 
ATOM   9140  N N   . PHE B 1 486 ? -11.244 54.476  -44.372  1.00 120.17 ? 495 PHE B N   1 
ATOM   9141  C CA  . PHE B 1 486 ? -11.320 53.105  -44.862  1.00 120.38 ? 495 PHE B CA  1 
ATOM   9142  C C   . PHE B 1 486 ? -10.762 53.011  -46.278  1.00 120.90 ? 495 PHE B C   1 
ATOM   9143  O O   . PHE B 1 486 ? -10.790 51.948  -46.898  1.00 121.35 ? 495 PHE B O   1 
ATOM   9144  C CB  . PHE B 1 486 ? -12.759 52.581  -44.814  1.00 120.28 ? 495 PHE B CB  1 
ATOM   9145  C CG  . PHE B 1 486 ? -13.700 53.286  -45.750  1.00 120.39 ? 495 PHE B CG  1 
ATOM   9146  C CD1 . PHE B 1 486 ? -13.822 52.880  -47.069  1.00 121.00 ? 495 PHE B CD1 1 
ATOM   9147  C CD2 . PHE B 1 486 ? -14.472 54.347  -45.310  1.00 120.16 ? 495 PHE B CD2 1 
ATOM   9148  C CE1 . PHE B 1 486 ? -14.690 53.525  -47.932  1.00 121.43 ? 495 PHE B CE1 1 
ATOM   9149  C CE2 . PHE B 1 486 ? -15.341 54.994  -46.168  1.00 120.58 ? 495 PHE B CE2 1 
ATOM   9150  C CZ  . PHE B 1 486 ? -15.450 54.582  -47.480  1.00 121.24 ? 495 PHE B CZ  1 
ATOM   9151  N N   . MET B 1 487 ? -10.253 54.132  -46.780  1.00 137.78 ? 496 MET B N   1 
ATOM   9152  C CA  . MET B 1 487 ? -9.685  54.188  -48.122  1.00 138.46 ? 496 MET B CA  1 
ATOM   9153  C C   . MET B 1 487 ? -8.989  55.521  -48.374  1.00 138.85 ? 496 MET B C   1 
ATOM   9154  O O   . MET B 1 487 ? -9.644  56.550  -48.533  1.00 138.90 ? 496 MET B O   1 
ATOM   9155  C CB  . MET B 1 487 ? -10.773 53.962  -49.173  1.00 138.77 ? 496 MET B CB  1 
ATOM   9156  C CG  . MET B 1 487 ? -10.288 54.095  -50.605  1.00 139.72 ? 496 MET B CG  1 
ATOM   9157  S SD  . MET B 1 487 ? -11.550 53.626  -51.804  1.00 140.50 ? 496 MET B SD  1 
ATOM   9158  C CE  . MET B 1 487 ? -11.765 51.894  -51.402  1.00 140.52 ? 496 MET B CE  1 
ATOM   9159  N N   . SER B 1 488 ? -7.660  55.497  -48.409  1.00 135.00 ? 497 SER B N   1 
ATOM   9160  C CA  . SER B 1 488 ? -6.876  56.702  -48.662  1.00 135.72 ? 497 SER B CA  1 
ATOM   9161  C C   . SER B 1 488 ? -6.769  56.977  -50.159  1.00 136.60 ? 497 SER B C   1 
ATOM   9162  O O   . SER B 1 488 ? -6.547  56.061  -50.950  1.00 136.94 ? 497 SER B O   1 
ATOM   9163  C CB  . SER B 1 488 ? -5.480  56.572  -48.049  1.00 136.27 ? 497 SER B CB  1 
ATOM   9164  O OG  . SER B 1 488 ? -5.551  56.342  -46.652  1.00 135.75 ? 497 SER B OG  1 
ATOM   9165  N N   . LEU B 1 489 ? -6.924  58.240  -50.542  1.00 126.87 ? 498 LEU B N   1 
ATOM   9166  C CA  . LEU B 1 489 ? -6.875  58.618  -51.950  1.00 127.98 ? 498 LEU B CA  1 
ATOM   9167  C C   . LEU B 1 489 ? -6.268  60.002  -52.151  1.00 129.21 ? 498 LEU B C   1 
ATOM   9168  O O   . LEU B 1 489 ? -5.608  60.539  -51.262  1.00 129.34 ? 498 LEU B O   1 
ATOM   9169  C CB  . LEU B 1 489 ? -8.274  58.580  -52.566  1.00 127.89 ? 498 LEU B CB  1 
ATOM   9170  C CG  . LEU B 1 489 ? -9.264  59.629  -52.055  1.00 127.77 ? 498 LEU B CG  1 
ATOM   9171  C CD1 . LEU B 1 489 ? -10.288 59.965  -53.127  1.00 128.67 ? 498 LEU B CD1 1 
ATOM   9172  C CD2 . LEU B 1 489 ? -9.944  59.164  -50.777  1.00 126.41 ? 498 LEU B CD2 1 
ATOM   9173  N N   . GLY B 1 490 ? -6.502  60.572  -53.329  1.00 132.98 ? 499 GLY B N   1 
ATOM   9174  C CA  . GLY B 1 490 ? -5.998  61.891  -53.662  1.00 134.54 ? 499 GLY B CA  1 
ATOM   9175  C C   . GLY B 1 490 ? -6.325  62.274  -55.093  1.00 136.02 ? 499 GLY B C   1 
ATOM   9176  O O   . GLY B 1 490 ? -7.117  61.606  -55.756  1.00 135.78 ? 499 GLY B O   1 
ATOM   9177  N N   . ILE B 1 491 ? -5.714  63.354  -55.569  1.00 133.80 ? 500 ILE B N   1 
ATOM   9178  C CA  . ILE B 1 491 ? -5.923  63.812  -56.938  1.00 135.63 ? 500 ILE B CA  1 
ATOM   9179  C C   . ILE B 1 491 ? -4.892  63.196  -57.879  1.00 136.54 ? 500 ILE B C   1 
ATOM   9180  O O   . ILE B 1 491 ? -3.691  63.255  -57.622  1.00 136.99 ? 500 ILE B O   1 
ATOM   9181  C CB  . ILE B 1 491 ? -5.856  65.347  -57.036  1.00 137.58 ? 500 ILE B CB  1 
ATOM   9182  C CG1 . ILE B 1 491 ? -6.886  65.986  -56.103  1.00 136.93 ? 500 ILE B CG1 1 
ATOM   9183  C CG2 . ILE B 1 491 ? -6.079  65.800  -58.469  1.00 139.76 ? 500 ILE B CG2 1 
ATOM   9184  C CD1 . ILE B 1 491 ? -6.910  67.498  -56.160  1.00 139.12 ? 500 ILE B CD1 1 
ATOM   9185  N N   . SER B 1 492 ? -5.368  62.607  -58.971  1.00 150.80 ? 501 SER B N   1 
ATOM   9186  C CA  . SER B 1 492 ? -4.490  61.918  -59.912  1.00 151.77 ? 501 SER B CA  1 
ATOM   9187  C C   . SER B 1 492 ? -4.588  62.488  -61.326  1.00 154.20 ? 501 SER B C   1 
ATOM   9188  O O   . SER B 1 492 ? -5.395  63.378  -61.594  1.00 155.16 ? 501 SER B O   1 
ATOM   9189  C CB  . SER B 1 492 ? -4.804  60.420  -59.932  1.00 150.43 ? 501 SER B CB  1 
ATOM   9190  O OG  . SER B 1 492 ? -6.151  60.189  -60.307  1.00 150.24 ? 501 SER B OG  1 
ATOM   9191  N N   . ILE B 1 493 ? -3.761  61.962  -62.225  1.00 163.01 ? 502 ILE B N   1 
ATOM   9192  C CA  . ILE B 1 493 ? -3.737  62.411  -63.614  1.00 165.58 ? 502 ILE B CA  1 
ATOM   9193  C C   . ILE B 1 493 ? -4.205  61.304  -64.554  1.00 165.91 ? 502 ILE B C   1 
ATOM   9194  O O   . ILE B 1 493 ? -3.787  60.153  -64.428  1.00 164.96 ? 502 ILE B O   1 
ATOM   9195  C CB  . ILE B 1 493 ? -2.322  62.850  -64.038  1.00 167.45 ? 502 ILE B CB  1 
ATOM   9196  C CG1 . ILE B 1 493 ? -1.755  63.867  -63.045  1.00 167.37 ? 502 ILE B CG1 1 
ATOM   9197  C CG2 . ILE B 1 493 ? -2.339  63.419  -65.448  1.00 170.38 ? 502 ILE B CG2 1 
ATOM   9198  C CD1 . ILE B 1 493 ? -0.334  64.290  -63.349  1.00 169.35 ? 502 ILE B CD1 1 
ATOM   9199  N N   . MET B 1 494 ? -5.071  61.657  -65.498  1.00 144.89 ? 503 MET B N   1 
ATOM   9200  C CA  . MET B 1 494 ? -5.576  60.692  -66.469  1.00 145.71 ? 503 MET B CA  1 
ATOM   9201  C C   . MET B 1 494 ? -5.212  61.096  -67.893  1.00 148.86 ? 503 MET B C   1 
ATOM   9202  O O   . MET B 1 494 ? -5.545  62.193  -68.338  1.00 150.66 ? 503 MET B O   1 
ATOM   9203  C CB  . MET B 1 494 ? -7.093  60.542  -66.344  1.00 145.10 ? 503 MET B CB  1 
ATOM   9204  C CG  . MET B 1 494 ? -7.705  59.615  -67.384  1.00 146.43 ? 503 MET B CG  1 
ATOM   9205  S SD  . MET B 1 494 ? -9.508  59.644  -67.393  1.00 146.57 ? 503 MET B SD  1 
ATOM   9206  C CE  . MET B 1 494 ? -9.871  58.970  -65.775  1.00 143.03 ? 503 MET B CE  1 
ATOM   9207  N N   . ILE B 1 495 ? -4.524  60.206  -68.602  1.00 157.43 ? 504 ILE B N   1 
ATOM   9208  C CA  . ILE B 1 495 ? -4.152  60.456  -69.989  1.00 157.43 ? 504 ILE B CA  1 
ATOM   9209  C C   . ILE B 1 495 ? -4.633  59.321  -70.884  1.00 157.43 ? 504 ILE B C   1 
ATOM   9210  O O   . ILE B 1 495 ? -5.080  58.282  -70.398  1.00 157.43 ? 504 ILE B O   1 
ATOM   9211  C CB  . ILE B 1 495 ? -2.628  60.606  -70.152  1.00 157.43 ? 504 ILE B CB  1 
ATOM   9212  C CG1 . ILE B 1 495 ? -1.931  59.265  -69.914  1.00 157.43 ? 504 ILE B CG1 1 
ATOM   9213  C CG2 . ILE B 1 495 ? -2.089  61.675  -69.211  1.00 157.43 ? 504 ILE B CG2 1 
ATOM   9214  C CD1 . ILE B 1 495 ? -0.428  59.315  -70.095  1.00 157.43 ? 504 ILE B CD1 1 
ATOM   9215  N N   . LYS B 1 496 ? -4.539  59.526  -72.194  1.00 158.48 ? 505 LYS B N   1 
ATOM   9216  C CA  . LYS B 1 496 ? -4.930  58.503  -73.155  1.00 158.48 ? 505 LYS B CA  1 
ATOM   9217  C C   . LYS B 1 496 ? -3.845  57.439  -73.279  1.00 158.48 ? 505 LYS B C   1 
ATOM   9218  O O   . LYS B 1 496 ? -2.654  57.753  -73.271  1.00 158.48 ? 505 LYS B O   1 
ATOM   9219  C CB  . LYS B 1 496 ? -5.211  59.131  -74.521  1.00 158.48 ? 505 LYS B CB  1 
ATOM   9220  N N   . LYS B 1 497 ? -4.263  56.182  -73.387  1.00 156.86 ? 506 LYS B N   1 
ATOM   9221  C CA  . LYS B 1 497 ? -3.325  55.076  -73.535  1.00 156.86 ? 506 LYS B CA  1 
ATOM   9222  C C   . LYS B 1 497 ? -2.446  55.282  -74.763  1.00 156.86 ? 506 LYS B C   1 
ATOM   9223  O O   . LYS B 1 497 ? -2.940  55.290  -75.890  1.00 156.86 ? 506 LYS B O   1 
ATOM   9224  C CB  . LYS B 1 497 ? -4.076  53.746  -73.638  1.00 156.86 ? 506 LYS B CB  1 
ATOM   9225  N N   . PRO B 1 498 ? -1.133  55.453  -74.542  1.00 164.82 ? 507 PRO B N   1 
ATOM   9226  C CA  . PRO B 1 498 ? -0.166  55.716  -75.613  1.00 164.82 ? 507 PRO B CA  1 
ATOM   9227  C C   . PRO B 1 498 ? -0.176  54.643  -76.698  1.00 164.82 ? 507 PRO B C   1 
ATOM   9228  O O   . PRO B 1 498 ? 0.548   53.654  -76.597  1.00 164.82 ? 507 PRO B O   1 
ATOM   9229  C CB  . PRO B 1 498 ? 1.179   55.705  -74.879  1.00 164.82 ? 507 PRO B CB  1 
ATOM   9230  C CG  . PRO B 1 498 ? 0.845   56.052  -73.470  1.00 164.82 ? 507 PRO B CG  1 
ATOM   9231  C CD  . PRO B 1 498 ? -0.494  55.425  -73.216  1.00 164.82 ? 507 PRO B CD  1 
ATOM   9232  N N   . GLN B 1 499 ? -0.997  54.844  -77.723  1.00 190.57 ? 508 GLN B N   1 
ATOM   9233  C CA  . GLN B 1 499 ? -0.998  53.970  -78.888  1.00 190.57 ? 508 GLN B CA  1 
ATOM   9234  C C   . GLN B 1 499 ? -0.256  54.665  -80.020  1.00 190.57 ? 508 GLN B C   1 
ATOM   9235  O O   . GLN B 1 499 ? -0.639  54.564  -81.186  1.00 190.57 ? 508 GLN B O   1 
ATOM   9236  C CB  . GLN B 1 499 ? -2.430  53.642  -79.314  1.00 190.57 ? 508 GLN B CB  1 
ATOM   9237  N N   . LYS B 1 500 ? 0.811   55.372  -79.660  1.00 190.95 ? 509 LYS B N   1 
ATOM   9238  C CA  . LYS B 1 500 ? 1.563   56.187  -80.607  1.00 190.95 ? 509 LYS B CA  1 
ATOM   9239  C C   . LYS B 1 500 ? 2.330   55.352  -81.626  1.00 190.95 ? 509 LYS B C   1 
ATOM   9240  O O   . LYS B 1 500 ? 3.308   54.684  -81.291  1.00 190.95 ? 509 LYS B O   1 
ATOM   9241  C CB  . LYS B 1 500 ? 2.524   57.118  -79.864  1.00 190.95 ? 509 LYS B CB  1 
ATOM   9242  N N   . SER B 1 501 ? 1.875   55.400  -82.874  1.00 283.20 ? 510 SER B N   1 
ATOM   9243  C CA  . SER B 1 501 ? 2.554   54.727  -83.973  1.00 283.20 ? 510 SER B CA  1 
ATOM   9244  C C   . SER B 1 501 ? 2.617   55.652  -85.184  1.00 283.20 ? 510 SER B C   1 
ATOM   9245  O O   . SER B 1 501 ? 2.023   55.373  -86.226  1.00 283.20 ? 510 SER B O   1 
ATOM   9246  C CB  . SER B 1 501 ? 1.839   53.423  -84.333  1.00 283.20 ? 510 SER B CB  1 
ATOM   9247  N N   . LYS B 1 502 ? 3.339   56.758  -85.032  1.00 204.59 ? 511 LYS B N   1 
ATOM   9248  C CA  . LYS B 1 502 ? 3.450   57.762  -86.083  1.00 204.59 ? 511 LYS B CA  1 
ATOM   9249  C C   . LYS B 1 502 ? 4.569   57.424  -87.066  1.00 204.59 ? 511 LYS B C   1 
ATOM   9250  O O   . LYS B 1 502 ? 5.364   56.515  -86.816  1.00 204.59 ? 511 LYS B O   1 
ATOM   9251  C CB  . LYS B 1 502 ? 3.685   59.143  -85.465  1.00 204.59 ? 511 LYS B CB  1 
ATOM   9252  N N   . PRO B 1 503 ? 4.627   58.149  -88.196  1.00 242.67 ? 512 PRO B N   1 
ATOM   9253  C CA  . PRO B 1 503 ? 5.741   57.988  -89.135  1.00 242.67 ? 512 PRO B CA  1 
ATOM   9254  C C   . PRO B 1 503 ? 7.063   58.375  -88.484  1.00 242.67 ? 512 PRO B C   1 
ATOM   9255  O O   . PRO B 1 503 ? 7.746   57.516  -87.927  1.00 242.67 ? 512 PRO B O   1 
ATOM   9256  C CB  . PRO B 1 503 ? 5.403   58.979  -90.253  1.00 242.67 ? 512 PRO B CB  1 
ATOM   9257  C CG  . PRO B 1 503 ? 3.927   59.159  -90.172  1.00 242.67 ? 512 PRO B CG  1 
ATOM   9258  C CD  . PRO B 1 503 ? 3.595   59.065  -88.713  1.00 242.67 ? 512 PRO B CD  1 
ATOM   9259  N N   . GLY B 1 504 ? 7.407   59.658  -88.549  1.00 194.84 ? 513 GLY B N   1 
ATOM   9260  C CA  . GLY B 1 504 ? 8.644   60.144  -87.970  1.00 195.08 ? 513 GLY B CA  1 
ATOM   9261  C C   . GLY B 1 504 ? 9.852   59.405  -88.506  1.00 193.44 ? 513 GLY B C   1 
ATOM   9262  O O   . GLY B 1 504 ? 10.140  58.283  -88.091  1.00 190.46 ? 513 GLY B O   1 
ATOM   9263  N N   . VAL B 1 505 ? 10.560  60.038  -89.436  1.00 173.92 ? 514 VAL B N   1 
ATOM   9264  C CA  . VAL B 1 505 ? 11.767  59.456  -90.013  1.00 172.98 ? 514 VAL B CA  1 
ATOM   9265  C C   . VAL B 1 505 ? 12.810  59.199  -88.924  1.00 171.36 ? 514 VAL B C   1 
ATOM   9266  O O   . VAL B 1 505 ? 13.846  58.584  -89.174  1.00 170.28 ? 514 VAL B O   1 
ATOM   9267  C CB  . VAL B 1 505 ? 12.367  60.375  -91.093  1.00 176.35 ? 514 VAL B CB  1 
ATOM   9268  C CG1 . VAL B 1 505 ? 13.324  59.600  -91.986  1.00 175.55 ? 514 VAL B CG1 1 
ATOM   9269  C CG2 . VAL B 1 505 ? 11.261  61.008  -91.923  1.00 178.99 ? 514 VAL B CG2 1 
ATOM   9270  N N   . PHE B 1 506 ? 12.521  59.673  -87.715  1.00 286.58 ? 515 PHE B N   1 
ATOM   9271  C CA  . PHE B 1 506 ? 13.427  59.515  -86.580  1.00 285.54 ? 515 PHE B CA  1 
ATOM   9272  C C   . PHE B 1 506 ? 13.381  58.112  -85.976  1.00 282.00 ? 515 PHE B C   1 
ATOM   9273  O O   . PHE B 1 506 ? 14.049  57.840  -84.980  1.00 281.08 ? 515 PHE B O   1 
ATOM   9274  C CB  . PHE B 1 506 ? 13.135  60.561  -85.499  1.00 287.47 ? 515 PHE B CB  1 
ATOM   9275  C CG  . PHE B 1 506 ? 13.535  61.956  -85.884  1.00 291.28 ? 515 PHE B CG  1 
ATOM   9276  C CD1 . PHE B 1 506 ? 14.777  62.201  -86.444  1.00 292.49 ? 515 PHE B CD1 1 
ATOM   9277  C CD2 . PHE B 1 506 ? 12.676  63.024  -85.675  1.00 293.94 ? 515 PHE B CD2 1 
ATOM   9278  C CE1 . PHE B 1 506 ? 15.154  63.483  -86.799  1.00 296.29 ? 515 PHE B CE1 1 
ATOM   9279  C CE2 . PHE B 1 506 ? 13.048  64.309  -86.026  1.00 297.78 ? 515 PHE B CE2 1 
ATOM   9280  C CZ  . PHE B 1 506 ? 14.289  64.539  -86.589  1.00 298.96 ? 515 PHE B CZ  1 
ATOM   9281  N N   . SER B 1 507 ? 12.589  57.227  -86.575  1.00 259.80 ? 516 SER B N   1 
ATOM   9282  C CA  . SER B 1 507 ? 12.562  55.830  -86.154  1.00 256.71 ? 516 SER B CA  1 
ATOM   9283  C C   . SER B 1 507 ? 13.572  55.037  -86.972  1.00 255.80 ? 516 SER B C   1 
ATOM   9284  O O   . SER B 1 507 ? 13.736  53.829  -86.786  1.00 253.53 ? 516 SER B O   1 
ATOM   9285  C CB  . SER B 1 507 ? 11.161  55.236  -86.318  1.00 255.61 ? 516 SER B CB  1 
ATOM   9286  O OG  . SER B 1 507 ? 10.834  55.065  -87.686  1.00 256.21 ? 516 SER B OG  1 
ATOM   9287  N N   . PHE B 1 508 ? 14.243  55.734  -87.884  1.00 202.56 ? 517 PHE B N   1 
ATOM   9288  C CA  . PHE B 1 508 ? 15.266  55.137  -88.732  1.00 202.34 ? 517 PHE B CA  1 
ATOM   9289  C C   . PHE B 1 508 ? 16.649  55.558  -88.255  1.00 203.28 ? 517 PHE B C   1 
ATOM   9290  O O   . PHE B 1 508 ? 17.631  54.847  -88.449  1.00 202.56 ? 517 PHE B O   1 
ATOM   9291  C CB  . PHE B 1 508 ? 15.058  55.570  -90.183  1.00 204.40 ? 517 PHE B CB  1 
ATOM   9292  C CG  . PHE B 1 508 ? 16.201  55.225  -91.093  1.00 205.03 ? 517 PHE B CG  1 
ATOM   9293  C CD1 . PHE B 1 508 ? 16.302  53.962  -91.653  1.00 203.38 ? 517 PHE B CD1 1 
ATOM   9294  C CD2 . PHE B 1 508 ? 17.172  56.166  -91.395  1.00 207.58 ? 517 PHE B CD2 1 
ATOM   9295  C CE1 . PHE B 1 508 ? 17.352  53.643  -92.493  1.00 204.25 ? 517 PHE B CE1 1 
ATOM   9296  C CE2 . PHE B 1 508 ? 18.225  55.853  -92.235  1.00 208.42 ? 517 PHE B CE2 1 
ATOM   9297  C CZ  . PHE B 1 508 ? 18.315  54.589  -92.785  1.00 206.75 ? 517 PHE B CZ  1 
ATOM   9298  N N   . LEU B 1 509 ? 16.712  56.724  -87.624  1.00 328.47 ? 518 LEU B N   1 
ATOM   9299  C CA  . LEU B 1 509 ? 17.963  57.244  -87.088  1.00 329.85 ? 518 LEU B CA  1 
ATOM   9300  C C   . LEU B 1 509 ? 18.217  56.700  -85.685  1.00 328.18 ? 518 LEU B C   1 
ATOM   9301  O O   . LEU B 1 509 ? 19.303  56.870  -85.130  1.00 329.04 ? 518 LEU B O   1 
ATOM   9302  C CB  . LEU B 1 509 ? 17.939  58.776  -87.066  1.00 333.17 ? 518 LEU B CB  1 
ATOM   9303  C CG  . LEU B 1 509 ? 17.610  59.462  -88.396  1.00 335.46 ? 518 LEU B CG  1 
ATOM   9304  C CD1 . LEU B 1 509 ? 17.482  60.972  -88.224  1.00 338.94 ? 518 LEU B CD1 1 
ATOM   9305  C CD2 . LEU B 1 509 ? 18.648  59.124  -89.456  1.00 336.09 ? 518 LEU B CD2 1 
ATOM   9306  N N   . ASP B 1 510 ? 17.210  56.046  -85.115  1.00 324.77 ? 519 ASP B N   1 
ATOM   9307  C CA  . ASP B 1 510 ? 17.319  55.492  -83.768  1.00 323.38 ? 519 ASP B CA  1 
ATOM   9308  C C   . ASP B 1 510 ? 18.071  54.164  -83.740  1.00 321.39 ? 519 ASP B C   1 
ATOM   9309  O O   . ASP B 1 510 ? 19.027  54.011  -82.977  1.00 321.67 ? 519 ASP B O   1 
ATOM   9310  C CB  . ASP B 1 510 ? 15.936  55.334  -83.132  1.00 322.28 ? 519 ASP B CB  1 
ATOM   9311  C CG  . ASP B 1 510 ? 15.321  56.660  -82.748  1.00 324.58 ? 519 ASP B CG  1 
ATOM   9312  O OD1 . ASP B 1 510 ? 15.969  57.702  -82.984  1.00 327.06 ? 519 ASP B OD1 1 
ATOM   9313  O OD2 . ASP B 1 510 ? 14.195  56.664  -82.210  1.00 324.16 ? 519 ASP B OD2 1 
ATOM   9314  N N   . PRO B 1 511 ? 17.644  53.201  -84.576  1.00 154.22 ? 520 PRO B N   1 
ATOM   9315  C CA  . PRO B 1 511 ? 18.299  51.891  -84.609  1.00 152.56 ? 520 PRO B CA  1 
ATOM   9316  C C   . PRO B 1 511 ? 19.807  52.065  -84.629  1.00 153.91 ? 520 PRO B C   1 
ATOM   9317  O O   . PRO B 1 511 ? 20.505  51.597  -83.726  1.00 153.60 ? 520 PRO B O   1 
ATOM   9318  C CB  . PRO B 1 511 ? 17.827  51.305  -85.935  1.00 151.87 ? 520 PRO B CB  1 
ATOM   9319  C CG  . PRO B 1 511 ? 16.484  51.919  -86.141  1.00 152.17 ? 520 PRO B CG  1 
ATOM   9320  C CD  . PRO B 1 511 ? 16.600  53.317  -85.610  1.00 154.22 ? 520 PRO B CD  1 
ATOM   9321  N N   . LEU B 1 512 ? 20.313  52.735  -85.651  1.00 202.12 ? 521 LEU B N   1 
ATOM   9322  C CA  . LEU B 1 512 ? 21.724  53.038  -85.670  1.00 203.85 ? 521 LEU B CA  1 
ATOM   9323  C C   . LEU B 1 512 ? 21.891  54.487  -85.207  1.00 206.32 ? 521 LEU B C   1 
ATOM   9324  O O   . LEU B 1 512 ? 21.376  55.428  -85.812  1.00 207.78 ? 521 LEU B O   1 
ATOM   9325  C CB  . LEU B 1 512 ? 22.302  52.765  -87.063  1.00 204.57 ? 521 LEU B CB  1 
ATOM   9326  C CG  . LEU B 1 512 ? 23.812  52.594  -87.354  1.00 206.03 ? 521 LEU B CG  1 
ATOM   9327  C CD1 . LEU B 1 512 ? 23.978  51.920  -88.718  1.00 206.00 ? 521 LEU B CD1 1 
