data_3KHR
# 
_entry.id   3KHR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3KHR         pdb_00003khr 10.2210/pdb3khr/pdb 
NDB   NA0322       ?            ?                   
RCSB  RCSB056008   ?            ?                   
WWPDB D_1000056008 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3KHG 'Dpo4 extension ternary complex with misinserted A opposite the 2-aminofluorene-guanine [AF]G lesion.'      unspecified 
PDB 3KHH 'Dpo4 extension ternary complex with a C base opposite the 2-aminofluorene-guanine [AF]G lesion.'           unspecified 
PDB 3KHL 'Dpo4 post-extension ternary complex with misinserted A opposite the 2-aminofluorene-guanine [AF]G lesion.' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KHR 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rechkoblit, O.' 1 
'Malinina, L.'   2 
'Patel, D.J.'    3 
# 
_citation.id                        primary 
_citation.title                     
'Mechanism of error-free and semitargeted mutagenic bypass of an aromatic amine lesion by Y-family polymerase Dpo4.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                379 
_citation.page_last                 388 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20154704 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1771 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rechkoblit, O.'   1 ? 
primary 'Kolbanovskiy, A.' 2 ? 
primary 'Malinina, L.'     3 ? 
primary 'Geacintov, N.E.'  4 ? 
primary 'Broyde, S.'       5 ? 
primary 'Patel, D.J.'      6 ? 
# 
_cell.entry_id           3KHR 
_cell.length_a           52.477 
_cell.length_b           53.019 
_cell.length_c           99.858 
_cell.angle_alpha        81.76 
_cell.angle_beta         76.76 
_cell.angle_gamma        70.14 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KHR 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                   38945.379 2   2.7.7.7 ? ? ? 
2 polymer     syn "5'-D(*TP*TP*GP*GP*AP*TP*GP*GP*TP*AP*GP*CP*(DDG))-3'"                 4046.645  2   ?       ? ? 
;DNA primer strand (Dideoxy-terminated at the 3'-end)
;
3 polymer     syn "5'-D(*CP*C*TP*AP*AP*CP*GP*CP*TP*AP*CP*CP*AP*TP*CP*CP*AP*AP*CP*C)-3'" 5678.703  2   ?       ? ? 
'DNA [AF]G-modified template strand'                   
4 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                                           482.168   2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                         40.078    6   ?       ? ? ? 
6 non-polymer syn 2-AMINOFLUORENE                                                       181.233   2   ?       ? ? ? 
7 water       nat water                                                                 18.015    402 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
;GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
A,B ? 
2 polydeoxyribonucleotide no yes '(DT)(DT)(DG)(DG)(DA)(DT)(DG)(DG)(DT)(DA)(DG)(DC)(DDG)' TTGGATGGTAGCG D,H ? 
3 polydeoxyribonucleotide no no  '(DC)(DT)(DA)(DA)(DC)(DG)(DC)(DT)(DA)(DC)(DC)(DA)(DT)(DC)(DC)(DA)(DA)(DC)(DC)' 
CTAACGCTACCATCCAACC E,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  TYR n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  PHE n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  ILE n 
1 60  PRO n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  LYS n 
1 66  LYS n 
1 67  ILE n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  TYR n 
1 74  LEU n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLN n 
1 83  GLN n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  TYR n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 ILE n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 VAL n 
1 116 ARG n 
1 117 ASP n 
1 118 TYR n 
1 119 ARG n 
1 120 GLU n 
1 121 ALA n 
1 122 TYR n 
1 123 ASN n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 LYS n 
1 130 ASN n 
1 131 LYS n 
1 132 ILE n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 LYS n 
1 138 ILE n 
1 139 THR n 
1 140 VAL n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 LYS n 
1 147 ASN n 
1 148 LYS n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 LYS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 MET n 
1 158 ALA n 
1 159 LYS n 
1 160 PRO n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 ASP n 
1 168 ASP n 
1 169 GLU n 
1 170 GLU n 
1 171 VAL n 
1 172 LYS n 
1 173 ARG n 
1 174 LEU n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 ASP n 
1 183 VAL n 
1 184 PRO n 
1 185 GLY n 
1 186 ILE n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 GLU n 
1 193 LYS n 
1 194 LEU n 
1 195 LYS n 
1 196 LYS n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 ASN n 
1 201 LYS n 
1 202 LEU n 
1 203 VAL n 
1 204 ASP n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 GLU n 
1 210 PHE n 
1 211 ASP n 
1 212 LYS n 
1 213 LEU n 
1 214 LYS n 
1 215 GLY n 
1 216 MET n 
1 217 ILE n 
1 218 GLY n 
1 219 GLU n 
1 220 ALA n 
1 221 LYS n 
1 222 ALA n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 ILE n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 ARG n 
1 231 ASP n 
1 232 GLU n 
1 233 TYR n 
1 234 ASN n 
1 235 GLU n 
1 236 PRO n 
1 237 ILE n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 VAL n 
1 242 ARG n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 GLY n 
1 247 ARG n 
1 248 ILE n 
1 249 VAL n 
1 250 THR n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ASN n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 TYR n 
1 265 LEU n 
1 266 PHE n 
1 267 ARG n 
1 268 ALA n 
1 269 ILE n 
1 270 GLU n 
1 271 GLU n 
1 272 SER n 
1 273 TYR n 
1 274 TYR n 
1 275 LYS n 
1 276 LEU n 
1 277 ASP n 
1 278 LYS n 
1 279 ARG n 
1 280 ILE n 
1 281 PRO n 
1 282 LYS n 
1 283 ALA n 
1 284 ILE n 
1 285 HIS n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 VAL n 
1 290 THR n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 VAL n 
1 297 SER n 
1 298 ARG n 
1 299 GLY n 
1 300 ARG n 
1 301 THR n 
1 302 PHE n 
1 303 PRO n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 LYS n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 TYR n 
1 313 SER n 
1 314 GLU n 
1 315 SER n 
1 316 VAL n 
1 317 LYS n 
1 318 LEU n 
1 319 LEU n 
1 320 GLN n 
1 321 LYS n 
1 322 ILE n 
1 323 LEU n 
1 324 GLU n 
1 325 GLU n 
1 326 ASP n 
1 327 GLU n 
1 328 ARG n 
1 329 LYS n 
1 330 ILE n 
1 331 ARG n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 VAL n 
1 336 ARG n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 PHE n 
1 341 ILE n 
2 1   DT  n 
2 2   DT  n 
2 3   DG  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DG  n 
2 12  DC  n 
2 13  DDG n 
3 1   DC  n 
3 2   DT  n 
3 3   DA  n 
3 4   DA  n 
3 5   DC  n 
3 6   DG  n 
3 7   DC  n 
3 8   DT  n 
3 9   DA  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DA  n 
3 17  DA  n 
3 18  DC  n 
3 19  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'P2 / DSM 1617 / JCM 11322' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus P2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL(STRATAGENE)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 
;DNA primer strand (Dideoxy-terminated at the 3'-end)
;
3 1 sample ? ? ? ? ? 'DNA [AF]G-modified template strand'                   
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 1 
;IVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVY
QQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPN
GIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRV
RKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQK
ILEEDERKIRRIGVRFSKFI
;
2 ? 
2 PDB 3KHR        3KHR   2 DTTGGATGGTAGCG 1 ? 
3 PDB 3KHR        3KHR   3 CTAACGCTACCATCCAACC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KHR A 2 ? 341 ? Q97W02 2    ? 341  ? 2    341  
2 2 3KHR D 1 ? 13  ? 3KHR   803  ? 815  ? 803  815  
3 3 3KHR E 1 ? 19  ? 3KHR   901  ? 919  ? 901  919  
4 1 3KHR B 2 ? 341 ? Q97W02 2    ? 341  ? 1002 1341 
5 2 3KHR H 1 ? 13  ? 3KHR   1803 ? 1815 ? 1803 1815 
6 3 3KHR J 1 ? 19  ? 3KHR   1901 ? 1919 ? 1901 1919 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KHR GLY A 1  ? UNP Q97W02 ? ?  'expression tag'      1    1 
2 3KHR DDG D 13 ? PDB 3KHR   G 14 'engineered mutation' 815  2 
4 3KHR GLY B 1  ? UNP Q97W02 ? ?  'expression tag'      1001 3 
5 3KHR DDG H 13 ? PDB 3KHR   G 14 'engineered mutation' 1815 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AF  non-polymer         . 2-AMINOFLUORENE                            ? 'C13 H11 N'         181.233 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                              ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DDG 'DNA linking'       n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"                ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3KHR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_percent_sol   52.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'100 mM HEPES pH 7.0, 100 mM Calcium acetate, 10% PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 HEPES             ? ? ? 
1 2 1 'Calcium acetate' ? ? ? 
1 3 1 'PEG 4000'        ? ? ? 
1 4 2 HEPES             ? ? ? 
1 5 2 'Calcium acetate' ? ? ? 
1 6 2 'PEG 4000'        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-07-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97914 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97914 
# 
_reflns.entry_id                     3KHR 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   63173 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_all   96.3 
_reflns_shell.Rmerge_I_obs           0.469 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4779 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3KHR 
_refine.ls_number_reflns_obs                     59976 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.01 
_refine.ls_percent_reflns_obs                    95.90 
_refine.ls_R_factor_obs                          0.20822 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20619 
_refine.ls_R_factor_R_free                       0.24650 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3185 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               33.588 
_refine.aniso_B[1][1]                            0.40 
_refine.aniso_B[2][2]                            -1.31 
_refine.aniso_B[3][3]                            0.25 
_refine.aniso_B[1][2]                            0.81 
_refine.aniso_B[1][3]                            -0.54 
_refine.aniso_B[2][3]                            1.28 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2ASD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.206 
_refine.pdbx_overall_ESU_R_Free                  0.177 
_refine.overall_SU_ML                            0.132 
_refine.overall_SU_B                             10.052 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5480 
_refine_hist.pdbx_number_atoms_nucleic_acid   1233 
_refine_hist.pdbx_number_atoms_ligand         92 
_refine_hist.number_atoms_solvent             402 
_refine_hist.number_atoms_total               7207 
_refine_hist.d_res_high                       2.01 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.010  0.022  ? 7083 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.444  2.225  ? 9783 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 4.913  5.000  ? 686  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 33.852 23.566 ? 244  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 15.979 15.000 ? 1128 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 17.692 15.000 ? 49   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.101  0.200  ? 1103 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.005  0.021  ? 4760 'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.802  1.500  ? 3432 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.296  2.000  ? 5555 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.743  3.000  ? 3651 'X-RAY DIFFRACTION' ? 
r_scangle_it           2.821  4.500  ? 4228 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.010 
_refine_ls_shell.d_res_low                        2.057 
_refine_ls_shell.number_reflns_R_work             3880 
_refine_ls_shell.R_factor_R_work                  0.260 
_refine_ls_shell.percent_reflns_obs               84.85 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             207 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KHR 
_struct.title                     
'Dpo4 post-extension ternary complex with the correct C opposite the 2-aminofluorene-guanine [AF]G lesion' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KHR 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;Lesion bypass, DNA polymerase, Y-family polymerase, 2-aminofluorene, semi-targeted mutagenesis, DNA DAMAGE, DNA REPAIR, DNA REPLICATION, DNA-BINDING, DNA-DIRECTED DNA POLYMERASE, MAGNESIUM, METAL-BINDING, MUTATOR PROTEIN, NUCLEOTIDYLTRANSFERASE, TRANSFERASE, TRANSFERASE-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10   ASN A 20   1 ? 11 
HELX_P HELX_P2  2  PRO A 21  ? LYS A 24  ? PRO A 21   LYS A 24   5 ? 4  
HELX_P HELX_P3  3  ASN A 47  ? LYS A 52  ? ASN A 47   LYS A 52   1 ? 6  
HELX_P HELX_P4  4  PRO A 60  ? LEU A 68  ? PRO A 60   LEU A 68   1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? ARG A 93  ? ARG A 77   ARG A 93   1 ? 17 
HELX_P HELX_P6  6  GLU A 94  ? SER A 96  ? GLU A 94   SER A 96   5 ? 3  
HELX_P HELX_P7  7  ASP A 117 ? LYS A 137 ? ASP A 117  LYS A 137  1 ? 21 
HELX_P HELX_P8  8  ASN A 147 ? LYS A 159 ? ASN A 147  LYS A 159  1 ? 13 
HELX_P HELX_P9  9  ASP A 167 ? LEU A 178 ? ASP A 167  LEU A 178  1 ? 12 
HELX_P HELX_P10 10 ASP A 179 ? VAL A 183 ? ASP A 179  VAL A 183  5 ? 5  
HELX_P HELX_P11 11 GLY A 187 ? LYS A 196 ? GLY A 187  LYS A 196  1 ? 10 
HELX_P HELX_P12 12 LYS A 201 ? ILE A 208 ? LYS A 201  ILE A 208  5 ? 8  
HELX_P HELX_P13 13 GLU A 209 ? GLY A 218 ? GLU A 209  GLY A 218  1 ? 10 
HELX_P HELX_P14 14 GLY A 218 ? ARG A 230 ? GLY A 218  ARG A 230  1 ? 13 
HELX_P HELX_P15 15 ASN A 257 ? ASP A 277 ? ASN A 257  ASP A 277  1 ? 21 
HELX_P HELX_P16 16 SER A 307 ? ASP A 326 ? SER A 307  ASP A 326  1 ? 20 
HELX_P HELX_P17 17 TYR D 10  ? ASN D 20  ? TYR B 1010 ASN B 1020 1 ? 11 
HELX_P HELX_P18 18 PRO D 21  ? LYS D 24  ? PRO B 1021 LYS B 1024 5 ? 4  
HELX_P HELX_P19 19 ASN D 47  ? PHE D 53  ? ASN B 1047 PHE B 1053 1 ? 7  
HELX_P HELX_P20 20 PRO D 60  ? LEU D 68  ? PRO B 1060 LEU B 1068 1 ? 9  
HELX_P HELX_P21 21 ARG D 77  ? GLU D 94  ? ARG B 1077 GLU B 1094 1 ? 18 
HELX_P HELX_P22 22 ASP D 117 ? LYS D 137 ? ASP B 1117 LYS B 1137 1 ? 21 
HELX_P HELX_P23 23 ASN D 147 ? LYS D 159 ? ASN B 1147 LYS B 1159 1 ? 13 
HELX_P HELX_P24 24 ASP D 167 ? LEU D 178 ? ASP B 1167 LEU B 1178 1 ? 12 
HELX_P HELX_P25 25 ASP D 179 ? VAL D 183 ? ASP B 1179 VAL B 1183 5 ? 5  
HELX_P HELX_P26 26 GLY D 187 ? LEU D 197 ? GLY B 1187 LEU B 1197 1 ? 11 
HELX_P HELX_P27 27 LYS D 201 ? ILE D 208 ? LYS B 1201 ILE B 1208 5 ? 8  
HELX_P HELX_P28 28 GLU D 209 ? GLY D 218 ? GLU B 1209 GLY B 1218 1 ? 10 
HELX_P HELX_P29 29 GLY D 218 ? ARG D 230 ? GLY B 1218 ARG B 1230 1 ? 13 
HELX_P HELX_P30 30 ASN D 257 ? LEU D 276 ? ASN B 1257 LEU B 1276 1 ? 20 
HELX_P HELX_P31 31 SER D 307 ? GLU D 324 ? SER B 1307 GLU B 1324 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? B DC  12  "O3'" ? ? ? 1_555 B DDG 13 P  ? ? D DC  814  D DDG 815  1_555 ? ? ? ? ? ? ?            1.595 ? ? 
covale2  covale none ? C DG  6   C8    ? ? ? 1_555 K AF  .  N  ? ? E DG  906  E AF  926  1_555 ? ? ? ? ? ? ?            1.449 ? ? 
covale3  covale both ? E DC  12  "O3'" ? ? ? 1_555 E DDG 13 P  ? ? H DC  1814 H DDG 1815 1_555 ? ? ? ? ? ? ?            1.595 ? ? 
covale4  covale none ? F DG  6   C8    ? ? ? 1_555 P AF  .  N  ? ? J DG  1906 J AF  1926 1_555 ? ? ? ? ? ? ?            1.448 ? ? 
metalc1  metalc ?    ? A ASP 7   OD1   ? ? ? 1_555 I CA  .  CA ? ? A ASP 7    A CA  416  1_555 ? ? ? ? ? ? ?            2.289 ? ? 
metalc2  metalc ?    ? A PHE 8   O     ? ? ? 1_555 I CA  .  CA ? ? A PHE 8    A CA  416  1_555 ? ? ? ? ? ? ?            2.307 ? ? 
metalc3  metalc ?    ? A ASP 105 OD1   ? ? ? 1_555 H CA  .  CA ? ? A ASP 105  A CA  415  1_555 ? ? ? ? ? ? ?            2.542 ? ? 
metalc4  metalc ?    ? A ASP 105 OD2   ? ? ? 1_555 I CA  .  CA ? ? A ASP 105  A CA  416  1_555 ? ? ? ? ? ? ?            2.331 ? ? 
metalc5  metalc ?    ? A ALA 181 O     ? ? ? 1_555 J CA  .  CA ? ? A ALA 181  A CA  417  1_555 ? ? ? ? ? ? ?            2.310 ? ? 
metalc6  metalc ?    ? A ILE 186 O     ? ? ? 1_555 J CA  .  CA ? ? A ILE 186  A CA  417  1_555 ? ? ? ? ? ? ?            2.326 ? ? 
metalc7  metalc ?    ? G TTP .   O1A   ? ? ? 1_555 H CA  .  CA ? ? A TTP 414  A CA  415  1_555 ? ? ? ? ? ? ?            2.349 ? ? 
metalc8  metalc ?    ? G TTP .   O1A   ? ? ? 1_555 I CA  .  CA ? ? A TTP 414  A CA  416  1_555 ? ? ? ? ? ? ?            2.323 ? ? 
metalc9  metalc ?    ? G TTP .   O1B   ? ? ? 1_555 I CA  .  CA ? ? A TTP 414  A CA  416  1_555 ? ? ? ? ? ? ?            2.314 ? ? 
metalc10 metalc ?    ? G TTP .   O3G   ? ? ? 1_555 I CA  .  CA ? ? A TTP 414  A CA  416  1_555 ? ? ? ? ? ? ?            2.396 ? ? 
metalc11 metalc ?    ? D ASP 7   OD2   ? ? ? 1_555 M CA  .  CA ? ? B ASP 1007 B CA  1415 1_555 ? ? ? ? ? ? ?            2.745 ? ? 
metalc12 metalc ?    ? D ASP 7   OD1   ? ? ? 1_555 N CA  .  CA ? ? B ASP 1007 B CA  1416 1_555 ? ? ? ? ? ? ?            2.296 ? ? 
metalc13 metalc ?    ? D PHE 8   O     ? ? ? 1_555 N CA  .  CA ? ? B PHE 1008 B CA  1416 1_555 ? ? ? ? ? ? ?            2.300 ? ? 
metalc14 metalc ?    ? D ASP 105 OD2   ? ? ? 1_555 N CA  .  CA ? ? B ASP 1105 B CA  1416 1_555 ? ? ? ? ? ? ?            2.338 ? ? 
metalc15 metalc ?    ? D GLU 106 OE2   ? ? ? 1_555 M CA  .  CA ? ? B GLU 1106 B CA  1415 1_555 ? ? ? ? ? ? ?            2.328 ? ? 
metalc16 metalc ?    ? D ALA 181 O     ? ? ? 1_555 O CA  .  CA ? ? B ALA 1181 B CA  1417 1_555 ? ? ? ? ? ? ?            2.308 ? ? 
metalc17 metalc ?    ? D ILE 186 O     ? ? ? 1_555 O CA  .  CA ? ? B ILE 1186 B CA  1417 1_555 ? ? ? ? ? ? ?            2.572 ? ? 
metalc18 metalc ?    ? L TTP .   O1A   ? ? ? 1_555 N CA  .  CA ? ? B TTP 1414 B CA  1416 1_555 ? ? ? ? ? ? ?            2.405 ? ? 
metalc19 metalc ?    ? L TTP .   O1B   ? ? ? 1_555 N CA  .  CA ? ? B TTP 1414 B CA  1416 1_555 ? ? ? ? ? ? ?            2.305 ? ? 
metalc20 metalc ?    ? L TTP .   O3G   ? ? ? 1_555 N CA  .  CA ? ? B TTP 1414 B CA  1416 1_555 ? ? ? ? ? ? ?            2.424 ? ? 
hydrog1  hydrog ?    ? B DT  2   N3    ? ? ? 1_555 C DA  16 N1 ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? B DT  2   O4    ? ? ? 1_555 C DA  16 N6 ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? B DG  3   N1    ? ? ? 1_555 C DC  15 N3 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? B DG  3   N2    ? ? ? 1_555 C DC  15 O2 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? B DG  3   O6    ? ? ? 1_555 C DC  15 N4 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? B DG  4   N1    ? ? ? 1_555 C DC  14 N3 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? B DG  4   N2    ? ? ? 1_555 C DC  14 O2 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? B DG  4   O6    ? ? ? 1_555 C DC  14 N4 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? B DA  5   N1    ? ? ? 1_555 C DT  13 N3 ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? B DA  5   N6    ? ? ? 1_555 C DT  13 O4 ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1 ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6 ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? B DG  7   N1    ? ? ? 1_555 C DC  11 N3 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? B DG  7   N2    ? ? ? 1_555 C DC  11 O2 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? B DG  7   O6    ? ? ? 1_555 C DC  11 N4 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? B DG  8   N1    ? ? ? 1_555 C DC  10 N3 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? B DG  8   N2    ? ? ? 1_555 C DC  10 O2 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? B DG  8   O6    ? ? ? 1_555 C DC  10 N4 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? B DT  9   N3    ? ? ? 1_555 C DA  9  N1 ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? B DT  9   O4    ? ? ? 1_555 C DA  9  N6 ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? B DA  10  N1    ? ? ? 1_555 C DT  8  N3 ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? B DA  10  N6    ? ? ? 1_555 C DT  8  O4 ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? B DG  11  N1    ? ? ? 1_555 C DC  7  N3 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? B DG  11  N2    ? ? ? 1_555 C DC  7  O2 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? B DG  11  O6    ? ? ? 1_555 C DC  7  N4 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? B DC  12  N3    ? ? ? 1_555 C DG  6  N1 ? ? D DC  814  E DG  906  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? B DC  12  N4    ? ? ? 1_555 C DG  6  O6 ? ? D DC  814  E DG  906  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ?    ? B DC  12  O2    ? ? ? 1_555 C DG  6  N2 ? ? D DC  814  E DG  906  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ?    ? B DDG 13  N1    ? ? ? 1_555 C DC  5  N3 ? ? D DDG 815  E DC  905  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ?    ? B DDG 13  N2    ? ? ? 1_555 C DC  5  O2 ? ? D DDG 815  E DC  905  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ?    ? B DDG 13  O6    ? ? ? 1_555 C DC  5  N4 ? ? D DDG 815  E DC  905  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ?    ? E DG  3   N1    ? ? ? 1_555 F DC  15 N3 ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ?    ? E DG  3   N2    ? ? ? 1_555 F DC  15 O2 ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ?    ? E DG  3   O6    ? ? ? 1_555 F DC  15 N4 ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ?    ? E DG  4   N1    ? ? ? 1_555 F DC  14 N3 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ?    ? E DG  4   N2    ? ? ? 1_555 F DC  14 O2 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ?    ? E DG  4   O6    ? ? ? 1_555 F DC  14 N4 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ?    ? E DA  5   N1    ? ? ? 1_555 F DT  13 N3 ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ?    ? E DA  5   N6    ? ? ? 1_555 F DT  13 O4 ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ?    ? E DT  6   N3    ? ? ? 1_555 F DA  12 N1 ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ?    ? E DT  6   O4    ? ? ? 1_555 F DA  12 N6 ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ?    ? E DG  7   N1    ? ? ? 1_555 F DC  11 N3 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ?    ? E DG  7   N2    ? ? ? 1_555 F DC  11 O2 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ?    ? E DG  7   O6    ? ? ? 1_555 F DC  11 N4 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ?    ? E DG  8   N1    ? ? ? 1_555 F DC  10 N3 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ?    ? E DG  8   N2    ? ? ? 1_555 F DC  10 O2 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47 hydrog ?    ? E DG  8   O6    ? ? ? 1_555 F DC  10 N4 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48 hydrog ?    ? E DT  9   N3    ? ? ? 1_555 F DA  9  N1 ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49 hydrog ?    ? E DT  9   O4    ? ? ? 1_555 F DA  9  N6 ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50 hydrog ?    ? E DA  10  N1    ? ? ? 1_555 F DT  8  N3 ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog51 hydrog ?    ? E DA  10  N6    ? ? ? 1_555 F DT  8  O4 ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog52 hydrog ?    ? E DG  11  N1    ? ? ? 1_555 F DC  7  N3 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog53 hydrog ?    ? E DG  11  N2    ? ? ? 1_555 F DC  7  O2 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog54 hydrog ?    ? E DG  11  O6    ? ? ? 1_555 F DC  7  N4 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog55 hydrog ?    ? E DC  12  N3    ? ? ? 1_555 F DG  6  N1 ? ? H DC  1814 J DG  1906 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog56 hydrog ?    ? E DC  12  N4    ? ? ? 1_555 F DG  6  O6 ? ? H DC  1814 J DG  1906 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog57 hydrog ?    ? E DC  12  O2    ? ? ? 1_555 F DG  6  N2 ? ? H DC  1814 J DG  1906 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog58 hydrog ?    ? E DDG 13  N1    ? ? ? 1_555 F DC  5  N3 ? ? H DDG 1815 J DC  1905 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog59 hydrog ?    ? E DDG 13  N2    ? ? ? 1_555 F DC  5  O2 ? ? H DDG 1815 J DC  1905 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog60 hydrog ?    ? E DDG 13  O6    ? ? ? 1_555 F DC  5  N4 ? ? H DDG 1815 J DC  1905 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 159 A . ? LYS 159  A PRO 160 A ? PRO 160  A 1 -8.16 
2 LYS 159 D . ? LYS 1159 B PRO 160 D ? PRO 1160 B 1 -5.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 99  ? SER A 103 ? ILE A 99   SER A 103  
A 2 GLU A 106 ? ASP A 110 ? GLU A 106  ASP A 110  
A 3 VAL A 3   ? PHE A 8   ? VAL A 3    PHE A 8    
A 4 VAL A 140 ? SER A 145 ? VAL A 140  SER A 145  
A 5 ILE A 163 ? VAL A 165 ? ILE A 163  VAL A 165  
B 1 GLY A 41  ? ALA A 46  ? GLY A 41   ALA A 46   
B 2 VAL A 28  ? PHE A 33  ? VAL A 28   PHE A 33   
B 3 VAL A 72  ? PRO A 75  ? VAL A 72   PRO A 75   
C 1 SER A 244 ? SER A 255 ? SER A 244  SER A 255  
C 2 ILE A 330 ? PHE A 340 ? ILE A 330  PHE A 340  
C 3 PRO A 281 ? THR A 290 ? PRO A 281  THR A 290  
C 4 ILE A 295 ? THR A 301 ? ILE A 295  THR A 301  
D 1 ILE D 99  ? SER D 103 ? ILE B 1099 SER B 1103 
D 2 GLU D 106 ? ASP D 110 ? GLU B 1106 ASP B 1110 
D 3 VAL D 3   ? PHE D 8   ? VAL B 1003 PHE B 1008 
D 4 VAL D 140 ? SER D 145 ? VAL B 1140 SER B 1145 
D 5 ILE D 163 ? VAL D 165 ? ILE B 1163 VAL B 1165 
E 1 GLY D 41  ? ALA D 46  ? GLY B 1041 ALA B 1046 
E 2 VAL D 28  ? PHE D 33  ? VAL B 1028 PHE B 1033 
E 3 VAL D 72  ? PRO D 75  ? VAL B 1072 PRO B 1075 
F 1 SER D 244 ? SER D 255 ? SER B 1244 SER B 1255 
F 2 ILE D 330 ? PHE D 340 ? ILE B 1330 PHE B 1340 
F 3 PRO D 281 ? THR D 290 ? PRO B 1281 THR B 1290 
F 4 ILE D 295 ? THR D 301 ? ILE B 1295 THR B 1301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100  O TYR A 108 ? O TYR A 108  
A 2 3 O LEU A 109 ? O LEU A 109  N LEU A 4   ? N LEU A 4    
A 3 4 N VAL A 3   ? N VAL A 3    O SER A 145 ? O SER A 145  
A 4 5 N ILE A 144 ? N ILE A 144  O LYS A 164 ? O LYS A 164  
B 1 2 O ALA A 42  ? O ALA A 42   N VAL A 32  ? N VAL A 32   
B 2 3 N CYS A 31  ? N CYS A 31   O LEU A 74  ? O LEU A 74   
C 1 2 N SER A 255 ? N SER A 255  O ILE A 330 ? O ILE A 330  
C 2 3 O GLY A 334 ? O GLY A 334  N VAL A 287 ? N VAL A 287  
C 3 4 N ALA A 288 ? N ALA A 288  O VAL A 296 ? O VAL A 296  
D 1 2 N GLU D 100 ? N GLU B 1100 O TYR D 108 ? O TYR B 1108 
D 2 3 O LEU D 109 ? O LEU B 1109 N LEU D 4   ? N LEU B 1004 
D 3 4 N PHE D 5   ? N PHE B 1005 O GLY D 143 ? O GLY B 1143 
D 4 5 N ILE D 144 ? N ILE B 1144 O LYS D 164 ? O LYS B 1164 
E 1 2 O ALA D 42  ? O ALA B 1042 N VAL D 32  ? N VAL B 1032 
E 2 3 N CYS D 31  ? N CYS B 1031 O LEU D 74  ? O LEU B 1074 
F 1 2 N SER D 255 ? N SER B 1255 O ILE D 330 ? O ILE B 1330 
F 2 3 O ARG D 331 ? O ARG B 1331 N VAL D 289 ? N VAL B 1289 
F 3 4 N ALA D 288 ? N ALA B 1288 O VAL D 296 ? O VAL B 1296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A TTP 414  ? 21 'BINDING SITE FOR RESIDUE TTP A 414'  
AC2 Software A CA  415  ? 7  'BINDING SITE FOR RESIDUE CA A 415'   
AC3 Software A CA  416  ? 5  'BINDING SITE FOR RESIDUE CA A 416'   
AC4 Software A CA  417  ? 5  'BINDING SITE FOR RESIDUE CA A 417'   
AC5 Software E AF  926  ? 9  'BINDING SITE FOR RESIDUE AF E 926'   
AC6 Software B TTP 1414 ? 22 'BINDING SITE FOR RESIDUE TTP B 1414' 
AC7 Software B CA  1415 ? 5  'BINDING SITE FOR RESIDUE CA B 1415'  
AC8 Software B CA  1416 ? 5  'BINDING SITE FOR RESIDUE CA B 1416'  
AC9 Software B CA  1417 ? 7  'BINDING SITE FOR RESIDUE CA B 1417'  
BC1 Software J AF  1926 ? 8  'BINDING SITE FOR RESIDUE AF J 1926'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ASP A 7   ? ASP A 7    . ? 1_555 ? 
2  AC1 21 PHE A 8   ? PHE A 8    . ? 1_555 ? 
3  AC1 21 TYR A 10  ? TYR A 10   . ? 1_555 ? 
4  AC1 21 PHE A 11  ? PHE A 11   . ? 1_555 ? 
5  AC1 21 TYR A 12  ? TYR A 12   . ? 1_555 ? 
6  AC1 21 ALA A 44  ? ALA A 44   . ? 1_555 ? 
7  AC1 21 THR A 45  ? THR A 45   . ? 1_555 ? 
8  AC1 21 TYR A 48  ? TYR A 48   . ? 1_555 ? 
9  AC1 21 ARG A 51  ? ARG A 51   . ? 1_555 ? 
10 AC1 21 ALA A 57  ? ALA A 57   . ? 1_555 ? 
11 AC1 21 ASP A 105 ? ASP A 105  . ? 1_555 ? 
12 AC1 21 LYS A 159 ? LYS A 159  . ? 1_555 ? 
13 AC1 21 CA  H .   ? CA  A 415  . ? 1_555 ? 
14 AC1 21 CA  I .   ? CA  A 416  . ? 1_555 ? 
15 AC1 21 HOH Q .   ? HOH A 524  . ? 1_555 ? 
16 AC1 21 HOH Q .   ? HOH A 553  . ? 1_555 ? 
17 AC1 21 HOH Q .   ? HOH A 567  . ? 1_555 ? 
18 AC1 21 HOH Q .   ? HOH A 587  . ? 1_555 ? 
19 AC1 21 HOH Q .   ? HOH A 597  . ? 1_555 ? 
20 AC1 21 DDG B 13  ? DDG D 815  . ? 1_555 ? 
21 AC1 21 DA  C 4   ? DA  E 904  . ? 1_555 ? 
22 AC2 7  ASP A 7   ? ASP A 7    . ? 1_555 ? 
23 AC2 7  ASP A 105 ? ASP A 105  . ? 1_555 ? 
24 AC2 7  GLU A 106 ? GLU A 106  . ? 1_555 ? 
25 AC2 7  TTP G .   ? TTP A 414  . ? 1_555 ? 
26 AC2 7  CA  I .   ? CA  A 416  . ? 1_555 ? 
27 AC2 7  HOH Q .   ? HOH A 510  . ? 1_555 ? 
28 AC2 7  DDG B 13  ? DDG D 815  . ? 1_555 ? 
29 AC3 5  ASP A 7   ? ASP A 7    . ? 1_555 ? 
30 AC3 5  PHE A 8   ? PHE A 8    . ? 1_555 ? 
31 AC3 5  ASP A 105 ? ASP A 105  . ? 1_555 ? 
32 AC3 5  TTP G .   ? TTP A 414  . ? 1_555 ? 
33 AC3 5  CA  H .   ? CA  A 415  . ? 1_555 ? 
34 AC4 5  ALA A 181 ? ALA A 181  . ? 1_555 ? 
35 AC4 5  ILE A 186 ? ILE A 186  . ? 1_555 ? 
36 AC4 5  HOH Q .   ? HOH A 513  . ? 1_555 ? 
37 AC4 5  HOH Q .   ? HOH A 585  . ? 1_555 ? 
38 AC4 5  HOH R .   ? HOH D 514  . ? 1_555 ? 
39 AC5 9  ARG A 247 ? ARG A 247  . ? 1_555 ? 
40 AC5 9  ILE A 248 ? ILE A 248  . ? 1_555 ? 
41 AC5 9  HIS A 285 ? HIS A 285  . ? 1_555 ? 
42 AC5 9  VAL A 287 ? VAL A 287  . ? 1_555 ? 
43 AC5 9  VAL A 335 ? VAL A 335  . ? 1_555 ? 
44 AC5 9  ARG A 336 ? ARG A 336  . ? 1_555 ? 
45 AC5 9  DC  C 5   ? DC  E 905  . ? 1_555 ? 
46 AC5 9  DG  C 6   ? DG  E 906  . ? 1_555 ? 
47 AC5 9  DC  C 7   ? DC  E 907  . ? 1_555 ? 
48 AC6 22 HOH T .   ? HOH B 21   . ? 1_555 ? 
49 AC6 22 HOH T .   ? HOH B 25   . ? 1_555 ? 
50 AC6 22 HOH T .   ? HOH B 39   . ? 1_555 ? 
51 AC6 22 HOH T .   ? HOH B 65   . ? 1_555 ? 
52 AC6 22 HOH T .   ? HOH B 167  . ? 1_555 ? 
53 AC6 22 HOH T .   ? HOH B 400  . ? 1_555 ? 
54 AC6 22 ASP D 7   ? ASP B 1007 . ? 1_555 ? 
55 AC6 22 PHE D 8   ? PHE B 1008 . ? 1_555 ? 
56 AC6 22 ASP D 9   ? ASP B 1009 . ? 1_555 ? 
57 AC6 22 TYR D 10  ? TYR B 1010 . ? 1_555 ? 
58 AC6 22 PHE D 11  ? PHE B 1011 . ? 1_555 ? 
59 AC6 22 TYR D 12  ? TYR B 1012 . ? 1_555 ? 
60 AC6 22 ALA D 44  ? ALA B 1044 . ? 1_555 ? 
61 AC6 22 THR D 45  ? THR B 1045 . ? 1_555 ? 
62 AC6 22 TYR D 48  ? TYR B 1048 . ? 1_555 ? 
63 AC6 22 ARG D 51  ? ARG B 1051 . ? 1_555 ? 
64 AC6 22 ALA D 57  ? ALA B 1057 . ? 1_555 ? 
65 AC6 22 ASP D 105 ? ASP B 1105 . ? 1_555 ? 
66 AC6 22 LYS D 159 ? LYS B 1159 . ? 1_555 ? 
67 AC6 22 CA  N .   ? CA  B 1416 . ? 1_555 ? 
68 AC6 22 DDG E 13  ? DDG H 1815 . ? 1_555 ? 
69 AC6 22 DA  F 4   ? DA  J 1904 . ? 1_555 ? 
70 AC7 5  ASP D 7   ? ASP B 1007 . ? 1_555 ? 
71 AC7 5  GLU D 106 ? GLU B 1106 . ? 1_555 ? 
72 AC7 5  LYS D 152 ? LYS B 1152 . ? 1_555 ? 
73 AC7 5  HOH T .   ? HOH B 1519 . ? 1_555 ? 
74 AC7 5  DDG E 13  ? DDG H 1815 . ? 1_555 ? 
75 AC8 5  ASP D 7   ? ASP B 1007 . ? 1_555 ? 
76 AC8 5  PHE D 8   ? PHE B 1008 . ? 1_555 ? 
77 AC8 5  ASP D 105 ? ASP B 1105 . ? 1_555 ? 
78 AC8 5  TTP L .   ? TTP B 1414 . ? 1_555 ? 
79 AC8 5  HOH T .   ? HOH B 1519 . ? 1_555 ? 
80 AC9 7  HOH T .   ? HOH B 344  . ? 1_555 ? 
81 AC9 7  ALA D 181 ? ALA B 1181 . ? 1_555 ? 
82 AC9 7  ILE D 186 ? ILE B 1186 . ? 1_555 ? 
83 AC9 7  HOH T .   ? HOH B 1511 . ? 1_555 ? 
84 AC9 7  HOH T .   ? HOH B 1512 . ? 1_555 ? 
85 AC9 7  HOH T .   ? HOH B 1513 . ? 1_555 ? 
86 AC9 7  HOH U .   ? HOH H 331  . ? 1_555 ? 
87 BC1 8  ILE D 248 ? ILE B 1248 . ? 1_555 ? 
88 BC1 8  HIS D 285 ? HIS B 1285 . ? 1_555 ? 
89 BC1 8  VAL D 287 ? VAL B 1287 . ? 1_555 ? 
90 BC1 8  VAL D 335 ? VAL B 1335 . ? 1_555 ? 
91 BC1 8  ARG D 336 ? ARG B 1336 . ? 1_555 ? 
92 BC1 8  DC  F 5   ? DC  J 1905 . ? 1_555 ? 
93 BC1 8  DG  F 6   ? DG  J 1906 . ? 1_555 ? 
94 BC1 8  DC  F 7   ? DC  J 1907 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KHR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KHR 
_atom_sites.fract_transf_matrix[1][1]   0.019056 
_atom_sites.fract_transf_matrix[1][2]   -0.006882 
_atom_sites.fract_transf_matrix[1][3]   -0.004000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020054 
_atom_sites.fract_transf_matrix[2][3]   -0.001441 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010314 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -22.407 9.027   -12.919 1.00 26.87  ? 1    GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -21.501 8.509   -11.859 1.00 25.94  ? 1    GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -20.964 9.628   -10.988 1.00 25.71  ? 1    GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -20.416 10.595  -11.489 1.00 25.77  ? 1    GLY A O     1 
ATOM   5    N  N     . ILE A 1 2   ? -21.122 9.495   -9.677  1.00 25.77  ? 2    ILE A N     1 
ATOM   6    C  CA    . ILE A 1 2   ? -20.553 10.461  -8.723  1.00 24.75  ? 2    ILE A CA    1 
ATOM   7    C  C     . ILE A 1 2   ? -19.872 9.708   -7.587  1.00 24.82  ? 2    ILE A C     1 
ATOM   8    O  O     . ILE A 1 2   ? -20.526 8.946   -6.862  1.00 25.37  ? 2    ILE A O     1 
ATOM   9    C  CB    . ILE A 1 2   ? -21.633 11.430  -8.154  1.00 24.63  ? 2    ILE A CB    1 
ATOM   10   C  CG1   . ILE A 1 2   ? -22.346 12.188  -9.285  1.00 25.42  ? 2    ILE A CG1   1 
ATOM   11   C  CG2   . ILE A 1 2   ? -21.015 12.412  -7.124  1.00 23.84  ? 2    ILE A CG2   1 
ATOM   12   C  CD1   . ILE A 1 2   ? -23.572 13.017  -8.838  1.00 26.64  ? 2    ILE A CD1   1 
ATOM   13   N  N     . VAL A 1 3   ? -18.565 9.923   -7.437  1.00 23.97  ? 3    VAL A N     1 
ATOM   14   C  CA    . VAL A 1 3   ? -17.775 9.247   -6.426  1.00 24.07  ? 3    VAL A CA    1 
ATOM   15   C  C     . VAL A 1 3   ? -17.264 10.258  -5.393  1.00 24.05  ? 3    VAL A C     1 
ATOM   16   O  O     . VAL A 1 3   ? -16.777 11.326  -5.754  1.00 24.15  ? 3    VAL A O     1 
ATOM   17   C  CB    . VAL A 1 3   ? -16.585 8.496   -7.057  1.00 24.26  ? 3    VAL A CB    1 
ATOM   18   C  CG1   . VAL A 1 3   ? -15.673 7.878   -5.978  1.00 24.40  ? 3    VAL A CG1   1 
ATOM   19   C  CG2   . VAL A 1 3   ? -17.078 7.441   -8.054  1.00 25.24  ? 3    VAL A CG2   1 
ATOM   20   N  N     . LEU A 1 4   ? -17.415 9.910   -4.119  1.00 23.98  ? 4    LEU A N     1 
ATOM   21   C  CA    . LEU A 1 4   ? -16.894 10.693  -3.002  1.00 24.43  ? 4    LEU A CA    1 
ATOM   22   C  C     . LEU A 1 4   ? -15.770 9.921   -2.302  1.00 24.46  ? 4    LEU A C     1 
ATOM   23   O  O     . LEU A 1 4   ? -15.958 8.758   -1.911  1.00 25.09  ? 4    LEU A O     1 
ATOM   24   C  CB    . LEU A 1 4   ? -18.014 11.036  -2.014  1.00 23.93  ? 4    LEU A CB    1 
ATOM   25   C  CG    . LEU A 1 4   ? -17.710 12.138  -0.986  1.00 24.59  ? 4    LEU A CG    1 
ATOM   26   C  CD1   . LEU A 1 4   ? -18.985 12.914  -0.670  1.00 25.75  ? 4    LEU A CD1   1 
ATOM   27   C  CD2   . LEU A 1 4   ? -17.092 11.566  0.287   1.00 24.33  ? 4    LEU A CD2   1 
ATOM   28   N  N     . PHE A 1 5   ? -14.617 10.580  -2.151  1.00 23.55  ? 5    PHE A N     1 
ATOM   29   C  CA    . PHE A 1 5   ? -13.402 9.995   -1.593  1.00 22.85  ? 5    PHE A CA    1 
ATOM   30   C  C     . PHE A 1 5   ? -13.007 10.749  -0.338  1.00 22.70  ? 5    PHE A C     1 
ATOM   31   O  O     . PHE A 1 5   ? -12.961 11.981  -0.335  1.00 23.20  ? 5    PHE A O     1 
ATOM   32   C  CB    . PHE A 1 5   ? -12.273 10.082  -2.627  1.00 22.48  ? 5    PHE A CB    1 
ATOM   33   C  CG    . PHE A 1 5   ? -10.924 9.614   -2.125  1.00 23.28  ? 5    PHE A CG    1 
ATOM   34   C  CD1   . PHE A 1 5   ? -10.689 8.273   -1.855  1.00 21.52  ? 5    PHE A CD1   1 
ATOM   35   C  CD2   . PHE A 1 5   ? -9.876  10.531  -1.929  1.00 22.23  ? 5    PHE A CD2   1 
ATOM   36   C  CE1   . PHE A 1 5   ? -9.435  7.838   -1.426  1.00 22.94  ? 5    PHE A CE1   1 
ATOM   37   C  CE2   . PHE A 1 5   ? -8.630  10.107  -1.496  1.00 24.52  ? 5    PHE A CE2   1 
ATOM   38   C  CZ    . PHE A 1 5   ? -8.398  8.754   -1.247  1.00 22.01  ? 5    PHE A CZ    1 
ATOM   39   N  N     . VAL A 1 6   ? -12.724 10.019  0.730   1.00 22.13  ? 6    VAL A N     1 
ATOM   40   C  CA    . VAL A 1 6   ? -12.337 10.633  2.006   1.00 22.04  ? 6    VAL A CA    1 
ATOM   41   C  C     . VAL A 1 6   ? -10.917 10.190  2.330   1.00 22.87  ? 6    VAL A C     1 
ATOM   42   O  O     . VAL A 1 6   ? -10.598 9.011   2.214   1.00 22.59  ? 6    VAL A O     1 
ATOM   43   C  CB    . VAL A 1 6   ? -13.282 10.243  3.152   1.00 21.77  ? 6    VAL A CB    1 
ATOM   44   C  CG1   . VAL A 1 6   ? -12.877 10.959  4.449   1.00 19.78  ? 6    VAL A CG1   1 
ATOM   45   C  CG2   . VAL A 1 6   ? -14.733 10.588  2.806   1.00 21.64  ? 6    VAL A CG2   1 
ATOM   46   N  N     . ASP A 1 7   ? -10.080 11.135  2.727   1.00 22.45  ? 7    ASP A N     1 
ATOM   47   C  CA    . ASP A 1 7   ? -8.671  10.870  2.992   1.00 23.30  ? 7    ASP A CA    1 
ATOM   48   C  C     . ASP A 1 7   ? -8.329  11.676  4.282   1.00 22.69  ? 7    ASP A C     1 
ATOM   49   O  O     . ASP A 1 7   ? -8.442  12.926  4.304   1.00 22.05  ? 7    ASP A O     1 
ATOM   50   C  CB    . ASP A 1 7   ? -7.873  11.312  1.752   1.00 23.91  ? 7    ASP A CB    1 
ATOM   51   C  CG    . ASP A 1 7   ? -6.360  11.099  1.880   1.00 28.54  ? 7    ASP A CG    1 
ATOM   52   O  OD1   . ASP A 1 7   ? -5.858  11.220  3.004   1.00 29.98  ? 7    ASP A OD1   1 
ATOM   53   O  OD2   . ASP A 1 7   ? -5.662  10.875  0.838   1.00 28.45  ? 7    ASP A OD2   1 
ATOM   54   N  N     . PHE A 1 8   ? -7.949  10.976  5.356   1.00 22.33  ? 8    PHE A N     1 
ATOM   55   C  CA    . PHE A 1 8   ? -7.810  11.619  6.683   1.00 22.89  ? 8    PHE A CA    1 
ATOM   56   C  C     . PHE A 1 8   ? -6.512  12.414  6.708   1.00 23.63  ? 8    PHE A C     1 
ATOM   57   O  O     . PHE A 1 8   ? -5.522  11.934  6.182   1.00 24.48  ? 8    PHE A O     1 