ATOM   9328  C CD2 . LEU B 1 512 ? 24.539  53.933  -87.286  1.00 209.02 ? 521 LEU B CD2 1 
ATOM   9329  N N   . ALA B 1 513 ? 22.567  54.621  -84.070  1.00 179.12 ? 522 ALA B N   1 
ATOM   9330  C CA  . ALA B 1 513 ? 22.734  55.880  -83.359  1.00 181.55 ? 522 ALA B CA  1 
ATOM   9331  C C   . ALA B 1 513 ? 23.400  56.908  -84.247  1.00 184.42 ? 522 ALA B C   1 
ATOM   9332  O O   . ALA B 1 513 ? 24.213  56.565  -85.108  1.00 184.84 ? 522 ALA B O   1 
ATOM   9333  C CB  . ALA B 1 513 ? 23.552  55.667  -82.093  1.00 182.05 ? 522 ALA B CB  1 
ATOM   9334  N N   . TYR B 1 514 ? 23.062  58.173  -84.029  1.00 242.54 ? 523 TYR B N   1 
ATOM   9335  C CA  . TYR B 1 514 ? 23.661  59.259  -84.792  1.00 245.77 ? 523 TYR B CA  1 
ATOM   9336  C C   . TYR B 1 514 ? 25.180  59.228  -84.668  1.00 247.46 ? 523 TYR B C   1 
ATOM   9337  O O   . TYR B 1 514 ? 25.899  59.557  -85.610  1.00 249.37 ? 523 TYR B O   1 
ATOM   9338  C CB  . TYR B 1 514 ? 23.139  60.600  -84.287  1.00 248.28 ? 523 TYR B CB  1 
ATOM   9339  C CG  . TYR B 1 514 ? 21.640  60.776  -84.406  1.00 247.25 ? 523 TYR B CG  1 
ATOM   9340  C CD1 . TYR B 1 514 ? 20.783  60.338  -83.403  1.00 245.24 ? 523 TYR B CD1 1 
ATOM   9341  C CD2 . TYR B 1 514 ? 21.084  61.397  -85.516  1.00 248.63 ? 523 TYR B CD2 1 
ATOM   9342  C CE1 . TYR B 1 514 ? 19.414  60.507  -83.509  1.00 244.57 ? 523 TYR B CE1 1 
ATOM   9343  C CE2 . TYR B 1 514 ? 19.721  61.571  -85.631  1.00 248.04 ? 523 TYR B CE2 1 
ATOM   9344  C CZ  . TYR B 1 514 ? 18.889  61.125  -84.626  1.00 245.98 ? 523 TYR B CZ  1 
ATOM   9345  O OH  . TYR B 1 514 ? 17.530  61.300  -84.745  1.00 245.64 ? 523 TYR B OH  1 
ATOM   9346  N N   . GLU B 1 515 ? 25.657  58.836  -83.491  1.00 222.50 ? 524 GLU B N   1 
ATOM   9347  C CA  . GLU B 1 515 ? 27.086  58.771  -83.229  1.00 224.31 ? 524 GLU B CA  1 
ATOM   9348  C C   . GLU B 1 515 ? 27.727  57.685  -84.079  1.00 222.94 ? 524 GLU B C   1 
ATOM   9349  O O   . GLU B 1 515 ? 28.872  57.816  -84.515  1.00 225.03 ? 524 GLU B O   1 
ATOM   9350  C CB  . GLU B 1 515 ? 27.354  58.497  -81.748  1.00 224.21 ? 524 GLU B CB  1 
ATOM   9351  C CG  . GLU B 1 515 ? 26.923  59.615  -80.810  1.00 226.31 ? 524 GLU B CG  1 
ATOM   9352  C CD  . GLU B 1 515 ? 25.421  59.659  -80.593  1.00 224.39 ? 524 GLU B CD  1 
ATOM   9353  O OE1 . GLU B 1 515 ? 24.745  58.648  -80.877  1.00 221.14 ? 524 GLU B OE1 1 
ATOM   9354  O OE2 . GLU B 1 515 ? 24.919  60.706  -80.132  1.00 226.37 ? 524 GLU B OE2 1 
ATOM   9355  N N   . ILE B 1 516 ? 26.978  56.612  -84.310  1.00 205.37 ? 525 ILE B N   1 
ATOM   9356  C CA  . ILE B 1 516 ? 27.478  55.486  -85.086  1.00 204.05 ? 525 ILE B CA  1 
ATOM   9357  C C   . ILE B 1 516 ? 27.472  55.790  -86.584  1.00 205.07 ? 525 ILE B C   1 
ATOM   9358  O O   . ILE B 1 516 ? 28.400  55.416  -87.299  1.00 206.04 ? 525 ILE B O   1 
ATOM   9359  C CB  . ILE B 1 516 ? 26.666  54.207  -84.817  1.00 200.53 ? 525 ILE B CB  1 
ATOM   9360  C CG1 . ILE B 1 516 ? 26.500  53.984  -83.313  1.00 199.75 ? 525 ILE B CG1 1 
ATOM   9361  C CG2 . ILE B 1 516 ? 27.329  53.007  -85.476  1.00 199.62 ? 525 ILE B CG2 1 
ATOM   9362  C CD1 . ILE B 1 516 ? 25.714  52.740  -82.972  1.00 196.63 ? 525 ILE B CD1 1 
ATOM   9363  N N   . TRP B 1 517 ? 26.427  56.467  -87.057  1.00 186.13 ? 526 TRP B N   1 
ATOM   9364  C CA  . TRP B 1 517 ? 26.370  56.887  -88.455  1.00 187.67 ? 526 TRP B CA  1 
ATOM   9365  C C   . TRP B 1 517 ? 27.555  57.791  -88.772  1.00 191.36 ? 526 TRP B C   1 
ATOM   9366  O O   . TRP B 1 517 ? 28.079  57.783  -89.887  1.00 192.89 ? 526 TRP B O   1 
ATOM   9367  C CB  . TRP B 1 517 ? 25.065  57.627  -88.765  1.00 187.78 ? 526 TRP B CB  1 
ATOM   9368  C CG  . TRP B 1 517 ? 23.847  56.758  -88.823  1.00 184.63 ? 526 TRP B CG  1 
ATOM   9369  C CD1 . TRP B 1 517 ? 22.811  56.744  -87.934  1.00 182.94 ? 526 TRP B CD1 1 
ATOM   9370  C CD2 . TRP B 1 517 ? 23.526  55.786  -89.826  1.00 183.14 ? 526 TRP B CD2 1 
ATOM   9371  N NE1 . TRP B 1 517 ? 21.870  55.824  -88.318  1.00 180.47 ? 526 TRP B NE1 1 
ATOM   9372  C CE2 . TRP B 1 517 ? 22.285  55.221  -89.475  1.00 180.56 ? 526 TRP B CE2 1 
ATOM   9373  C CE3 . TRP B 1 517 ? 24.172  55.336  -90.983  1.00 184.00 ? 526 TRP B CE3 1 
ATOM   9374  C CZ2 . TRP B 1 517 ? 21.674  54.229  -90.238  1.00 178.86 ? 526 TRP B CZ2 1 
ATOM   9375  C CZ3 . TRP B 1 517 ? 23.560  54.350  -91.742  1.00 182.32 ? 526 TRP B CZ3 1 
ATOM   9376  C CH2 . TRP B 1 517 ? 22.324  53.809  -91.366  1.00 179.79 ? 526 TRP B CH2 1 
ATOM   9377  N N   . MET B 1 518 ? 27.970  58.573  -87.782  1.00 205.15 ? 527 MET B N   1 
ATOM   9378  C CA  . MET B 1 518 ? 29.085  59.492  -87.953  1.00 209.00 ? 527 MET B CA  1 
ATOM   9379  C C   . MET B 1 518 ? 30.396  58.735  -88.117  1.00 209.49 ? 527 MET B C   1 
ATOM   9380  O O   . MET B 1 518 ? 31.096  58.902  -89.114  1.00 211.64 ? 527 MET B O   1 
ATOM   9381  C CB  . MET B 1 518 ? 29.181  60.453  -86.766  1.00 210.86 ? 527 MET B CB  1 
ATOM   9382  C CG  . MET B 1 518 ? 28.018  61.423  -86.653  1.00 211.43 ? 527 MET B CG  1 
ATOM   9383  S SD  . MET B 1 518 ? 27.857  62.489  -88.098  1.00 214.66 ? 527 MET B SD  1 
ATOM   9384  C CE  . MET B 1 518 ? 29.398  63.399  -88.019  1.00 219.37 ? 527 MET B CE  1 
ATOM   9385  N N   . CYS B 1 519 ? 30.720  57.900  -87.135  1.00 218.57 ? 528 CYS B N   1 
ATOM   9386  C CA  . CYS B 1 519 ? 31.970  57.149  -87.149  1.00 219.24 ? 528 CYS B CA  1 
ATOM   9387  C C   . CYS B 1 519 ? 32.091  56.242  -88.371  1.00 218.23 ? 528 CYS B C   1 
ATOM   9388  O O   . CYS B 1 519 ? 33.179  56.078  -88.924  1.00 220.27 ? 528 CYS B O   1 
ATOM   9389  C CB  . CYS B 1 519 ? 32.124  56.333  -85.864  1.00 217.48 ? 528 CYS B CB  1 
ATOM   9390  S SG  . CYS B 1 519 ? 32.403  57.329  -84.382  1.00 219.77 ? 528 CYS B SG  1 
ATOM   9391  N N   . ILE B 1 520 ? 30.975  55.654  -88.790  1.00 207.33 ? 529 ILE B N   1 
ATOM   9392  C CA  . ILE B 1 520 ? 30.974  54.789  -89.965  1.00 206.53 ? 529 ILE B CA  1 
ATOM   9393  C C   . ILE B 1 520 ? 31.272  55.600  -91.223  1.00 209.55 ? 529 ILE B C   1 
ATOM   9394  O O   . ILE B 1 520 ? 31.703  55.055  -92.239  1.00 210.25 ? 529 ILE B O   1 
ATOM   9395  C CB  . ILE B 1 520 ? 29.635  54.040  -90.130  1.00 203.12 ? 529 ILE B CB  1 
ATOM   9396  C CG1 . ILE B 1 520 ? 29.785  52.890  -91.129  1.00 202.30 ? 529 ILE B CG1 1 
ATOM   9397  C CG2 . ILE B 1 520 ? 28.537  54.989  -90.576  1.00 203.47 ? 529 ILE B CG2 1 
ATOM   9398  C CD1 . ILE B 1 520 ? 28.478  52.211  -91.476  1.00 199.55 ? 529 ILE B CD1 1 
ATOM   9399  N N   . VAL B 1 521 ? 31.041  56.908  -91.145  1.00 180.07 ? 530 VAL B N   1 
ATOM   9400  C CA  . VAL B 1 521 ? 31.348  57.811  -92.249  1.00 183.50 ? 530 VAL B CA  1 
ATOM   9401  C C   . VAL B 1 521 ? 32.790  58.303  -92.156  1.00 187.03 ? 530 VAL B C   1 
ATOM   9402  O O   . VAL B 1 521 ? 33.463  58.478  -93.172  1.00 189.71 ? 530 VAL B O   1 
ATOM   9403  C CB  . VAL B 1 521 ? 30.388  59.016  -92.280  1.00 184.58 ? 530 VAL B CB  1 
ATOM   9404  C CG1 . VAL B 1 521 ? 30.909  60.091  -93.220  1.00 188.93 ? 530 VAL B CG1 1 
ATOM   9405  C CG2 . VAL B 1 521 ? 28.993  58.571  -92.693  1.00 181.86 ? 530 VAL B CG2 1 
ATOM   9406  N N   . PHE B 1 522 ? 33.259  58.523  -90.932  1.00 221.83 ? 531 PHE B N   1 
ATOM   9407  C CA  . PHE B 1 522 ? 34.643  58.926  -90.708  1.00 225.25 ? 531 PHE B CA  1 
ATOM   9408  C C   . PHE B 1 522 ? 35.599  57.812  -91.118  1.00 225.14 ? 531 PHE B C   1 
ATOM   9409  O O   . PHE B 1 522 ? 36.621  58.062  -91.758  1.00 228.41 ? 531 PHE B O   1 
ATOM   9410  C CB  . PHE B 1 522 ? 34.870  59.307  -89.244  1.00 225.55 ? 531 PHE B CB  1 
ATOM   9411  C CG  . PHE B 1 522 ? 34.324  60.657  -88.878  1.00 227.38 ? 531 PHE B CG  1 
ATOM   9412  C CD1 . PHE B 1 522 ? 33.147  60.772  -88.158  1.00 224.96 ? 531 PHE B CD1 1 
ATOM   9413  C CD2 . PHE B 1 522 ? 34.987  61.813  -89.257  1.00 231.83 ? 531 PHE B CD2 1 
ATOM   9414  C CE1 . PHE B 1 522 ? 32.642  62.013  -87.820  1.00 226.94 ? 531 PHE B CE1 1 
ATOM   9415  C CE2 . PHE B 1 522 ? 34.488  63.057  -88.922  1.00 233.86 ? 531 PHE B CE2 1 
ATOM   9416  C CZ  . PHE B 1 522 ? 33.313  63.157  -88.203  1.00 231.42 ? 531 PHE B CZ  1 
ATOM   9417  N N   . ALA B 1 523 ? 35.262  56.582  -90.743  1.00 229.47 ? 532 ALA B N   1 
ATOM   9418  C CA  . ALA B 1 523 ? 36.048  55.420  -91.136  1.00 229.24 ? 532 ALA B CA  1 
ATOM   9419  C C   . ALA B 1 523 ? 35.871  55.156  -92.627  1.00 229.71 ? 532 ALA B C   1 
ATOM   9420  O O   . ALA B 1 523 ? 36.737  54.565  -93.273  1.00 231.19 ? 532 ALA B O   1 
ATOM   9421  C CB  . ALA B 1 523 ? 35.639  54.203  -90.325  1.00 225.58 ? 532 ALA B CB  1 
ATOM   9422  N N   . TYR B 1 524 ? 34.739  55.599  -93.163  1.00 204.84 ? 533 TYR B N   1 
ATOM   9423  C CA  . TYR B 1 524 ? 34.450  55.469  -94.586  1.00 205.66 ? 533 TYR B CA  1 
ATOM   9424  C C   . TYR B 1 524 ? 35.480  56.234  -95.410  1.00 210.23 ? 533 TYR B C   1 
ATOM   9425  O O   . TYR B 1 524 ? 36.120  55.672  -96.300  1.00 211.70 ? 533 TYR B O   1 
ATOM   9426  C CB  . TYR B 1 524 ? 33.040  55.982  -94.884  1.00 204.32 ? 533 TYR B CB  1 
ATOM   9427  C CG  . TYR B 1 524 ? 32.695  56.063  -96.353  1.00 205.88 ? 533 TYR B CG  1 
ATOM   9428  C CD1 . TYR B 1 524 ? 32.075  55.003  -97.001  1.00 203.79 ? 533 TYR B CD1 1 
ATOM   9429  C CD2 . TYR B 1 524 ? 32.979  57.205  -97.090  1.00 209.78 ? 533 TYR B CD2 1 
ATOM   9430  C CE1 . TYR B 1 524 ? 31.753  55.076  -98.341  1.00 205.56 ? 533 TYR B CE1 1 
ATOM   9431  C CE2 . TYR B 1 524 ? 32.661  57.287  -98.430  1.00 211.58 ? 533 TYR B CE2 1 
ATOM   9432  C CZ  . TYR B 1 524 ? 32.048  56.221  -99.051  1.00 209.47 ? 533 TYR B CZ  1 
ATOM   9433  O OH  . TYR B 1 524 ? 31.731  56.302  -100.386 1.00 211.60 ? 533 TYR B OH  1 
ATOM   9434  N N   . ILE B 1 525 ? 35.636  57.519  -95.107  1.00 193.32 ? 534 ILE B N   1 
ATOM   9435  C CA  . ILE B 1 525 ? 36.638  58.342  -95.769  1.00 198.05 ? 534 ILE B CA  1 
ATOM   9436  C C   . ILE B 1 525 ? 38.025  57.997  -95.241  1.00 199.68 ? 534 ILE B C   1 
ATOM   9437  O O   . ILE B 1 525 ? 39.036  58.323  -95.862  1.00 203.53 ? 534 ILE B O   1 
ATOM   9438  C CB  . ILE B 1 525 ? 36.374  59.845  -95.556  1.00 200.58 ? 534 ILE B CB  1 
ATOM   9439  C CG1 . ILE B 1 525 ? 36.629  60.233  -94.098  1.00 200.22 ? 534 ILE B CG1 1 
ATOM   9440  C CG2 . ILE B 1 525 ? 34.954  60.202  -95.972  1.00 199.09 ? 534 ILE B CG2 1 
ATOM   9441  C CD1 . ILE B 1 525 ? 36.450  61.709  -93.818  1.00 203.14 ? 534 ILE B CD1 1 
ATOM   9442  N N   . GLY B 1 526 ? 38.062  57.334  -94.089  1.00 213.93 ? 535 GLY B N   1 
ATOM   9443  C CA  . GLY B 1 526 ? 39.314  56.913  -93.489  1.00 215.37 ? 535 GLY B CA  1 
ATOM   9444  C C   . GLY B 1 526 ? 39.928  55.746  -94.236  1.00 215.43 ? 535 GLY B C   1 
ATOM   9445  O O   . GLY B 1 526 ? 41.121  55.471  -94.107  1.00 217.78 ? 535 GLY B O   1 
ATOM   9446  N N   . VAL B 1 527 ? 39.106  55.056  -95.019  1.00 220.84 ? 536 VAL B N   1 
ATOM   9447  C CA  . VAL B 1 527 ? 39.576  53.941  -95.832  1.00 221.06 ? 536 VAL B CA  1 
ATOM   9448  C C   . VAL B 1 527 ? 39.839  54.394  -97.264  1.00 224.47 ? 536 VAL B C   1 
ATOM   9449  O O   . VAL B 1 527 ? 40.784  53.938  -97.907  1.00 226.99 ? 536 VAL B O   1 
ATOM   9450  C CB  . VAL B 1 527 ? 38.563  52.780  -95.837  1.00 216.79 ? 536 VAL B CB  1 
ATOM   9451  C CG1 . VAL B 1 527 ? 38.960  51.729  -96.862  1.00 217.57 ? 536 VAL B CG1 1 
ATOM   9452  C CG2 . VAL B 1 527 ? 38.458  52.167  -94.451  1.00 213.89 ? 536 VAL B CG2 1 
ATOM   9453  N N   . SER B 1 528 ? 39.000  55.301  -97.754  1.00 248.54 ? 537 SER B N   1 
ATOM   9454  C CA  . SER B 1 528 ? 39.157  55.839  -99.100  1.00 252.10 ? 537 SER B CA  1 
ATOM   9455  C C   . SER B 1 528 ? 40.401  56.718  -99.196  1.00 256.93 ? 537 SER B C   1 
ATOM   9456  O O   . SER B 1 528 ? 40.865  57.034  -100.292 1.00 260.63 ? 537 SER B O   1 
ATOM   9457  C CB  . SER B 1 528 ? 37.915  56.632  -99.513  1.00 251.53 ? 537 SER B CB  1 
ATOM   9458  O OG  . SER B 1 528 ? 37.716  57.748  -98.664  1.00 251.91 ? 537 SER B OG  1 
ATOM   9459  N N   . VAL B 1 529 ? 40.935  57.113  -98.044  1.00 211.04 ? 538 VAL B N   1 
ATOM   9460  C CA  . VAL B 1 529 ? 42.156  57.908  -98.002  1.00 215.74 ? 538 VAL B CA  1 
ATOM   9461  C C   . VAL B 1 529 ? 43.377  57.002  -97.867  1.00 216.94 ? 538 VAL B C   1 
ATOM   9462  O O   . VAL B 1 529 ? 44.452  57.313  -98.382  1.00 221.33 ? 538 VAL B O   1 
ATOM   9463  C CB  . VAL B 1 529 ? 42.136  58.933  -96.848  1.00 216.20 ? 538 VAL B CB  1 
ATOM   9464  C CG1 . VAL B 1 529 ? 42.136  58.224  -95.503  1.00 212.88 ? 538 VAL B CG1 1 
ATOM   9465  C CG2 . VAL B 1 529 ? 43.323  59.878  -96.955  1.00 221.67 ? 538 VAL B CG2 1 
ATOM   9466  N N   . VAL B 1 530 ? 43.204  55.880  -97.175  1.00 252.48 ? 539 VAL B N   1 
ATOM   9467  C CA  . VAL B 1 530 ? 44.268  54.893  -97.037  1.00 253.44 ? 539 VAL B CA  1 
ATOM   9468  C C   . VAL B 1 530 ? 44.519  54.205  -98.374  1.00 254.93 ? 539 VAL B C   1 
ATOM   9469  O O   . VAL B 1 530 ? 45.665  53.981  -98.766  1.00 258.47 ? 539 VAL B O   1 
ATOM   9470  C CB  . VAL B 1 530 ? 43.926  53.836  -95.968  1.00 249.26 ? 539 VAL B CB  1 
ATOM   9471  C CG1 . VAL B 1 530 ? 44.847  52.631  -96.095  1.00 250.15 ? 539 VAL B CG1 1 
ATOM   9472  C CG2 . VAL B 1 530 ? 44.017  54.442  -94.576  1.00 248.88 ? 539 VAL B CG2 1 
ATOM   9473  N N   . LEU B 1 531 ? 43.436  53.875  -99.071  1.00 231.25 ? 540 LEU B N   1 
ATOM   9474  C CA  . LEU B 1 531 ? 43.528  53.295  -100.404 1.00 232.84 ? 540 LEU B CA  1 
ATOM   9475  C C   . LEU B 1 531 ? 44.107  54.315  -101.377 1.00 237.91 ? 540 LEU B C   1 
ATOM   9476  O O   . LEU B 1 531 ? 44.824  53.961  -102.313 1.00 241.13 ? 540 LEU B O   1 
ATOM   9477  C CB  . LEU B 1 531 ? 42.150  52.840  -100.885 1.00 229.35 ? 540 LEU B CB  1 
ATOM   9478  C CG  . LEU B 1 531 ? 41.483  51.707  -100.104 1.00 224.52 ? 540 LEU B CG  1 
ATOM   9479  C CD1 . LEU B 1 531 ? 40.029  51.549  -100.522 1.00 221.45 ? 540 LEU B CD1 1 
ATOM   9480  C CD2 . LEU B 1 531 ? 42.245  50.403  -100.289 1.00 225.05 ? 540 LEU B CD2 1 
ATOM   9481  N N   . PHE B 1 532 ? 43.789  55.584  -101.145 1.00 226.39 ? 541 PHE B N   1 
ATOM   9482  C CA  . PHE B 1 532 ? 44.272  56.668  -101.991 1.00 231.41 ? 541 PHE B CA  1 
ATOM   9483  C C   . PHE B 1 532 ? 45.792  56.778  -101.944 1.00 235.83 ? 541 PHE B C   1 
ATOM   9484  O O   . PHE B 1 532 ? 46.418  57.250  -102.893 1.00 240.49 ? 541 PHE B O   1 
ATOM   9485  C CB  . PHE B 1 532 ? 43.632  57.995  -101.574 1.00 231.55 ? 541 PHE B CB  1 
ATOM   9486  C CG  . PHE B 1 532 ? 44.249  59.197  -102.227 1.00 237.14 ? 541 PHE B CG  1 
ATOM   9487  C CD1 . PHE B 1 532 ? 44.011  59.475  -103.563 1.00 239.91 ? 541 PHE B CD1 1 
ATOM   9488  C CD2 . PHE B 1 532 ? 45.064  60.052  -101.504 1.00 239.94 ? 541 PHE B CD2 1 
ATOM   9489  C CE1 . PHE B 1 532 ? 44.579  60.582  -104.167 1.00 245.37 ? 541 PHE B CE1 1 
ATOM   9490  C CE2 . PHE B 1 532 ? 45.634  61.161  -102.102 1.00 245.38 ? 541 PHE B CE2 1 
ATOM   9491  C CZ  . PHE B 1 532 ? 45.391  61.426  -103.435 1.00 248.08 ? 541 PHE B CZ  1 
ATOM   9492  N N   . LEU B 1 533 ? 46.380  56.340  -100.836 1.00 244.49 ? 542 LEU B N   1 
ATOM   9493  C CA  . LEU B 1 533 ? 47.827  56.391  -100.667 1.00 248.67 ? 542 LEU B CA  1 
ATOM   9494  C C   . LEU B 1 533 ? 48.503  55.176  -101.291 1.00 249.66 ? 542 LEU B C   1 
ATOM   9495  O O   . LEU B 1 533 ? 49.726  55.138  -101.430 1.00 253.77 ? 542 LEU B O   1 
ATOM   9496  C CB  . LEU B 1 533 ? 48.192  56.489  -99.184  1.00 247.51 ? 542 LEU B CB  1 
ATOM   9497  C CG  . LEU B 1 533 ? 47.638  57.697  -98.425  1.00 247.00 ? 542 LEU B CG  1 
ATOM   9498  C CD1 . LEU B 1 533 ? 48.075  57.661  -96.968  1.00 246.23 ? 542 LEU B CD1 1 
ATOM   9499  C CD2 . LEU B 1 533 ? 48.073  58.995  -99.087  1.00 252.15 ? 542 LEU B CD2 1 
ATOM   9500  N N   . VAL B 1 534 ? 47.702  54.185  -101.668 1.00 230.92 ? 543 VAL B N   1 
ATOM   9501  C CA  . VAL B 1 534 ? 48.225  52.962  -102.267 1.00 231.72 ? 543 VAL B CA  1 
ATOM   9502  C C   . VAL B 1 534 ? 48.614  53.172  -103.728 1.00 236.23 ? 543 VAL B C   1 
ATOM   9503  O O   . VAL B 1 534 ? 49.720  52.820  -104.143 1.00 240.10 ? 543 VAL B O   1 
ATOM   9504  C CB  . VAL B 1 534 ? 47.209  51.808  -102.171 1.00 226.69 ? 543 VAL B CB  1 
ATOM   9505  C CG1 . VAL B 1 534 ? 47.737  50.576  -102.891 1.00 228.07 ? 543 VAL B CG1 1 
ATOM   9506  C CG2 . VAL B 1 534 ? 46.903  51.493  -100.716 1.00 222.61 ? 543 VAL B CG2 1 
ATOM   9507  N N   . SER B 1 535 ? 47.700  53.746  -104.505 1.00 273.27 ? 544 SER B N   1 
ATOM   9508  C CA  . SER B 1 535 ? 47.947  53.999  -105.921 1.00 277.70 ? 544 SER B CA  1 
ATOM   9509  C C   . SER B 1 535 ? 49.077  55.006  -106.112 1.00 283.38 ? 544 SER B C   1 
ATOM   9510  O O   . SER B 1 535 ? 50.138  54.669  -106.637 1.00 287.44 ? 544 SER B O   1 
ATOM   9511  C CB  . SER B 1 535 ? 46.675  54.501  -106.609 1.00 276.43 ? 544 SER B CB  1 
ATOM   9512  O OG  . SER B 1 535 ? 46.267  55.751  -106.081 1.00 276.19 ? 544 SER B OG  1 
ATOM   9513  N N   . THR B 1 559 ? 49.830  66.394  -111.961 1.00 291.33 ? 568 THR B N   1 
ATOM   9514  C CA  . THR B 1 559 ? 49.992  65.513  -110.811 1.00 285.74 ? 568 THR B CA  1 
ATOM   9515  C C   . THR B 1 559 ? 48.903  65.756  -109.771 1.00 280.09 ? 568 THR B C   1 