ATOM   58   C  CB    . PHE A 1 8   ? -7.807  10.614  7.855   1.00 23.02  ? 8    PHE A CB    1 
ATOM   59   C  CG    . PHE A 1 8   ? -8.921  9.579   7.813   1.00 23.10  ? 8    PHE A CG    1 
ATOM   60   C  CD1   . PHE A 1 8   ? -10.070 9.772   7.056   1.00 23.35  ? 8    PHE A CD1   1 
ATOM   61   C  CD2   . PHE A 1 8   ? -8.808  8.417   8.567   1.00 24.30  ? 8    PHE A CD2   1 
ATOM   62   C  CE1   . PHE A 1 8   ? -11.090 8.792   7.006   1.00 24.39  ? 8    PHE A CE1   1 
ATOM   63   C  CE2   . PHE A 1 8   ? -9.810  7.431   8.531   1.00 23.91  ? 8    PHE A CE2   1 
ATOM   64   C  CZ    . PHE A 1 8   ? -10.950 7.626   7.749   1.00 23.18  ? 8    PHE A CZ    1 
ATOM   65   N  N     . ASP A 1 9   ? -6.512  13.610  7.310   1.00 23.50  ? 9    ASP A N     1 
ATOM   66   C  CA    . ASP A 1 9   ? -5.345  14.506  7.221   1.00 23.81  ? 9    ASP A CA    1 
ATOM   67   C  C     . ASP A 1 9   ? -4.208  14.079  8.173   1.00 22.96  ? 9    ASP A C     1 
ATOM   68   O  O     . ASP A 1 9   ? -4.439  13.814  9.352   1.00 23.01  ? 9    ASP A O     1 
ATOM   69   C  CB    . ASP A 1 9   ? -5.705  15.989  7.511   1.00 23.90  ? 9    ASP A CB    1 
ATOM   70   C  CG    . ASP A 1 9   ? -6.762  16.571  6.557   1.00 25.96  ? 9    ASP A CG    1 
ATOM   71   O  OD1   . ASP A 1 9   ? -6.768  16.282  5.339   1.00 25.69  ? 9    ASP A OD1   1 
ATOM   72   O  OD2   . ASP A 1 9   ? -7.619  17.341  7.050   1.00 28.73  ? 9    ASP A OD2   1 
ATOM   73   N  N     . TYR A 1 10  ? -2.983  14.051  7.655   1.00 22.76  ? 10   TYR A N     1 
ATOM   74   C  CA    . TYR A 1 10  ? -1.769  13.639  8.393   1.00 22.61  ? 10   TYR A CA    1 
ATOM   75   C  C     . TYR A 1 10  ? -2.060  12.606  9.485   1.00 22.77  ? 10   TYR A C     1 
ATOM   76   O  O     . TYR A 1 10  ? -1.729  12.799  10.662  1.00 21.99  ? 10   TYR A O     1 
ATOM   77   C  CB    . TYR A 1 10  ? -0.974  14.862  8.909   1.00 22.90  ? 10   TYR A CB    1 
ATOM   78   C  CG    . TYR A 1 10  ? -1.715  15.809  9.869   1.00 23.74  ? 10   TYR A CG    1 
ATOM   79   C  CD1   . TYR A 1 10  ? -1.385  15.855  11.238  1.00 21.35  ? 10   TYR A CD1   1 
ATOM   80   C  CD2   . TYR A 1 10  ? -2.709  16.662  9.401   1.00 22.66  ? 10   TYR A CD2   1 
ATOM   81   C  CE1   . TYR A 1 10  ? -2.036  16.731  12.103  1.00 23.06  ? 10   TYR A CE1   1 
ATOM   82   C  CE2   . TYR A 1 10  ? -3.381  17.518  10.247  1.00 25.17  ? 10   TYR A CE2   1 
ATOM   83   C  CZ    . TYR A 1 10  ? -3.040  17.552  11.591  1.00 25.25  ? 10   TYR A CZ    1 
ATOM   84   O  OH    . TYR A 1 10  ? -3.732  18.400  12.404  1.00 27.09  ? 10   TYR A OH    1 
ATOM   85   N  N     . PHE A 1 11  ? -2.695  11.503  9.073   1.00 22.11  ? 11   PHE A N     1 
ATOM   86   C  CA    . PHE A 1 11  ? -3.509  10.708  10.007  1.00 21.99  ? 11   PHE A CA    1 
ATOM   87   C  C     . PHE A 1 11  ? -2.863  10.337  11.354  1.00 21.53  ? 11   PHE A C     1 
ATOM   88   O  O     . PHE A 1 11  ? -3.407  10.714  12.385  1.00 21.68  ? 11   PHE A O     1 
ATOM   89   C  CB    . PHE A 1 11  ? -4.168  9.495   9.310   1.00 21.80  ? 11   PHE A CB    1 
ATOM   90   C  CG    . PHE A 1 11  ? -5.136  8.741   10.178  1.00 21.98  ? 11   PHE A CG    1 
ATOM   91   C  CD1   . PHE A 1 11  ? -6.091  9.418   10.947  1.00 21.78  ? 11   PHE A CD1   1 
ATOM   92   C  CD2   . PHE A 1 11  ? -5.100  7.346   10.221  1.00 23.52  ? 11   PHE A CD2   1 
ATOM   93   C  CE1   . PHE A 1 11  ? -6.981  8.716   11.759  1.00 23.80  ? 11   PHE A CE1   1 
ATOM   94   C  CE2   . PHE A 1 11  ? -5.984  6.623   11.035  1.00 23.50  ? 11   PHE A CE2   1 
ATOM   95   C  CZ    . PHE A 1 11  ? -6.929  7.297   11.796  1.00 22.68  ? 11   PHE A CZ    1 
ATOM   96   N  N     . TYR A 1 12  ? -1.739  9.607   11.359  1.00 21.65  ? 12   TYR A N     1 
ATOM   97   C  CA    . TYR A 1 12  ? -1.158  9.134   12.629  1.00 22.33  ? 12   TYR A CA    1 
ATOM   98   C  C     . TYR A 1 12  ? -0.770  10.279  13.565  1.00 22.19  ? 12   TYR A C     1 
ATOM   99   O  O     . TYR A 1 12  ? -1.057  10.239  14.769  1.00 22.35  ? 12   TYR A O     1 
ATOM   100  C  CB    . TYR A 1 12  ? 0.070   8.242   12.391  1.00 22.36  ? 12   TYR A CB    1 
ATOM   101  C  CG    . TYR A 1 12  ? -0.186  6.904   11.733  1.00 23.35  ? 12   TYR A CG    1 
ATOM   102  C  CD1   . TYR A 1 12  ? -1.451  6.547   11.275  1.00 23.83  ? 12   TYR A CD1   1 
ATOM   103  C  CD2   . TYR A 1 12  ? 0.872   6.004   11.536  1.00 25.55  ? 12   TYR A CD2   1 
ATOM   104  C  CE1   . TYR A 1 12  ? -1.664  5.308   10.651  1.00 27.90  ? 12   TYR A CE1   1 
ATOM   105  C  CE2   . TYR A 1 12  ? 0.680   4.787   10.905  1.00 27.75  ? 12   TYR A CE2   1 
ATOM   106  C  CZ    . TYR A 1 12  ? -0.590  4.437   10.479  1.00 27.24  ? 12   TYR A CZ    1 
ATOM   107  O  OH    . TYR A 1 12  ? -0.768  3.219   9.871   1.00 30.72  ? 12   TYR A OH    1 
ATOM   108  N  N     . ALA A 1 13  ? -0.105  11.293  13.009  1.00 22.01  ? 13   ALA A N     1 
ATOM   109  C  CA    . ALA A 1 13  ? 0.293   12.474  13.776  1.00 22.15  ? 13   ALA A CA    1 
ATOM   110  C  C     . ALA A 1 13  ? -0.932  13.226  14.327  1.00 22.14  ? 13   ALA A C     1 
ATOM   111  O  O     . ALA A 1 13  ? -0.926  13.674  15.498  1.00 22.57  ? 13   ALA A O     1 
ATOM   112  C  CB    . ALA A 1 13  ? 1.174   13.407  12.900  1.00 22.09  ? 13   ALA A CB    1 
ATOM   113  N  N     . GLN A 1 14  ? -1.976  13.338  13.512  1.00 21.92  ? 14   GLN A N     1 
ATOM   114  C  CA    . GLN A 1 14  ? -3.215  14.017  13.940  1.00 23.46  ? 14   GLN A CA    1 
ATOM   115  C  C     . GLN A 1 14  ? -3.883  13.320  15.121  1.00 23.21  ? 14   GLN A C     1 
ATOM   116  O  O     . GLN A 1 14  ? -4.347  13.986  16.050  1.00 23.86  ? 14   GLN A O     1 
ATOM   117  C  CB    . GLN A 1 14  ? -4.234  14.216  12.794  1.00 23.39  ? 14   GLN A CB    1 
ATOM   118  C  CG    . GLN A 1 14  ? -5.410  15.145  13.236  1.00 23.71  ? 14   GLN A CG    1 
ATOM   119  C  CD    . GLN A 1 14  ? -6.488  15.400  12.174  1.00 26.27  ? 14   GLN A CD    1 
ATOM   120  O  OE1   . GLN A 1 14  ? -6.455  14.881  11.031  1.00 25.56  ? 14   GLN A OE1   1 
ATOM   121  N  NE2   . GLN A 1 14  ? -7.464  16.209  12.554  1.00 23.59  ? 14   GLN A NE2   1 
ATOM   122  N  N     . VAL A 1 15  ? -3.923  11.985  15.093  1.00 24.08  ? 15   VAL A N     1 
ATOM   123  C  CA    . VAL A 1 15  ? -4.429  11.222  16.244  1.00 24.31  ? 15   VAL A CA    1 
ATOM   124  C  C     . VAL A 1 15  ? -3.615  11.579  17.497  1.00 25.82  ? 15   VAL A C     1 
ATOM   125  O  O     . VAL A 1 15  ? -4.195  11.808  18.573  1.00 25.03  ? 15   VAL A O     1 
ATOM   126  C  CB    . VAL A 1 15  ? -4.412  9.685   16.010  1.00 24.71  ? 15   VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 15  ? -4.754  8.918   17.295  1.00 24.70  ? 15   VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 15  ? -5.393  9.282   14.889  1.00 23.23  ? 15   VAL A CG2   1 
ATOM   129  N  N     . GLU A 1 16  ? -2.278  11.636  17.359  1.00 25.91  ? 16   GLU A N     1 
ATOM   130  C  CA    . GLU A 1 16  ? -1.424  11.983  18.500  1.00 26.79  ? 16   GLU A CA    1 
ATOM   131  C  C     . GLU A 1 16  ? -1.727  13.388  19.022  1.00 27.31  ? 16   GLU A C     1 
ATOM   132  O  O     . GLU A 1 16  ? -1.667  13.625  20.223  1.00 27.81  ? 16   GLU A O     1 
ATOM   133  C  CB    . GLU A 1 16  ? 0.073   11.813  18.174  1.00 26.80  ? 16   GLU A CB    1 
ATOM   134  C  CG    . GLU A 1 16  ? 0.514   10.360  17.853  1.00 26.32  ? 16   GLU A CG    1 
ATOM   135  C  CD    . GLU A 1 16  ? 0.418   9.394   19.036  1.00 28.59  ? 16   GLU A CD    1 
ATOM   136  O  OE1   . GLU A 1 16  ? 0.320   9.845   20.198  1.00 30.37  ? 16   GLU A OE1   1 
ATOM   137  O  OE2   . GLU A 1 16  ? 0.451   8.164   18.799  1.00 30.83  ? 16   GLU A OE2   1 
ATOM   138  N  N     . GLU A 1 17  ? -2.070  14.314  18.127  1.00 27.93  ? 17   GLU A N     1 
ATOM   139  C  CA    . GLU A 1 17  ? -2.465  15.663  18.553  1.00 29.48  ? 17   GLU A CA    1 
ATOM   140  C  C     . GLU A 1 17  ? -3.819  15.671  19.278  1.00 30.09  ? 17   GLU A C     1 
ATOM   141  O  O     . GLU A 1 17  ? -3.989  16.422  20.240  1.00 30.28  ? 17   GLU A O     1 
ATOM   142  C  CB    . GLU A 1 17  ? -2.506  16.651  17.402  1.00 29.73  ? 17   GLU A CB    1 
ATOM   143  C  CG    . GLU A 1 17  ? -1.184  16.907  16.722  1.00 32.01  ? 17   GLU A CG    1 
ATOM   144  C  CD    . GLU A 1 17  ? -1.330  17.891  15.579  1.00 34.46  ? 17   GLU A CD    1 
ATOM   145  O  OE1   . GLU A 1 17  ? -2.478  18.290  15.267  1.00 36.70  ? 17   GLU A OE1   1 
ATOM   146  O  OE2   . GLU A 1 17  ? -0.303  18.254  14.977  1.00 35.97  ? 17   GLU A OE2   1 
ATOM   147  N  N     . VAL A 1 18  ? -4.766  14.846  18.831  1.00 30.26  ? 18   VAL A N     1 
ATOM   148  C  CA    . VAL A 1 18  ? -6.052  14.718  19.544  1.00 30.87  ? 18   VAL A CA    1 
ATOM   149  C  C     . VAL A 1 18  ? -5.809  14.195  20.960  1.00 31.21  ? 18   VAL A C     1 
ATOM   150  O  O     . VAL A 1 18  ? -6.352  14.726  21.921  1.00 31.40  ? 18   VAL A O     1 
ATOM   151  C  CB    . VAL A 1 18  ? -7.084  13.832  18.787  1.00 30.92  ? 18   VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 18  ? -8.375  13.668  19.618  1.00 31.59  ? 18   VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 18  ? -7.420  14.450  17.437  1.00 30.61  ? 18   VAL A CG2   1 
ATOM   154  N  N     . LEU A 1 19  ? -4.960  13.176  21.068  1.00 31.50  ? 19   LEU A N     1 
ATOM   155  C  CA    . LEU A 1 19  ? -4.633  12.539  22.337  1.00 32.00  ? 19   LEU A CA    1 
ATOM   156  C  C     . LEU A 1 19  ? -3.810  13.461  23.241  1.00 32.06  ? 19   LEU A C     1 
ATOM   157  O  O     . LEU A 1 19  ? -3.938  13.425  24.474  1.00 31.70  ? 19   LEU A O     1 
ATOM   158  C  CB    . LEU A 1 19  ? -3.894  11.221  22.080  1.00 32.06  ? 19   LEU A CB    1 
ATOM   159  C  CG    . LEU A 1 19  ? -4.656  9.888   22.011  1.00 34.21  ? 19   LEU A CG    1 
ATOM   160  C  CD1   . LEU A 1 19  ? -6.146  10.025  21.676  1.00 36.10  ? 19   LEU A CD1   1 
ATOM   161  C  CD2   . LEU A 1 19  ? -3.964  8.937   21.047  1.00 33.28  ? 19   LEU A CD2   1 
ATOM   162  N  N     . ASN A 1 20  ? -2.977  14.294  22.631  1.00 31.66  ? 20   ASN A N     1 
ATOM   163  C  CA    . ASN A 1 20  ? -2.221  15.293  23.383  1.00 31.75  ? 20   ASN A CA    1 
ATOM   164  C  C     . ASN A 1 20  ? -2.264  16.674  22.725  1.00 31.64  ? 20   ASN A C     1 
ATOM   165  O  O     . ASN A 1 20  ? -1.355  17.027  21.965  1.00 32.52  ? 20   ASN A O     1 
ATOM   166  C  CB    . ASN A 1 20  ? -0.783  14.799  23.611  1.00 31.59  ? 20   ASN A CB    1 
ATOM   167  C  CG    . ASN A 1 20  ? 0.069   15.779  24.411  1.00 31.31  ? 20   ASN A CG    1 
ATOM   168  O  OD1   . ASN A 1 20  ? -0.352  16.895  24.719  1.00 30.13  ? 20   ASN A OD1   1 
ATOM   169  N  ND2   . ASN A 1 20  ? 1.291   15.366  24.723  1.00 29.39  ? 20   ASN A ND2   1 
ATOM   170  N  N     . PRO A 1 21  ? -3.310  17.476  23.021  1.00 31.82  ? 21   PRO A N     1 
ATOM   171  C  CA    . PRO A 1 21  ? -3.516  18.773  22.351  1.00 31.57  ? 21   PRO A CA    1 
ATOM   172  C  C     . PRO A 1 21  ? -2.382  19.794  22.448  1.00 31.42  ? 21   PRO A C     1 
ATOM   173  O  O     . PRO A 1 21  ? -2.345  20.707  21.629  1.00 31.87  ? 21   PRO A O     1 
ATOM   174  C  CB    . PRO A 1 21  ? -4.800  19.314  22.991  1.00 31.58  ? 21   PRO A CB    1 
ATOM   175  C  CG    . PRO A 1 21  ? -5.503  18.103  23.512  1.00 32.01  ? 21   PRO A CG    1 
ATOM   176  C  CD    . PRO A 1 21  ? -4.420  17.161  23.949  1.00 32.19  ? 21   PRO A CD    1 
ATOM   177  N  N     . SER A 1 22  ? -1.466  19.650  23.410  1.00 31.44  ? 22   SER A N     1 
ATOM   178  C  CA    . SER A 1 22  ? -0.297  20.551  23.503  1.00 31.41  ? 22   SER A CA    1 
ATOM   179  C  C     . SER A 1 22  ? 0.631   20.433  22.277  1.00 31.77  ? 22   SER A C     1 
ATOM   180  O  O     . SER A 1 22  ? 1.446   21.320  22.022  1.00 31.82  ? 22   SER A O     1 
ATOM   181  C  CB    . SER A 1 22  ? 0.504   20.314  24.790  1.00 31.08  ? 22   SER A CB    1 
ATOM   182  O  OG    . SER A 1 22  ? 0.981   18.974  24.869  1.00 31.11  ? 22   SER A OG    1 
ATOM   183  N  N     . LEU A 1 23  ? 0.481   19.342  21.525  1.00 31.69  ? 23   LEU A N     1 
ATOM   184  C  CA    . LEU A 1 23  ? 1.272   19.097  20.320  1.00 31.89  ? 23   LEU A CA    1 
ATOM   185  C  C     . LEU A 1 23  ? 0.854   19.964  19.140  1.00 32.04  ? 23   LEU A C     1 
ATOM   186  O  O     . LEU A 1 23  ? 1.669   20.273  18.270  1.00 32.28  ? 23   LEU A O     1 
ATOM   187  C  CB    . LEU A 1 23  ? 1.177   17.625  19.931  1.00 31.50  ? 23   LEU A CB    1 
ATOM   188  C  CG    . LEU A 1 23  ? 2.227   16.616  20.404  1.00 32.54  ? 23   LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1 23  ? 3.035   17.044  21.607  1.00 32.19  ? 23   LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1 23  ? 1.609   15.238  20.614  1.00 32.58  ? 23   LEU A CD2   1 
ATOM   191  N  N     . LYS A 1 24  ? -0.420  20.342  19.104  1.00 32.07  ? 24   LYS A N     1 
ATOM   192  C  CA    . LYS A 1 24  ? -0.994  21.046  17.964  1.00 31.79  ? 24   LYS A CA    1 
ATOM   193  C  C     . LYS A 1 24  ? -0.227  22.317  17.631  1.00 31.18  ? 24   LYS A C     1 
ATOM   194  O  O     . LYS A 1 24  ? 0.146   23.075  18.519  1.00 30.86  ? 24   LYS A O     1 
ATOM   195  C  CB    . LYS A 1 24  ? -2.460  21.380  18.232  1.00 32.32  ? 24   LYS A CB    1 
ATOM   196  C  CG    . LYS A 1 24  ? -3.285  21.576  16.973  1.00 34.39  ? 24   LYS A CG    1 
ATOM   197  C  CD    . LYS A 1 24  ? -4.723  21.945  17.317  1.00 36.51  ? 24   LYS A CD    1 
ATOM   198  C  CE    . LYS A 1 24  ? -5.468  22.393  16.085  1.00 38.06  ? 24   LYS A CE    1 
ATOM   199  N  NZ    . LYS A 1 24  ? -5.537  21.282  15.096  1.00 39.76  ? 24   LYS A NZ    1 
ATOM   200  N  N     . GLY A 1 25  ? 0.021   22.520  16.345  1.00 29.98  ? 25   GLY A N     1 
ATOM   201  C  CA    . GLY A 1 25  ? 0.706   23.717  15.871  1.00 29.07  ? 25   GLY A CA    1 
ATOM   202  C  C     . GLY A 1 25  ? 2.223   23.669  16.000  1.00 27.96  ? 25   GLY A C     1 
ATOM   203  O  O     . GLY A 1 25  ? 2.887   24.648  15.716  1.00 28.09  ? 25   GLY A O     1 
ATOM   204  N  N     . LYS A 1 26  ? 2.766   22.541  16.450  1.00 26.81  ? 26   LYS A N     1 
ATOM   205  C  CA    . LYS A 1 26  ? 4.220   22.359  16.561  1.00 26.09  ? 26   LYS A CA    1 
ATOM   206  C  C     . LYS A 1 26  ? 4.603   21.086  15.804  1.00 24.93  ? 26   LYS A C     1 
ATOM   207  O  O     . LYS A 1 26  ? 3.777   20.204  15.662  1.00 24.22  ? 26   LYS A O     1 
ATOM   208  C  CB    . LYS A 1 26  ? 4.630   22.240  18.033  1.00 26.42  ? 26   LYS A CB    1 
ATOM   209  C  CG    . LYS A 1 26  ? 4.275   23.471  18.903  1.00 29.04  ? 26   LYS A CG    1 
ATOM   210  C  CD    . LYS A 1 26  ? 4.293   23.108  20.381  1.00 33.81  ? 26   LYS A CD    1 
ATOM   211  C  CE    . LYS A 1 26  ? 4.063   24.318  21.266  1.00 35.40  ? 26   LYS A CE    1 
ATOM   212  N  NZ    . LYS A 1 26  ? 3.807   23.854  22.653  1.00 39.57  ? 26   LYS A NZ    1 
ATOM   213  N  N     . PRO A 1 27  ? 5.853   20.985  15.320  1.00 24.19  ? 27   PRO A N     1 
ATOM   214  C  CA    . PRO A 1 27  ? 6.185   19.784  14.537  1.00 23.40  ? 27   PRO A CA    1 
ATOM   215  C  C     . PRO A 1 27  ? 6.076   18.461  15.339  1.00 22.40  ? 27   PRO A C     1 
ATOM   216  O  O     . PRO A 1 27  ? 6.523   18.360  16.499  1.00 22.33  ? 27   PRO A O     1 
ATOM   217  C  CB    . PRO A 1 27  ? 7.624   20.043  14.079  1.00 23.61  ? 27   PRO A CB    1 
ATOM   218  C  CG    . PRO A 1 27  ? 7.789   21.582  14.155  1.00 24.42  ? 27   PRO A CG    1 
ATOM   219  C  CD    . PRO A 1 27  ? 6.980   21.943  15.379  1.00 24.45  ? 27   PRO A CD    1 
ATOM   220  N  N     . VAL A 1 28  ? 5.457   17.472  14.709  1.00 21.64  ? 28   VAL A N     1 
ATOM   221  C  CA    . VAL A 1 28  ? 5.295   16.137  15.274  1.00 20.14  ? 28   VAL A CA    1 
ATOM   222  C  C     . VAL A 1 28  ? 5.696   15.149  14.189  1.00 20.19  ? 28   VAL A C     1 
ATOM   223  O  O     . VAL A 1 28  ? 5.239   15.273  13.051  1.00 18.93  ? 28   VAL A O     1 
ATOM   224  C  CB    . VAL A 1 28  ? 3.817   15.851  15.671  1.00 20.12  ? 28   VAL A CB    1 
ATOM   225  C  CG1   . VAL A 1 28  ? 3.606   14.367  16.042  1.00 19.63  ? 28   VAL A CG1   1 
ATOM   226  C  CG2   . VAL A 1 28  ? 3.391   16.768  16.817  1.00 19.58  ? 28   VAL A CG2   1 
ATOM   227  N  N     . VAL A 1 29  ? 6.525   14.175  14.569  1.00 19.98  ? 29   VAL A N     1 
ATOM   228  C  CA    . VAL A 1 29  ? 6.979   13.125  13.680  1.00 20.62  ? 29   VAL A CA    1 
ATOM   229  C  C     . VAL A 1 29  ? 6.679   11.753  14.285  1.00 21.22  ? 29   VAL A C     1 
ATOM   230  O  O     . VAL A 1 29  ? 7.140   11.431  15.381  1.00 21.37  ? 29   VAL A O     1 
ATOM   231  C  CB    . VAL A 1 29  ? 8.510   13.206  13.447  1.00 20.69  ? 29   VAL A CB    1 
ATOM   232  C  CG1   . VAL A 1 29  ? 8.927   12.133  12.423  1.00 20.20  ? 29   VAL A CG1   1 
ATOM   233  C  CG2   . VAL A 1 29  ? 8.931   14.606  12.985  1.00 18.91  ? 29   VAL A CG2   1 
ATOM   234  N  N     . VAL A 1 30  ? 5.917   10.944  13.567  1.00 21.93  ? 30   VAL A N     1 
ATOM   235  C  CA    . VAL A 1 30  ? 5.597   9.584   14.033  1.00 22.85  ? 30   VAL A CA    1 
ATOM   236  C  C     . VAL A 1 30  ? 6.553   8.588   13.390  1.00 23.61  ? 30   VAL A C     1 
ATOM   237  O  O     . VAL A 1 30  ? 6.713   8.575   12.163  1.00 24.04  ? 30   VAL A O     1 
ATOM   238  C  CB    . VAL A 1 30  ? 4.117   9.248   13.761  1.00 23.07  ? 30   VAL A CB    1 
ATOM   239  C  CG1   . VAL A 1 30  ? 3.766   7.831   14.286  1.00 23.05  ? 30   VAL A CG1   1 
ATOM   240  C  CG2   . VAL A 1 30  ? 3.218   10.307  14.440  1.00 21.43  ? 30   VAL A CG2   1 
ATOM   241  N  N     . CYS A 1 31  ? 7.205   7.781   14.228  1.00 25.05  ? 31   CYS A N     1 
ATOM   242  C  CA    . CYS A 1 31  ? 8.373   7.002   13.834  1.00 26.77  ? 31   CYS A CA    1 
ATOM   243  C  C     . CYS A 1 31  ? 8.198   5.492   13.978  1.00 28.05  ? 31   CYS A C     1 
ATOM   244  O  O     . CYS A 1 31  ? 7.610   5.027   14.962  1.00 28.15  ? 31   CYS A O     1 
ATOM   245  C  CB    . CYS A 1 31  ? 9.552   7.421   14.698  1.00 27.42  ? 31   CYS A CB    1 
ATOM   246  S  SG    . CYS A 1 31  ? 9.875   9.179   14.580  1.00 29.50  ? 31   CYS A SG    1 
ATOM   247  N  N     . VAL A 1 32  ? 8.727   4.743   13.002  1.00 28.41  ? 32   VAL A N     1 
ATOM   248  C  CA    . VAL A 1 32  ? 8.842   3.278   13.109  1.00 29.38  ? 32   VAL A CA    1 
ATOM   249  C  C     . VAL A 1 32  ? 10.275  2.912   13.538  1.00 30.44  ? 32   VAL A C     1 
ATOM   250  O  O     . VAL A 1 32  ? 11.196  2.864   12.722  1.00 30.45  ? 32   VAL A O     1 
ATOM   251  C  CB    . VAL A 1 32  ? 8.454   2.560   11.773  1.00 29.17  ? 32   VAL A CB    1 
ATOM   252  C  CG1   . VAL A 1 32  ? 8.439   1.022   11.944  1.00 29.56  ? 32   VAL A CG1   1 
ATOM   253  C  CG2   . VAL A 1 32  ? 7.079   3.001   11.298  1.00 28.14  ? 32   VAL A CG2   1 
ATOM   254  N  N     . PHE A 1 33  ? 10.470  2.686   14.828  1.00 32.57  ? 33   PHE A N     1 
ATOM   255  C  CA    . PHE A 1 33  ? 11.791  2.314   15.337  1.00 34.97  ? 33   PHE A CA    1 
ATOM   256  C  C     . PHE A 1 33  ? 12.071  0.830   15.074  1.00 36.12  ? 33   PHE A C     1 
ATOM   257  O  O     . PHE A 1 33  ? 11.263  -0.012  15.420  1.00 36.48  ? 33   PHE A O     1 
ATOM   258  C  CB    . PHE A 1 33  ? 11.891  2.634   16.825  1.00 35.01  ? 33   PHE A CB    1 
ATOM   259  C  CG    . PHE A 1 33  ? 11.905  4.110   17.131  1.00 35.64  ? 33   PHE A CG    1 
ATOM   260  C  CD1   . PHE A 1 33  ? 13.088  4.839   17.043  1.00 36.11  ? 33   PHE A CD1   1 
ATOM   261  C  CD2   . PHE A 1 33  ? 10.740  4.765   17.513  1.00 35.09  ? 33   PHE A CD2   1 
ATOM   262  C  CE1   . PHE A 1 33  ? 13.114  6.207   17.335  1.00 37.02  ? 33   PHE A CE1   1 
ATOM   263  C  CE2   . PHE A 1 33  ? 10.749  6.127   17.805  1.00 37.17  ? 33   PHE A CE2   1 
ATOM   264  C  CZ    . PHE A 1 33  ? 11.939  6.854   17.713  1.00 35.73  ? 33   PHE A CZ    1 
ATOM   265  N  N     . SER A 1 34  ? 13.210  0.519   14.460  1.00 37.98  ? 34   SER A N     1 
ATOM   266  C  CA    . SER A 1 34  ? 13.495  -0.857  14.022  1.00 39.80  ? 34   SER A CA    1 
ATOM   267  C  C     . SER A 1 34  ? 14.203  -1.751  15.050  1.00 41.04  ? 34   SER A C     1 
ATOM   268  O  O     . SER A 1 34  ? 14.257  -2.979  14.872  1.00 41.00  ? 34   SER A O     1 
ATOM   269  C  CB    . SER A 1 34  ? 14.264  -0.869  12.689  1.00 39.90  ? 34   SER A CB    1 
ATOM   270  O  OG    . SER A 1 34  ? 15.457  -0.099  12.761  1.00 39.96  ? 34   SER A OG    1 
ATOM   271  N  N     . GLY A 1 35  ? 14.737  -1.153  16.114  1.00 42.16  ? 35   GLY A N     1 
ATOM   272  C  CA    . GLY A 1 35  ? 15.413  -1.927  17.158  1.00 43.60  ? 35   GLY A CA    1 
ATOM   273  C  C     . GLY A 1 35  ? 16.927  -1.957  17.044  1.00 44.70  ? 35   GLY A C     1 
ATOM   274  O  O     . GLY A 1 35  ? 17.618  -1.911  18.058  1.00 45.06  ? 35   GLY A O     1 
ATOM   275  N  N     . ARG A 1 36  ? 17.441  -2.022  15.814  1.00 45.64  ? 36   ARG A N     1 
ATOM   276  C  CA    . ARG A 1 36  ? 18.891  -2.125  15.549  1.00 46.83  ? 36   ARG A CA    1 
ATOM   277  C  C     . ARG A 1 36  ? 19.791  -1.368  16.526  1.00 47.05  ? 36   ARG A C     1 
ATOM   278  O  O     . ARG A 1 36  ? 20.600  -1.982  17.223  1.00 47.45  ? 36   ARG A O     1 
ATOM   279  C  CB    . ARG A 1 36  ? 19.228  -1.677  14.119  1.00 47.18  ? 36   ARG A CB    1 
ATOM   280  C  CG    . ARG A 1 36  ? 18.864  -2.658  13.046  1.00 48.32  ? 36   ARG A CG    1 
ATOM   281  C  CD    . ARG A 1 36  ? 19.809  -3.840  13.046  1.00 51.58  ? 36   ARG A CD    1 
ATOM   282  N  NE    . ARG A 1 36  ? 20.816  -3.758  11.996  1.00 52.81  ? 36   ARG A NE    1 
ATOM   283  C  CZ    . ARG A 1 36  ? 21.386  -4.819  11.432  1.00 54.13  ? 36   ARG A CZ    1 
ATOM   284  N  NH1   . ARG A 1 36  ? 22.296  -4.651  10.480  1.00 54.29  ? 36   ARG A NH1   1 
ATOM   285  N  NH2   . ARG A 1 36  ? 21.043  -6.051  11.808  1.00 54.00  ? 36   ARG A NH2   1 
ATOM   286  N  N     . PHE A 1 37  ? 19.652  -0.040  16.545  1.00 47.31  ? 37   PHE A N     1 
ATOM   287  C  CA    . PHE A 1 37  ? 20.406  0.864   17.426  1.00 47.45  ? 37   PHE A CA    1 
ATOM   288  C  C     . PHE A 1 37  ? 19.562  2.106   17.713  1.00 47.00  ? 37   PHE A C     1 
ATOM   289  O  O     . PHE A 1 37  ? 18.387  2.156   17.334  1.00 46.87  ? 37   PHE A O     1 
ATOM   290  C  CB    . PHE A 1 37  ? 21.752  1.264   16.800  1.00 48.05  ? 37   PHE A CB    1 
ATOM   291  C  CG    . PHE A 1 37  ? 21.651  1.693   15.365  1.00 49.97  ? 37   PHE A CG    1 
ATOM   292  C  CD1   . PHE A 1 37  ? 21.265  2.992   15.035  1.00 51.72  ? 37   PHE A CD1   1 
ATOM   293  C  CD2   . PHE A 1 37  ? 21.926  0.789   14.337  1.00 51.96  ? 37   PHE A CD2   1 
ATOM   294  C  CE1   . PHE A 1 37  ? 21.155  3.389   13.703  1.00 52.46  ? 37   PHE A CE1   1 
ATOM   295  C  CE2   . PHE A 1 37  ? 21.817  1.172   13.000  1.00 52.88  ? 37   PHE A CE2   1 
ATOM   296  C  CZ    . PHE A 1 37  ? 21.432  2.477   12.685  1.00 52.92  ? 37   PHE A CZ    1 
ATOM   297  N  N     . GLU A 1 38  ? 20.159  3.102   18.369  1.00 46.51  ? 38   GLU A N     1 
ATOM   298  C  CA    . GLU A 1 38  ? 19.436  4.311   18.760  1.00 46.18  ? 38   GLU A CA    1 
ATOM   299  C  C     . GLU A 1 38  ? 18.971  5.127   17.556  1.00 45.49  ? 38   GLU A C     1 
ATOM   300  O  O     . GLU A 1 38  ? 19.785  5.525   16.720  1.00 45.66  ? 38   GLU A O     1 
ATOM   301  C  CB    . GLU A 1 38  ? 20.272  5.196   19.690  1.00 46.21  ? 38   GLU A CB    1 
ATOM   302  C  CG    . GLU A 1 38  ? 19.606  6.555   19.968  1.00 47.51  ? 38   GLU A CG    1 
ATOM   303  C  CD    . GLU A 1 38  ? 20.297  7.375   21.040  1.00 48.99  ? 38   GLU A CD    1 
ATOM   304  O  OE1   . GLU A 1 38  ? 20.488  8.593   20.819  1.00 49.69  ? 38   GLU A OE1   1 
ATOM   305  O  OE2   . GLU A 1 38  ? 20.639  6.813   22.106  1.00 50.16  ? 38   GLU A OE2   1 
ATOM   306  N  N     . ASP A 1 39  ? 17.664  5.384   17.497  1.00 44.42  ? 39   ASP A N     1 
ATOM   307  C  CA    . ASP A 1 39  ? 17.032  6.133   16.392  1.00 43.41  ? 39   ASP A CA    1 
ATOM   308  C  C     . ASP A 1 39  ? 17.081  5.416   15.036  1.00 42.16  ? 39   ASP A C     1 
ATOM   309  O  O     . ASP A 1 39  ? 16.925  6.054   13.989  1.00 42.49  ? 39   ASP A O     1 
ATOM   310  C  CB    . ASP A 1 39  ? 17.626  7.551   16.256  1.00 43.54  ? 39   ASP A CB    1 
ATOM   311  C  CG    . ASP A 1 39  ? 17.258  8.470   17.420  1.00 44.55  ? 39   ASP A CG    1 
ATOM   312  O  OD1   . ASP A 1 39  ? 16.232  8.231   18.102  1.00 44.44  ? 39   ASP A OD1   1 
ATOM   313  O  OD2   . ASP A 1 39  ? 18.002  9.452   17.643  1.00 45.31  ? 39   ASP A OD2   1 
ATOM   314  N  N     . SER A 1 40  ? 17.302  4.105   15.033  1.00 40.47  ? 40   SER A N     1 
ATOM   315  C  CA    . SER A 1 40  ? 17.260  3.368   13.766  1.00 38.47  ? 40   SER A CA    1 
ATOM   316  C  C     . SER A 1 40  ? 15.808  3.157   13.334  1.00 36.59  ? 40   SER A C     1 
ATOM   317  O  O     . SER A 1 40  ? 14.916  2.954   14.164  1.00 36.02  ? 40   SER A O     1 
ATOM   318  C  CB    . SER A 1 40  ? 18.037  2.050   13.848  1.00 38.91  ? 40   SER A CB    1 
ATOM   319  O  OG    . SER A 1 40  ? 17.257  1.001   14.387  1.00 40.38  ? 40   SER A OG    1 
ATOM   320  N  N     . GLY A 1 41  ? 15.571  3.241   12.030  1.00 34.45  ? 41   GLY A N     1 
ATOM   321  C  CA    . GLY A 1 41  ? 14.217  3.122   11.503  1.00 32.10  ? 41   GLY A CA    1 
ATOM   322  C  C     . GLY A 1 41  ? 13.800  4.272   10.605  1.00 30.37  ? 41   GLY A C     1 
ATOM   323  O  O     . GLY A 1 41  ? 14.635  5.057   10.151  1.00 30.33  ? 41   GLY A O     1 
ATOM   324  N  N     . ALA A 1 42  ? 12.498  4.368   10.359  1.00 28.43  ? 42   ALA A N     1 
ATOM   325  C  CA    . ALA A 1 42  ? 11.985  5.324   9.407   1.00 26.91  ? 42   ALA A CA    1 
ATOM   326  C  C     . ALA A 1 42  ? 10.743  6.058   9.917   1.00 26.07  ? 42   ALA A C     1 
ATOM   327  O  O     . ALA A 1 42  ? 10.081  5.612   10.840  1.00 26.22  ? 42   ALA A O     1 
ATOM   328  C  CB    . ALA A 1 42  ? 11.694  4.634   8.068   1.00 26.49  ? 42   ALA A CB    1 
ATOM   329  N  N     . VAL A 1 43  ? 10.421  7.165   9.261   1.00 24.99  ? 43   VAL A N     1 
ATOM   330  C  CA    . VAL A 1 43  ? 9.252   7.964   9.601   1.00 23.60  ? 43   VAL A CA    1 
ATOM   331  C  C     . VAL A 1 43  ? 8.006   7.387   8.938   1.00 22.85  ? 43   VAL A C     1 
ATOM   332  O  O     . VAL A 1 43  ? 8.024   7.116   7.745   1.00 22.77  ? 43   VAL A O     1 
ATOM   333  C  CB    . VAL A 1 43  ? 9.463   9.436   9.122   1.00 23.28  ? 43   VAL A CB    1 
ATOM   334  C  CG1   . VAL A 1 43  ? 8.167   10.240  9.223   1.00 22.67  ? 43   VAL A CG1   1 
ATOM   335  C  CG2   . VAL A 1 43  ? 10.592  10.119  9.910   1.00 24.35  ? 43   VAL A CG2   1 
ATOM   336  N  N     . ALA A 1 44  ? 6.917   7.237   9.693   1.00 22.53  ? 44   ALA A N     1 
ATOM   337  C  CA    . ALA A 1 44  ? 5.644   6.807   9.113   1.00 22.64  ? 44   ALA A CA    1 
ATOM   338  C  C     . ALA A 1 44  ? 4.886   7.997   8.516   1.00 22.33  ? 44   ALA A C     1 
ATOM   339  O  O     . ALA A 1 44  ? 4.288   7.885   7.432   1.00 21.72  ? 44   ALA A O     1 
ATOM   340  C  CB    . ALA A 1 44  ? 4.758   6.068   10.165  1.00 22.70  ? 44   ALA A CB    1 
ATOM   341  N  N     . THR A 1 45  ? 4.857   9.107   9.261   1.00 21.16  ? 45   THR A N     1 
ATOM   342  C  CA    . THR A 1 45  ? 4.296   10.372  8.755   1.00 21.03  ? 45   THR A CA    1 
ATOM   343  C  C     . THR A 1 45  ? 4.691   11.526  9.667   1.00 20.69  ? 45   THR A C     1 
ATOM   344  O  O     . THR A 1 45  ? 5.323   11.310  10.698  1.00 19.79  ? 45   THR A O     1 
ATOM   345  C  CB    . THR A 1 45  ? 2.740   10.363  8.625   1.00 21.15  ? 45   THR A CB    1 
ATOM   346  O  OG1   . THR A 1 45  ? 2.342   11.523  7.888   1.00 21.69  ? 45   THR A OG1   1 
ATOM   347  C  CG2   . THR A 1 45  ? 2.062   10.407  9.983   1.00 20.56  ? 45   THR A CG2   1 
ATOM   348  N  N     . ALA A 1 46  ? 4.310   12.746  9.285   1.00 20.02  ? 46   ALA A N     1 
ATOM   349  C  CA    . ALA A 1 46  ? 4.561   13.894  10.152  1.00 20.83  ? 46   ALA A CA    1 
ATOM   350  C  C     . ALA A 1 46  ? 3.495   14.920  9.869   1.00 20.20  ? 46   ALA A C     1 
ATOM   351  O  O     . ALA A 1 46  ? 2.929   14.938  8.770   1.00 19.84  ? 46   ALA A O     1 
ATOM   352  C  CB    . ALA A 1 46  ? 5.954   14.479  9.896   1.00 20.85  ? 46   ALA A CB    1 
ATOM   353  N  N     . ASN A 1 47  ? 3.216   15.781  10.843  1.00 19.51  ? 47   ASN A N     1 
ATOM   354  C  CA    . ASN A 1 47  ? 2.226   16.830  10.604  1.00 19.59  ? 47   ASN A CA    1 
ATOM   355  C  C     . ASN A 1 47  ? 2.784   17.849  9.627   1.00 19.56  ? 47   ASN A C     1 
ATOM   356  O  O     . ASN A 1 47  ? 3.961   17.761  9.216   1.00 18.86  ? 47   ASN A O     1 
ATOM   357  C  CB    . ASN A 1 47  ? 1.680   17.481  11.908  1.00 19.42  ? 47   ASN A CB    1 
ATOM   358  C  CG    . ASN A 1 47  ? 2.750   18.214  12.704  1.00 19.49  ? 47   ASN A CG    1 
ATOM   359  O  OD1   . ASN A 1 47  ? 3.841   18.476  12.215  1.00 17.26  ? 47   ASN A OD1   1 
ATOM   360  N  ND2   . ASN A 1 47  ? 2.430   18.540  13.957  1.00 19.70  ? 47   ASN A ND2   1 
ATOM   361  N  N     . TYR A 1 48  ? 1.946   18.803  9.235   1.00 19.40  ? 48   TYR A N     1 
ATOM   362  C  CA    . TYR A 1 48  ? 2.350   19.754  8.216   1.00 20.66  ? 48   TYR A CA    1 
ATOM   363  C  C     . TYR A 1 48  ? 3.438   20.704  8.691   1.00 21.08  ? 48   TYR A C     1 
ATOM   364  O  O     . TYR A 1 48  ? 4.268   21.143  7.887   1.00 22.01  ? 48   TYR A O     1 
ATOM   365  C  CB    . TYR A 1 48  ? 1.123   20.469  7.637   1.00 21.99  ? 48   TYR A CB    1 
ATOM   366  C  CG    . TYR A 1 48  ? 0.432   19.603  6.612   1.00 23.19  ? 48   TYR A CG    1 
ATOM   367  C  CD1   . TYR A 1 48  ? -0.388  18.539  7.003   1.00 26.64  ? 48   TYR A CD1   1 
ATOM   368  C  CD2   . TYR A 1 48  ? 0.631   19.816  5.239   1.00 28.73  ? 48   TYR A CD2   1 
ATOM   369  C  CE1   . TYR A 1 48  ? -1.024  17.711  6.055   1.00 26.12  ? 48   TYR A CE1   1 
ATOM   370  C  CE2   . TYR A 1 48  ? -0.011  18.992  4.277   1.00 30.25  ? 48   TYR A CE2   1 
ATOM   371  C  CZ    . TYR A 1 48  ? -0.827  17.937  4.705   1.00 28.60  ? 48   TYR A CZ    1 
ATOM   372  O  OH    . TYR A 1 48  ? -1.459  17.121  3.772   1.00 29.59  ? 48   TYR A OH    1 
ATOM   373  N  N     . GLU A 1 49  ? 3.454   21.013  9.986   1.00 20.31  ? 49   GLU A N     1 
ATOM   374  C  CA    . GLU A 1 49  ? 4.524   21.834  10.551  1.00 21.01  ? 49   GLU A CA    1 
ATOM   375  C  C     . GLU A 1 49  ? 5.902   21.191  10.345  1.00 20.30  ? 49   GLU A C     1 
ATOM   376  O  O     . GLU A 1 49  ? 6.859   21.858  9.969   1.00 20.42  ? 49   GLU A O     1 
ATOM   377  C  CB    . GLU A 1 49  ? 4.285   22.061  12.040  1.00 21.31  ? 49   GLU A CB    1 
ATOM   378  C  CG    . GLU A 1 49  ? 3.179   23.050  12.338  1.00 26.68  ? 49   GLU A CG    1 
ATOM   379  C  CD    . GLU A 1 49  ? 1.756   22.465  12.226  1.00 32.20  ? 49   GLU A CD    1 
ATOM   380  O  OE1   . GLU A 1 49  ? 1.560   21.230  11.976  1.00 31.84  ? 49   GLU A OE1   1 
ATOM   381  O  OE2   . GLU A 1 49  ? 0.819   23.280  12.382  1.00 34.54  ? 49   GLU A OE2   1 
ATOM   382  N  N     . ALA A 1 50  ? 6.001   19.892  10.598  1.00 19.00  ? 50   ALA A N     1 
ATOM   383  C  CA    . ALA A 1 50  ? 7.244   19.142  10.357  1.00 19.50  ? 50   ALA A CA    1 
ATOM   384  C  C     . ALA A 1 50  ? 7.624   19.038  8.875   1.00 19.94  ? 50   ALA A C     1 
ATOM   385  O  O     . ALA A 1 50  ? 8.817   19.053  8.529   1.00 19.78  ? 50   ALA A O     1 
ATOM   386  C  CB    . ALA A 1 50  ? 7.140   17.721  10.988  1.00 18.97  ? 50   ALA A CB    1 
ATOM   387  N  N     . ARG A 1 51  ? 6.620   18.961  8.000   1.00 20.71  ? 51   ARG A N     1 
ATOM   388  C  CA    . ARG A 1 51  ? 6.866   18.780  6.564   1.00 22.19  ? 51   ARG A CA    1 
ATOM   389  C  C     . ARG A 1 51  ? 7.487   20.002  5.916   1.00 23.02  ? 51   ARG A C     1 
ATOM   390  O  O     . ARG A 1 51  ? 8.168   19.872  4.898   1.00 23.05  ? 51   ARG A O     1 
ATOM   391  C  CB    . ARG A 1 51  ? 5.603   18.399  5.802   1.00 21.65  ? 51   ARG A CB    1 
ATOM   392  C  CG    . ARG A 1 51  ? 5.044   17.034  6.196   1.00 22.39  ? 51   ARG A CG    1 
ATOM   393  C  CD    . ARG A 1 51  ? 3.780   16.709  5.399   1.00 22.32  ? 51   ARG A CD    1 
ATOM   394  N  NE    . ARG A 1 51  ? 2.992   15.686  6.095   1.00 22.84  ? 51   ARG A NE    1 
ATOM   395  C  CZ    . ARG A 1 51  ? 1.931   15.076  5.596   1.00 22.26  ? 51   ARG A CZ    1 
ATOM   396  N  NH1   . ARG A 1 51  ? 1.516   15.341  4.351   1.00 23.19  ? 51   ARG A NH1   1 
ATOM   397  N  NH2   . ARG A 1 51  ? 1.301   14.172  6.343   1.00 23.36  ? 51   ARG A NH2   1 
ATOM   398  N  N     A LYS A 1 52  ? 7.261   21.177  6.500   0.50 23.29  ? 52   LYS A N     1 
ATOM   399  N  N     B LYS A 1 52  ? 7.246   21.177  6.496   0.50 23.23  ? 52   LYS A N     1 
ATOM   400  C  CA    A LYS A 1 52  ? 7.880   22.411  5.997   0.50 23.76  ? 52   LYS A CA    1 
ATOM   401  C  CA    B LYS A 1 52  ? 7.885   22.415  6.030   0.50 23.68  ? 52   LYS A CA    1 
ATOM   402  C  C     A LYS A 1 52  ? 9.405   22.384  6.112   0.50 24.02  ? 52   LYS A C     1 
ATOM   403  C  C     B LYS A 1 52  ? 9.400   22.233  5.954   0.50 23.96  ? 52   LYS A C     1 
ATOM   404  O  O     A LYS A 1 52  ? 10.089  23.212  5.509   0.50 23.73  ? 52   LYS A O     1 
ATOM   405  O  O     B LYS A 1 52  ? 10.062  22.791  5.067   0.50 23.49  ? 52   LYS A O     1 
ATOM   406  C  CB    A LYS A 1 52  ? 7.322   23.642  6.714   0.50 24.18  ? 52   LYS A CB    1 
ATOM   407  C  CB    B LYS A 1 52  ? 7.566   23.585  6.971   0.50 23.97  ? 52   LYS A CB    1 
ATOM   408  C  CG    A LYS A 1 52  ? 5.933   24.053  6.256   0.50 24.35  ? 52   LYS A CG    1 
ATOM   409  C  CG    B LYS A 1 52  ? 6.094   23.978  7.045   0.50 24.33  ? 52   LYS A CG    1 
ATOM   410  C  CD    A LYS A 1 52  ? 5.560   25.399  6.842   0.50 27.11  ? 52   LYS A CD    1 
ATOM   411  C  CD    B LYS A 1 52  ? 5.916   25.127  8.022   0.50 26.90  ? 52   LYS A CD    1 
ATOM   412  C  CE    A LYS A 1 52  ? 4.045   25.542  7.008   0.50 28.23  ? 52   LYS A CE    1 
ATOM   413  C  CE    B LYS A 1 52  ? 4.449   25.544  8.196   0.50 27.57  ? 52   LYS A CE    1 
ATOM   414  N  NZ    A LYS A 1 52  ? 3.365   25.759  5.712   0.50 29.38  ? 52   LYS A NZ    1 
ATOM   415  N  NZ    B LYS A 1 52  ? 4.194   26.147  9.539   0.50 25.72  ? 52   LYS A NZ    1 
ATOM   416  N  N     . PHE A 1 53  ? 9.924   21.421  6.871   1.00 24.00  ? 53   PHE A N     1 
ATOM   417  C  CA    . PHE A 1 53  ? 11.379  21.242  7.056   1.00 24.78  ? 53   PHE A CA    1 
ATOM   418  C  C     . PHE A 1 53  ? 11.920  19.999  6.369   1.00 25.26  ? 53   PHE A C     1 
ATOM   419  O  O     . PHE A 1 53  ? 13.080  19.630  6.576   1.00 25.50  ? 53   PHE A O     1 
ATOM   420  C  CB    . PHE A 1 53  ? 11.723  21.227  8.563   1.00 25.14  ? 53   PHE A CB    1 
ATOM   421  C  CG    . PHE A 1 53  ? 11.419  22.516  9.249   1.00 25.36  ? 53   PHE A CG    1 
ATOM   422  C  CD1   . PHE A 1 53  ? 12.333  23.566  9.216   1.00 25.75  ? 53   PHE A CD1   1 
ATOM   423  C  CD2   . PHE A 1 53  ? 10.208  22.700  9.901   1.00 25.31  ? 53   PHE A CD2   1 
ATOM   424  C  CE1   . PHE A 1 53  ? 12.054  24.780  9.827   1.00 25.66  ? 53   PHE A CE1   1 
ATOM   425  C  CE2   . PHE A 1 53  ? 9.914   23.899  10.521  1.00 24.83  ? 53   PHE A CE2   1 
ATOM   426  C  CZ    . PHE A 1 53  ? 10.843  24.947  10.489  1.00 27.41  ? 53   PHE A CZ    1 
ATOM   427  N  N     . GLY A 1 54  ? 11.075  19.366  5.546   1.00 25.12  ? 54   GLY A N     1 
ATOM   428  C  CA    . GLY A 1 54  ? 11.461  18.249  4.688   1.00 24.84  ? 54   GLY A CA    1 
ATOM   429  C  C     . GLY A 1 54  ? 11.239  16.871  5.312   1.00 25.56  ? 54   GLY A C     1 
ATOM   430  O  O     . GLY A 1 54  ? 11.662  15.870  4.761   1.00 24.63  ? 54   GLY A O     1 
ATOM   431  N  N     . VAL A 1 55  ? 10.596  16.818  6.477   1.00 25.94  ? 55   VAL A N     1 
ATOM   432  C  CA    . VAL A 1 55  ? 10.348  15.544  7.136   1.00 26.74  ? 55   VAL A CA    1 
ATOM   433  C  C     . VAL A 1 55  ? 9.058   14.970  6.601   1.00 28.39  ? 55   VAL A C     1 
ATOM   434  O  O     . VAL A 1 55  ? 7.989   15.573  6.756   1.00 29.29  ? 55   VAL A O     1 
ATOM   435  C  CB    . VAL A 1 55  ? 10.261  15.683  8.665   1.00 27.06  ? 55   VAL A CB    1 
ATOM   436  C  CG1   . VAL A 1 55  ? 10.143  14.314  9.319   1.00 27.11  ? 55   VAL A CG1   1 
ATOM   437  C  CG2   . VAL A 1 55  ? 11.485  16.413  9.192   1.00 25.48  ? 55   VAL A CG2   1 
ATOM   438  N  N     . LYS A 1 56  ? 9.168   13.804  5.971   1.00 28.62  ? 56   LYS A N     1 
ATOM   439  C  CA    . LYS A 1 56  ? 8.018   13.106  5.397   1.00 29.54  ? 56   LYS A CA    1 
ATOM   440  C  C     . LYS A 1 56  ? 8.137   11.578  5.555   1.00 28.84  ? 56   LYS A C     1 
ATOM   441  O  O     . LYS A 1 56  ? 9.191   11.062  5.943   1.00 27.25  ? 56   LYS A O     1 
ATOM   442  C  CB    . LYS A 1 56  ? 7.875   13.469  3.919   1.00 30.07  ? 56   LYS A CB    1 
ATOM   443  C  CG    . LYS A 1 56  ? 9.079   13.108  3.073   1.00 33.04  ? 56   LYS A CG    1 
ATOM   444  C  CD    . LYS A 1 56  ? 9.229   14.064  1.884   1.00 38.29  ? 56   LYS A CD    1 
ATOM   445  C  CE    . LYS A 1 56  ? 9.991   13.415  0.724   1.00 41.78  ? 56   LYS A CE    1 
ATOM   446  N  NZ    . LYS A 1 56  ? 11.373  12.942  1.101   1.00 44.15  ? 56   LYS A NZ    1 
ATOM   447  N  N     . ALA A 1 57  ? 7.047   10.881  5.232   1.00 28.42  ? 57   ALA A N     1 
ATOM   448  C  CA    . ALA A 1 57  ? 6.978   9.426   5.302   1.00 29.11  ? 57   ALA A CA    1 
ATOM   449  C  C     . ALA A 1 57  ? 8.185   8.761   4.616   1.00 28.89  ? 57   ALA A C     1 
ATOM   450  O  O     . ALA A 1 57  ? 8.582   9.158   3.533   1.00 28.87  ? 57   ALA A O     1 
ATOM   451  C  CB    . ALA A 1 57  ? 5.642   8.942   4.687   1.00 28.70  ? 57   ALA A CB    1 
ATOM   452  N  N     . GLY A 1 58  ? 8.807   7.797   5.285   1.00 29.73  ? 58   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 58  ? 9.850   6.986   4.658   1.00 30.19  ? 58   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 58  ? 11.295  7.397   4.849   1.00 30.79  ? 58   GLY A C     1 
ATOM   455  O  O     . GLY A 1 58  ? 12.205  6.576   4.664   1.00 31.51  ? 58   GLY A O     1 
ATOM   456  N  N     . ILE A 1 59  ? 11.557  8.649   5.203   1.00 30.35  ? 59   ILE A N     1 
ATOM   457  C  CA    . ILE A 1 59  ? 12.958  8.998   5.455   1.00 29.98  ? 59   ILE A CA    1 
ATOM   458  C  C     . ILE A 1 59  ? 13.463  8.385   6.775   1.00 29.76  ? 59   ILE A C     1 
ATOM   459  O  O     . ILE A 1 59  ? 12.657  8.105   7.677   1.00 29.12  ? 59   ILE A O     1 
ATOM   460  C  CB    . ILE A 1 59  ? 13.248  10.519  5.364   1.00 30.47  ? 59   ILE A CB    1 
ATOM   461  C  CG1   . ILE A 1 59  ? 12.610  11.286  6.529   1.00 30.21  ? 59   ILE A CG1   1 
ATOM   462  C  CG2   . ILE A 1 59  ? 12.840  11.070  3.976   1.00 30.80  ? 59   ILE A CG2   1 
ATOM   463  C  CD1   . ILE A 1 59  ? 13.097  12.767  6.598   1.00 33.12  ? 59   ILE A CD1   1 
ATOM   464  N  N     . PRO A 1 60  ? 14.788  8.140   6.867   1.00 29.09  ? 60   PRO A N     1 
ATOM   465  C  CA    . PRO A 1 60  ? 15.382  7.617   8.092   1.00 29.27  ? 60   PRO A CA    1 
ATOM   466  C  C     . PRO A 1 60  ? 15.179  8.602   9.239   1.00 29.07  ? 60   PRO A C     1 
ATOM   467  O  O     . PRO A 1 60  ? 15.267  9.825   9.029   1.00 28.73  ? 60   PRO A O     1 
ATOM   468  C  CB    . PRO A 1 60  ? 16.880  7.497   7.753   1.00 29.10  ? 60   PRO A CB    1 
ATOM   469  C  CG    . PRO A 1 60  ? 16.968  7.568   6.260   1.00 29.82  ? 60   PRO A CG    1 
ATOM   470  C  CD    . PRO A 1 60  ? 15.801  8.401   5.825   1.00 29.42  ? 60   PRO A CD    1 
ATOM   471  N  N     . ILE A 1 61  ? 14.891  8.070   10.425  1.00 28.89  ? 61   ILE A N     1 
ATOM   472  C  CA    . ILE A 1 61  ? 14.731  8.893   11.622  1.00 29.23  ? 61   ILE A CA    1 
ATOM   473  C  C     . ILE A 1 61  ? 15.954  9.773   11.848  1.00 29.78  ? 61   ILE A C     1 
ATOM   474  O  O     . ILE A 1 61  ? 15.826  10.987  12.042  1.00 29.10  ? 61   ILE A O     1 
ATOM   475  C  CB    . ILE A 1 61  ? 14.428  8.037   12.870  1.00 28.53  ? 61   ILE A CB    1 
ATOM   476  C  CG1   . ILE A 1 61  ? 13.069  7.353   12.706  1.00 29.67  ? 61   ILE A CG1   1 
ATOM   477  C  CG2   . ILE A 1 61  ? 14.465  8.882   14.134  1.00 28.06  ? 61   ILE A CG2   1 
ATOM   478  C  CD1   . ILE A 1 61  ? 12.852  6.147   13.628  1.00 30.61  ? 61   ILE A CD1   1 
ATOM   479  N  N     . VAL A 1 62  ? 17.137  9.163   11.791  1.00 30.78  ? 62   VAL A N     1 
ATOM   480  C  CA    . VAL A 1 62  ? 18.408  9.895   11.987  1.00 31.18  ? 62   VAL A CA    1 
ATOM   481  C  C     . VAL A 1 62  ? 18.505  11.088  11.038  1.00 31.13  ? 62   VAL A C     1 
ATOM   482  O  O     . VAL A 1 62  ? 19.050  12.149  11.392  1.00 30.69  ? 62   VAL A O     1 
ATOM   483  C  CB    . VAL A 1 62  ? 19.653  8.961   11.834  1.00 31.15  ? 62   VAL A CB    1 
ATOM   484  C  CG1   . VAL A 1 62  ? 20.964  9.730   12.018  1.00 32.26  ? 62   VAL A CG1   1 
ATOM   485  C  CG2   . VAL A 1 62  ? 19.587  7.840   12.841  1.00 32.70  ? 62   VAL A CG2   1 
ATOM   486  N  N     . GLU A 1 63  ? 17.965  10.921  9.835   1.00 30.61  ? 63   GLU A N     1 
ATOM   487  C  CA    . GLU A 1 63  ? 18.000  11.986  8.846   1.00 31.17  ? 63   GLU A CA    1 
ATOM   488  C  C     . GLU A 1 63  ? 17.027  13.132  9.180   1.00 30.02  ? 63   GLU A C     1 
ATOM   489  O  O     . GLU A 1 63  ? 17.389  14.319  9.072   1.00 29.53  ? 63   GLU A O     1 
ATOM   490  C  CB    . GLU A 1 63  ? 17.718  11.426  7.449   1.00 32.04  ? 63   GLU A CB    1 
ATOM   491  C  CG    . GLU A 1 63  ? 18.685  11.952  6.400   1.00 37.24  ? 63   GLU A CG    1 
ATOM   492  C  CD    . GLU A 1 63  ? 18.294  13.314  5.863   1.00 42.53  ? 63   GLU A CD    1 
ATOM   493  O  OE1   . GLU A 1 63  ? 17.126  13.460  5.442   1.00 45.96  ? 63   GLU A OE1   1 
ATOM   494  O  OE2   . GLU A 1 63  ? 19.157  14.228  5.843   1.00 44.22  ? 63   GLU A OE2   1 
ATOM   495  N  N     . ALA A 1 64  ? 15.808  12.766  9.583   1.00 28.37  ? 64   ALA A N     1 
ATOM   496  C  CA    . ALA A 1 64  ? 14.786  13.720  10.020  1.00 27.82  ? 64   ALA A CA    1 
ATOM   497  C  C     . ALA A 1 64  ? 15.321  14.592  11.161  1.00 27.99  ? 64   ALA A C     1 
ATOM   498  O  O     . ALA A 1 64  ? 15.031  15.783  11.238  1.00 27.28  ? 64   ALA A O     1 
ATOM   499  C  CB    . ALA A 1 64  ? 13.520  12.968  10.469  1.00 27.23  ? 64   ALA A CB    1 
ATOM   500  N  N     . LYS A 1 65  ? 16.116  13.984  12.035  1.00 28.32  ? 65   LYS A N     1 
ATOM   501  C  CA    . LYS A 1 65  ? 16.695  14.702  13.171  1.00 29.55  ? 65   LYS A CA    1 
ATOM   502  C  C     . LYS A 1 65  ? 17.799  15.695  12.781  1.00 29.75  ? 65   LYS A C     1 
ATOM   503  O  O     . LYS A 1 65  ? 18.066  16.645  13.522  1.00 29.85  ? 65   LYS A O     1 
ATOM   504  C  CB    . LYS A 1 65  ? 17.152  13.707  14.233  1.00 29.51  ? 65   LYS A CB    1 
ATOM   505  C  CG    . LYS A 1 65  ? 15.972  13.105  14.964  1.00 30.87  ? 65   LYS A CG    1 
ATOM   506  C  CD    . LYS A 1 65  ? 16.345  11.859  15.708  1.00 33.54  ? 65   LYS A CD    1 
ATOM   507  C  CE    . LYS A 1 65  ? 15.295  11.521  16.745  1.00 35.48  ? 65   LYS A CE    1 
ATOM   508  N  NZ    . LYS A 1 65  ? 15.215  12.554  17.830  1.00 35.61  ? 65   LYS A NZ    1 
ATOM   509  N  N     . LYS A 1 66  ? 18.399  15.498  11.604  1.00 29.52  ? 66   LYS A N     1 
ATOM   510  C  CA    . LYS A 1 66  ? 19.380  16.437  11.056  1.00 29.42  ? 66   LYS A CA    1 
ATOM   511  C  C     . LYS A 1 66  ? 18.733  17.685  10.461  1.00 28.43  ? 66   LYS A C     1 
ATOM   512  O  O     . LYS A 1 66  ? 19.305  18.783  10.505  1.00 28.20  ? 66   LYS A O     1 
ATOM   513  C  CB    . LYS A 1 66  ? 20.286  15.747  10.019  1.00 29.67  ? 66   LYS A CB    1 
ATOM   514  C  CG    . LYS A 1 66  ? 21.555  15.149  10.624  1.00 32.25  ? 66   LYS A CG    1 
ATOM   515  C  CD    . LYS A 1 66  ? 22.006  13.886  9.897   1.00 36.58  ? 66   LYS A CD    1 
ATOM   516  C  CE    . LYS A 1 66  ? 23.254  13.279  10.562  1.00 38.72  ? 66   LYS A CE    1 
ATOM   517  N  NZ    . LYS A 1 66  ? 23.356  11.801  10.274  1.00 40.25  ? 66   LYS A NZ    1 
ATOM   518  N  N     . ILE A 1 67  ? 17.554  17.531  9.884   1.00 27.03  ? 67   ILE A N     1 
ATOM   519  C  CA    . ILE A 1 67  ? 16.867  18.694  9.349   1.00 26.63  ? 67   ILE A CA    1 
ATOM   520  C  C     . ILE A 1 67  ? 15.891  19.300  10.361  1.00 25.88  ? 67   ILE A C     1 
ATOM   521  O  O     . ILE A 1 67  ? 15.534  20.484  10.257  1.00 25.34  ? 67   ILE A O     1 
ATOM   522  C  CB    . ILE A 1 67  ? 16.191  18.413  7.980   1.00 26.80  ? 67   ILE A CB    1 
ATOM   523  C  CG1   . ILE A 1 67  ? 15.197  17.248  8.077   1.00 27.53  ? 67   ILE A CG1   1 
ATOM   524  C  CG2   . ILE A 1 67  ? 17.271  18.157  6.902   1.00 28.02  ? 67   ILE A CG2   1 
ATOM   525  C  CD1   . ILE A 1 67  ? 14.647  16.776  6.738   1.00 28.39  ? 67   ILE A CD1   1 
ATOM   526  N  N     . LEU A 1 68  ? 15.458  18.484  11.324  1.00 24.65  ? 68   LEU A N     1 
ATOM   527  C  CA    . LEU A 1 68  ? 14.477  18.922  12.308  1.00 24.34  ? 68   LEU A CA    1 
ATOM   528  C  C     . LEU A 1 68  ? 14.749  18.340  13.693  1.00 23.43  ? 68   LEU A C     1 
ATOM   529  O  O     . LEU A 1 68  ? 13.974  17.487  14.162  1.00 22.80  ? 68   LEU A O     1 
ATOM   530  C  CB    . LEU A 1 68  ? 13.068  18.496  11.884  1.00 24.43  ? 68   LEU A CB    1 
ATOM   531  C  CG    . LEU A 1 68  ? 11.905  19.485  11.845  1.00 25.96  ? 68   LEU A CG    1 
ATOM   532  C  CD1   . LEU A 1 68  ? 10.575  18.766  12.050  1.00 25.92  ? 68   LEU A CD1   1 
ATOM   533  C  CD2   . LEU A 1 68  ? 12.050  20.703  12.752  1.00 24.64  ? 68   LEU A CD2   1 
ATOM   534  N  N     . PRO A 1 69  ? 15.835  18.772  14.359  1.00 22.98  ? 69   PRO A N     1 
ATOM   535  C  CA    . PRO A 1 69  ? 15.942  18.249  15.729  1.00 23.18  ? 69   PRO A CA    1 
ATOM   536  C  C     . PRO A 1 69  ? 14.797  18.682  16.685  1.00 23.00  ? 69   PRO A C     1 
ATOM   537  O  O     . PRO A 1 69  ? 14.452  17.932  17.594  1.00 21.62  ? 69   PRO A O     1 
ATOM   538  C  CB    . PRO A 1 69  ? 17.293  18.782  16.228  1.00 23.11  ? 69   PRO A CB    1 
ATOM   539  C  CG    . PRO A 1 69  ? 17.708  19.849  15.271  1.00 23.33  ? 69   PRO A CG    1 
ATOM   540  C  CD    . PRO A 1 69  ? 16.988  19.609  13.973  1.00 23.25  ? 69   PRO A CD    1 
ATOM   541  N  N     . ASN A 1 70  ? 14.191  19.847  16.463  1.00 23.12  ? 70   ASN A N     1 
ATOM   542  C  CA    . ASN A 1 70  ? 13.313  20.425  17.491  1.00 24.95  ? 70   ASN A CA    1 
ATOM   543  C  C     . ASN A 1 70  ? 11.934  19.742  17.755  1.00 26.04  ? 70   ASN A C     1 
ATOM   544  O  O     . ASN A 1 70  ? 11.343  19.861  18.868  1.00 29.34  ? 70   ASN A O     1 
ATOM   545  C  CB    . ASN A 1 70  ? 13.224  21.954  17.333  1.00 24.46  ? 70   ASN A CB    1 
ATOM   546  C  CG    . ASN A 1 70  ? 12.311  22.598  18.359  1.00 25.64  ? 70   ASN A CG    1 
ATOM   547  O  OD1   . ASN A 1 70  ? 11.870  21.949  19.313  1.00 23.74  ? 70   ASN A OD1   1 
ATOM   548  N  ND2   . ASN A 1 70  ? 12.014  23.879  18.166  1.00 25.01  ? 70   ASN A ND2   1 
ATOM   549  N  N     . ALA A 1 71  ? 11.491  18.943  16.816  1.00 24.59  ? 71   ALA A N     1 
ATOM   550  C  CA    . ALA A 1 71  ? 10.164  18.316  16.816  1.00 23.65  ? 71   ALA A CA    1 
ATOM   551  C  C     . ALA A 1 71  ? 9.942   17.257  17.903  1.00 23.14  ? 71   ALA A C     1 
ATOM   552  O  O     . ALA A 1 71  ? 10.899  16.730  18.492  1.00 22.63  ? 71   ALA A O     1 
ATOM   553  C  CB    . ALA A 1 71  ? 9.924   17.679  15.448  1.00 22.60  ? 71   ALA A CB    1 
ATOM   554  N  N     . VAL A 1 72  ? 8.672   16.932  18.120  1.00 22.24  ? 72   VAL A N     1 
ATOM   555  C  CA    . VAL A 1 72  ? 8.301   15.799  18.969  1.00 22.00  ? 72   VAL A CA    1 
ATOM   556  C  C     . VAL A 1 72  ? 8.292   14.510  18.163  1.00 22.08  ? 72   VAL A C     1 
ATOM   557  O  O     . VAL A 1 72  ? 7.505   14.350  17.217  1.00 22.28  ? 72   VAL A O     1 
ATOM   558  C  CB    . VAL A 1 72  ? 6.938   16.012  19.646  1.00 21.65  ? 72   VAL A CB    1 
ATOM   559  C  CG1   . VAL A 1 72  ? 6.685   14.881  20.667  1.00 21.30  ? 72   VAL A CG1   1 
ATOM   560  C  CG2   . VAL A 1 72  ? 6.924   17.365  20.351  1.00 22.33  ? 72   VAL A CG2   1 
ATOM   561  N  N     . TYR A 1 73  ? 9.185   13.596  18.536  1.00 22.15  ? 73   TYR A N     1 
ATOM   562  C  CA    . TYR A 1 73  ? 9.341   12.325  17.830  1.00 22.32  ? 73   TYR A CA    1 
ATOM   563  C  C     . TYR A 1 73  ? 8.657   11.263  18.652  1.00 23.14  ? 73   TYR A C     1 
ATOM   564  O  O     . TYR A 1 73  ? 9.042   11.021  19.788  1.00 22.54  ? 73   TYR A O     1 
ATOM   565  C  CB    . TYR A 1 73  ? 10.833  12.006  17.648  1.00 22.31  ? 73   TYR A CB    1 
ATOM   566  C  CG    . TYR A 1 73  ? 11.465  12.828  16.532  1.00 22.71  ? 73   TYR A CG    1 
ATOM   567  C  CD1   . TYR A 1 73  ? 11.553  12.321  15.234  1.00 23.48  ? 73   TYR A CD1   1 
ATOM   568  C  CD2   . TYR A 1 73  ? 11.944  14.104  16.768  1.00 22.62  ? 73   TYR A CD2   1 
ATOM   569  C  CE1   . TYR A 1 73  ? 12.115  13.084  14.199  1.00 22.13  ? 73   TYR A CE1   1 
ATOM   570  C  CE2   . TYR A 1 73  ? 12.515  14.881  15.735  1.00 21.67  ? 73   TYR A CE2   1 
ATOM   571  C  CZ    . TYR A 1 73  ? 12.584  14.352  14.455  1.00 22.76  ? 73   TYR A CZ    1 
ATOM   572  O  OH    . TYR A 1 73  ? 13.139  15.080  13.425  1.00 23.47  ? 73   TYR A OH    1 
ATOM   573  N  N     . LEU A 1 74  ? 7.621   10.660  18.079  1.00 24.84  ? 74   LEU A N     1 
ATOM   574  C  CA    . LEU A 1 74  ? 6.784   9.692   18.784  1.00 25.97  ? 74   LEU A CA    1 
ATOM   575  C  C     . LEU A 1 74  ? 6.830   8.313   18.116  1.00 27.22  ? 74   LEU A C     1 
ATOM   576  O  O     . LEU A 1 74  ? 6.866   8.224   16.880  1.00 26.82  ? 74   LEU A O     1 
ATOM   577  C  CB    . LEU A 1 74  ? 5.333   10.191  18.797  1.00 25.86  ? 74   LEU A CB    1 
ATOM   578  C  CG    . LEU A 1 74  ? 5.013   11.500  19.543  1.00 26.98  ? 74   LEU A CG    1 
ATOM   579  C  CD1   . LEU A 1 74  ? 3.539   11.818  19.370  1.00 26.87  ? 74   LEU A CD1   1 
ATOM   580  C  CD2   . LEU A 1 74  ? 5.390   11.418  21.047  1.00 27.23  ? 74   LEU A CD2   1 
ATOM   581  N  N     . PRO A 1 75  ? 6.801   7.229   18.925  1.00 28.17  ? 75   PRO A N     1 
ATOM   582  C  CA    . PRO A 1 75  ? 6.745   5.892   18.331  1.00 29.14  ? 75   PRO A CA    1 
ATOM   583  C  C     . PRO A 1 75  ? 5.364   5.621   17.716  1.00 30.27  ? 75   PRO A C     1 
ATOM   584  O  O     . PRO A 1 75  ? 4.360   6.035   18.281  1.00 30.82  ? 75   PRO A O     1 
ATOM   585  C  CB    . PRO A 1 75  ? 6.998   4.962   19.528  1.00 29.43  ? 75   PRO A CB    1 
ATOM   586  C  CG    . PRO A 1 75  ? 6.572   5.743   20.726  1.00 28.79  ? 75   PRO A CG    1 
ATOM   587  C  CD    . PRO A 1 75  ? 6.862   7.189   20.402  1.00 28.01  ? 75   PRO A CD    1 
ATOM   588  N  N     . MET A 1 76  ? 5.321   4.954   16.565  1.00 31.04  ? 76   MET A N     1 
ATOM   589  C  CA    . MET A 1 76  ? 4.053   4.643   15.900  1.00 32.51  ? 76   MET A CA    1 
ATOM   590  C  C     . MET A 1 76  ? 3.262   3.621   16.725  1.00 32.98  ? 76   MET A C     1 
ATOM   591  O  O     . MET A 1 76  ? 3.775   2.538   17.026  1.00 33.07  ? 76   MET A O     1 
ATOM   592  C  CB    . MET A 1 76  ? 4.310   4.108   14.484  1.00 32.73  ? 76   MET A CB    1 
ATOM   593  C  CG    . MET A 1 76  ? 3.047   3.761   13.708  1.00 36.06  ? 76   MET A CG    1 
ATOM   594  S  SD    . MET A 1 76  ? 3.327   2.699   12.290  1.00 45.21  ? 76   MET A SD    1 
ATOM   595  C  CE    . MET A 1 76  ? 3.996   1.195   13.012  1.00 40.93  ? 76   MET A CE    1 
ATOM   596  N  N     . ARG A 1 77  ? 2.041   3.997   17.110  1.00 33.25  ? 77   ARG A N     1 
ATOM   597  C  CA    . ARG A 1 77  ? 1.124   3.130   17.865  1.00 33.91  ? 77   ARG A CA    1 
ATOM   598  C  C     . ARG A 1 77  ? -0.030  2.638   16.983  1.00 33.72  ? 77   ARG A C     1 
ATOM   599  O  O     . ARG A 1 77  ? -1.158  3.107   17.135  1.00 33.19  ? 77   ARG A O     1 
ATOM   600  C  CB    . ARG A 1 77  ? 0.537   3.884   19.055  1.00 33.59  ? 77   ARG A CB    1 
ATOM   601  C  CG    . ARG A 1 77  ? 1.550   4.370   20.058  1.00 35.15  ? 77   ARG A CG    1 
ATOM   602  C  CD    . ARG A 1 77  ? 0.837   4.777   21.312  1.00 35.38  ? 77   ARG A CD    1 
ATOM   603  N  NE    . ARG A 1 77  ? 0.384   6.161   21.280  1.00 36.52  ? 77   ARG A NE    1 
ATOM   604  C  CZ    . ARG A 1 77  ? -0.370  6.707   22.229  1.00 37.24  ? 77   ARG A CZ    1 
ATOM   605  N  NH1   . ARG A 1 77  ? -0.786  5.963   23.254  1.00 36.11  ? 77   ARG A NH1   1 
ATOM   606  N  NH2   . ARG A 1 77  ? -0.721  7.987   22.152  1.00 35.76  ? 77   ARG A NH2   1 
ATOM   607  N  N     . LYS A 1 78  ? 0.271   1.704   16.078  1.00 34.19  ? 78   LYS A N     1 
ATOM   608  C  CA    . LYS A 1 78  ? -0.647  1.263   15.018  1.00 35.39  ? 78   LYS A CA    1 
ATOM   609  C  C     . LYS A 1 78  ? -2.056  0.890   15.508  1.00 35.27  ? 78   LYS A C     1 
ATOM   610  O  O     . LYS A 1 78  ? -3.059  1.373   14.962  1.00 35.15  ? 78   LYS A O     1 
ATOM   611  C  CB    . LYS A 1 78  ? -0.012  0.108   14.218  1.00 35.92  ? 78   LYS A CB    1 
ATOM   612  C  CG    . LYS A 1 78  ? -0.834  -0.450  13.052  1.00 38.72  ? 78   LYS A CG    1 
ATOM   613  C  CD    . LYS A 1 78  ? -0.635  0.353   11.769  1.00 42.14  ? 78   LYS A CD    1 
ATOM   614  C  CE    . LYS A 1 78  ? -1.185  -0.382  10.532  1.00 44.28  ? 78   LYS A CE    1 
ATOM   615  N  NZ    . LYS A 1 78  ? -0.128  -1.128  9.756   1.00 45.83  ? 78   LYS A NZ    1 
ATOM   616  N  N     . GLU A 1 79  ? -2.124  0.055   16.546  1.00 35.55  ? 79   GLU A N     1 
ATOM   617  C  CA    . GLU A 1 79  ? -3.405  -0.383  17.137  1.00 35.74  ? 79   GLU A CA    1 
ATOM   618  C  C     . GLU A 1 79  ? -4.325  0.794   17.486  1.00 34.96  ? 79   GLU A C     1 
ATOM   619  O  O     . GLU A 1 79  ? -5.538  0.726   17.266  1.00 35.09  ? 79   GLU A O     1 
ATOM   620  C  CB    . GLU A 1 79  ? -3.196  -1.247  18.404  1.00 36.26  ? 79   GLU A CB    1 
ATOM   621  C  CG    . GLU A 1 79  ? -1.725  -1.592  18.755  1.00 39.50  ? 79   GLU A CG    1 
ATOM   622  C  CD    . GLU A 1 79  ? -0.953  -0.423  19.424  1.00 41.88  ? 79   GLU A CD    1 
ATOM   623  O  OE1   . GLU A 1 79  ? -1.574  0.382   20.158  1.00 45.59  ? 79   GLU A OE1   1 
ATOM   624  O  OE2   . GLU A 1 79  ? 0.275   -0.306  19.217  1.00 39.33  ? 79   GLU A OE2   1 
ATOM   625  N  N     . VAL A 1 80  ? -3.738  1.858   18.037  1.00 33.27  ? 80   VAL A N     1 
ATOM   626  C  CA    . VAL A 1 80  ? -4.475  3.070   18.422  1.00 32.36  ? 80   VAL A CA    1 
ATOM   627  C  C     . VAL A 1 80  ? -5.111  3.801   17.210  1.00 31.22  ? 80   VAL A C     1 
ATOM   628  O  O     . VAL A 1 80  ? -6.293  4.170   17.223  1.00 30.62  ? 80   VAL A O     1 
ATOM   629  C  CB    . VAL A 1 80  ? -3.537  4.044   19.190  1.00 32.75  ? 80   VAL A CB    1 
ATOM   630  C  CG1   . VAL A 1 80  ? -4.239  5.365   19.515  1.00 32.50  ? 80   VAL A CG1   1 
ATOM   631  C  CG2   . VAL A 1 80  ? -2.990  3.384   20.453  1.00 32.73  ? 80   VAL A CG2   1 
ATOM   632  N  N     . TYR A 1 81  ? -4.313  4.007   16.170  1.00 30.00  ? 81   TYR A N     1 
ATOM   633  C  CA    . TYR A 1 81  ? -4.791  4.632   14.937  1.00 29.10  ? 81   TYR A CA    1 
ATOM   634  C  C     . TYR A 1 81  ? -5.850  3.767   14.262  1.00 28.77  ? 81   TYR A C     1 
ATOM   635  O  O     . TYR A 1 81  ? -6.822  4.282   13.714  1.00 28.53  ? 81   TYR A O     1 
ATOM   636  C  CB    . TYR A 1 81  ? -3.617  4.901   13.982  1.00 28.88  ? 81   TYR A CB    1 
ATOM   637  C  CG    . TYR A 1 81  ? -2.406  5.486   14.677  1.00 27.50  ? 81   TYR A CG    1 
ATOM   638  C  CD1   . TYR A 1 81  ? -2.537  6.480   15.641  1.00 26.77  ? 81   TYR A CD1   1 
ATOM   639  C  CD2   . TYR A 1 81  ? -1.133  5.037   14.368  1.00 26.87  ? 81   TYR A CD2   1 
ATOM   640  C  CE1   . TYR A 1 81  ? -1.427  7.003   16.275  1.00 29.13  ? 81   TYR A CE1   1 
ATOM   641  C  CE2   . TYR A 1 81  ? -0.031  5.551   14.987  1.00 28.07  ? 81   TYR A CE2   1 
ATOM   642  C  CZ    . TYR A 1 81  ? -0.171  6.528   15.930  1.00 29.21  ? 81   TYR A CZ    1 
ATOM   643  O  OH    . TYR A 1 81  ? 0.959   7.023   16.532  1.00 30.92  ? 81   TYR A OH    1 
ATOM   644  N  N     . GLN A 1 82  ? -5.678  2.453   14.328  1.00 28.90  ? 82   GLN A N     1 
ATOM   645  C  CA    . GLN A 1 82  ? -6.663  1.548   13.738  1.00 29.38  ? 82   GLN A CA    1 
ATOM   646  C  C     . GLN A 1 82  ? -8.032  1.647   14.439  1.00 28.92  ? 82   GLN A C     1 
ATOM   647  O  O     . GLN A 1 82  ? -9.069  1.554   13.782  1.00 28.45  ? 82   GLN A O     1 
ATOM   648  C  CB    . GLN A 1 82  ? -6.148  0.106   13.690  1.00 30.10  ? 82   GLN A CB    1 
ATOM   649  C  CG    . GLN A 1 82  ? -7.190  -0.918  13.198  1.00 30.84  ? 82   GLN A CG    1 
ATOM   650  C  CD    . GLN A 1 82  ? -7.588  -0.729  11.733  1.00 34.42  ? 82   GLN A CD    1 
ATOM   651  O  OE1   . GLN A 1 82  ? -6.757  -0.818  10.835  1.00 34.92  ? 82   GLN A OE1   1 
ATOM   652  N  NE2   . GLN A 1 82  ? -8.875  -0.489  11.492  1.00 34.85  ? 82   GLN A NE2   1 
ATOM   653  N  N     . GLN A 1 83  ? -8.021  1.863   15.757  1.00 29.28  ? 83   GLN A N     1 
ATOM   654  C  CA    . GLN A 1 83  ? -9.246  2.055   16.550  1.00 28.91  ? 83   GLN A CA    1 
ATOM   655  C  C     . GLN A 1 83  ? -10.024 3.305   16.090  1.00 29.12  ? 83   GLN A C     1 
ATOM   656  O  O     . GLN A 1 83  ? -11.248 3.262   15.897  1.00 28.61  ? 83   GLN A O     1 
ATOM   657  C  CB    . GLN A 1 83  ? -8.908  2.118   18.054  1.00 29.70  ? 83   GLN A CB    1 
ATOM   658  C  CG    . GLN A 1 83  ? -8.353  0.779   18.630  1.00 31.27  ? 83   GLN A CG    1 
ATOM   659  C  CD    . GLN A 1 83  ? -7.498  0.922   19.925  1.00 33.70  ? 83   GLN A CD    1 
ATOM   660  O  OE1   . GLN A 1 83  ? -7.551  1.927   20.644  1.00 34.35  ? 83   GLN A OE1   1 
ATOM   661  N  NE2   . GLN A 1 83  ? -6.709  -0.107  20.209  1.00 34.44  ? 83   GLN A NE2   1 
ATOM   662  N  N     . VAL A 1 84  ? -9.304  4.411   15.881  1.00 28.74  ? 84   VAL A N     1 
ATOM   663  C  CA    . VAL A 1 84  ? -9.903  5.639   15.354  1.00 28.19  ? 84   VAL A CA    1 
ATOM   664  C  C     . VAL A 1 84  ? -10.440 5.403   13.937  1.00 27.80  ? 84   VAL A C     1 
ATOM   665  O  O     . VAL A 1 84  ? -11.579 5.785   13.627  1.00 27.14  ? 84   VAL A O     1 
ATOM   666  C  CB    . VAL A 1 84  ? -8.901  6.851   15.405  1.00 28.29  ? 84   VAL A CB    1 
ATOM   667  C  CG1   . VAL A 1 84  ? -9.422  8.037   14.614  1.00 27.01  ? 84   VAL A CG1   1 
ATOM   668  C  CG2   . VAL A 1 84  ? -8.642  7.274   16.876  1.00 30.32  ? 84   VAL A CG2   1 
ATOM   669  N  N     . SER A 1 85  ? -9.634  4.762   13.093  1.00 27.31  ? 85   SER A N     1 
ATOM   670  C  CA    . SER A 1 85  ? -10.023 4.498   11.705  1.00 27.92  ? 85   SER A CA    1 
ATOM   671  C  C     . SER A 1 85  ? -11.308 3.666   11.619  1.00 28.39  ? 85   SER A C     1 
ATOM   672  O  O     . SER A 1 85  ? -12.253 4.014   10.905  1.00 28.63  ? 85   SER A O     1 
ATOM   673  C  CB    . SER A 1 85  ? -8.895  3.783   10.974  1.00 27.58  ? 85   SER A CB    1 
ATOM   674  O  OG    . SER A 1 85  ? -9.270  3.523   9.632   1.00 27.61  ? 85   SER A OG    1 
ATOM   675  N  N     . SER A 1 86  ? -11.338 2.575   12.374  1.00 28.69  ? 86   SER A N     1 
ATOM   676  C  CA    . SER A 1 86  ? -12.509 1.715   12.428  1.00 29.59  ? 86   SER A CA    1 
ATOM   677  C  C     . SER A 1 86  ? -13.770 2.501   12.774  1.00 29.73  ? 86   SER A C     1 
ATOM   678  O  O     . SER A 1 86  ? -14.776 2.331   12.104  1.00 29.87  ? 86   SER A O     1 
ATOM   679  C  CB    . SER A 1 86  ? -12.276 0.541   13.387  1.00 29.56  ? 86   SER A CB    1 
ATOM   680  O  OG    . SER A 1 86  ? -11.290 -0.314  12.812  1.00 31.49  ? 86   SER A OG    1 
ATOM   681  N  N     . ARG A 1 87  ? -13.695 3.372   13.784  1.00 29.86  ? 87   ARG A N     1 
ATOM   682  C  CA    . ARG A 1 87  ? -14.813 4.248   14.143  1.00 30.57  ? 87   ARG A CA    1 
ATOM   683  C  C     . ARG A 1 87  ? -15.196 5.209   13.011  1.00 30.45  ? 87   ARG A C     1 
ATOM   684  O  O     . ARG A 1 87  ? -16.382 5.422   12.754  1.00 30.15  ? 87   ARG A O     1 
ATOM   685  C  CB    . ARG A 1 87  ? -14.532 5.043   15.440  1.00 30.71  ? 87   ARG A CB    1 
ATOM   686  C  CG    . ARG A 1 87  ? -14.538 4.191   16.731  1.00 31.55  ? 87   ARG A CG    1 
ATOM   687  C  CD    . ARG A 1 87  ? -14.700 5.045   18.003  1.00 32.90  ? 87   ARG A CD    1 
ATOM   688  N  NE    . ARG A 1 87  ? -13.581 5.975   18.220  1.00 34.65  ? 87   ARG A NE    1 
ATOM   689  C  CZ    . ARG A 1 87  ? -12.433 5.669   18.827  1.00 34.43  ? 87   ARG A CZ    1 
ATOM   690  N  NH1   . ARG A 1 87  ? -12.219 4.449   19.300  1.00 34.89  ? 87   ARG A NH1   1 
ATOM   691  N  NH2   . ARG A 1 87  ? -11.482 6.588   18.950  1.00 34.78  ? 87   ARG A NH2   1 
ATOM   692  N  N     . ILE A 1 88  ? -14.209 5.804   12.338  1.00 29.80  ? 88   ILE A N     1 
ATOM   693  C  CA    . ILE A 1 88  ? -14.550 6.718   11.261  1.00 29.56  ? 88   ILE A CA    1 
ATOM   694  C  C     . ILE A 1 88  ? -15.218 5.963   10.107  1.00 29.85  ? 88   ILE A C     1 
ATOM   695  O  O     . ILE A 1 88  ? -16.220 6.421   9.553   1.00 29.41  ? 88   ILE A O     1 
ATOM   696  C  CB    . ILE A 1 88  ? -13.348 7.548   10.759  1.00 29.53  ? 88   ILE A CB    1 
ATOM   697  C  CG1   . ILE A 1 88  ? -12.726 8.338   11.925  1.00 29.52  ? 88   ILE A CG1   1 
ATOM   698  C  CG2   . ILE A 1 88  ? -13.821 8.481   9.647   1.00 29.41  ? 88   ILE A CG2   1 
ATOM   699  C  CD1   . ILE A 1 88  ? -11.460 9.187   11.566  1.00 28.34  ? 88   ILE A CD1   1 
ATOM   700  N  N     . MET A 1 89  ? -14.679 4.797   9.764   1.00 30.11  ? 89   MET A N     1 
ATOM   701  C  CA    . MET A 1 89  ? -15.224 4.037   8.643   1.00 31.18  ? 89   MET A CA    1 
ATOM   702  C  C     . MET A 1 89  ? -16.678 3.615   8.894   1.00 31.96  ? 89   MET A C     1 
ATOM   703  O  O     . MET A 1 89  ? -17.433 3.440   7.951   1.00 32.11  ? 89   MET A O     1 
ATOM   704  C  CB    . MET A 1 89  ? -14.364 2.814   8.304   1.00 31.02  ? 89   MET A CB    1 
ATOM   705  C  CG    . MET A 1 89  ? -12.913 3.119   7.916   1.00 30.30  ? 89   MET A CG    1 
ATOM   706  S  SD    . MET A 1 89  ? -12.739 4.252   6.510   1.00 31.56  ? 89   MET A SD    1 
ATOM   707  C  CE    . MET A 1 89  ? -10.948 4.333   6.329   1.00 28.10  ? 89   MET A CE    1 
ATOM   708  N  N     . ASN A 1 90  ? -17.052 3.445   10.158  1.00 32.68  ? 90   ASN A N     1 
ATOM   709  C  CA    . ASN A 1 90  ? -18.430 3.098   10.503  1.00 34.08  ? 90   ASN A CA    1 
ATOM   710  C  C     . ASN A 1 90  ? -19.354 4.308   10.361  1.00 34.27  ? 90   ASN A C     1 
ATOM   711  O  O     . ASN A 1 90  ? -20.537 4.164   10.048  1.00 34.63  ? 90   ASN A O     1 
ATOM   712  C  CB    . ASN A 1 90  ? -18.515 2.497   11.914  1.00 33.94  ? 90   ASN A CB    1 
ATOM   713  C  CG    . ASN A 1 90  ? -17.951 1.060   11.997  1.00 35.38  ? 90   ASN A CG    1 
ATOM   714  O  OD1   . ASN A 1 90  ? -17.818 0.348   10.987  1.00 35.68  ? 90   ASN A OD1   1 
ATOM   715  N  ND2   . ASN A 1 90  ? -17.621 0.635   13.218  1.00 35.88  ? 90   ASN A ND2   1 
ATOM   716  N  N     . LEU A 1 91  ? -18.811 5.502   10.582  1.00 34.80  ? 91   LEU A N     1 
ATOM   717  C  CA    . LEU A 1 91  ? -19.570 6.732   10.349  1.00 35.45  ? 91   LEU A CA    1 
ATOM   718  C  C     . LEU A 1 91  ? -19.873 6.896   8.863   1.00 35.90  ? 91   LEU A C     1 
ATOM   719  O  O     . LEU A 1 91  ? -20.997 7.225   8.493   1.00 36.09  ? 91   LEU A O     1 
ATOM   720  C  CB    . LEU A 1 91  ? -18.833 7.964   10.889  1.00 35.23  ? 91   LEU A CB    1 
ATOM   721  C  CG    . LEU A 1 91  ? -18.534 8.042   12.392  1.00 35.69  ? 91   LEU A CG    1 
ATOM   722  C  CD1   . LEU A 1 91  ? -17.625 9.245   12.704  1.00 35.93  ? 91   LEU A CD1   1 
ATOM   723  C  CD2   . LEU A 1 91  ? -19.812 8.090   13.227  1.00 36.01  ? 91   LEU A CD2   1 
ATOM   724  N  N     . LEU A 1 92  ? -18.871 6.638   8.024   1.00 36.42  ? 92   LEU A N     1 
ATOM   725  C  CA    . LEU A 1 92  ? -18.985 6.824   6.578   1.00 37.37  ? 92   LEU A CA    1 
ATOM   726  C  C     . LEU A 1 92  ? -19.993 5.856   5.967   1.00 38.19  ? 92   LEU A C     1 
ATOM   727  O  O     . LEU A 1 92  ? -20.687 6.203   5.007   1.00 38.08  ? 92   LEU A O     1 
ATOM   728  C  CB    . LEU A 1 92  ? -17.624 6.663   5.888   1.00 36.98  ? 92   LEU A CB    1 
ATOM   729  C  CG    . LEU A 1 92  ? -16.541 7.727   6.094   1.00 37.28  ? 92   LEU A CG    1 
ATOM   730  C  CD1   . LEU A 1 92  ? -15.231 7.278   5.443   1.00 36.67  ? 92   LEU A CD1   1 
ATOM   731  C  CD2   . LEU A 1 92  ? -16.978 9.065   5.529   1.00 36.18  ? 92   LEU A CD2   1 
ATOM   732  N  N     . ARG A 1 93  ? -20.063 4.647   6.534   1.00 39.29  ? 93   ARG A N     1 
ATOM   733  C  CA    . ARG A 1 93  ? -21.057 3.636   6.146   1.00 40.74  ? 93   ARG A CA    1 
ATOM   734  C  C     . ARG A 1 93  ? -22.493 4.157   6.171   1.00 41.23  ? 93   ARG A C     1 
ATOM   735  O  O     . ARG A 1 93  ? -23.335 3.692   5.406   1.00 41.77  ? 93   ARG A O     1 
ATOM   736  C  CB    . ARG A 1 93  ? -20.945 2.390   7.029   1.00 40.88  ? 93   ARG A CB    1 
ATOM   737  C  CG    . ARG A 1 93  ? -19.767 1.485   6.694   1.00 41.85  ? 93   ARG A CG    1 
ATOM   738  C  CD    . ARG A 1 93  ? -19.571 0.401   7.753   1.00 44.64  ? 93   ARG A CD    1 
ATOM   739  N  NE    . ARG A 1 93  ? -18.171 -0.012  7.874   1.00 46.43  ? 93   ARG A NE    1 
ATOM   740  C  CZ    . ARG A 1 93  ? -17.584 -0.933  7.115   1.00 47.68  ? 93   ARG A CZ    1 
ATOM   741  N  NH1   . ARG A 1 93  ? -18.264 -1.556  6.161   1.00 49.09  ? 93   ARG A NH1   1 
ATOM   742  N  NH2   . ARG A 1 93  ? -16.307 -1.233  7.310   1.00 48.36  ? 93   ARG A NH2   1 
ATOM   743  N  N     . GLU A 1 94  ? -22.754 5.127   7.043   1.00 41.96  ? 94   GLU A N     1 
ATOM   744  C  CA    . GLU A 1 94  ? -24.066 5.757   7.153   1.00 42.91  ? 94   GLU A CA    1 
ATOM   745  C  C     . GLU A 1 94  ? -24.414 6.634   5.954   1.00 42.91  ? 94   GLU A C     1 
ATOM   746  O  O     . GLU A 1 94  ? -25.542 7.105   5.845   1.00 43.44  ? 94   GLU A O     1 
ATOM   747  C  CB    . GLU A 1 94  ? -24.169 6.589   8.441   1.00 43.10  ? 94   GLU A CB    1 
ATOM   748  C  CG    . GLU A 1 94  ? -23.712 5.851   9.689   1.00 45.40  ? 94   GLU A CG    1 
ATOM   749  C  CD    . GLU A 1 94  ? -24.259 6.450   10.965  1.00 48.05  ? 94   GLU A CD    1 
ATOM   750  O  OE1   . GLU A 1 94  ? -25.473 6.266   11.233  1.00 50.17  ? 94   GLU A OE1   1 
ATOM   751  O  OE2   . GLU A 1 94  ? -23.475 7.085   11.708  1.00 48.79  ? 94   GLU A OE2   1 
ATOM   752  N  N     . TYR A 1 95  ? -23.463 6.850   5.053   1.00 42.65  ? 95   TYR A N     1 
ATOM   753  C  CA    . TYR A 1 95  ? -23.711 7.730   3.916   1.00 42.39  ? 95   TYR A CA    1 
ATOM   754  C  C     . TYR A 1 95  ? -23.906 7.008   2.588   1.00 42.35  ? 95   TYR A C     1 
ATOM   755  O  O     . TYR A 1 95  ? -24.449 7.590   1.651   1.00 42.41  ? 95   TYR A O     1 
ATOM   756  C  CB    . TYR A 1 95  ? -22.626 8.802   3.819   1.00 42.00  ? 95   TYR A CB    1 
ATOM   757  C  CG    . TYR A 1 95  ? -22.676 9.770   4.972   1.00 42.05  ? 95   TYR A CG    1 
ATOM   758  C  CD1   . TYR A 1 95  ? -23.609 10.808  4.994   1.00 41.39  ? 95   TYR A CD1   1 
ATOM   759  C  CD2   . TYR A 1 95  ? -21.803 9.645   6.054   1.00 42.06  ? 95   TYR A CD2   1 
ATOM   760  C  CE1   . TYR A 1 95  ? -23.666 11.697  6.058   1.00 41.53  ? 95   TYR A CE1   1 
ATOM   761  C  CE2   . TYR A 1 95  ? -21.853 10.531  7.120   1.00 41.55  ? 95   TYR A CE2   1 
ATOM   762  C  CZ    . TYR A 1 95  ? -22.783 11.556  7.112   1.00 41.98  ? 95   TYR A CZ    1 
ATOM   763  O  OH    . TYR A 1 95  ? -22.831 12.442  8.161   1.00 43.45  ? 95   TYR A OH    1 
ATOM   764  N  N     . SER A 1 96  ? -23.475 5.747   2.513   1.00 42.08  ? 96   SER A N     1 
ATOM   765  C  CA    . SER A 1 96  ? -23.675 4.931   1.308   1.00 41.93  ? 96   SER A CA    1 
ATOM   766  C  C     . SER A 1 96  ? -23.391 3.450   1.561   1.00 42.03  ? 96   SER A C     1 
ATOM   767  O  O     . SER A 1 96  ? -22.407 3.110   2.216   1.00 42.76  ? 96   SER A O     1 
ATOM   768  C  CB    . SER A 1 96  ? -22.799 5.442   0.149   1.00 41.50  ? 96   SER A CB    1 
ATOM   769  O  OG    . SER A 1 96  ? -23.103 4.765   -1.061  1.00 40.45  ? 96   SER A OG    1 
ATOM   770  N  N     . GLU A 1 97  ? -24.236 2.577   1.018   1.00 42.14  ? 97   GLU A N     1 
ATOM   771  C  CA    . GLU A 1 97  ? -23.986 1.125   1.058   1.00 42.28  ? 97   GLU A CA    1 
ATOM   772  C  C     . GLU A 1 97  ? -22.803 0.770   0.189   1.00 41.37  ? 97   GLU A C     1 
ATOM   773  O  O     . GLU A 1 97  ? -22.111 -0.212  0.452   1.00 41.68  ? 97   GLU A O     1 
ATOM   774  C  CB    . GLU A 1 97  ? -25.185 0.309   0.558   1.00 42.83  ? 97   GLU A CB    1 
ATOM   775  C  CG    . GLU A 1 97  ? -26.475 0.595   1.255   1.00 44.82  ? 97   GLU A CG    1 
ATOM   776  C  CD    . GLU A 1 97  ? -27.014 1.949   0.880   1.00 47.35  ? 97   GLU A CD    1 
ATOM   777  O  OE1   . GLU A 1 97  ? -27.100 2.809   1.783   1.00 49.31  ? 97   GLU A OE1   1 
ATOM   778  O  OE2   . GLU A 1 97  ? -27.326 2.157   -0.316  1.00 48.35  ? 97   GLU A OE2   1 
ATOM   779  N  N     . LYS A 1 98  ? -22.592 1.558   -0.862  1.00 40.17  ? 98   LYS A N     1 
ATOM   780  C  CA    . LYS A 1 98  ? -21.517 1.294   -1.808  1.00 38.92  ? 98   LYS A CA    1 
ATOM   781  C  C     . LYS A 1 98  ? -20.242 2.015   -1.347  1.00 38.05  ? 98   LYS A C     1 
ATOM   782  O  O     . LYS A 1 98  ? -19.997 3.169   -1.710  1.00 37.44  ? 98   LYS A O     1 
ATOM   783  C  CB    . LYS A 1 98  ? -21.931 1.714   -3.214  1.00 39.07  ? 98   LYS A CB    1 
ATOM   784  C  CG    . LYS A 1 98  ? -23.175 0.996   -3.747  1.00 40.22  ? 98   LYS A CG    1 
ATOM   785  C  CD    . LYS A 1 98  ? -23.399 1.355   -5.200  1.00 41.32  ? 98   LYS A CD    1 
ATOM   786  C  CE    . LYS A 1 98  ? -24.590 0.626   -5.787  1.00 42.92  ? 98   LYS A CE    1 
ATOM   787  N  NZ    . LYS A 1 98  ? -24.568 0.777   -7.267  1.00 43.54  ? 98   LYS A NZ    1 
ATOM   788  N  N     . ILE A 1 99  ? -19.455 1.325   -0.525  1.00 36.70  ? 99   ILE A N     1 
ATOM   789  C  CA    . ILE A 1 99  ? -18.243 1.904   0.061   1.00 36.08  ? 99   ILE A CA    1 
ATOM   790  C  C     . ILE A 1 99  ? -17.056 0.953   -0.113  1.00 35.14  ? 99   ILE A C     1 
ATOM   791  O  O     . ILE A 1 99  ? -17.195 -0.272  -0.016  1.00 34.61  ? 99   ILE A O     1 
ATOM   792  C  CB    . ILE A 1 99  ? -18.477 2.300   1.547   1.00 36.12  ? 99   ILE A CB    1 
ATOM   793  C  CG1   . ILE A 1 99  ? -17.191 2.808   2.209   1.00 37.10  ? 99   ILE A CG1   1 
ATOM   794  C  CG2   . ILE A 1 99  ? -19.101 1.132   2.335   1.00 37.24  ? 99   ILE A CG2   1 
ATOM   795  C  CD1   . ILE A 1 99  ? -17.441 3.546   3.518   1.00 37.35  ? 99   ILE A CD1   1 
ATOM   796  N  N     . GLU A 1 100 ? -15.903 1.530   -0.417  1.00 33.78  ? 100  GLU A N     1 
ATOM   797  C  CA    . GLU A 1 100 ? -14.683 0.777   -0.593  1.00 32.87  ? 100  GLU A CA    1 
ATOM   798  C  C     . GLU A 1 100 ? -13.606 1.348   0.323   1.00 32.82  ? 100  GLU A C     1 
ATOM   799  O  O     . GLU A 1 100 ? -13.082 2.443   0.073   1.00 31.81  ? 100  GLU A O     1 
ATOM   800  C  CB    . GLU A 1 100 ? -14.243 0.864   -2.044  1.00 32.05  ? 100  GLU A CB    1 
ATOM   801  C  CG    . GLU A 1 100 ? -12.887 0.274   -2.321  1.00 33.36  ? 100  GLU A CG    1 
ATOM   802  C  CD    . GLU A 1 100 ? -12.599 0.191   -3.806  1.00 35.49  ? 100  GLU A CD    1 
ATOM   803  O  OE1   . GLU A 1 100 ? -13.547 0.332   -4.620  1.00 35.52  ? 100  GLU A OE1   1 
ATOM   804  O  OE2   . GLU A 1 100 ? -11.424 -0.027  -4.166  1.00 34.93  ? 100  GLU A OE2   1 
ATOM   805  N  N     . ILE A 1 101 ? -13.274 0.598   1.370   1.00 32.31  ? 101  ILE A N     1 
ATOM   806  C  CA    . ILE A 1 101 ? -12.200 0.976   2.273   1.00 32.59  ? 101  ILE A CA    1 
ATOM   807  C  C     . ILE A 1 101 ? -10.890 0.685   1.580   1.00 32.52  ? 101  ILE A C     1 
ATOM   808  O  O     . ILE A 1 101 ? -10.545 -0.467  1.369   1.00 32.76  ? 101  ILE A O     1 
ATOM   809  C  CB    . ILE A 1 101 ? -12.237 0.188   3.599   1.00 32.87  ? 101  ILE A CB    1 
ATOM   810  C  CG1   . ILE A 1 101 ? -13.651 0.126   4.181   1.00 33.23  ? 101  ILE A CG1   1 
ATOM   811  C  CG2   . ILE A 1 101 ? -11.215 0.754   4.607   1.00 33.03  ? 101  ILE A CG2   1 
ATOM   812  C  CD1   . ILE A 1 101 ? -14.258 1.449   4.537   1.00 35.04  ? 101  ILE A CD1   1 
ATOM   813  N  N     . ALA A 1 102 ? -10.160 1.729   1.212   1.00 31.56  ? 102  ALA A N     1 
ATOM   814  C  CA    . ALA A 1 102 ? -8.953  1.529   0.438   1.00 31.07  ? 102  ALA A CA    1 
ATOM   815  C  C     . ALA A 1 102 ? -7.712  1.301   1.306   1.00 30.84  ? 102  ALA A C     1 
ATOM   816  O  O     . ALA A 1 102 ? -6.784  0.634   0.860   1.00 31.84  ? 102  ALA A O     1 
ATOM   817  C  CB    . ALA A 1 102 ? -8.741  2.674   -0.547  1.00 30.81  ? 102  ALA A CB    1 
ATOM   818  N  N     . SER A 1 103 ? -7.700  1.839   2.529   1.00 29.39  ? 103  SER A N     1 
ATOM   819  C  CA    . SER A 1 103 ? -6.554  1.729   3.444   1.00 28.22  ? 103  SER A CA    1 
ATOM   820  C  C     . SER A 1 103 ? -6.974  2.174   4.833   1.00 27.46  ? 103  SER A C     1 
ATOM   821  O  O     . SER A 1 103 ? -8.148  2.467   5.048   1.00 27.74  ? 103  SER A O     1 
ATOM   822  C  CB    . SER A 1 103 ? -5.408  2.628   2.988   1.00 28.26  ? 103  SER A CB    1 
ATOM   823  O  OG    . SER A 1 103 ? -5.826  3.978   3.110   1.00 29.03  ? 103  SER A OG    1 
ATOM   824  N  N     . ILE A 1 104 ? -6.016  2.276   5.756   1.00 26.48  ? 104  ILE A N     1 
ATOM   825  C  CA    . ILE A 1 104 ? -6.315  2.743   7.110   1.00 26.82  ? 104  ILE A CA    1 
ATOM   826  C  C     . ILE A 1 104 ? -6.989  4.137   7.134   1.00 26.21  ? 104  ILE A C     1 
ATOM   827  O  O     . ILE A 1 104 ? -7.705  4.461   8.074   1.00 26.03  ? 104  ILE A O     1 
ATOM   828  C  CB    . ILE A 1 104 ? -5.066  2.711   8.055   1.00 26.81  ? 104  ILE A CB    1 
ATOM   829  C  CG1   . ILE A 1 104 ? -5.514  2.700   9.533   1.00 27.97  ? 104  ILE A CG1   1 
ATOM   830  C  CG2   . ILE A 1 104 ? -4.107  3.880   7.748   1.00 27.51  ? 104  ILE A CG2   1 
ATOM   831  C  CD1   . ILE A 1 104 ? -4.522  2.102   10.501  1.00 30.01  ? 104  ILE A CD1   1 
ATOM   832  N  N     . ASP A 1 105 ? -6.791  4.944   6.100   1.00 26.02  ? 105  ASP A N     1 
ATOM   833  C  CA    . ASP A 1 105 ? -7.335  6.321   6.147   1.00 27.17  ? 105  ASP A CA    1 
ATOM   834  C  C     . ASP A 1 105 ? -8.012  6.856   4.873   1.00 26.95  ? 105  ASP A C     1 
ATOM   835  O  O     . ASP A 1 105 ? -8.142  8.083   4.700   1.00 26.44  ? 105  ASP A O     1 
ATOM   836  C  CB    . ASP A 1 105 ? -6.264  7.295   6.689   1.00 27.01  ? 105  ASP A CB    1 
ATOM   837  C  CG    . ASP A 1 105 ? -5.384  7.881   5.593   1.00 29.03  ? 105  ASP A CG    1 
ATOM   838  O  OD1   . ASP A 1 105 ? -5.147  7.185   4.594   1.00 29.89  ? 105  ASP A OD1   1 
ATOM   839  O  OD2   . ASP A 1 105 ? -4.948  9.049   5.706   1.00 28.09  ? 105  ASP A OD2   1 
ATOM   840  N  N     . GLU A 1 106 ? -8.461  5.937   4.010   1.00 27.11  ? 106  GLU A N     1 
ATOM   841  C  CA    . GLU A 1 106 ? -9.106  6.264   2.734   1.00 28.26  ? 106  GLU A CA    1 
ATOM   842  C  C     . GLU A 1 106 ? -10.340 5.415   2.528   1.00 27.53  ? 106  GLU A C     1 
ATOM   843  O  O     . GLU A 1 106 ? -10.283 4.201   2.719   1.00 26.62  ? 106  GLU A O     1 
ATOM   844  C  CB    . GLU A 1 106 ? -8.213  5.887   1.550   1.00 29.06  ? 106  GLU A CB    1 
ATOM   845  C  CG    . GLU A 1 106 ? -6.911  6.577   1.444   1.00 33.91  ? 106  GLU A CG    1 
ATOM   846  C  CD    . GLU A 1 106 ? -6.116  6.080   0.255   1.00 38.87  ? 106  GLU A CD    1 
ATOM   847  O  OE1   . GLU A 1 106 ? -6.007  4.841   0.058   1.00 44.56  ? 106  GLU A OE1   1 
ATOM   848  O  OE2   . GLU A 1 106 ? -5.581  6.928   -0.481  1.00 40.41  ? 106  GLU A OE2   1 
ATOM   849  N  N     . ALA A 1 107 ? -11.424 6.039   2.082   1.00 26.78  ? 107  ALA A N     1 
ATOM   850  C  CA    . ALA A 1 107 ? -12.605 5.298   1.621   1.00 26.62  ? 107  ALA A CA    1 
ATOM   851  C  C     . ALA A 1 107 ? -13.259 5.985   0.415   1.00 26.77  ? 107  ALA A C     1 
ATOM   852  O  O     . ALA A 1 107 ? -13.293 7.227   0.334   1.00 26.41  ? 107  ALA A O     1 
ATOM   853  C  CB    . ALA A 1 107 ? -13.602 5.154   2.746   1.00 26.61  ? 107  ALA A CB    1 
ATOM   854  N  N     . TYR A 1 108 ? -13.763 5.178   -0.521  1.00 26.20  ? 108  TYR A N     1 