ATOM   9516  O O   . THR B 1 559 ? 48.503  64.841  -109.050 1.00 274.21 ? 568 THR B O   1 
ATOM   9517  C CB  . THR B 1 559 ? 51.370  65.694  -110.149 1.00 288.75 ? 568 THR B CB  1 
ATOM   9518  N N   . ASN B 1 560 ? 48.426  66.995  -109.698 1.00 301.45 ? 569 ASN B N   1 
ATOM   9519  C CA  . ASN B 1 560 ? 47.375  67.358  -108.755 1.00 296.84 ? 569 ASN B CA  1 
ATOM   9520  C C   . ASN B 1 560 ? 46.022  66.782  -109.160 1.00 292.33 ? 569 ASN B C   1 
ATOM   9521  O O   . ASN B 1 560 ? 45.240  66.351  -108.312 1.00 286.52 ? 569 ASN B O   1 
ATOM   9522  C CB  . ASN B 1 560 ? 47.280  68.878  -108.617 1.00 301.08 ? 569 ASN B CB  1 
ATOM   9523  N N   . GLU B 1 561 ? 45.754  66.779  -110.463 1.00 317.52 ? 570 GLU B N   1 
ATOM   9524  C CA  . GLU B 1 561 ? 44.510  66.230  -110.989 1.00 314.09 ? 570 GLU B CA  1 
ATOM   9525  C C   . GLU B 1 561 ? 44.526  64.707  -110.930 1.00 309.47 ? 570 GLU B C   1 
ATOM   9526  O O   . GLU B 1 561 ? 43.487  64.072  -110.745 1.00 304.44 ? 570 GLU B O   1 
ATOM   9527  C CB  . GLU B 1 561 ? 44.283  66.700  -112.426 1.00 319.43 ? 570 GLU B CB  1 
ATOM   9528  N N   . PHE B 1 562 ? 45.712  64.128  -111.088 1.00 285.70 ? 571 PHE B N   1 
ATOM   9529  C CA  . PHE B 1 562 ? 45.877  62.681  -111.013 1.00 282.00 ? 571 PHE B CA  1 
ATOM   9530  C C   . PHE B 1 562 ? 45.486  62.171  -109.631 1.00 275.53 ? 571 PHE B C   1 
ATOM   9531  O O   . PHE B 1 562 ? 45.092  61.015  -109.471 1.00 271.10 ? 571 PHE B O   1 
ATOM   9532  C CB  . PHE B 1 562 ? 47.320  62.288  -111.333 1.00 286.02 ? 571 PHE B CB  1 
ATOM   9533  N N   . GLY B 1 563 ? 45.600  63.043  -108.633 1.00 304.00 ? 572 GLY B N   1 
ATOM   9534  C CA  . GLY B 1 563 ? 45.214  62.706  -107.277 1.00 298.42 ? 572 GLY B CA  1 
ATOM   9535  C C   . GLY B 1 563 ? 43.724  62.882  -107.063 1.00 294.34 ? 572 GLY B C   1 
ATOM   9536  O O   . GLY B 1 563 ? 43.137  62.266  -106.174 1.00 288.94 ? 572 GLY B O   1 
ATOM   9537  N N   . ILE B 1 564 ? 43.111  63.729  -107.885 1.00 328.55 ? 573 ILE B N   1 
ATOM   9538  C CA  . ILE B 1 564 ? 41.675  63.970  -107.806 1.00 325.45 ? 573 ILE B CA  1 
ATOM   9539  C C   . ILE B 1 564 ? 40.899  62.832  -108.460 1.00 322.30 ? 573 ILE B C   1 
ATOM   9540  O O   . ILE B 1 564 ? 39.898  62.359  -107.921 1.00 317.26 ? 573 ILE B O   1 
ATOM   9541  C CB  . ILE B 1 564 ? 41.288  65.299  -108.481 1.00 330.17 ? 573 ILE B CB  1 
ATOM   9542  N N   . PHE B 1 565 ? 41.369  62.398  -109.626 1.00 294.12 ? 574 PHE B N   1 
ATOM   9543  C CA  . PHE B 1 565 ? 40.743  61.293  -110.341 1.00 291.95 ? 574 PHE B CA  1 
ATOM   9544  C C   . PHE B 1 565 ? 40.842  60.006  -109.530 1.00 286.66 ? 574 PHE B C   1 
ATOM   9545  O O   . PHE B 1 565 ? 39.939  59.169  -109.562 1.00 282.75 ? 574 PHE B O   1 
ATOM   9546  C CB  . PHE B 1 565 ? 41.397  61.103  -111.711 1.00 297.23 ? 574 PHE B CB  1 
ATOM   9547  N N   . ASN B 1 566 ? 41.946  59.857  -108.805 1.00 286.95 ? 575 ASN B N   1 
ATOM   9548  C CA  . ASN B 1 566 ? 42.157  58.691  -107.957 1.00 282.49 ? 575 ASN B CA  1 
ATOM   9549  C C   . ASN B 1 566 ? 41.319  58.757  -106.685 1.00 277.23 ? 575 ASN B C   1 
ATOM   9550  O O   . ASN B 1 566 ? 40.749  57.755  -106.253 1.00 272.60 ? 575 ASN B O   1 
ATOM   9551  C CB  . ASN B 1 566 ? 43.638  58.545  -107.604 1.00 284.99 ? 575 ASN B CB  1 
ATOM   9552  N N   . SER B 1 567 ? 41.249  59.944  -106.090 1.00 245.88 ? 576 SER B N   1 
ATOM   9553  C CA  . SER B 1 567 ? 40.456  60.152  -104.884 1.00 241.54 ? 576 SER B CA  1 
ATOM   9554  C C   . SER B 1 567 ? 38.976  59.921  -105.169 1.00 238.29 ? 576 SER B C   1 
ATOM   9555  O O   . SER B 1 567 ? 38.206  59.582  -104.271 1.00 233.68 ? 576 SER B O   1 
ATOM   9556  C CB  . SER B 1 567 ? 40.672  61.563  -104.335 1.00 244.21 ? 576 SER B CB  1 
ATOM   9557  N N   . LEU B 1 568 ? 38.587  60.109  -106.426 1.00 326.47 ? 577 LEU B N   1 
ATOM   9558  C CA  . LEU B 1 568 ? 37.214  59.867  -106.849 1.00 324.11 ? 577 LEU B CA  1 
ATOM   9559  C C   . LEU B 1 568 ? 37.009  58.391  -107.172 1.00 321.21 ? 577 LEU B C   1 
ATOM   9560  O O   . LEU B 1 568 ? 35.884  57.888  -107.144 1.00 317.83 ? 577 LEU B O   1 
ATOM   9561  C CB  . LEU B 1 568 ? 36.867  60.727  -108.065 1.00 328.78 ? 577 LEU B CB  1 
ATOM   9562  N N   . TRP B 1 569 ? 38.105  57.704  -107.479 1.00 318.80 ? 578 TRP B N   1 
ATOM   9563  C CA  . TRP B 1 569 ? 38.064  56.275  -107.764 1.00 316.58 ? 578 TRP B CA  1 
ATOM   9564  C C   . TRP B 1 569 ? 38.042  55.475  -106.466 1.00 311.56 ? 578 TRP B C   1 
ATOM   9565  O O   . TRP B 1 569 ? 37.364  54.452  -106.367 1.00 308.02 ? 578 TRP B O   1 
ATOM   9566  C CB  . TRP B 1 569 ? 39.265  55.863  -108.618 1.00 320.76 ? 578 TRP B CB  1 
ATOM   9567  N N   . PHE B 1 570 ? 38.787  55.951  -105.473 1.00 263.29 ? 579 PHE B N   1 
ATOM   9568  C CA  . PHE B 1 570 ? 38.813  55.316  -104.162 1.00 259.04 ? 579 PHE B CA  1 
ATOM   9569  C C   . PHE B 1 570 ? 37.525  55.629  -103.404 1.00 255.10 ? 579 PHE B C   1 
ATOM   9570  O O   . PHE B 1 570 ? 37.136  54.896  -102.490 1.00 250.94 ? 579 PHE B O   1 
ATOM   9571  C CB  . PHE B 1 570 ? 40.026  55.784  -103.357 1.00 260.89 ? 579 PHE B CB  1 
ATOM   9572  N N   . SER B 1 571 ? 36.871  56.724  -103.787 1.00 269.10 ? 580 SER B N   1 
ATOM   9573  C CA  . SER B 1 571 ? 35.579  57.085  -103.221 1.00 265.96 ? 580 SER B CA  1 
ATOM   9574  C C   . SER B 1 571 ? 34.489  56.224  -103.846 1.00 263.59 ? 580 SER B C   1 
ATOM   9575  O O   . SER B 1 571 ? 33.410  56.057  -103.276 1.00 260.02 ? 580 SER B O   1 
ATOM   9576  C CB  . SER B 1 571 ? 35.287  58.565  -103.461 1.00 269.08 ? 580 SER B CB  1 
ATOM   9577  N N   . LEU B 1 572 ? 34.781  55.691  -105.030 1.00 220.81 ? 581 LEU B N   1 
ATOM   9578  C CA  . LEU B 1 572 ? 33.884  54.760  -105.701 1.00 219.15 ? 581 LEU B CA  1 
ATOM   9579  C C   . LEU B 1 572 ? 34.138  53.356  -105.168 1.00 215.84 ? 581 LEU B C   1 
ATOM   9580  O O   . LEU B 1 572 ? 33.229  52.526  -105.104 1.00 212.75 ? 581 LEU B O   1 
ATOM   9581  C CB  . LEU B 1 572 ? 34.100  54.802  -107.213 1.00 223.59 ? 581 LEU B CB  1 
ATOM   9582  N N   . GLY B 1 573 ? 35.387  53.097  -104.791 1.00 230.18 ? 582 GLY B N   1 
ATOM   9583  C CA  . GLY B 1 573 ? 35.735  51.870  -104.102 1.00 227.32 ? 582 GLY B CA  1 
ATOM   9584  C C   . GLY B 1 573 ? 35.257  51.963  -102.667 1.00 223.30 ? 582 GLY B C   1 
ATOM   9585  O O   . GLY B 1 573 ? 35.234  50.973  -101.936 1.00 220.29 ? 582 GLY B O   1 
ATOM   9586  N N   . ALA B 1 574 ? 34.876  53.174  -102.270 1.00 317.93 ? 583 ALA B N   1 
ATOM   9587  C CA  . ALA B 1 574 ? 34.313  53.424  -100.950 1.00 314.56 ? 583 ALA B CA  1 
ATOM   9588  C C   . ALA B 1 574 ? 32.806  53.202  -100.985 1.00 311.54 ? 583 ALA B C   1 
ATOM   9589  O O   . ALA B 1 574 ? 32.287  52.335  -100.277 1.00 307.89 ? 583 ALA B O   1 
ATOM   9590  C CB  . ALA B 1 574 ? 34.637  54.836  -100.494 1.00 316.71 ? 583 ALA B CB  1 
ATOM   9591  N N   . PHE B 1 575 ? 32.112  53.993  -101.802 1.00 285.76 ? 584 PHE B N   1 
ATOM   9592  C CA  . PHE B 1 575 ? 30.709  53.738  -102.107 1.00 283.74 ? 584 PHE B CA  1 
ATOM   9593  C C   . PHE B 1 575 ? 30.599  52.237  -102.349 1.00 281.68 ? 584 PHE B C   1 
ATOM   9594  O O   . PHE B 1 575 ? 31.035  51.731  -103.383 1.00 283.91 ? 584 PHE B O   1 
ATOM   9595  C CB  . PHE B 1 575 ? 30.269  54.530  -103.340 1.00 287.22 ? 584 PHE B CB  1 
ATOM   9596  N N   . MET B 1 576 ? 30.019  51.534  -101.382 1.00 187.34 ? 585 MET B N   1 
ATOM   9597  C CA  . MET B 1 576 ? 30.268  50.103  -101.200 1.00 185.36 ? 585 MET B CA  1 
ATOM   9598  C C   . MET B 1 576 ? 29.712  49.141  -102.249 1.00 185.57 ? 585 MET B C   1 
ATOM   9599  O O   . MET B 1 576 ? 28.821  49.477  -103.029 1.00 186.47 ? 585 MET B O   1 
ATOM   9600  C CB  . MET B 1 576 ? 29.808  49.660  -99.805  1.00 181.34 ? 585 MET B CB  1 
ATOM   9601  N N   . GLN B 1 577 ? 30.273  47.935  -102.239 1.00 181.29 ? 586 GLN B N   1 
ATOM   9602  C CA  . GLN B 1 577 ? 29.785  46.808  -103.023 1.00 181.19 ? 586 GLN B CA  1 
ATOM   9603  C C   . GLN B 1 577 ? 29.994  45.522  -102.224 1.00 178.60 ? 586 GLN B C   1 
ATOM   9604  O O   . GLN B 1 577 ? 30.648  45.529  -101.176 1.00 177.40 ? 586 GLN B O   1 
ATOM   9605  C CB  . GLN B 1 577 ? 30.509  46.719  -104.368 1.00 185.34 ? 586 GLN B CB  1 
ATOM   9606  N N   . PRO B 1 584 ? 44.599  44.401  -108.643 1.00 241.49 ? 593 PRO B N   1 
ATOM   9607  C CA  . PRO B 1 584 ? 44.697  42.949  -108.467 1.00 240.47 ? 593 PRO B CA  1 
ATOM   9608  C C   . PRO B 1 584 ? 45.036  42.562  -107.030 1.00 237.48 ? 593 PRO B C   1 
ATOM   9609  O O   . PRO B 1 584 ? 44.424  43.074  -106.091 1.00 233.67 ? 593 PRO B O   1 
ATOM   9610  C CB  . PRO B 1 584 ? 45.845  42.567  -109.402 1.00 246.09 ? 593 PRO B CB  1 
ATOM   9611  C CG  . PRO B 1 584 ? 45.789  43.586  -110.483 1.00 249.52 ? 593 PRO B CG  1 
ATOM   9612  C CD  . PRO B 1 584 ? 45.342  44.866  -109.828 1.00 247.16 ? 593 PRO B CD  1 
ATOM   9613  N N   . ARG B 1 585 ? 46.007  41.668  -106.867 1.00 287.25 ? 594 ARG B N   1 
ATOM   9614  C CA  . ARG B 1 585 ? 46.378  41.169  -105.548 1.00 284.99 ? 594 ARG B CA  1 
ATOM   9615  C C   . ARG B 1 585 ? 47.441  42.029  -104.872 1.00 286.91 ? 594 ARG B C   1 
ATOM   9616  O O   . ARG B 1 585 ? 48.525  41.547  -104.548 1.00 289.40 ? 594 ARG B O   1 
ATOM   9617  C CB  . ARG B 1 585 ? 46.856  39.718  -105.641 1.00 286.36 ? 594 ARG B CB  1 
ATOM   9618  N N   . SER B 1 586 ? 47.125  43.303  -104.662 1.00 252.91 ? 595 SER B N   1 
ATOM   9619  C CA  . SER B 1 586 ? 48.000  44.189  -103.905 1.00 254.43 ? 595 SER B CA  1 
ATOM   9620  C C   . SER B 1 586 ? 47.767  43.971  -102.413 1.00 250.53 ? 595 SER B C   1 
ATOM   9621  O O   . SER B 1 586 ? 46.960  44.658  -101.792 1.00 247.26 ? 595 SER B O   1 
ATOM   9622  C CB  . SER B 1 586 ? 47.747  45.651  -104.274 1.00 255.42 ? 595 SER B CB  1 
ATOM   9623  O OG  . SER B 1 586 ? 46.383  45.996  -104.104 1.00 251.20 ? 595 SER B OG  1 
ATOM   9624  N N   . LEU B 1 587 ? 48.481  43.002  -101.849 1.00 219.67 ? 596 LEU B N   1 
ATOM   9625  C CA  . LEU B 1 587 ? 48.287  42.575  -100.463 1.00 216.37 ? 596 LEU B CA  1 
ATOM   9626  C C   . LEU B 1 587 ? 48.018  43.729  -99.500  1.00 214.46 ? 596 LEU B C   1 
ATOM   9627  O O   . LEU B 1 587 ? 47.168  43.621  -98.618  1.00 210.34 ? 596 LEU B O   1 
ATOM   9628  C CB  . LEU B 1 587 ? 49.491  41.759  -99.980  1.00 219.18 ? 596 LEU B CB  1 
ATOM   9629  C CG  . LEU B 1 587 ? 49.308  41.034  -98.645  1.00 216.29 ? 596 LEU B CG  1 
ATOM   9630  C CD1 . LEU B 1 587 ? 48.147  40.058  -98.727  1.00 212.45 ? 596 LEU B CD1 1 
ATOM   9631  C CD2 . LEU B 1 587 ? 50.588  40.318  -98.242  1.00 219.88 ? 596 LEU B CD2 1 
ATOM   9632  N N   . SER B 1 588 ? 48.749  44.828  -99.669  1.00 290.59 ? 597 SER B N   1 
ATOM   9633  C CA  . SER B 1 588 ? 48.579  45.999  -98.815  1.00 289.53 ? 597 SER B CA  1 
ATOM   9634  C C   . SER B 1 588 ? 47.116  46.424  -98.733  1.00 285.12 ? 597 SER B C   1 
ATOM   9635  O O   . SER B 1 588 ? 46.445  46.181  -97.729  1.00 281.38 ? 597 SER B O   1 
ATOM   9636  C CB  . SER B 1 588 ? 49.431  47.163  -99.323  1.00 294.08 ? 597 SER B CB  1 
ATOM   9637  O OG  . SER B 1 588 ? 49.194  48.333  -98.559  1.00 293.25 ? 597 SER B OG  1 
ATOM   9638  N N   . GLY B 1 589 ? 46.626  47.055  -99.796  1.00 256.87 ? 598 GLY B N   1 
ATOM   9639  C CA  . GLY B 1 589 ? 45.251  47.519  -99.843  1.00 253.30 ? 598 GLY B CA  1 
ATOM   9640  C C   . GLY B 1 589 ? 44.250  46.383  -99.932  1.00 249.57 ? 598 GLY B C   1 
ATOM   9641  O O   . GLY B 1 589 ? 43.042  46.599  -99.830  1.00 246.24 ? 598 GLY B O   1 
ATOM   9642  N N   . ARG B 1 590 ? 44.754  45.169  -100.125 1.00 234.63 ? 599 ARG B N   1 
ATOM   9643  C CA  . ARG B 1 590 ? 43.901  43.991  -100.231 1.00 231.65 ? 599 ARG B CA  1 
ATOM   9644  C C   . ARG B 1 590 ? 43.222  43.677  -98.901  1.00 227.36 ? 599 ARG B C   1 
ATOM   9645  O O   . ARG B 1 590 ? 42.003  43.521  -98.840  1.00 223.89 ? 599 ARG B O   1 
ATOM   9646  C CB  . ARG B 1 590 ? 44.710  42.783  -100.707 1.00 234.16 ? 599 ARG B CB  1 
ATOM   9647  N N   . ILE B 1 591 ? 44.017  43.585  -97.839  1.00 208.63 ? 600 ILE B N   1 
ATOM   9648  C CA  . ILE B 1 591 ? 43.482  43.298  -96.513  1.00 205.12 ? 600 ILE B CA  1 
ATOM   9649  C C   . ILE B 1 591 ? 42.627  44.456  -96.008  1.00 202.75 ? 600 ILE B C   1 
ATOM   9650  O O   . ILE B 1 591 ? 41.773  44.276  -95.141  1.00 199.26 ? 600 ILE B O   1 
ATOM   9651  C CB  . ILE B 1 591 ? 44.600  42.997  -95.494  1.00 206.90 ? 600 ILE B CB  1 
ATOM   9652  C CG1 . ILE B 1 591 ? 45.475  44.233  -95.271  1.00 209.87 ? 600 ILE B CG1 1 
ATOM   9653  C CG2 . ILE B 1 591 ? 45.440  41.816  -95.956  1.00 209.48 ? 600 ILE B CG2 1 
ATOM   9654  C CD1 . ILE B 1 591 ? 46.554  44.035  -94.226  1.00 211.93 ? 600 ILE B CD1 1 
ATOM   9655  N N   . VAL B 1 592 ? 42.862  45.645  -96.556  1.00 238.09 ? 601 VAL B N   1 
ATOM   9656  C CA  . VAL B 1 592 ? 42.056  46.812  -96.221  1.00 236.42 ? 601 VAL B CA  1 
ATOM   9657  C C   . VAL B 1 592 ? 40.622  46.618  -96.694  1.00 233.16 ? 601 VAL B C   1 
ATOM   9658  O O   . VAL B 1 592 ? 39.673  46.884  -95.957  1.00 230.04 ? 601 VAL B O   1 
ATOM   9659  C CB  . VAL B 1 592 ? 42.624  48.097  -96.852  1.00 240.02 ? 601 VAL B CB  1 
ATOM   9660  C CG1 . VAL B 1 592 ? 41.567  49.190  -96.878  1.00 238.44 ? 601 VAL B CG1 1 
ATOM   9661  C CG2 . VAL B 1 592 ? 43.851  48.560  -96.094  1.00 242.90 ? 601 VAL B CG2 1 
ATOM   9662  N N   . GLY B 1 593 ? 40.473  46.151  -97.930  1.00 193.09 ? 602 GLY B N   1 
ATOM   9663  C CA  . GLY B 1 593 ? 39.163  45.884  -98.491  1.00 190.56 ? 602 GLY B CA  1 
ATOM   9664  C C   . GLY B 1 593 ? 38.460  44.750  -97.770  1.00 186.93 ? 602 GLY B C   1 
ATOM   9665  O O   . GLY B 1 593 ? 37.237  44.751  -97.635  1.00 183.94 ? 602 GLY B O   1 
ATOM   9666  N N   . GLY B 1 594 ? 39.240  43.779  -97.304  1.00 224.17 ? 603 GLY B N   1 
ATOM   9667  C CA  . GLY B 1 594 ? 38.696  42.644  -96.580  1.00 221.27 ? 603 GLY B CA  1 
ATOM   9668  C C   . GLY B 1 594 ? 38.238  43.018  -95.182  1.00 218.52 ? 603 GLY B C   1 
ATOM   9669  O O   . GLY B 1 594 ? 37.134  42.665  -94.766  1.00 215.31 ? 603 GLY B O   1 
ATOM   9670  N N   . VAL B 1 595 ? 39.090  43.735  -94.457  1.00 181.65 ? 604 VAL B N   1 
ATOM   9671  C CA  . VAL B 1 595 ? 38.766  44.172  -93.103  1.00 179.67 ? 604 VAL B CA  1 
ATOM   9672  C C   . VAL B 1 595 ? 37.608  45.165  -93.105  1.00 177.59 ? 604 VAL B C   1 
ATOM   9673  O O   . VAL B 1 595 ? 36.733  45.112  -92.242  1.00 174.73 ? 604 VAL B O   1 
ATOM   9674  C CB  . VAL B 1 595 ? 39.987  44.800  -92.402  1.00 182.44 ? 604 VAL B CB  1 
ATOM   9675  C CG1 . VAL B 1 595 ? 39.570  45.473  -91.103  1.00 180.80 ? 604 VAL B CG1 1 
ATOM   9676  C CG2 . VAL B 1 595 ? 41.051  43.743  -92.143  1.00 184.33 ? 604 VAL B CG2 1 
ATOM   9677  N N   . TRP B 1 596 ? 37.607  46.068  -94.081  1.00 200.06 ? 605 TRP B N   1 
ATOM   9678  C CA  . TRP B 1 596 ? 36.525  47.034  -94.221  1.00 198.63 ? 605 TRP B CA  1 
ATOM   9679  C C   . TRP B 1 596 ? 35.210  46.329  -94.528  1.00 195.56 ? 605 TRP B C   1 
ATOM   9680  O O   . TRP B 1 596 ? 34.144  46.766  -94.095  1.00 193.28 ? 605 TRP B O   1 
ATOM   9681  C CB  . TRP B 1 596 ? 36.842  48.053  -95.316  1.00 201.66 ? 605 TRP B CB  1 
ATOM   9682  C CG  . TRP B 1 596 ? 35.676  48.923  -95.674  1.00 200.58 ? 605 TRP B CG  1 
ATOM   9683  C CD1 . TRP B 1 596 ? 34.874  48.809  -96.773  1.00 200.35 ? 605 TRP B CD1 1 
ATOM   9684  C CD2 . TRP B 1 596 ? 35.174  50.038  -94.926  1.00 199.91 ? 605 TRP B CD2 1 
ATOM   9685  N NE1 . TRP B 1 596 ? 33.908  49.786  -96.758  1.00 199.60 ? 605 TRP B NE1 1 
ATOM   9686  C CE2 . TRP B 1 596 ? 34.070  50.553  -95.634  1.00 199.30 ? 605 TRP B CE2 1 
ATOM   9687  C CE3 . TRP B 1 596 ? 35.552  50.650  -93.727  1.00 200.06 ? 605 TRP B CE3 1 
ATOM   9688  C CZ2 . TRP B 1 596 ? 33.341  51.651  -95.184  1.00 198.83 ? 605 TRP B CZ2 1 
ATOM   9689  C CZ3 . TRP B 1 596 ? 34.827  51.741  -93.282  1.00 199.59 ? 605 TRP B CZ3 1 
ATOM   9690  C CH2 . TRP B 1 596 ? 33.734  52.229  -94.008  1.00 198.96 ? 605 TRP B CH2 1 
ATOM   9691  N N   . TRP B 1 597 ? 35.294  45.235  -95.279  1.00 192.74 ? 606 TRP B N   1 
ATOM   9692  C CA  . TRP B 1 597 ? 34.118  44.441  -95.608  1.00 190.24 ? 606 TRP B CA  1 
ATOM   9693  C C   . TRP B 1 597 ? 33.580  43.742  -94.365  1.00 187.18 ? 606 TRP B C   1 
ATOM   9694  O O   . TRP B 1 597 ? 32.372  43.712  -94.130  1.00 184.61 ? 606 TRP B O   1 
ATOM   9695  C CB  . TRP B 1 597 ? 34.452  43.409  -96.685  1.00 191.80 ? 606 TRP B CB  1 
ATOM   9696  C CG  . TRP B 1 597 ? 33.301  42.523  -97.046  1.00 189.67 ? 606 TRP B CG  1 
ATOM   9697  C CD1 . TRP B 1 597 ? 32.401  42.717  -98.053  1.00 189.71 ? 606 TRP B CD1 1 
ATOM   9698  C CD2 . TRP B 1 597 ? 32.925  41.299  -96.402  1.00 187.55 ? 606 TRP B CD2 1 
ATOM   9699  N NE1 . TRP B 1 597 ? 31.488  41.690  -98.077  1.00 187.73 ? 606 TRP B NE1 1 
ATOM   9700  C CE2 . TRP B 1 597 ? 31.788  40.807  -97.073  1.00 186.36 ? 606 TRP B CE2 1 
ATOM   9701  C CE3 . TRP B 1 597 ? 33.440  40.572  -95.324  1.00 186.83 ? 606 TRP B CE3 1 
ATOM   9702  C CZ2 . TRP B 1 597 ? 31.157  39.622  -96.702  1.00 184.47 ? 606 TRP B CZ2 1 
ATOM   9703  C CZ3 . TRP B 1 597 ? 32.811  39.396  -94.957  1.00 184.97 ? 606 TRP B CZ3 1 
ATOM   9704  C CH2 . TRP B 1 597 ? 31.682  38.933  -95.643  1.00 183.79 ? 606 TRP B CH2 1 