ATOM   855  C  CA    . TYR A 1 108 ? -14.535 5.674   -1.653  1.00 25.75  ? 108  TYR A CA    1 
ATOM   856  C  C     . TYR A 1 108 ? -16.001 5.358   -1.427  1.00 26.27  ? 108  TYR A C     1 
ATOM   857  O  O     . TYR A 1 108 ? -16.348 4.221   -1.077  1.00 26.40  ? 108  TYR A O     1 
ATOM   858  C  CB    . TYR A 1 108 ? -14.111 5.024   -2.975  1.00 25.00  ? 108  TYR A CB    1 
ATOM   859  C  CG    . TYR A 1 108 ? -12.690 5.269   -3.401  1.00 24.89  ? 108  TYR A CG    1 
ATOM   860  C  CD1   . TYR A 1 108 ? -12.379 6.302   -4.274  1.00 25.62  ? 108  TYR A CD1   1 
ATOM   861  C  CD2   . TYR A 1 108 ? -11.651 4.434   -2.961  1.00 24.57  ? 108  TYR A CD2   1 
ATOM   862  C  CE1   . TYR A 1 108 ? -11.053 6.525   -4.682  1.00 26.61  ? 108  TYR A CE1   1 
ATOM   863  C  CE2   . TYR A 1 108 ? -10.328 4.648   -3.357  1.00 25.40  ? 108  TYR A CE2   1 
ATOM   864  C  CZ    . TYR A 1 108 ? -10.036 5.684   -4.215  1.00 27.50  ? 108  TYR A CZ    1 
ATOM   865  O  OH    . TYR A 1 108 ? -8.732  5.897   -4.612  1.00 27.78  ? 108  TYR A OH    1 
ATOM   866  N  N     . LEU A 1 109 ? -16.854 6.360   -1.633  1.00 25.87  ? 109  LEU A N     1 
ATOM   867  C  CA    . LEU A 1 109 ? -18.292 6.195   -1.515  1.00 26.41  ? 109  LEU A CA    1 
ATOM   868  C  C     . LEU A 1 109 ? -18.928 6.472   -2.863  1.00 26.67  ? 109  LEU A C     1 
ATOM   869  O  O     . LEU A 1 109 ? -18.701 7.522   -3.470  1.00 26.40  ? 109  LEU A O     1 
ATOM   870  C  CB    . LEU A 1 109 ? -18.878 7.134   -0.454  1.00 26.07  ? 109  LEU A CB    1 
ATOM   871  C  CG    . LEU A 1 109 ? -18.649 6.898   1.043   1.00 26.45  ? 109  LEU A CG    1 
ATOM   872  C  CD1   . LEU A 1 109 ? -17.180 6.974   1.435   1.00 26.50  ? 109  LEU A CD1   1 
ATOM   873  C  CD2   . LEU A 1 109 ? -19.402 7.975   1.807   1.00 29.19  ? 109  LEU A CD2   1 
ATOM   874  N  N     . ASP A 1 110 ? -19.714 5.523   -3.351  1.00 27.14  ? 110  ASP A N     1 
ATOM   875  C  CA    . ASP A 1 110 ? -20.464 5.771   -4.569  1.00 27.90  ? 110  ASP A CA    1 
ATOM   876  C  C     . ASP A 1 110 ? -21.794 6.387   -4.169  1.00 27.64  ? 110  ASP A C     1 
ATOM   877  O  O     . ASP A 1 110 ? -22.648 5.704   -3.609  1.00 28.25  ? 110  ASP A O     1 
ATOM   878  C  CB    . ASP A 1 110 ? -20.656 4.488   -5.376  1.00 27.84  ? 110  ASP A CB    1 
ATOM   879  C  CG    . ASP A 1 110 ? -21.462 4.705   -6.651  1.00 29.83  ? 110  ASP A CG    1 
ATOM   880  O  OD1   . ASP A 1 110 ? -22.378 5.547   -6.673  1.00 30.30  ? 110  ASP A OD1   1 
ATOM   881  O  OD2   . ASP A 1 110 ? -21.189 4.003   -7.639  1.00 33.63  ? 110  ASP A OD2   1 
ATOM   882  N  N     . ILE A 1 111 ? -21.959 7.679   -4.444  1.00 27.41  ? 111  ILE A N     1 
ATOM   883  C  CA    . ILE A 1 111 ? -23.190 8.396   -4.059  1.00 27.35  ? 111  ILE A CA    1 
ATOM   884  C  C     . ILE A 1 111 ? -24.076 8.775   -5.255  1.00 27.33  ? 111  ILE A C     1 
ATOM   885  O  O     . ILE A 1 111 ? -24.925 9.662   -5.145  1.00 27.01  ? 111  ILE A O     1 
ATOM   886  C  CB    . ILE A 1 111 ? -22.893 9.643   -3.184  1.00 27.10  ? 111  ILE A CB    1 
ATOM   887  C  CG1   . ILE A 1 111 ? -21.976 10.624  -3.939  1.00 27.16  ? 111  ILE A CG1   1 
ATOM   888  C  CG2   . ILE A 1 111 ? -22.302 9.228   -1.827  1.00 26.77  ? 111  ILE A CG2   1 
ATOM   889  C  CD1   . ILE A 1 111 ? -21.702 11.915  -3.217  1.00 27.72  ? 111  ILE A CD1   1 
ATOM   890  N  N     . SER A 1 112 ? -23.873 8.092   -6.385  1.00 28.08  ? 112  SER A N     1 
ATOM   891  C  CA    . SER A 1 112 ? -24.654 8.323   -7.602  1.00 29.09  ? 112  SER A CA    1 
ATOM   892  C  C     . SER A 1 112 ? -26.157 8.281   -7.352  1.00 29.78  ? 112  SER A C     1 
ATOM   893  O  O     . SER A 1 112 ? -26.919 9.010   -7.980  1.00 29.26  ? 112  SER A O     1 
ATOM   894  C  CB    . SER A 1 112 ? -24.303 7.301   -8.679  1.00 29.10  ? 112  SER A CB    1 
ATOM   895  O  OG    . SER A 1 112 ? -22.931 7.365   -9.016  1.00 30.14  ? 112  SER A OG    1 
ATOM   896  N  N     . ASP A 1 113 ? -26.573 7.420   -6.431  1.00 30.96  ? 113  ASP A N     1 
ATOM   897  C  CA    . ASP A 1 113 ? -27.991 7.259   -6.117  1.00 32.17  ? 113  ASP A CA    1 
ATOM   898  C  C     . ASP A 1 113 ? -28.442 8.078   -4.897  1.00 32.06  ? 113  ASP A C     1 
ATOM   899  O  O     . ASP A 1 113 ? -29.631 8.110   -4.588  1.00 31.86  ? 113  ASP A O     1 
ATOM   900  C  CB    . ASP A 1 113 ? -28.333 5.765   -5.935  1.00 32.75  ? 113  ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 113 ? -28.306 4.986   -7.255  1.00 35.07  ? 113  ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 113 ? -28.867 5.461   -8.271  1.00 37.51  ? 113  ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 113 ? -27.718 3.888   -7.283  1.00 38.89  ? 113  ASP A OD2   1 
ATOM   904  N  N     . LYS A 1 114 ? -27.505 8.732   -4.208  1.00 31.78  ? 114  LYS A N     1 
ATOM   905  C  CA    . LYS A 1 114 ? -27.851 9.520   -3.008  1.00 31.83  ? 114  LYS A CA    1 
ATOM   906  C  C     . LYS A 1 114 ? -28.030 11.015  -3.283  1.00 31.76  ? 114  LYS A C     1 
ATOM   907  O  O     . LYS A 1 114 ? -28.696 11.713  -2.516  1.00 32.09  ? 114  LYS A O     1 
ATOM   908  C  CB    . LYS A 1 114 ? -26.814 9.344   -1.881  1.00 31.95  ? 114  LYS A CB    1 
ATOM   909  C  CG    . LYS A 1 114 ? -26.338 7.929   -1.614  1.00 32.41  ? 114  LYS A CG    1 
ATOM   910  C  CD    . LYS A 1 114 ? -27.447 7.025   -1.089  1.00 33.46  ? 114  LYS A CD    1 
ATOM   911  C  CE    . LYS A 1 114 ? -26.898 5.640   -0.742  1.00 33.61  ? 114  LYS A CE    1 
ATOM   912  N  NZ    . LYS A 1 114 ? -28.031 4.719   -0.375  1.00 34.18  ? 114  LYS A NZ    1 
ATOM   913  N  N     . VAL A 1 115 ? -27.416 11.507  -4.358  1.00 31.24  ? 115  VAL A N     1 
ATOM   914  C  CA    . VAL A 1 115 ? -27.460 12.927  -4.703  1.00 30.48  ? 115  VAL A CA    1 
ATOM   915  C  C     . VAL A 1 115 ? -27.723 13.085  -6.190  1.00 30.74  ? 115  VAL A C     1 
ATOM   916  O  O     . VAL A 1 115 ? -27.349 12.213  -6.978  1.00 30.51  ? 115  VAL A O     1 
ATOM   917  C  CB    . VAL A 1 115 ? -26.138 13.669  -4.336  1.00 30.57  ? 115  VAL A CB    1 
ATOM   918  C  CG1   . VAL A 1 115 ? -25.971 13.778  -2.824  1.00 30.16  ? 115  VAL A CG1   1 
ATOM   919  C  CG2   . VAL A 1 115 ? -24.924 13.003  -4.981  1.00 29.27  ? 115  VAL A CG2   1 
ATOM   920  N  N     . ARG A 1 116 ? -28.353 14.197  -6.569  1.00 30.71  ? 116  ARG A N     1 
ATOM   921  C  CA    . ARG A 1 116 ? -28.710 14.453  -7.970  1.00 31.21  ? 116  ARG A CA    1 
ATOM   922  C  C     . ARG A 1 116 ? -27.588 15.051  -8.827  1.00 30.83  ? 116  ARG A C     1 
ATOM   923  O  O     . ARG A 1 116 ? -27.568 14.844  -10.045 1.00 31.16  ? 116  ARG A O     1 
ATOM   924  C  CB    . ARG A 1 116 ? -29.970 15.321  -8.066  1.00 31.69  ? 116  ARG A CB    1 
ATOM   925  C  CG    . ARG A 1 116 ? -31.274 14.511  -8.058  1.00 34.35  ? 116  ARG A CG    1 
ATOM   926  C  CD    . ARG A 1 116 ? -32.516 15.403  -8.046  1.00 38.45  ? 116  ARG A CD    1 
ATOM   927  N  NE    . ARG A 1 116 ? -32.520 16.318  -6.897  1.00 42.01  ? 116  ARG A NE    1 
ATOM   928  C  CZ    . ARG A 1 116 ? -33.189 16.120  -5.759  1.00 43.39  ? 116  ARG A CZ    1 
ATOM   929  N  NH1   . ARG A 1 116 ? -33.938 15.034  -5.590  1.00 43.09  ? 116  ARG A NH1   1 
ATOM   930  N  NH2   . ARG A 1 116 ? -33.109 17.023  -4.785  1.00 43.69  ? 116  ARG A NH2   1 
ATOM   931  N  N     . ASP A 1 117 ? -26.674 15.791  -8.195  1.00 30.02  ? 117  ASP A N     1 
ATOM   932  C  CA    . ASP A 1 117 ? -25.616 16.546  -8.895  1.00 29.46  ? 117  ASP A CA    1 
ATOM   933  C  C     . ASP A 1 117 ? -24.440 16.902  -7.965  1.00 28.61  ? 117  ASP A C     1 
ATOM   934  O  O     . ASP A 1 117 ? -24.422 16.511  -6.795  1.00 27.91  ? 117  ASP A O     1 
ATOM   935  C  CB    . ASP A 1 117 ? -26.201 17.823  -9.510  1.00 30.05  ? 117  ASP A CB    1 
ATOM   936  C  CG    . ASP A 1 117 ? -26.879 18.714  -8.474  1.00 30.68  ? 117  ASP A CG    1 
ATOM   937  O  OD1   . ASP A 1 117 ? -27.873 19.377  -8.817  1.00 31.92  ? 117  ASP A OD1   1 
ATOM   938  O  OD2   . ASP A 1 117 ? -26.424 18.745  -7.311  1.00 32.28  ? 117  ASP A OD2   1 
ATOM   939  N  N     . TYR A 1 118 ? -23.469 17.650  -8.482  1.00 28.00  ? 118  TYR A N     1 
ATOM   940  C  CA    . TYR A 1 118 ? -22.245 17.947  -7.734  1.00 27.65  ? 118  TYR A CA    1 
ATOM   941  C  C     . TYR A 1 118 ? -22.495 18.921  -6.602  1.00 27.49  ? 118  TYR A C     1 
ATOM   942  O  O     . TYR A 1 118 ? -21.783 18.912  -5.592  1.00 27.15  ? 118  TYR A O     1 
ATOM   943  C  CB    . TYR A 1 118 ? -21.124 18.476  -8.653  1.00 27.73  ? 118  TYR A CB    1 
ATOM   944  C  CG    . TYR A 1 118 ? -20.416 17.397  -9.453  1.00 27.46  ? 118  TYR A CG    1 
ATOM   945  C  CD1   . TYR A 1 118 ? -19.963 16.233  -8.831  1.00 26.88  ? 118  TYR A CD1   1 
ATOM   946  C  CD2   . TYR A 1 118 ? -20.187 17.545  -10.829 1.00 27.93  ? 118  TYR A CD2   1 
ATOM   947  C  CE1   . TYR A 1 118 ? -19.314 15.231  -9.550  1.00 26.97  ? 118  TYR A CE1   1 
ATOM   948  C  CE2   . TYR A 1 118 ? -19.534 16.544  -11.566 1.00 27.50  ? 118  TYR A CE2   1 
ATOM   949  C  CZ    . TYR A 1 118 ? -19.099 15.385  -10.911 1.00 27.86  ? 118  TYR A CZ    1 
ATOM   950  O  OH    . TYR A 1 118 ? -18.444 14.377  -11.592 1.00 25.97  ? 118  TYR A OH    1 
ATOM   951  N  N     . ARG A 1 119 ? -23.495 19.777  -6.794  1.00 27.06  ? 119  ARG A N     1 
ATOM   952  C  CA    . ARG A 1 119 ? -23.904 20.740  -5.784  1.00 27.06  ? 119  ARG A CA    1 
ATOM   953  C  C     . ARG A 1 119 ? -24.371 20.000  -4.527  1.00 26.41  ? 119  ARG A C     1 
ATOM   954  O  O     . ARG A 1 119 ? -23.945 20.316  -3.416  1.00 26.26  ? 119  ARG A O     1 
ATOM   955  C  CB    . ARG A 1 119 ? -25.004 21.651  -6.360  1.00 26.51  ? 119  ARG A CB    1 
ATOM   956  C  CG    . ARG A 1 119 ? -25.611 22.627  -5.391  1.00 27.95  ? 119  ARG A CG    1 
ATOM   957  C  CD    . ARG A 1 119 ? -26.619 23.570  -6.089  1.00 28.96  ? 119  ARG A CD    1 
ATOM   958  N  NE    . ARG A 1 119 ? -25.933 24.535  -6.957  1.00 32.04  ? 119  ARG A NE    1 
ATOM   959  C  CZ    . ARG A 1 119 ? -25.317 25.644  -6.535  1.00 34.78  ? 119  ARG A CZ    1 
ATOM   960  N  NH1   . ARG A 1 119 ? -25.294 25.963  -5.241  1.00 34.72  ? 119  ARG A NH1   1 
ATOM   961  N  NH2   . ARG A 1 119 ? -24.713 26.445  -7.408  1.00 34.56  ? 119  ARG A NH2   1 
ATOM   962  N  N     . GLU A 1 120 ? -25.242 19.012  -4.721  1.00 26.47  ? 120  GLU A N     1 
ATOM   963  C  CA    . GLU A 1 120 ? -25.707 18.159  -3.626  1.00 26.66  ? 120  GLU A CA    1 
ATOM   964  C  C     . GLU A 1 120 ? -24.547 17.315  -3.087  1.00 26.31  ? 120  GLU A C     1 
ATOM   965  O  O     . GLU A 1 120 ? -24.417 17.126  -1.875  1.00 26.57  ? 120  GLU A O     1 
ATOM   966  C  CB    . GLU A 1 120 ? -26.851 17.256  -4.080  1.00 26.28  ? 120  GLU A CB    1 
ATOM   967  C  CG    . GLU A 1 120 ? -28.131 17.979  -4.451  1.00 29.19  ? 120  GLU A CG    1 
ATOM   968  C  CD    . GLU A 1 120 ? -29.310 17.026  -4.630  1.00 31.20  ? 120  GLU A CD    1 
ATOM   969  O  OE1   . GLU A 1 120 ? -29.194 15.828  -4.281  1.00 31.93  ? 120  GLU A OE1   1 
ATOM   970  O  OE2   . GLU A 1 120 ? -30.364 17.477  -5.116  1.00 34.24  ? 120  GLU A OE2   1 
ATOM   971  N  N     . ALA A 1 121 ? -23.691 16.835  -3.981  1.00 25.68  ? 121  ALA A N     1 
ATOM   972  C  CA    . ALA A 1 121 ? -22.504 16.086  -3.550  1.00 25.57  ? 121  ALA A CA    1 
ATOM   973  C  C     . ALA A 1 121 ? -21.598 16.907  -2.615  1.00 25.40  ? 121  ALA A C     1 
ATOM   974  O  O     . ALA A 1 121 ? -21.145 16.413  -1.578  1.00 24.35  ? 121  ALA A O     1 
ATOM   975  C  CB    . ALA A 1 121 ? -21.727 15.576  -4.753  1.00 25.68  ? 121  ALA A CB    1 
ATOM   976  N  N     . TYR A 1 122 ? -21.359 18.167  -2.981  1.00 25.70  ? 122  TYR A N     1 
ATOM   977  C  CA    . TYR A 1 122 ? -20.546 19.070  -2.170  1.00 26.00  ? 122  TYR A CA    1 
ATOM   978  C  C     . TYR A 1 122 ? -21.126 19.206  -0.749  1.00 26.32  ? 122  TYR A C     1 
ATOM   979  O  O     . TYR A 1 122 ? -20.402 19.088  0.244   1.00 25.81  ? 122  TYR A O     1 
ATOM   980  C  CB    . TYR A 1 122 ? -20.452 20.439  -2.860  1.00 26.44  ? 122  TYR A CB    1 
ATOM   981  C  CG    . TYR A 1 122 ? -19.399 21.362  -2.295  1.00 27.78  ? 122  TYR A CG    1 
ATOM   982  C  CD1   . TYR A 1 122 ? -18.190 21.553  -2.953  1.00 29.61  ? 122  TYR A CD1   1 
ATOM   983  C  CD2   . TYR A 1 122 ? -19.613 22.050  -1.104  1.00 29.53  ? 122  TYR A CD2   1 
ATOM   984  C  CE1   . TYR A 1 122 ? -17.215 22.411  -2.435  1.00 30.55  ? 122  TYR A CE1   1 
ATOM   985  C  CE2   . TYR A 1 122 ? -18.656 22.899  -0.581  1.00 29.69  ? 122  TYR A CE2   1 
ATOM   986  C  CZ    . TYR A 1 122 ? -17.459 23.080  -1.249  1.00 30.95  ? 122  TYR A CZ    1 
ATOM   987  O  OH    . TYR A 1 122 ? -16.518 23.938  -0.719  1.00 31.86  ? 122  TYR A OH    1 
ATOM   988  N  N     . ASN A 1 123 ? -22.433 19.445  -0.672  1.00 26.84  ? 123  ASN A N     1 
ATOM   989  C  CA    . ASN A 1 123 ? -23.147 19.520  0.604   1.00 28.26  ? 123  ASN A CA    1 
ATOM   990  C  C     . ASN A 1 123 ? -23.000 18.235  1.439   1.00 27.21  ? 123  ASN A C     1 
ATOM   991  O  O     . ASN A 1 123 ? -22.784 18.306  2.642   1.00 27.06  ? 123  ASN A O     1 
ATOM   992  C  CB    . ASN A 1 123 ? -24.629 19.897  0.391   1.00 29.20  ? 123  ASN A CB    1 
ATOM   993  C  CG    . ASN A 1 123 ? -24.919 21.395  0.636   1.00 34.98  ? 123  ASN A CG    1 
ATOM   994  O  OD1   . ASN A 1 123 ? -24.688 21.926  1.738   1.00 40.38  ? 123  ASN A OD1   1 
ATOM   995  N  ND2   . ASN A 1 123 ? -25.468 22.074  -0.385  1.00 38.84  ? 123  ASN A ND2   1 
ATOM   996  N  N     . LEU A 1 124 ? -23.093 17.071  0.800   1.00 27.08  ? 124  LEU A N     1 
ATOM   997  C  CA    . LEU A 1 124 ? -22.865 15.804  1.496   1.00 26.83  ? 124  LEU A CA    1 
ATOM   998  C  C     . LEU A 1 124 ? -21.444 15.695  2.034   1.00 26.79  ? 124  LEU A C     1 
ATOM   999  O  O     . LEU A 1 124 ? -21.237 15.221  3.152   1.00 26.45  ? 124  LEU A O     1 
ATOM   1000 C  CB    . LEU A 1 124 ? -23.172 14.607  0.592   1.00 27.67  ? 124  LEU A CB    1 
ATOM   1001 C  CG    . LEU A 1 124 ? -23.342 13.217  1.251   1.00 27.33  ? 124  LEU A CG    1 
ATOM   1002 C  CD1   . LEU A 1 124 ? -24.461 13.208  2.308   1.00 27.85  ? 124  LEU A CD1   1 
ATOM   1003 C  CD2   . LEU A 1 124 ? -23.609 12.167  0.188   1.00 27.47  ? 124  LEU A CD2   1 
ATOM   1004 N  N     . GLY A 1 125 ? -20.463 16.133  1.235   1.00 26.81  ? 125  GLY A N     1 
ATOM   1005 C  CA    . GLY A 1 125 ? -19.062 16.097  1.647   1.00 25.94  ? 125  GLY A CA    1 
ATOM   1006 C  C     . GLY A 1 125 ? -18.847 16.949  2.892   1.00 26.26  ? 125  GLY A C     1 
ATOM   1007 O  O     . GLY A 1 125 ? -18.121 16.552  3.796   1.00 25.55  ? 125  GLY A O     1 
ATOM   1008 N  N     . LEU A 1 126 ? -19.512 18.107  2.955   1.00 26.23  ? 126  LEU A N     1 
ATOM   1009 C  CA    . LEU A 1 126 ? -19.437 18.966  4.144   1.00 26.46  ? 126  LEU A CA    1 
ATOM   1010 C  C     . LEU A 1 126 ? -20.095 18.318  5.374   1.00 26.98  ? 126  LEU A C     1 
ATOM   1011 O  O     . LEU A 1 126 ? -19.543 18.368  6.470   1.00 26.61  ? 126  LEU A O     1 
ATOM   1012 C  CB    . LEU A 1 126 ? -20.031 20.353  3.865   1.00 26.66  ? 126  LEU A CB    1 
ATOM   1013 C  CG    . LEU A 1 126 ? -19.304 21.299  2.891   1.00 27.30  ? 126  LEU A CG    1 
ATOM   1014 C  CD1   . LEU A 1 126 ? -20.138 22.574  2.692   1.00 25.74  ? 126  LEU A CD1   1 
ATOM   1015 C  CD2   . LEU A 1 126 ? -17.885 21.680  3.350   1.00 28.34  ? 126  LEU A CD2   1 
ATOM   1016 N  N     . GLU A 1 127 ? -21.263 17.704  5.187   1.00 27.21  ? 127  GLU A N     1 
ATOM   1017 C  CA    . GLU A 1 127 ? -21.889 16.928  6.261   1.00 28.46  ? 127  GLU A CA    1 
ATOM   1018 C  C     . GLU A 1 127 ? -20.934 15.852  6.782   1.00 28.34  ? 127  GLU A C     1 
ATOM   1019 O  O     . GLU A 1 127 ? -20.697 15.757  7.998   1.00 28.29  ? 127  GLU A O     1 
ATOM   1020 C  CB    . GLU A 1 127 ? -23.201 16.295  5.803   1.00 28.72  ? 127  GLU A CB    1 
ATOM   1021 C  CG    . GLU A 1 127 ? -24.276 17.318  5.489   1.00 31.85  ? 127  GLU A CG    1 
ATOM   1022 C  CD    . GLU A 1 127 ? -25.631 16.702  5.202   1.00 35.53  ? 127  GLU A CD    1 
ATOM   1023 O  OE1   . GLU A 1 127 ? -26.496 17.437  4.680   1.00 37.24  ? 127  GLU A OE1   1 
ATOM   1024 O  OE2   . GLU A 1 127 ? -25.840 15.498  5.499   1.00 38.17  ? 127  GLU A OE2   1 
ATOM   1025 N  N     . ILE A 1 128 ? -20.378 15.061  5.867   1.00 27.76  ? 128  ILE A N     1 
ATOM   1026 C  CA    . ILE A 1 128 ? -19.401 14.033  6.244   1.00 27.71  ? 128  ILE A CA    1 
ATOM   1027 C  C     . ILE A 1 128 ? -18.260 14.632  7.067   1.00 27.55  ? 128  ILE A C     1 
ATOM   1028 O  O     . ILE A 1 128 ? -17.972 14.151  8.164   1.00 27.32  ? 128  ILE A O     1 
ATOM   1029 C  CB    . ILE A 1 128 ? -18.846 13.298  5.009   1.00 27.53  ? 128  ILE A CB    1 
ATOM   1030 C  CG1   . ILE A 1 128 ? -19.934 12.396  4.415   1.00 28.09  ? 128  ILE A CG1   1 
ATOM   1031 C  CG2   . ILE A 1 128 ? -17.610 12.453  5.386   1.00 27.44  ? 128  ILE A CG2   1 
ATOM   1032 C  CD1   . ILE A 1 128 ? -19.655 11.931  2.998   1.00 27.20  ? 128  ILE A CD1   1 
ATOM   1033 N  N     . LYS A 1 129 ? -17.632 15.685  6.539   1.00 27.45  ? 129  LYS A N     1 
ATOM   1034 C  CA    . LYS A 1 129 ? -16.517 16.358  7.212   1.00 27.52  ? 129  LYS A CA    1 
ATOM   1035 C  C     . LYS A 1 129 ? -16.894 16.821  8.624   1.00 27.42  ? 129  LYS A C     1 
ATOM   1036 O  O     . LYS A 1 129 ? -16.173 16.560  9.599   1.00 26.59  ? 129  LYS A O     1 
ATOM   1037 C  CB    . LYS A 1 129 ? -15.998 17.530  6.371   1.00 27.68  ? 129  LYS A CB    1 
ATOM   1038 C  CG    . LYS A 1 129 ? -14.994 17.125  5.317   1.00 28.07  ? 129  LYS A CG    1 
ATOM   1039 C  CD    . LYS A 1 129 ? -14.757 18.213  4.262   1.00 27.26  ? 129  LYS A CD    1 
ATOM   1040 C  CE    . LYS A 1 129 ? -14.135 19.473  4.841   1.00 27.00  ? 129  LYS A CE    1 
ATOM   1041 N  NZ    . LYS A 1 129 ? -12.754 19.213  5.338   1.00 28.80  ? 129  LYS A NZ    1 
ATOM   1042 N  N     . ASN A 1 130 ? -18.049 17.473  8.727   1.00 27.68  ? 130  ASN A N     1 
ATOM   1043 C  CA    . ASN A 1 130 ? -18.506 18.013  9.995   1.00 28.00  ? 130  ASN A CA    1 
ATOM   1044 C  C     . ASN A 1 130 ? -18.782 16.916  11.030  1.00 27.94  ? 130  ASN A C     1 
ATOM   1045 O  O     . ASN A 1 130 ? -18.383 17.032  12.180  1.00 28.04  ? 130  ASN A O     1 
ATOM   1046 C  CB    . ASN A 1 130 ? -19.718 18.934  9.776   1.00 28.17  ? 130  ASN A CB    1 
ATOM   1047 C  CG    . ASN A 1 130 ? -19.347 20.234  9.035   1.00 29.32  ? 130  ASN A CG    1 
ATOM   1048 O  OD1   . ASN A 1 130 ? -18.168 20.547  8.862   1.00 29.09  ? 130  ASN A OD1   1 
ATOM   1049 N  ND2   . ASN A 1 130 ? -20.358 20.993  8.606   1.00 28.62  ? 130  ASN A ND2   1 
ATOM   1050 N  N     . LYS A 1 131 ? -19.429 15.840  10.604  1.00 28.38  ? 131  LYS A N     1 
ATOM   1051 C  CA    . LYS A 1 131 ? -19.742 14.714  11.492  1.00 29.26  ? 131  LYS A CA    1 
ATOM   1052 C  C     . LYS A 1 131 ? -18.473 14.034  12.025  1.00 28.96  ? 131  LYS A C     1 
ATOM   1053 O  O     . LYS A 1 131 ? -18.394 13.707  13.208  1.00 29.09  ? 131  LYS A O     1 
ATOM   1054 C  CB    . LYS A 1 131 ? -20.623 13.702  10.765  1.00 29.14  ? 131  LYS A CB    1 
ATOM   1055 C  CG    . LYS A 1 131 ? -21.061 12.485  11.598  1.00 32.05  ? 131  LYS A CG    1 
ATOM   1056 C  CD    . LYS A 1 131 ? -22.208 12.791  12.564  1.00 36.03  ? 131  LYS A CD    1 
ATOM   1057 C  CE    . LYS A 1 131 ? -23.551 12.829  11.855  1.00 38.10  ? 131  LYS A CE    1 
ATOM   1058 N  NZ    . LYS A 1 131 ? -24.689 12.588  12.804  1.00 40.91  ? 131  LYS A NZ    1 
ATOM   1059 N  N     . ILE A 1 132 ? -17.491 13.818  11.157  1.00 28.71  ? 132  ILE A N     1 
ATOM   1060 C  CA    . ILE A 1 132 ? -16.205 13.227  11.583  1.00 28.92  ? 132  ILE A CA    1 
ATOM   1061 C  C     . ILE A 1 132 ? -15.484 14.140  12.588  1.00 29.31  ? 132  ILE A C     1 
ATOM   1062 O  O     . ILE A 1 132 ? -14.983 13.675  13.622  1.00 29.14  ? 132  ILE A O     1 
ATOM   1063 C  CB    . ILE A 1 132 ? -15.293 12.875  10.381  1.00 28.73  ? 132  ILE A CB    1 
ATOM   1064 C  CG1   . ILE A 1 132 ? -15.916 11.743  9.551   1.00 27.91  ? 132  ILE A CG1   1 
ATOM   1065 C  CG2   . ILE A 1 132 ? -13.882 12.475  10.860  1.00 28.77  ? 132  ILE A CG2   1 
ATOM   1066 C  CD1   . ILE A 1 132 ? -15.342 11.598  8.136   1.00 26.44  ? 132  ILE A CD1   1 
ATOM   1067 N  N     . LEU A 1 133 ? -15.480 15.439  12.312  1.00 29.73  ? 133  LEU A N     1 
ATOM   1068 C  CA    . LEU A 1 133 ? -14.876 16.398  13.238  1.00 30.61  ? 133  LEU A CA    1 
ATOM   1069 C  C     . LEU A 1 133 ? -15.599 16.413  14.602  1.00 31.22  ? 133  LEU A C     1 
ATOM   1070 O  O     . LEU A 1 133 ? -14.953 16.446  15.646  1.00 30.87  ? 133  LEU A O     1 
ATOM   1071 C  CB    . LEU A 1 133 ? -14.796 17.804  12.617  1.00 30.42  ? 133  LEU A CB    1 
ATOM   1072 C  CG    . LEU A 1 133 ? -14.045 18.885  13.414  1.00 30.90  ? 133  LEU A CG    1 
ATOM   1073 C  CD1   . LEU A 1 133 ? -12.572 18.551  13.608  1.00 31.93  ? 133  LEU A CD1   1 
ATOM   1074 C  CD2   . LEU A 1 133 ? -14.176 20.254  12.763  1.00 30.49  ? 133  LEU A CD2   1 
ATOM   1075 N  N     . GLU A 1 134 ? -16.926 16.363  14.591  1.00 32.52  ? 134  GLU A N     1 
ATOM   1076 C  CA    . GLU A 1 134 ? -17.716 16.372  15.843  1.00 34.31  ? 134  GLU A CA    1 
ATOM   1077 C  C     . GLU A 1 134 ? -17.500 15.113  16.667  1.00 34.34  ? 134  GLU A C     1 
ATOM   1078 O  O     . GLU A 1 134 ? -17.304 15.190  17.883  1.00 34.72  ? 134  GLU A O     1 
ATOM   1079 C  CB    . GLU A 1 134 ? -19.210 16.480  15.556  1.00 34.71  ? 134  GLU A CB    1 
ATOM   1080 C  CG    . GLU A 1 134 ? -19.650 17.807  14.999  1.00 38.91  ? 134  GLU A CG    1 
ATOM   1081 C  CD    . GLU A 1 134 ? -21.038 17.759  14.363  1.00 43.22  ? 134  GLU A CD    1 
ATOM   1082 O  OE1   . GLU A 1 134 ? -21.700 16.689  14.428  1.00 44.90  ? 134  GLU A OE1   1 
ATOM   1083 O  OE2   . GLU A 1 134 ? -21.457 18.799  13.796  1.00 44.97  ? 134  GLU A OE2   1 
ATOM   1084 N  N     . LYS A 1 135 ? -17.554 13.962  16.004  1.00 34.44  ? 135  LYS A N     1 
ATOM   1085 C  CA    . LYS A 1 135 ? -17.480 12.678  16.679  1.00 35.20  ? 135  LYS A CA    1 
ATOM   1086 C  C     . LYS A 1 135 ? -16.054 12.231  17.028  1.00 35.66  ? 135  LYS A C     1 
ATOM   1087 O  O     . LYS A 1 135 ? -15.850 11.571  18.047  1.00 35.78  ? 135  LYS A O     1 
ATOM   1088 C  CB    . LYS A 1 135 ? -18.215 11.609  15.868  1.00 35.44  ? 135  LYS A CB    1 
ATOM   1089 C  CG    . LYS A 1 135 ? -19.739 11.686  15.982  1.00 37.11  ? 135  LYS A CG    1 
ATOM   1090 C  CD    . LYS A 1 135 ? -20.246 10.606  16.925  1.00 40.51  ? 135  LYS A CD    1 
ATOM   1091 C  CE    . LYS A 1 135 ? -21.324 11.113  17.887  1.00 42.41  ? 135  LYS A CE    1 
ATOM   1092 N  NZ    . LYS A 1 135 ? -22.705 10.969  17.352  1.00 44.19  ? 135  LYS A NZ    1 
ATOM   1093 N  N     . GLU A 1 136 ? -15.070 12.605  16.209  1.00 35.27  ? 136  GLU A N     1 
ATOM   1094 C  CA    . GLU A 1 136 ? -13.695 12.126  16.408  1.00 34.90  ? 136  GLU A CA    1 
ATOM   1095 C  C     . GLU A 1 136 ? -12.603 13.197  16.545  1.00 34.29  ? 136  GLU A C     1 
ATOM   1096 O  O     . GLU A 1 136 ? -11.434 12.868  16.792  1.00 34.66  ? 136  GLU A O     1 
ATOM   1097 C  CB    . GLU A 1 136 ? -13.330 11.142  15.306  1.00 35.12  ? 136  GLU A CB    1 
ATOM   1098 C  CG    . GLU A 1 136 ? -14.177 9.884   15.310  1.00 36.89  ? 136  GLU A CG    1 
ATOM   1099 C  CD    . GLU A 1 136 ? -13.853 8.952   16.482  1.00 39.21  ? 136  GLU A CD    1 
ATOM   1100 O  OE1   . GLU A 1 136 ? -12.743 9.049   17.063  1.00 39.81  ? 136  GLU A OE1   1 
ATOM   1101 O  OE2   . GLU A 1 136 ? -14.718 8.122   16.817  1.00 38.89  ? 136  GLU A OE2   1 
ATOM   1102 N  N     . LYS A 1 137 ? -12.971 14.467  16.404  1.00 32.75  ? 137  LYS A N     1 
ATOM   1103 C  CA    . LYS A 1 137 ? -11.991 15.568  16.407  1.00 32.68  ? 137  LYS A CA    1 
ATOM   1104 C  C     . LYS A 1 137 ? -10.909 15.398  15.319  1.00 31.27  ? 137  LYS A C     1 
ATOM   1105 O  O     . LYS A 1 137 ? -9.775  15.863  15.479  1.00 31.45  ? 137  LYS A O     1 
ATOM   1106 C  CB    . LYS A 1 137 ? -11.359 15.756  17.806  1.00 32.79  ? 137  LYS A CB    1 
ATOM   1107 C  CG    . LYS A 1 137 ? -12.356 16.136  18.921  1.00 35.59  ? 137  LYS A CG    1 
ATOM   1108 C  CD    . LYS A 1 137 ? -12.883 17.584  18.779  1.00 39.30  ? 137  LYS A CD    1 
ATOM   1109 C  CE    . LYS A 1 137 ? -11.994 18.648  19.478  1.00 41.06  ? 137  LYS A CE    1 
ATOM   1110 N  NZ    . LYS A 1 137 ? -12.354 18.909  20.917  1.00 41.79  ? 137  LYS A NZ    1 
ATOM   1111 N  N     . ILE A 1 138 ? -11.274 14.740  14.217  1.00 29.61  ? 138  ILE A N     1 
ATOM   1112 C  CA    . ILE A 1 138 ? -10.351 14.486  13.110  1.00 28.30  ? 138  ILE A CA    1 
ATOM   1113 C  C     . ILE A 1 138 ? -10.779 15.257  11.850  1.00 27.42  ? 138  ILE A C     1 
ATOM   1114 O  O     . ILE A 1 138 ? -11.934 15.173  11.422  1.00 26.68  ? 138  ILE A O     1 
ATOM   1115 C  CB    . ILE A 1 138 ? -10.221 12.954  12.811  1.00 28.80  ? 138  ILE A CB    1 
ATOM   1116 C  CG1   . ILE A 1 138 ? -9.449  12.229  13.930  1.00 29.43  ? 138  ILE A CG1   1 
ATOM   1117 C  CG2   . ILE A 1 138 ? -9.550  12.695  11.468  1.00 28.00  ? 138  ILE A CG2   1 
ATOM   1118 C  CD1   . ILE A 1 138 ? -8.025  12.759  14.182  1.00 29.81  ? 138  ILE A CD1   1 
ATOM   1119 N  N     . THR A 1 139 ? -9.855  16.019  11.272  1.00 25.82  ? 139  THR A N     1 
ATOM   1120 C  CA    . THR A 1 139 ? -10.125 16.669  9.992   1.00 25.38  ? 139  THR A CA    1 
ATOM   1121 C  C     . THR A 1 139 ? -9.757  15.731  8.847   1.00 24.92  ? 139  THR A C     1 
ATOM   1122 O  O     . THR A 1 139 ? -8.768  14.981  8.913   1.00 24.81  ? 139  THR A O     1 
ATOM   1123 C  CB    . THR A 1 139 ? -9.418  18.032  9.819   1.00 24.62  ? 139  THR A CB    1 
ATOM   1124 O  OG1   . THR A 1 139 ? -8.005  17.828  9.674   1.00 25.92  ? 139  THR A OG1   1 
ATOM   1125 C  CG2   . THR A 1 139 ? -9.694  18.963  11.022  1.00 25.62  ? 139  THR A CG2   1 
ATOM   1126 N  N     . VAL A 1 140 ? -10.570 15.783  7.803   1.00 24.36  ? 140  VAL A N     1 
ATOM   1127 C  CA    . VAL A 1 140 ? -10.357 14.985  6.615   1.00 24.24  ? 140  VAL A CA    1 
ATOM   1128 C  C     . VAL A 1 140 ? -10.510 15.840  5.365   1.00 24.50  ? 140  VAL A C     1 
ATOM   1129 O  O     . VAL A 1 140 ? -11.058 16.943  5.394   1.00 25.22  ? 140  VAL A O     1 
ATOM   1130 C  CB    . VAL A 1 140 ? -11.348 13.776  6.551   1.00 24.42  ? 140  VAL A CB    1 
ATOM   1131 C  CG1   . VAL A 1 140 ? -11.351 12.982  7.880   1.00 22.96  ? 140  VAL A CG1   1 
ATOM   1132 C  CG2   . VAL A 1 140 ? -12.752 14.246  6.207   1.00 23.72  ? 140  VAL A CG2   1 
ATOM   1133 N  N     . THR A 1 141 ? -10.007 15.335  4.260   1.00 24.16  ? 141  THR A N     1 
ATOM   1134 C  CA    . THR A 1 141 ? -10.171 16.023  3.005   1.00 23.76  ? 141  THR A CA    1 
ATOM   1135 C  C     . THR A 1 141 ? -11.048 15.176  2.118   1.00 23.14  ? 141  THR A C     1 
ATOM   1136 O  O     . THR A 1 141 ? -10.851 13.966  2.039   1.00 23.17  ? 141  THR A O     1 
ATOM   1137 C  CB    . THR A 1 141 ? -8.809  16.260  2.360   1.00 23.43  ? 141  THR A CB    1 
ATOM   1138 O  OG1   . THR A 1 141 ? -8.080  17.159  3.200   1.00 24.15  ? 141  THR A OG1   1 
ATOM   1139 C  CG2   . THR A 1 141 ? -8.954  16.885  0.994   1.00 22.48  ? 141  THR A CG2   1 
ATOM   1140 N  N     . VAL A 1 142 ? -12.011 15.829  1.467   1.00 22.19  ? 142  VAL A N     1 
ATOM   1141 C  CA    . VAL A 1 142 ? -12.954 15.185  0.568   1.00 21.12  ? 142  VAL A CA    1 
ATOM   1142 C  C     . VAL A 1 142 ? -12.699 15.567  -0.889  1.00 20.57  ? 142  VAL A C     1 
ATOM   1143 O  O     . VAL A 1 142 ? -12.537 16.752  -1.221  1.00 20.11  ? 142  VAL A O     1 
ATOM   1144 C  CB    . VAL A 1 142 ? -14.433 15.494  0.981   1.00 21.40  ? 142  VAL A CB    1 
ATOM   1145 C  CG1   . VAL A 1 142 ? -15.408 15.080  -0.099  1.00 19.96  ? 142  VAL A CG1   1 
ATOM   1146 C  CG2   . VAL A 1 142 ? -14.783 14.777  2.300   1.00 22.94  ? 142  VAL A CG2   1 
ATOM   1147 N  N     . GLY A 1 143 ? -12.653 14.552  -1.746  1.00 20.10  ? 143  GLY A N     1 
ATOM   1148 C  CA    . GLY A 1 143 ? -12.564 14.731  -3.187  1.00 20.38  ? 143  GLY A CA    1 
ATOM   1149 C  C     . GLY A 1 143 ? -13.805 14.149  -3.863  1.00 21.07  ? 143  GLY A C     1 
ATOM   1150 O  O     . GLY A 1 143 ? -14.266 13.056  -3.506  1.00 20.98  ? 143  GLY A O     1 
ATOM   1151 N  N     . ILE A 1 144 ? -14.349 14.882  -4.834  1.00 20.54  ? 144  ILE A N     1 
ATOM   1152 C  CA    . ILE A 1 144 ? -15.581 14.472  -5.508  1.00 20.60  ? 144  ILE A CA    1 
ATOM   1153 C  C     . ILE A 1 144 ? -15.423 14.587  -7.015  1.00 20.73  ? 144  ILE A C     1 
ATOM   1154 O  O     . ILE A 1 144 ? -15.051 15.645  -7.530  1.00 21.17  ? 144  ILE A O     1 
ATOM   1155 C  CB    . ILE A 1 144 ? -16.791 15.328  -5.068  1.00 20.84  ? 144  ILE A CB    1 
ATOM   1156 C  CG1   . ILE A 1 144 ? -17.029 15.198  -3.560  1.00 20.37  ? 144  ILE A CG1   1 
ATOM   1157 C  CG2   . ILE A 1 144 ? -18.055 14.953  -5.899  1.00 19.86  ? 144  ILE A CG2   1 
ATOM   1158 C  CD1   . ILE A 1 144 ? -17.908 16.327  -2.968  1.00 21.79  ? 144  ILE A CD1   1 
ATOM   1159 N  N     . SER A 1 145 ? -15.685 13.496  -7.725  1.00 20.36  ? 145  SER A N     1 
ATOM   1160 C  CA    . SER A 1 145 ? -15.645 13.537  -9.190  1.00 20.24  ? 145  SER A CA    1 
ATOM   1161 C  C     . SER A 1 145 ? -16.440 12.378  -9.786  1.00 20.85  ? 145  SER A C     1 
ATOM   1162 O  O     . SER A 1 145 ? -17.219 11.732  -9.083  1.00 20.73  ? 145  SER A O     1 
ATOM   1163 C  CB    . SER A 1 145 ? -14.183 13.511  -9.686  1.00 20.09  ? 145  SER A CB    1 
ATOM   1164 O  OG    . SER A 1 145 ? -14.093 13.976  -11.026 1.00 19.11  ? 145  SER A OG    1 
ATOM   1165 N  N     . LYS A 1 146 ? -16.216 12.100  -11.073 1.00 21.33  ? 146  LYS A N     1 
ATOM   1166 C  CA    . LYS A 1 146 ? -17.040 11.139  -11.821 1.00 22.81  ? 146  LYS A CA    1 
ATOM   1167 C  C     . LYS A 1 146 ? -16.588 9.671   -11.665 1.00 23.23  ? 146  LYS A C     1 
ATOM   1168 O  O     . LYS A 1 146 ? -17.355 8.749   -11.956 1.00 22.89  ? 146  LYS A O     1 
ATOM   1169 C  CB    . LYS A 1 146 ? -17.105 11.541  -13.304 1.00 22.72  ? 146  LYS A CB    1 
ATOM   1170 C  CG    . LYS A 1 146 ? -15.754 11.390  -14.038 1.00 24.75  ? 146  LYS A CG    1 
ATOM   1171 C  CD    . LYS A 1 146 ? -15.675 12.169  -15.345 1.00 25.93  ? 146  LYS A CD    1 
ATOM   1172 C  CE    . LYS A 1 146 ? -16.778 11.795  -16.294 1.00 27.56  ? 146  LYS A CE    1 
ATOM   1173 N  NZ    . LYS A 1 146 ? -16.546 12.409  -17.629 1.00 27.65  ? 146  LYS A NZ    1 
ATOM   1174 N  N     . ASN A 1 147 ? -15.349 9.471   -11.212 1.00 23.05  ? 147  ASN A N     1 
ATOM   1175 C  CA    . ASN A 1 147 ? -14.795 8.146   -10.954 1.00 23.67  ? 147  ASN A CA    1 
ATOM   1176 C  C     . ASN A 1 147 ? -13.797 8.191   -9.782  1.00 23.99  ? 147  ASN A C     1 
ATOM   1177 O  O     . ASN A 1 147 ? -13.494 9.275   -9.272  1.00 24.03  ? 147  ASN A O     1 
ATOM   1178 C  CB    . ASN A 1 147 ? -14.144 7.574   -12.227 1.00 23.64  ? 147  ASN A CB    1 
ATOM   1179 C  CG    . ASN A 1 147 ? -12.994 8.421   -12.731 1.00 24.68  ? 147  ASN A CG    1 
ATOM   1180 O  OD1   . ASN A 1 147 ? -12.094 8.786   -11.968 1.00 26.12  ? 147  ASN A OD1   1 
ATOM   1181 N  ND2   . ASN A 1 147 ? -13.001 8.725   -14.033 1.00 23.68  ? 147  ASN A ND2   1 
ATOM   1182 N  N     . LYS A 1 148 ? -13.280 7.033   -9.371  1.00 23.65  ? 148  LYS A N     1 
ATOM   1183 C  CA    . LYS A 1 148 ? -12.379 6.953   -8.212  1.00 23.88  ? 148  LYS A CA    1 
ATOM   1184 C  C     . LYS A 1 148 ? -11.069 7.725   -8.372  1.00 23.19  ? 148  LYS A C     1 
ATOM   1185 O  O     . LYS A 1 148 ? -10.565 8.314   -7.406  1.00 23.03  ? 148  LYS A O     1 
ATOM   1186 C  CB    . LYS A 1 148 ? -12.019 5.498   -7.910  1.00 23.87  ? 148  LYS A CB    1 
ATOM   1187 C  CG    . LYS A 1 148 ? -13.174 4.645   -7.423  1.00 26.68  ? 148  LYS A CG    1 
ATOM   1188 C  CD    . LYS A 1 148 ? -12.636 3.333   -6.855  1.00 29.40  ? 148  LYS A CD    1 
ATOM   1189 C  CE    . LYS A 1 148 ? -12.590 2.250   -7.905  1.00 29.75  ? 148  LYS A CE    1 
ATOM   1190 N  NZ    . LYS A 1 148 ? -12.295 0.933   -7.269  1.00 31.52  ? 148  LYS A NZ    1 
ATOM   1191 N  N     . VAL A 1 149 ? -10.483 7.659   -9.566  1.00 22.70  ? 149  VAL A N     1 
ATOM   1192 C  CA    . VAL A 1 149 ? -9.170  8.256   -9.784  1.00 22.33  ? 149  VAL A CA    1 
ATOM   1193 C  C     . VAL A 1 149 ? -9.260  9.766   -9.642  1.00 22.36  ? 149  VAL A C     1 
ATOM   1194 O  O     . VAL A 1 149 ? -8.517  10.342  -8.857  1.00 21.81  ? 149  VAL A O     1 
ATOM   1195 C  CB    . VAL A 1 149 ? -8.529  7.838   -11.133 1.00 22.88  ? 149  VAL A CB    1 
ATOM   1196 C  CG1   . VAL A 1 149 ? -7.155  8.485   -11.305 1.00 22.27  ? 149  VAL A CG1   1 
ATOM   1197 C  CG2   . VAL A 1 149 ? -8.395  6.301   -11.191 1.00 23.53  ? 149  VAL A CG2   1 
ATOM   1198 N  N     . PHE A 1 150 ? -10.195 10.399  -10.355 1.00 21.80  ? 150  PHE A N     1 
ATOM   1199 C  CA    . PHE A 1 150 ? -10.334 11.846  -10.255 1.00 22.16  ? 150  PHE A CA    1 
ATOM   1200 C  C     . PHE A 1 150 ? -10.828 12.351  -8.898  1.00 21.95  ? 150  PHE A C     1 
ATOM   1201 O  O     . PHE A 1 150 ? -10.473 13.451  -8.491  1.00 22.69  ? 150  PHE A O     1 
ATOM   1202 C  CB    . PHE A 1 150 ? -11.129 12.398  -11.423 1.00 22.17  ? 150  PHE A CB    1 
ATOM   1203 C  CG    . PHE A 1 150 ? -10.320 12.454  -12.678 1.00 24.38  ? 150  PHE A CG    1 
ATOM   1204 C  CD1   . PHE A 1 150 ? -9.346  13.441  -12.845 1.00 26.04  ? 150  PHE A CD1   1 
ATOM   1205 C  CD2   . PHE A 1 150 ? -10.489 11.505  -13.674 1.00 25.13  ? 150  PHE A CD2   1 
ATOM   1206 C  CE1   . PHE A 1 150 ? -8.577  13.493  -13.998 1.00 27.04  ? 150  PHE A CE1   1 
ATOM   1207 C  CE2   . PHE A 1 150 ? -9.721  11.552  -14.834 1.00 26.15  ? 150  PHE A CE2   1 
ATOM   1208 C  CZ    . PHE A 1 150 ? -8.760  12.551  -14.995 1.00 27.16  ? 150  PHE A CZ    1 
ATOM   1209 N  N     . ALA A 1 151 ? -11.601 11.524  -8.201  1.00 21.73  ? 151  ALA A N     1 
ATOM   1210 C  CA    . ALA A 1 151 ? -11.976 11.791  -6.822  1.00 22.47  ? 151  ALA A CA    1 
ATOM   1211 C  C     . ALA A 1 151 ? -10.748 11.821  -5.918  1.00 22.67  ? 151  ALA A C     1 
ATOM   1212 O  O     . ALA A 1 151 ? -10.668 12.643  -5.016  1.00 23.27  ? 151  ALA A O     1 
ATOM   1213 C  CB    . ALA A 1 151 ? -12.969 10.742  -6.335  1.00 22.70  ? 151  ALA A CB    1 
ATOM   1214 N  N     . LYS A 1 152 ? -9.795  10.909  -6.153  1.00 22.89  ? 152  LYS A N     1 
ATOM   1215 C  CA    . LYS A 1 152 ? -8.581  10.870  -5.357  1.00 23.01  ? 152  LYS A CA    1 
ATOM   1216 C  C     . LYS A 1 152 ? -7.696  12.084  -5.697  1.00 22.84  ? 152  LYS A C     1 
ATOM   1217 O  O     . LYS A 1 152 ? -7.137  12.729  -4.801  1.00 22.00  ? 152  LYS A O     1 
ATOM   1218 C  CB    . LYS A 1 152 ? -7.812  9.563   -5.595  1.00 23.72  ? 152  LYS A CB    1 
ATOM   1219 C  CG    . LYS A 1 152 ? -6.583  9.398   -4.696  1.00 25.54  ? 152  LYS A CG    1 
ATOM   1220 C  CD    . LYS A 1 152 ? -5.889  8.081   -4.984  1.00 28.94  ? 152  LYS A CD    1 
ATOM   1221 C  CE    . LYS A 1 152 ? -5.618  7.298   -3.725  1.00 32.65  ? 152  LYS A CE    1 
ATOM   1222 N  NZ    . LYS A 1 152 ? -4.561  7.904   -2.903  1.00 34.40  ? 152  LYS A NZ    1 
ATOM   1223 N  N     . ILE A 1 153 ? -7.558  12.367  -6.995  1.00 21.89  ? 153  ILE A N     1 
ATOM   1224 C  CA    . ILE A 1 153 ? -6.864  13.581  -7.442  1.00 22.33  ? 153  ILE A CA    1 
ATOM   1225 C  C     . ILE A 1 153 ? -7.476  14.878  -6.843  1.00 22.43  ? 153  ILE A C     1 
ATOM   1226 O  O     . ILE A 1 153 ? -6.739  15.783  -6.417  1.00 22.22  ? 153  ILE A O     1 
ATOM   1227 C  CB    . ILE A 1 153 ? -6.800  13.688  -8.979  1.00 22.42  ? 153  ILE A CB    1 
ATOM   1228 C  CG1   . ILE A 1 153 ? -5.951  12.557  -9.574  1.00 22.11  ? 153  ILE A CG1   1 
ATOM   1229 C  CG2   . ILE A 1 153 ? -6.215  15.068  -9.379  1.00 22.24  ? 153  ILE A CG2   1 
ATOM   1230 C  CD1   . ILE A 1 153 ? -6.205  12.304  -11.078 1.00 21.30  ? 153  ILE A CD1   1 
ATOM   1231 N  N     . ALA A 1 154 ? -8.810  14.964  -6.803  1.00 22.52  ? 154  ALA A N     1 
ATOM   1232 C  CA    . ALA A 1 154 ? -9.476  16.122  -6.193  1.00 23.16  ? 154  ALA A CA    1 
ATOM   1233 C  C     . ALA A 1 154 ? -9.081  16.287  -4.712  1.00 24.10  ? 154  ALA A C     1 
ATOM   1234 O  O     . ALA A 1 154 ? -8.837  17.401  -4.244  1.00 23.25  ? 154  ALA A O     1 
ATOM   1235 C  CB    . ALA A 1 154 ? -10.992 16.010  -6.327  1.00 22.55  ? 154  ALA A CB    1 
ATOM   1236 N  N     . ALA A 1 155 ? -9.027  15.179  -3.987  1.00 24.77  ? 155  ALA A N     1 
ATOM   1237 C  CA    . ALA A 1 155 ? -8.584  15.218  -2.593  1.00 26.51  ? 155  ALA A CA    1 
ATOM   1238 C  C     . ALA A 1 155 ? -7.127  15.678  -2.473  1.00 27.71  ? 155  ALA A C     1 
ATOM   1239 O  O     . ALA A 1 155 ? -6.808  16.478  -1.605  1.00 28.24  ? 155  ALA A O     1 
ATOM   1240 C  CB    . ALA A 1 155 ? -8.787  13.873  -1.926  1.00 25.93  ? 155  ALA A CB    1 
ATOM   1241 N  N     . ASP A 1 156 ? -6.255  15.184  -3.346  1.00 29.11  ? 156  ASP A N     1 
ATOM   1242 C  CA    . ASP A 1 156 ? -4.843  15.584  -3.349  1.00 30.85  ? 156  ASP A CA    1 
ATOM   1243 C  C     . ASP A 1 156 ? -4.717  17.098  -3.529  1.00 31.49  ? 156  ASP A C     1 
ATOM   1244 O  O     . ASP A 1 156 ? -3.894  17.731  -2.868  1.00 31.36  ? 156  ASP A O     1 
ATOM   1245 C  CB    . ASP A 1 156 ? -4.062  14.885  -4.472  1.00 31.18  ? 156  ASP A CB    1 
ATOM   1246 C  CG    . ASP A 1 156 ? -3.852  13.392  -4.218  1.00 35.07  ? 156  ASP A CG    1 
ATOM   1247 O  OD1   . ASP A 1 156 ? -3.914  12.958  -3.048  1.00 35.44  ? 156  ASP A OD1   1 
ATOM   1248 O  OD2   . ASP A 1 156 ? -3.613  12.650  -5.212  1.00 38.90  ? 156  ASP A OD2   1 
ATOM   1249 N  N     . MET A 1 157 ? -5.553  17.665  -4.403  1.00 31.14  ? 157  MET A N     1 
ATOM   1250 C  CA    . MET A 1 157 ? -5.553  19.105  -4.668  1.00 31.79  ? 157  MET A CA    1 
ATOM   1251 C  C     . MET A 1 157 ? -6.012  19.943  -3.495  1.00 31.95  ? 157  MET A C     1 
ATOM   1252 O  O     . MET A 1 157 ? -5.540  21.055  -3.338  1.00 32.44  ? 157  MET A O     1 
ATOM   1253 C  CB    . MET A 1 157 ? -6.424  19.445  -5.880  1.00 31.97  ? 157  MET A CB    1 