ATOM   9705  N N   . PHE B 1 598 ? 34.484  43.176  -93.573  1.00 169.36 ? 607 PHE B N   1 
ATOM   9706  C CA  . PHE B 1 598 ? 34.104  42.521  -92.328  1.00 167.00 ? 607 PHE B CA  1 
ATOM   9707  C C   . PHE B 1 598 ? 33.525  43.539  -91.352  1.00 165.47 ? 607 PHE B C   1 
ATOM   9708  O O   . PHE B 1 598 ? 32.650  43.219  -90.548  1.00 162.95 ? 607 PHE B O   1 
ATOM   9709  C CB  . PHE B 1 598 ? 35.311  41.816  -91.707  1.00 168.65 ? 607 PHE B CB  1 
ATOM   9710  C CG  . PHE B 1 598 ? 35.020  41.169  -90.382  1.00 166.78 ? 607 PHE B CG  1 
ATOM   9711  C CD1 . PHE B 1 598 ? 34.454  39.907  -90.321  1.00 165.27 ? 607 PHE B CD1 1 
ATOM   9712  C CD2 . PHE B 1 598 ? 35.318  41.822  -89.197  1.00 166.87 ? 607 PHE B CD2 1 
ATOM   9713  C CE1 . PHE B 1 598 ? 34.188  39.308  -89.103  1.00 163.87 ? 607 PHE B CE1 1 
ATOM   9714  C CE2 . PHE B 1 598 ? 35.054  41.229  -87.976  1.00 165.50 ? 607 PHE B CE2 1 
ATOM   9715  C CZ  . PHE B 1 598 ? 34.489  39.971  -87.929  1.00 163.99 ? 607 PHE B CZ  1 
ATOM   9716  N N   . PHE B 1 599 ? 34.023  44.769  -91.432  1.00 207.85 ? 608 PHE B N   1 
ATOM   9717  C CA  . PHE B 1 599 ? 33.545  45.851  -90.582  1.00 207.01 ? 608 PHE B CA  1 
ATOM   9718  C C   . PHE B 1 599 ? 32.104  46.220  -90.915  1.00 204.83 ? 608 PHE B C   1 
ATOM   9719  O O   . PHE B 1 599 ? 31.251  46.280  -90.030  1.00 202.66 ? 608 PHE B O   1 
ATOM   9720  C CB  . PHE B 1 599 ? 34.447  47.078  -90.726  1.00 210.00 ? 608 PHE B CB  1 
ATOM   9721  C CG  . PHE B 1 599 ? 33.864  48.332  -90.141  1.00 209.65 ? 608 PHE B CG  1 
ATOM   9722  C CD1 . PHE B 1 599 ? 34.041  48.636  -88.801  1.00 209.49 ? 608 PHE B CD1 1 
ATOM   9723  C CD2 . PHE B 1 599 ? 33.141  49.211  -90.932  1.00 209.82 ? 608 PHE B CD2 1 
ATOM   9724  C CE1 . PHE B 1 599 ? 33.506  49.790  -88.261  1.00 209.47 ? 608 PHE B CE1 1 
ATOM   9725  C CE2 . PHE B 1 599 ? 32.604  50.365  -90.398  1.00 209.80 ? 608 PHE B CE2 1 
ATOM   9726  C CZ  . PHE B 1 599 ? 32.787  50.655  -89.061  1.00 209.62 ? 608 PHE B CZ  1 
ATOM   9727  N N   . THR B 1 600 ? 31.840  46.469  -92.193  1.00 168.11 ? 609 THR B N   1 
ATOM   9728  C CA  . THR B 1 600 ? 30.499  46.834  -92.635  1.00 166.57 ? 609 THR B CA  1 
ATOM   9729  C C   . THR B 1 600 ? 29.526  45.669  -92.474  1.00 163.81 ? 609 THR B C   1 
ATOM   9730  O O   . THR B 1 600 ? 28.331  45.874  -92.265  1.00 161.93 ? 609 THR B O   1 
ATOM   9731  C CB  . THR B 1 600 ? 30.492  47.319  -94.100  1.00 168.68 ? 609 THR B CB  1 
ATOM   9732  O OG1 . THR B 1 600 ? 29.156  47.663  -94.487  1.00 167.39 ? 609 THR B OG1 1 
ATOM   9733  C CG2 . THR B 1 600 ? 31.020  46.237  -95.026  1.00 169.74 ? 609 THR B CG2 1 
ATOM   9734  N N   . LEU B 1 601 ? 30.045  44.449  -92.571  1.00 200.85 ? 610 LEU B N   1 
ATOM   9735  C CA  . LEU B 1 601 ? 29.232  43.255  -92.380  1.00 198.63 ? 610 LEU B CA  1 
ATOM   9736  C C   . LEU B 1 601 ? 28.634  43.237  -90.978  1.00 196.36 ? 610 LEU B C   1 
ATOM   9737  O O   . LEU B 1 601 ? 27.439  42.999  -90.803  1.00 194.31 ? 610 LEU B O   1 
ATOM   9738  C CB  . LEU B 1 601 ? 30.069  41.994  -92.604  1.00 199.62 ? 610 LEU B CB  1 
ATOM   9739  C CG  . LEU B 1 601 ? 29.355  40.665  -92.349  1.00 197.77 ? 610 LEU B CG  1 
ATOM   9740  C CD1 . LEU B 1 601 ? 28.262  40.437  -93.382  1.00 197.16 ? 610 LEU B CD1 1 
ATOM   9741  C CD2 . LEU B 1 601 ? 30.345  39.511  -92.350  1.00 199.17 ? 610 LEU B CD2 1 
ATOM   9742  N N   . ILE B 1 602 ? 29.476  43.491  -89.982  1.00 158.28 ? 611 ILE B N   1 
ATOM   9743  C CA  . ILE B 1 602 ? 29.038  43.518  -88.593  1.00 156.66 ? 611 ILE B CA  1 
ATOM   9744  C C   . ILE B 1 602 ? 28.004  44.615  -88.361  1.00 155.61 ? 611 ILE B C   1 
ATOM   9745  O O   . ILE B 1 602 ? 26.985  44.392  -87.708  1.00 153.61 ? 611 ILE B O   1 
ATOM   9746  C CB  . ILE B 1 602 ? 30.223  43.732  -87.633  1.00 158.25 ? 611 ILE B CB  1 
ATOM   9747  C CG1 . ILE B 1 602 ? 31.219  42.576  -87.750  1.00 159.47 ? 611 ILE B CG1 1 
ATOM   9748  C CG2 . ILE B 1 602 ? 29.730  43.873  -86.204  1.00 156.95 ? 611 ILE B CG2 1 
ATOM   9749  C CD1 . ILE B 1 602 ? 30.609  41.215  -87.490  1.00 157.76 ? 611 ILE B CD1 1 
ATOM   9750  N N   . ILE B 1 603 ? 28.272  45.799  -88.902  1.00 157.21 ? 612 ILE B N   1 
ATOM   9751  C CA  . ILE B 1 603 ? 27.376  46.937  -88.726  1.00 156.77 ? 612 ILE B CA  1 
ATOM   9752  C C   . ILE B 1 603 ? 25.987  46.686  -89.310  1.00 155.03 ? 612 ILE B C   1 
ATOM   9753  O O   . ILE B 1 603 ? 24.982  46.863  -88.624  1.00 153.46 ? 612 ILE B O   1 
ATOM   9754  C CB  . ILE B 1 603 ? 27.965  48.229  -89.325  1.00 159.34 ? 612 ILE B CB  1 
ATOM   9755  C CG1 . ILE B 1 603 ? 29.052  48.787  -88.405  1.00 161.03 ? 612 ILE B CG1 1 
ATOM   9756  C CG2 . ILE B 1 603 ? 26.873  49.267  -89.537  1.00 159.12 ? 612 ILE B CG2 1 
ATOM   9757  C CD1 . ILE B 1 603 ? 29.445  50.212  -88.719  1.00 163.58 ? 612 ILE B CD1 1 
ATOM   9758  N N   . ILE B 1 604 ? 25.933  46.275  -90.573  1.00 161.16 ? 613 ILE B N   1 
ATOM   9759  C CA  . ILE B 1 604 ? 24.655  46.010  -91.225  1.00 159.96 ? 613 ILE B CA  1 
ATOM   9760  C C   . ILE B 1 604 ? 23.913  44.865  -90.540  1.00 157.58 ? 613 ILE B C   1 
ATOM   9761  O O   . ILE B 1 604 ? 22.683  44.825  -90.538  1.00 156.26 ? 613 ILE B O   1 
ATOM   9762  C CB  . ILE B 1 604 ? 24.823  45.703  -92.726  1.00 161.47 ? 613 ILE B CB  1 
ATOM   9763  C CG1 . ILE B 1 604 ? 25.665  44.441  -92.927  1.00 161.75 ? 613 ILE B CG1 1 
ATOM   9764  C CG2 . ILE B 1 604 ? 25.445  46.891  -93.443  1.00 164.09 ? 613 ILE B CG2 1 
ATOM   9765  C CD1 . ILE B 1 604 ? 25.885  44.081  -94.382  1.00 163.57 ? 613 ILE B CD1 1 
ATOM   9766  N N   . SER B 1 605 ? 24.666  43.937  -89.959  1.00 193.95 ? 614 SER B N   1 
ATOM   9767  C CA  . SER B 1 605 ? 24.075  42.843  -89.198  1.00 192.06 ? 614 SER B CA  1 
ATOM   9768  C C   . SER B 1 605 ? 23.487  43.374  -87.897  1.00 190.84 ? 614 SER B C   1 
ATOM   9769  O O   . SER B 1 605 ? 22.403  42.966  -87.481  1.00 189.23 ? 614 SER B O   1 
ATOM   9770  C CB  . SER B 1 605 ? 25.117  41.764  -88.904  1.00 192.63 ? 614 SER B CB  1 
ATOM   9771  O OG  . SER B 1 605 ? 25.561  41.147  -90.101  1.00 193.86 ? 614 SER B OG  1 
ATOM   9772  N N   . SER B 1 606 ? 24.212  44.289  -87.261  1.00 148.86 ? 615 SER B N   1 
ATOM   9773  C CA  . SER B 1 606 ? 23.745  44.920  -86.033  1.00 148.23 ? 615 SER B CA  1 
ATOM   9774  C C   . SER B 1 606 ? 22.487  45.737  -86.294  1.00 147.60 ? 615 SER B C   1 
ATOM   9775  O O   . SER B 1 606 ? 21.517  45.650  -85.544  1.00 146.29 ? 615 SER B O   1 
ATOM   9776  C CB  . SER B 1 606 ? 24.836  45.809  -85.432  1.00 150.04 ? 615 SER B CB  1 
ATOM   9777  O OG  . SER B 1 606 ? 25.927  45.035  -84.966  1.00 150.75 ? 615 SER B OG  1 
ATOM   9778  N N   . TYR B 1 607 ? 22.509  46.530  -87.360  1.00 149.34 ? 616 TYR B N   1 
ATOM   9779  C CA  . TYR B 1 607 ? 21.352  47.336  -87.730  1.00 149.21 ? 616 TYR B CA  1 
ATOM   9780  C C   . TYR B 1 607 ? 20.124  46.461  -87.950  1.00 147.47 ? 616 TYR B C   1 
ATOM   9781  O O   . TYR B 1 607 ? 19.033  46.779  -87.481  1.00 146.67 ? 616 TYR B O   1 
ATOM   9782  C CB  . TYR B 1 607 ? 21.637  48.154  -88.991  1.00 151.17 ? 616 TYR B CB  1 
ATOM   9783  C CG  . TYR B 1 607 ? 20.413  48.851  -89.544  1.00 151.36 ? 616 TYR B CG  1 
ATOM   9784  C CD1 . TYR B 1 607 ? 20.087  50.142  -89.149  1.00 152.40 ? 616 TYR B CD1 1 
ATOM   9785  C CD2 . TYR B 1 607 ? 19.579  48.214  -90.454  1.00 150.82 ? 616 TYR B CD2 1 
ATOM   9786  C CE1 . TYR B 1 607 ? 18.967  50.780  -89.649  1.00 152.89 ? 616 TYR B CE1 1 
ATOM   9787  C CE2 . TYR B 1 607 ? 18.457  48.844  -90.959  1.00 151.31 ? 616 TYR B CE2 1 
ATOM   9788  C CZ  . TYR B 1 607 ? 18.156  50.127  -90.553  1.00 152.34 ? 616 TYR B CZ  1 
ATOM   9789  O OH  . TYR B 1 607 ? 17.040  50.759  -91.053  1.00 153.14 ? 616 TYR B OH  1 
ATOM   9790  N N   . THR B 1 608 ? 20.309  45.360  -88.670  1.00 163.21 ? 617 THR B N   1 
ATOM   9791  C CA  . THR B 1 608 ? 19.213  44.446  -88.967  1.00 161.92 ? 617 THR B CA  1 
ATOM   9792  C C   . THR B 1 608 ? 18.657  43.812  -87.697  1.00 160.24 ? 617 THR B C   1 
ATOM   9793  O O   . THR B 1 608 ? 17.446  43.802  -87.475  1.00 159.35 ? 617 THR B O   1 
ATOM   9794  C CB  . THR B 1 608 ? 19.656  43.331  -89.930  1.00 162.32 ? 617 THR B CB  1 
ATOM   9795  O OG1 . THR B 1 608 ? 20.084  43.909  -91.170  1.00 164.15 ? 617 THR B OG1 1 
ATOM   9796  C CG2 . THR B 1 608 ? 18.507  42.369  -90.194  1.00 161.26 ? 617 THR B CG2 1 
ATOM   9797  N N   . ALA B 1 609 ? 19.550  43.283  -86.866  1.00 146.19 ? 618 ALA B N   1 
ATOM   9798  C CA  . ALA B 1 609 ? 19.155  42.648  -85.615  1.00 145.00 ? 618 ALA B CA  1 
ATOM   9799  C C   . ALA B 1 609 ? 18.423  43.627  -84.701  1.00 144.72 ? 618 ALA B C   1 
ATOM   9800  O O   . ALA B 1 609 ? 17.350  43.322  -84.181  1.00 143.72 ? 618 ALA B O   1 
ATOM   9801  C CB  . ALA B 1 609 ? 20.372  42.070  -84.909  1.00 145.49 ? 618 ALA B CB  1 
ATOM   9802  N N   . ASN B 1 610 ? 19.010  44.804  -84.513  1.00 176.75 ? 619 ASN B N   1 
ATOM   9803  C CA  . ASN B 1 610 ? 18.425  45.827  -83.654  1.00 176.97 ? 619 ASN B CA  1 
ATOM   9804  C C   . ASN B 1 610 ? 17.062  46.288  -84.152  1.00 176.61 ? 619 ASN B C   1 
ATOM   9805  O O   . ASN B 1 610 ? 16.140  46.497  -83.364  1.00 176.16 ? 619 ASN B O   1 
ATOM   9806  C CB  . ASN B 1 610 ? 19.369  47.024  -83.530  1.00 178.73 ? 619 ASN B CB  1 
ATOM   9807  C CG  . ASN B 1 610 ? 18.875  48.055  -82.537  1.00 179.34 ? 619 ASN B CG  1 
ATOM   9808  O OD1 . ASN B 1 610 ? 19.108  49.253  -82.700  1.00 180.90 ? 619 ASN B OD1 1 
ATOM   9809  N ND2 . ASN B 1 610 ? 18.185  47.594  -81.500  1.00 178.39 ? 619 ASN B ND2 1 
ATOM   9810  N N   . LEU B 1 611 ? 16.941  46.448  -85.466  1.00 144.15 ? 620 LEU B N   1 
ATOM   9811  C CA  . LEU B 1 611 ? 15.688  46.880  -86.072  1.00 144.23 ? 620 LEU B CA  1 
ATOM   9812  C C   . LEU B 1 611 ? 14.594  45.843  -85.859  1.00 142.77 ? 620 LEU B C   1 
ATOM   9813  O O   . LEU B 1 611 ? 13.409  46.174  -85.824  1.00 142.74 ? 620 LEU B O   1 
ATOM   9814  C CB  . LEU B 1 611 ? 15.876  47.142  -87.567  1.00 145.40 ? 620 LEU B CB  1 
ATOM   9815  C CG  . LEU B 1 611 ? 14.637  47.616  -88.329  1.00 146.00 ? 620 LEU B CG  1 
ATOM   9816  C CD1 . LEU B 1 611 ? 14.103  48.908  -87.732  1.00 146.89 ? 620 LEU B CD1 1 
ATOM   9817  C CD2 . LEU B 1 611 ? 14.952  47.792  -89.806  1.00 147.52 ? 620 LEU B CD2 1 
ATOM   9818  N N   . ALA B 1 612 ? 14.998  44.587  -85.716  1.00 141.21 ? 621 ALA B N   1 
ATOM   9819  C CA  . ALA B 1 612 ? 14.048  43.513  -85.473  1.00 140.09 ? 621 ALA B CA  1 
ATOM   9820  C C   . ALA B 1 612 ? 13.452  43.618  -84.064  1.00 139.51 ? 621 ALA B C   1 
ATOM   9821  O O   . ALA B 1 612 ? 12.319  43.202  -83.835  1.00 138.97 ? 621 ALA B O   1 
ATOM   9822  C CB  . ALA B 1 612 ? 14.708  42.154  -85.700  1.00 139.66 ? 621 ALA B CB  1 
ATOM   9823  N N   . ALA B 1 613 ? 14.184  44.245  -83.142  1.00 200.20 ? 622 ALA B N   1 
ATOM   9824  C CA  . ALA B 1 613 ? 13.790  44.286  -81.732  1.00 200.00 ? 622 ALA B CA  1 
ATOM   9825  C C   . ALA B 1 613 ? 12.564  45.159  -81.473  1.00 200.34 ? 622 ALA B C   1 
ATOM   9826  O O   . ALA B 1 613 ? 11.600  44.718  -80.846  1.00 199.89 ? 622 ALA B O   1 
ATOM   9827  C CB  . ALA B 1 613 ? 14.958  44.742  -80.864  1.00 200.81 ? 622 ALA B CB  1 
ATOM   9828  N N   . PHE B 1 614 ? 12.606  46.399  -81.950  1.00 266.12 ? 623 PHE B N   1 
ATOM   9829  C CA  . PHE B 1 614 ? 11.504  47.333  -81.742  1.00 266.87 ? 623 PHE B CA  1 
ATOM   9830  C C   . PHE B 1 614 ? 10.197  46.800  -82.315  1.00 266.34 ? 623 PHE B C   1 
ATOM   9831  O O   . PHE B 1 614 ? 9.129   46.994  -81.738  1.00 266.57 ? 623 PHE B O   1 
ATOM   9832  C CB  . PHE B 1 614 ? 11.818  48.694  -82.368  1.00 268.44 ? 623 PHE B CB  1 
ATOM   9833  C CG  . PHE B 1 614 ? 12.893  49.458  -81.652  1.00 269.51 ? 623 PHE B CG  1 
ATOM   9834  C CD1 . PHE B 1 614 ? 12.817  49.673  -80.286  1.00 269.87 ? 623 PHE B CD1 1 
ATOM   9835  C CD2 . PHE B 1 614 ? 13.970  49.977  -82.350  1.00 270.47 ? 623 PHE B CD2 1 
ATOM   9836  C CE1 . PHE B 1 614 ? 13.803  50.380  -79.626  1.00 271.20 ? 623 PHE B CE1 1 
ATOM   9837  C CE2 . PHE B 1 614 ? 14.959  50.687  -81.696  1.00 271.75 ? 623 PHE B CE2 1 
ATOM   9838  C CZ  . PHE B 1 614 ? 14.875  50.889  -80.332  1.00 272.13 ? 623 PHE B CZ  1 
ATOM   9839  N N   . LEU B 1 615 ? 10.292  46.130  -83.458  1.00 140.95 ? 624 LEU B N   1 
ATOM   9840  C CA  . LEU B 1 615 ? 9.112   45.633  -84.154  1.00 140.83 ? 624 LEU B CA  1 
ATOM   9841  C C   . LEU B 1 615 ? 8.621   44.312  -83.574  1.00 139.70 ? 624 LEU B C   1 
ATOM   9842  O O   . LEU B 1 615 ? 7.545   43.831  -83.929  1.00 139.73 ? 624 LEU B O   1 
ATOM   9843  C CB  . LEU B 1 615 ? 9.402   45.484  -85.648  1.00 141.29 ? 624 LEU B CB  1 
ATOM   9844  C CG  . LEU B 1 615 ? 9.748   46.789  -86.366  1.00 142.83 ? 624 LEU B CG  1 
ATOM   9845  C CD1 . LEU B 1 615 ? 10.373  46.518  -87.727  1.00 143.40 ? 624 LEU B CD1 1 
ATOM   9846  C CD2 . LEU B 1 615 ? 8.516   47.674  -86.497  1.00 144.06 ? 624 LEU B CD2 1 
ATOM   9847  N N   . THR B 1 616 ? 9.409   43.731  -82.676  1.00 180.30 ? 625 THR B N   1 
ATOM   9848  C CA  . THR B 1 616 ? 9.031   42.483  -82.024  1.00 179.54 ? 625 THR B CA  1 
ATOM   9849  C C   . THR B 1 616 ? 8.309   42.743  -80.703  1.00 179.77 ? 625 THR B C   1 
ATOM   9850  O O   . THR B 1 616 ? 7.143   42.384  -80.541  1.00 179.85 ? 625 THR B O   1 
ATOM   9851  C CB  . THR B 1 616 ? 10.254  41.582  -81.771  1.00 179.04 ? 625 THR B CB  1 
ATOM   9852  O OG1 . THR B 1 616 ? 10.850  41.220  -83.022  1.00 179.04 ? 625 THR B OG1 1 
ATOM   9853  C CG2 . THR B 1 616 ? 9.841   40.319  -81.032  1.00 178.62 ? 625 THR B CG2 1 
ATOM   9854  N N   . VAL B 1 617 ? 9.009   43.371  -79.764  1.00 186.77 ? 626 VAL B N   1 
ATOM   9855  C CA  . VAL B 1 617 ? 8.435   43.681  -78.460  1.00 187.35 ? 626 VAL B CA  1 
ATOM   9856  C C   . VAL B 1 617 ? 7.430   44.824  -78.568  1.00 188.30 ? 626 VAL B C   1 
ATOM   9857  O O   . VAL B 1 617 ? 6.256   44.666  -78.230  1.00 188.62 ? 626 VAL B O   1 
ATOM   9858  C CB  . VAL B 1 617 ? 9.525   44.056  -77.440  1.00 187.91 ? 626 VAL B CB  1 
ATOM   9859  C CG1 . VAL B 1 617 ? 8.900   44.427  -76.104  1.00 188.91 ? 626 VAL B CG1 1 
ATOM   9860  C CG2 . VAL B 1 617 ? 10.517  42.916  -77.277  1.00 187.32 ? 626 VAL B CG2 1 
ATOM   9861  N N   . GLU B 1 618 ? 7.902   45.974  -79.037  1.00 152.83 ? 627 GLU B N   1 
ATOM   9862  C CA  . GLU B 1 618 ? 7.045   47.133  -79.265  1.00 154.09 ? 627 GLU B CA  1 
ATOM   9863  C C   . GLU B 1 618 ? 6.288   47.570  -78.012  1.00 155.12 ? 627 GLU B C   1 
ATOM   9864  O O   . GLU B 1 618 ? 5.058   47.598  -78.002  1.00 155.64 ? 627 GLU B O   1 
ATOM   9865  C CB  . GLU B 1 618 ? 6.057   46.851  -80.400  1.00 153.99 ? 627 GLU B CB  1 
ATOM   9866  N N   . ARG B 1 619 ? 7.026   47.912  -76.960  1.00 233.81 ? 628 ARG B N   1 
ATOM   9867  C CA  . ARG B 1 619 ? 6.411   48.428  -75.742  1.00 235.22 ? 628 ARG B CA  1 
ATOM   9868  C C   . ARG B 1 619 ? 6.256   49.944  -75.824  1.00 237.10 ? 628 ARG B C   1 
ATOM   9869  O O   . ARG B 1 619 ? 7.154   50.645  -76.292  1.00 237.54 ? 628 ARG B O   1 
ATOM   9870  C CB  . ARG B 1 619 ? 7.222   48.039  -74.503  1.00 235.42 ? 628 ARG B CB  1 
ATOM   9871  C CG  . ARG B 1 619 ? 8.621   48.628  -74.452  1.00 235.93 ? 628 ARG B CG  1 
ATOM   9872  C CD  . ARG B 1 619 ? 9.134   48.686  -73.022  1.00 237.23 ? 628 ARG B CD  1 
ATOM   9873  N NE  . ARG B 1 619 ? 8.994   47.405  -72.336  1.00 236.51 ? 628 ARG B NE  1 
ATOM   9874  C CZ  . ARG B 1 619 ? 9.986   46.537  -72.163  1.00 235.87 ? 628 ARG B CZ  1 
ATOM   9875  N NH1 . ARG B 1 619 ? 11.199  46.813  -72.624  1.00 235.81 ? 628 ARG B NH1 1 
ATOM   9876  N NH2 . ARG B 1 619 ? 9.766   45.394  -71.527  1.00 235.57 ? 628 ARG B NH2 1 
ATOM   9877  N N   . MET B 1 620 ? 5.112   50.444  -75.367  1.00 198.26 ? 629 MET B N   1 
ATOM   9878  C CA  . MET B 1 620 ? 4.798   51.864  -75.480  1.00 200.41 ? 629 MET B CA  1 
ATOM   9879  C C   . MET B 1 620 ? 5.407   52.694  -74.355  1.00 202.23 ? 629 MET B C   1 
ATOM   9880  O O   . MET B 1 620 ? 5.555   52.222  -73.228  1.00 202.34 ? 629 MET B O   1 
ATOM   9881  C CB  . MET B 1 620 ? 3.283   52.075  -75.522  1.00 201.50 ? 629 MET B CB  1 
ATOM   9882  C CG  . MET B 1 620 ? 2.588   51.435  -76.718  1.00 200.34 ? 629 MET B CG  1 
ATOM   9883  S SD  . MET B 1 620 ? 2.916   52.273  -78.284  1.00 200.88 ? 629 MET B SD  1 
ATOM   9884  C CE  . MET B 1 620 ? 4.471   51.525  -78.771  1.00 198.68 ? 629 MET B CE  1 
ATOM   9885  N N   . VAL B 1 621 ? 5.759   53.935  -74.677  1.00 220.92 ? 630 VAL B N   1 
ATOM   9886  C CA  . VAL B 1 621 ? 6.289   54.872  -73.695  1.00 223.21 ? 630 VAL B CA  1 
ATOM   9887  C C   . VAL B 1 621 ? 5.365   56.079  -73.574  1.00 225.96 ? 630 VAL B C   1 
ATOM   9888  O O   . VAL B 1 621 ? 4.601   56.379  -74.492  1.00 226.18 ? 630 VAL B O   1 
ATOM   9889  C CB  . VAL B 1 621 ? 7.702   55.353  -74.076  1.00 223.46 ? 630 VAL B CB  1 
ATOM   9890  C CG1 . VAL B 1 621 ? 8.655   54.171  -74.188  1.00 221.06 ? 630 VAL B CG1 1 
ATOM   9891  C CG2 . VAL B 1 621 ? 7.662   56.139  -75.379  1.00 224.05 ? 630 VAL B CG2 1 
ATOM   9892  N N   . SER B 1 622 ? 5.433   56.767  -72.439  1.00 210.79 ? 631 SER B N   1 
ATOM   9893  C CA  . SER B 1 622 ? 4.588   57.934  -72.207  1.00 213.86 ? 631 SER B CA  1 
ATOM   9894  C C   . SER B 1 622 ? 5.405   59.132  -71.732  1.00 216.72 ? 631 SER B C   1 
ATOM   9895  O O   . SER B 1 622 ? 6.349   58.978  -70.956  1.00 216.91 ? 631 SER B O   1 
ATOM   9896  C CB  . SER B 1 622 ? 3.489   57.611  -71.193  1.00 214.74 ? 631 SER B CB  1 
ATOM   9897  O OG  . SER B 1 622 ? 4.041   57.229  -69.946  1.00 215.10 ? 631 SER B OG  1 
ATOM   9898  N N   . PRO B 1 623 ? 5.038   60.333  -72.201  1.00 191.33 ? 632 PRO B N   1 
ATOM   9899  C CA  . PRO B 1 623 ? 5.732   61.578  -71.854  1.00 194.56 ? 632 PRO B CA  1 
ATOM   9900  C C   . PRO B 1 623 ? 5.554   61.942  -70.385  1.00 197.22 ? 632 PRO B C   1 
ATOM   9901  O O   . PRO B 1 623 ? 6.522   61.949  -69.625  1.00 197.90 ? 632 PRO B O   1 
ATOM   9902  C CB  . PRO B 1 623 ? 5.035   62.626  -72.732  1.00 196.76 ? 632 PRO B CB  1 
ATOM   9903  C CG  . PRO B 1 623 ? 4.338   61.849  -73.802  1.00 194.10 ? 632 PRO B CG  1 
ATOM   9904  C CD  . PRO B 1 623 ? 3.944   60.562  -73.159  1.00 191.54 ? 632 PRO B CD  1 
ATOM   9905  N N   . ILE B 1 624 ? 4.318   62.240  -69.998  1.00 195.30 ? 633 ILE B N   1 
ATOM   9906  C CA  . ILE B 1 624 ? 4.014   62.690  -68.645  1.00 198.43 ? 633 ILE B CA  1 
ATOM   9907  C C   . ILE B 1 624 ? 4.135   61.567  -67.618  1.00 196.88 ? 633 ILE B C   1 
ATOM   9908  O O   . ILE B 1 624 ? 3.431   60.559  -67.698  1.00 194.53 ? 633 ILE B O   1 
ATOM   9909  C CB  . ILE B 1 624 ? 2.598   63.287  -68.567  1.00 200.94 ? 633 ILE B CB  1 
ATOM   9910  C CG1 . ILE B 1 624 ? 2.355   64.224  -69.752  1.00 202.21 ? 633 ILE B CG1 1 
ATOM   9911  C CG2 . ILE B 1 624 ? 2.396   64.013  -67.246  1.00 205.03 ? 633 ILE B CG2 1 
ATOM   9912  C CD1 . ILE B 1 624 ? 0.913   64.639  -69.914  1.00 204.25 ? 633 ILE B CD1 1 
ATOM   9913  N N   . GLU B 1 625 ? 5.029   61.754  -66.652  1.00 187.65 ? 634 GLU B N   1 
ATOM   9914  C CA  . GLU B 1 625 ? 5.233   60.782  -65.584  1.00 186.91 ? 634 GLU B CA  1 
ATOM   9915  C C   . GLU B 1 625 ? 4.715   61.296  -64.232  1.00 190.87 ? 634 GLU B C   1 
ATOM   9916  O O   . GLU B 1 625 ? 4.251   60.507  -63.410  1.00 190.66 ? 634 GLU B O   1 
ATOM   9917  C CB  . GLU B 1 625 ? 6.713   60.402  -65.480  1.00 185.80 ? 634 GLU B CB  1 
ATOM   9918  N N   . SER B 1 626 ? 4.810   62.612  -64.005  1.00 183.22 ? 635 SER B N   1 
ATOM   9919  C CA  . SER B 1 626 ? 4.347   63.265  -62.771  1.00 181.67 ? 635 SER B CA  1 
ATOM   9920  C C   . SER B 1 626 ? 3.563   64.544  -63.079  1.00 182.70 ? 635 SER B C   1 
ATOM   9921  O O   . SER B 1 626 ? 3.338   64.875  -64.243  1.00 184.55 ? 635 SER B O   1 
ATOM   9922  C CB  . SER B 1 626 ? 5.531   63.603  -61.857  1.00 182.36 ? 635 SER B CB  1 
ATOM   9923  O OG  . SER B 1 626 ? 6.380   64.572  -62.452  1.00 185.44 ? 635 SER B OG  1 
ATOM   9924  N N   . ALA B 1 627 ? 3.154   65.261  -62.035  1.00 185.55 ? 636 ALA B N   1 
ATOM   9925  C CA  . ALA B 1 627 ? 2.422   66.514  -62.205  1.00 186.73 ? 636 ALA B CA  1 
ATOM   9926  C C   . ALA B 1 627 ? 3.350   67.628  -62.674  1.00 190.09 ? 636 ALA B C   1 
ATOM   9927  O O   . ALA B 1 627 ? 2.939   68.525  -63.411  1.00 192.14 ? 636 ALA B O   1 
ATOM   9928  C CB  . ALA B 1 627 ? 1.735   66.910  -60.909  1.00 184.90 ? 636 ALA B CB  1 
ATOM   9929  N N   . GLU B 1 628 ? 4.605   67.564  -62.239  1.00 155.85 ? 637 GLU B N   1 
ATOM   9930  C CA  . GLU B 1 628 ? 5.602   68.552  -62.628  1.00 159.29 ? 637 GLU B CA  1 
ATOM   9931  C C   . GLU B 1 628 ? 5.826   68.522  -64.135  1.00 161.61 ? 637 GLU B C   1 
ATOM   9932  O O   . GLU B 1 628 ? 6.257   69.510  -64.729  1.00 164.80 ? 637 GLU B O   1 
ATOM   9933  C CB  . GLU B 1 628 ? 6.920   68.298  -61.895  1.00 159.77 ? 637 GLU B CB  1 
ATOM   9934  N N   . ASP B 1 629 ? 5.525   67.381  -64.747  1.00 167.79 ? 638 ASP B N   1 
ATOM   9935  C CA  . ASP B 1 629 ? 5.684   67.220  -66.187  1.00 169.96 ? 638 ASP B CA  1 
ATOM   9936  C C   . ASP B 1 629 ? 4.614   67.991  -66.954  1.00 171.18 ? 638 ASP B C   1 
ATOM   9937  O O   . ASP B 1 629 ? 4.835   68.412  -68.087  1.00 174.11 ? 638 ASP B O   1 
ATOM   9938  C CB  . ASP B 1 629 ? 5.650   65.738  -66.570  1.00 168.32 ? 638 ASP B CB  1 
ATOM   9939  C CG  . ASP B 1 629 ? 6.858   64.976  -66.058  1.00 168.02 ? 638 ASP B CG  1 
ATOM   9940  O OD1 . ASP B 1 629 ? 6.948   63.757  -66.316  1.00 167.00 ? 638 ASP B OD1 1 
ATOM   9941  O OD2 . ASP B 1 629 ? 7.720   65.595  -65.398  1.00 169.06 ? 638 ASP B OD2 1 
ATOM   9942  N N   . LEU B 1 630 ? 3.455   68.172  -66.329  1.00 160.46 ? 639 LEU B N   1 
ATOM   9943  C CA  . LEU B 1 630 ? 2.361   68.914  -66.947  1.00 161.68 ? 639 LEU B CA  1 
ATOM   9944  C C   . LEU B 1 630 ? 2.633   70.415  -66.946  1.00 164.69 ? 639 LEU B C   1 
ATOM   9945  O O   . LEU B 1 630 ? 2.145   71.144  -67.810  1.00 167.19 ? 639 LEU B O   1 
ATOM   9946  C CB  . LEU B 1 630 ? 1.042   68.623  -66.230  1.00 158.74 ? 639 LEU B CB  1 
ATOM   9947  C CG  . LEU B 1 630 ? 0.378   67.282  -66.540  1.00 156.55 ? 639 LEU B CG  1 
ATOM   9948  C CD1 . LEU B 1 630 ? -0.816  67.053  -65.629  1.00 153.73 ? 639 LEU B CD1 1 
ATOM   9949  C CD2 . LEU B 1 630 ? -0.041  67.226  -67.998  1.00 158.80 ? 639 LEU B CD2 1 
ATOM   9950  N N   . SER B 1 631 ? 3.413   70.870  -65.973  1.00 165.94 ? 640 SER B N   1 
ATOM   9951  C CA  . SER B 1 631 ? 3.727   72.288  -65.845  1.00 168.97 ? 640 SER B CA  1 
ATOM   9952  C C   . SER B 1 631 ? 4.920   72.682  -66.710  1.00 172.65 ? 640 SER B C   1 
ATOM   9953  O O   . SER B 1 631 ? 4.997   73.808  -67.201  1.00 176.10 ? 640 SER B O   1 
ATOM   9954  C CB  . SER B 1 631 ? 4.000   72.643  -64.382  1.00 167.74 ? 640 SER B CB  1 
ATOM   9955  O OG  . SER B 1 631 ? 5.058   71.861  -63.856  1.00 166.61 ? 640 SER B OG  1 
ATOM   9956  N N   . LYS B 1 632 ? 5.848   71.748  -66.895  1.00 192.62 ? 641 LYS B N   1 
ATOM   9957  C CA  . LYS B 1 632 ? 7.064   72.015  -67.655  1.00 196.07 ? 641 LYS B CA  1 
ATOM   9958  C C   . LYS B 1 632 ? 6.807   72.062  -69.160  1.00 198.49 ? 641 LYS B C   1 
ATOM   9959  O O   . LYS B 1 632 ? 7.655   72.521  -69.926  1.00 202.04 ? 641 LYS B O   1 
ATOM   9960  C CB  . LYS B 1 632 ? 8.132   70.967  -67.337  1.00 194.89 ? 641 LYS B CB  1 
ATOM   9961  N N   . GLN B 1 633 ? 5.639   71.585  -69.578  1.00 177.01 ? 642 GLN B N   1 
ATOM   9962  C CA  . GLN B 1 633 ? 5.288   71.564  -70.994  1.00 179.33 ? 642 GLN B CA  1 
ATOM   9963  C C   . GLN B 1 633 ? 3.929   72.212  -71.245  1.00 179.75 ? 642 GLN B C   1 
ATOM   9964  O O   . GLN B 1 633 ? 3.188   72.504  -70.307  1.00 177.73 ? 642 GLN B O   1 
ATOM   9965  C CB  . GLN B 1 633 ? 5.313   70.130  -71.532  1.00 177.59 ? 642 GLN B CB  1 
ATOM   9966  C CG  . GLN B 1 633 ? 4.252   69.216  -70.941  1.00 173.55 ? 642 GLN B CG  1 
ATOM   9967  C CD  . GLN B 1 633 ? 2.946   69.269  -71.706  1.00 173.97 ? 642 GLN B CD  1 
ATOM   9968  O OE1 . GLN B 1 633 ? 2.933   69.485  -72.917  1.00 176.99 ? 642 GLN B OE1 1 
ATOM   9969  N NE2 . GLN B 1 633 ? 1.839   69.063  -71.003  1.00 171.18 ? 642 GLN B NE2 1 
ATOM   9970  N N   . THR B 1 634 ? 3.608   72.435  -72.516  1.00 208.75 ? 643 THR B N   1 
ATOM   9971  C CA  . THR B 1 634 ? 2.359   73.093  -72.885  1.00 209.88 ? 643 THR B CA  1 
ATOM   9972  C C   . THR B 1 634 ? 1.661   72.385  -74.042  1.00 210.44 ? 643 THR B C   1 
ATOM   9973  O O   . THR B 1 634 ? 0.477   72.608  -74.293  1.00 210.69 ? 643 THR B O   1 
ATOM   9974  C CB  . THR B 1 634 ? 2.592   74.565  -73.271  1.00 214.36 ? 643 THR B CB  1 
ATOM   9975  O OG1 . THR B 1 634 ? 1.335   75.197  -73.542  1.00 215.51 ? 643 THR B OG1 1 
ATOM   9976  C CG2 . THR B 1 634 ? 3.479   74.658  -74.505  1.00 218.23 ? 643 THR B CG2 1 
ATOM   9977  N N   . GLU B 1 635 ? 2.402   71.535  -74.747  1.00 196.34 ? 644 GLU B N   1 
ATOM   9978  C CA  . GLU B 1 635 ? 1.858   70.804  -75.886  1.00 197.22 ? 644 GLU B CA  1 
ATOM   9979  C C   . GLU B 1 635 ? 0.588   70.048  -75.507  1.00 193.98 ? 644 GLU B C   1 
ATOM   9980  O O   . GLU B 1 635 ? -0.391  70.049  -76.253  1.00 195.32 ? 644 GLU B O   1 
ATOM   9981  C CB  . GLU B 1 635 ? 2.900   69.833  -76.447  1.00 197.53 ? 644 GLU B CB  1 
ATOM   9982  N N   . ILE B 1 636 ? 0.612   69.408  -74.343  1.00 218.61 ? 645 ILE B N   1 
ATOM   9983  C CA  . ILE B 1 636 ? -0.536  68.650  -73.861  1.00 215.44 ? 645 ILE B CA  1 
ATOM   9984  C C   . ILE B 1 636 ? -1.355  69.467  -72.869  1.00 214.13 ? 645 ILE B C   1 
ATOM   9985  O O   . ILE B 1 636 ? -0.920  69.709  -71.743  1.00 212.25 ? 645 ILE B O   1 
ATOM   9986  C CB  . ILE B 1 636 ? -0.102  67.339  -73.181  1.00 211.93 ? 645 ILE B CB  1 
ATOM   9987  C CG1 . ILE B 1 636 ? 0.884   66.576  -74.068  1.00 213.43 ? 645 ILE B CG1 1 
ATOM   9988  C CG2 . ILE B 1 636 ? -1.314  66.480  -72.856  1.00 209.22 ? 645 ILE B CG2 1 
ATOM   9989  C CD1 . ILE B 1 636 ? 1.365   65.275  -73.464  1.00 210.49 ? 645 ILE B CD1 1 
ATOM   9990  N N   . ALA B 1 637 ? -2.541  69.890  -73.293  1.00 187.60 ? 646 ALA B N   1 
ATOM   9991  C CA  . ALA B 1 637 ? -3.433  70.653  -72.430  1.00 186.68 ? 646 ALA B CA  1 
ATOM   9992  C C   . ALA B 1 637 ? -3.960  69.778  -71.299  1.00 182.28 ? 646 ALA B C   1 
ATOM   9993  O O   . ALA B 1 637 ? -3.912  68.551  -71.380  1.00 180.32 ? 646 ALA B O   1 
ATOM   9994  C CB  . ALA B 1 637 ? -4.585  71.233  -73.236  1.00 189.41 ? 646 ALA B CB  1 
ATOM   9995  N N   . TYR B 1 638 ? -4.459  70.415  -70.245  1.00 178.28 ? 647 TYR B N   1 
ATOM   9996  C CA  . TYR B 1 638 ? -5.004  69.690  -69.103  1.00 174.35 ? 647 TYR B CA  1 
ATOM   9997  C C   . TYR B 1 638 ? -5.910  70.585  -68.265  1.00 174.02 ? 647 TYR B C   1 
ATOM   9998  O O   . TYR B 1 638 ? -5.732  71.801  -68.227  1.00 176.36 ? 647 TYR B O   1 
ATOM   9999  C CB  . TYR B 1 638 ? -3.878  69.120  -68.238  1.00 171.94 ? 647 TYR B CB  1 
ATOM   10000 C CG  . TYR B 1 638 ? -2.910  70.161  -67.723  1.00 173.22 ? 647 TYR B CG  1 
ATOM   10001 C CD1 . TYR B 1 638 ? -1.740  70.450  -68.413  1.00 175.74 ? 647 TYR B CD1 1 
ATOM   10002 C CD2 . TYR B 1 638 ? -3.164  70.854  -66.546  1.00 172.17 ? 647 TYR B CD2 1 
ATOM   10003 C CE1 . TYR B 1 638 ? -0.852  71.400  -67.947  1.00 177.24 ? 647 TYR B CE1 1 
ATOM   10004 C CE2 . TYR B 1 638 ? -2.282  71.806  -66.072  1.00 173.67 ? 647 TYR B CE2 1 
ATOM   10005 C CZ  . TYR B 1 638 ? -1.127  72.075  -66.776  1.00 176.24 ? 647 TYR B CZ  1 
ATOM   10006 O OH  . TYR B 1 638 ? -0.245  73.022  -66.308  1.00 178.05 ? 647 TYR B OH  1 
ATOM   10007 N N   . GLY B 1 639 ? -6.883  69.974  -67.596  1.00 169.76 ? 648 GLY B N   1 
ATOM   10008 C CA  . GLY B 1 639 ? -7.814  70.712  -66.765  1.00 169.34 ? 648 GLY B CA  1 
ATOM   10009 C C   . GLY B 1 639 ? -8.510  69.835  -65.743  1.00 165.70 ? 648 GLY B C   1 
ATOM   10010 O O   . GLY B 1 639 ? -8.236  68.639  -65.643  1.00 163.48 ? 648 GLY B O   1 
ATOM   10011 N N   . THR B 1 640 ? -9.415  70.438  -64.977  1.00 156.41 ? 649 THR B N   1 
ATOM   10012 C CA  . THR B 1 640 ? -10.168 69.715  -63.960  1.00 153.27 ? 649 THR B CA  1 
ATOM   10013 C C   . THR B 1 640 ? -11.660 69.975  -64.118  1.00 154.18 ? 649 THR B C   1 
ATOM   10014 O O   . THR B 1 640 ? -12.094 70.582  -65.097  1.00 157.23 ? 649 THR B O   1 
ATOM   10015 C CB  . THR B 1 640 ? -9.745  70.137  -62.542  1.00 151.54 ? 649 THR B CB  1 
ATOM   10016 O OG1 . THR B 1 640 ? -10.140 71.494  -62.308  1.00 153.67 ? 649 THR B OG1 1 
ATOM   10017 C CG2 . THR B 1 640 ? -8.238  70.016  -62.375  1.00 151.18 ? 649 THR B CG2 1 
ATOM   10018 N N   . LEU B 1 641 ? -12.443 69.514  -63.149  1.00 177.33 ? 650 LEU B N   1 
ATOM   10019 C CA  . LEU B 1 641 ? -13.878 69.764  -63.150  1.00 178.17 ? 650 LEU B CA  1 
ATOM   10020 C C   . LEU B 1 641 ? -14.134 71.236  -62.847  1.00 180.37 ? 650 LEU B C   1 
ATOM   10021 O O   . LEU B 1 641 ? -13.469 71.826  -61.996  1.00 179.78 ? 650 LEU B O   1 
ATOM   10022 C CB  . LEU B 1 641 ? -14.577 68.877  -62.119  1.00 175.10 ? 650 LEU B CB  1 
ATOM   10023 C CG  . LEU B 1 641 ? -16.097 68.758  -62.235  1.00 175.81 ? 650 LEU B CG  1 
ATOM   10024 C CD1 . LEU B 1 641 ? -16.492 68.268  -63.619  1.00 177.84 ? 650 LEU B CD1 1 
ATOM   10025 C CD2 . LEU B 1 641 ? -16.646 67.833  -61.160  1.00 172.79 ? 650 LEU B CD2 1 
ATOM   10026 N N   . ASP B 1 642 ? -15.098 71.827  -63.548  1.00 221.49 ? 651 ASP B N   1 
ATOM   10027 C CA  . ASP B 1 642 ? -15.382 73.253  -63.405  1.00 224.23 ? 651 ASP B CA  1 
ATOM   10028 C C   . ASP B 1 642 ? -15.798 73.631  -61.984  1.00 222.61 ? 651 ASP B C   1 
ATOM   10029 O O   . ASP B 1 642 ? -15.704 74.795  -61.592  1.00 224.43 ? 651 ASP B O   1 
ATOM   10030 C CB  . ASP B 1 642 ? -16.448 73.698  -64.411  1.00 227.70 ? 651 ASP B CB  1 
ATOM   10031 C CG  . ASP B 1 642 ? -17.730 72.893  -64.304  1.00 226.61 ? 651 ASP B CG  1 
ATOM   10032 O OD1 . ASP B 1 642 ? -17.880 72.125  -63.330  1.00 223.23 ? 651 ASP B OD1 1 
ATOM   10033 O OD2 . ASP B 1 642 ? -18.591 73.029  -65.198  1.00 229.37 ? 651 ASP B OD2 1 
ATOM   10034 N N   . SER B 1 643 ? -16.253 72.645  -61.218  1.00 174.87 ? 652 SER B N   1 
ATOM   10035 C CA  . SER B 1 643 ? -16.678 72.878  -59.843  1.00 173.23 ? 652 SER B CA  1 
ATOM   10036 C C   . SER B 1 643 ? -16.419 71.655  -58.970  1.00 169.30 ? 652 SER B C   1 
ATOM   10037 O O   . SER B 1 643 ? -16.816 70.542  -59.313  1.00 167.98 ? 652 SER B O   1 
ATOM   10038 C CB  . SER B 1 643 ? -18.161 73.252  -59.795  1.00 174.75 ? 652 SER B CB  1 
ATOM   10039 O OG  . SER B 1 643 ? -18.970 72.198  -60.285  1.00 173.99 ? 652 SER B OG  1 
ATOM   10040 N N   . GLY B 1 644 ? -15.752 71.869  -57.841  1.00 176.35 ? 653 GLY B N   1 
ATOM   10041 C CA  . GLY B 1 644 ? -15.439 70.788  -56.926  1.00 172.93 ? 653 GLY B CA  1 
ATOM   10042 C C   . GLY B 1 644 ? -14.154 71.032  -56.161  1.00 172.03 ? 653 GLY B C   1 
ATOM   10043 O O   . GLY B 1 644 ? -13.432 71.992  -56.433  1.00 174.07 ? 653 GLY B O   1 
ATOM   10044 N N   . SER B 1 645 ? -13.867 70.158  -55.202  1.00 166.23 ? 654 SER B N   1 
ATOM   10045 C CA  . SER B 1 645 ? -12.667 70.283  -54.383  1.00 165.40 ? 654 SER B CA  1 
ATOM   10046 C C   . SER B 1 645 ? -11.406 70.174  -55.232  1.00 166.16 ? 654 SER B C   1 
ATOM   10047 O O   . SER B 1 645 ? -10.366 70.736  -54.890  1.00 166.90 ? 654 SER B O   1 
ATOM   10048 C CB  . SER B 1 645 ? -12.650 69.217  -53.286  1.00 162.45 ? 654 SER B CB  1 
ATOM   10049 O OG  . SER B 1 645 ? -12.522 67.919  -53.839  1.00 160.98 ? 654 SER B OG  1 
ATOM   10050 N N   . THR B 1 646 ? -11.503 69.445  -56.339  1.00 149.54 ? 655 THR B N   1 
ATOM   10051 C CA  . THR B 1 646 ? -10.370 69.264  -57.237  1.00 150.41 ? 655 THR B CA  1 
ATOM   10052 C C   . THR B 1 646 ? -9.903  70.600  -57.806  1.00 153.52 ? 655 THR B C   1 
ATOM   10053 O O   . THR B 1 646 ? -8.719  70.932  -57.746  1.00 154.26 ? 655 THR B O   1 
ATOM   10054 C CB  . THR B 1 646 ? -10.717 68.317  -58.400  1.00 150.38 ? 655 THR B CB  1 
ATOM   10055 O OG1 . THR B 1 646 ? -11.184 67.067  -57.879  1.00 147.80 ? 655 THR B OG1 1 
ATOM   10056 C CG2 . THR B 1 646 ? -9.494  68.075  -59.271  1.00 151.29 ? 655 THR B CG2 1 
ATOM   10057 N N   . LYS B 1 647 ? -10.843 71.361  -58.357  1.00 146.60 ? 656 LYS B N   1 
ATOM   10058 C CA  . LYS B 1 647 ? -10.537 72.667  -58.929  1.00 149.99 ? 656 LYS B CA  1 
ATOM   10059 C C   . LYS B 1 647 ? -10.130 73.658  -57.845  1.00 150.63 ? 656 LYS B C   1 
ATOM   10060 O O   . LYS B 1 647 ? -9.145  74.381  -57.990  1.00 152.58 ? 656 LYS B O   1 
ATOM   10061 C CB  . LYS B 1 647 ? -11.739 73.206  -59.707  1.00 152.25 ? 656 LYS B CB  1 
ATOM   10062 N N   . GLU B 1 648 ? -10.895 73.683  -56.758  1.00 171.78 ? 657 GLU B N   1 
ATOM   10063 C CA  . GLU B 1 648 ? -10.627 74.594  -55.652  1.00 172.49 ? 657 GLU B CA  1 
ATOM   10064 C C   . GLU B 1 648 ? -9.280  74.297  -54.999  1.00 171.37 ? 657 GLU B C   1 
ATOM   10065 O O   . GLU B 1 648 ? -8.705  75.153  -54.326  1.00 172.79 ? 657 GLU B O   1 
ATOM   10066 C CB  . GLU B 1 648 ? -11.746 74.516  -54.610  1.00 171.02 ? 657 GLU B CB  1 
ATOM   10067 N N   . PHE B 1 649 ? -8.782  73.082  -55.202  1.00 146.68 ? 658 PHE B N   1 
ATOM   10068 C CA  . PHE B 1 649 ? -7.496  72.685  -54.644  1.00 145.75 ? 658 PHE B CA  1 
ATOM   10069 C C   . PHE B 1 649 ? -6.359  73.496  -55.253  1.00 148.60 ? 658 PHE B C   1 
ATOM   10070 O O   . PHE B 1 649 ? -5.570  74.110  -54.535  1.00 149.67 ? 658 PHE B O   1 
ATOM   10071 C CB  . PHE B 1 649 ? -7.248  71.192  -54.860  1.00 143.12 ? 658 PHE B CB  1 
ATOM   10072 C CG  . PHE B 1 649 ? -5.836  70.766  -54.577  1.00 142.74 ? 658 PHE B CG  1 
ATOM   10073 C CD1 . PHE B 1 649 ? -5.366  70.698  -53.276  1.00 141.74 ? 658 PHE B CD1 1 
ATOM   10074 C CD2 . PHE B 1 649 ? -4.979  70.434  -55.611  1.00 143.63 ? 658 PHE B CD2 1 
ATOM   10075 C CE1 . PHE B 1 649 ? -4.067  70.308  -53.013  1.00 141.70 ? 658 PHE B CE1 1 
ATOM   10076 C CE2 . PHE B 1 649 ? -3.679  70.043  -55.355  1.00 143.53 ? 658 PHE B CE2 1 
ATOM   10077 C CZ  . PHE B 1 649 ? -3.222  69.980  -54.054  1.00 142.60 ? 658 PHE B CZ  1 
ATOM   10078 N N   . PHE B 1 650 ? -6.281  73.492  -56.579  1.00 163.92 ? 659 PHE B N   1 
ATOM   10079 C CA  . PHE B 1 650 ? -5.235  74.220  -57.287  1.00 166.88 ? 659 PHE B CA  1 
ATOM   10080 C C   . PHE B 1 650 ? -5.334  75.721  -57.040  1.00 170.04 ? 659 PHE B C   1 