ATOM   1254 C  CG    . MET A 1 157 ? -5.852  18.913  -7.169  1.00 33.64  ? 157  MET A CG    1 
ATOM   1255 S  SD    . MET A 1 157 ? -6.966  19.165  -8.571  1.00 38.49  ? 157  MET A SD    1 
ATOM   1256 C  CE    . MET A 1 157 ? -5.762  18.728  -9.813  1.00 38.57  ? 157  MET A CE    1 
ATOM   1257 N  N     . ALA A 1 158 ? -6.940  19.432  -2.691  1.00 31.23  ? 158  ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 158 ? -7.483  20.215  -1.577  1.00 31.51  ? 158  ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 158 ? -6.840  19.952  -0.193  1.00 31.14  ? 158  ALA A C     1 
ATOM   1260 O  O     . ALA A 1 158 ? -7.221  20.589  0.783   1.00 31.23  ? 158  ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 158 ? -9.012  20.051  -1.512  1.00 30.91  ? 158  ALA A CB    1 
ATOM   1262 N  N     . LYS A 1 159 ? -5.896  19.011  -0.113  1.00 31.35  ? 159  LYS A N     1 
ATOM   1263 C  CA    . LYS A 1 159 ? -5.221  18.629  1.154   1.00 32.52  ? 159  LYS A CA    1 
ATOM   1264 C  C     . LYS A 1 159 ? -4.466  19.822  1.756   1.00 32.26  ? 159  LYS A C     1 
ATOM   1265 O  O     . LYS A 1 159 ? -3.894  20.587  1.002   1.00 33.06  ? 159  LYS A O     1 
ATOM   1266 C  CB    . LYS A 1 159 ? -4.196  17.505  0.890   1.00 32.37  ? 159  LYS A CB    1 
ATOM   1267 C  CG    . LYS A 1 159 ? -4.730  16.102  1.001   1.00 33.92  ? 159  LYS A CG    1 
ATOM   1268 C  CD    . LYS A 1 159 ? -3.591  15.058  1.019   1.00 33.33  ? 159  LYS A CD    1 
ATOM   1269 C  CE    . LYS A 1 159 ? -4.127  13.653  0.691   1.00 34.79  ? 159  LYS A CE    1 
ATOM   1270 N  NZ    . LYS A 1 159 ? -3.197  12.495  1.010   1.00 31.21  ? 159  LYS A NZ    1 
ATOM   1271 N  N     . PRO A 1 160 ? -4.480  20.001  3.102   1.00 32.45  ? 160  PRO A N     1 
ATOM   1272 C  CA    . PRO A 1 160 ? -5.257  19.305  4.149   1.00 31.60  ? 160  PRO A CA    1 
ATOM   1273 C  C     . PRO A 1 160 ? -6.575  20.022  4.457   1.00 30.86  ? 160  PRO A C     1 
ATOM   1274 O  O     . PRO A 1 160 ? -6.755  21.168  4.063   1.00 30.64  ? 160  PRO A O     1 
ATOM   1275 C  CB    . PRO A 1 160 ? -4.332  19.383  5.369   1.00 32.11  ? 160  PRO A CB    1 
ATOM   1276 C  CG    . PRO A 1 160 ? -3.606  20.718  5.197   1.00 32.25  ? 160  PRO A CG    1 
ATOM   1277 C  CD    . PRO A 1 160 ? -3.515  20.962  3.687   1.00 32.69  ? 160  PRO A CD    1 
ATOM   1278 N  N     . ASN A 1 161 ? -7.480  19.333  5.150   1.00 30.19  ? 161  ASN A N     1 
ATOM   1279 C  CA    . ASN A 1 161 ? -8.771  19.870  5.598   1.00 29.59  ? 161  ASN A CA    1 
ATOM   1280 C  C     . ASN A 1 161 ? -9.574  20.562  4.505   1.00 29.03  ? 161  ASN A C     1 
ATOM   1281 O  O     . ASN A 1 161 ? -10.145 21.641  4.699   1.00 28.71  ? 161  ASN A O     1 
ATOM   1282 C  CB    . ASN A 1 161 ? -8.572  20.785  6.827   1.00 30.62  ? 161  ASN A CB    1 
ATOM   1283 C  CG    . ASN A 1 161 ? -9.863  21.034  7.608   1.00 31.74  ? 161  ASN A CG    1 
ATOM   1284 O  OD1   . ASN A 1 161 ? -10.919 20.447  7.344   1.00 33.17  ? 161  ASN A OD1   1 
ATOM   1285 N  ND2   . ASN A 1 161 ? -9.772  21.919  8.588   1.00 36.28  ? 161  ASN A ND2   1 
ATOM   1286 N  N     . GLY A 1 162 ? -9.627  19.943  3.335   1.00 28.32  ? 162  GLY A N     1 
ATOM   1287 C  CA    . GLY A 1 162 ? -10.302 20.597  2.221   1.00 26.31  ? 162  GLY A CA    1 
ATOM   1288 C  C     . GLY A 1 162 ? -11.500 19.825  1.712   1.00 25.65  ? 162  GLY A C     1 
ATOM   1289 O  O     . GLY A 1 162 ? -11.882 18.784  2.270   1.00 25.09  ? 162  GLY A O     1 
ATOM   1290 N  N     . ILE A 1 163 ? -12.097 20.366  0.659   1.00 24.46  ? 163  ILE A N     1 
ATOM   1291 C  CA    . ILE A 1 163 ? -13.131 19.714  -0.129  1.00 24.22  ? 163  ILE A CA    1 
ATOM   1292 C  C     . ILE A 1 163 ? -13.065 20.310  -1.546  1.00 24.26  ? 163  ILE A C     1 
ATOM   1293 O  O     . ILE A 1 163 ? -12.959 21.541  -1.710  1.00 23.74  ? 163  ILE A O     1 
ATOM   1294 C  CB    . ILE A 1 163 ? -14.534 19.872  0.514   1.00 24.32  ? 163  ILE A CB    1 
ATOM   1295 C  CG1   . ILE A 1 163 ? -15.617 19.166  -0.310  1.00 24.28  ? 163  ILE A CG1   1 
ATOM   1296 C  CG2   . ILE A 1 163 ? -14.864 21.362  0.793   1.00 24.99  ? 163  ILE A CG2   1 
ATOM   1297 C  CD1   . ILE A 1 163 ? -16.947 18.991  0.433   1.00 24.93  ? 163  ILE A CD1   1 
ATOM   1298 N  N     . LYS A 1 164 ? -13.118 19.439  -2.551  1.00 23.09  ? 164  LYS A N     1 
ATOM   1299 C  CA    . LYS A 1 164 ? -12.999 19.850  -3.948  1.00 23.51  ? 164  LYS A CA    1 
ATOM   1300 C  C     . LYS A 1 164 ? -13.822 18.935  -4.851  1.00 22.79  ? 164  LYS A C     1 
ATOM   1301 O  O     . LYS A 1 164 ? -13.766 17.704  -4.719  1.00 23.01  ? 164  LYS A O     1 
ATOM   1302 C  CB    . LYS A 1 164 ? -11.512 19.816  -4.359  1.00 23.36  ? 164  LYS A CB    1 
ATOM   1303 C  CG    . LYS A 1 164 ? -11.220 19.881  -5.853  1.00 26.27  ? 164  LYS A CG    1 
ATOM   1304 C  CD    . LYS A 1 164 ? -11.228 21.298  -6.369  1.00 30.15  ? 164  LYS A CD    1 
ATOM   1305 C  CE    . LYS A 1 164 ? -10.838 21.329  -7.843  1.00 31.94  ? 164  LYS A CE    1 
ATOM   1306 N  NZ    . LYS A 1 164 ? -11.480 22.476  -8.504  1.00 31.66  ? 164  LYS A NZ    1 
ATOM   1307 N  N     . VAL A 1 165 ? -14.606 19.553  -5.729  1.00 21.95  ? 165  VAL A N     1 
ATOM   1308 C  CA    . VAL A 1 165 ? -15.298 18.873  -6.813  1.00 21.89  ? 165  VAL A CA    1 
ATOM   1309 C  C     . VAL A 1 165 ? -14.461 19.044  -8.076  1.00 21.57  ? 165  VAL A C     1 
ATOM   1310 O  O     . VAL A 1 165 ? -14.024 20.149  -8.397  1.00 20.98  ? 165  VAL A O     1 
ATOM   1311 C  CB    . VAL A 1 165 ? -16.716 19.454  -7.044  1.00 22.24  ? 165  VAL A CB    1 
ATOM   1312 C  CG1   . VAL A 1 165 ? -17.347 18.907  -8.346  1.00 21.84  ? 165  VAL A CG1   1 
ATOM   1313 C  CG2   . VAL A 1 165 ? -17.612 19.162  -5.846  1.00 21.40  ? 165  VAL A CG2   1 
ATOM   1314 N  N     . ILE A 1 166 ? -14.190 17.946  -8.764  1.00 20.63  ? 166  ILE A N     1 
ATOM   1315 C  CA    . ILE A 1 166 ? -13.605 18.060  -10.100 1.00 21.23  ? 166  ILE A CA    1 
ATOM   1316 C  C     . ILE A 1 166 ? -14.693 17.699  -11.101 1.00 21.40  ? 166  ILE A C     1 
ATOM   1317 O  O     . ILE A 1 166 ? -15.020 16.520  -11.274 1.00 20.37  ? 166  ILE A O     1 
ATOM   1318 C  CB    . ILE A 1 166 ? -12.319 17.208  -10.279 1.00 21.03  ? 166  ILE A CB    1 
ATOM   1319 C  CG1   . ILE A 1 166 ? -11.184 17.759  -9.406  1.00 20.72  ? 166  ILE A CG1   1 
ATOM   1320 C  CG2   . ILE A 1 166 ? -11.880 17.157  -11.789 1.00 20.43  ? 166  ILE A CG2   1 
ATOM   1321 C  CD1   . ILE A 1 166 ? -9.867  16.916  -9.481  1.00 19.60  ? 166  ILE A CD1   1 
ATOM   1322 N  N     . ASP A 1 167 ? -15.280 18.726  -11.721 1.00 22.43  ? 167  ASP A N     1 
ATOM   1323 C  CA    . ASP A 1 167 ? -16.415 18.535  -12.627 1.00 23.22  ? 167  ASP A CA    1 
ATOM   1324 C  C     . ASP A 1 167 ? -15.946 18.135  -14.023 1.00 23.83  ? 167  ASP A C     1 
ATOM   1325 O  O     . ASP A 1 167 ? -14.734 18.035  -14.271 1.00 23.39  ? 167  ASP A O     1 
ATOM   1326 C  CB    . ASP A 1 167 ? -17.316 19.784  -12.685 1.00 23.46  ? 167  ASP A CB    1 
ATOM   1327 C  CG    . ASP A 1 167 ? -16.668 20.963  -13.429 1.00 25.52  ? 167  ASP A CG    1 
ATOM   1328 O  OD1   . ASP A 1 167 ? -15.654 20.788  -14.133 1.00 26.45  ? 167  ASP A OD1   1 
ATOM   1329 O  OD2   . ASP A 1 167 ? -17.195 22.091  -13.325 1.00 28.23  ? 167  ASP A OD2   1 
ATOM   1330 N  N     . ASP A 1 168 ? -16.901 17.932  -14.934 1.00 23.99  ? 168  ASP A N     1 
ATOM   1331 C  CA    . ASP A 1 168 ? -16.584 17.377  -16.244 1.00 24.97  ? 168  ASP A CA    1 
ATOM   1332 C  C     . ASP A 1 168 ? -15.579 18.236  -16.997 1.00 25.09  ? 168  ASP A C     1 
ATOM   1333 O  O     . ASP A 1 168 ? -14.603 17.719  -17.545 1.00 24.89  ? 168  ASP A O     1 
ATOM   1334 C  CB    . ASP A 1 168 ? -17.849 17.123  -17.073 1.00 25.21  ? 168  ASP A CB    1 
ATOM   1335 C  CG    . ASP A 1 168 ? -18.565 15.832  -16.669 1.00 26.60  ? 168  ASP A CG    1 
ATOM   1336 O  OD1   . ASP A 1 168 ? -18.058 15.101  -15.795 1.00 28.90  ? 168  ASP A OD1   1 
ATOM   1337 O  OD2   . ASP A 1 168 ? -19.645 15.538  -17.231 1.00 30.31  ? 168  ASP A OD2   1 
ATOM   1338 N  N     . GLU A 1 169 ? -15.798 19.547  -16.986 1.00 25.36  ? 169  GLU A N     1 
ATOM   1339 C  CA    . GLU A 1 169 ? -14.870 20.465  -17.623 1.00 25.95  ? 169  GLU A CA    1 
ATOM   1340 C  C     . GLU A 1 169 ? -13.459 20.452  -17.013 1.00 25.62  ? 169  GLU A C     1 
ATOM   1341 O  O     . GLU A 1 169 ? -12.484 20.546  -17.747 1.00 25.28  ? 169  GLU A O     1 
ATOM   1342 C  CB    . GLU A 1 169 ? -15.450 21.881  -17.674 1.00 26.56  ? 169  GLU A CB    1 
ATOM   1343 C  CG    . GLU A 1 169 ? -16.580 22.023  -18.688 1.00 29.68  ? 169  GLU A CG    1 
ATOM   1344 C  CD    . GLU A 1 169 ? -16.225 21.410  -20.049 1.00 34.57  ? 169  GLU A CD    1 
ATOM   1345 O  OE1   . GLU A 1 169 ? -15.252 21.879  -20.697 1.00 35.90  ? 169  GLU A OE1   1 
ATOM   1346 O  OE2   . GLU A 1 169 ? -16.916 20.450  -20.459 1.00 35.71  ? 169  GLU A OE2   1 
ATOM   1347 N  N     . GLU A 1 170 ? -13.345 20.354  -15.686 1.00 25.05  ? 170  GLU A N     1 
ATOM   1348 C  CA    . GLU A 1 170 ? -12.019 20.303  -15.065 1.00 25.08  ? 170  GLU A CA    1 
ATOM   1349 C  C     . GLU A 1 170 ? -11.331 18.947  -15.260 1.00 24.30  ? 170  GLU A C     1 
ATOM   1350 O  O     . GLU A 1 170 ? -10.102 18.880  -15.318 1.00 23.94  ? 170  GLU A O     1 
ATOM   1351 C  CB    . GLU A 1 170 ? -12.051 20.685  -13.582 1.00 25.83  ? 170  GLU A CB    1 
ATOM   1352 C  CG    . GLU A 1 170 ? -10.642 20.766  -12.961 1.00 28.40  ? 170  GLU A CG    1 
ATOM   1353 C  CD    . GLU A 1 170 ? -10.598 21.579  -11.685 1.00 33.84  ? 170  GLU A CD    1 
ATOM   1354 O  OE1   . GLU A 1 170 ? -11.680 21.844  -11.108 1.00 35.34  ? 170  GLU A OE1   1 
ATOM   1355 O  OE2   . GLU A 1 170 ? -9.480  21.949  -11.261 1.00 35.70  ? 170  GLU A OE2   1 
ATOM   1356 N  N     . VAL A 1 171 ? -12.112 17.872  -15.376 1.00 23.49  ? 171  VAL A N     1 
ATOM   1357 C  CA    . VAL A 1 171 ? -11.542 16.579  -15.768 1.00 23.19  ? 171  VAL A CA    1 
ATOM   1358 C  C     . VAL A 1 171 ? -10.789 16.726  -17.102 1.00 23.30  ? 171  VAL A C     1 
ATOM   1359 O  O     . VAL A 1 171 ? -9.660  16.237  -17.243 1.00 22.97  ? 171  VAL A O     1 
ATOM   1360 C  CB    . VAL A 1 171 ? -12.609 15.458  -15.841 1.00 22.94  ? 171  VAL A CB    1 
ATOM   1361 C  CG1   . VAL A 1 171 ? -12.029 14.206  -16.485 1.00 23.34  ? 171  VAL A CG1   1 
ATOM   1362 C  CG2   . VAL A 1 171 ? -13.141 15.114  -14.449 1.00 21.87  ? 171  VAL A CG2   1 
ATOM   1363 N  N     . LYS A 1 172 ? -11.415 17.425  -18.055 1.00 23.66  ? 172  LYS A N     1 
ATOM   1364 C  CA    . LYS A 1 172 ? -10.824 17.696  -19.375 1.00 24.57  ? 172  LYS A CA    1 
ATOM   1365 C  C     . LYS A 1 172 ? -9.550  18.540  -19.302 1.00 24.15  ? 172  LYS A C     1 
ATOM   1366 O  O     . LYS A 1 172 ? -8.554  18.232  -19.968 1.00 23.88  ? 172  LYS A O     1 
ATOM   1367 C  CB    . LYS A 1 172 ? -11.842 18.342  -20.319 1.00 24.40  ? 172  LYS A CB    1 
ATOM   1368 C  CG    . LYS A 1 172 ? -12.904 17.365  -20.818 1.00 25.46  ? 172  LYS A CG    1 
ATOM   1369 C  CD    . LYS A 1 172 ? -14.023 18.107  -21.535 1.00 28.61  ? 172  LYS A CD    1 
ATOM   1370 C  CE    . LYS A 1 172 ? -15.247 17.222  -21.688 1.00 29.12  ? 172  LYS A CE    1 
ATOM   1371 N  NZ    . LYS A 1 172 ? -16.448 18.012  -22.053 1.00 32.63  ? 172  LYS A NZ    1 
ATOM   1372 N  N     . ARG A 1 173 ? -9.588  19.593  -18.492 1.00 24.15  ? 173  ARG A N     1 
ATOM   1373 C  CA    . ARG A 1 173 ? -8.381  20.371  -18.204 1.00 24.74  ? 173  ARG A CA    1 
ATOM   1374 C  C     . ARG A 1 173 ? -7.253  19.484  -17.638 1.00 24.20  ? 173  ARG A C     1 
ATOM   1375 O  O     . ARG A 1 173 ? -6.110  19.582  -18.071 1.00 24.30  ? 173  ARG A O     1 
ATOM   1376 C  CB    . ARG A 1 173 ? -8.679  21.549  -17.255 1.00 25.34  ? 173  ARG A CB    1 
ATOM   1377 C  CG    . ARG A 1 173 ? -7.479  22.500  -17.071 1.00 27.25  ? 173  ARG A CG    1 
ATOM   1378 C  CD    . ARG A 1 173 ? -7.734  23.636  -16.083 1.00 30.46  ? 173  ARG A CD    1 
ATOM   1379 N  NE    . ARG A 1 173 ? -7.863  23.196  -14.688 1.00 32.64  ? 173  ARG A NE    1 
ATOM   1380 C  CZ    . ARG A 1 173 ? -6.851  22.826  -13.902 1.00 33.49  ? 173  ARG A CZ    1 
ATOM   1381 N  NH1   . ARG A 1 173 ? -5.597  22.815  -14.357 1.00 32.42  ? 173  ARG A NH1   1 
ATOM   1382 N  NH2   . ARG A 1 173 ? -7.095  22.459  -12.650 1.00 33.17  ? 173  ARG A NH2   1 
ATOM   1383 N  N     . LEU A 1 174 ? -7.581  18.601  -16.700 1.00 23.94  ? 174  LEU A N     1 
ATOM   1384 C  CA    . LEU A 1 174 ? -6.551  17.792  -16.037 1.00 23.77  ? 174  LEU A CA    1 
ATOM   1385 C  C     . LEU A 1 174 ? -5.886  16.780  -16.958 1.00 23.04  ? 174  LEU A C     1 
ATOM   1386 O  O     . LEU A 1 174 ? -4.664  16.601  -16.923 1.00 22.37  ? 174  LEU A O     1 
ATOM   1387 C  CB    . LEU A 1 174 ? -7.115  17.119  -14.789 1.00 23.72  ? 174  LEU A CB    1 
ATOM   1388 C  CG    . LEU A 1 174 ? -7.333  18.143  -13.664 1.00 24.62  ? 174  LEU A CG    1 
ATOM   1389 C  CD1   . LEU A 1 174 ? -8.110  17.507  -12.532 1.00 26.92  ? 174  LEU A CD1   1 
ATOM   1390 C  CD2   . LEU A 1 174 ? -6.007  18.736  -13.170 1.00 25.28  ? 174  LEU A CD2   1 
ATOM   1391 N  N     . ILE A 1 175 ? -6.701  16.118  -17.774 1.00 22.61  ? 175  ILE A N     1 
ATOM   1392 C  CA    . ILE A 1 175 ? -6.200  15.279  -18.855 1.00 22.73  ? 175  ILE A CA    1 
ATOM   1393 C  C     . ILE A 1 175 ? -5.174  16.039  -19.702 1.00 23.63  ? 175  ILE A C     1 
ATOM   1394 O  O     . ILE A 1 175 ? -4.152  15.478  -20.082 1.00 24.41  ? 175  ILE A O     1 
ATOM   1395 C  CB    . ILE A 1 175 ? -7.373  14.712  -19.719 1.00 22.20  ? 175  ILE A CB    1 
ATOM   1396 C  CG1   . ILE A 1 175 ? -8.200  13.728  -18.880 1.00 21.46  ? 175  ILE A CG1   1 
ATOM   1397 C  CG2   . ILE A 1 175 ? -6.852  13.994  -20.966 1.00 21.50  ? 175  ILE A CG2   1 
ATOM   1398 C  CD1   . ILE A 1 175 ? -9.579  13.388  -19.476 1.00 23.16  ? 175  ILE A CD1   1 
ATOM   1399 N  N     . ARG A 1 176 ? -5.440  17.316  -19.977 1.00 24.66  ? 176  ARG A N     1 
ATOM   1400 C  CA    . ARG A 1 176 ? -4.521  18.156  -20.744 1.00 25.92  ? 176  ARG A CA    1 
ATOM   1401 C  C     . ARG A 1 176 ? -3.307  18.627  -19.935 1.00 26.87  ? 176  ARG A C     1 
ATOM   1402 O  O     . ARG A 1 176 ? -2.198  18.680  -20.476 1.00 27.24  ? 176  ARG A O     1 
ATOM   1403 C  CB    . ARG A 1 176 ? -5.242  19.392  -21.303 1.00 25.99  ? 176  ARG A CB    1 
ATOM   1404 C  CG    . ARG A 1 176 ? -6.325  19.093  -22.319 1.00 26.17  ? 176  ARG A CG    1 
ATOM   1405 C  CD    . ARG A 1 176 ? -6.826  20.368  -22.955 1.00 27.93  ? 176  ARG A CD    1 
ATOM   1406 N  NE    . ARG A 1 176 ? -8.016  20.897  -22.290 1.00 27.88  ? 176  ARG A NE    1 
ATOM   1407 C  CZ    . ARG A 1 176 ? -8.014  21.973  -21.525 1.00 29.75  ? 176  ARG A CZ    1 
ATOM   1408 N  NH1   . ARG A 1 176 ? -6.877  22.641  -21.322 1.00 32.63  ? 176  ARG A NH1   1 
ATOM   1409 N  NH2   . ARG A 1 176 ? -9.140  22.372  -20.948 1.00 29.47  ? 176  ARG A NH2   1 
ATOM   1410 N  N     . GLU A 1 177 ? -3.516  18.967  -18.658 1.00 27.45  ? 177  GLU A N     1 
ATOM   1411 C  CA    . GLU A 1 177 ? -2.525  19.754  -17.891 1.00 28.78  ? 177  GLU A CA    1 
ATOM   1412 C  C     . GLU A 1 177 ? -1.876  19.116  -16.657 1.00 29.46  ? 177  GLU A C     1 
ATOM   1413 O  O     . GLU A 1 177 ? -0.864  19.622  -16.171 1.00 29.69  ? 177  GLU A O     1 
ATOM   1414 C  CB    . GLU A 1 177 ? -3.129  21.081  -17.441 1.00 28.76  ? 177  GLU A CB    1 
ATOM   1415 C  CG    . GLU A 1 177 ? -3.395  22.077  -18.551 1.00 30.18  ? 177  GLU A CG    1 
ATOM   1416 C  CD    . GLU A 1 177 ? -4.052  23.344  -18.036 1.00 32.48  ? 177  GLU A CD    1 
ATOM   1417 O  OE1   . GLU A 1 177 ? -4.155  23.521  -16.803 1.00 35.13  ? 177  GLU A OE1   1 
ATOM   1418 O  OE2   . GLU A 1 177 ? -4.479  24.165  -18.861 1.00 34.34  ? 177  GLU A OE2   1 
ATOM   1419 N  N     . LEU A 1 178 ? -2.448  18.041  -16.132 1.00 29.87  ? 178  LEU A N     1 
ATOM   1420 C  CA    . LEU A 1 178 ? -1.875  17.412  -14.947 1.00 30.61  ? 178  LEU A CA    1 
ATOM   1421 C  C     . LEU A 1 178 ? -0.625  16.594  -15.287 1.00 30.95  ? 178  LEU A C     1 
ATOM   1422 O  O     . LEU A 1 178 ? -0.655  15.758  -16.176 1.00 30.72  ? 178  LEU A O     1 
ATOM   1423 C  CB    . LEU A 1 178 ? -2.917  16.548  -14.225 1.00 31.00  ? 178  LEU A CB    1 
ATOM   1424 C  CG    . LEU A 1 178 ? -2.467  15.827  -12.941 1.00 31.23  ? 178  LEU A CG    1 
ATOM   1425 C  CD1   . LEU A 1 178 ? -2.491  16.759  -11.741 1.00 33.15  ? 178  LEU A CD1   1 
ATOM   1426 C  CD2   . LEU A 1 178 ? -3.351  14.612  -12.711 1.00 33.17  ? 178  LEU A CD2   1 
ATOM   1427 N  N     . ASP A 1 179 ? 0.477   16.864  -14.588 1.00 31.52  ? 179  ASP A N     1 
ATOM   1428 C  CA    . ASP A 1 179 ? 1.693   16.053  -14.714 1.00 31.94  ? 179  ASP A CA    1 
ATOM   1429 C  C     . ASP A 1 179 ? 1.318   14.582  -14.501 1.00 31.37  ? 179  ASP A C     1 
ATOM   1430 O  O     . ASP A 1 179 ? 0.680   14.213  -13.501 1.00 30.03  ? 179  ASP A O     1 
ATOM   1431 C  CB    . ASP A 1 179 ? 2.727   16.501  -13.676 1.00 32.67  ? 179  ASP A CB    1 
ATOM   1432 C  CG    . ASP A 1 179 ? 4.098   15.826  -13.845 1.00 36.14  ? 179  ASP A CG    1 
ATOM   1433 O  OD1   . ASP A 1 179 ? 4.245   14.772  -14.521 1.00 38.33  ? 179  ASP A OD1   1 
ATOM   1434 O  OD2   . ASP A 1 179 ? 5.062   16.370  -13.261 1.00 41.24  ? 179  ASP A OD2   1 
ATOM   1435 N  N     . ILE A 1 180 ? 1.703   13.748  -15.457 1.00 30.59  ? 180  ILE A N     1 
ATOM   1436 C  CA    . ILE A 1 180 ? 1.306   12.352  -15.427 1.00 30.64  ? 180  ILE A CA    1 
ATOM   1437 C  C     . ILE A 1 180 ? 1.868   11.621  -14.194 1.00 30.86  ? 180  ILE A C     1 
ATOM   1438 O  O     . ILE A 1 180 ? 1.260   10.665  -13.717 1.00 30.13  ? 180  ILE A O     1 
ATOM   1439 C  CB    . ILE A 1 180 ? 1.619   11.614  -16.740 1.00 30.58  ? 180  ILE A CB    1 
ATOM   1440 C  CG1   . ILE A 1 180 ? 0.673   10.421  -16.900 1.00 29.80  ? 180  ILE A CG1   1 
ATOM   1441 C  CG2   . ILE A 1 180 ? 3.087   11.208  -16.808 1.00 30.16  ? 180  ILE A CG2   1 
ATOM   1442 C  CD1   . ILE A 1 180 ? 0.505   9.966   -18.322 1.00 29.37  ? 180  ILE A CD1   1 
ATOM   1443 N  N     . ALA A 1 181 ? 3.000   12.102  -13.674 1.00 30.89  ? 181  ALA A N     1 
ATOM   1444 C  CA    . ALA A 1 181 ? 3.547   11.610  -12.396 1.00 32.10  ? 181  ALA A CA    1 
ATOM   1445 C  C     . ALA A 1 181 ? 2.551   11.766  -11.245 1.00 32.00  ? 181  ALA A C     1 
ATOM   1446 O  O     . ALA A 1 181 ? 2.639   11.055  -10.255 1.00 34.60  ? 181  ALA A O     1 
ATOM   1447 C  CB    . ALA A 1 181 ? 4.868   12.322  -12.048 1.00 31.62  ? 181  ALA A CB    1 
ATOM   1448 N  N     . ASP A 1 182 ? 1.606   12.686  -11.375 1.00 31.25  ? 182  ASP A N     1 
ATOM   1449 C  CA    . ASP A 1 182 ? 0.612   12.907  -10.317 1.00 31.36  ? 182  ASP A CA    1 
ATOM   1450 C  C     . ASP A 1 182 ? -0.662  12.054  -10.408 1.00 29.94  ? 182  ASP A C     1 
ATOM   1451 O  O     . ASP A 1 182 ? -1.565  12.190  -9.594  1.00 30.05  ? 182  ASP A O     1 
ATOM   1452 C  CB    . ASP A 1 182 ? 0.271   14.393  -10.225 1.00 32.13  ? 182  ASP A CB    1 
ATOM   1453 C  CG    . ASP A 1 182 ? 1.464   15.235  -9.757  1.00 35.86  ? 182  ASP A CG    1 
ATOM   1454 O  OD1   . ASP A 1 182 ? 2.504   14.640  -9.378  1.00 37.49  ? 182  ASP A OD1   1 
ATOM   1455 O  OD2   . ASP A 1 182 ? 1.357   16.487  -9.774  1.00 40.14  ? 182  ASP A OD2   1 
ATOM   1456 N  N     . VAL A 1 183 ? -0.720  11.174  -11.399 1.00 28.88  ? 183  VAL A N     1 
ATOM   1457 C  CA    . VAL A 1 183 ? -1.819  10.221  -11.525 1.00 28.21  ? 183  VAL A CA    1 
ATOM   1458 C  C     . VAL A 1 183 ? -1.577  9.040   -10.570 1.00 27.79  ? 183  VAL A C     1 
ATOM   1459 O  O     . VAL A 1 183 ? -0.504  8.437   -10.593 1.00 27.16  ? 183  VAL A O     1 
ATOM   1460 C  CB    . VAL A 1 183 ? -1.924  9.677   -12.996 1.00 27.82  ? 183  VAL A CB    1 
ATOM   1461 C  CG1   . VAL A 1 183 ? -2.957  8.579   -13.096 1.00 27.87  ? 183  VAL A CG1   1 
ATOM   1462 C  CG2   . VAL A 1 183 ? -2.238  10.805  -13.977 1.00 27.21  ? 183  VAL A CG2   1 
ATOM   1463 N  N     . PRO A 1 184 ? -2.577  8.694   -9.741  1.00 28.24  ? 184  PRO A N     1 
ATOM   1464 C  CA    . PRO A 1 184 ? -2.483  7.477   -8.919  1.00 28.69  ? 184  PRO A CA    1 
ATOM   1465 C  C     . PRO A 1 184 ? -1.924  6.278   -9.681  1.00 29.20  ? 184  PRO A C     1 
ATOM   1466 O  O     . PRO A 1 184 ? -2.358  5.985   -10.804 1.00 29.35  ? 184  PRO A O     1 
ATOM   1467 C  CB    . PRO A 1 184 ? -3.940  7.217   -8.538  1.00 28.93  ? 184  PRO A CB    1 
ATOM   1468 C  CG    . PRO A 1 184 ? -4.496  8.601   -8.416  1.00 28.51  ? 184  PRO A CG    1 
ATOM   1469 C  CD    . PRO A 1 184 ? -3.849  9.402   -9.517  1.00 27.05  ? 184  PRO A CD    1 
ATOM   1470 N  N     . GLY A 1 185 ? -0.967  5.585   -9.077  1.00 29.69  ? 185  GLY A N     1 
ATOM   1471 C  CA    . GLY A 1 185 ? -0.416  4.378   -9.685  1.00 30.50  ? 185  GLY A CA    1 
ATOM   1472 C  C     . GLY A 1 185 ? 0.822   4.620   -10.528 1.00 31.20  ? 185  GLY A C     1 
ATOM   1473 O  O     . GLY A 1 185 ? 1.443   3.664   -10.999 1.00 30.83  ? 185  GLY A O     1 
ATOM   1474 N  N     . ILE A 1 186 ? 1.192   5.887   -10.711 1.00 31.79  ? 186  ILE A N     1 
ATOM   1475 C  CA    . ILE A 1 186 ? 2.386   6.232   -11.482 1.00 32.85  ? 186  ILE A CA    1 
ATOM   1476 C  C     . ILE A 1 186 ? 3.452   6.756   -10.521 1.00 33.87  ? 186  ILE A C     1 
ATOM   1477 O  O     . ILE A 1 186 ? 3.317   7.858   -9.955  1.00 35.59  ? 186  ILE A O     1 
ATOM   1478 C  CB    . ILE A 1 186 ? 2.101   7.293   -12.604 1.00 33.13  ? 186  ILE A CB    1 
ATOM   1479 C  CG1   . ILE A 1 186 ? 0.948   6.858   -13.543 1.00 32.50  ? 186  ILE A CG1   1 
ATOM   1480 C  CG2   . ILE A 1 186 ? 3.382   7.628   -13.401 1.00 32.75  ? 186  ILE A CG2   1 
ATOM   1481 C  CD1   . ILE A 1 186 ? 1.094   5.509   -14.176 1.00 32.14  ? 186  ILE A CD1   1 
ATOM   1482 N  N     . GLY A 1 187 ? 4.479   5.941   -10.305 1.00 33.83  ? 187  GLY A N     1 
ATOM   1483 C  CA    . GLY A 1 187 ? 5.620   6.338   -9.480  1.00 34.47  ? 187  GLY A CA    1 
ATOM   1484 C  C     . GLY A 1 187 ? 6.802   6.760   -10.333 1.00 35.18  ? 187  GLY A C     1 
ATOM   1485 O  O     . GLY A 1 187 ? 6.665   6.913   -11.555 1.00 34.75  ? 187  GLY A O     1 
ATOM   1486 N  N     . ASN A 1 188 ? 7.964   6.930   -9.692  1.00 35.83  ? 188  ASN A N     1 
ATOM   1487 C  CA    . ASN A 1 188 ? 9.182   7.389   -10.373 1.00 36.52  ? 188  ASN A CA    1 
ATOM   1488 C  C     . ASN A 1 188 ? 9.577   6.516   -11.549 1.00 35.83  ? 188  ASN A C     1 
ATOM   1489 O  O     . ASN A 1 188 ? 9.936   7.034   -12.609 1.00 35.63  ? 188  ASN A O     1 
ATOM   1490 C  CB    . ASN A 1 188 ? 10.375  7.475   -9.412  1.00 37.45  ? 188  ASN A CB    1 
ATOM   1491 C  CG    . ASN A 1 188 ? 10.128  8.400   -8.244  1.00 40.64  ? 188  ASN A CG    1 
ATOM   1492 O  OD1   . ASN A 1 188 ? 9.458   9.425   -8.374  1.00 45.25  ? 188  ASN A OD1   1 
ATOM   1493 N  ND2   . ASN A 1 188 ? 10.688  8.049   -7.084  1.00 43.79  ? 188  ASN A ND2   1 
ATOM   1494 N  N     . ILE A 1 189 ? 9.514   5.197   -11.361 1.00 35.41  ? 189  ILE A N     1 
ATOM   1495 C  CA    . ILE A 1 189 ? 9.954   4.265   -12.398 1.00 35.11  ? 189  ILE A CA    1 
ATOM   1496 C  C     . ILE A 1 189 ? 9.116   4.378   -13.667 1.00 34.64  ? 189  ILE A C     1 
ATOM   1497 O  O     . ILE A 1 189 ? 9.663   4.394   -14.781 1.00 34.47  ? 189  ILE A O     1 
ATOM   1498 C  CB    . ILE A 1 189 ? 9.984   2.785   -11.909 1.00 35.46  ? 189  ILE A CB    1 
ATOM   1499 C  CG1   . ILE A 1 189 ? 10.970  2.588   -10.743 1.00 36.64  ? 189  ILE A CG1   1 
ATOM   1500 C  CG2   . ILE A 1 189 ? 10.324  1.843   -13.060 1.00 35.82  ? 189  ILE A CG2   1 
ATOM   1501 C  CD1   . ILE A 1 189 ? 12.431  2.972   -11.069 1.00 39.05  ? 189  ILE A CD1   1 
ATOM   1502 N  N     . THR A 1 190 ? 7.796   4.451   -13.509 1.00 34.03  ? 190  THR A N     1 
ATOM   1503 C  CA    . THR A 1 190 ? 6.906   4.528   -14.674 1.00 33.81  ? 190  THR A CA    1 
ATOM   1504 C  C     . THR A 1 190 ? 6.987   5.904   -15.322 1.00 33.81  ? 190  THR A C     1 
ATOM   1505 O  O     . THR A 1 190 ? 6.988   6.017   -16.543 1.00 33.64  ? 190  THR A O     1 
ATOM   1506 C  CB    . THR A 1 190 ? 5.439   4.195   -14.320 1.00 33.72  ? 190  THR A CB    1 
ATOM   1507 O  OG1   . THR A 1 190 ? 5.391   2.918   -13.677 1.00 33.11  ? 190  THR A OG1   1 
ATOM   1508 C  CG2   . THR A 1 190 ? 4.566   4.144   -15.582 1.00 32.95  ? 190  THR A CG2   1 
ATOM   1509 N  N     . ALA A 1 191 ? 7.062   6.933   -14.491 1.00 34.23  ? 191  ALA A N     1 
ATOM   1510 C  CA    . ALA A 1 191 ? 7.135   8.309   -14.961 1.00 35.34  ? 191  ALA A CA    1 
ATOM   1511 C  C     . ALA A 1 191 ? 8.381   8.538   -15.808 1.00 36.52  ? 191  ALA A C     1 
ATOM   1512 O  O     . ALA A 1 191 ? 8.316   9.238   -16.830 1.00 36.79  ? 191  ALA A O     1 
ATOM   1513 C  CB    . ALA A 1 191 ? 7.116   9.258   -13.792 1.00 35.01  ? 191  ALA A CB    1 
ATOM   1514 N  N     . GLU A 1 192 ? 9.509   7.956   -15.384 1.00 37.41  ? 192  GLU A N     1 
ATOM   1515 C  CA    . GLU A 1 192 ? 10.761  8.058   -16.138 1.00 38.42  ? 192  GLU A CA    1 
ATOM   1516 C  C     . GLU A 1 192 ? 10.634  7.359   -17.473 1.00 38.28  ? 192  GLU A C     1 
ATOM   1517 O  O     . GLU A 1 192 ? 11.026  7.908   -18.499 1.00 38.88  ? 192  GLU A O     1 
ATOM   1518 C  CB    . GLU A 1 192 ? 11.954  7.498   -15.353 1.00 38.68  ? 192  GLU A CB    1 
ATOM   1519 C  CG    . GLU A 1 192 ? 12.487  8.435   -14.267 1.00 41.75  ? 192  GLU A CG    1 
ATOM   1520 C  CD    . GLU A 1 192 ? 12.753  9.848   -14.766 1.00 45.31  ? 192  GLU A CD    1 
ATOM   1521 O  OE1   . GLU A 1 192 ? 13.508  10.005  -15.754 1.00 48.31  ? 192  GLU A OE1   1 
ATOM   1522 O  OE2   . GLU A 1 192 ? 12.207  10.804  -14.173 1.00 46.07  ? 192  GLU A OE2   1 
ATOM   1523 N  N     . LYS A 1 193 ? 10.081  6.151   -17.448 1.00 38.43  ? 193  LYS A N     1 
ATOM   1524 C  CA    . LYS A 1 193 ? 9.780   5.392   -18.658 1.00 38.68  ? 193  LYS A CA    1 
ATOM   1525 C  C     . LYS A 1 193 ? 8.837   6.163   -19.590 1.00 38.72  ? 193  LYS A C     1 
ATOM   1526 O  O     . LYS A 1 193 ? 9.000   6.109   -20.805 1.00 38.83  ? 193  LYS A O     1 
ATOM   1527 C  CB    . LYS A 1 193 ? 9.161   4.035   -18.311 1.00 39.00  ? 193  LYS A CB    1 
ATOM   1528 C  CG    . LYS A 1 193 ? 10.126  2.952   -17.815 1.00 39.76  ? 193  LYS A CG    1 
ATOM   1529 C  CD    . LYS A 1 193 ? 9.361   1.634   -17.653 1.00 42.18  ? 193  LYS A CD    1 
ATOM   1530 C  CE    . LYS A 1 193 ? 10.009  0.684   -16.654 1.00 43.31  ? 193  LYS A CE    1 
ATOM   1531 N  NZ    . LYS A 1 193 ? 9.025   -0.332  -16.129 1.00 42.72  ? 193  LYS A NZ    1 
ATOM   1532 N  N     . LEU A 1 194 ? 7.863   6.879   -19.024 1.00 38.70  ? 194  LEU A N     1 
ATOM   1533 C  CA    . LEU A 1 194 ? 6.941   7.686   -19.830 1.00 38.90  ? 194  LEU A CA    1 
ATOM   1534 C  C     . LEU A 1 194 ? 7.638   8.862   -20.518 1.00 39.62  ? 194  LEU A C     1 
ATOM   1535 O  O     . LEU A 1 194 ? 7.416   9.093   -21.710 1.00 39.50  ? 194  LEU A O     1 
ATOM   1536 C  CB    . LEU A 1 194 ? 5.721   8.148   -19.026 1.00 38.12  ? 194  LEU A CB    1 
ATOM   1537 C  CG    . LEU A 1 194 ? 4.720   7.040   -18.662 1.00 38.16  ? 194  LEU A CG    1 
ATOM   1538 C  CD1   . LEU A 1 194 ? 3.733   7.498   -17.595 1.00 37.63  ? 194  LEU A CD1   1 
ATOM   1539 C  CD2   . LEU A 1 194 ? 3.982   6.481   -19.884 1.00 38.46  ? 194  LEU A CD2   1 
ATOM   1540 N  N     . LYS A 1 195 ? 8.487   9.580   -19.779 1.00 40.43  ? 195  LYS A N     1 
ATOM   1541 C  CA    . LYS A 1 195 ? 9.268   10.698  -20.339 1.00 41.55  ? 195  LYS A CA    1 
ATOM   1542 C  C     . LYS A 1 195 ? 10.058  10.323  -21.594 1.00 41.71  ? 195  LYS A C     1 
ATOM   1543 O  O     . LYS A 1 195 ? 10.196  11.137  -22.504 1.00 41.81  ? 195  LYS A O     1 
ATOM   1544 C  CB    . LYS A 1 195 ? 10.202  11.321  -19.292 1.00 41.85  ? 195  LYS A CB    1 
ATOM   1545 C  CG    . LYS A 1 195 ? 9.487   11.884  -18.082 1.00 44.10  ? 195  LYS A CG    1 
ATOM   1546 C  CD    . LYS A 1 195 ? 10.223  13.050  -17.429 1.00 47.70  ? 195  LYS A CD    1 
ATOM   1547 C  CE    . LYS A 1 195 ? 9.896   14.364  -18.142 1.00 50.28  ? 195  LYS A CE    1 
ATOM   1548 N  NZ    . LYS A 1 195 ? 9.953   15.559  -17.236 1.00 52.29  ? 195  LYS A NZ    1 
ATOM   1549 N  N     . LYS A 1 196 ? 10.548  9.084   -21.652 1.00 41.97  ? 196  LYS A N     1 
ATOM   1550 C  CA    . LYS A 1 196 ? 11.318  8.602   -22.808 1.00 42.13  ? 196  LYS A CA    1 
ATOM   1551 C  C     . LYS A 1 196 ? 10.442  8.410   -24.047 1.00 41.45  ? 196  LYS A C     1 
ATOM   1552 O  O     . LYS A 1 196 ? 10.947  8.387   -25.165 1.00 41.53  ? 196  LYS A O     1 
ATOM   1553 C  CB    . LYS A 1 196 ? 12.067  7.290   -22.497 1.00 42.66  ? 196  LYS A CB    1 
ATOM   1554 C  CG    . LYS A 1 196 ? 12.963  7.297   -21.249 1.00 44.93  ? 196  LYS A CG    1 
ATOM   1555 C  CD    . LYS A 1 196 ? 14.093  8.331   -21.312 1.00 47.74  ? 196  LYS A CD    1 
ATOM   1556 C  CE    . LYS A 1 196 ? 14.819  8.413   -19.963 1.00 48.76  ? 196  LYS A CE    1 
ATOM   1557 N  NZ    . LYS A 1 196 ? 15.984  9.347   -19.993 1.00 49.19  ? 196  LYS A NZ    1 
ATOM   1558 N  N     . LEU A 1 197 ? 9.136   8.257   -23.842 1.00 40.59  ? 197  LEU A N     1 
ATOM   1559 C  CA    . LEU A 1 197 ? 8.184   8.143   -24.953 1.00 39.66  ? 197  LEU A CA    1 
ATOM   1560 C  C     . LEU A 1 197 ? 7.565   9.506   -25.305 1.00 38.88  ? 197  LEU A C     1 
ATOM   1561 O  O     . LEU A 1 197 ? 6.703   9.598   -26.176 1.00 38.80  ? 197  LEU A O     1 
ATOM   1562 C  CB    . LEU A 1 197 ? 7.082   7.122   -24.619 1.00 39.76  ? 197  LEU A CB    1 
ATOM   1563 C  CG    . LEU A 1 197 ? 7.447   5.653   -24.348 1.00 39.72  ? 197  LEU A CG    1 
ATOM   1564 C  CD1   . LEU A 1 197 ? 6.311   4.959   -23.617 1.00 39.74  ? 197  LEU A CD1   1 
ATOM   1565 C  CD2   . LEU A 1 197 ? 7.780   4.909   -25.622 1.00 39.17  ? 197  LEU A CD2   1 
ATOM   1566 N  N     . GLY A 1 198 ? 8.018   10.557  -24.626 1.00 38.25  ? 198  GLY A N     1 
ATOM   1567 C  CA    . GLY A 1 198 ? 7.453   11.898  -24.789 1.00 37.29  ? 198  GLY A CA    1 
ATOM   1568 C  C     . GLY A 1 198 ? 6.130   12.101  -24.065 1.00 36.53  ? 198  GLY A C     1 
ATOM   1569 O  O     . GLY A 1 198 ? 5.452   13.103  -24.287 1.00 36.82  ? 198  GLY A O     1 
ATOM   1570 N  N     . ILE A 1 199 ? 5.764   11.163  -23.190 1.00 35.57  ? 199  ILE A N     1 
ATOM   1571 C  CA    . ILE A 1 199 ? 4.513   11.251  -22.427 1.00 33.96  ? 199  ILE A CA    1 
ATOM   1572 C  C     . ILE A 1 199 ? 4.696   11.964  -21.086 1.00 34.16  ? 199  ILE A C     1 
ATOM   1573 O  O     . ILE A 1 199 ? 5.322   11.432  -20.161 1.00 34.28  ? 199  ILE A O     1 
ATOM   1574 C  CB    . ILE A 1 199 ? 3.859   9.856   -22.255 1.00 33.95  ? 199  ILE A CB    1 
ATOM   1575 C  CG1   . ILE A 1 199 ? 3.604   9.242   -23.645 1.00 33.77  ? 199  ILE A CG1   1 
ATOM   1576 C  CG2   . ILE A 1 199 ? 2.577   9.938   -21.429 1.00 31.68  ? 199  ILE A CG2   1 
ATOM   1577 C  CD1   . ILE A 1 199 ? 2.878   7.904   -23.640 1.00 34.12  ? 199  ILE A CD1   1 
ATOM   1578 N  N     . ASN A 1 200 ? 4.143   13.173  -20.998 1.00 33.32  ? 200  ASN A N     1 
ATOM   1579 C  CA    . ASN A 1 200 ? 4.214   14.006  -19.803 1.00 32.81  ? 200  ASN A CA    1 
ATOM   1580 C  C     . ASN A 1 200 ? 2.827   14.292  -19.218 1.00 31.80  ? 200  ASN A C     1 
ATOM   1581 O  O     . ASN A 1 200 ? 2.697   14.729  -18.067 1.00 30.91  ? 200  ASN A O     1 
ATOM   1582 C  CB    . ASN A 1 200 ? 4.910   15.338  -20.123 1.00 33.96  ? 200  ASN A CB    1 
ATOM   1583 C  CG    . ASN A 1 200 ? 6.343   15.159  -20.603 1.00 36.03  ? 200  ASN A CG    1 
ATOM   1584 O  OD1   . ASN A 1 200 ? 7.277   15.178  -19.800 1.00 40.02  ? 200  ASN A OD1   1 
ATOM   1585 N  ND2   . ASN A 1 200 ? 6.523   14.977  -21.909 1.00 37.54  ? 200  ASN A ND2   1 
ATOM   1586 N  N     . LYS A 1 201 ? 1.795   14.066  -20.030 1.00 30.64  ? 201  LYS A N     1 
ATOM   1587 C  CA    . LYS A 1 201 ? 0.407   14.309  -19.635 1.00 30.15  ? 201  LYS A CA    1 
ATOM   1588 C  C     . LYS A 1 201 ? -0.455  13.112  -20.031 1.00 29.15  ? 201  LYS A C     1 
ATOM   1589 O  O     . LYS A 1 201 ? -0.106  12.382  -20.964 1.00 29.36  ? 201  LYS A O     1 
ATOM   1590 C  CB    . LYS A 1 201 ? -0.131  15.585  -20.321 1.00 30.04  ? 201  LYS A CB    1 
ATOM   1591 C  CG    . LYS A 1 201 ? 0.787   16.816  -20.299 1.00 30.15  ? 201  LYS A CG    1 
ATOM   1592 C  CD    . LYS A 1 201 ? 0.853   17.468  -18.911 1.00 30.41  ? 201  LYS A CD    1 
ATOM   1593 C  CE    . LYS A 1 201 ? 1.844   18.635  -18.904 1.00 31.14  ? 201  LYS A CE    1 
ATOM   1594 N  NZ    . LYS A 1 201 ? 1.875   19.269  -17.567 1.00 31.25  ? 201  LYS A NZ    1 
ATOM   1595 N  N     . LEU A 1 202 ? -1.586  12.921  -19.355 1.00 28.31  ? 202  LEU A N     1 
ATOM   1596 C  CA    . LEU A 1 202 ? -2.542  11.879  -19.774 1.00 28.15  ? 202  LEU A CA    1 
ATOM   1597 C  C     . LEU A 1 202 ? -2.877  11.965  -21.262 1.00 27.46  ? 202  LEU A C     1 
ATOM   1598 O  O     . LEU A 1 202 ? -2.942  10.954  -21.933 1.00 27.47  ? 202  LEU A O     1 
ATOM   1599 C  CB    . LEU A 1 202 ? -3.846  11.920  -18.967 1.00 27.70  ? 202  LEU A CB    1 
ATOM   1600 C  CG    . LEU A 1 202 ? -3.850  11.278  -17.586 1.00 28.49  ? 202  LEU A CG    1 
ATOM   1601 C  CD1   . LEU A 1 202 ? -5.113  11.637  -16.814 1.00 28.64  ? 202  LEU A CD1   1 
ATOM   1602 C  CD2   . LEU A 1 202 ? -3.723  9.769   -17.720 1.00 28.91  ? 202  LEU A CD2   1 
ATOM   1603 N  N     . VAL A 1 203 ? -3.086  13.175  -21.764 1.00 27.41  ? 203  VAL A N     1 
ATOM   1604 C  CA    . VAL A 1 203 ? -3.481  13.367  -23.164 1.00 27.30  ? 203  VAL A CA    1 
ATOM   1605 C  C     . VAL A 1 203 ? -2.426  12.823  -24.159 1.00 27.55  ? 203  VAL A C     1 
ATOM   1606 O  O     . VAL A 1 203 ? -2.777  12.342  -25.254 1.00 27.25  ? 203  VAL A O     1 
ATOM   1607 C  CB    . VAL A 1 203 ? -3.915  14.847  -23.452 1.00 27.39  ? 203  VAL A CB    1 
ATOM   1608 C  CG1   . VAL A 1 203 ? -2.733  15.839  -23.327 1.00 27.12  ? 203  VAL A CG1   1 
ATOM   1609 C  CG2   . VAL A 1 203 ? -4.609  14.957  -24.820 1.00 27.95  ? 203  VAL A CG2   1 
ATOM   1610 N  N     . ASP A 1 204 ? -1.152  12.851  -23.762 1.00 27.60  ? 204  ASP A N     1 
ATOM   1611 C  CA    . ASP A 1 204 ? -0.077  12.308  -24.608 1.00 28.54  ? 204  ASP A CA    1 
ATOM   1612 C  C     . ASP A 1 204 ? -0.246  10.819  -24.907 1.00 28.84  ? 204  ASP A C     1 
ATOM   1613 O  O     . ASP A 1 204 ? 0.236   10.342  -25.939 1.00 28.45  ? 204  ASP A O     1 
ATOM   1614 C  CB    . ASP A 1 204 ? 1.312   12.583  -24.013 1.00 28.63  ? 204  ASP A CB    1 
ATOM   1615 C  CG    . ASP A 1 204 ? 1.585   14.068  -23.811 1.00 30.18  ? 204  ASP A CG    1 
ATOM   1616 O  OD1   . ASP A 1 204 ? 0.910   14.900  -24.450 1.00 31.35  ? 204  ASP A OD1   1 
ATOM   1617 O  OD2   . ASP A 1 204 ? 2.467   14.417  -22.990 1.00 32.98  ? 204  ASP A OD2   1 
ATOM   1618 N  N     . THR A 1 205 ? -0.945  10.093  -24.027 1.00 29.02  ? 205  THR A N     1 
ATOM   1619 C  CA    . THR A 1 205 ? -1.171  8.651   -24.231 1.00 30.03  ? 205  THR A CA    1 
ATOM   1620 C  C     . THR A 1 205 ? -2.089  8.315   -25.424 1.00 30.46  ? 205  THR A C     1 
ATOM   1621 O  O     . THR A 1 205 ? -2.099  7.184   -25.899 1.00 30.93  ? 205  THR A O     1 
ATOM   1622 C  CB    . THR A 1 205 ? -1.730  7.939   -22.958 1.00 30.53  ? 205  THR A CB    1 
ATOM   1623 O  OG1   . THR A 1 205 ? -3.084  8.351   -22.721 1.00 30.34  ? 205  THR A OG1   1 
ATOM   1624 C  CG2   . THR A 1 205 ? -0.865  8.229   -21.717 1.00 30.10  ? 205  THR A CG2   1 
ATOM   1625 N  N     . LEU A 1 206 ? -2.853  9.295   -25.893 1.00 30.94  ? 206  LEU A N     1 
ATOM   1626 C  CA    . LEU A 1 206 ? -3.830  9.085   -26.960 1.00 31.64  ? 206  LEU A CA    1 
ATOM   1627 C  C     . LEU A 1 206 ? -3.172  8.976   -28.322 1.00 32.10  ? 206  LEU A C     1 
ATOM   1628 O  O     . LEU A 1 206 ? -3.695  8.308   -29.222 1.00 32.32  ? 206  LEU A O     1 
ATOM   1629 C  CB    . LEU A 1 206 ? -4.847  10.231  -26.991 1.00 31.26  ? 206  LEU A CB    1 
ATOM   1630 C  CG    . LEU A 1 206 ? -5.659  10.459  -25.716 1.00 32.27  ? 206  LEU A CG    1 
ATOM   1631 C  CD1   . LEU A 1 206 ? -6.497  11.729  -25.829 1.00 33.00  ? 206  LEU A CD1   1 
ATOM   1632 C  CD2   . LEU A 1 206 ? -6.530  9.253   -25.397 1.00 32.84  ? 206  LEU A CD2   1 
ATOM   1633 N  N     . SER A 1 207 ? -2.028  9.639   -28.471 1.00 32.43  ? 207  SER A N     1 
ATOM   1634 C  CA    . SER A 1 207 ? -1.377  9.747   -29.763 1.00 33.24  ? 207  SER A CA    1 
ATOM   1635 C  C     . SER A 1 207 ? -0.116  8.888   -29.862 1.00 33.49  ? 207  SER A C     1 
ATOM   1636 O  O     . SER A 1 207 ? 0.719   9.098   -30.740 1.00 33.27  ? 207  SER A O     1 
ATOM   1637 C  CB    . SER A 1 207 ? -1.072  11.212  -30.068 1.00 33.35  ? 207  SER A CB    1 
ATOM   1638 O  OG    . SER A 1 207 ? -2.225  12.011  -29.830 1.00 34.72  ? 207  SER A OG    1 
ATOM   1639 N  N     . ILE A 1 208 ? 0.022   7.924   -28.958 1.00 34.05  ? 208  ILE A N     1 
ATOM   1640 C  CA    . ILE A 1 208 ? 1.114   6.968   -29.047 1.00 34.69  ? 208  ILE A CA    1 
ATOM   1641 C  C     . ILE A 1 208 ? 0.562   5.615   -29.482 1.00 35.06  ? 208  ILE A C     1 
ATOM   1642 O  O     . ILE A 1 208 ? -0.580  5.272   -29.159 1.00 35.05  ? 208  ILE A O     1 
ATOM   1643 C  CB    . ILE A 1 208 ? 1.923   6.875   -27.715 1.00 34.77  ? 208  ILE A CB    1 
ATOM   1644 C  CG1   . ILE A 1 208 ? 3.258   6.155   -27.946 1.00 35.40  ? 208  ILE A CG1   1 
ATOM   1645 C  CG2   . ILE A 1 208 ? 1.085   6.234   -26.607 1.00 34.07  ? 208  ILE A CG2   1 
ATOM   1646 C  CD1   . ILE A 1 208 ? 4.106   5.959   -26.705 1.00 36.56  ? 208  ILE A CD1   1 
ATOM   1647 N  N     . GLU A 1 209 ? 1.361   4.879   -30.254 1.00 35.71  ? 209  GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 209 ? 1.107   3.472   -30.568 1.00 36.34  ? 209  GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 209 ? 0.851   2.668   -29.285 1.00 36.44  ? 209  GLU A C     1 
ATOM   1650 O  O     . GLU A 1 209 ? 1.666   2.709   -28.361 1.00 36.12  ? 209  GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 209 ? 2.326   2.917   -31.320 1.00 36.98  ? 209  GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 209 ? 2.415   1.401   -31.492 1.00 38.17  ? 209  GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 209 ? 3.542   0.976   -32.456 1.00 40.97  ? 209  GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 209 ? 3.769   -0.246  -32.606 1.00 41.95  ? 209  GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 209 ? 4.196   1.854   -33.069 1.00 41.02  ? 209  GLU A OE2   1 
ATOM   1656 N  N     . PHE A 1 210 ? -0.275  1.954   -29.226 1.00 36.50  ? 210  PHE A N     1 
ATOM   1657 C  CA    . PHE A 1 210 ? -0.635  1.208   -28.020 1.00 36.84  ? 210  PHE A CA    1 
ATOM   1658 C  C     . PHE A 1 210 ? 0.396   0.125   -27.705 1.00 36.80  ? 210  PHE A C     1 
ATOM   1659 O  O     . PHE A 1 210 ? 0.771   -0.068  -26.546 1.00 36.15  ? 210  PHE A O     1 
ATOM   1660 C  CB    . PHE A 1 210 ? -2.050  0.607   -28.101 1.00 36.94  ? 210  PHE A CB    1 
ATOM   1661 C  CG    . PHE A 1 210 ? -2.380  -0.334  -26.955 1.00 38.32  ? 210  PHE A CG    1 
ATOM   1662 C  CD1   . PHE A 1 210 ? -2.670  0.161   -25.684 1.00 39.42  ? 210  PHE A CD1   1 
ATOM   1663 C  CD2   . PHE A 1 210 ? -2.385  -1.716  -27.148 1.00 39.55  ? 210  PHE A CD2   1 
ATOM   1664 C  CE1   . PHE A 1 210 ? -2.964  -0.704  -24.622 1.00 39.90  ? 210  PHE A CE1   1 
ATOM   1665 C  CE2   . PHE A 1 210 ? -2.679  -2.589  -26.093 1.00 40.12  ? 210  PHE A CE2   1 
ATOM   1666 C  CZ    . PHE A 1 210 ? -2.968  -2.082  -24.828 1.00 39.75  ? 210  PHE A CZ    1 
ATOM   1667 N  N     . ASP A 1 211 ? 0.857   -0.569  -28.742 1.00 36.60  ? 211  ASP A N     1 
ATOM   1668 C  CA    . ASP A 1 211 ? 1.851   -1.625  -28.562 1.00 36.70  ? 211  ASP A CA    1 
ATOM   1669 C  C     . ASP A 1 211 ? 3.199   -1.085  -28.069 1.00 36.36  ? 211  ASP A C     1 
ATOM   1670 O  O     . ASP A 1 211 ? 3.901   -1.768  -27.335 1.00 36.47  ? 211  ASP A O     1 
ATOM   1671 C  CB    . ASP A 1 211 ? 1.983   -2.476  -29.836 1.00 36.92  ? 211  ASP A CB    1 
ATOM   1672 C  CG    . ASP A 1 211 ? 0.779   -3.389  -30.054 1.00 37.85  ? 211  ASP A CG    1 
ATOM   1673 O  OD1   . ASP A 1 211 ? 0.424   -3.657  -31.218 1.00 40.96  ? 211  ASP A OD1   1 
ATOM   1674 O  OD2   . ASP A 1 211 ? 0.176   -3.847  -29.059 1.00 39.82  ? 211  ASP A OD2   1 
ATOM   1675 N  N     . LYS A 1 212 ? 3.534   0.148   -28.439 1.00 36.05  ? 212  LYS A N     1 
ATOM   1676 C  CA    . LYS A 1 212 ? 4.756   0.803   -27.959 1.00 36.03  ? 212  LYS A CA    1 
ATOM   1677 C  C     . LYS A 1 212 ? 4.659   1.184   -26.473 1.00 36.07  ? 212  LYS A C     1 
ATOM   1678 O  O     . LYS A 1 212 ? 5.634   1.068   -25.722 1.00 35.81  ? 212  LYS A O     1 
ATOM   1679 C  CB    . LYS A 1 212 ? 5.045   2.042   -28.804 1.00 36.36  ? 212  LYS A CB    1 
ATOM   1680 C  CG    . LYS A 1 212 ? 6.321   2.806   -28.446 1.00 37.60  ? 212  LYS A CG    1 
ATOM   1681 C  CD    . LYS A 1 212 ? 6.718   3.746   -29.583 1.00 39.62  ? 212  LYS A CD    1 
ATOM   1682 C  CE    . LYS A 1 212 ? 8.083   4.374   -29.348 1.00 40.12  ? 212  LYS A CE    1 
ATOM   1683 N  NZ    . LYS A 1 212 ? 8.716   4.721   -30.655 1.00 42.28  ? 212  LYS A NZ    1 
ATOM   1684 N  N     . LEU A 1 213 ? 3.486   1.656   -26.063 1.00 35.65  ? 213  LEU A N     1 
ATOM   1685 C  CA    . LEU A 1 213 ? 3.261   2.022   -24.670 1.00 36.04  ? 213  LEU A CA    1 
ATOM   1686 C  C     . LEU A 1 213 ? 3.273   0.758   -23.816 1.00 36.18  ? 213  LEU A C     1 
ATOM   1687 O  O     . LEU A 1 213 ? 3.862   0.737   -22.732 1.00 36.38  ? 213  LEU A O     1 
ATOM   1688 C  CB    . LEU A 1 213 ? 1.935   2.766   -24.523 1.00 35.70  ? 213  LEU A CB    1 
ATOM   1689 C  CG    . LEU A 1 213 ? 1.535   3.259   -23.136 1.00 35.16  ? 213  LEU A CG    1 
ATOM   1690 C  CD1   . LEU A 1 213 ? 2.496   4.335   -22.633 1.00 34.91  ? 213  LEU A CD1   1 
ATOM   1691 C  CD2   . LEU A 1 213 ? 0.100   3.771   -23.180 1.00 34.69  ? 213  LEU A CD2   1 
ATOM   1692 N  N     . LYS A 1 214 ? 2.632   -0.287  -24.337 1.00 36.77  ? 214  LYS A N     1 
ATOM   1693 C  CA    . LYS A 1 214 ? 2.528   -1.589  -23.691 1.00 37.68  ? 214  LYS A CA    1 
ATOM   1694 C  C     . LYS A 1 214 ? 3.905   -2.222  -23.473 1.00 37.70  ? 214  LYS A C     1 
ATOM   1695 O  O     . LYS A 1 214 ? 4.182   -2.754  -22.398 1.00 37.39  ? 214  LYS A O     1 
ATOM   1696 C  CB    . LYS A 1 214 ? 1.630   -2.515  -24.522 1.00 38.04  ? 214  LYS A CB    1 
ATOM   1697 C  CG    . LYS A 1 214 ? 1.475   -3.928  -23.968 1.00 39.95  ? 214  LYS A CG    1 
ATOM   1698 C  CD    . LYS A 1 214 ? 0.408   -4.698  -24.736 1.00 43.36  ? 214  LYS A CD    1 
ATOM   1699 C  CE    . LYS A 1 214 ? 0.673   -6.199  -24.698 1.00 44.62  ? 214  LYS A CE    1 
ATOM   1700 N  NZ    . LYS A 1 214 ? 1.662   -6.607  -25.750 1.00 46.57  ? 214  LYS A NZ    1 
ATOM   1701 N  N     . GLY A 1 215 ? 4.759   -2.149  -24.490 1.00 37.69  ? 215  GLY A N     1 
ATOM   1702 C  CA    . GLY A 1 215 ? 6.120   -2.676  -24.402 1.00 38.13  ? 215  GLY A CA    1 
ATOM   1703 C  C     . GLY A 1 215 ? 6.988   -1.958  -23.380 1.00 38.40  ? 215  GLY A C     1 
ATOM   1704 O  O     . GLY A 1 215 ? 7.971   -2.511  -22.903 1.00 38.90  ? 215  GLY A O     1 
ATOM   1705 N  N     . MET A 1 216 ? 6.629   -0.728  -23.036 1.00 38.54  ? 216  MET A N     1 
ATOM   1706 C  CA    . MET A 1 216 ? 7.388   0.040   -22.055 1.00 38.55  ? 216  MET A CA    1 
ATOM   1707 C  C     . MET A 1 216 ? 6.849   -0.125  -20.622 1.00 37.78  ? 216  MET A C     1 
ATOM   1708 O  O     . MET A 1 216 ? 7.617   -0.346  -19.692 1.00 37.92  ? 216  MET A O     1 
ATOM   1709 C  CB    . MET A 1 216 ? 7.433   1.513   -22.466 1.00 39.39  ? 216  MET A CB    1 
ATOM   1710 C  CG    . MET A 1 216 ? 8.323   2.405   -21.594 1.00 42.06  ? 216  MET A CG    1 
ATOM   1711 S  SD    . MET A 1 216 ? 10.107  2.259   -21.903 1.00 47.86  ? 216  MET A SD    1 
ATOM   1712 C  CE    . MET A 1 216 ? 10.270  3.043   -23.508 1.00 45.31  ? 216  MET A CE    1 
ATOM   1713 N  N     . ILE A 1 217 ? 5.534   -0.036  -20.444 1.00 36.62  ? 217  ILE A N     1 
ATOM   1714 C  CA    . ILE A 1 217 ? 4.953   -0.051  -19.096 1.00 35.42  ? 217  ILE A CA    1 
ATOM   1715 C  C     . ILE A 1 217 ? 4.059   -1.250  -18.807 1.00 35.12  ? 217  ILE A C     1 
ATOM   1716 O  O     . ILE A 1 217 ? 3.561   -1.400  -17.697 1.00 34.85  ? 217  ILE A O     1 
ATOM   1717 C  CB    . ILE A 1 217 ? 4.201   1.281   -18.755 1.00 35.21  ? 217  ILE A CB    1 
ATOM   1718 C  CG1   . ILE A 1 217 ? 2.920   1.437   -19.600 1.00 33.69  ? 217  ILE A CG1   1 
ATOM   1719 C  CG2   . ILE A 1 217 ? 5.146   2.476   -18.878 1.00 34.52  ? 217  ILE A CG2   1 
ATOM   1720 C  CD1   . ILE A 1 217 ? 2.024   2.648   -19.224 1.00 29.82  ? 217  ILE A CD1   1 
ATOM   1721 N  N     . GLY A 1 218 ? 3.861   -2.112  -19.798 1.00 34.80  ? 218  GLY A N     1 
ATOM   1722 C  CA    . GLY A 1 218 ? 2.994   -3.271  -19.618 1.00 34.58  ? 218  GLY A CA    1 
ATOM   1723 C  C     . GLY A 1 218 ? 1.543   -2.979  -19.953 1.00 34.56  ? 218  GLY A C     1 
ATOM   1724 O  O     . GLY A 1 218 ? 1.107   -1.823  -19.933 1.00 34.38  ? 218  GLY A O     1 
ATOM   1725 N  N     . GLU A 1 219 ? 0.802   -4.042  -20.250 1.00 34.27  ? 219  GLU A N     1 
ATOM   1726 C  CA    . GLU A 1 219 ? -0.585  -3.970  -20.700 1.00 34.37  ? 219  GLU A CA    1 
ATOM   1727 C  C     . GLU A 1 219 ? -1.517  -3.269  -19.715 1.00 33.58  ? 219  GLU A C     1 
ATOM   1728 O  O     . GLU A 1 219 ? -2.241  -2.348  -20.097 1.00 34.58  ? 219  GLU A O     1 
ATOM   1729 C  CB    . GLU A 1 219 ? -1.100  -5.382  -21.013 1.00 34.39  ? 219  GLU A CB    1 
ATOM   1730 C  CG    . GLU A 1 219 ? -2.463  -5.454  -21.695 1.00 36.48  ? 219  GLU A CG    1 
ATOM   1731 C  CD    . GLU A 1 219 ? -2.896  -6.894  -22.005 1.00 39.58  ? 219  GLU A CD    1 
ATOM   1732 O  OE1   . GLU A 1 219 ? -3.832  -7.079  -22.808 1.00 40.62  ? 219  GLU A OE1   1 
ATOM   1733 O  OE2   . GLU A 1 219 ? -2.310  -7.846  -21.442 1.00 41.38  ? 219  GLU A OE2   1 
ATOM   1734 N  N     . ALA A 1 220 ? -1.506  -3.706  -18.460 1.00 32.61  ? 220  ALA A N     1 
ATOM   1735 C  CA    . ALA A 1 220 ? -2.409  -3.159  -17.443 1.00 31.41  ? 220  ALA A CA    1 
ATOM   1736 C  C     . ALA A 1 220 ? -2.269  -1.639  -17.234 1.00 30.88  ? 220  ALA A C     1 
ATOM   1737 O  O     . ALA A 1 220 ? -3.272  -0.924  -17.243 1.00 30.47  ? 220  ALA A O     1 
ATOM   1738 C  CB    . ALA A 1 220 ? -2.242  -3.900  -16.147 1.00 31.75  ? 220  ALA A CB    1 
ATOM   1739 N  N     . LYS A 1 221 ? -1.038  -1.151  -17.073 1.00 29.72  ? 221  LYS A N     1 
ATOM   1740 C  CA    . LYS A 1 221 ? -0.797  0.293   -16.933 1.00 29.49  ? 221  LYS A CA    1 
ATOM   1741 C  C     . LYS A 1 221 ? -1.093  1.076   -18.210 1.00 28.31  ? 221  LYS A C     1 
ATOM   1742 O  O     . LYS A 1 221 ? -1.562  2.215   -18.145 1.00 27.58  ? 221  LYS A O     1 
ATOM   1743 C  CB    . LYS A 1 221 ? 0.635   0.588   -16.463 1.00 29.25  ? 221  LYS A CB    1 
ATOM   1744 C  CG    . LYS A 1 221 ? 0.823   0.423   -14.970 1.00 32.32  ? 221  LYS A CG    1 
ATOM   1745 C  CD    . LYS A 1 221 ? 2.109   1.108   -14.507 1.00 35.05  ? 221  LYS A CD    1 
ATOM   1746 C  CE    . LYS A 1 221 ? 2.241   1.082   -13.007 1.00 37.91  ? 221  LYS A CE    1 
ATOM   1747 N  NZ    . LYS A 1 221 ? 2.956   -0.156  -12.525 1.00 41.89  ? 221  LYS A NZ    1 
ATOM   1748 N  N     . ALA A 1 222 ? -0.806  0.468   -19.364 1.00 27.69  ? 222  ALA A N     1 
ATOM   1749 C  CA    . ALA A 1 222 ? -1.121  1.080   -20.648 1.00 26.51  ? 222  ALA A CA    1 
ATOM   1750 C  C     . ALA A 1 222 ? -2.632  1.270   -20.783 1.00 26.39  ? 222  ALA A C     1 
ATOM   1751 O  O     . ALA A 1 222 ? -3.081  2.377   -21.037 1.00 26.07  ? 222  ALA A O     1 
ATOM   1752 C  CB    . ALA A 1 222 ? -0.565  0.255   -21.806 1.00 26.77  ? 222  ALA A CB    1 
ATOM   1753 N  N     . LYS A 1 223 ? -3.404  0.201   -20.570 1.00 26.34  ? 223  LYS A N     1 
ATOM   1754 C  CA    . LYS A 1 223 ? -4.884  0.256   -20.599 1.00 26.38  ? 223  LYS A CA    1 
ATOM   1755 C  C     . LYS A 1 223 ? -5.464  1.260   -19.598 1.00 25.78  ? 223  LYS A C     1 
ATOM   1756 O  O     . LYS A 1 223 ? -6.375  2.029   -19.934 1.00 25.02  ? 223  LYS A O     1 
ATOM   1757 C  CB    . LYS A 1 223 ? -5.484  -1.133  -20.341 1.00 26.37  ? 223  LYS A CB    1 
ATOM   1758 C  CG    . LYS A 1 223 ? -5.525  -2.039  -21.586 1.00 30.09  ? 223  LYS A CG    1 
ATOM   1759 C  CD    . LYS A 1 223 ? -5.767  -3.492  -21.192 1.00 33.35  ? 223  LYS A CD    1 
ATOM   1760 C  CE    . LYS A 1 223 ? -6.131  -4.349  -22.412 1.00 37.71  ? 223  LYS A CE    1 
ATOM   1761 N  NZ    . LYS A 1 223 ? -7.489  -4.017  -22.941 1.00 39.70  ? 223  LYS A NZ    1 
ATOM   1762 N  N     . TYR A 1 224 ? -4.922  1.248   -18.377 1.00 24.66  ? 224  TYR A N     1 
ATOM   1763 C  CA    . TYR A 1 224 ? -5.331  2.174   -17.316 1.00 24.32  ? 224  TYR A CA    1 
ATOM   1764 C  C     . TYR A 1 224 ? -5.236  3.627   -17.776 1.00 23.82  ? 224  TYR A C     1 
ATOM   1765 O  O     . TYR A 1 224 ? -6.237  4.351   -17.753 1.00 22.31  ? 224  TYR A O     1 
ATOM   1766 C  CB    . TYR A 1 224 ? -4.484  1.923   -16.065 1.00 24.25  ? 224  TYR A CB    1 
ATOM   1767 C  CG    . TYR A 1 224 ? -4.642  2.890   -14.913 1.00 25.16  ? 224  TYR A CG    1 
ATOM   1768 C  CD1   . TYR A 1 224 ? -5.819  2.942   -14.167 1.00 27.39  ? 224  TYR A CD1   1 
ATOM   1769 C  CD2   . TYR A 1 224 ? -3.583  3.721   -14.533 1.00 27.30  ? 224  TYR A CD2   1 
ATOM   1770 C  CE1   . TYR A 1 224 ? -5.949  3.804   -13.089 1.00 28.15  ? 224  TYR A CE1   1 
ATOM   1771 C  CE2   . TYR A 1 224 ? -3.696  4.597   -13.453 1.00 25.10  ? 224  TYR A CE2   1 
ATOM   1772 C  CZ    . TYR A 1 224 ? -4.884  4.634   -12.742 1.00 28.30  ? 224  TYR A CZ    1 
ATOM   1773 O  OH    . TYR A 1 224 ? -5.013  5.477   -11.660 1.00 29.70  ? 224  TYR A OH    1 
ATOM   1774 N  N     . LEU A 1 225 ? -4.040  4.033   -18.217 1.00 23.73  ? 225  LEU A N     1 
ATOM   1775 C  CA    . LEU A 1 225 ? -3.778  5.418   -18.610 1.00 23.50  ? 225  LEU A CA    1 
ATOM   1776 C  C     . LEU A 1 225 ? -4.616  5.858   -19.819 1.00 23.84  ? 225  LEU A C     1 
ATOM   1777 O  O     . LEU A 1 225 ? -5.176  6.959   -19.844 1.00 23.42  ? 225  LEU A O     1 
ATOM   1778 C  CB    . LEU A 1 225 ? -2.283  5.635   -18.904 1.00 23.58  ? 225  LEU A CB    1 
ATOM   1779 C  CG    . LEU A 1 225 ? -1.332  5.502   -17.705 1.00 23.41  ? 225  LEU A CG    1 
ATOM   1780 C  CD1   . LEU A 1 225 ? 0.113   5.642   -18.157 1.00 22.99  ? 225  LEU A CD1   1 
ATOM   1781 C  CD2   . LEU A 1 225 ? -1.650  6.506   -16.593 1.00 23.59  ? 225  LEU A CD2   1 
ATOM   1782 N  N     . ILE A 1 226 ? -4.714  4.991   -20.816 1.00 23.88  ? 226  ILE A N     1 
ATOM   1783 C  CA    . ILE A 1 226 ? -5.495  5.325   -22.003 1.00 24.44  ? 226  ILE A CA    1 
ATOM   1784 C  C     . ILE A 1 226 ? -6.971  5.530   -21.641 1.00 23.87  ? 226  ILE A C     1 
ATOM   1785 O  O     . ILE A 1 226 ? -7.596  6.493   -22.091 1.00 23.53  ? 226  ILE A O     1 
ATOM   1786 C  CB    . ILE A 1 226 ? -5.287  4.286   -23.114 1.00 24.85  ? 226  ILE A CB    1 
ATOM   1787 C  CG1   . ILE A 1 226 ? -3.843  4.363   -23.598 1.00 25.83  ? 226  ILE A CG1   1 
ATOM   1788 C  CG2   . ILE A 1 226 ? -6.228  4.545   -24.298 1.00 25.39  ? 226  ILE A CG2   1 
ATOM   1789 C  CD1   . ILE A 1 226 ? -3.472  3.240   -24.551 1.00 29.30  ? 226  ILE A CD1   1 
ATOM   1790 N  N     . SER A 1 227 ? -7.496  4.653   -20.790 1.00 23.85  ? 227  SER A N     1 
ATOM   1791 C  CA    . SER A 1 227 ? -8.881  4.730   -20.326 1.00 24.64  ? 227  SER A CA    1 
ATOM   1792 C  C     . SER A 1 227 ? -9.176  6.061   -19.610 1.00 24.01  ? 227  SER A C     1 
ATOM   1793 O  O     . SER A 1 227 ? -10.229 6.686   -19.824 1.00 23.50  ? 227  SER A O     1 
ATOM   1794 C  CB    . SER A 1 227 ? -9.167  3.553   -19.399 1.00 25.31  ? 227  SER A CB    1 
ATOM   1795 O  OG    . SER A 1 227 ? -10.510 3.567   -18.950 1.00 29.71  ? 227  SER A OG    1 
ATOM   1796 N  N     . LEU A 1 228 ? -8.236  6.481   -18.761 1.00 23.32  ? 228  LEU A N     1 
ATOM   1797 C  CA    . LEU A 1 228 ? -8.328  7.749   -18.065 1.00 22.81  ? 228  LEU A CA    1 
ATOM   1798 C  C     . LEU A 1 228 ? -8.263  8.879   -19.064 1.00 22.27  ? 228  LEU A C     1 
ATOM   1799 O  O     . LEU A 1 228 ? -9.084  9.777   -19.017 1.00 21.54  ? 228  LEU A O     1 
ATOM   1800 C  CB    . LEU A 1 228 ? -7.181  7.911   -17.049 1.00 22.80  ? 228  LEU A CB    1 
ATOM   1801 C  CG    . LEU A 1 228 ? -7.251  7.136   -15.751 1.00 22.75  ? 228  LEU A CG    1 
ATOM   1802 C  CD1   . LEU A 1 228 ? -5.866  7.192   -15.093 1.00 23.33  ? 228  LEU A CD1   1 
ATOM   1803 C  CD2   . LEU A 1 228 ? -8.324  7.743   -14.851 1.00 22.50  ? 228  LEU A CD2   1 
ATOM   1804 N  N     . ALA A 1 229 ? -7.289  8.827   -19.974 1.00 22.36  ? 229  ALA A N     1 
ATOM   1805 C  CA    . ALA A 1 229 ? -7.110  9.904   -20.959 1.00 23.17  ? 229  ALA A CA    1 
ATOM   1806 C  C     . ALA A 1 229 ? -8.297  10.043  -21.908 1.00 23.51  ? 229  ALA A C     1 
ATOM   1807 O  O     . ALA A 1 229 ? -8.580  11.139  -22.384 1.00 22.10  ? 229  ALA A O     1 
ATOM   1808 C  CB    . ALA A 1 229 ? -5.840  9.708   -21.761 1.00 22.79  ? 229  ALA A CB    1 
ATOM   1809 N  N     . ARG A 1 230 ? -8.981  8.929   -22.153 1.00 24.70  ? 230  ARG A N     1 
ATOM   1810 C  CA    . ARG A 1 230 ? -10.161 8.913   -23.019 1.00 27.03  ? 230  ARG A CA    1 
ATOM   1811 C  C     . ARG A 1 230 ? -11.409 9.346   -22.270 1.00 27.81  ? 230  ARG A C     1 
ATOM   1812 O  O     . ARG A 1 230 ? -12.480 9.443   -22.865 1.00 27.48  ? 230  ARG A O     1 
ATOM   1813 C  CB    . ARG A 1 230 ? -10.380 7.526   -23.626 1.00 26.76  ? 230  ARG A CB    1 
ATOM   1814 C  CG    . ARG A 1 230 ? -9.486  7.261   -24.802 1.00 30.05  ? 230  ARG A CG    1 
ATOM   1815 C  CD    . ARG A 1 230 ? -9.704  5.890   -25.433 1.00 33.46  ? 230  ARG A CD    1 
ATOM   1816 N  NE    . ARG A 1 230 ? -8.742  5.707   -26.526 1.00 38.83  ? 230  ARG A NE    1 
ATOM   1817 C  CZ    . ARG A 1 230 ? -8.429  4.539   -27.086 1.00 39.89  ? 230  ARG A CZ    1 
ATOM   1818 N  NH1   . ARG A 1 230 ? -9.008  3.415   -26.678 1.00 41.36  ? 230  ARG A NH1   1 
ATOM   1819 N  NH2   . ARG A 1 230 ? -7.530  4.500   -28.059 1.00 41.24  ? 230  ARG A NH2   1 
ATOM   1820 N  N     . ASP A 1 231 ? -11.270 9.593   -20.967 1.00 29.10  ? 231  ASP A N     1 
ATOM   1821 C  CA    . ASP A 1 231 ? -12.394 10.028  -20.132 1.00 30.67  ? 231  ASP A CA    1 
ATOM   1822 C  C     . ASP A 1 231 ? -13.428 8.890   -20.012 1.00 31.49  ? 231  ASP A C     1 
ATOM   1823 O  O     . ASP A 1 231 ? -14.643 9.136   -20.009 1.00 31.48  ? 231  ASP A O     1 
ATOM   1824 C  CB    . ASP A 1 231 ? -13.024 11.294  -20.745 1.00 31.28  ? 231  ASP A CB    1 
ATOM   1825 C  CG    . ASP A 1 231 ? -13.712 12.178  -19.720 1.00 32.51  ? 231  ASP A CG    1 
ATOM   1826 O  OD1   . ASP A 1 231 ? -13.896 11.748  -18.563 1.00 32.86  ? 231  ASP A OD1   1 
ATOM   1827 O  OD2   . ASP A 1 231 ? -14.077 13.319  -20.089 1.00 35.24  ? 231  ASP A OD2   1 
ATOM   1828 N  N     . GLU A 1 232 ? -12.928 7.652   -19.916 1.00 31.84  ? 232  GLU A N     1 
ATOM   1829 C  CA    . GLU A 1 232 ? -13.754 6.441   -19.887 1.00 32.60  ? 232  GLU A CA    1 
ATOM   1830 C  C     . GLU A 1 232 ? -13.579 5.562   -18.647 1.00 32.92  ? 232  GLU A C     1 
ATOM   1831 O  O     . GLU A 1 232 ? -14.354 4.633   -18.440 1.00 33.48  ? 232  GLU A O     1 
ATOM   1832 C  CB    . GLU A 1 232 ? -13.477 5.576   -21.118 1.00 32.51  ? 232  GLU A CB    1 
ATOM   1833 C  CG    . GLU A 1 232 ? -13.903 6.204   -22.419 1.00 33.99  ? 232  GLU A CG    1 
ATOM   1834 C  CD    . GLU A 1 232 ? -13.695 5.289   -23.607 1.00 35.49  ? 232  GLU A CD    1 
ATOM   1835 O  OE1   . GLU A 1 232 ? -12.740 4.483   -23.601 1.00 37.71  ? 232  GLU A OE1   1 
ATOM   1836 O  OE2   . GLU A 1 232 ? -14.490 5.384   -24.555 1.00 37.81  ? 232  GLU A OE2   1 
ATOM   1837 N  N     . TYR A 1 233 ? -12.557 5.817   -17.836 1.00 33.05  ? 233  TYR A N     1 
ATOM   1838 C  CA    . TYR A 1 233 ? -12.355 5.029   -16.626 1.00 33.45  ? 233  TYR A CA    1 
ATOM   1839 C  C     . TYR A 1 233 ? -13.642 5.045   -15.807 1.00 34.14  ? 233  TYR A C     1 
ATOM   1840 O  O     . TYR A 1 233 ? -14.201 6.117   -15.545 1.00 33.81  ? 233  TYR A O     1 
ATOM   1841 C  CB    . TYR A 1 233 ? -11.178 5.583   -15.811 1.00 32.86  ? 233  TYR A CB    1 
ATOM   1842 C  CG    . TYR A 1 233 ? -10.904 4.838   -14.532 1.00 32.27  ? 233  TYR A CG    1 
ATOM   1843 C  CD1   . TYR A 1 233 ? -9.898  3.860   -14.467 1.00 31.16  ? 233  TYR A CD1   1 
ATOM   1844 C  CD2   . TYR A 1 233 ? -11.639 5.113   -13.375 1.00 30.91  ? 233  TYR A CD2   1 
ATOM   1845 C  CE1   . TYR A 1 233 ? -9.637  3.174   -13.277 1.00 30.12  ? 233  TYR A CE1   1 
ATOM   1846 C  CE2   . TYR A 1 233 ? -11.390 4.435   -12.182 1.00 31.15  ? 233  TYR A CE2   1 
ATOM   1847 C  CZ    . TYR A 1 233 ? -10.386 3.467   -12.144 1.00 31.86  ? 233  TYR A CZ    1 
ATOM   1848 O  OH    . TYR A 1 233 ? -10.152 2.808   -10.962 1.00 34.48  ? 233  TYR A OH    1 
ATOM   1849 N  N     . ASN A 1 234 ? -14.112 3.862   -15.418 1.00 35.08  ? 234  ASN A N     1 
ATOM   1850 C  CA    . ASN A 1 234 ? -15.378 3.749   -14.696 1.00 36.56  ? 234  ASN A CA    1 
ATOM   1851 C  C     . ASN A 1 234 ? -15.416 2.511   -13.803 1.00 36.89  ? 234  ASN A C     1 
ATOM   1852 O  O     . ASN A 1 234 ? -16.424 1.806   -13.750 1.00 36.95  ? 234  ASN A O     1 
ATOM   1853 C  CB    . ASN A 1 234 ? -16.552 3.738   -15.684 1.00 36.91  ? 234  ASN A CB    1 
ATOM   1854 C  CG    . ASN A 1 234 ? -17.890 4.103   -15.036 1.00 39.13  ? 234  ASN A CG    1 
ATOM   1855 O  OD1   . ASN A 1 234 ? -17.943 4.623   -13.920 1.00 41.64  ? 234  ASN A OD1   1 
ATOM   1856 N  ND2   . ASN A 1 234 ? -18.982 3.830   -15.750 1.00 40.62  ? 234  ASN A ND2   1 
ATOM   1857 N  N     . GLU A 1 235 ? -14.319 2.273   -13.088 1.00 37.20  ? 235  GLU A N     1 
ATOM   1858 C  CA    . GLU A 1 235 ? -14.181 1.095   -12.237 1.00 37.42  ? 235  GLU A CA    1 
ATOM   1859 C  C     . GLU A 1 235 ? -15.056 1.169   -10.990 1.00 37.02  ? 235  GLU A C     1 
ATOM   1860 O  O     . GLU A 1 235 ? -15.026 2.177   -10.272 1.00 36.47  ? 235  GLU A O     1 
ATOM   1861 C  CB    . GLU A 1 235 ? -12.716 0.861   -11.868 1.00 37.77  ? 235  GLU A CB    1 
ATOM   1862 C  CG    . GLU A 1 235 ? -11.890 0.320   -13.025 1.00 40.04  ? 235  GLU A CG    1 
ATOM   1863 C  CD    . GLU A 1 235 ? -12.515 -0.921  -13.659 1.00 42.67  ? 235  GLU A CD    1 
ATOM   1864 O  OE1   . GLU A 1 235 ? -12.667 -1.941  -12.951 1.00 45.60  ? 235  GLU A OE1   1 
ATOM   1865 O  OE2   . GLU A 1 235 ? -12.865 -0.871  -14.857 1.00 42.52  ? 235  GLU A OE2   1 
ATOM   1866 N  N     . PRO A 1 236 ? -15.831 0.095   -10.723 1.00 36.73  ? 236  PRO A N     1 
ATOM   1867 C  CA    . PRO A 1 236 ? -16.841 0.156   -9.656  1.00 36.48  ? 236  PRO A CA    1 
ATOM   1868 C  C     . PRO A 1 236 ? -16.239 0.268   -8.256  1.00 36.17  ? 236  PRO A C     1 
ATOM   1869 O  O     . PRO A 1 236 ? -15.104 -0.142  -8.017  1.00 35.54  ? 236  PRO A O     1 
ATOM   1870 C  CB    . PRO A 1 236 ? -17.632 -1.154  -9.820  1.00 36.53  ? 236  PRO A CB    1 
ATOM   1871 C  CG    . PRO A 1 236 ? -16.728 -2.070  -10.568 1.00 37.04  ? 236  PRO A CG    1 
ATOM   1872 C  CD    . PRO A 1 236 ? -15.812 -1.214  -11.407 1.00 36.89  ? 236  PRO A CD    1 
ATOM   1873 N  N     . ILE A 1 237 ? -17.003 0.857   -7.350  1.00 36.12  ? 237  ILE A N     1 
ATOM   1874 C  CA    . ILE A 1 237 ? -16.637 0.873   -5.951  1.00 36.67  ? 237  ILE A CA    1 
ATOM   1875 C  C     . ILE A 1 237 ? -17.005 -0.509  -5.414  1.00 37.28  ? 237  ILE A C     1 
ATOM   1876 O  O     . ILE A 1 237 ? -18.162 -0.912  -5.486  1.00 37.10  ? 237  ILE A O     1 
ATOM   1877 C  CB    . ILE A 1 237 ? -17.380 2.007   -5.185  1.00 36.50  ? 237  ILE A CB    1 
ATOM   1878 C  CG1   . ILE A 1 237 ? -16.735 3.380   -5.451  1.00 35.84  ? 237  ILE A CG1   1 
ATOM   1879 C  CG2   . ILE A 1 237 ? -17.362 1.764   -3.698  1.00 36.39  ? 237  ILE A CG2   1 
ATOM   1880 C  CD1   . ILE A 1 237 ? -16.769 3.843   -6.887  1.00 34.79  ? 237  ILE A CD1   1 
ATOM   1881 N  N     . ARG A 1 238 ? -16.020 -1.245  -4.911  1.00 37.92  ? 238  ARG A N     1 
ATOM   1882 C  CA    . ARG A 1 238 ? -16.299 -2.564  -4.361  1.00 39.02  ? 238  ARG A CA    1 
ATOM   1883 C  C     . ARG A 1 238 ? -15.642 -2.823  -3.012  1.00 39.04  ? 238  ARG A C     1 
ATOM   1884 O  O     . ARG A 1 238 ? -14.635 -2.210  -2.669  1.00 38.30  ? 238  ARG A O     1 
ATOM   1885 C  CB    . ARG A 1 238 ? -15.977 -3.677  -5.370  1.00 39.66  ? 238  ARG A CB    1 
ATOM   1886 C  CG    . ARG A 1 238 ? -14.532 -4.161  -5.432  1.00 42.14  ? 238  ARG A CG    1 
ATOM   1887 C  CD    . ARG A 1 238 ? -14.461 -5.501  -6.188  1.00 46.31  ? 238  ARG A CD    1 
ATOM   1888 N  NE    . ARG A 1 238 ? -14.464 -5.326  -7.646  1.00 50.31  ? 238  ARG A NE    1 
ATOM   1889 C  CZ    . ARG A 1 238 ? -15.542 -5.364  -8.438  1.00 52.14  ? 238  ARG A CZ    1 
ATOM   1890 N  NH1   . ARG A 1 238 ? -15.397 -5.188  -9.745  1.00 53.32  ? 238  ARG A NH1   1 
ATOM   1891 N  NH2   . ARG A 1 238 ? -16.758 -5.578  -7.945  1.00 53.43  ? 238  ARG A NH2   1 
ATOM   1892 N  N     . THR A 1 239 ? -16.254 -3.726  -2.253  1.00 39.19  ? 239  THR A N     1 
ATOM   1893 C  CA    . THR A 1 239 ? -15.749 -4.159  -0.966  1.00 39.39  ? 239  THR A CA    1 
ATOM   1894 C  C     . THR A 1 239 ? -14.378 -4.789  -1.202  1.00 39.00  ? 239  THR A C     1 
ATOM   1895 O  O     . THR A 1 239 ? -14.234 -5.653  -2.052  1.00 38.95  ? 239  THR A O     1 
ATOM   1896 C  CB    . THR A 1 239 ? -16.726 -5.178  -0.328  1.00 39.29  ? 239  THR A CB    1 
ATOM   1897 O  OG1   . THR A 1 239 ? -17.997 -4.547  -0.131  1.00 40.12  ? 239  THR A OG1   1 
ATOM   1898 C  CG2   . THR A 1 239 ? -16.200 -5.708  1.005   1.00 39.21  ? 239  THR A CG2   1 
ATOM   1899 N  N     . ARG A 1 240 ? -13.362 -4.313  -0.495  1.00 39.02  ? 240  ARG A N     1 
ATOM   1900 C  CA    . ARG A 1 240 ? -12.040 -4.933  -0.613  1.00 38.98  ? 240  ARG A CA    1 
ATOM   1901 C  C     . ARG A 1 240 ? -12.006 -6.119  0.344   1.00 38.05  ? 240  ARG A C     1 
ATOM   1902 O  O     . ARG A 1 240 ? -12.506 -6.035  1.455   1.00 38.36  ? 240  ARG A O     1 
ATOM   1903 C  CB    . ARG A 1 240 ? -10.898 -3.944  -0.310  1.00 39.56  ? 240  ARG A CB    1 
ATOM   1904 C  CG    . ARG A 1 240 ? -10.877 -2.707  -1.219  1.00 40.91  ? 240  ARG A CG    1 
ATOM   1905 C  CD    . ARG A 1 240 ? -9.470  -2.181  -1.518  1.00 42.38  ? 240  ARG A CD    1 
ATOM   1906 N  NE    . ARG A 1 240 ? -9.537  -0.972  -2.347  1.00 44.68  ? 240  ARG A NE    1 
ATOM   1907 C  CZ    . ARG A 1 240 ? -8.496  -0.233  -2.727  1.00 46.06  ? 240  ARG A CZ    1 
ATOM   1908 N  NH1   . ARG A 1 240 ? -7.259  -0.549  -2.352  1.00 47.74  ? 240  ARG A NH1   1 
ATOM   1909 N  NH2   . ARG A 1 240 ? -8.693  0.839   -3.489  1.00 47.26  ? 240  ARG A NH2   1 
ATOM   1910 N  N     . VAL A 1 241 ? -11.454 -7.233  -0.103  1.00 37.13  ? 241  VAL A N     1 
ATOM   1911 C  CA    . VAL A 1 241 ? -11.278 -8.382  0.781   1.00 36.40  ? 241  VAL A CA    1 
ATOM   1912 C  C     . VAL A 1 241 ? -9.787  -8.647  0.941   1.00 35.20  ? 241  VAL A C     1 
ATOM   1913 O  O     . VAL A 1 241 ? -9.068  -8.748  -0.044  1.00 34.97  ? 241  VAL A O     1 
ATOM   1914 C  CB    . VAL A 1 241 ? -12.063 -9.619  0.276   1.00 36.39  ? 241  VAL A CB    1 
ATOM   1915 C  CG1   . VAL A 1 241 ? -11.652 -10.894 1.015   1.00 36.38  ? 241  VAL A CG1   1 
ATOM   1916 C  CG2   . VAL A 1 241 ? -13.573 -9.373  0.430   1.00 36.96  ? 241  VAL A CG2   1 
ATOM   1917 N  N     . ARG A 1 242 ? -9.336  -8.706  2.191   1.00 34.83  ? 242  ARG A N     1 
ATOM   1918 C  CA    . ARG A 1 242 ? -7.925  -8.923  2.521   1.00 34.33  ? 242  ARG A CA    1 
ATOM   1919 C  C     . ARG A 1 242 ? -7.471  -10.250 1.910   1.00 33.51  ? 242  ARG A C     1 
ATOM   1920 O  O     . ARG A 1 242 ? -8.152  -11.272 2.056   1.00 33.44  ? 242  ARG A O     1 
ATOM   1921 C  CB    . ARG A 1 242 ? -7.737  -8.882  4.048   1.00 34.56  ? 242  ARG A CB    1 
ATOM   1922 C  CG    . ARG A 1 242 ? -6.323  -9.209  4.573   1.00 37.22  ? 242  ARG A CG    1 
ATOM   1923 C  CD    . ARG A 1 242 ? -5.261  -8.118  4.261   1.00 41.62  ? 242  ARG A CD    1 
ATOM   1924 N  NE    . ARG A 1 242 ? -5.633  -6.794  4.743   1.00 45.37  ? 242  ARG A NE    1 
ATOM   1925 C  CZ    . ARG A 1 242 ? -6.110  -5.822  3.968   1.00 48.32  ? 242  ARG A CZ    1 
ATOM   1926 N  NH1   . ARG A 1 242 ? -6.264  -6.017  2.655   1.00 48.84  ? 242  ARG A NH1   1 
ATOM   1927 N  NH2   . ARG A 1 242 ? -6.424  -4.649  4.505   1.00 48.65  ? 242  ARG A NH2   1 
ATOM   1928 N  N     . LYS A 1 243 ? -6.356  -10.209 1.185   1.00 32.02  ? 243  LYS A N     1 
ATOM   1929 C  CA    . LYS A 1 243 ? -5.813  -11.373 0.479   1.00 30.65  ? 243  LYS A CA    1 
ATOM   1930 C  C     . LYS A 1 243 ? -4.556  -11.988 1.132   1.00 29.22  ? 243  LYS A C     1 
ATOM   1931 O  O     . LYS A 1 243 ? -4.229  -13.159 0.899   1.00 29.06  ? 243  LYS A O     1 
ATOM   1932 C  CB    . LYS A 1 243 ? -5.504  -11.004 -0.981  1.00 30.93  ? 243  LYS A CB    1 
ATOM   1933 C  CG    . LYS A 1 243 ? -6.758  -10.851 -1.842  1.00 34.25  ? 243  LYS A CG    1 
ATOM   1934 C  CD    . LYS A 1 243 ? -6.455  -10.857 -3.319  1.00 36.96  ? 243  LYS A CD    1 
ATOM   1935 C  CE    . LYS A 1 243 ? -7.733  -10.646 -4.121  1.00 39.17  ? 243  LYS A CE    1 
ATOM   1936 N  NZ    . LYS A 1 243 ? -8.268  -9.275  -3.897  1.00 41.29  ? 243  LYS A NZ    1 
ATOM   1937 N  N     . SER A 1 244 ? -3.838  -11.200 1.921   1.00 26.75  ? 244  SER A N     1 
ATOM   1938 C  CA    . SER A 1 244 ? -2.615  -11.687 2.562   1.00 26.08  ? 244  SER A CA    1 
ATOM   1939 C  C     . SER A 1 244 ? -2.439  -11.009 3.916   1.00 25.22  ? 244  SER A C     1 
ATOM   1940 O  O     . SER A 1 244 ? -2.900  -9.901  4.100   1.00 24.55  ? 244  SER A O     1 
ATOM   1941 C  CB    . SER A 1 244 ? -1.384  -11.455 1.666   1.00 25.56  ? 244  SER A CB    1 
ATOM   1942 O  OG    . SER A 1 244 ? -1.052  -10.070 1.516   1.00 24.80  ? 244  SER A OG    1 
ATOM   1943 N  N     . ILE A 1 245 ? -1.832  -11.713 4.862   1.00 24.36  ? 245  ILE A N     1 
ATOM   1944 C  CA    . ILE A 1 245 ? -1.497  -11.173 6.173   1.00 24.65  ? 245  ILE A CA    1 
ATOM   1945 C  C     . ILE A 1 245 ? -0.114  -11.655 6.487   1.00 24.56  ? 245  ILE A C     1 
ATOM   1946 O  O     . ILE A 1 245 ? 0.171   -12.857 6.387   1.00 23.25  ? 245  ILE A O     1 
ATOM   1947 C  CB    . ILE A 1 245 ? -2.460  -11.656 7.282   1.00 25.13  ? 245  ILE A CB    1 
ATOM   1948 C  CG1   . ILE A 1 245 ? -3.883  -11.147 7.013   1.00 27.49  ? 245  ILE A CG1   1 
ATOM   1949 C  CG2   . ILE A 1 245 ? -1.957  -11.205 8.686   1.00 26.12  ? 245  ILE A CG2   1 
ATOM   1950 C  CD1   . ILE A 1 245 ? -4.161  -9.768  7.625   1.00 33.73  ? 245  ILE A CD1   1 
ATOM   1951 N  N     . GLY A 1 246 ? 0.746   -10.715 6.874   1.00 25.01  ? 246  GLY A N     1 
ATOM   1952 C  CA    . GLY A 1 246 ? 2.155   -11.006 7.029   1.00 26.31  ? 246  GLY A CA    1 
ATOM   1953 C  C     . GLY A 1 246 ? 2.845   -10.048 7.976   1.00 26.80  ? 246  GLY A C     1 
ATOM   1954 O  O     . GLY A 1 246 ? 2.287   -9.031  8.341   1.00 26.93  ? 246  GLY A O     1 
ATOM   1955 N  N     . ARG A 1 247 ? 4.073   -10.376 8.343   1.00 27.36  ? 247  ARG A N     1 
ATOM   1956 C  CA    . ARG A 1 247 ? 4.783   -9.642  9.380   1.00 29.02  ? 247  ARG A CA    1 
ATOM   1957 C  C     . ARG A 1 247 ? 6.259   -9.758  9.032   1.00 29.24  ? 247  ARG A C     1 
ATOM   1958 O  O     . ARG A 1 247 ? 6.719   -10.835 8.583   1.00 28.51  ? 247  ARG A O     1 
ATOM   1959 C  CB    . ARG A 1 247 ? 4.442   -10.266 10.751  1.00 29.73  ? 247  ARG A CB    1 
ATOM   1960 C  CG    . ARG A 1 247 ? 4.579   -9.394  11.996  1.00 34.40  ? 247  ARG A CG    1 
ATOM   1961 C  CD    . ARG A 1 247 ? 3.449   -8.337  12.168  1.00 40.04  ? 247  ARG A CD    1 
ATOM   1962 N  NE    . ARG A 1 247 ? 3.592   -7.570  13.432  1.00 43.95  ? 247  ARG A NE    1 
ATOM   1963 C  CZ    . ARG A 1 247 ? 4.662   -6.842  13.791  1.00 45.19  ? 247  ARG A CZ    1 
ATOM   1964 N  NH1   . ARG A 1 247 ? 5.744   -6.791  13.013  1.00 45.60  ? 247  ARG A NH1   1 
ATOM   1965 N  NH2   . ARG A 1 247 ? 4.670   -6.194  14.958  1.00 44.64  ? 247  ARG A NH2   1 
ATOM   1966 N  N     . ILE A 1 248 ? 6.987   -8.647  9.170   1.00 28.87  ? 248  ILE A N     1 
ATOM   1967 C  CA    . ILE A 1 248 ? 8.431   -8.615  8.900   1.00 29.22  ? 248  ILE A CA    1 
ATOM   1968 C  C     . ILE A 1 248 ? 9.168   -7.830  9.993   1.00 30.12  ? 248  ILE A C     1 
ATOM   1969 O  O     . ILE A 1 248 ? 8.637   -6.864  10.547  1.00 29.62  ? 248  ILE A O     1 
ATOM   1970 C  CB    . ILE A 1 248 ? 8.770   -8.140  7.443   1.00 28.49  ? 248  ILE A CB    1 
ATOM   1971 C  CG1   . ILE A 1 248 ? 10.257  -8.322  7.116   1.00 28.81  ? 248  ILE A CG1   1 
ATOM   1972 C  CG2   . ILE A 1 248 ? 8.310   -6.737  7.185   1.00 28.60  ? 248  ILE A CG2   1 
ATOM   1973 C  CD1   . ILE A 1 248 ? 10.629  -7.937  5.678   1.00 29.75  ? 248  ILE A CD1   1 
ATOM   1974 N  N     . VAL A 1 249 ? 10.375  -8.290  10.320  1.00 31.28  ? 249  VAL A N     1 
ATOM   1975 C  CA    . VAL A 1 249 ? 11.139  -7.732  11.427  1.00 31.83  ? 249  VAL A CA    1 
ATOM   1976 C  C     . VAL A 1 249 ? 12.602  -7.557  11.062  1.00 32.87  ? 249  VAL A C     1 
ATOM   1977 O  O     . VAL A 1 249 ? 13.189  -8.371  10.339  1.00 32.84  ? 249  VAL A O     1 
ATOM   1978 C  CB    . VAL A 1 249 ? 11.008  -8.573  12.746  1.00 32.07  ? 249  VAL A CB    1 
ATOM   1979 C  CG1   . VAL A 1 249 ? 9.557   -8.617  13.241  1.00 32.31  ? 249  VAL A CG1   1 
ATOM   1980 C  CG2   . VAL A 1 249 ? 11.577  -9.990  12.590  1.00 31.40  ? 249  VAL A CG2   1 
ATOM   1981 N  N     . THR A 1 250 ? 13.187  -6.479  11.567  1.00 33.70  ? 250  THR A N     1 
ATOM   1982 C  CA    . THR A 1 250 ? 14.622  -6.286  11.473  1.00 34.47  ? 250  THR A CA    1 
ATOM   1983 C  C     . THR A 1 250 ? 15.282  -6.951  12.676  1.00 35.09  ? 250  THR A C     1 
ATOM   1984 O  O     . THR A 1 250 ? 14.884  -6.733  13.828  1.00 35.53  ? 250  THR A O     1 
ATOM   1985 C  CB    . THR A 1 250 ? 14.978  -4.786  11.349  1.00 34.58  ? 250  THR A CB    1 
ATOM   1986 O  OG1   . THR A 1 250 ? 14.326  -4.256  10.182  1.00 34.86  ? 250  THR A OG1   1 
ATOM   1987 C  CG2   . THR A 1 250 ? 16.478  -4.591  11.204  1.00 34.48  ? 250  THR A CG2   1 
ATOM   1988 N  N     . MET A 1 251 ? 16.264  -7.795  12.398  1.00 35.58  ? 251  MET A N     1 
ATOM   1989 C  CA    . MET A 1 251 ? 16.985  -8.490  13.455  1.00 37.04  ? 251  MET A CA    1 
ATOM   1990 C  C     . MET A 1 251 ? 18.057  -7.581  14.061  1.00 38.00  ? 251  MET A C     1 
ATOM   1991 O  O     . MET A 1 251 ? 18.532  -6.654  13.405  1.00 37.96  ? 251  MET A O     1 
ATOM   1992 C  CB    . MET A 1 251 ? 17.621  -9.763  12.915  1.00 36.72  ? 251  MET A CB    1 
ATOM   1993 C  CG    . MET A 1 251 ? 16.631  -10.722 12.284  1.00 36.87  ? 251  MET A CG    1 
ATOM   1994 S  SD    . MET A 1 251 ? 17.449  -12.250 11.857  1.00 39.12  ? 251  MET A SD    1 
ATOM   1995 C  CE    . MET A 1 251 ? 18.080  -11.884 10.225  1.00 37.50  ? 251  MET A CE    1 
ATOM   1996 N  N     . LYS A 1 252 ? 18.418  -7.841  15.312  1.00 39.40  ? 252  LYS A N     1 
ATOM   1997 C  CA    . LYS A 1 252 ? 19.457  -7.054  15.993  1.00 41.25  ? 252  LYS A CA    1 
ATOM   1998 C  C     . LYS A 1 252 ? 20.809  -7.114  15.275  1.00 41.97  ? 252  LYS A C     1 
ATOM   1999 O  O     . LYS A 1 252 ? 21.434  -6.082  15.028  1.00 42.36  ? 252  LYS A O     1 
ATOM   2000 C  CB    . LYS A 1 252 ? 19.609  -7.482  17.450  1.00 41.13  ? 252  LYS A CB    1 
ATOM   2001 C  CG    . LYS A 1 252 ? 18.866  -6.606  18.442  1.00 43.34  ? 252  LYS A CG    1 
ATOM   2002 C  CD    . LYS A 1 252 ? 17.417  -7.052  18.627  1.00 46.48  ? 252  LYS A CD    1 
ATOM   2003 C  CE    . LYS A 1 252 ? 16.841  -6.540  19.952  1.00 48.88  ? 252  LYS A CE    1 
ATOM   2004 N  NZ    . LYS A 1 252 ? 16.845  -5.044  20.055  1.00 50.21  ? 252  LYS A NZ    1 
ATOM   2005 N  N     . ARG A 1 253 ? 21.248  -8.316  14.929  1.00 42.75  ? 253  ARG A N     1 
ATOM   2006 C  CA    . ARG A 1 253 ? 22.461  -8.476  14.145  1.00 43.82  ? 253  ARG A CA    1 
ATOM   2007 C  C     . ARG A 1 253 ? 22.182  -9.300  12.897  1.00 44.00  ? 253  ARG A C     1 
ATOM   2008 O  O     . ARG A 1 253 ? 21.434  -10.271 12.947  1.00 44.23  ? 253  ARG A O     1 
ATOM   2009 C  CB    . ARG A 1 253 ? 23.583  -9.101  14.991  1.00 43.86  ? 253  ARG A CB    1 
ATOM   2010 C  CG    . ARG A 1 253 ? 23.226  -10.423 15.658  1.00 45.11  ? 253  ARG A CG    1 
ATOM   2011 C  CD    . ARG A 1 253 ? 24.133  -10.712 16.851  1.00 47.75  ? 253  ARG A CD    1 
ATOM   2012 N  NE    . ARG A 1 253 ? 25.516  -10.983 16.453  1.00 50.17  ? 253  ARG A NE    1 
ATOM   2013 C  CZ    . ARG A 1 253 ? 26.098  -12.182 16.483  1.00 51.26  ? 253  ARG A CZ    1 
ATOM   2014 N  NH1   . ARG A 1 253 ? 25.428  -13.253 16.900  1.00 51.79  ? 253  ARG A NH1   1 
ATOM   2015 N  NH2   . ARG A 1 253 ? 27.363  -12.309 16.100  1.00 51.50  ? 253  ARG A NH2   1 
ATOM   2016 N  N     . ASN A 1 254 ? 22.776  -8.896  11.779  1.00 44.30  ? 254  ASN A N     1 
ATOM   2017 C  CA    . ASN A 1 254 ? 22.714  -9.680  10.550  1.00 44.56  ? 254  ASN A CA    1 
ATOM   2018 C  C     . ASN A 1 254 ? 23.289  -11.073 10.759  1.00 44.46  ? 254  ASN A C     1 
ATOM   2019 O  O     . ASN A 1 254 ? 24.285  -11.238 11.466  1.00 44.38  ? 254  ASN A O     1 
ATOM   2020 C  CB    . ASN A 1 254 ? 23.434  -8.961  9.414   1.00 44.73  ? 254  ASN A CB    1 
ATOM   2021 C  CG    . ASN A 1 254 ? 22.815  -7.620  9.096   1.00 45.49  ? 254  ASN A CG    1 
ATOM   2022 O  OD1   . ASN A 1 254 ? 21.803  -7.238  9.683   1.00 47.33  ? 254  ASN A OD1   1 
ATOM   2023 N  ND2   . ASN A 1 254 ? 23.416  -6.896  8.162   1.00 46.05  ? 254  ASN A ND2   1 
ATOM   2024 N  N     . SER A 1 255 ? 22.652  -12.074 10.156  1.00 44.31  ? 255  SER A N     1 
ATOM   2025 C  CA    . SER A 1 255 ? 22.970  -13.465 10.468  1.00 44.23  ? 255  SER A CA    1 
ATOM   2026 C  C     . SER A 1 255 ? 22.757  -14.437 9.315   1.00 44.28  ? 255  SER A C     1 
ATOM   2027 O  O     . SER A 1 255 ? 22.034  -14.150 8.357   1.00 44.61  ? 255  SER A O     1 
ATOM   2028 C  CB    . SER A 1 255 ? 22.152  -13.930 11.675  1.00 44.18  ? 255  SER A CB    1 
ATOM   2029 O  OG    . SER A 1 255 ? 22.529  -15.239 12.070  1.00 43.90  ? 255  SER A OG    1 
ATOM   2030 N  N     . ARG A 1 256 ? 23.401  -15.592 9.432   1.00 43.99  ? 256  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 256 ? 23.185  -16.712 8.535   1.00 43.92  ? 256  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 256 ? 22.895  -17.951 9.372   1.00 43.57  ? 256  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 256 ? 22.703  -19.051 8.843   1.00 43.25  ? 256  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 256 ? 24.415  -16.936 7.657   1.00 44.35  ? 256  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 256 ? 24.551  -15.931 6.534   1.00 45.20  ? 256  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 256 ? 25.534  -16.388 5.467   1.00 46.25  ? 256  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 256 ? 25.252  -17.741 4.979   1.00 47.32  ? 256  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 256 ? 24.295  -18.054 4.107   1.00 47.21  ? 256  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 256 ? 23.495  -17.116 3.613   1.00 46.94  ? 256  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 256 ? 24.131  -19.317 3.737   1.00 46.47  ? 256  ARG A NH2   1 
ATOM   2041 N  N     . ASN A 1 257 ? 22.863  -17.747 10.687  1.00 43.11  ? 257  ASN A N     1 
ATOM   2042 C  CA    . ASN A 1 257 ? 22.634  -18.808 11.654  1.00 42.79  ? 257  ASN A CA    1 
ATOM   2043 C  C     . ASN A 1 257 ? 21.141  -19.063 11.829  1.00 42.13  ? 257  ASN A C     1 
ATOM   2044 O  O     . ASN A 1 257 ? 20.423  -18.218 12.355  1.00 41.96  ? 257  ASN A O     1 
ATOM   2045 C  CB    . ASN A 1 257 ? 23.286  -18.434 12.994  1.00 42.91  ? 257  ASN A CB    1 
ATOM   2046 C  CG    . ASN A 1 257 ? 22.974  -19.427 14.113  1.00 44.01  ? 257  ASN A CG    1 
ATOM   2047 O  OD1   . ASN A 1 257 ? 22.981  -19.065 15.291  1.00 45.65  ? 257  ASN A OD1   1 
ATOM   2048 N  ND2   . ASN A 1 257 ? 22.707  -20.676 13.754  1.00 44.00  ? 257  ASN A ND2   1 