ATOM   10081 O O   . PHE B 1 650 ? -4.321  76.404  -56.890  1.00 172.17 ? 659 PHE B O   1 
ATOM   10082 C CB  . PHE B 1 650 ? -5.299  73.928  -58.788  1.00 168.03 ? 659 PHE B CB  1 
ATOM   10083 C CG  . PHE B 1 650 ? -4.982  72.504  -59.142  1.00 165.60 ? 659 PHE B CG  1 
ATOM   10084 C CD1 . PHE B 1 650 ? -3.668  72.083  -59.259  1.00 165.65 ? 659 PHE B CD1 1 
ATOM   10085 C CD2 . PHE B 1 650 ? -5.996  71.587  -59.358  1.00 163.55 ? 659 PHE B CD2 1 
ATOM   10086 C CE1 . PHE B 1 650 ? -3.371  70.773  -59.583  1.00 163.70 ? 659 PHE B CE1 1 
ATOM   10087 C CE2 . PHE B 1 650 ? -5.705  70.275  -59.683  1.00 161.63 ? 659 PHE B CE2 1 
ATOM   10088 C CZ  . PHE B 1 650 ? -4.391  69.868  -59.795  1.00 161.70 ? 659 PHE B CZ  1 
ATOM   10089 N N   . ARG B 1 651 ? -6.562  76.227  -56.999  1.00 157.24 ? 660 ARG B N   1 
ATOM   10090 C CA  . ARG B 1 651 ? -6.798  77.650  -56.791  1.00 160.50 ? 660 ARG B CA  1 
ATOM   10091 C C   . ARG B 1 651 ? -6.213  78.127  -55.466  1.00 160.59 ? 660 ARG B C   1 
ATOM   10092 O O   . ARG B 1 651 ? -5.613  79.200  -55.394  1.00 163.79 ? 660 ARG B O   1 
ATOM   10093 C CB  . ARG B 1 651 ? -8.296  77.956  -56.842  1.00 160.78 ? 660 ARG B CB  1 
ATOM   10094 N N   . ARG B 1 652 ? -6.385  77.323  -54.423  1.00 160.88 ? 661 ARG B N   1 
ATOM   10095 C CA  . ARG B 1 652 ? -5.944  77.698  -53.084  1.00 160.89 ? 661 ARG B CA  1 
ATOM   10096 C C   . ARG B 1 652 ? -4.550  77.167  -52.755  1.00 160.20 ? 661 ARG B C   1 
ATOM   10097 O O   . ARG B 1 652 ? -3.936  77.583  -51.772  1.00 161.03 ? 661 ARG B O   1 
ATOM   10098 C CB  . ARG B 1 652 ? -6.949  77.214  -52.035  1.00 158.19 ? 661 ARG B CB  1 
ATOM   10099 N N   . SER B 1 653 ? -4.053  76.251  -53.579  1.00 182.98 ? 662 SER B N   1 
ATOM   10100 C CA  . SER B 1 653 ? -2.752  75.635  -53.339  1.00 182.35 ? 662 SER B CA  1 
ATOM   10101 C C   . SER B 1 653 ? -1.618  76.647  -53.467  1.00 186.00 ? 662 SER B C   1 
ATOM   10102 O O   . SER B 1 653 ? -1.533  77.378  -54.454  1.00 188.77 ? 662 SER B O   1 
ATOM   10103 C CB  . SER B 1 653 ? -2.525  74.463  -54.297  1.00 180.59 ? 662 SER B CB  1 
ATOM   10104 O OG  . SER B 1 653 ? -1.300  73.807  -54.017  1.00 180.01 ? 662 SER B OG  1 
ATOM   10105 N N   . LYS B 1 654 ? -0.749  76.681  -52.462  1.00 159.93 ? 663 LYS B N   1 
ATOM   10106 C CA  . LYS B 1 654 ? 0.393   77.589  -52.464  1.00 163.57 ? 663 LYS B CA  1 
ATOM   10107 C C   . LYS B 1 654 ? 1.682   76.846  -52.801  1.00 163.45 ? 663 LYS B C   1 
ATOM   10108 O O   . LYS B 1 654 ? 2.779   77.384  -52.651  1.00 166.22 ? 663 LYS B O   1 
ATOM   10109 C CB  . LYS B 1 654 ? 0.525   78.286  -51.108  1.00 164.79 ? 663 LYS B CB  1 
ATOM   10110 N N   . ILE B 1 655 ? 1.541   75.605  -53.257  1.00 182.36 ? 664 ILE B N   1 
ATOM   10111 C CA  . ILE B 1 655 ? 2.692   74.787  -53.622  1.00 182.15 ? 664 ILE B CA  1 
ATOM   10112 C C   . ILE B 1 655 ? 3.241   75.204  -54.983  1.00 184.87 ? 664 ILE B C   1 
ATOM   10113 O O   . ILE B 1 655 ? 2.483   75.574  -55.880  1.00 185.51 ? 664 ILE B O   1 
ATOM   10114 C CB  . ILE B 1 655 ? 2.334   73.289  -53.641  1.00 178.30 ? 664 ILE B CB  1 
ATOM   10115 C CG1 . ILE B 1 655 ? 1.690   72.881  -52.313  1.00 175.75 ? 664 ILE B CG1 1 
ATOM   10116 C CG2 . ILE B 1 655 ? 3.569   72.446  -53.921  1.00 178.35 ? 664 ILE B CG2 1 
ATOM   10117 C CD1 . ILE B 1 655 ? 1.332   71.414  -52.230  1.00 172.25 ? 664 ILE B CD1 1 
ATOM   10118 N N   . ALA B 1 656 ? 4.561   75.141  -55.125  1.00 163.20 ? 665 ALA B N   1 
ATOM   10119 C CA  . ALA B 1 656 ? 5.240   75.587  -56.339  1.00 166.27 ? 665 ALA B CA  1 
ATOM   10120 C C   . ALA B 1 656 ? 4.596   75.055  -57.619  1.00 165.19 ? 665 ALA B C   1 
ATOM   10121 O O   . ALA B 1 656 ? 4.035   75.819  -58.405  1.00 167.07 ? 665 ALA B O   1 
ATOM   10122 C CB  . ALA B 1 656 ? 6.715   75.206  -56.289  1.00 167.60 ? 665 ALA B CB  1 
ATOM   10123 N N   . VAL B 1 657 ? 4.683   73.744  -57.820  1.00 179.26 ? 666 VAL B N   1 
ATOM   10124 C CA  . VAL B 1 657 ? 4.189   73.120  -59.043  1.00 178.44 ? 666 VAL B CA  1 
ATOM   10125 C C   . VAL B 1 657 ? 2.709   73.402  -59.291  1.00 177.47 ? 666 VAL B C   1 
ATOM   10126 O O   . VAL B 1 657 ? 2.333   73.897  -60.354  1.00 179.40 ? 666 VAL B O   1 
ATOM   10127 C CB  . VAL B 1 657 ? 4.412   71.595  -59.027  1.00 175.51 ? 666 VAL B CB  1 
ATOM   10128 C CG1 . VAL B 1 657 ? 3.902   70.973  -60.318  1.00 175.06 ? 666 VAL B CG1 1 
ATOM   10129 C CG2 . VAL B 1 657 ? 5.885   71.277  -58.822  1.00 176.72 ? 666 VAL B CG2 1 
ATOM   10130 N N   . PHE B 1 658 ? 1.875   73.085  -58.306  1.00 171.67 ? 667 PHE B N   1 
ATOM   10131 C CA  . PHE B 1 658 ? 0.430   73.239  -58.446  1.00 170.59 ? 667 PHE B CA  1 
ATOM   10132 C C   . PHE B 1 658 ? 0.029   74.686  -58.716  1.00 173.77 ? 667 PHE B C   1 
ATOM   10133 O O   . PHE B 1 658 ? -1.012  74.947  -59.320  1.00 174.13 ? 667 PHE B O   1 
ATOM   10134 C CB  . PHE B 1 658 ? -0.291  72.711  -57.204  1.00 167.40 ? 667 PHE B CB  1 
ATOM   10135 C CG  . PHE B 1 658 ? 0.056   71.290  -56.862  1.00 164.51 ? 667 PHE B CG  1 
ATOM   10136 C CD1 . PHE B 1 658 ? -0.314  70.252  -57.701  1.00 163.03 ? 667 PHE B CD1 1 
ATOM   10137 C CD2 . PHE B 1 658 ? 0.750   70.992  -55.701  1.00 163.57 ? 667 PHE B CD2 1 
ATOM   10138 C CE1 . PHE B 1 658 ? 0.004   68.944  -57.391  1.00 160.70 ? 667 PHE B CE1 1 
ATOM   10139 C CE2 . PHE B 1 658 ? 1.070   69.685  -55.385  1.00 161.24 ? 667 PHE B CE2 1 
ATOM   10140 C CZ  . PHE B 1 658 ? 0.697   68.660  -56.231  1.00 159.81 ? 667 PHE B CZ  1 
ATOM   10141 N N   . ASP B 1 659 ? 0.858   75.623  -58.268  1.00 187.23 ? 668 ASP B N   1 
ATOM   10142 C CA  . ASP B 1 659 ? 0.601   77.040  -58.496  1.00 190.79 ? 668 ASP B CA  1 
ATOM   10143 C C   . ASP B 1 659 ? 0.604   77.345  -59.989  1.00 193.37 ? 668 ASP B C   1 
ATOM   10144 O O   . ASP B 1 659 ? -0.376  77.861  -60.529  1.00 194.49 ? 668 ASP B O   1 
ATOM   10145 C CB  . ASP B 1 659 ? 1.645   77.898  -57.776  1.00 193.44 ? 668 ASP B CB  1 
ATOM   10146 C CG  . ASP B 1 659 ? 1.355   79.385  -57.880  1.00 197.35 ? 668 ASP B CG  1 
ATOM   10147 O OD1 . ASP B 1 659 ? 0.984   79.851  -58.979  1.00 199.52 ? 668 ASP B OD1 1 
ATOM   10148 O OD2 . ASP B 1 659 ? 1.505   80.091  -56.861  1.00 198.53 ? 668 ASP B OD2 1 
ATOM   10149 N N   . LYS B 1 660 ? 1.711   77.021  -60.650  1.00 169.80 ? 669 LYS B N   1 
ATOM   10150 C CA  . LYS B 1 660 ? 1.849   77.254  -62.082  1.00 172.48 ? 669 LYS B CA  1 
ATOM   10151 C C   . LYS B 1 660 ? 0.722   76.582  -62.861  1.00 170.70 ? 669 LYS B C   1 
ATOM   10152 O O   . LYS B 1 660 ? 0.166   77.164  -63.793  1.00 173.12 ? 669 LYS B O   1 
ATOM   10153 C CB  . LYS B 1 660 ? 3.205   76.750  -62.579  1.00 173.39 ? 669 LYS B CB  1 
ATOM   10154 N N   . MET B 1 661 ? 0.390   75.356  -62.469  1.00 168.75 ? 670 MET B N   1 
ATOM   10155 C CA  . MET B 1 661 ? -0.674  74.604  -63.123  1.00 167.00 ? 670 MET B CA  1 
ATOM   10156 C C   . MET B 1 661 ? -1.982  75.385  -63.112  1.00 167.84 ? 670 MET B C   1 
ATOM   10157 O O   . MET B 1 661 ? -2.652  75.507  -64.138  1.00 169.34 ? 670 MET B O   1 
ATOM   10158 C CB  . MET B 1 661 ? -0.868  73.247  -62.443  1.00 162.75 ? 670 MET B CB  1 
ATOM   10159 C CG  . MET B 1 661 ? 0.362   72.356  -62.473  1.00 161.94 ? 670 MET B CG  1 
ATOM   10160 S SD  . MET B 1 661 ? 0.045   70.721  -61.782  1.00 157.40 ? 670 MET B SD  1 
ATOM   10161 C CE  . MET B 1 661 ? -1.237  70.129  -62.885  1.00 156.83 ? 670 MET B CE  1 
ATOM   10162 N N   . TRP B 1 662 ? -2.341  75.913  -61.946  1.00 184.00 ? 671 TRP B N   1 
ATOM   10163 C CA  . TRP B 1 662 ? -3.566  76.692  -61.808  1.00 184.93 ? 671 TRP B CA  1 
ATOM   10164 C C   . TRP B 1 662 ? -3.518  77.956  -62.658  1.00 189.58 ? 671 TRP B C   1 
ATOM   10165 O O   . TRP B 1 662 ? -4.499  78.311  -63.310  1.00 191.05 ? 671 TRP B O   1 
ATOM   10166 C CB  . TRP B 1 662 ? -3.818  77.051  -60.343  1.00 183.58 ? 671 TRP B CB  1 
ATOM   10167 C CG  . TRP B 1 662 ? -4.947  78.017  -60.153  1.00 185.20 ? 671 TRP B CG  1 
ATOM   10168 C CD1 . TRP B 1 662 ? -4.869  79.279  -59.642  1.00 188.01 ? 671 TRP B CD1 1 
ATOM   10169 C CD2 . TRP B 1 662 ? -6.324  77.803  -60.487  1.00 184.45 ? 671 TRP B CD2 1 
ATOM   10170 N NE1 . TRP B 1 662 ? -6.113  79.863  -59.629  1.00 189.01 ? 671 TRP B NE1 1 
ATOM   10171 C CE2 . TRP B 1 662 ? -7.024  78.978  -60.143  1.00 186.86 ? 671 TRP B CE2 1 
ATOM   10172 C CE3 . TRP B 1 662 ? -7.034  76.733  -61.039  1.00 182.23 ? 671 TRP B CE3 1 
ATOM   10173 C CZ2 . TRP B 1 662 ? -8.397  79.111  -60.334  1.00 187.09 ? 671 TRP B CZ2 1 
ATOM   10174 C CZ3 . TRP B 1 662 ? -8.398  76.868  -61.228  1.00 182.49 ? 671 TRP B CZ3 1 
ATOM   10175 C CH2 . TRP B 1 662 ? -9.065  78.048  -60.876  1.00 184.88 ? 671 TRP B CH2 1 
ATOM   10176 N N   . THR B 1 663 ? -2.372  78.630  -62.648  1.00 176.77 ? 672 THR B N   1 
ATOM   10177 C CA  . THR B 1 663 ? -2.189  79.840  -63.441  1.00 181.59 ? 672 THR B CA  1 
ATOM   10178 C C   . THR B 1 663 ? -2.512  79.572  -64.907  1.00 183.05 ? 672 THR B C   1 
ATOM   10179 O O   . THR B 1 663 ? -3.146  80.389  -65.574  1.00 186.24 ? 672 THR B O   1 
ATOM   10180 C CB  . THR B 1 663 ? -0.751  80.376  -63.328  1.00 184.12 ? 672 THR B CB  1 
ATOM   10181 O OG1 . THR B 1 663 ? -0.462  80.691  -61.960  1.00 183.25 ? 672 THR B OG1 1 
ATOM   10182 C CG2 . THR B 1 663 ? -0.579  81.625  -64.178  1.00 189.44 ? 672 THR B CG2 1 
ATOM   10183 N N   . TYR B 1 664 ? -2.074  78.418  -65.398  1.00 183.70 ? 673 TYR B N   1 
ATOM   10184 C CA  . TYR B 1 664 ? -2.335  78.018  -66.776  1.00 184.94 ? 673 TYR B CA  1 
ATOM   10185 C C   . TYR B 1 664 ? -3.817  77.746  -67.010  1.00 183.85 ? 673 TYR B C   1 
ATOM   10186 O O   . TYR B 1 664 ? -4.425  78.310  -67.918  1.00 186.91 ? 673 TYR B O   1 
ATOM   10187 C CB  . TYR B 1 664 ? -1.511  76.780  -67.136  1.00 182.86 ? 673 TYR B CB  1 
ATOM   10188 C CG  . TYR B 1 664 ? -2.086  75.971  -68.278  1.00 182.64 ? 673 TYR B CG  1 
ATOM   10189 C CD1 . TYR B 1 664 ? -1.899  76.362  -69.597  1.00 186.43 ? 673 TYR B CD1 1 
ATOM   10190 C CD2 . TYR B 1 664 ? -2.815  74.814  -68.034  1.00 178.94 ? 673 TYR B CD2 1 
ATOM   10191 C CE1 . TYR B 1 664 ? -2.424  75.624  -70.641  1.00 186.53 ? 673 TYR B CE1 1 
ATOM   10192 C CE2 . TYR B 1 664 ? -3.343  74.070  -69.070  1.00 179.05 ? 673 TYR B CE2 1 
ATOM   10193 C CZ  . TYR B 1 664 ? -3.145  74.480  -70.372  1.00 182.85 ? 673 TYR B CZ  1 
ATOM   10194 O OH  . TYR B 1 664 ? -3.670  73.741  -71.408  1.00 183.25 ? 673 TYR B OH  1 
ATOM   10195 N N   . MET B 1 665 ? -4.392  76.879  -66.182  1.00 174.76 ? 674 MET B N   1 
ATOM   10196 C CA  . MET B 1 665 ? -5.790  76.488  -66.326  1.00 173.51 ? 674 MET B CA  1 
ATOM   10197 C C   . MET B 1 665 ? -6.742  77.663  -66.121  1.00 175.89 ? 674 MET B C   1 
ATOM   10198 O O   . MET B 1 665 ? -7.839  77.687  -66.677  1.00 176.84 ? 674 MET B O   1 
ATOM   10199 C CB  . MET B 1 665 ? -6.132  75.363  -65.346  1.00 168.78 ? 674 MET B CB  1 
ATOM   10200 C CG  . MET B 1 665 ? -5.331  74.089  -65.557  1.00 166.46 ? 674 MET B CG  1 
ATOM   10201 S SD  . MET B 1 665 ? -5.791  72.781  -64.405  1.00 161.37 ? 674 MET B SD  1 
ATOM   10202 C CE  . MET B 1 665 ? -5.347  73.533  -62.841  1.00 160.53 ? 674 MET B CE  1 
ATOM   10203 N N   . ARG B 1 666 ? -6.314  78.636  -65.323  1.00 178.03 ? 675 ARG B N   1 
ATOM   10204 C CA  . ARG B 1 666 ? -7.155  79.780  -64.988  1.00 180.41 ? 675 ARG B CA  1 
ATOM   10205 C C   . ARG B 1 666 ? -7.433  80.674  -66.193  1.00 185.27 ? 675 ARG B C   1 
ATOM   10206 O O   . ARG B 1 666 ? -8.464  81.343  -66.251  1.00 187.24 ? 675 ARG B O   1 
ATOM   10207 C CB  . ARG B 1 666 ? -6.519  80.602  -63.864  1.00 180.98 ? 675 ARG B CB  1 
ATOM   10208 N N   . SER B 1 667 ? -6.513  80.682  -67.152  1.00 189.61 ? 676 SER B N   1 
ATOM   10209 C CA  . SER B 1 667 ? -6.641  81.546  -68.321  1.00 194.63 ? 676 SER B CA  1 
ATOM   10210 C C   . SER B 1 667 ? -6.488  80.778  -69.630  1.00 195.16 ? 676 SER B C   1 
ATOM   10211 O O   . SER B 1 667 ? -6.354  81.377  -70.698  1.00 199.43 ? 676 SER B O   1 
ATOM   10212 C CB  . SER B 1 667 ? -5.618  82.682  -68.258  1.00 198.37 ? 676 SER B CB  1 
ATOM   10213 O OG  . SER B 1 667 ? -4.296  82.175  -68.191  1.00 197.11 ? 676 SER B OG  1 
ATOM   10214 N N   . ALA B 1 668 ? -6.512  79.452  -69.545  1.00 196.29 ? 677 ALA B N   1 
ATOM   10215 C CA  . ALA B 1 668 ? -6.356  78.609  -70.725  1.00 196.60 ? 677 ALA B CA  1 
ATOM   10216 C C   . ALA B 1 668 ? -7.582  78.683  -71.631  1.00 198.80 ? 677 ALA B C   1 
ATOM   10217 O O   . ALA B 1 668 ? -8.717  78.572  -71.166  1.00 197.37 ? 677 ALA B O   1 
ATOM   10218 C CB  . ALA B 1 668 ? -6.080  77.170  -70.318  1.00 191.84 ? 677 ALA B CB  1 
ATOM   10219 N N   . GLU B 1 669 ? -7.344  78.872  -72.925  1.00 227.10 ? 678 GLU B N   1 
ATOM   10220 C CA  . GLU B 1 669 ? -8.421  78.943  -73.905  1.00 229.82 ? 678 GLU B CA  1 
ATOM   10221 C C   . GLU B 1 669 ? -8.182  77.961  -75.049  1.00 230.12 ? 678 GLU B C   1 
ATOM   10222 O O   . GLU B 1 669 ? -7.072  77.879  -75.576  1.00 231.27 ? 678 GLU B O   1 
ATOM   10223 C CB  . GLU B 1 669 ? -8.558  80.366  -74.450  1.00 235.39 ? 678 GLU B CB  1 
ATOM   10224 N N   . PRO B 1 670 ? -9.225  77.210  -75.437  1.00 216.81 ? 679 PRO B N   1 
ATOM   10225 C CA  . PRO B 1 670 ? -10.566 77.237  -74.840  1.00 215.58 ? 679 PRO B CA  1 
ATOM   10226 C C   . PRO B 1 670 ? -10.580 76.694  -73.413  1.00 210.37 ? 679 PRO B C   1 
ATOM   10227 O O   . PRO B 1 670 ? -9.539  76.287  -72.896  1.00 207.79 ? 679 PRO B O   1 
ATOM   10228 C CB  . PRO B 1 670 ? -11.364 76.301  -75.756  1.00 215.99 ? 679 PRO B CB  1 
ATOM   10229 C CG  . PRO B 1 670 ? -10.321 75.408  -76.359  1.00 215.12 ? 679 PRO B CG  1 
ATOM   10230 C CD  . PRO B 1 670 ? -9.194  76.345  -76.627  1.00 217.89 ? 679 PRO B CD  1 
ATOM   10231 N N   . SER B 1 671 ? -11.755 76.686  -72.792  1.00 217.92 ? 680 SER B N   1 
ATOM   10232 C CA  . SER B 1 671 ? -11.898 76.214  -71.420  1.00 213.31 ? 680 SER B CA  1 
ATOM   10233 C C   . SER B 1 671 ? -11.369 74.792  -71.253  1.00 209.31 ? 680 SER B C   1 
ATOM   10234 O O   . SER B 1 671 ? -11.795 73.873  -71.952  1.00 209.09 ? 680 SER B O   1 
ATOM   10235 C CB  . SER B 1 671 ? -13.363 76.286  -70.980  1.00 212.98 ? 680 SER B CB  1 
ATOM   10236 O OG  . SER B 1 671 ? -13.513 75.875  -69.632  1.00 208.77 ? 680 SER B OG  1 
ATOM   10237 N N   . VAL B 1 672 ? -10.436 74.621  -70.321  1.00 190.50 ? 681 VAL B N   1 
ATOM   10238 C CA  . VAL B 1 672 ? -9.868  73.310  -70.036  1.00 186.80 ? 681 VAL B CA  1 
ATOM   10239 C C   . VAL B 1 672 ? -10.700 72.573  -68.994  1.00 183.01 ? 681 VAL B C   1 
ATOM   10240 O O   . VAL B 1 672 ? -10.425 71.418  -68.669  1.00 179.92 ? 681 VAL B O   1 
ATOM   10241 C CB  . VAL B 1 672 ? -8.416  73.419  -69.536  1.00 185.80 ? 681 VAL B CB  1 
ATOM   10242 C CG1 . VAL B 1 672 ? -7.502  73.891  -70.658  1.00 189.40 ? 681 VAL B CG1 1 
ATOM   10243 C CG2 . VAL B 1 672 ? -8.335  74.357  -68.340  1.00 185.29 ? 681 VAL B CG2 1 
ATOM   10244 N N   . PHE B 1 673 ? -11.718 73.250  -68.473  1.00 200.17 ? 682 PHE B N   1 
ATOM   10245 C CA  . PHE B 1 673 ? -12.601 72.659  -67.474  1.00 197.00 ? 682 PHE B CA  1 
ATOM   10246 C C   . PHE B 1 673 ? -13.824 72.031  -68.134  1.00 197.65 ? 682 PHE B C   1 
ATOM   10247 O O   . PHE B 1 673 ? -14.342 72.549  -69.123  1.00 201.21 ? 682 PHE B O   1 
ATOM   10248 C CB  . PHE B 1 673 ? -13.038 73.713  -66.455  1.00 197.22 ? 682 PHE B CB  1 
ATOM   10249 C CG  . PHE B 1 673 ? -11.898 74.482  -65.852  1.00 197.38 ? 682 PHE B CG  1 
ATOM   10250 C CD1 . PHE B 1 673 ? -11.169 73.955  -64.799  1.00 194.01 ? 682 PHE B CD1 1 
ATOM   10251 C CD2 . PHE B 1 673 ? -11.555 75.731  -66.339  1.00 201.23 ? 682 PHE B CD2 1 
ATOM   10252 C CE1 . PHE B 1 673 ? -10.119 74.661  -64.243  1.00 194.47 ? 682 PHE B CE1 1 
ATOM   10253 C CE2 . PHE B 1 673 ? -10.506 76.442  -65.787  1.00 201.72 ? 682 PHE B CE2 1 
ATOM   10254 C CZ  . PHE B 1 673 ? -9.787  75.906  -64.738  1.00 198.34 ? 682 PHE B CZ  1 
ATOM   10255 N N   . VAL B 1 674 ? -14.282 70.913  -67.580  1.00 184.15 ? 683 VAL B N   1 
ATOM   10256 C CA  . VAL B 1 674 ? -15.440 70.210  -68.121  1.00 184.71 ? 683 VAL B CA  1 
ATOM   10257 C C   . VAL B 1 674 ? -16.635 70.311  -67.180  1.00 183.54 ? 683 VAL B C   1 
ATOM   10258 O O   . VAL B 1 674 ? -16.483 70.632  -66.002  1.00 181.46 ? 683 VAL B O   1 
ATOM   10259 C CB  . VAL B 1 674 ? -15.125 68.727  -68.386  1.00 182.60 ? 683 VAL B CB  1 
ATOM   10260 C CG1 . VAL B 1 674 ? -14.115 68.595  -69.514  1.00 184.43 ? 683 VAL B CG1 1 
ATOM   10261 C CG2 . VAL B 1 674 ? -14.611 68.059  -67.120  1.00 178.44 ? 683 VAL B CG2 1 
ATOM   10262 N N   . ARG B 1 675 ? -17.823 70.035  -67.710  1.00 168.14 ? 684 ARG B N   1 
ATOM   10263 C CA  . ARG B 1 675 ? -19.052 70.112  -66.926  1.00 167.53 ? 684 ARG B CA  1 
ATOM   10264 C C   . ARG B 1 675 ? -19.175 68.939  -65.958  1.00 163.52 ? 684 ARG B C   1 
ATOM   10265 O O   . ARG B 1 675 ? -19.391 69.129  -64.761  1.00 161.47 ? 684 ARG B O   1 
ATOM   10266 C CB  . ARG B 1 675 ? -20.272 70.164  -67.849  1.00 170.91 ? 684 ARG B CB  1 
ATOM   10267 N N   . THR B 1 676 ? -19.037 67.726  -66.484  1.00 214.71 ? 685 THR B N   1 
ATOM   10268 C CA  . THR B 1 676 ? -19.124 66.522  -65.667  1.00 211.31 ? 685 THR B CA  1 