ATOM   2049 N  N     . LEU A 1 258 ? 20.699  -20.244 11.402  1.00 41.78  ? 258  LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 258 ? 19.291  -20.653 11.465  1.00 41.21  ? 258  LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 258 ? 18.710  -20.521 12.870  1.00 40.70  ? 258  LEU A C     1 
ATOM   2052 O  O     . LEU A 1 258 ? 17.618  -19.991 13.043  1.00 40.76  ? 258  LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 258 ? 19.134  -22.095 10.956  1.00 41.28  ? 258  LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 258 ? 17.746  -22.668 10.659  1.00 41.75  ? 258  LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 258 ? 17.161  -22.055 9.396   1.00 41.79  ? 258  LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 258 ? 17.814  -24.179 10.518  1.00 40.67  ? 258  LEU A CD2   1 
ATOM   2057 N  N     . GLU A 1 259 ? 19.458  -20.973 13.872  1.00 39.88  ? 259  GLU A N     1 
ATOM   2058 C  CA    . GLU A 1 259 ? 18.971  -20.968 15.251  1.00 39.48  ? 259  GLU A CA    1 
ATOM   2059 C  C     . GLU A 1 259 ? 18.843  -19.563 15.820  1.00 38.66  ? 259  GLU A C     1 
ATOM   2060 O  O     . GLU A 1 259 ? 18.106  -19.337 16.785  1.00 38.81  ? 259  GLU A O     1 
ATOM   2061 C  CB    . GLU A 1 259 ? 19.848  -21.857 16.143  1.00 39.75  ? 259  GLU A CB    1 
ATOM   2062 C  CG    . GLU A 1 259 ? 19.811  -23.337 15.762  1.00 41.58  ? 259  GLU A CG    1 
ATOM   2063 C  CD    . GLU A 1 259 ? 18.401  -23.921 15.798  1.00 43.74  ? 259  GLU A CD    1 
ATOM   2064 O  OE1   . GLU A 1 259 ? 17.690  -23.719 16.810  1.00 44.90  ? 259  GLU A OE1   1 
ATOM   2065 O  OE2   . GLU A 1 259 ? 18.003  -24.583 14.814  1.00 44.67  ? 259  GLU A OE2   1 
ATOM   2066 N  N     . GLU A 1 260 ? 19.545  -18.620 15.196  1.00 37.45  ? 260  GLU A N     1 
ATOM   2067 C  CA    . GLU A 1 260 ? 19.502  -17.218 15.584  1.00 36.61  ? 260  GLU A CA    1 
ATOM   2068 C  C     . GLU A 1 260 ? 18.329  -16.482 14.923  1.00 35.28  ? 260  GLU A C     1 
ATOM   2069 O  O     . GLU A 1 260 ? 17.709  -15.612 15.525  1.00 34.47  ? 260  GLU A O     1 
ATOM   2070 C  CB    . GLU A 1 260 ? 20.820  -16.551 15.201  1.00 36.90  ? 260  GLU A CB    1 
ATOM   2071 C  CG    . GLU A 1 260 ? 20.995  -15.141 15.707  1.00 38.56  ? 260  GLU A CG    1 
ATOM   2072 C  CD    . GLU A 1 260 ? 22.435  -14.699 15.609  1.00 41.99  ? 260  GLU A CD    1 
ATOM   2073 O  OE1   . GLU A 1 260 ? 22.893  -14.437 14.479  1.00 42.76  ? 260  GLU A OE1   1 
ATOM   2074 O  OE2   . GLU A 1 260 ? 23.111  -14.622 16.660  1.00 42.48  ? 260  GLU A OE2   1 
ATOM   2075 N  N     . ILE A 1 261 ? 18.053  -16.841 13.676  1.00 34.30  ? 261  ILE A N     1 
ATOM   2076 C  CA    . ILE A 1 261 ? 16.971  -16.236 12.897  1.00 33.11  ? 261  ILE A CA    1 
ATOM   2077 C  C     . ILE A 1 261 ? 15.594  -16.777 13.319  1.00 32.72  ? 261  ILE A C     1 
ATOM   2078 O  O     . ILE A 1 261 ? 14.603  -16.028 13.341  1.00 31.97  ? 261  ILE A O     1 
ATOM   2079 C  CB    . ILE A 1 261 ? 17.208  -16.458 11.384  1.00 32.85  ? 261  ILE A CB    1 
ATOM   2080 C  CG1   . ILE A 1 261 ? 18.583  -15.901 10.981  1.00 32.88  ? 261  ILE A CG1   1 
ATOM   2081 C  CG2   . ILE A 1 261 ? 16.087  -15.823 10.550  1.00 32.45  ? 261  ILE A CG2   1 
ATOM   2082 C  CD1   . ILE A 1 261 ? 19.089  -16.353 9.622   1.00 32.00  ? 261  ILE A CD1   1 
ATOM   2083 N  N     . LYS A 1 262 ? 15.552  -18.065 13.662  1.00 31.79  ? 262  LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 262 ? 14.304  -18.772 13.970  1.00 31.82  ? 262  LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 262 ? 13.349  -18.073 14.950  1.00 31.41  ? 262  LYS A C     1 
ATOM   2086 O  O     . LYS A 1 262 ? 12.170  -17.926 14.633  1.00 31.31  ? 262  LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 262 ? 14.560  -20.235 14.393  1.00 31.53  ? 262  LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 262 ? 14.606  -21.203 13.211  1.00 32.22  ? 262  LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 262 ? 15.335  -22.516 13.523  1.00 31.81  ? 262  LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 262 ? 14.541  -23.417 14.434  1.00 31.55  ? 262  LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 262 ? 15.010  -24.836 14.340  1.00 31.18  ? 262  LYS A NZ    1 
ATOM   2092 N  N     . PRO A 1 263 ? 13.841  -17.626 16.123  1.00 31.16  ? 263  PRO A N     1 
ATOM   2093 C  CA    . PRO A 1 263 ? 12.912  -16.940 17.041  1.00 30.92  ? 263  PRO A CA    1 
ATOM   2094 C  C     . PRO A 1 263 ? 12.207  -15.699 16.447  1.00 30.77  ? 263  PRO A C     1 
ATOM   2095 O  O     . PRO A 1 263 ? 11.034  -15.447 16.774  1.00 31.22  ? 263  PRO A O     1 
ATOM   2096 C  CB    . PRO A 1 263 ? 13.822  -16.533 18.217  1.00 31.25  ? 263  PRO A CB    1 
ATOM   2097 C  CG    . PRO A 1 263 ? 14.925  -17.537 18.185  1.00 30.75  ? 263  PRO A CG    1 
ATOM   2098 C  CD    . PRO A 1 263 ? 15.187  -17.735 16.717  1.00 31.50  ? 263  PRO A CD    1 
ATOM   2099 N  N     . TYR A 1 264 ? 12.907  -14.939 15.599  1.00 29.76  ? 264  TYR A N     1 
ATOM   2100 C  CA    . TYR A 1 264 ? 12.317  -13.787 14.908  1.00 29.54  ? 264  TYR A CA    1 
ATOM   2101 C  C     . TYR A 1 264 ? 11.191  -14.269 13.975  1.00 29.07  ? 264  TYR A C     1 
ATOM   2102 O  O     . TYR A 1 264 ? 10.090  -13.705 13.948  1.00 28.52  ? 264  TYR A O     1 
ATOM   2103 C  CB    . TYR A 1 264 ? 13.373  -13.035 14.087  1.00 29.37  ? 264  TYR A CB    1 
ATOM   2104 C  CG    . TYR A 1 264 ? 14.424  -12.262 14.878  1.00 31.71  ? 264  TYR A CG    1 
ATOM   2105 C  CD1   . TYR A 1 264 ? 14.147  -10.997 15.402  1.00 32.20  ? 264  TYR A CD1   1 
ATOM   2106 C  CD2   . TYR A 1 264 ? 15.710  -12.786 15.067  1.00 32.70  ? 264  TYR A CD2   1 
ATOM   2107 C  CE1   . TYR A 1 264 ? 15.122  -10.275 16.115  1.00 33.38  ? 264  TYR A CE1   1 
ATOM   2108 C  CE2   . TYR A 1 264 ? 16.693  -12.068 15.771  1.00 32.87  ? 264  TYR A CE2   1 
ATOM   2109 C  CZ    . TYR A 1 264 ? 16.392  -10.821 16.292  1.00 33.47  ? 264  TYR A CZ    1 
ATOM   2110 O  OH    . TYR A 1 264 ? 17.367  -10.120 16.990  1.00 35.46  ? 264  TYR A OH    1 
ATOM   2111 N  N     . LEU A 1 265 ? 11.487  -15.316 13.208  1.00 28.73  ? 265  LEU A N     1 
ATOM   2112 C  CA    . LEU A 1 265 ? 10.510  -15.941 12.315  1.00 28.21  ? 265  LEU A CA    1 
ATOM   2113 C  C     . LEU A 1 265 ? 9.272   -16.401 13.078  1.00 28.09  ? 265  LEU A C     1 
ATOM   2114 O  O     . LEU A 1 265 ? 8.154   -16.037 12.720  1.00 28.18  ? 265  LEU A O     1 
ATOM   2115 C  CB    . LEU A 1 265 ? 11.155  -17.106 11.568  1.00 28.70  ? 265  LEU A CB    1 
ATOM   2116 C  CG    . LEU A 1 265 ? 10.447  -17.831 10.420  1.00 27.39  ? 265  LEU A CG    1 
ATOM   2117 C  CD1   . LEU A 1 265 ? 9.990   -16.854 9.354   1.00 27.83  ? 265  LEU A CD1   1 
ATOM   2118 C  CD2   . LEU A 1 265 ? 11.429  -18.807 9.832   1.00 27.32  ? 265  LEU A CD2   1 
ATOM   2119 N  N     . PHE A 1 266 ? 9.478   -17.169 14.143  1.00 28.14  ? 266  PHE A N     1 
ATOM   2120 C  CA    . PHE A 1 266 ? 8.366   -17.758 14.898  1.00 28.55  ? 266  PHE A CA    1 
ATOM   2121 C  C     . PHE A 1 266 ? 7.469   -16.661 15.467  1.00 28.13  ? 266  PHE A C     1 
ATOM   2122 O  O     . PHE A 1 266 ? 6.251   -16.804 15.501  1.00 27.98  ? 266  PHE A O     1 
ATOM   2123 C  CB    . PHE A 1 266 ? 8.853   -18.684 16.018  1.00 28.29  ? 266  PHE A CB    1 
ATOM   2124 C  CG    . PHE A 1 266 ? 9.561   -19.931 15.535  1.00 29.27  ? 266  PHE A CG    1 
ATOM   2125 C  CD1   . PHE A 1 266 ? 9.464   -20.353 14.210  1.00 29.86  ? 266  PHE A CD1   1 
ATOM   2126 C  CD2   . PHE A 1 266 ? 10.306  -20.701 16.429  1.00 29.82  ? 266  PHE A CD2   1 
ATOM   2127 C  CE1   . PHE A 1 266 ? 10.109  -21.511 13.780  1.00 30.70  ? 266  PHE A CE1   1 
ATOM   2128 C  CE2   . PHE A 1 266 ? 10.955  -21.859 16.010  1.00 30.09  ? 266  PHE A CE2   1 
ATOM   2129 C  CZ    . PHE A 1 266 ? 10.860  -22.264 14.683  1.00 29.13  ? 266  PHE A CZ    1 
ATOM   2130 N  N     . ARG A 1 267 ? 8.096   -15.579 15.916  1.00 27.75  ? 267  ARG A N     1 
ATOM   2131 C  CA    . ARG A 1 267 ? 7.399   -14.374 16.393  1.00 27.84  ? 267  ARG A CA    1 
ATOM   2132 C  C     . ARG A 1 267 ? 6.484   -13.778 15.305  1.00 25.74  ? 267  ARG A C     1 
ATOM   2133 O  O     . ARG A 1 267 ? 5.328   -13.466 15.561  1.00 25.30  ? 267  ARG A O     1 
ATOM   2134 C  CB    . ARG A 1 267 ? 8.453   -13.345 16.840  1.00 28.44  ? 267  ARG A CB    1 
ATOM   2135 C  CG    . ARG A 1 267 ? 7.984   -12.190 17.698  1.00 32.68  ? 267  ARG A CG    1 
ATOM   2136 C  CD    . ARG A 1 267 ? 9.205   -11.503 18.409  1.00 36.03  ? 267  ARG A CD    1 
ATOM   2137 N  NE    . ARG A 1 267 ? 10.067  -12.474 19.106  1.00 36.69  ? 267  ARG A NE    1 
ATOM   2138 C  CZ    . ARG A 1 267 ? 11.401  -12.556 19.004  1.00 36.84  ? 267  ARG A CZ    1 
ATOM   2139 N  NH1   . ARG A 1 267 ? 12.093  -11.719 18.242  1.00 37.44  ? 267  ARG A NH1   1 
ATOM   2140 N  NH2   . ARG A 1 267 ? 12.056  -13.492 19.678  1.00 35.38  ? 267  ARG A NH2   1 
ATOM   2141 N  N     . ALA A 1 268 ? 7.003   -13.626 14.091  1.00 24.38  ? 268  ALA A N     1 
ATOM   2142 C  CA    . ALA A 1 268 ? 6.190   -13.135 12.976  1.00 23.23  ? 268  ALA A CA    1 
ATOM   2143 C  C     . ALA A 1 268 ? 5.031   -14.099 12.681  1.00 22.49  ? 268  ALA A C     1 
ATOM   2144 O  O     . ALA A 1 268 ? 3.919   -13.666 12.369  1.00 21.92  ? 268  ALA A O     1 
ATOM   2145 C  CB    . ALA A 1 268 ? 7.049   -12.917 11.739  1.00 23.42  ? 268  ALA A CB    1 
ATOM   2146 N  N     . ILE A 1 269 ? 5.278   -15.400 12.810  1.00 21.43  ? 269  ILE A N     1 
ATOM   2147 C  CA    . ILE A 1 269 ? 4.212   -16.375 12.566  1.00 20.72  ? 269  ILE A CA    1 
ATOM   2148 C  C     . ILE A 1 269 ? 3.100   -16.217 13.589  1.00 20.71  ? 269  ILE A C     1 
ATOM   2149 O  O     . ILE A 1 269 ? 1.926   -16.125 13.208  1.00 19.63  ? 269  ILE A O     1 
ATOM   2150 C  CB    . ILE A 1 269 ? 4.724   -17.817 12.587  1.00 21.03  ? 269  ILE A CB    1 
ATOM   2151 C  CG1   . ILE A 1 269 ? 5.561   -18.076 11.328  1.00 20.46  ? 269  ILE A CG1   1 
ATOM   2152 C  CG2   . ILE A 1 269 ? 3.524   -18.792 12.666  1.00 19.51  ? 269  ILE A CG2   1 
ATOM   2153 C  CD1   . ILE A 1 269 ? 6.437   -19.296 11.406  1.00 24.75  ? 269  ILE A CD1   1 
ATOM   2154 N  N     . GLU A 1 270 ? 3.477   -16.157 14.878  1.00 21.06  ? 270  GLU A N     1 
ATOM   2155 C  CA    . GLU A 1 270 ? 2.494   -15.980 15.961  1.00 22.24  ? 270  GLU A CA    1 
ATOM   2156 C  C     . GLU A 1 270 ? 1.691   -14.702 15.771  1.00 22.38  ? 270  GLU A C     1 
ATOM   2157 O  O     . GLU A 1 270 ? 0.475   -14.722 15.915  1.00 23.70  ? 270  GLU A O     1 
ATOM   2158 C  CB    . GLU A 1 270 ? 3.135   -16.006 17.383  1.00 22.01  ? 270  GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1 270 ? 3.606   -17.388 17.890  1.00 25.06  ? 270  GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1 270 ? 2.492   -18.438 18.035  1.00 26.68  ? 270  GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1 270 ? 1.303   -18.074 18.235  1.00 25.36  ? 270  GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1 270 ? 2.824   -19.653 17.971  1.00 28.41  ? 270  GLU A OE2   1 
ATOM   2163 N  N     . GLU A 1 271 ? 2.367   -13.596 15.454  1.00 23.70  ? 271  GLU A N     1 
ATOM   2164 C  CA    . GLU A 1 271 ? 1.688   -12.323 15.186  1.00 23.95  ? 271  GLU A CA    1 
ATOM   2165 C  C     . GLU A 1 271 ? 0.709   -12.410 13.984  1.00 24.36  ? 271  GLU A C     1 
ATOM   2166 O  O     . GLU A 1 271 ? -0.438  -11.920 14.054  1.00 24.18  ? 271  GLU A O     1 
ATOM   2167 C  CB    . GLU A 1 271 ? 2.719   -11.176 15.030  1.00 25.12  ? 271  GLU A CB    1 
ATOM   2168 C  CG    . GLU A 1 271 ? 3.550   -10.957 16.309  1.00 28.69  ? 271  GLU A CG    1 
ATOM   2169 C  CD    . GLU A 1 271 ? 4.551   -9.799  16.253  1.00 35.27  ? 271  GLU A CD    1 
ATOM   2170 O  OE1   . GLU A 1 271 ? 4.612   -9.063  15.234  1.00 35.64  ? 271  GLU A OE1   1 
ATOM   2171 O  OE2   . GLU A 1 271 ? 5.277   -9.629  17.267  1.00 39.69  ? 271  GLU A OE2   1 
ATOM   2172 N  N     . SER A 1 272 ? 1.140   -13.050 12.893  1.00 24.04  ? 272  SER A N     1 
ATOM   2173 C  CA    . SER A 1 272 ? 0.259   -13.244 11.722  1.00 24.09  ? 272  SER A CA    1 
ATOM   2174 C  C     . SER A 1 272 ? -1.006  -14.071 12.016  1.00 23.80  ? 272  SER A C     1 
ATOM   2175 O  O     . SER A 1 272 ? -2.104  -13.704 11.581  1.00 23.15  ? 272  SER A O     1 
ATOM   2176 C  CB    . SER A 1 272 ? 1.027   -13.900 10.575  1.00 23.64  ? 272  SER A CB    1 
ATOM   2177 O  OG    . SER A 1 272 ? 2.078   -13.074 10.148  1.00 24.64  ? 272  SER A OG    1 
ATOM   2178 N  N     . TYR A 1 273 ? -0.844  -15.179 12.733  1.00 23.92  ? 273  TYR A N     1 
ATOM   2179 C  CA    . TYR A 1 273 ? -1.973  -16.083 12.991  1.00 25.39  ? 273  TYR A CA    1 
ATOM   2180 C  C     . TYR A 1 273 ? -2.982  -15.443 13.904  1.00 26.46  ? 273  TYR A C     1 
ATOM   2181 O  O     . TYR A 1 273 ? -4.188  -15.644 13.742  1.00 26.00  ? 273  TYR A O     1 
ATOM   2182 C  CB    . TYR A 1 273 ? -1.526  -17.445 13.528  1.00 24.99  ? 273  TYR A CB    1 
ATOM   2183 C  CG    . TYR A 1 273 ? -1.360  -18.425 12.400  1.00 25.79  ? 273  TYR A CG    1 
ATOM   2184 C  CD1   . TYR A 1 273 ? -2.347  -19.369 12.115  1.00 25.29  ? 273  TYR A CD1   1 
ATOM   2185 C  CD2   . TYR A 1 273 ? -0.238  -18.364 11.574  1.00 25.95  ? 273  TYR A CD2   1 
ATOM   2186 C  CE1   . TYR A 1 273 ? -2.206  -20.243 11.043  1.00 25.70  ? 273  TYR A CE1   1 
ATOM   2187 C  CE2   . TYR A 1 273 ? -0.086  -19.223 10.515  1.00 26.97  ? 273  TYR A CE2   1 
ATOM   2188 C  CZ    . TYR A 1 273 ? -1.065  -20.167 10.250  1.00 27.59  ? 273  TYR A CZ    1 
ATOM   2189 O  OH    . TYR A 1 273 ? -0.873  -21.021 9.178   1.00 27.55  ? 273  TYR A OH    1 
ATOM   2190 N  N     . TYR A 1 274 ? -2.471  -14.641 14.839  1.00 27.50  ? 274  TYR A N     1 
ATOM   2191 C  CA    . TYR A 1 274 ? -3.316  -13.843 15.705  1.00 28.81  ? 274  TYR A CA    1 
ATOM   2192 C  C     . TYR A 1 274 ? -4.227  -12.900 14.909  1.00 29.03  ? 274  TYR A C     1 
ATOM   2193 O  O     . TYR A 1 274 ? -5.428  -12.860 15.166  1.00 28.72  ? 274  TYR A O     1 
ATOM   2194 C  CB    . TYR A 1 274 ? -2.459  -13.087 16.722  1.00 29.68  ? 274  TYR A CB    1 
ATOM   2195 C  CG    . TYR A 1 274 ? -3.249  -12.488 17.865  1.00 32.35  ? 274  TYR A CG    1 
ATOM   2196 C  CD1   . TYR A 1 274 ? -3.734  -13.287 18.908  1.00 33.96  ? 274  TYR A CD1   1 
ATOM   2197 C  CD2   . TYR A 1 274 ? -3.513  -11.123 17.897  1.00 34.41  ? 274  TYR A CD2   1 
ATOM   2198 C  CE1   . TYR A 1 274 ? -4.458  -12.733 19.954  1.00 36.36  ? 274  TYR A CE1   1 
ATOM   2199 C  CE2   . TYR A 1 274 ? -4.228  -10.557 18.944  1.00 36.67  ? 274  TYR A CE2   1 
ATOM   2200 C  CZ    . TYR A 1 274 ? -4.697  -11.365 19.963  1.00 36.62  ? 274  TYR A CZ    1 
ATOM   2201 O  OH    . TYR A 1 274 ? -5.411  -10.793 20.989  1.00 40.50  ? 274  TYR A OH    1 
ATOM   2202 N  N     . LYS A 1 275 ? -3.665  -12.179 13.931  1.00 29.52  ? 275  LYS A N     1 
ATOM   2203 C  CA    . LYS A 1 275 ? -4.441  -11.311 13.034  1.00 30.52  ? 275  LYS A CA    1 
ATOM   2204 C  C     . LYS A 1 275 ? -5.364  -12.116 12.107  1.00 30.38  ? 275  LYS A C     1 
ATOM   2205 O  O     . LYS A 1 275 ? -6.406  -11.625 11.688  1.00 29.79  ? 275  LYS A O     1 
ATOM   2206 C  CB    . LYS A 1 275 ? -3.533  -10.397 12.156  1.00 30.89  ? 275  LYS A CB    1 
ATOM   2207 C  CG    . LYS A 1 275 ? -2.818  -9.219  12.874  1.00 35.32  ? 275  LYS A CG    1 
ATOM   2208 C  CD    . LYS A 1 275 ? -2.176  -8.229  11.841  1.00 39.75  ? 275  LYS A CD    1 
ATOM   2209 C  CE    . LYS A 1 275 ? -0.909  -7.487  12.350  1.00 41.38  ? 275  LYS A CE    1 
ATOM   2210 N  NZ    . LYS A 1 275 ? 0.348   -7.737  11.534  1.00 41.33  ? 275  LYS A NZ    1 
ATOM   2211 N  N     . LEU A 1 276 ? -4.964  -13.336 11.755  1.00 30.74  ? 276  LEU A N     1 
ATOM   2212 C  CA    . LEU A 1 276 ? -5.739  -14.141 10.804  1.00 31.43  ? 276  LEU A CA    1 
ATOM   2213 C  C     . LEU A 1 276 ? -7.138  -14.457 11.359  1.00 32.51  ? 276  LEU A C     1 
ATOM   2214 O  O     . LEU A 1 276 ? -8.133  -14.397 10.632  1.00 32.52  ? 276  LEU A O     1 
ATOM   2215 C  CB    . LEU A 1 276 ? -4.989  -15.432 10.413  1.00 30.31  ? 276  LEU A CB    1 
ATOM   2216 C  CG    . LEU A 1 276 ? -3.998  -15.340 9.235   1.00 30.64  ? 276  LEU A CG    1 
ATOM   2217 C  CD1   . LEU A 1 276 ? -2.920  -16.413 9.326   1.00 29.64  ? 276  LEU A CD1   1 
ATOM   2218 C  CD2   . LEU A 1 276 ? -4.692  -15.407 7.861   1.00 27.56  ? 276  LEU A CD2   1 
ATOM   2219 N  N     . ASP A 1 277 ? -7.208  -14.774 12.648  1.00 33.86  ? 277  ASP A N     1 
ATOM   2220 C  CA    . ASP A 1 277 ? -8.504  -14.988 13.333  1.00 35.45  ? 277  ASP A CA    1 
ATOM   2221 C  C     . ASP A 1 277 ? -9.615  -15.681 12.504  1.00 35.38  ? 277  ASP A C     1 
ATOM   2222 O  O     . ASP A 1 277 ? -10.466 -15.020 11.870  1.00 36.93  ? 277  ASP A O     1 
ATOM   2223 C  CB    . ASP A 1 277 ? -9.043  -13.660 13.873  1.00 35.76  ? 277  ASP A CB    1 
ATOM   2224 C  CG    . ASP A 1 277 ? -10.223 -13.858 14.820  1.00 37.58  ? 277  ASP A CG    1 
ATOM   2225 O  OD1   . ASP A 1 277 ? -11.164 -13.038 14.790  1.00 40.19  ? 277  ASP A OD1   1 
ATOM   2226 O  OD2   . ASP A 1 277 ? -10.209 -14.852 15.578  1.00 38.61  ? 277  ASP A OD2   1 
ATOM   2227 N  N     . LYS A 1 278 ? -9.609  -17.003 12.522  1.00 34.81  ? 278  LYS A N     1 
ATOM   2228 C  CA    . LYS A 1 278 ? -10.629 -17.830 11.831  1.00 34.36  ? 278  LYS A CA    1 
ATOM   2229 C  C     . LYS A 1 278 ? -10.381 -18.000 10.328  1.00 32.96  ? 278  LYS A C     1 
ATOM   2230 O  O     . LYS A 1 278 ? -10.837 -18.960 9.728   1.00 32.51  ? 278  LYS A O     1 
ATOM   2231 C  CB    . LYS A 1 278 ? -12.083 -17.350 12.078  1.00 35.07  ? 278  LYS A CB    1 
ATOM   2232 C  CG    . LYS A 1 278 ? -12.458 -17.039 13.533  1.00 36.39  ? 278  LYS A CG    1 
ATOM   2233 C  CD    . LYS A 1 278 ? -12.134 -18.183 14.489  1.00 39.94  ? 278  LYS A CD    1 
ATOM   2234 C  CE    . LYS A 1 278 ? -12.126 -17.685 15.939  1.00 41.31  ? 278  LYS A CE    1 
ATOM   2235 N  NZ    . LYS A 1 278 ? -12.080 -18.827 16.882  1.00 43.38  ? 278  LYS A NZ    1 
ATOM   2236 N  N     . ARG A 1 279 ? -9.669  -17.062 9.719   1.00 31.69  ? 279  ARG A N     1 
ATOM   2237 C  CA    . ARG A 1 279 ? -9.295  -17.226 8.323   1.00 29.86  ? 279  ARG A CA    1 
ATOM   2238 C  C     . ARG A 1 279 ? -8.139  -18.198 8.265   1.00 28.19  ? 279  ARG A C     1 
ATOM   2239 O  O     . ARG A 1 279 ? -7.223  -18.130 9.094   1.00 27.33  ? 279  ARG A O     1 
ATOM   2240 C  CB    . ARG A 1 279 ? -8.896  -15.898 7.714   1.00 30.88  ? 279  ARG A CB    1 
ATOM   2241 C  CG    . ARG A 1 279 ? -10.065 -14.967 7.478   1.00 32.65  ? 279  ARG A CG    1 
ATOM   2242 C  CD    . ARG A 1 279 ? -9.542  -13.609 7.115   1.00 35.59  ? 279  ARG A CD    1 
ATOM   2243 N  NE    . ARG A 1 279 ? -8.824  -13.011 8.239   1.00 37.21  ? 279  ARG A NE    1 
ATOM   2244 C  CZ    . ARG A 1 279 ? -8.390  -11.760 8.256   1.00 38.35  ? 279  ARG A CZ    1 
ATOM   2245 N  NH1   . ARG A 1 279 ? -8.616  -10.975 7.213   1.00 40.40  ? 279  ARG A NH1   1 
ATOM   2246 N  NH2   . ARG A 1 279 ? -7.732  -11.292 9.309   1.00 38.66  ? 279  ARG A NH2   1 
ATOM   2247 N  N     . ILE A 1 280 ? -8.193  -19.103 7.288   1.00 26.14  ? 280  ILE A N     1 
ATOM   2248 C  CA    . ILE A 1 280 ? -7.228  -20.193 7.171   1.00 24.75  ? 280  ILE A CA    1 
ATOM   2249 C  C     . ILE A 1 280 ? -6.471  -20.109 5.834   1.00 23.04  ? 280  ILE A C     1 
ATOM   2250 O  O     . ILE A 1 280 ? -7.083  -20.170 4.778   1.00 22.21  ? 280  ILE A O     1 
ATOM   2251 C  CB    . ILE A 1 280 ? -7.938  -21.569 7.222   1.00 25.02  ? 280  ILE A CB    1 
ATOM   2252 C  CG1   . ILE A 1 280 ? -8.844  -21.685 8.458   1.00 26.45  ? 280  ILE A CG1   1 
ATOM   2253 C  CG2   . ILE A 1 280 ? -6.913  -22.702 7.133   1.00 24.52  ? 280  ILE A CG2   1 
ATOM   2254 C  CD1   . ILE A 1 280 ? -8.073  -21.788 9.736   1.00 30.47  ? 280  ILE A CD1   1 
ATOM   2255 N  N     . PRO A 1 281 ? -5.142  -19.993 5.887   1.00 22.25  ? 281  PRO A N     1 
ATOM   2256 C  CA    . PRO A 1 281 ? -4.361  -19.812 4.658   1.00 21.05  ? 281  PRO A CA    1 
ATOM   2257 C  C     . PRO A 1 281 ? -3.925  -21.130 4.036   1.00 20.30  ? 281  PRO A C     1 
ATOM   2258 O  O     . PRO A 1 281 ? -3.679  -22.111 4.739   1.00 19.13  ? 281  PRO A O     1 
ATOM   2259 C  CB    . PRO A 1 281 ? -3.147  -19.027 5.152   1.00 21.12  ? 281  PRO A CB    1 
ATOM   2260 C  CG    . PRO A 1 281 ? -2.955  -19.524 6.553   1.00 21.91  ? 281  PRO A CG    1 
ATOM   2261 C  CD    . PRO A 1 281 ? -4.320  -19.789 7.097   1.00 22.12  ? 281  PRO A CD    1 
ATOM   2262 N  N     . LYS A 1 282 ? -3.839  -21.150 2.711   1.00 20.06  ? 282  LYS A N     1 
ATOM   2263 C  CA    . LYS A 1 282 ? -3.333  -22.309 2.004   1.00 19.70  ? 282  LYS A CA    1 
ATOM   2264 C  C     . LYS A 1 282 ? -1.909  -22.074 1.490   1.00 19.25  ? 282  LYS A C     1 
ATOM   2265 O  O     . LYS A 1 282 ? -1.286  -23.010 0.999   1.00 18.60  ? 282  LYS A O     1 
ATOM   2266 C  CB    . LYS A 1 282 ? -4.258  -22.688 0.834   1.00 20.04  ? 282  LYS A CB    1 
ATOM   2267 C  CG    . LYS A 1 282 ? -5.632  -23.142 1.246   1.00 21.38  ? 282  LYS A CG    1 
ATOM   2268 C  CD    . LYS A 1 282 ? -6.403  -23.809 0.088   1.00 24.94  ? 282  LYS A CD    1 
ATOM   2269 C  CE    . LYS A 1 282 ? -6.875  -22.787 -0.961  1.00 27.14  ? 282  LYS A CE    1 
ATOM   2270 N  NZ    . LYS A 1 282 ? -7.556  -23.501 -2.097  1.00 33.42  ? 282  LYS A NZ    1 
ATOM   2271 N  N     . ALA A 1 283 ? -1.405  -20.841 1.589   1.00 19.00  ? 283  ALA A N     1 
ATOM   2272 C  CA    . ALA A 1 283 ? -0.042  -20.532 1.132   1.00 19.89  ? 283  ALA A CA    1 
ATOM   2273 C  C     . ALA A 1 283 ? 0.785   -19.816 2.197   1.00 20.04  ? 283  ALA A C     1 
ATOM   2274 O  O     . ALA A 1 283 ? 0.243   -19.049 2.993   1.00 19.90  ? 283  ALA A O     1 
ATOM   2275 C  CB    . ALA A 1 283 ? -0.064  -19.700 -0.170  1.00 20.14  ? 283  ALA A CB    1 
ATOM   2276 N  N     . ILE A 1 284 ? 2.095   -20.078 2.204   1.00 20.28  ? 284  ILE A N     1 
ATOM   2277 C  CA    . ILE A 1 284 ? 3.025   -19.396 3.122   1.00 20.31  ? 284  ILE A CA    1 
ATOM   2278 C  C     . ILE A 1 284 ? 4.253   -18.939 2.338   1.00 21.32  ? 284  ILE A C     1 
ATOM   2279 O  O     . ILE A 1 284 ? 4.759   -19.691 1.498   1.00 21.07  ? 284  ILE A O     1 
ATOM   2280 C  CB    . ILE A 1 284 ? 3.446   -20.298 4.342   1.00 20.59  ? 284  ILE A CB    1 
ATOM   2281 C  CG1   . ILE A 1 284 ? 4.516   -19.615 5.228   1.00 20.88  ? 284  ILE A CG1   1 
ATOM   2282 C  CG2   . ILE A 1 284 ? 3.895   -21.685 3.898   1.00 19.54  ? 284  ILE A CG2   1 
ATOM   2283 C  CD1   . ILE A 1 284 ? 4.837   -20.389 6.504   1.00 22.98  ? 284  ILE A CD1   1 
ATOM   2284 N  N     . HIS A 1 285 ? 4.700   -17.708 2.599   1.00 21.30  ? 285  HIS A N     1 
ATOM   2285 C  CA    . HIS A 1 285 ? 5.907   -17.176 1.971   1.00 22.58  ? 285  HIS A CA    1 
ATOM   2286 C  C     . HIS A 1 285 ? 6.844   -16.630 3.028   1.00 22.79  ? 285  HIS A C     1 
ATOM   2287 O  O     . HIS A 1 285 ? 6.426   -15.920 3.943   1.00 23.68  ? 285  HIS A O     1 
ATOM   2288 C  CB    . HIS A 1 285 ? 5.587   -16.121 0.890   1.00 22.51  ? 285  HIS A CB    1 
ATOM   2289 C  CG    . HIS A 1 285 ? 4.888   -16.691 -0.314  1.00 23.68  ? 285  HIS A CG    1 
ATOM   2290 N  ND1   . HIS A 1 285 ? 5.535   -16.934 -1.510  1.00 26.50  ? 285  HIS A ND1   1 
ATOM   2291 C  CD2   . HIS A 1 285 ? 3.607   -17.089 -0.498  1.00 25.03  ? 285  HIS A CD2   1 
ATOM   2292 C  CE1   . HIS A 1 285 ? 4.684   -17.452 -2.378  1.00 24.19  ? 285  HIS A CE1   1 
ATOM   2293 N  NE2   . HIS A 1 285 ? 3.503   -17.550 -1.793  1.00 26.84  ? 285  HIS A NE2   1 
ATOM   2294 N  N     . VAL A 1 286 ? 8.111   -16.991 2.928   1.00 23.04  ? 286  VAL A N     1 
ATOM   2295 C  CA    . VAL A 1 286 ? 9.105   -16.405 3.817   1.00 23.27  ? 286  VAL A CA    1 
ATOM   2296 C  C     . VAL A 1 286 ? 9.932   -15.426 2.991   1.00 24.38  ? 286  VAL A C     1 
ATOM   2297 O  O     . VAL A 1 286 ? 10.292  -15.713 1.845   1.00 24.59  ? 286  VAL A O     1 
ATOM   2298 C  CB    . VAL A 1 286 ? 9.960   -17.482 4.491   1.00 23.15  ? 286  VAL A CB    1 
ATOM   2299 C  CG1   . VAL A 1 286 ? 11.177  -16.883 5.199   1.00 22.25  ? 286  VAL A CG1   1 
ATOM   2300 C  CG2   . VAL A 1 286 ? 9.092   -18.292 5.510   1.00 22.63  ? 286  VAL A CG2   1 
ATOM   2301 N  N     . VAL A 1 287 ? 10.204  -14.267 3.571   1.00 25.79  ? 287  VAL A N     1 
ATOM   2302 C  CA    . VAL A 1 287 ? 11.014  -13.253 2.903   1.00 27.23  ? 287  VAL A CA    1 
ATOM   2303 C  C     . VAL A 1 287 ? 12.236  -12.917 3.750   1.00 27.98  ? 287  VAL A C     1 
ATOM   2304 O  O     . VAL A 1 287 ? 12.157  -12.814 4.978   1.00 26.72  ? 287  VAL A O     1 
ATOM   2305 C  CB    . VAL A 1 287 ? 10.199  -11.978 2.565   1.00 27.32  ? 287  VAL A CB    1 
ATOM   2306 C  CG1   . VAL A 1 287 ? 9.906   -11.166 3.810   1.00 26.75  ? 287  VAL A CG1   1 
ATOM   2307 C  CG2   . VAL A 1 287 ? 10.939  -11.112 1.540   1.00 28.55  ? 287  VAL A CG2   1 
ATOM   2308 N  N     . ALA A 1 288 ? 13.370  -12.769 3.074   1.00 29.82  ? 288  ALA A N     1 
ATOM   2309 C  CA    . ALA A 1 288 ? 14.583  -12.315 3.719   1.00 31.70  ? 288  ALA A CA    1 
ATOM   2310 C  C     . ALA A 1 288 ? 15.107  -11.097 2.984   1.00 33.58  ? 288  ALA A C     1 
ATOM   2311 O  O     . ALA A 1 288 ? 15.007  -11.012 1.752   1.00 34.30  ? 288  ALA A O     1 
ATOM   2312 C  CB    . ALA A 1 288 ? 15.628  -13.408 3.734   1.00 31.46  ? 288  ALA A CB    1 
ATOM   2313 N  N     . VAL A 1 289 ? 15.663  -10.162 3.749   1.00 35.54  ? 289  VAL A N     1 
ATOM   2314 C  CA    . VAL A 1 289 ? 16.321  -8.979  3.188   1.00 37.22  ? 289  VAL A CA    1 
ATOM   2315 C  C     . VAL A 1 289 ? 17.782  -9.091  3.592   1.00 38.29  ? 289  VAL A C     1 
ATOM   2316 O  O     . VAL A 1 289 ? 18.098  -9.067  4.781   1.00 37.82  ? 289  VAL A O     1 
ATOM   2317 C  CB    . VAL A 1 289 ? 15.713  -7.656  3.729   1.00 37.20  ? 289  VAL A CB    1 
ATOM   2318 C  CG1   . VAL A 1 289 ? 16.315  -6.437  3.008   1.00 37.57  ? 289  VAL A CG1   1 
ATOM   2319 C  CG2   . VAL A 1 289 ? 14.200  -7.647  3.590   1.00 37.36  ? 289  VAL A CG2   1 
ATOM   2320 N  N     . THR A 1 290 ? 18.661  -9.262  2.605   1.00 40.23  ? 290  THR A N     1 
ATOM   2321 C  CA    . THR A 1 290 ? 20.105  -9.428  2.853   1.00 42.33  ? 290  THR A CA    1 
ATOM   2322 C  C     . THR A 1 290 ? 20.801  -8.117  3.269   1.00 43.60  ? 290  THR A C     1 
ATOM   2323 O  O     . THR A 1 290 ? 20.176  -7.053  3.246   1.00 43.96  ? 290  THR A O     1 
ATOM   2324 C  CB    . THR A 1 290 ? 20.829  -10.010 1.622   1.00 42.30  ? 290  THR A CB    1 
ATOM   2325 O  OG1   . THR A 1 290 ? 20.586  -9.175  0.484   1.00 43.20  ? 290  THR A OG1   1 
ATOM   2326 C  CG2   . THR A 1 290 ? 20.353  -11.431 1.324   1.00 42.76  ? 290  THR A CG2   1 
ATOM   2327 N  N     . GLU A 1 291 ? 22.085  -8.213  3.644   1.00 45.63  ? 291  GLU A N     1 
ATOM   2328 C  CA    . GLU A 1 291 ? 22.931  -7.062  4.046   1.00 47.37  ? 291  GLU A CA    1 
ATOM   2329 C  C     . GLU A 1 291 ? 22.905  -5.903  3.060   1.00 48.18  ? 291  GLU A C     1 
ATOM   2330 O  O     . GLU A 1 291 ? 22.800  -4.740  3.452   1.00 48.46  ? 291  GLU A O     1 
ATOM   2331 C  CB    . GLU A 1 291 ? 24.394  -7.482  4.211   1.00 47.67  ? 291  GLU A CB    1 
ATOM   2332 C  CG    . GLU A 1 291 ? 24.692  -8.358  5.408   1.00 49.71  ? 291  GLU A CG    1 
ATOM   2333 C  CD    . GLU A 1 291 ? 26.183  -8.505  5.662   1.00 52.40  ? 291  GLU A CD    1 
ATOM   2334 O  OE1   . GLU A 1 291 ? 26.751  -9.550  5.274   1.00 54.23  ? 291  GLU A OE1   1 
ATOM   2335 O  OE2   . GLU A 1 291 ? 26.792  -7.579  6.237   1.00 52.42  ? 291  GLU A OE2   1 
ATOM   2336 N  N     . ASP A 1 292 ? 23.026  -6.228  1.778   1.00 49.12  ? 292  ASP A N     1 
ATOM   2337 C  CA    . ASP A 1 292 ? 23.059  -5.223  0.721   1.00 49.47  ? 292  ASP A CA    1 
ATOM   2338 C  C     . ASP A 1 292 ? 21.654  -4.855  0.247   1.00 49.33  ? 292  ASP A C     1 
ATOM   2339 O  O     . ASP A 1 292 ? 21.471  -4.348  -0.869  1.00 49.41  ? 292  ASP A O     1 
ATOM   2340 C  CB    . ASP A 1 292 ? 23.937  -5.705  -0.440  1.00 49.81  ? 292  ASP A CB    1 
ATOM   2341 C  CG    . ASP A 1 292 ? 23.430  -6.996  -1.071  1.00 51.50  ? 292  ASP A CG    1 
ATOM   2342 O  OD1   . ASP A 1 292 ? 23.682  -7.190  -2.283  1.00 52.57  ? 292  ASP A OD1   1 
ATOM   2343 O  OD2   . ASP A 1 292 ? 22.784  -7.814  -0.368  1.00 52.69  ? 292  ASP A OD2   1 
ATOM   2344 N  N     . LEU A 1 293 ? 20.669  -5.125  1.109   1.00 49.25  ? 293  LEU A N     1 
ATOM   2345 C  CA    . LEU A 1 293 ? 19.263  -4.719  0.923   1.00 48.74  ? 293  LEU A CA    1 
ATOM   2346 C  C     . LEU A 1 293 ? 18.524  -5.386  -0.228  1.00 48.32  ? 293  LEU A C     1 
ATOM   2347 O  O     . LEU A 1 293 ? 17.463  -4.919  -0.645  1.00 48.57  ? 293  LEU A O     1 
ATOM   2348 C  CB    . LEU A 1 293 ? 19.134  -3.191  0.821   1.00 49.06  ? 293  LEU A CB    1 
ATOM   2349 C  CG    . LEU A 1 293 ? 19.509  -2.354  2.049   1.00 49.36  ? 293  LEU A CG    1 
ATOM   2350 C  CD1   . LEU A 1 293 ? 18.951  -0.933  1.881   1.00 49.79  ? 293  LEU A CD1   1 
ATOM   2351 C  CD2   . LEU A 1 293 ? 19.011  -2.976  3.354   1.00 48.23  ? 293  LEU A CD2   1 
ATOM   2352 N  N     . ASP A 1 294 ? 19.068  -6.485  -0.735  1.00 48.00  ? 294  ASP A N     1 
ATOM   2353 C  CA    . ASP A 1 294 ? 18.369  -7.255  -1.745  1.00 47.62  ? 294  ASP A CA    1 
ATOM   2354 C  C     . ASP A 1 294 ? 17.263  -8.040  -1.054  1.00 46.95  ? 294  ASP A C     1 
ATOM   2355 O  O     . ASP A 1 294 ? 17.331  -8.295  0.152   1.00 47.34  ? 294  ASP A O     1 
ATOM   2356 C  CB    . ASP A 1 294 ? 19.330  -8.197  -2.465  1.00 48.30  ? 294  ASP A CB    1 
ATOM   2357 C  CG    . ASP A 1 294 ? 18.763  -8.738  -3.772  1.00 49.73  ? 294  ASP A CG    1 
ATOM   2358 O  OD1   . ASP A 1 294 ? 17.915  -8.062  -4.406  1.00 51.45  ? 294  ASP A OD1   1 
ATOM   2359 O  OD2   . ASP A 1 294 ? 19.185  -9.844  -4.171  1.00 51.47  ? 294  ASP A OD2   1 
ATOM   2360 N  N     . ILE A 1 295 ? 16.237  -8.398  -1.813  1.00 45.51  ? 295  ILE A N     1 
ATOM   2361 C  CA    . ILE A 1 295 ? 15.097  -9.115  -1.266  1.00 44.02  ? 295  ILE A CA    1 
ATOM   2362 C  C     . ILE A 1 295 ? 15.060  -10.506 -1.899  1.00 42.59  ? 295  ILE A C     1 
ATOM   2363 O  O     . ILE A 1 295 ? 15.314  -10.661 -3.093  1.00 42.35  ? 295  ILE A O     1 
ATOM   2364 C  CB    . ILE A 1 295 ? 13.769  -8.312  -1.436  1.00 44.07  ? 295  ILE A CB    1 
ATOM   2365 C  CG1   . ILE A 1 295 ? 13.886  -6.929  -0.771  1.00 44.50  ? 295  ILE A CG1   1 
ATOM   2366 C  CG2   . ILE A 1 295 ? 12.594  -9.064  -0.828  1.00 44.79  ? 295  ILE A CG2   1 
ATOM   2367 C  CD1   . ILE A 1 295 ? 12.677  -6.001  -0.984  1.00 44.46  ? 295  ILE A CD1   1 
ATOM   2368 N  N     . VAL A 1 296 ? 14.818  -11.515 -1.061  1.00 40.77  ? 296  VAL A N     1 
ATOM   2369 C  CA    . VAL A 1 296 ? 14.680  -12.905 -1.482  1.00 38.65  ? 296  VAL A CA    1 
ATOM   2370 C  C     . VAL A 1 296 ? 13.401  -13.462 -0.843  1.00 37.14  ? 296  VAL A C     1 
ATOM   2371 O  O     . VAL A 1 296 ? 13.112  -13.172 0.318   1.00 36.46  ? 296  VAL A O     1 
ATOM   2372 C  CB    . VAL A 1 296 ? 15.856  -13.775 -0.987  1.00 38.62  ? 296  VAL A CB    1 
ATOM   2373 C  CG1   . VAL A 1 296 ? 15.974  -15.037 -1.824  1.00 39.40  ? 296  VAL A CG1   1 
ATOM   2374 C  CG2   . VAL A 1 296 ? 17.165  -13.016 -1.012  1.00 39.70  ? 296  VAL A CG2   1 
ATOM   2375 N  N     . SER A 1 297 ? 12.642  -14.263 -1.587  1.00 35.26  ? 297  SER A N     1 
ATOM   2376 C  CA    . SER A 1 297 ? 11.501  -14.950 -0.991  1.00 33.21  ? 297  SER A CA    1 
ATOM   2377 C  C     . SER A 1 297 ? 11.313  -16.377 -1.496  1.00 31.37  ? 297  SER A C     1 
ATOM   2378 O  O     . SER A 1 297 ? 11.596  -16.704 -2.663  1.00 30.71  ? 297  SER A O     1 
ATOM   2379 C  CB    . SER A 1 297 ? 10.209  -14.121 -1.099  1.00 33.60  ? 297  SER A CB    1 
ATOM   2380 O  OG    . SER A 1 297 ? 9.532   -14.352 -2.316  1.00 35.40  ? 297  SER A OG    1 
ATOM   2381 N  N     . ARG A 1 298 ? 10.864  -17.238 -0.593  1.00 28.24  ? 298  ARG A N     1 
ATOM   2382 C  CA    . ARG A 1 298 ? 10.532  -18.605 -0.979  1.00 26.63  ? 298  ARG A CA    1 
ATOM   2383 C  C     . ARG A 1 298 ? 9.176   -18.964 -0.408  1.00 24.77  ? 298  ARG A C     1 
ATOM   2384 O  O     . ARG A 1 298 ? 8.897   -18.671 0.742   1.00 23.53  ? 298  ARG A O     1 
ATOM   2385 C  CB    . ARG A 1 298 ? 11.617  -19.577 -0.510  1.00 26.14  ? 298  ARG A CB    1 
ATOM   2386 C  CG    . ARG A 1 298 ? 12.982  -19.395 -1.219  1.00 27.85  ? 298  ARG A CG    1 
ATOM   2387 C  CD    . ARG A 1 298 ? 12.935  -19.676 -2.731  1.00 27.60  ? 298  ARG A CD    1 
ATOM   2388 N  NE    . ARG A 1 298 ? 14.276  -19.562 -3.306  1.00 30.21  ? 298  ARG A NE    1 
ATOM   2389 C  CZ    . ARG A 1 298 ? 14.825  -18.433 -3.755  1.00 30.56  ? 298  ARG A CZ    1 
ATOM   2390 N  NH1   . ARG A 1 298 ? 14.160  -17.288 -3.723  1.00 29.50  ? 298  ARG A NH1   1 
ATOM   2391 N  NH2   . ARG A 1 298 ? 16.055  -18.453 -4.239  1.00 31.19  ? 298  ARG A NH2   1 
ATOM   2392 N  N     . GLY A 1 299 ? 8.331   -19.599 -1.211  1.00 24.06  ? 299  GLY A N     1 
ATOM   2393 C  CA    . GLY A 1 299 ? 6.994   -19.925 -0.742  1.00 23.44  ? 299  GLY A CA    1 
ATOM   2394 C  C     . GLY A 1 299 ? 6.592   -21.358 -1.036  1.00 23.77  ? 299  GLY A C     1 
ATOM   2395 O  O     . GLY A 1 299 ? 7.298   -22.082 -1.740  1.00 22.89  ? 299  GLY A O     1 
ATOM   2396 N  N     . ARG A 1 300 ? 5.446   -21.752 -0.491  1.00 22.80  ? 300  ARG A N     1 
ATOM   2397 C  CA    . ARG A 1 300 ? 4.862   -23.050 -0.757  1.00 23.60  ? 300  ARG A CA    1 
ATOM   2398 C  C     . ARG A 1 300 ? 3.342   -22.925 -0.648  1.00 23.12  ? 300  ARG A C     1 
ATOM   2399 O  O     . ARG A 1 300 ? 2.841   -22.300 0.270   1.00 22.31  ? 300  ARG A O     1 
ATOM   2400 C  CB    . ARG A 1 300 ? 5.408   -24.088 0.244   1.00 24.03  ? 300  ARG A CB    1 
ATOM   2401 C  CG    . ARG A 1 300 ? 4.879   -25.503 -0.002  1.00 26.65  ? 300  ARG A CG    1 
ATOM   2402 C  CD    . ARG A 1 300 ? 5.605   -26.577 0.827   1.00 29.42  ? 300  ARG A CD    1 
ATOM   2403 N  NE    . ARG A 1 300 ? 4.998   -27.893 0.591   1.00 33.09  ? 300  ARG A NE    1 
ATOM   2404 C  CZ    . ARG A 1 300 ? 5.086   -28.943 1.409   1.00 33.26  ? 300  ARG A CZ    1 
ATOM   2405 N  NH1   . ARG A 1 300 ? 5.765   -28.869 2.551   1.00 31.21  ? 300  ARG A NH1   1 
ATOM   2406 N  NH2   . ARG A 1 300 ? 4.485   -30.079 1.075   1.00 34.03  ? 300  ARG A NH2   1 
ATOM   2407 N  N     . THR A 1 301 ? 2.622   -23.517 -1.596  1.00 23.65  ? 301  THR A N     1 
ATOM   2408 C  CA    . THR A 1 301 ? 1.159   -23.557 -1.579  1.00 23.86  ? 301  THR A CA    1 
ATOM   2409 C  C     . THR A 1 301 ? 0.706   -24.993 -1.362  1.00 23.81  ? 301  THR A C     1 
ATOM   2410 O  O     . THR A 1 301 ? 1.252   -25.925 -1.958  1.00 23.49  ? 301  THR A O     1 
ATOM   2411 C  CB    . THR A 1 301 ? 0.601   -23.030 -2.911  1.00 24.64  ? 301  THR A CB    1 
ATOM   2412 O  OG1   . THR A 1 301 ? 1.122   -21.723 -3.129  1.00 24.04  ? 301  THR A OG1   1 
ATOM   2413 C  CG2   . THR A 1 301 ? -0.949  -22.990 -2.943  1.00 24.61  ? 301  THR A CG2   1 
ATOM   2414 N  N     . PHE A 1 302 ? -0.263  -25.173 -0.474  1.00 23.60  ? 302  PHE A N     1 
ATOM   2415 C  CA    . PHE A 1 302 ? -0.829  -26.495 -0.205  1.00 23.00  ? 302  PHE A CA    1 
ATOM   2416 C  C     . PHE A 1 302 ? -2.229  -26.568 -0.808  1.00 22.67  ? 302  PHE A C     1 
ATOM   2417 O  O     . PHE A 1 302 ? -2.892  -25.530 -0.985  1.00 22.79  ? 302  PHE A O     1 
ATOM   2418 C  CB    . PHE A 1 302 ? -0.949  -26.736 1.304   1.00 23.70  ? 302  PHE A CB    1 
ATOM   2419 C  CG    . PHE A 1 302 ? 0.357   -26.718 2.036   1.00 24.97  ? 302  PHE A CG    1 
ATOM   2420 C  CD1   . PHE A 1 302 ? 0.960   -25.521 2.371   1.00 25.05  ? 302  PHE A CD1   1 
ATOM   2421 C  CD2   . PHE A 1 302 ? 0.978   -27.906 2.387   1.00 27.86  ? 302  PHE A CD2   1 
ATOM   2422 C  CE1   . PHE A 1 302 ? 2.186   -25.492 3.047   1.00 28.00  ? 302  PHE A CE1   1 
ATOM   2423 C  CE2   . PHE A 1 302 ? 2.193   -27.899 3.066   1.00 29.36  ? 302  PHE A CE2   1 
ATOM   2424 C  CZ    . PHE A 1 302 ? 2.804   -26.688 3.394   1.00 27.95  ? 302  PHE A CZ    1 
ATOM   2425 N  N     . PRO A 1 303 ? -2.710  -27.791 -1.079  1.00 21.63  ? 303  PRO A N     1 
ATOM   2426 C  CA    . PRO A 1 303 ? -4.113  -27.947 -1.468  1.00 21.73  ? 303  PRO A CA    1 
ATOM   2427 C  C     . PRO A 1 303 ? -5.112  -27.864 -0.286  1.00 21.39  ? 303  PRO A C     1 
ATOM   2428 O  O     . PRO A 1 303 ? -6.267  -28.204 -0.443  1.00 22.11  ? 303  PRO A O     1 
ATOM   2429 C  CB    . PRO A 1 303 ? -4.144  -29.339 -2.109  1.00 21.60  ? 303  PRO A CB    1 
ATOM   2430 C  CG    . PRO A 1 303 ? -2.988  -30.094 -1.506  1.00 20.96  ? 303  PRO A CG    1 
ATOM   2431 C  CD    . PRO A 1 303 ? -1.992  -29.081 -0.989  1.00 21.68  ? 303  PRO A CD    1 
ATOM   2432 N  N     . HIS A 1 304 ? -4.675  -27.416 0.887   1.00 20.79  ? 304  HIS A N     1 
ATOM   2433 C  CA    . HIS A 1 304 ? -5.558  -27.372 2.061   1.00 19.88  ? 304  HIS A CA    1 
ATOM   2434 C  C     . HIS A 1 304 ? -4.994  -26.312 2.999   1.00 19.59  ? 304  HIS A C     1 
ATOM   2435 O  O     . HIS A 1 304 ? -3.903  -25.768 2.744   1.00 19.20  ? 304  HIS A O     1 
ATOM   2436 C  CB    . HIS A 1 304 ? -5.610  -28.750 2.749   1.00 19.94  ? 304  HIS A CB    1 
ATOM   2437 C  CG    . HIS A 1 304 ? -4.280  -29.198 3.271   1.00 21.29  ? 304  HIS A CG    1 
ATOM   2438 N  ND1   . HIS A 1 304 ? -3.547  -30.201 2.679   1.00 25.11  ? 304  HIS A ND1   1 
ATOM   2439 C  CD2   . HIS A 1 304 ? -3.521  -28.734 4.295   1.00 22.75  ? 304  HIS A CD2   1 
ATOM   2440 C  CE1   . HIS A 1 304 ? -2.406  -30.349 3.326   1.00 25.56  ? 304  HIS A CE1   1 
ATOM   2441 N  NE2   . HIS A 1 304 ? -2.369  -29.477 4.316   1.00 24.19  ? 304  HIS A NE2   1 
ATOM   2442 N  N     . GLY A 1 305 ? -5.714  -26.009 4.076   1.00 18.33  ? 305  GLY A N     1 
ATOM   2443 C  CA    . GLY A 1 305 ? -5.259  -24.970 5.017   1.00 16.87  ? 305  GLY A CA    1 
ATOM   2444 C  C     . GLY A 1 305 ? -4.029  -25.376 5.812   1.00 16.54  ? 305  GLY A C     1 
ATOM   2445 O  O     . GLY A 1 305 ? -3.778  -26.542 6.017   1.00 16.53  ? 305  GLY A O     1 
ATOM   2446 N  N     . ILE A 1 306 ? -3.295  -24.388 6.291   1.00 16.97  ? 306  ILE A N     1 