ATOM   10269 C C   . THR B 1 676 ? -17.875 65.661  -65.830  1.00 209.50 ? 685 THR B C   1 
ATOM   10270 O O   . THR B 1 676 ? -17.020 65.943  -66.669  1.00 211.01 ? 685 THR B O   1 
ATOM   10271 C CB  . THR B 1 676 ? -20.365 65.682  -66.025  1.00 212.17 ? 685 THR B CB  1 
ATOM   10272 O OG1 . THR B 1 676 ? -20.244 65.193  -67.367  1.00 214.47 ? 685 THR B OG1 1 
ATOM   10273 C CG2 . THR B 1 676 ? -21.629 66.521  -65.907  1.00 214.32 ? 685 THR B CG2 1 
ATOM   10274 N N   . THR B 1 677 ? -17.778 64.611  -65.022  1.00 171.74 ? 686 THR B N   1 
ATOM   10275 C CA  . THR B 1 677 ? -16.637 63.705  -65.078  1.00 170.05 ? 686 THR B CA  1 
ATOM   10276 C C   . THR B 1 677 ? -16.630 62.917  -66.384  1.00 171.97 ? 686 THR B C   1 
ATOM   10277 O O   . THR B 1 677 ? -15.569 62.609  -66.929  1.00 172.13 ? 686 THR B O   1 
ATOM   10278 C CB  . THR B 1 677 ? -16.637 62.728  -63.890  1.00 166.74 ? 686 THR B CB  1 
ATOM   10279 O OG1 . THR B 1 677 ? -16.623 63.468  -62.663  1.00 165.14 ? 686 THR B OG1 1 
ATOM   10280 C CG2 . THR B 1 677 ? -15.416 61.822  -63.943  1.00 165.30 ? 686 THR B CG2 1 
ATOM   10281 N N   . ALA B 1 678 ? -17.819 62.598  -66.883  1.00 189.66 ? 687 ALA B N   1 
ATOM   10282 C CA  . ALA B 1 678 ? -17.951 61.869  -68.139  1.00 191.95 ? 687 ALA B CA  1 
ATOM   10283 C C   . ALA B 1 678 ? -17.403 62.687  -69.303  1.00 194.94 ? 687 ALA B C   1 
ATOM   10284 O O   . ALA B 1 678 ? -16.756 62.149  -70.203  1.00 196.08 ? 687 ALA B O   1 
ATOM   10285 C CB  . ALA B 1 678 ? -19.404 61.498  -68.387  1.00 193.58 ? 687 ALA B CB  1 
ATOM   10286 N N   . GLU B 1 679 ? -17.665 63.990  -69.277  1.00 163.41 ? 688 GLU B N   1 
ATOM   10287 C CA  . GLU B 1 679 ? -17.184 64.892  -70.316  1.00 166.56 ? 688 GLU B CA  1 
ATOM   10288 C C   . GLU B 1 679 ? -15.661 64.949  -70.323  1.00 165.47 ? 688 GLU B C   1 
ATOM   10289 O O   . GLU B 1 679 ? -15.035 64.980  -71.383  1.00 167.69 ? 688 GLU B O   1 
ATOM   10290 C CB  . GLU B 1 679 ? -17.764 66.295  -70.119  1.00 168.34 ? 688 GLU B CB  1 
ATOM   10291 N N   . GLY B 1 680 ? -15.070 64.962  -69.132  1.00 159.10 ? 689 GLY B N   1 
ATOM   10292 C CA  . GLY B 1 680 ? -13.626 64.999  -68.995  1.00 158.02 ? 689 GLY B CA  1 
ATOM   10293 C C   . GLY B 1 680 ? -12.965 63.771  -69.589  1.00 157.64 ? 689 GLY B C   1 
ATOM   10294 O O   . GLY B 1 680 ? -11.983 63.878  -70.323  1.00 159.05 ? 689 GLY B O   1 
ATOM   10295 N N   . VAL B 1 681 ? -13.507 62.601  -69.268  1.00 158.83 ? 690 VAL B N   1 
ATOM   10296 C CA  . VAL B 1 681 ? -12.985 61.345  -69.791  1.00 158.66 ? 690 VAL B CA  1 
ATOM   10297 C C   . VAL B 1 681 ? -13.119 61.297  -71.309  1.00 162.30 ? 690 VAL B C   1 
ATOM   10298 O O   . VAL B 1 681 ? -12.211 60.848  -72.009  1.00 163.20 ? 690 VAL B O   1 
ATOM   10299 C CB  . VAL B 1 681 ? -13.711 60.133  -69.180  1.00 156.72 ? 690 VAL B CB  1 
ATOM   10300 C CG1 . VAL B 1 681 ? -13.202 58.841  -69.799  1.00 157.08 ? 690 VAL B CG1 1 
ATOM   10301 C CG2 . VAL B 1 681 ? -13.530 60.114  -67.671  1.00 153.27 ? 690 VAL B CG2 1 
ATOM   10302 N N   . ALA B 1 682 ? -14.257 61.767  -71.811  1.00 162.18 ? 691 ALA B N   1 
ATOM   10303 C CA  . ALA B 1 682 ? -14.507 61.797  -73.247  1.00 166.06 ? 691 ALA B CA  1 
ATOM   10304 C C   . ALA B 1 682 ? -13.506 62.702  -73.958  1.00 168.14 ? 691 ALA B C   1 
ATOM   10305 O O   . ALA B 1 682 ? -13.084 62.417  -75.079  1.00 170.64 ? 691 ALA B O   1 
ATOM   10306 C CB  . ALA B 1 682 ? -15.930 62.253  -73.526  1.00 168.29 ? 691 ALA B CB  1 
ATOM   10307 N N   . ARG B 1 683 ? -13.130 63.793  -73.298  1.00 167.29 ? 692 ARG B N   1 
ATOM   10308 C CA  . ARG B 1 683 ? -12.177 64.742  -73.862  1.00 169.37 ? 692 ARG B CA  1 
ATOM   10309 C C   . ARG B 1 683 ? -10.787 64.124  -73.971  1.00 168.33 ? 692 ARG B C   1 
ATOM   10310 O O   . ARG B 1 683 ? -10.025 64.444  -74.882  1.00 170.84 ? 692 ARG B O   1 
ATOM   10311 C CB  . ARG B 1 683 ? -12.122 66.015  -73.015  1.00 168.78 ? 692 ARG B CB  1 
ATOM   10312 N N   . VAL B 1 684 ? -10.464 63.236  -73.037  1.00 165.54 ? 693 VAL B N   1 
ATOM   10313 C CA  . VAL B 1 684 ? -9.170  62.565  -73.034  1.00 164.49 ? 693 VAL B CA  1 
ATOM   10314 C C   . VAL B 1 684 ? -9.131  61.458  -74.083  1.00 166.10 ? 693 VAL B C   1 
ATOM   10315 O O   . VAL B 1 684 ? -8.075  61.151  -74.639  1.00 167.05 ? 693 VAL B O   1 
ATOM   10316 C CB  . VAL B 1 684 ? -8.851  61.966  -71.651  1.00 160.49 ? 693 VAL B CB  1 
ATOM   10317 C CG1 . VAL B 1 684 ? -7.495  61.278  -71.666  1.00 159.76 ? 693 VAL B CG1 1 
ATOM   10318 C CG2 . VAL B 1 684 ? -8.890  63.049  -70.586  1.00 159.08 ? 693 VAL B CG2 1 
ATOM   10319 N N   . ARG B 1 685 ? -10.290 60.868  -74.354  1.00 168.01 ? 694 ARG B N   1 
ATOM   10320 C CA  . ARG B 1 685 ? -10.388 59.766  -75.304  1.00 169.75 ? 694 ARG B CA  1 
ATOM   10321 C C   . ARG B 1 685 ? -10.516 60.250  -76.746  1.00 174.13 ? 694 ARG B C   1 
ATOM   10322 O O   . ARG B 1 685 ? -10.388 59.463  -77.684  1.00 176.19 ? 694 ARG B O   1 
ATOM   10323 C CB  . ARG B 1 685 ? -11.575 58.866  -74.952  1.00 168.77 ? 694 ARG B CB  1 
ATOM   10324 C CG  . ARG B 1 685 ? -11.435 58.139  -73.626  1.00 164.83 ? 694 ARG B CG  1 
ATOM   10325 C CD  . ARG B 1 685 ? -12.688 57.341  -73.303  1.00 164.28 ? 694 ARG B CD  1 
ATOM   10326 N NE  . ARG B 1 685 ? -12.517 56.506  -72.118  1.00 160.91 ? 694 ARG B NE  1 
ATOM   10327 C CZ  . ARG B 1 685 ? -13.475 55.749  -71.593  1.00 159.96 ? 694 ARG B CZ  1 
ATOM   10328 N NH1 . ARG B 1 685 ? -14.679 55.722  -72.147  1.00 162.13 ? 694 ARG B NH1 1 
ATOM   10329 N NH2 . ARG B 1 685 ? -13.230 55.019  -70.513  1.00 157.11 ? 694 ARG B NH2 1 
ATOM   10330 N N   . LYS B 1 686 ? -10.767 61.543  -76.919  1.00 172.65 ? 695 LYS B N   1 
ATOM   10331 C CA  . LYS B 1 686 ? -10.994 62.100  -78.249  1.00 177.12 ? 695 LYS B CA  1 
ATOM   10332 C C   . LYS B 1 686 ? -9.954  63.149  -78.636  1.00 178.85 ? 695 LYS B C   1 
ATOM   10333 O O   . LYS B 1 686 ? -10.071 63.790  -79.682  1.00 182.76 ? 695 LYS B O   1 
ATOM   10334 C CB  . LYS B 1 686 ? -12.400 62.698  -78.343  1.00 178.79 ? 695 LYS B CB  1 
ATOM   10335 N N   . SER B 1 687 ? -8.937  63.322  -77.797  1.00 178.09 ? 696 SER B N   1 
ATOM   10336 C CA  . SER B 1 687 ? -7.890  64.304  -78.063  1.00 179.71 ? 696 SER B CA  1 
ATOM   10337 C C   . SER B 1 687 ? -6.592  63.651  -78.527  1.00 180.05 ? 696 SER B C   1 
ATOM   10338 O O   . SER B 1 687 ? -5.591  64.333  -78.747  1.00 181.42 ? 696 SER B O   1 
ATOM   10339 C CB  . SER B 1 687 ? -7.632  65.169  -76.827  1.00 177.26 ? 696 SER B CB  1 
ATOM   10340 O OG  . SER B 1 687 ? -8.727  66.033  -76.573  1.00 177.94 ? 696 SER B OG  1 
ATOM   10341 N N   . LYS B 1 688 ? -6.616  62.331  -78.672  1.00 187.12 ? 697 LYS B N   1 
ATOM   10342 C CA  . LYS B 1 688 ? -5.448  61.583  -79.129  1.00 187.61 ? 697 LYS B CA  1 
ATOM   10343 C C   . LYS B 1 688 ? -4.231  61.823  -78.238  1.00 185.32 ? 697 LYS B C   1 
ATOM   10344 O O   . LYS B 1 688 ? -3.095  61.822  -78.711  1.00 186.78 ? 697 LYS B O   1 
ATOM   10345 C CB  . LYS B 1 688 ? -5.118  61.940  -80.581  1.00 192.22 ? 697 LYS B CB  1 
ATOM   10346 N N   . GLY B 1 689 ? -4.479  62.029  -76.948  1.00 183.36 ? 698 GLY B N   1 
ATOM   10347 C CA  . GLY B 1 689 ? -3.410  62.229  -75.986  1.00 181.17 ? 698 GLY B CA  1 
ATOM   10348 C C   . GLY B 1 689 ? -2.946  63.670  -75.893  1.00 182.59 ? 698 GLY B C   1 
ATOM   10349 O O   . GLY B 1 689 ? -1.843  63.945  -75.418  1.00 182.05 ? 698 GLY B O   1 
ATOM   10350 N N   . LYS B 1 690 ? -3.789  64.592  -76.345  1.00 175.56 ? 699 LYS B N   1 
ATOM   10351 C CA  . LYS B 1 690 ? -3.458  66.012  -76.306  1.00 177.43 ? 699 LYS B CA  1 
ATOM   10352 C C   . LYS B 1 690 ? -4.086  66.699  -75.097  1.00 175.16 ? 699 LYS B C   1 
ATOM   10353 O O   . LYS B 1 690 ? -3.778  67.853  -74.800  1.00 176.27 ? 699 LYS B O   1 
ATOM   10354 C CB  . LYS B 1 690 ? -3.904  66.705  -77.595  1.00 181.83 ? 699 LYS B CB  1 
ATOM   10355 N N   . TYR B 1 691 ? -4.965  65.984  -74.402  1.00 187.68 ? 700 TYR B N   1 
ATOM   10356 C CA  . TYR B 1 691 ? -5.635  66.535  -73.229  1.00 185.49 ? 700 TYR B CA  1 
ATOM   10357 C C   . TYR B 1 691 ? -5.611  65.574  -72.044  1.00 181.31 ? 700 TYR B C   1 
ATOM   10358 O O   . TYR B 1 691 ? -5.984  64.407  -72.168  1.00 180.07 ? 700 TYR B O   1 
ATOM   10359 C CB  . TYR B 1 691 ? -7.078  66.920  -73.564  1.00 186.82 ? 700 TYR B CB  1 
ATOM   10360 C CG  . TYR B 1 691 ? -7.874  67.387  -72.366  1.00 184.62 ? 700 TYR B CG  1 
ATOM   10361 C CD1 . TYR B 1 691 ? -7.648  68.636  -71.803  1.00 185.26 ? 700 TYR B CD1 1 
ATOM   10362 C CD2 . TYR B 1 691 ? -8.852  66.580  -71.799  1.00 182.15 ? 700 TYR B CD2 1 
ATOM   10363 C CE1 . TYR B 1 691 ? -8.371  69.068  -70.707  1.00 183.45 ? 700 TYR B CE1 1 
ATOM   10364 C CE2 . TYR B 1 691 ? -9.581  67.004  -70.704  1.00 180.30 ? 700 TYR B CE2 1 
ATOM   10365 C CZ  . TYR B 1 691 ? -9.336  68.249  -70.162  1.00 180.93 ? 700 TYR B CZ  1 
ATOM   10366 O OH  . TYR B 1 691 ? -10.058 68.676  -69.072  1.00 179.28 ? 700 TYR B OH  1 
ATOM   10367 N N   . ALA B 1 692 ? -5.172  66.078  -70.895  1.00 163.64 ? 701 ALA B N   1 
ATOM   10368 C CA  . ALA B 1 692 ? -5.148  65.292  -69.669  1.00 159.90 ? 701 ALA B CA  1 
ATOM   10369 C C   . ALA B 1 692 ? -6.221  65.789  -68.709  1.00 158.33 ? 701 ALA B C   1 
ATOM   10370 O O   . ALA B 1 692 ? -6.524  66.981  -68.668  1.00 159.89 ? 701 ALA B O   1 
ATOM   10371 C CB  . ALA B 1 692 ? -3.777  65.366  -69.018  1.00 159.03 ? 701 ALA B CB  1 
ATOM   10372 N N   . TYR B 1 693 ? -6.795  64.871  -67.938  1.00 162.35 ? 702 TYR B N   1 
ATOM   10373 C CA  . TYR B 1 693 ? -7.852  65.221  -66.996  1.00 160.82 ? 702 TYR B CA  1 
ATOM   10374 C C   . TYR B 1 693 ? -7.459  64.873  -65.565  1.00 157.67 ? 702 TYR B C   1 
ATOM   10375 O O   . TYR B 1 693 ? -7.014  63.761  -65.285  1.00 155.91 ? 702 TYR B O   1 
ATOM   10376 C CB  . TYR B 1 693 ? -9.159  64.523  -67.377  1.00 160.74 ? 702 TYR B CB  1 
ATOM   10377 C CG  . TYR B 1 693 ? -10.309 64.811  -66.438  1.00 159.32 ? 702 TYR B CG  1 
ATOM   10378 C CD1 . TYR B 1 693 ? -10.787 66.104  -66.270  1.00 160.72 ? 702 TYR B CD1 1 
ATOM   10379 C CD2 . TYR B 1 693 ? -10.924 63.788  -65.728  1.00 156.85 ? 702 TYR B CD2 1 
ATOM   10380 C CE1 . TYR B 1 693 ? -11.839 66.371  -65.415  1.00 159.62 ? 702 TYR B CE1 1 
ATOM   10381 C CE2 . TYR B 1 693 ? -11.978 64.046  -64.872  1.00 155.73 ? 702 TYR B CE2 1 
ATOM   10382 C CZ  . TYR B 1 693 ? -12.432 65.338  -64.719  1.00 157.09 ? 702 TYR B CZ  1 
ATOM   10383 O OH  . TYR B 1 693 ? -13.481 65.599  -63.867  1.00 156.15 ? 702 TYR B OH  1 
ATOM   10384 N N   . LEU B 1 694 ? -7.626  65.836  -64.663  1.00 150.28 ? 703 LEU B N   1 
ATOM   10385 C CA  . LEU B 1 694 ? -7.282  65.643  -63.259  1.00 147.66 ? 703 LEU B CA  1 
ATOM   10386 C C   . LEU B 1 694 ? -8.526  65.342  -62.430  1.00 145.72 ? 703 LEU B C   1 
ATOM   10387 O O   . LEU B 1 694 ? -9.475  66.125  -62.412  1.00 146.65 ? 703 LEU B O   1 
ATOM   10388 C CB  . LEU B 1 694 ? -6.572  66.882  -62.712  1.00 148.64 ? 703 LEU B CB  1 
ATOM   10389 C CG  . LEU B 1 694 ? -5.359  67.366  -63.508  1.00 151.04 ? 703 LEU B CG  1 
ATOM   10390 C CD1 . LEU B 1 694 ? -4.857  68.696  -62.971  1.00 152.47 ? 703 LEU B CD1 1 
ATOM   10391 C CD2 . LEU B 1 694 ? -4.253  66.324  -63.490  1.00 149.94 ? 703 LEU B CD2 1 
ATOM   10392 N N   . LEU B 1 695 ? -8.513  64.203  -61.743  1.00 141.81 ? 704 LEU B N   1 
ATOM   10393 C CA  . LEU B 1 695 ? -9.658  63.779  -60.945  1.00 140.03 ? 704 LEU B CA  1 
ATOM   10394 C C   . LEU B 1 695 ? -9.236  62.886  -59.783  1.00 137.42 ? 704 LEU B C   1 
ATOM   10395 O O   . LEU B 1 695 ? -8.059  62.555  -59.637  1.00 137.06 ? 704 LEU B O   1 
ATOM   10396 C CB  . LEU B 1 695 ? -10.678 63.048  -61.820  1.00 140.67 ? 704 LEU B CB  1 
ATOM   10397 C CG  . LEU B 1 695 ? -10.335 61.618  -62.246  1.00 140.02 ? 704 LEU B CG  1 
ATOM   10398 C CD1 . LEU B 1 695 ? -11.516 60.981  -62.960  1.00 140.87 ? 704 LEU B CD1 1 
ATOM   10399 C CD2 . LEU B 1 695 ? -9.093  61.581  -63.124  1.00 141.41 ? 704 LEU B CD2 1 
ATOM   10400 N N   . GLU B 1 696 ? -10.206 62.499  -58.960  1.00 155.07 ? 705 GLU B N   1 
ATOM   10401 C CA  . GLU B 1 696 ? -9.944  61.634  -57.817  1.00 152.81 ? 705 GLU B CA  1 
ATOM   10402 C C   . GLU B 1 696 ? -9.396  60.285  -58.268  1.00 152.42 ? 705 GLU B C   1 
ATOM   10403 O O   . GLU B 1 696 ? -9.928  59.664  -59.188  1.00 153.21 ? 705 GLU B O   1 
ATOM   10404 C CB  . GLU B 1 696 ? -11.217 61.436  -56.992  1.00 151.60 ? 705 GLU B CB  1 
ATOM   10405 N N   . SER B 1 697 ? -8.329  59.837  -57.613  1.00 135.76 ? 706 SER B N   1 
ATOM   10406 C CA  . SER B 1 697 ? -7.679  58.580  -57.965  1.00 135.61 ? 706 SER B CA  1 
ATOM   10407 C C   . SER B 1 697 ? -8.660  57.412  -57.960  1.00 134.91 ? 706 SER B C   1 
ATOM   10408 O O   . SER B 1 697 ? -8.614  56.549  -58.835  1.00 135.74 ? 706 SER B O   1 
ATOM   10409 C CB  . SER B 1 697 ? -6.517  58.290  -57.011  1.00 134.71 ? 706 SER B CB  1 
ATOM   10410 O OG  . SER B 1 697 ? -6.985  58.054  -55.694  1.00 133.03 ? 706 SER B OG  1 
ATOM   10411 N N   . THR B 1 698 ? -9.546  57.390  -56.969  1.00 135.68 ? 707 THR B N   1 
ATOM   10412 C CA  . THR B 1 698 ? -10.519 56.312  -56.833  1.00 135.16 ? 707 THR B CA  1 
ATOM   10413 C C   . THR B 1 698 ? -11.342 56.124  -58.104  1.00 136.73 ? 707 THR B C   1 
ATOM   10414 O O   . THR B 1 698 ? -11.413 55.024  -58.650  1.00 137.30 ? 707 THR B O   1 
ATOM   10415 C CB  . THR B 1 698 ? -11.471 56.557  -55.648  1.00 133.87 ? 707 THR B CB  1 
ATOM   10416 O OG1 . THR B 1 698 ? -12.083 57.846  -55.779  1.00 134.48 ? 707 THR B OG1 1 
ATOM   10417 C CG2 . THR B 1 698 ? -10.709 56.495  -54.335  1.00 132.48 ? 707 THR B CG2 1 
ATOM   10418 N N   . MET B 1 699 ? -11.963 57.203  -58.568  1.00 144.06 ? 708 MET B N   1 
ATOM   10419 C CA  . MET B 1 699 ? -12.785 57.150  -59.771  1.00 145.92 ? 708 MET B CA  1 
ATOM   10420 C C   . MET B 1 699 ? -11.928 56.896  -61.006  1.00 147.52 ? 708 MET B C   1 
ATOM   10421 O O   . MET B 1 699 ? -12.367 56.248  -61.955  1.00 148.97 ? 708 MET B O   1 
ATOM   10422 C CB  . MET B 1 699 ? -13.576 58.449  -59.937  1.00 146.90 ? 708 MET B CB  1 
ATOM   10423 C CG  . MET B 1 699 ? -14.635 58.395  -61.026  1.00 148.99 ? 708 MET B CG  1 
ATOM   10424 S SD  . MET B 1 699 ? -15.943 57.209  -60.657  1.00 148.58 ? 708 MET B SD  1 
ATOM   10425 C CE  . MET B 1 699 ? -16.962 57.359  -62.121  1.00 151.73 ? 708 MET B CE  1 
ATOM   10426 N N   . ASN B 1 700 ? -10.704 57.412  -60.986  1.00 135.93 ? 709 ASN B N   1 
ATOM   10427 C CA  . ASN B 1 700 ? -9.776  57.233  -62.095  1.00 137.53 ? 709 ASN B CA  1 
ATOM   10428 C C   . ASN B 1 700 ? -9.396  55.768  -62.277  1.00 137.40 ? 709 ASN B C   1 
ATOM   10429 O O   . ASN B 1 700 ? -9.519  55.216  -63.370  1.00 139.11 ? 709 ASN B O   1 
ATOM   10430 C CB  . ASN B 1 700 ? -8.520  58.082  -61.882  1.00 137.55 ? 709 ASN B CB  1 
ATOM   10431 C CG  . ASN B 1 700 ? -7.567  58.027  -63.061  1.00 139.50 ? 709 ASN B CG  1 
ATOM   10432 O OD1 . ASN B 1 700 ? -7.839  57.372  -64.066  1.00 140.87 ? 709 ASN B OD1 1 
ATOM   10433 N ND2 . ASN B 1 700 ? -6.440  58.718  -62.941  1.00 139.85 ? 709 ASN B ND2 1 
ATOM   10434 N N   . GLU B 1 701 ? -8.936  55.144  -61.197  1.00 147.03 ? 710 GLU B N   1 
ATOM   10435 C CA  . GLU B 1 701 ? -8.547  53.740  -61.222  1.00 147.01 ? 710 GLU B CA  1 
ATOM   10436 C C   . GLU B 1 701 ? -9.672  52.871  -61.771  1.00 147.91 ? 710 GLU B C   1 
ATOM   10437 O O   . GLU B 1 701 ? -9.428  51.901  -62.488  1.00 149.20 ? 710 GLU B O   1 
ATOM   10438 C CB  . GLU B 1 701 ? -8.160  53.269  -59.819  1.00 145.08 ? 710 GLU B CB  1 
ATOM   10439 C CG  . GLU B 1 701 ? -6.945  53.972  -59.237  1.00 144.50 ? 710 GLU B CG  1 
ATOM   10440 C CD  . GLU B 1 701 ? -6.722  53.637  -57.776  1.00 142.78 ? 710 GLU B CD  1 
ATOM   10441 O OE1 . GLU B 1 701 ? -5.665  54.020  -57.232  1.00 142.53 ? 710 GLU B OE1 1 
ATOM   10442 O OE2 . GLU B 1 701 ? -7.603  52.991  -57.170  1.00 141.91 ? 710 GLU B OE2 1 
ATOM   10443 N N   . TYR B 1 702 ? -10.905 53.228  -61.430  1.00 136.31 ? 711 TYR B N   1 
ATOM   10444 C CA  . TYR B 1 702 ? -12.073 52.487  -61.887  1.00 137.39 ? 711 TYR B CA  1 
ATOM   10445 C C   . TYR B 1 702 ? -12.277 52.651  -63.390  1.00 139.94 ? 711 TYR B C   1 
ATOM   10446 O O   . TYR B 1 702 ? -12.558 51.683  -64.096  1.00 141.50 ? 711 TYR B O   1 
ATOM   10447 C CB  . TYR B 1 702 ? -13.322 52.942  -61.130  1.00 136.49 ? 711 TYR B CB  1 
ATOM   10448 C CG  . TYR B 1 702 ? -14.597 52.268  -61.582  1.00 137.88 ? 711 TYR B CG  1 
ATOM   10449 C CD1 . TYR B 1 702 ? -14.912 50.981  -61.164  1.00 137.74 ? 711 TYR B CD1 1 
ATOM   10450 C CD2 . TYR B 1 702 ? -15.490 52.919  -62.422  1.00 139.66 ? 711 TYR B CD2 1 
ATOM   10451 C CE1 . TYR B 1 702 ? -16.078 50.361  -61.573  1.00 139.32 ? 711 TYR B CE1 1 
ATOM   10452 C CE2 . TYR B 1 702 ? -16.659 52.308  -62.837  1.00 141.25 ? 711 TYR B CE2 1 
ATOM   10453 C CZ  . TYR B 1 702 ? -16.948 51.029  -62.409  1.00 141.07 ? 711 TYR B CZ  1 
ATOM   10454 O OH  . TYR B 1 702 ? -18.111 50.417  -62.819  1.00 142.96 ? 711 TYR B OH  1 
ATOM   10455 N N   . ILE B 1 703 ? -12.131 53.881  -63.873  1.00 160.61 ? 712 ILE B N   1 
ATOM   10456 C CA  . ILE B 1 703 ? -12.280 54.170  -65.295  1.00 163.29 ? 712 ILE B CA  1 
ATOM   10457 C C   . ILE B 1 703 ? -11.280 53.372  -66.124  1.00 164.57 ? 712 ILE B C   1 
ATOM   10458 O O   . ILE B 1 703 ? -11.600 52.897  -67.214  1.00 166.89 ? 712 ILE B O   1 
ATOM   10459 C CB  . ILE B 1 703 ? -12.098 55.673  -65.588  1.00 163.93 ? 712 ILE B CB  1 
ATOM   10460 C CG1 . ILE B 1 703 ? -13.224 56.482  -64.942  1.00 163.30 ? 712 ILE B CG1 1 
ATOM   10461 C CG2 . ILE B 1 703 ? -12.059 55.924  -67.087  1.00 166.96 ? 712 ILE B CG2 1 
ATOM   10462 C CD1 . ILE B 1 703 ? -14.604 56.130  -65.457  1.00 164.89 ? 712 ILE B CD1 1 
ATOM   10463 N N   . GLU B 1 704 ? -10.069 53.222  -65.596  1.00 159.64 ? 713 GLU B N   1 
ATOM   10464 C CA  . GLU B 1 704 ? -9.018  52.473  -66.276  1.00 160.85 ? 713 GLU B CA  1 
ATOM   10465 C C   . GLU B 1 704 ? -9.423  51.017  -66.492  1.00 161.65 ? 713 GLU B C   1 
ATOM   10466 O O   . GLU B 1 704 ? -8.905  50.344  -67.383  1.00 163.55 ? 713 GLU B O   1 
ATOM   10467 C CB  . GLU B 1 704 ? -7.711  52.549  -65.482  1.00 159.31 ? 713 GLU B CB  1 
ATOM   10468 C CG  . GLU B 1 704 ? -6.580  51.710  -66.053  1.00 160.56 ? 713 GLU B CG  1 
ATOM   10469 C CD  . GLU B 1 704 ? -5.271  51.920  -65.316  1.00 159.43 ? 713 GLU B CD  1 
ATOM   10470 O OE1 . GLU B 1 704 ? -5.092  53.003  -64.719  1.00 158.31 ? 713 GLU B OE1 1 
ATOM   10471 O OE2 . GLU B 1 704 ? -4.421  51.004  -65.337  1.00 159.91 ? 713 GLU B OE2 1 
ATOM   10472 N N   . GLN B 1 705 ? -10.355 50.540  -65.674  1.00 168.21 ? 714 GLN B N   1 
ATOM   10473 C CA  . GLN B 1 705 ? -10.816 49.160  -65.762  1.00 169.11 ? 714 GLN B CA  1 
ATOM   10474 C C   . GLN B 1 705 ? -12.165 49.071  -66.469  1.00 170.99 ? 714 GLN B C   1 
ATOM   10475 O O   . GLN B 1 705 ? -12.954 48.162  -66.208  1.00 171.36 ? 714 GLN B O   1 
ATOM   10476 C CB  . GLN B 1 705 ? -10.910 48.539  -64.367  1.00 166.93 ? 714 GLN B CB  1 
ATOM   10477 C CG  . GLN B 1 705 ? -9.717  48.842  -63.473  1.00 164.98 ? 714 GLN B CG  1 
ATOM   10478 C CD  . GLN B 1 705 ? -8.401  48.397  -64.080  1.00 166.16 ? 714 GLN B CD  1 
ATOM   10479 O OE1 . GLN B 1 705 ? -8.356  47.452  -64.866  1.00 168.13 ? 714 GLN B OE1 1 
ATOM   10480 N NE2 . GLN B 1 705 ? -7.321  49.078  -63.715  1.00 165.19 ? 714 GLN B NE2 1 
ATOM   10481 N N   . ARG B 1 706 ? -12.424 50.019  -67.365  1.00 183.78 ? 715 ARG B N   1 
ATOM   10482 C CA  . ARG B 1 706 ? -13.664 50.036  -68.131  1.00 186.02 ? 715 ARG B CA  1 
ATOM   10483 C C   . ARG B 1 706 ? -13.370 50.183  -69.620  1.00 189.08 ? 715 ARG B C   1 
ATOM   10484 O O   . ARG B 1 706 ? -12.454 50.907  -70.011  1.00 189.20 ? 715 ARG B O   1 
ATOM   10485 C CB  . ARG B 1 706 ? -14.569 51.177  -67.662  1.00 185.12 ? 715 ARG B CB  1 
ATOM   10486 C CG  . ARG B 1 706 ? -14.773 51.237  -66.156  1.00 182.09 ? 715 ARG B CG  1 
ATOM   10487 C CD  . ARG B 1 706 ? -15.462 49.986  -65.633  1.00 181.98 ? 715 ARG B CD  1 
ATOM   10488 N NE  . ARG B 1 706 ? -16.819 49.848  -66.154  1.00 184.09 ? 715 ARG B NE  1 
ATOM   10489 C CZ  . ARG B 1 706 ? -17.668 48.896  -65.781  1.00 184.55 ? 715 ARG B CZ  1 
ATOM   10490 N NH1 . ARG B 1 706 ? -17.303 47.994  -64.880  1.00 183.02 ? 715 ARG B NH1 1 
ATOM   10491 N NH2 . ARG B 1 706 ? -18.885 48.846  -66.308  1.00 186.81 ? 715 ARG B NH2 1 
ATOM   10492 N N   . LYS B 1 707 ? -14.150 49.493  -70.447  1.00 155.84 ? 716 LYS B N   1 
ATOM   10493 C CA  . LYS B 1 707 ? -13.977 49.551  -71.894  1.00 159.18 ? 716 LYS B CA  1 
ATOM   10494 C C   . LYS B 1 707 ? -14.050 50.991  -72.394  1.00 159.89 ? 716 LYS B C   1 
ATOM   10495 O O   . LYS B 1 707 ? -14.731 51.824  -71.796  1.00 158.66 ? 716 LYS B O   1 
ATOM   10496 C CB  . LYS B 1 707 ? -15.037 48.695  -72.592  1.00 162.17 ? 716 LYS B CB  1 
ATOM   10497 N N   . PRO B 1 708 ? -13.349 51.290  -73.500  1.00 175.37 ? 717 PRO B N   1 
ATOM   10498 C CA  . PRO B 1 708 ? -12.516 50.348  -74.256  1.00 177.12 ? 717 PRO B CA  1 
ATOM   10499 C C   . PRO B 1 708 ? -11.101 50.233  -73.695  1.00 174.94 ? 717 PRO B C   1 
ATOM   10500 O O   . PRO B 1 708 ? -10.175 49.926  -74.445  1.00 176.56 ? 717 PRO B O   1 
ATOM   10501 C CB  . PRO B 1 708 ? -12.459 50.977  -75.658  1.00 180.63 ? 717 PRO B CB  1 
ATOM   10502 C CG  . PRO B 1 708 ? -13.424 52.146  -75.631  1.00 180.93 ? 717 PRO B CG  1 
ATOM   10503 C CD  . PRO B 1 708 ? -13.485 52.570  -74.207  1.00 177.05 ? 717 PRO B CD  1 
ATOM   10504 N N   . CYS B 1 709 ? -10.940 50.479  -72.398  1.00 171.04 ? 718 CYS B N   1 
ATOM   10505 C CA  . CYS B 1 709 ? -9.632  50.386  -71.757  1.00 169.05 ? 718 CYS B CA  1 
ATOM   10506 C C   . CYS B 1 709 ? -8.615  51.279  -72.459  1.00 170.16 ? 718 CYS B C   1 
ATOM   10507 O O   . CYS B 1 709 ? -7.547  50.820  -72.863  1.00 171.06 ? 718 CYS B O   1 
ATOM   10508 C CB  . CYS B 1 709 ? -9.140  48.938  -71.756  1.00 169.55 ? 718 CYS B CB  1 
ATOM   10509 S SG  . CYS B 1 709 ? -10.354 47.732  -71.179  1.00 169.31 ? 718 CYS B SG  1 
ATOM   10510 N N   . ASP B 1 710 ? -8.952  52.556  -72.599  1.00 182.97 ? 719 ASP B N   1 
ATOM   10511 C CA  . ASP B 1 710 ? -8.099  53.498  -73.316  1.00 184.47 ? 719 ASP B CA  1 
ATOM   10512 C C   . ASP B 1 710 ? -7.615  54.638  -72.423  1.00 182.30 ? 719 ASP B C   1 
ATOM   10513 O O   . ASP B 1 710 ? -7.143  55.664  -72.914  1.00 183.62 ? 719 ASP B O   1 
ATOM   10514 C CB  . ASP B 1 710 ? -8.836  54.062  -74.533  1.00 187.72 ? 719 ASP B CB  1 
ATOM   10515 C CG  . ASP B 1 710 ? -10.163 54.702  -74.168  1.00 187.28 ? 719 ASP B CG  1 
ATOM   10516 O OD1 . ASP B 1 710 ? -10.516 54.705  -72.970  1.00 184.38 ? 719 ASP B OD1 1 
ATOM   10517 O OD2 . ASP B 1 710 ? -10.854 55.201  -75.080  1.00 190.04 ? 719 ASP B OD2 1 
ATOM   10518 N N   . THR B 1 711 ? -7.733  54.454  -71.113  1.00 155.11 ? 720 THR B N   1 
ATOM   10519 C CA  . THR B 1 711 ? -7.289  55.463  -70.158  1.00 153.10 ? 720 THR B CA  1 
ATOM   10520 C C   . THR B 1 711 ? -6.441  54.834  -69.059  1.00 150.66 ? 720 THR B C   1 
ATOM   10521 O O   . THR B 1 711 ? -6.651  53.680  -68.686  1.00 149.80 ? 720 THR B O   1 
ATOM   10522 C CB  . THR B 1 711 ? -8.478  56.198  -69.518  1.00 151.98 ? 720 THR B CB  1 
ATOM   10523 O OG1 . THR B 1 711 ? -9.337  55.250  -68.874  1.00 150.51 ? 720 THR B OG1 1 
ATOM   10524 C CG2 . THR B 1 711 ? -9.266  56.953  -70.575  1.00 154.70 ? 720 THR B CG2 1 
ATOM   10525 N N   . MET B 1 712 ? -5.484  55.597  -68.543  1.00 168.17 ? 721 MET B N   1 
ATOM   10526 C CA  . MET B 1 712 ? -4.596  55.100  -67.498  1.00 166.21 ? 721 MET B CA  1 
ATOM   10527 C C   . MET B 1 712 ? -4.157  56.213  -66.553  1.00 164.84 ? 721 MET B C   1 
ATOM   10528 O O   . MET B 1 712 ? -3.969  57.356  -66.968  1.00 166.08 ? 721 MET B O   1 
ATOM   10529 C CB  . MET B 1 712 ? -3.367  54.429  -68.115  1.00 167.67 ? 721 MET B CB  1 
ATOM   10530 C CG  . MET B 1 712 ? -2.504  55.362  -68.949  1.00 169.77 ? 721 MET B CG  1 
ATOM   10531 S SD  . MET B 1 712 ? -1.014  54.561  -69.571  1.00 171.54 ? 721 MET B SD  1 
ATOM   10532 C CE  . MET B 1 712 ? -0.196  54.131  -68.036  1.00 169.02 ? 721 MET B CE  1 
ATOM   10533 N N   . LYS B 1 713 ? -3.997  55.869  -65.279  1.00 158.07 ? 722 LYS B N   1 
ATOM   10534 C CA  . LYS B 1 713 ? -3.512  56.817  -64.284  1.00 156.89 ? 722 LYS B CA  1 
ATOM   10535 C C   . LYS B 1 713 ? -1.987  56.833  -64.278  1.00 157.66 ? 722 LYS B C   1 
ATOM   10536 O O   . LYS B 1 713 ? -1.346  55.783  -64.343  1.00 157.81 ? 722 LYS B O   1 
ATOM   10537 C CB  . LYS B 1 713 ? -4.044  56.460  -62.895  1.00 154.36 ? 722 LYS B CB  1 
ATOM   10538 N N   . VAL B 1 714 ? -1.409  58.027  -64.203  1.00 153.54 ? 723 VAL B N   1 
ATOM   10539 C CA  . VAL B 1 714 ? 0.041   58.171  -64.224  1.00 154.65 ? 723 VAL B CA  1 
ATOM   10540 C C   . VAL B 1 714 ? 0.552   58.944  -63.012  1.00 153.69 ? 723 VAL B C   1 
ATOM   10541 O O   . VAL B 1 714 ? -0.064  59.917  -62.577  1.00 153.22 ? 723 VAL B O   1 
ATOM   10542 C CB  . VAL B 1 714 ? 0.518   58.868  -65.512  1.00 157.46 ? 723 VAL B CB  1 
ATOM   10543 C CG1 . VAL B 1 714 ? 0.291   57.967  -66.717  1.00 158.81 ? 723 VAL B CG1 1 
ATOM   10544 C CG2 . VAL B 1 714 ? -0.194  60.199  -65.689  1.00 158.14 ? 723 VAL B CG2 1 
ATOM   10545 N N   . GLY B 1 715 ? 1.681   58.499  -62.470  1.00 214.67 ? 724 GLY B N   1 
ATOM   10546 C CA  . GLY B 1 715 ? 2.283   59.144  -61.318  1.00 214.15 ? 724 GLY B CA  1 
ATOM   10547 C C   . GLY B 1 715 ? 1.469   58.963  -60.052  1.00 211.68 ? 724 GLY B C   1 
ATOM   10548 O O   . GLY B 1 715 ? 0.350   58.451  -60.088  1.00 210.38 ? 724 GLY B O   1 
ATOM   10549 N N   . GLY B 1 716 ? 2.036   59.384  -58.926  1.00 173.50 ? 725 GLY B N   1 
ATOM   10550 C CA  . GLY B 1 716 ? 1.354   59.288  -57.649  1.00 171.42 ? 725 GLY B CA  1 
ATOM   10551 C C   . GLY B 1 716 ? 0.350   60.406  -57.456  1.00 171.01 ? 725 GLY B C   1 
ATOM   10552 O O   . GLY B 1 716 ? 0.277   61.332  -58.264  1.00 172.52 ? 725 GLY B O   1 
ATOM   10553 N N   . ASN B 1 717 ? -0.429  60.321  -56.382  1.00 144.50 ? 726 ASN B N   1 
ATOM   10554 C CA  . ASN B 1 717 ? -1.430  61.337  -56.081  1.00 144.15 ? 726 ASN B CA  1 
ATOM   10555 C C   . ASN B 1 717 ? -0.798  62.685  -55.751  1.00 145.64 ? 726 ASN B C   1 
ATOM   10556 O O   . ASN B 1 717 ? 0.362   62.756  -55.348  1.00 146.48 ? 726 ASN B O   1 
ATOM   10557 C CB  . ASN B 1 717 ? -2.329  60.878  -54.932  1.00 142.02 ? 726 ASN B CB  1 
ATOM   10558 C CG  . ASN B 1 717 ? -3.133  59.642  -55.281  1.00 140.85 ? 726 ASN B CG  1 
ATOM   10559 O OD1 . ASN B 1 717 ? -3.180  59.223  -56.438  1.00 141.65 ? 726 ASN B OD1 1 
ATOM   10560 N ND2 . ASN B 1 717 ? -3.773  59.050  -54.279  1.00 139.19 ? 726 ASN B ND2 1 
ATOM   10561 N N   . LEU B 1 718 ? -1.570  63.754  -55.926  1.00 138.50 ? 727 LEU B N   1 
ATOM   10562 C CA  . LEU B 1 718 ? -1.074  65.104  -55.687  1.00 140.31 ? 727 LEU B CA  1 
ATOM   10563 C C   . LEU B 1 718 ? -1.253  65.512  -54.229  1.00 139.44 ? 727 LEU B C   1 
ATOM   10564 O O   . LEU B 1 718 ? -0.529  66.367  -53.719  1.00 140.90 ? 727 LEU B O   1 
ATOM   10565 C CB  . LEU B 1 718 ? -1.782  66.102  -56.605  1.00 141.88 ? 727 LEU B CB  1 
ATOM   10566 C CG  . LEU B 1 718 ? -1.745  65.765  -58.097  1.00 143.03 ? 727 LEU B CG  1 
ATOM   10567 C CD1 . LEU B 1 718 ? -2.350  66.891  -58.922  1.00 145.10 ? 727 LEU B CD1 1 
ATOM   10568 C CD2 . LEU B 1 718 ? -0.322  65.474  -58.542  1.00 144.35 ? 727 LEU B CD2 1 
ATOM   10569 N N   . ASP B 1 719 ? -2.223  64.894  -53.564  1.00 153.95 ? 728 ASP B N   1 
ATOM   10570 C CA  . ASP B 1 719 ? -2.484  65.170  -52.157  1.00 153.08 ? 728 ASP B CA  1 
ATOM   10571 C C   . ASP B 1 719 ? -2.986  63.921  -51.442  1.00 150.75 ? 728 ASP B C   1 
ATOM   10572 O O   . ASP B 1 719 ? -3.297  62.913  -52.077  1.00 149.84 ? 728 ASP B O   1 
ATOM   10573 C CB  . ASP B 1 719 ? -3.493  66.312  -52.006  1.00 153.64 ? 728 ASP B CB  1 
ATOM   10574 C CG  . ASP B 1 719 ? -4.818  66.017  -52.685  1.00 152.76 ? 728 ASP B CG  1 
ATOM   10575 O OD1 . ASP B 1 719 ? -4.939  64.955  -53.331  1.00 151.84 ? 728 ASP B OD1 1 
ATOM   10576 O OD2 . ASP B 1 719 ? -5.741  66.851  -52.573  1.00 153.24 ? 728 ASP B OD2 1 
ATOM   10577 N N   . SER B 1 720 ? -3.062  63.993  -50.117  1.00 164.49 ? 729 SER B N   1 
ATOM   10578 C CA  . SER B 1 720 ? -3.504  62.858  -49.317  1.00 162.57 ? 729 SER B CA  1 
ATOM   10579 C C   . SER B 1 720 ? -4.881  63.098  -48.706  1.00 161.47 ? 729 SER B C   1 
ATOM   10580 O O   . SER B 1 720 ? -5.039  63.928  -47.811  1.00 161.87 ? 729 SER B O   1 
ATOM   10581 C CB  . SER B 1 720 ? -2.486  62.550  -48.216  1.00 162.77 ? 729 SER B CB  1 
ATOM   10582 O OG  . SER B 1 720 ? -1.220  62.232  -48.767  1.00 163.90 ? 729 SER B OG  1 
ATOM   10583 N N   . LYS B 1 721 ? -5.874  62.366  -49.200  1.00 146.01 ? 730 LYS B N   1 
ATOM   10584 C CA  . LYS B 1 721 ? -7.228  62.445  -48.668  1.00 145.05 ? 730 LYS B CA  1 
ATOM   10585 C C   . LYS B 1 721 ? -7.636  61.100  -48.077  1.00 143.47 ? 730 LYS B C   1 
ATOM   10586 O O   . LYS B 1 721 ? -6.787  60.252  -47.803  1.00 143.22 ? 730 LYS B O   1 
ATOM   10587 C CB  . LYS B 1 721 ? -8.212  62.865  -49.762  1.00 145.55 ? 730 LYS B CB  1 
ATOM   10588 N N   . GLY B 1 722 ? -8.937  60.908  -47.882  1.00 145.68 ? 731 GLY B N   1 
ATOM   10589 C CA  . GLY B 1 722 ? -9.441  59.660  -47.341  1.00 144.47 ? 731 GLY B CA  1 
ATOM   10590 C C   . GLY B 1 722 ? -10.918 59.694  -47.004  1.00 143.93 ? 731 GLY B C   1 
ATOM   10591 O O   . GLY B 1 722 ? -11.412 60.665  -46.431  1.00 144.20 ? 731 GLY B O   1 
ATOM   10592 N N   . TYR B 1 723 ? -11.626 58.628  -47.365  1.00 122.89 ? 732 TYR B N   1 
ATOM   10593 C CA  . TYR B 1 723 ? -13.037 58.495  -47.031  1.00 122.55 ? 732 TYR B CA  1 
ATOM   10594 C C   . TYR B 1 723 ? -13.191 57.853  -45.658  1.00 121.75 ? 732 TYR B C   1 
ATOM   10595 O O   . TYR B 1 723 ? -12.277 57.192  -45.167  1.00 121.47 ? 732 TYR B O   1 
ATOM   10596 C CB  . TYR B 1 723 ? -13.768 57.653  -48.078  1.00 122.77 ? 732 TYR B CB  1 
ATOM   10597 C CG  . TYR B 1 723 ? -13.631 58.158  -49.496  1.00 123.81 ? 732 TYR B CG  1 
ATOM   10598 C CD1 . TYR B 1 723 ? -13.960 59.465  -49.824  1.00 124.67 ? 732 TYR B CD1 1 
ATOM   10599 C CD2 . TYR B 1 723 ? -13.189 57.319  -50.510  1.00 124.20 ? 732 TYR B CD2 1 
ATOM   10600 C CE1 . TYR B 1 723 ? -13.841 59.926  -51.121  1.00 125.90 ? 732 TYR B CE1 1 
ATOM   10601 C CE2 . TYR B 1 723 ? -13.069 57.771  -51.810  1.00 125.37 ? 732 TYR B CE2 1 
ATOM   10602 C CZ  . TYR B 1 723 ? -13.396 59.076  -52.109  1.00 126.22 ? 732 TYR B CZ  1 
ATOM   10603 O OH  . TYR B 1 723 ? -13.279 59.532  -53.402  1.00 127.65 ? 732 TYR B OH  1 
ATOM   10604 N N   . GLY B 1 724 ? -14.353 58.045  -45.044  1.00 128.66 ? 733 GLY B N   1 
ATOM   10605 C CA  . GLY B 1 724 ? -14.622 57.474  -43.738  1.00 128.13 ? 733 GLY B CA  1 
ATOM   10606 C C   . GLY B 1 724 ? -16.105 57.321  -43.467  1.00 128.16 ? 733 GLY B C   1 
ATOM   10607 O O   . GLY B 1 724 ? -16.936 57.936  -44.136  1.00 128.69 ? 733 GLY B O   1 
ATOM   10608 N N   . ILE B 1 725 ? -16.436 56.491  -42.484  1.00 124.12 ? 734 ILE B N   1 
ATOM   10609 C CA  . ILE B 1 725 ? -17.825 56.291  -42.091  1.00 124.34 ? 734 ILE B CA  1 
ATOM   10610 C C   . ILE B 1 725 ? -18.276 57.428  -41.184  1.00 124.56 ? 734 ILE B C   1 
ATOM   10611 O O   . ILE B 1 725 ? -17.686 57.666  -40.130  1.00 124.42 ? 734 ILE B O   1 
ATOM   10612 C CB  . ILE B 1 725 ? -18.020 54.952  -41.359  1.00 124.22 ? 734 ILE B CB  1 
ATOM   10613 C CG1 . ILE B 1 725 ? -17.399 53.806  -42.162  1.00 124.25 ? 734 ILE B CG1 1 
ATOM   10614 C CG2 . ILE B 1 725 ? -19.496 54.695  -41.112  1.00 124.72 ? 734 ILE B CG2 1 
ATOM   10615 C CD1 . ILE B 1 725 ? -18.039 53.595  -43.517  1.00 124.76 ? 734 ILE B CD1 1 
ATOM   10616 N N   . ALA B 1 726 ? -19.323 58.131  -41.600  1.00 128.91 ? 735 ALA B N   1 
ATOM   10617 C CA  . ALA B 1 726 ? -19.804 59.292  -40.860  1.00 129.44 ? 735 ALA B CA  1 
ATOM   10618 C C   . ALA B 1 726 ? -20.924 58.933  -39.890  1.00 129.69 ? 735 ALA B C   1 
ATOM   10619 O O   . ALA B 1 726 ? -21.887 58.261  -40.255  1.00 129.99 ? 735 ALA B O   1 
ATOM   10620 C CB  . ALA B 1 726 ? -20.259 60.380  -41.820  1.00 130.35 ? 735 ALA B CB  1 
ATOM   10621 N N   . THR B 1 727 ? -20.790 59.393  -38.651  1.00 122.32 ? 736 THR B N   1 
ATOM   10622 C CA  . THR B 1 727 ? -21.793 59.144  -37.625  1.00 122.75 ? 736 THR B CA  1 
ATOM   10623 C C   . THR B 1 727 ? -22.093 60.422  -36.846  1.00 123.60 ? 736 THR B C   1 
ATOM   10624 O O   . THR B 1 727 ? -21.180 61.181  -36.521  1.00 123.69 ? 736 THR B O   1 
ATOM   10625 C CB  . THR B 1 727 ? -21.338 58.042  -36.650  1.00 122.30 ? 736 THR B CB  1 
ATOM   10626 O OG1 . THR B 1 727 ? -22.329 57.860  -35.633  1.00 122.94 ? 736 THR B OG1 1 
ATOM   10627 C CG2 . THR B 1 727 ? -20.013 58.413  -36.000  1.00 122.07 ? 736 THR B CG2 1 
ATOM   10628 N N   . PRO B 1 728 ? -23.381 60.664  -36.550  1.00 124.93 ? 737 PRO B N   1 
ATOM   10629 C CA  . PRO B 1 728 ? -23.818 61.861  -35.823  1.00 126.06 ? 737 PRO B CA  1 
ATOM   10630 C C   . PRO B 1 728 ? -22.972 62.118  -34.581  1.00 126.07 ? 737 PRO B C   1 
ATOM   10631 O O   . PRO B 1 728 ? -22.640 61.179  -33.858  1.00 125.53 ? 737 PRO B O   1 
ATOM   10632 C CB  . PRO B 1 728 ? -25.251 61.514  -35.422  1.00 126.86 ? 737 PRO B CB  1 
ATOM   10633 C CG  . PRO B 1 728 ? -25.714 60.590  -36.489  1.00 126.52 ? 737 PRO B CG  1 
ATOM   10634 C CD  . PRO B 1 728 ? -24.511 59.781  -36.887  1.00 125.18 ? 737 PRO B CD  1 
ATOM   10635 N N   . LYS B 1 729 ? -22.631 63.382  -34.346  1.00 128.66 ? 738 LYS B N   1 
ATOM   10636 C CA  . LYS B 1 729 ? -21.799 63.758  -33.209  1.00 129.08 ? 738 LYS B CA  1 
ATOM   10637 C C   . LYS B 1 729 ? -22.375 63.222  -31.904  1.00 129.47 ? 738 LYS B C   1 
ATOM   10638 O O   . LYS B 1 729 ? -23.544 63.447  -31.592  1.00 130.33 ? 738 LYS B O   1 
ATOM   10639 C CB  . LYS B 1 729 ? -21.650 65.279  -33.135  1.00 130.56 ? 738 LYS B CB  1 
ATOM   10640 N N   . GLY B 1 730 ? -21.549 62.507  -31.148  1.00 140.95 ? 739 GLY B N   1 
ATOM   10641 C CA  . GLY B 1 730 ? -21.972 61.943  -29.880  1.00 141.51 ? 739 GLY B CA  1 
ATOM   10642 C C   . GLY B 1 730 ? -22.952 60.798  -30.045  1.00 141.04 ? 739 GLY B C   1 
ATOM   10643 O O   . GLY B 1 730 ? -23.931 60.697  -29.307  1.00 141.93 ? 739 GLY B O   1 
ATOM   10644 N N   . SER B 1 731 ? -22.686 59.932  -31.018  1.00 126.52 ? 740 SER B N   1 
ATOM   10645 C CA  . SER B 1 731 ? -23.541 58.779  -31.271  1.00 126.30 ? 740 SER B