ATOM   2447 C  CA    . ILE A 1 306 ? -2.058  -24.583 7.004   1.00 17.58  ? 306  ILE A CA    1 
ATOM   2448 C  C     . ILE A 1 306 ? -2.341  -24.281 8.468   1.00 17.10  ? 306  ILE A C     1 
ATOM   2449 O  O     . ILE A 1 306 ? -2.660  -23.146 8.790   1.00 18.30  ? 306  ILE A O     1 
ATOM   2450 C  CB    . ILE A 1 306 ? -0.983  -23.560 6.492   1.00 16.65  ? 306  ILE A CB    1 
ATOM   2451 C  CG1   . ILE A 1 306 ? -0.691  -23.808 5.004   1.00 17.26  ? 306  ILE A CG1   1 
ATOM   2452 C  CG2   . ILE A 1 306 ? 0.292   -23.627 7.321   1.00 17.68  ? 306  ILE A CG2   1 
ATOM   2453 C  CD1   . ILE A 1 306 ? 0.149   -22.728 4.345   1.00 20.48  ? 306  ILE A CD1   1 
ATOM   2454 N  N     . SER A 1 307 ? -2.199  -25.268 9.346   1.00 16.73  ? 307  SER A N     1 
ATOM   2455 C  CA    . SER A 1 307 ? -2.371  -25.015 10.800  1.00 17.12  ? 307  SER A CA    1 
ATOM   2456 C  C     . SER A 1 307 ? -1.207  -24.158 11.334  1.00 16.92  ? 307  SER A C     1 
ATOM   2457 O  O     . SER A 1 307 ? -0.144  -24.103 10.718  1.00 16.74  ? 307  SER A O     1 
ATOM   2458 C  CB    . SER A 1 307 ? -2.475  -26.327 11.581  1.00 16.60  ? 307  SER A CB    1 
ATOM   2459 O  OG    . SER A 1 307 ? -1.196  -26.926 11.744  1.00 16.81  ? 307  SER A OG    1 
ATOM   2460 N  N     . LYS A 1 308 ? -1.407  -23.492 12.472  1.00 17.81  ? 308  LYS A N     1 
ATOM   2461 C  CA    . LYS A 1 308 ? -0.351  -22.650 13.060  1.00 18.22  ? 308  LYS A CA    1 
ATOM   2462 C  C     . LYS A 1 308 ? 0.917   -23.445 13.317  1.00 17.93  ? 308  LYS A C     1 
ATOM   2463 O  O     . LYS A 1 308 ? 2.023   -22.985 13.021  1.00 16.94  ? 308  LYS A O     1 
ATOM   2464 C  CB    . LYS A 1 308 ? -0.832  -21.961 14.352  1.00 19.31  ? 308  LYS A CB    1 
ATOM   2465 C  CG    . LYS A 1 308 ? 0.182   -20.953 14.932  1.00 21.20  ? 308  LYS A CG    1 
ATOM   2466 C  CD    . LYS A 1 308 ? -0.437  -20.009 15.995  1.00 25.79  ? 308  LYS A CD    1 
ATOM   2467 C  CE    . LYS A 1 308 ? -0.868  -20.742 17.254  1.00 30.51  ? 308  LYS A CE    1 
ATOM   2468 N  NZ    . LYS A 1 308 ? 0.299   -21.037 18.136  1.00 32.40  ? 308  LYS A NZ    1 
ATOM   2469 N  N     . GLU A 1 309 ? 0.739   -24.649 13.847  1.00 18.28  ? 309  GLU A N     1 
ATOM   2470 C  CA    . GLU A 1 309 ? 1.836   -25.552 14.162  1.00 19.33  ? 309  GLU A CA    1 
ATOM   2471 C  C     . GLU A 1 309 ? 2.592   -25.948 12.893  1.00 20.00  ? 309  GLU A C     1 
ATOM   2472 O  O     . GLU A 1 309 ? 3.827   -25.979 12.884  1.00 20.70  ? 309  GLU A O     1 
ATOM   2473 C  CB    . GLU A 1 309 ? 1.305   -26.816 14.873  1.00 19.27  ? 309  GLU A CB    1 
ATOM   2474 C  CG    . GLU A 1 309 ? 0.758   -26.589 16.309  1.00 20.81  ? 309  GLU A CG    1 
ATOM   2475 C  CD    . GLU A 1 309 ? -0.562  -25.814 16.355  1.00 24.70  ? 309  GLU A CD    1 
ATOM   2476 O  OE1   . GLU A 1 309 ? -1.413  -25.956 15.430  1.00 23.15  ? 309  GLU A OE1   1 
ATOM   2477 O  OE2   . GLU A 1 309 ? -0.750  -25.054 17.337  1.00 28.05  ? 309  GLU A OE2   1 
ATOM   2478 N  N     . THR A 1 310 ? 1.854   -26.258 11.825  1.00 20.34  ? 310  THR A N     1 
ATOM   2479 C  CA    . THR A 1 310 ? 2.479   -26.601 10.534  1.00 21.13  ? 310  THR A CA    1 
ATOM   2480 C  C     . THR A 1 310 ? 3.247   -25.424 9.922   1.00 20.34  ? 310  THR A C     1 
ATOM   2481 O  O     . THR A 1 310 ? 4.301   -25.619 9.296   1.00 21.39  ? 310  THR A O     1 
ATOM   2482 C  CB    . THR A 1 310 ? 1.434   -27.121 9.522   1.00 21.00  ? 310  THR A CB    1 
ATOM   2483 O  OG1   . THR A 1 310 ? 0.929   -28.380 9.981   1.00 24.49  ? 310  THR A OG1   1 
ATOM   2484 C  CG2   . THR A 1 310 ? 2.048   -27.304 8.135   1.00 22.73  ? 310  THR A CG2   1 
ATOM   2485 N  N     . ALA A 1 311 ? 2.718   -24.219 10.093  1.00 19.47  ? 311  ALA A N     1 
ATOM   2486 C  CA    . ALA A 1 311 ? 3.386   -23.008 9.615   1.00 20.11  ? 311  ALA A CA    1 
ATOM   2487 C  C     . ALA A 1 311 ? 4.813   -22.862 10.176  1.00 20.87  ? 311  ALA A C     1 
ATOM   2488 O  O     . ALA A 1 311 ? 5.732   -22.433 9.459   1.00 20.03  ? 311  ALA A O     1 
ATOM   2489 C  CB    . ALA A 1 311 ? 2.546   -21.751 9.931   1.00 19.45  ? 311  ALA A CB    1 
ATOM   2490 N  N     . TYR A 1 312 ? 4.998   -23.229 11.447  1.00 21.51  ? 312  TYR A N     1 
ATOM   2491 C  CA    . TYR A 1 312 ? 6.319   -23.173 12.075  1.00 22.61  ? 312  TYR A CA    1 
ATOM   2492 C  C     . TYR A 1 312 ? 7.357   -23.946 11.282  1.00 23.07  ? 312  TYR A C     1 
ATOM   2493 O  O     . TYR A 1 312 ? 8.335   -23.360 10.825  1.00 22.89  ? 312  TYR A O     1 
ATOM   2494 C  CB    . TYR A 1 312 ? 6.283   -23.740 13.496  1.00 23.32  ? 312  TYR A CB    1 
ATOM   2495 C  CG    . TYR A 1 312 ? 6.000   -22.721 14.567  1.00 24.60  ? 312  TYR A CG    1 
ATOM   2496 C  CD1   . TYR A 1 312 ? 6.949   -22.452 15.551  1.00 26.96  ? 312  TYR A CD1   1 
ATOM   2497 C  CD2   . TYR A 1 312 ? 4.788   -22.044 14.609  1.00 26.07  ? 312  TYR A CD2   1 
ATOM   2498 C  CE1   . TYR A 1 312 ? 6.700   -21.541 16.547  1.00 28.43  ? 312  TYR A CE1   1 
ATOM   2499 C  CE2   . TYR A 1 312 ? 4.525   -21.127 15.600  1.00 28.43  ? 312  TYR A CE2   1 
ATOM   2500 C  CZ    . TYR A 1 312 ? 5.490   -20.879 16.568  1.00 29.30  ? 312  TYR A CZ    1 
ATOM   2501 O  OH    . TYR A 1 312 ? 5.258   -19.955 17.553  1.00 31.55  ? 312  TYR A OH    1 
ATOM   2502 N  N     . SER A 1 313 ? 7.136   -25.254 11.122  1.00 22.74  ? 313  SER A N     1 
ATOM   2503 C  CA    . SER A 1 313 ? 8.118   -26.116 10.488  1.00 23.59  ? 313  SER A CA    1 
ATOM   2504 C  C     . SER A 1 313 ? 8.244   -25.869 8.994   1.00 23.29  ? 313  SER A C     1 
ATOM   2505 O  O     . SER A 1 313 ? 9.335   -26.008 8.438   1.00 22.63  ? 313  SER A O     1 
ATOM   2506 C  CB    . SER A 1 313 ? 7.847   -27.590 10.776  1.00 23.86  ? 313  SER A CB    1 
ATOM   2507 O  OG    . SER A 1 313 ? 6.492   -27.878 10.554  1.00 25.56  ? 313  SER A OG    1 
ATOM   2508 N  N     . GLU A 1 314 ? 7.135   -25.501 8.347   1.00 23.29  ? 314  GLU A N     1 
ATOM   2509 C  CA    . GLU A 1 314 ? 7.184   -25.097 6.947   1.00 23.58  ? 314  GLU A CA    1 
ATOM   2510 C  C     . GLU A 1 314 ? 8.012   -23.818 6.712   1.00 22.89  ? 314  GLU A C     1 
ATOM   2511 O  O     . GLU A 1 314 ? 8.767   -23.730 5.748   1.00 22.07  ? 314  GLU A O     1 
ATOM   2512 C  CB    . GLU A 1 314 ? 5.785   -24.949 6.350   1.00 24.08  ? 314  GLU A CB    1 
ATOM   2513 C  CG    . GLU A 1 314 ? 5.845   -24.674 4.839   1.00 27.54  ? 314  GLU A CG    1 
ATOM   2514 C  CD    . GLU A 1 314 ? 6.673   -25.748 4.095   1.00 30.72  ? 314  GLU A CD    1 
ATOM   2515 O  OE1   . GLU A 1 314 ? 7.769   -25.404 3.513   1.00 27.05  ? 314  GLU A OE1   1 
ATOM   2516 O  OE2   . GLU A 1 314 ? 6.225   -26.928 4.132   1.00 26.13  ? 314  GLU A OE2   1 
ATOM   2517 N  N     . SER A 1 315 ? 7.868   -22.832 7.586   1.00 22.98  ? 315  SER A N     1 
ATOM   2518 C  CA    . SER A 1 315 ? 8.647   -21.597 7.454   1.00 23.56  ? 315  SER A CA    1 
ATOM   2519 C  C     . SER A 1 315 ? 10.149  -21.871 7.623   1.00 23.44  ? 315  SER A C     1 
ATOM   2520 O  O     . SER A 1 315 ? 10.975  -21.264 6.939   1.00 23.09  ? 315  SER A O     1 
ATOM   2521 C  CB    . SER A 1 315 ? 8.170   -20.549 8.457   1.00 23.79  ? 315  SER A CB    1 
ATOM   2522 O  OG    . SER A 1 315 ? 8.541   -20.905 9.780   1.00 25.52  ? 315  SER A OG    1 
ATOM   2523 N  N     . VAL A 1 316 ? 10.493  -22.800 8.519   1.00 23.63  ? 316  VAL A N     1 
ATOM   2524 C  CA    . VAL A 1 316 ? 11.904  -23.157 8.756   1.00 24.02  ? 316  VAL A CA    1 
ATOM   2525 C  C     . VAL A 1 316 ? 12.524  -23.649 7.458   1.00 24.10  ? 316  VAL A C     1 
ATOM   2526 O  O     . VAL A 1 316 ? 13.619  -23.225 7.086   1.00 24.14  ? 316  VAL A O     1 
ATOM   2527 C  CB    . VAL A 1 316 ? 12.075  -24.188 9.909   1.00 24.55  ? 316  VAL A CB    1 
ATOM   2528 C  CG1   . VAL A 1 316 ? 13.475  -24.837 9.904   1.00 24.70  ? 316  VAL A CG1   1 
ATOM   2529 C  CG2   . VAL A 1 316 ? 11.819  -23.525 11.246  1.00 25.60  ? 316  VAL A CG2   1 
ATOM   2530 N  N     . LYS A 1 317 ? 11.795  -24.510 6.755   1.00 23.72  ? 317  LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 317 ? 12.294  -25.119 5.540   1.00 23.96  ? 317  LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 317 ? 12.496  -24.076 4.458   1.00 24.35  ? 317  LYS A C     1 
ATOM   2533 O  O     . LYS A 1 317 ? 13.507  -24.108 3.742   1.00 24.63  ? 317  LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 317 ? 11.381  -26.261 5.071   1.00 23.48  ? 317  LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 317 ? 11.498  -27.511 5.923   1.00 22.73  ? 317  LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 317 ? 10.588  -28.652 5.428   1.00 21.17  ? 317  LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 317 ? 9.098   -28.374 5.669   1.00 21.82  ? 317  LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 317 ? 8.255   -29.438 5.035   1.00 20.77  ? 317  LYS A NZ    1 
ATOM   2539 N  N     . LEU A 1 318 ? 11.549  -23.147 4.356   1.00 23.74  ? 318  LEU A N     1 
ATOM   2540 C  CA    . LEU A 1 318 ? 11.654  -22.029 3.419   1.00 24.43  ? 318  LEU A CA    1 
ATOM   2541 C  C     . LEU A 1 318 ? 12.865  -21.136 3.703   1.00 24.54  ? 318  LEU A C     1 
ATOM   2542 O  O     . LEU A 1 318 ? 13.561  -20.713 2.768   1.00 25.05  ? 318  LEU A O     1 
ATOM   2543 C  CB    . LEU A 1 318 ? 10.344  -21.224 3.391   1.00 24.10  ? 318  LEU A CB    1 
ATOM   2544 C  CG    . LEU A 1 318 ? 9.160   -22.006 2.800   1.00 24.59  ? 318  LEU A CG    1 
ATOM   2545 C  CD1   . LEU A 1 318 ? 7.832   -21.309 3.088   1.00 26.05  ? 318  LEU A CD1   1 
ATOM   2546 C  CD2   . LEU A 1 318 ? 9.336   -22.213 1.291   1.00 22.92  ? 318  LEU A CD2   1 
ATOM   2547 N  N     . LEU A 1 319 ? 13.123  -20.866 4.979   1.00 24.72  ? 319  LEU A N     1 
ATOM   2548 C  CA    . LEU A 1 319 ? 14.320  -20.119 5.387   1.00 25.68  ? 319  LEU A CA    1 
ATOM   2549 C  C     . LEU A 1 319 ? 15.601  -20.896 5.017   1.00 26.63  ? 319  LEU A C     1 
ATOM   2550 O  O     . LEU A 1 319 ? 16.573  -20.310 4.528   1.00 25.78  ? 319  LEU A O     1 
ATOM   2551 C  CB    . LEU A 1 319 ? 14.274  -19.815 6.889   1.00 25.43  ? 319  LEU A CB    1 
ATOM   2552 C  CG    . LEU A 1 319 ? 15.510  -19.235 7.601   1.00 26.20  ? 319  LEU A CG    1 
ATOM   2553 C  CD1   . LEU A 1 319 ? 15.988  -17.925 6.987   1.00 26.71  ? 319  LEU A CD1   1 
ATOM   2554 C  CD2   . LEU A 1 319 ? 15.223  -19.040 9.074   1.00 25.36  ? 319  LEU A CD2   1 
ATOM   2555 N  N     . GLN A 1 320 ? 15.580  -22.215 5.229   1.00 26.98  ? 320  GLN A N     1 
ATOM   2556 C  CA    . GLN A 1 320 ? 16.720  -23.065 4.873   1.00 28.25  ? 320  GLN A CA    1 
ATOM   2557 C  C     . GLN A 1 320 ? 16.950  -23.059 3.365   1.00 29.29  ? 320  GLN A C     1 
ATOM   2558 O  O     . GLN A 1 320 ? 18.091  -23.153 2.906   1.00 28.93  ? 320  GLN A O     1 
ATOM   2559 C  CB    . GLN A 1 320 ? 16.483  -24.501 5.323   1.00 27.88  ? 320  GLN A CB    1 
ATOM   2560 C  CG    . GLN A 1 320 ? 16.510  -24.723 6.819   1.00 28.29  ? 320  GLN A CG    1 
ATOM   2561 C  CD    . GLN A 1 320 ? 16.247  -26.185 7.156   1.00 28.81  ? 320  GLN A CD    1 
ATOM   2562 O  OE1   . GLN A 1 320 ? 15.304  -26.784 6.639   1.00 27.30  ? 320  GLN A OE1   1 
ATOM   2563 N  NE2   . GLN A 1 320 ? 17.085  -26.764 8.010   1.00 28.89  ? 320  GLN A NE2   1 
ATOM   2564 N  N     . LYS A 1 321 ? 15.875  -22.949 2.589   1.00 29.89  ? 321  LYS A N     1 
ATOM   2565 C  CA    . LYS A 1 321 ? 16.045  -22.853 1.145   1.00 31.31  ? 321  LYS A CA    1 
ATOM   2566 C  C     . LYS A 1 321 ? 16.791  -21.577 0.782   1.00 31.99  ? 321  LYS A C     1 
ATOM   2567 O  O     . LYS A 1 321 ? 17.740  -21.612 -0.017  1.00 32.13  ? 321  LYS A O     1 
ATOM   2568 C  CB    . LYS A 1 321 ? 14.723  -22.927 0.398   1.00 31.20  ? 321  LYS A CB    1 
ATOM   2569 C  CG    . LYS A 1 321 ? 14.909  -22.864 -1.104  1.00 32.36  ? 321  LYS A CG    1 
ATOM   2570 C  CD    . LYS A 1 321 ? 13.612  -23.052 -1.857  1.00 35.02  ? 321  LYS A CD    1 
ATOM   2571 C  CE    . LYS A 1 321 ? 13.314  -24.508 -2.117  1.00 35.35  ? 321  LYS A CE    1 
ATOM   2572 N  NZ    . LYS A 1 321 ? 11.969  -24.623 -2.745  1.00 36.76  ? 321  LYS A NZ    1 
ATOM   2573 N  N     . ILE A 1 322 ? 16.373  -20.463 1.380   1.00 32.60  ? 322  ILE A N     1 
ATOM   2574 C  CA    . ILE A 1 322 ? 17.004  -19.173 1.133   1.00 33.59  ? 322  ILE A CA    1 
ATOM   2575 C  C     . ILE A 1 322 ? 18.498  -19.212 1.495   1.00 35.06  ? 322  ILE A C     1 
ATOM   2576 O  O     . ILE A 1 322 ? 19.345  -18.778 0.711   1.00 34.73  ? 322  ILE A O     1 
ATOM   2577 C  CB    . ILE A 1 322 ? 16.289  -18.032 1.890   1.00 33.48  ? 322  ILE A CB    1 
ATOM   2578 C  CG1   . ILE A 1 322 ? 14.813  -17.972 1.495   1.00 32.65  ? 322  ILE A CG1   1 
ATOM   2579 C  CG2   . ILE A 1 322 ? 16.979  -16.670 1.620   1.00 32.26  ? 322  ILE A CG2   1 
ATOM   2580 C  CD1   . ILE A 1 322 ? 13.989  -17.000 2.308   1.00 30.61  ? 322  ILE A CD1   1 
ATOM   2581 N  N     . LEU A 1 323 ? 18.792  -19.744 2.678   1.00 36.68  ? 323  LEU A N     1 
ATOM   2582 C  CA    . LEU A 1 323 ? 20.151  -19.900 3.193   1.00 39.13  ? 323  LEU A CA    1 
ATOM   2583 C  C     . LEU A 1 323 ? 21.040  -20.867 2.384   1.00 40.42  ? 323  LEU A C     1 
ATOM   2584 O  O     . LEU A 1 323 ? 22.266  -20.779 2.438   1.00 40.90  ? 323  LEU A O     1 
ATOM   2585 C  CB    . LEU A 1 323 ? 20.081  -20.364 4.654   1.00 39.14  ? 323  LEU A CB    1 
ATOM   2586 C  CG    . LEU A 1 323 ? 20.322  -19.407 5.829   1.00 39.64  ? 323  LEU A CG    1 
ATOM   2587 C  CD1   . LEU A 1 323 ? 20.395  -17.937 5.429   1.00 39.62  ? 323  LEU A CD1   1 
ATOM   2588 C  CD2   . LEU A 1 323 ? 19.304  -19.630 6.951   1.00 39.80  ? 323  LEU A CD2   1 
ATOM   2589 N  N     . GLU A 1 324 ? 20.429  -21.805 1.667   1.00 41.73  ? 324  GLU A N     1 
ATOM   2590 C  CA    . GLU A 1 324 ? 21.174  -22.682 0.778   1.00 43.47  ? 324  GLU A CA    1 
ATOM   2591 C  C     . GLU A 1 324 ? 21.323  -22.032 -0.603  1.00 44.62  ? 324  GLU A C     1 
ATOM   2592 O  O     . GLU A 1 324 ? 22.236  -22.367 -1.355  1.00 44.77  ? 324  GLU A O     1 
ATOM   2593 C  CB    . GLU A 1 324 ? 20.500  -24.058 0.673   1.00 43.39  ? 324  GLU A CB    1 
ATOM   2594 C  CG    . GLU A 1 324 ? 21.349  -25.172 0.023   1.00 44.66  ? 324  GLU A CG    1 
ATOM   2595 C  CD    . GLU A 1 324 ? 22.375  -25.813 0.970   1.00 46.42  ? 324  GLU A CD    1 
ATOM   2596 O  OE1   . GLU A 1 324 ? 23.209  -26.625 0.492   1.00 45.75  ? 324  GLU A OE1   1 
ATOM   2597 O  OE2   . GLU A 1 324 ? 22.355  -25.512 2.188   1.00 47.94  ? 324  GLU A OE2   1 
ATOM   2598 N  N     . GLU A 1 325 ? 20.438  -21.091 -0.927  1.00 46.03  ? 325  GLU A N     1 
ATOM   2599 C  CA    . GLU A 1 325 ? 20.408  -20.500 -2.270  1.00 47.30  ? 325  GLU A CA    1 
ATOM   2600 C  C     . GLU A 1 325 ? 20.892  -19.060 -2.322  1.00 48.12  ? 325  GLU A C     1 
ATOM   2601 O  O     . GLU A 1 325 ? 20.860  -18.429 -3.382  1.00 48.55  ? 325  GLU A O     1 
ATOM   2602 C  CB    . GLU A 1 325 ? 19.014  -20.632 -2.894  1.00 47.23  ? 325  GLU A CB    1 
ATOM   2603 C  CG    . GLU A 1 325 ? 18.574  -22.085 -3.022  1.00 48.05  ? 325  GLU A CG    1 
ATOM   2604 C  CD    . GLU A 1 325 ? 17.340  -22.276 -3.874  1.00 49.00  ? 325  GLU A CD    1 
ATOM   2605 O  OE1   . GLU A 1 325 ? 16.545  -21.322 -4.020  1.00 49.74  ? 325  GLU A OE1   1 
ATOM   2606 O  OE2   . GLU A 1 325 ? 17.166  -23.399 -4.396  1.00 50.00  ? 325  GLU A OE2   1 
ATOM   2607 N  N     . ASP A 1 326 ? 21.341  -18.546 -1.179  1.00 48.96  ? 326  ASP A N     1 
ATOM   2608 C  CA    . ASP A 1 326 ? 21.893  -17.199 -1.095  1.00 49.74  ? 326  ASP A CA    1 
ATOM   2609 C  C     . ASP A 1 326 ? 22.915  -17.149 0.035   1.00 50.13  ? 326  ASP A C     1 
ATOM   2610 O  O     . ASP A 1 326 ? 22.573  -17.330 1.208   1.00 50.11  ? 326  ASP A O     1 
ATOM   2611 C  CB    . ASP A 1 326 ? 20.787  -16.171 -0.872  1.00 50.00  ? 326  ASP A CB    1 
ATOM   2612 C  CG    . ASP A 1 326 ? 21.160  -14.792 -1.380  1.00 51.38  ? 326  ASP A CG    1 
ATOM   2613 O  OD1   . ASP A 1 326 ? 22.152  -14.207 -0.880  1.00 52.27  ? 326  ASP A OD1   1 
ATOM   2614 O  OD2   . ASP A 1 326 ? 20.446  -14.293 -2.278  1.00 52.64  ? 326  ASP A OD2   1 
ATOM   2615 N  N     . GLU A 1 327 ? 24.171  -16.908 -0.337  1.00 50.47  ? 327  GLU A N     1 
ATOM   2616 C  CA    . GLU A 1 327 ? 25.305  -16.931 0.600   1.00 50.68  ? 327  GLU A CA    1 
ATOM   2617 C  C     . GLU A 1 327 ? 25.447  -15.688 1.493   1.00 50.28  ? 327  GLU A C     1 
ATOM   2618 O  O     . GLU A 1 327 ? 26.152  -15.738 2.503   1.00 50.46  ? 327  GLU A O     1 
ATOM   2619 C  CB    . GLU A 1 327 ? 26.627  -17.228 -0.140  1.00 51.04  ? 327  GLU A CB    1 
ATOM   2620 C  CG    . GLU A 1 327 ? 26.638  -16.885 -1.642  1.00 52.44  ? 327  GLU A CG    1 
ATOM   2621 C  CD    . GLU A 1 327 ? 26.128  -15.479 -1.943  1.00 54.34  ? 327  GLU A CD    1 
ATOM   2622 O  OE1   . GLU A 1 327 ? 26.868  -14.504 -1.683  1.00 55.35  ? 327  GLU A OE1   1 
ATOM   2623 O  OE2   . GLU A 1 327 ? 24.981  -15.356 -2.438  1.00 55.19  ? 327  GLU A OE2   1 
ATOM   2624 N  N     . ARG A 1 328 ? 24.778  -14.592 1.125   1.00 49.86  ? 328  ARG A N     1 
ATOM   2625 C  CA    . ARG A 1 328 ? 24.821  -13.333 1.888   1.00 49.12  ? 328  ARG A CA    1 
ATOM   2626 C  C     . ARG A 1 328 ? 24.143  -13.465 3.250   1.00 48.46  ? 328  ARG A C     1 
ATOM   2627 O  O     . ARG A 1 328 ? 23.293  -14.347 3.445   1.00 48.30  ? 328  ARG A O     1 
ATOM   2628 C  CB    . ARG A 1 328 ? 24.154  -12.203 1.101   1.00 49.34  ? 328  ARG A CB    1 
ATOM   2629 C  CG    . ARG A 1 328 ? 24.885  -11.821 -0.176  1.00 50.58  ? 328  ARG A CG    1 
ATOM   2630 C  CD    . ARG A 1 328 ? 24.046  -10.904 -1.040  1.00 52.31  ? 328  ARG A CD    1 
ATOM   2631 N  NE    . ARG A 1 328 ? 22.836  -11.561 -1.531  1.00 54.05  ? 328  ARG A NE    1 
ATOM   2632 C  CZ    . ARG A 1 328 ? 21.907  -10.974 -2.283  1.00 54.32  ? 328  ARG A CZ    1 
ATOM   2633 N  NH1   . ARG A 1 328 ? 22.036  -9.706  -2.645  1.00 54.38  ? 328  ARG A NH1   1 
ATOM   2634 N  NH2   . ARG A 1 328 ? 20.843  -11.659 -2.678  1.00 54.96  ? 328  ARG A NH2   1 
ATOM   2635 N  N     . LYS A 1 329 ? 24.514  -12.584 4.180   1.00 47.03  ? 329  LYS A N     1 
ATOM   2636 C  CA    . LYS A 1 329 ? 23.922  -12.568 5.517   1.00 45.87  ? 329  LYS A CA    1 
ATOM   2637 C  C     . LYS A 1 329 ? 22.557  -11.894 5.472   1.00 44.70  ? 329  LYS A C     1 
ATOM   2638 O  O     . LYS A 1 329 ? 22.300  -11.079 4.582   1.00 44.62  ? 329  LYS A O     1 
ATOM   2639 C  CB    . LYS A 1 329 ? 24.841  -11.867 6.526   1.00 46.12  ? 329  LYS A CB    1 
ATOM   2640 C  CG    . LYS A 1 329 ? 26.200  -12.546 6.712   1.00 47.06  ? 329  LYS A CG    1 
ATOM   2641 C  CD    . LYS A 1 329 ? 26.798  -12.333 8.118   1.00 48.48  ? 329  LYS A CD    1 
ATOM   2642 C  CE    . LYS A 1 329 ? 27.516  -10.988 8.262   1.00 48.89  ? 329  LYS A CE    1 
ATOM   2643 N  NZ    . LYS A 1 329 ? 28.505  -10.992 9.388   1.00 48.89  ? 329  LYS A NZ    1 
ATOM   2644 N  N     . ILE A 1 330 ? 21.683  -12.242 6.419   1.00 43.04  ? 330  ILE A N     1 
ATOM   2645 C  CA    . ILE A 1 330 ? 20.319  -11.701 6.443   1.00 41.73  ? 330  ILE A CA    1 
ATOM   2646 C  C     . ILE A 1 330 ? 20.132  -10.633 7.523   1.00 40.57  ? 330  ILE A C     1 
ATOM   2647 O  O     . ILE A 1 330 ? 20.600  -10.785 8.652   1.00 39.95  ? 330  ILE A O     1 
ATOM   2648 C  CB    . ILE A 1 330 ? 19.244  -12.813 6.587   1.00 41.68  ? 330  ILE A CB    1 
ATOM   2649 C  CG1   . ILE A 1 330 ? 19.324  -13.790 5.410   1.00 41.80  ? 330  ILE A CG1   1 
ATOM   2650 C  CG2   . ILE A 1 330 ? 17.840  -12.209 6.641   1.00 41.96  ? 330  ILE A CG2   1 
ATOM   2651 C  CD1   . ILE A 1 330 ? 18.504  -15.055 5.592   1.00 42.69  ? 330  ILE A CD1   1 
ATOM   2652 N  N     . ARG A 1 331 ? 19.424  -9.569  7.150   1.00 39.52  ? 331  ARG A N     1 
ATOM   2653 C  CA    . ARG A 1 331 ? 19.169  -8.421  8.024   1.00 38.64  ? 331  ARG A CA    1 
ATOM   2654 C  C     . ARG A 1 331 ? 17.720  -8.389  8.502   1.00 37.26  ? 331  ARG A C     1 
ATOM   2655 O  O     . ARG A 1 331 ? 17.454  -8.086  9.672   1.00 36.96  ? 331  ARG A O     1 
ATOM   2656 C  CB    . ARG A 1 331 ? 19.509  -7.113  7.292   1.00 38.95  ? 331  ARG A CB    1 
ATOM   2657 C  CG    . ARG A 1 331 ? 19.113  -5.816  8.024   1.00 41.09  ? 331  ARG A CG    1 
ATOM   2658 C  CD    . ARG A 1 331 ? 19.267  -4.619  7.086   1.00 44.04  ? 331  ARG A CD    1 
ATOM   2659 N  NE    . ARG A 1 331 ? 18.492  -3.431  7.466   1.00 46.97  ? 331  ARG A NE    1 
ATOM   2660 C  CZ    . ARG A 1 331 ? 18.992  -2.379  8.114   1.00 47.80  ? 331  ARG A CZ    1 
ATOM   2661 N  NH1   . ARG A 1 331 ? 20.266  -2.363  8.487   1.00 47.48  ? 331  ARG A NH1   1 
ATOM   2662 N  NH2   . ARG A 1 331 ? 18.211  -1.342  8.397   1.00 48.52  ? 331  ARG A NH2   1 
ATOM   2663 N  N     . ARG A 1 332 ? 16.795  -8.665  7.582   1.00 35.50  ? 332  ARG A N     1 
ATOM   2664 C  CA    . ARG A 1 332 ? 15.372  -8.711  7.906   1.00 34.17  ? 332  ARG A CA    1 
ATOM   2665 C  C     . ARG A 1 332 ? 14.756  -10.038 7.468   1.00 32.45  ? 332  ARG A C     1 
ATOM   2666 O  O     . ARG A 1 332 ? 15.099  -10.584 6.413   1.00 32.51  ? 332  ARG A O     1 
ATOM   2667 C  CB    . ARG A 1 332 ? 14.619  -7.532  7.282   1.00 34.40  ? 332  ARG A CB    1 
ATOM   2668 C  CG    . ARG A 1 332 ? 15.327  -6.182  7.519   1.00 36.22  ? 332  ARG A CG    1 
ATOM   2669 C  CD    . ARG A 1 332 ? 14.640  -5.052  6.813   1.00 38.49  ? 332  ARG A CD    1 
ATOM   2670 N  NE    . ARG A 1 332 ? 13.380  -4.716  7.457   1.00 39.80  ? 332  ARG A NE    1 
ATOM   2671 C  CZ    . ARG A 1 332 ? 12.269  -4.392  6.806   1.00 39.59  ? 332  ARG A CZ    1 
ATOM   2672 N  NH1   . ARG A 1 332 ? 11.167  -4.100  7.484   1.00 40.59  ? 332  ARG A NH1   1 
ATOM   2673 N  NH2   . ARG A 1 332 ? 12.247  -4.379  5.481   1.00 39.86  ? 332  ARG A NH2   1 
ATOM   2674 N  N     . ILE A 1 333 ? 13.855  -10.550 8.294   1.00 30.32  ? 333  ILE A N     1 
ATOM   2675 C  CA    . ILE A 1 333 ? 13.173  -11.815 8.019   1.00 28.18  ? 333  ILE A CA    1 
ATOM   2676 C  C     . ILE A 1 333 ? 11.671  -11.621 8.197   1.00 27.04  ? 333  ILE A C     1 
ATOM   2677 O  O     . ILE A 1 333 ? 11.230  -11.023 9.177   1.00 26.48  ? 333  ILE A O     1 
ATOM   2678 C  CB    . ILE A 1 333 ? 13.689  -12.957 8.955   1.00 27.75  ? 333  ILE A CB    1 
ATOM   2679 C  CG1   . ILE A 1 333 ? 13.159  -14.333 8.512   1.00 28.06  ? 333  ILE A CG1   1 
ATOM   2680 C  CG2   . ILE A 1 333 ? 13.315  -12.690 10.416  1.00 26.71  ? 333  ILE A CG2   1 
ATOM   2681 C  CD1   . ILE A 1 333 ? 13.760  -14.861 7.199   1.00 25.28  ? 333  ILE A CD1   1 
ATOM   2682 N  N     . GLY A 1 334 ? 10.889  -12.124 7.250   1.00 26.11  ? 334  GLY A N     1 
ATOM   2683 C  CA    . GLY A 1 334 ? 9.433   -12.046 7.371   1.00 25.31  ? 334  GLY A CA    1 
ATOM   2684 C  C     . GLY A 1 334 ? 8.679   -13.264 6.869   1.00 24.55  ? 334  GLY A C     1 
ATOM   2685 O  O     . GLY A 1 334 ? 9.226   -14.084 6.128   1.00 24.01  ? 334  GLY A O     1 
ATOM   2686 N  N     . VAL A 1 335 ? 7.400   -13.344 7.236   1.00 23.90  ? 335  VAL A N     1 
ATOM   2687 C  CA    . VAL A 1 335 ? 6.515   -14.387 6.737   1.00 23.65  ? 335  VAL A CA    1 
ATOM   2688 C  C     . VAL A 1 335 ? 5.135   -13.835 6.364   1.00 23.46  ? 335  VAL A C     1 
ATOM   2689 O  O     . VAL A 1 335 ? 4.637   -12.937 7.022   1.00 22.62  ? 335  VAL A O     1 
ATOM   2690 C  CB    . VAL A 1 335 ? 6.349   -15.549 7.764   1.00 23.44  ? 335  VAL A CB    1 
ATOM   2691 C  CG1   . VAL A 1 335 ? 5.589   -15.099 8.988   1.00 23.53  ? 335  VAL A CG1   1 
ATOM   2692 C  CG2   . VAL A 1 335 ? 5.609   -16.735 7.106   1.00 22.64  ? 335  VAL A CG2   1 
ATOM   2693 N  N     . ARG A 1 336 ? 4.515   -14.410 5.331   1.00 23.02  ? 336  ARG A N     1 
ATOM   2694 C  CA    . ARG A 1 336 ? 3.196   -13.986 4.879   1.00 23.33  ? 336  ARG A CA    1 
ATOM   2695 C  C     . ARG A 1 336 ? 2.290   -15.178 4.516   1.00 22.31  ? 336  ARG A C     1 
ATOM   2696 O  O     . ARG A 1 336 ? 2.741   -16.156 3.924   1.00 21.72  ? 336  ARG A O     1 
ATOM   2697 C  CB    . ARG A 1 336 ? 3.364   -13.063 3.664   1.00 23.43  ? 336  ARG A CB    1 
ATOM   2698 C  CG    . ARG A 1 336 ? 2.074   -12.557 3.025   1.00 28.40  ? 336  ARG A CG    1 
ATOM   2699 C  CD    . ARG A 1 336 ? 2.367   -11.299 2.179   1.00 29.62  ? 336  ARG A CD    1 
ATOM   2700 N  NE    . ARG A 1 336 ? 3.090   -11.614 0.936   1.00 30.81  ? 336  ARG A NE    1 
ATOM   2701 C  CZ    . ARG A 1 336 ? 3.574   -10.687 0.102   1.00 32.31  ? 336  ARG A CZ    1 
ATOM   2702 N  NH1   . ARG A 1 336 ? 3.420   -9.398  0.389   1.00 27.66  ? 336  ARG A NH1   1 
ATOM   2703 N  NH2   . ARG A 1 336 ? 4.207   -11.045 -1.022  1.00 31.67  ? 336  ARG A NH2   1 
ATOM   2704 N  N     . PHE A 1 337 ? 1.010   -15.037 4.838   1.00 21.79  ? 337  PHE A N     1 
ATOM   2705 C  CA    . PHE A 1 337 ? -0.013  -16.052 4.576   1.00 21.46  ? 337  PHE A CA    1 
ATOM   2706 C  C     . PHE A 1 337 ? -1.021  -15.533 3.596   1.00 21.67  ? 337  PHE A C     1 
ATOM   2707 O  O     . PHE A 1 337 ? -1.378  -14.356 3.646   1.00 21.54  ? 337  PHE A O     1 
ATOM   2708 C  CB    . PHE A 1 337 ? -0.647  -16.456 5.905   1.00 20.52  ? 337  PHE A CB    1 
ATOM   2709 C  CG    . PHE A 1 337 ? 0.362   -17.045 6.833   1.00 22.76  ? 337  PHE A CG    1 
ATOM   2710 C  CD1   . PHE A 1 337 ? 0.742   -18.380 6.692   1.00 21.03  ? 337  PHE A CD1   1 
ATOM   2711 C  CD2   . PHE A 1 337 ? 1.021   -16.245 7.774   1.00 23.85  ? 337  PHE A CD2   1 
ATOM   2712 C  CE1   . PHE A 1 337 ? 1.735   -18.923 7.511   1.00 22.67  ? 337  PHE A CE1   1 
ATOM   2713 C  CE2   . PHE A 1 337 ? 2.015   -16.777 8.595   1.00 23.87  ? 337  PHE A CE2   1 
ATOM   2714 C  CZ    . PHE A 1 337 ? 2.371   -18.120 8.465   1.00 24.14  ? 337  PHE A CZ    1 
ATOM   2715 N  N     . SER A 1 338 ? -1.446  -16.398 2.676   1.00 22.20  ? 338  SER A N     1 
ATOM   2716 C  CA    . SER A 1 338 ? -2.359  -15.994 1.615   1.00 22.46  ? 338  SER A CA    1 
ATOM   2717 C  C     . SER A 1 338 ? -3.194  -17.176 1.141   1.00 22.71  ? 338  SER A C     1 
ATOM   2718 O  O     . SER A 1 338 ? -3.114  -18.271 1.730   1.00 21.54  ? 338  SER A O     1 
ATOM   2719 C  CB    . SER A 1 338 ? -1.565  -15.359 0.456   1.00 23.09  ? 338  SER A CB    1 
ATOM   2720 O  OG    . SER A 1 338 ? -0.579  -16.264 -0.007  1.00 24.06  ? 338  SER A OG    1 
ATOM   2721 N  N     . LYS A 1 339 ? -4.003  -16.948 0.094   1.00 23.34  ? 339  LYS A N     1 
ATOM   2722 C  CA    . LYS A 1 339 ? -4.904  -17.959 -0.485  1.00 24.42  ? 339  LYS A CA    1 
ATOM   2723 C  C     . LYS A 1 339 ? -5.831  -18.528 0.595   1.00 25.08  ? 339  LYS A C     1 
ATOM   2724 O  O     . LYS A 1 339 ? -5.805  -19.734 0.899   1.00 23.95  ? 339  LYS A O     1 
ATOM   2725 C  CB    . LYS A 1 339 ? -4.122  -19.084 -1.187  1.00 25.07  ? 339  LYS A CB    1 
ATOM   2726 C  CG    . LYS A 1 339 ? -3.315  -18.626 -2.416  1.00 28.52  ? 339  LYS A CG    1 
ATOM   2727 C  CD    . LYS A 1 339 ? -2.196  -19.634 -2.753  1.00 32.90  ? 339  LYS A CD    1 
ATOM   2728 C  CE    . LYS A 1 339 ? -1.456  -19.329 -4.095  1.00 35.60  ? 339  LYS A CE    1 
ATOM   2729 N  NZ    . LYS A 1 339 ? 0.078   -19.481 -4.034  1.00 34.82  ? 339  LYS A NZ    1 
ATOM   2730 N  N     . PHE A 1 340 ? -6.646  -17.653 1.178   1.00 25.71  ? 340  PHE A N     1 
ATOM   2731 C  CA    . PHE A 1 340 ? -7.469  -18.036 2.318   1.00 26.95  ? 340  PHE A CA    1 
ATOM   2732 C  C     . PHE A 1 340 ? -8.607  -18.940 1.866   1.00 28.20  ? 340  PHE A C     1 
ATOM   2733 O  O     . PHE A 1 340 ? -9.035  -18.874 0.721   1.00 28.85  ? 340  PHE A O     1 
ATOM   2734 C  CB    . PHE A 1 340 ? -8.035  -16.806 3.041   1.00 26.91  ? 340  PHE A CB    1 
ATOM   2735 C  CG    . PHE A 1 340 ? -6.999  -15.812 3.484   1.00 26.66  ? 340  PHE A CG    1 
ATOM   2736 C  CD1   . PHE A 1 340 ? -5.713  -16.212 3.848   1.00 27.24  ? 340  PHE A CD1   1 
ATOM   2737 C  CD2   . PHE A 1 340 ? -7.324  -14.466 3.590   1.00 27.56  ? 340  PHE A CD2   1 
ATOM   2738 C  CE1   . PHE A 1 340 ? -4.760  -15.286 4.268   1.00 26.33  ? 340  PHE A CE1   1 
ATOM   2739 C  CE2   . PHE A 1 340 ? -6.368  -13.543 4.018   1.00 28.77  ? 340  PHE A CE2   1 
ATOM   2740 C  CZ    . PHE A 1 340 ? -5.086  -13.962 4.354   1.00 26.84  ? 340  PHE A CZ    1 
ATOM   2741 N  N     . ILE A 1 341 ? -9.082  -19.799 2.756   1.00 28.93  ? 341  ILE A N     1 
ATOM   2742 C  CA    . ILE A 1 341 ? -10.239 -20.631 2.442   1.00 30.29  ? 341  ILE A CA    1 
ATOM   2743 C  C     . ILE A 1 341 ? -11.508 -19.790 2.566   1.00 31.22  ? 341  ILE A C     1 
ATOM   2744 O  O     . ILE A 1 341 ? -11.684 -19.065 3.553   1.00 31.46  ? 341  ILE A O     1 
ATOM   2745 C  CB    . ILE A 1 341 ? -10.301 -21.895 3.330   1.00 29.91  ? 341  ILE A CB    1 
ATOM   2746 C  CG1   . ILE A 1 341 ? -9.068  -22.757 3.066   1.00 28.97  ? 341  ILE A CG1   1 
ATOM   2747 C  CG2   . ILE A 1 341 ? -11.599 -22.693 3.063   1.00 30.39  ? 341  ILE A CG2   1 
ATOM   2748 C  CD1   . ILE A 1 341 ? -8.883  -23.916 4.007   1.00 29.20  ? 341  ILE A CD1   1 
ATOM   2749 O  OXT   . ILE A 1 341 ? -12.363 -19.808 1.663   1.00 32.38  ? 341  ILE A OXT   1 
ATOM   2750 O  "O5'" . DT  B 2 1   ? -2.814  -25.208 -29.709 1.00 84.46  ? 803  DT  D "O5'" 1 
ATOM   2751 C  "C5'" . DT  B 2 1   ? -2.194  -24.133 -29.019 1.00 84.71  ? 803  DT  D "C5'" 1 
ATOM   2752 C  "C4'" . DT  B 2 1   ? -2.044  -24.465 -27.543 1.00 84.94  ? 803  DT  D "C4'" 1 
ATOM   2753 O  "O4'" . DT  B 2 1   ? -0.933  -25.382 -27.362 1.00 85.28  ? 803  DT  D "O4'" 1 
ATOM   2754 C  "C3'" . DT  B 2 1   ? -1.767  -23.273 -26.625 1.00 84.87  ? 803  DT  D "C3'" 1 
ATOM   2755 O  "O3'" . DT  B 2 1   ? -2.619  -23.326 -25.480 1.00 84.40  ? 803  DT  D "O3'" 1 
ATOM   2756 C  "C2'" . DT  B 2 1   ? -0.304  -23.458 -26.222 1.00 85.07  ? 803  DT  D "C2'" 1 
ATOM   2757 C  "C1'" . DT  B 2 1   ? -0.211  -24.980 -26.212 1.00 85.37  ? 803  DT  D "C1'" 1 
ATOM   2758 N  N1    . DT  B 2 1   ? 1.186   -25.551 -26.232 1.00 85.61  ? 803  DT  D N1    1 
ATOM   2759 C  C2    . DT  B 2 1   ? 1.668   -26.198 -25.103 1.00 85.62  ? 803  DT  D C2    1 
ATOM   2760 O  O2    . DT  B 2 1   ? 1.032   -26.340 -24.071 1.00 85.42  ? 803  DT  D O2    1 
ATOM   2761 N  N3    . DT  B 2 1   ? 2.950   -26.685 -25.225 1.00 85.74  ? 803  DT  D N3    1 
ATOM   2762 C  C4    . DT  B 2 1   ? 3.781   -26.597 -26.334 1.00 85.85  ? 803  DT  D C4    1 
ATOM   2763 O  O4    . DT  B 2 1   ? 4.914   -27.072 -26.329 1.00 85.82  ? 803  DT  D O4    1 
ATOM   2764 C  C5    . DT  B 2 1   ? 3.218   -25.913 -27.481 1.00 85.84  ? 803  DT  D C5    1 
ATOM   2765 C  C7    . DT  B 2 1   ? 4.013   -25.749 -28.746 1.00 85.75  ? 803  DT  D C7    1 
ATOM   2766 C  C6    . DT  B 2 1   ? 1.967   -25.432 -27.374 1.00 85.77  ? 803  DT  D C6    1 
ATOM   2767 P  P     . DT  B 2 2   ? -3.994  -22.502 -25.404 1.00 83.99  ? 804  DT  D P     1 
ATOM   2768 O  OP1   . DT  B 2 2   ? -4.777  -22.791 -26.629 1.00 84.12  ? 804  DT  D OP1   1 
ATOM   2769 O  OP2   . DT  B 2 2   ? -3.667  -21.102 -25.045 1.00 84.02  ? 804  DT  D OP2   1 
ATOM   2770 O  "O5'" . DT  B 2 2   ? -4.757  -23.158 -24.154 1.00 82.91  ? 804  DT  D "O5'" 1 
ATOM   2771 C  "C5'" . DT  B 2 2   ? -4.129  -24.124 -23.310 1.00 80.90  ? 804  DT  D "C5'" 1 
ATOM   2772 C  "C4'" . DT  B 2 2   ? -3.803  -23.557 -21.934 1.00 79.57  ? 804  DT  D "C4'" 1 
ATOM   2773 O  "O4'" . DT  B 2 2   ? -2.537  -24.098 -21.485 1.00 79.38  ? 804  DT  D "O4'" 1 
ATOM   2774 C  "C3'" . DT  B 2 2   ? -3.686  -22.033 -21.810 1.00 78.64  ? 804  DT  D "C3'" 1 
ATOM   2775 O  "O3'" . DT  B 2 2   ? -4.262  -21.508 -20.596 1.00 77.47  ? 804  DT  D "O3'" 1 
ATOM   2776 C  "C2'" . DT  B 2 2   ? -2.177  -21.799 -21.844 1.00 78.42  ? 804  DT  D "C2'" 1 
ATOM   2777 C  "C1'" . DT  B 2 2   ? -1.653  -23.051 -21.142 1.00 78.42  ? 804  DT  D "C1'" 1 
ATOM   2778 N  N1    . DT  B 2 2   ? -0.257  -23.486 -21.513 1.00 78.07  ? 804  DT  D N1    1 
ATOM   2779 C  C2    . DT  B 2 2   ? 0.307   -24.585 -20.878 1.00 77.52  ? 804  DT  D C2    1 
ATOM   2780 O  O2    . DT  B 2 2   ? -0.255  -25.243 -20.016 1.00 76.74  ? 804  DT  D O2    1 
ATOM   2781 N  N3    . DT  B 2 2   ? 1.583   -24.891 -21.292 1.00 77.50  ? 804  DT  D N3    1 
ATOM   2782 C  C4    . DT  B 2 2   ? 2.337   -24.231 -22.253 1.00 77.69  ? 804  DT  D C4    1 
ATOM   2783 O  O4    . DT  B 2 2   ? 3.472   -24.596 -22.548 1.00 77.59  ? 804  DT  D O4    1 
ATOM   2784 C  C5    . DT  B 2 2   ? 1.693   -23.097 -22.881 1.00 77.84  ? 804  DT  D C5    1 
ATOM   2785 C  C7    . DT  B 2 2   ? 2.399   -22.295 -23.937 1.00 77.66  ? 804  DT  D C7    1 
ATOM   2786 C  C6    . DT  B 2 2   ? 0.447   -22.787 -22.485 1.00 78.08  ? 804  DT  D C6    1 
ATOM   2787 P  P     . DG  B 2 3   ? -5.574  -22.095 -19.873 1.00 76.55  ? 805  DG  D P     1 
ATOM   2788 O  OP1   . DG  B 2 3   ? -6.478  -22.688 -20.888 1.00 76.67  ? 805  DG  D OP1   1 
ATOM   2789 O  OP2   . DG  B 2 3   ? -6.103  -21.020 -18.998 1.00 76.62  ? 805  DG  D OP2   1 
ATOM   2790 O  "O5'" . DG  B 2 3   ? -4.945  -23.283 -18.990 1.00 74.66  ? 805  DG  D "O5'" 1 
ATOM   2791 C  "C5'" . DG  B 2 3   ? -5.409  -23.613 -17.682 1.00 71.71  ? 805  DG  D "C5'" 1 
ATOM   2792 C  "C4'" . DG  B 2 3   ? -4.471  -23.091 -16.600 1.00 69.48  ? 805  DG  D "C4'" 1 
ATOM   2793 O  "O4'" . DG  B 2 3   ? -3.088  -23.067 -17.041 1.00 68.75  ? 805  DG  D "O4'" 1 
ATOM   2794 C  "C3'" . DG  B 2 3   ? -4.774  -21.679 -16.106 1.00 68.08  ? 805  DG  D "C3'" 1 
ATOM   2795 O  "O3'" . DG  B 2 3   ? -4.684  -21.676 -14.695 1.00 66.92  ? 805  DG  D "O3'" 1 
ATOM   2796 C  "C2'" . DG  B 2 3   ? -3.674  -20.826 -16.729 1.00 67.69  ? 805  DG  D "C2'" 1 
ATOM   2797 C  "C1'" . DG  B 2 3   ? -2.520  -21.820 -16.696 1.00 67.57  ? 805  DG  D "C1'" 1 
ATOM   2798 N  N9    . DG  B 2 3   ? -1.415  -21.543 -17.612 1.00 66.89  ? 805  DG  D N9    1 
ATOM   2799 C  C8    . DG  B 2 3   ? -1.315  -20.549 -18.562 1.00 66.75  ? 805  DG  D C8    1 
ATOM   2800 N  N7    . DG  B 2 3   ? -0.188  -20.574 -19.225 1.00 66.51  ? 805  DG  D N7    1 
ATOM   2801 C  C5    . DG  B 2 3   ? 0.513   -21.653 -18.685 1.00 66.23  ? 805  DG  D C5    1 
ATOM   2802 C  C6    . DG  B 2 3   ? 1.803   -22.183 -18.995 1.00 65.71  ? 805  DG  D C6    1 
ATOM   2803 O  O6    . DG  B 2 3   ? 2.626   -21.797 -19.842 1.00 65.13  ? 805  DG  D O6    1 
ATOM   2804 N  N1    . DG  B 2 3   ? 2.119   -23.288 -18.199 1.00 65.31  ? 805  DG  D N1    1 
ATOM   2805 C  C2    . DG  B 2 3   ? 1.295   -23.814 -17.227 1.00 65.41  ? 805  DG  D C2    1 
ATOM   2806 N  N2    . DG  B 2 3   ? 1.766   -24.875 -16.561 1.00 64.89  ? 805  DG  D N2    1 
ATOM   2807 N  N3    . DG  B 2 3   ? 0.090   -23.333 -16.926 1.00 65.57  ? 805  DG  D N3    1 
ATOM   2808 C  C4    . DG  B 2 3   ? -0.239  -22.258 -17.691 1.00 66.36  ? 805  DG  D C4    1 
ATOM   2809 P  P     . DG  B 2 4   ? -5.972  -21.940 -13.777 1.00 66.25  ? 806  DG  D P     1 
ATOM   2810 O  OP1   . DG  B 2 4   ? -6.951  -22.741 -14.554 1.00 65.60  ? 806  DG  D OP1   1 
ATOM   2811 O  OP2   . DG  B 2 4   ? -6.363  -20.627 -13.198 1.00 65.88  ? 806  DG  D OP2   1 
ATOM   2812 O  "O5'" . DG  B 2 4   ? -5.390  -22.858 -12.589 1.00 62.94  ? 806  DG  D "O5'" 1 
ATOM   2813 C  "C5'" . DG  B 2 4   ? -5.054  -22.289 -11.317 1.00 56.68  ? 806  DG  D "C5'" 1 
ATOM   2814 C  "C4'" . DG  B 2 4   ? -3.757  -22.866 -10.761 1.00 52.36  ? 806  DG  D "C4'" 1 
ATOM   2815 O  "O4'" . DG  B 2 4   ? -2.724  -22.968 -11.784 1.00 50.45  ? 806  DG  D "O4'" 1 
ATOM   2816 C  "C3'" . DG  B 2 4   ? -3.145  -22.047 -9.632  1.00 49.78  ? 806  DG  D "C3'" 1 
ATOM   2817 O  "O3'" . DG  B 2 4   ? -2.524  -22.917 -8.702  1.00 47.27  ? 806  DG  D "O3'" 1 
ATOM   2818 C  "C2'" . DG  B 2 4   ? -2.111  -21.195 -10.350 1.00 48.82  ? 806  DG  D "C2'" 1 
ATOM   2819 C  "C1'" . DG  B 2 4   ? -1.632  -22.130 -11.454 1.00 48.49  ? 806  DG  D "C1'" 1 
ATOM   2820 N  N9    . DG  B 2 4   ? -1.210  -21.389 -12.640 1.00 46.51  ? 806  DG  D N9    1 
ATOM   2821 C  C8    . DG  B 2 4   ? -1.934  -20.427 -13.301 1.00 45.86  ? 806  DG  D C8    1 
ATOM   2822 N  N7    . DG  B 2 4   ? -1.312  -19.917 -14.325 1.00 45.32  ? 806  DG  D N7    1 
ATOM   2823 C  C5    . DG  B 2 4   ? -0.096  -20.584 -14.350 1.00 44.39  ? 806  DG  D C5    1 
ATOM   2824 C  C6    . DG  B 2 4   ? 0.996   -20.446 -15.241 1.00 43.26  ? 806  DG  D C6    1 
ATOM   2825 O  O6    . DG  B 2 4   ? 1.084   -19.687 -16.215 1.00 43.24  ? 806  DG  D O6    1 
ATOM   2826 N  N1    . DG  B 2 4   ? 2.051   -21.301 -14.924 1.00 42.09  ? 806  DG  D N1    1 
ATOM   2827 C  C2    . DG  B 2 4   ? 2.044   -22.183 -13.865 1.00 42.09  ? 806  DG  D C2    1 
ATOM   2828 N  N2    . DG  B 2 4   ? 3.145   -22.926 -13.700 1.00 41.11  ? 806  DG  D N2    1 
ATOM   2829 N  N3    . DG  B 2 4   ? 1.027   -22.321 -13.018 1.00 43.49  ? 806  DG  D N3    1 
ATOM   2830 C  C4    . DG  B 2 4   ? -0.011  -21.493 -13.316 1.00 45.03  ? 806  DG  D C4    1 
ATOM   2831 P  P     . DA  B 2 5   ? -2.236  -22.490 -7.181  1.00 44.45  ? 807  DA  D P     1 
ATOM   2832 O  OP1   . DA  B 2 5   ? -2.923  -23.503 -6.345  1.00 45.78  ? 807  DA  D OP1   1 
ATOM   2833 O  OP2   . DA  B 2 5   ? -2.533  -21.054 -6.992  1.00 45.18  ? 807  DA  D OP2   1 
ATOM   2834 O  "O5'" . DA  B 2 5   ? -0.651  -22.698 -7.052  1.00 42.32  ? 807  DA  D "O5'" 1 
ATOM   2835 C  "C5'" . DA  B 2 5   ? 0.016   -23.809 -7.683  1.00 38.19  ? 807  DA  D "C5'" 1 
ATOM   2836 C  "C4'" . DA  B 2 5   ? 1.492   -23.510 -7.908  1.00 34.90  ? 807  DA  D "C4'" 1 
ATOM   2837 O  "O4'" . DA  B 2 5   ? 1.678   -22.769 -9.138  1.00 33.59  ? 807  DA  D "O4'" 1 
ATOM   2838 C  "C3'" . DA  B 2 5   ? 2.163   -22.668 -6.828  1.00 33.82  ? 807  DA  D "C3'" 1 
ATOM   2839 O  "O3'" . DA  B 2 5   ? 3.397   -23.290 -6.601  1.00 32.55  ? 807  DA  D "O3'" 1 
ATOM   2840 C  "C2'" . DA  B 2 5   ? 2.325   -21.287 -7.466  1.00 33.13  ? 807  DA  D "C2'" 1 
ATOM   2841 C  "C1'" . DA  B 2 5   ? 2.551   -21.672 -8.928  1.00 32.67  ? 807  DA  D "C1'" 1 
ATOM   2842 N  N9    . DA  B 2 5   ? 2.190   -20.660 -9.925  1.00 32.29  ? 807  DA  D N9    1 
ATOM   2843 C  C8    . DA  B 2 5   ? 0.989   -20.005 -10.002 1.00 31.85  ? 807  DA  D C8    1 
ATOM   2844 N  N7    . DA  B 2 5   ? 0.904   -19.157 -10.995 1.00 31.94  ? 807  DA  D N7    1 
ATOM   2845 C  C5    . DA  B 2 5   ? 2.136   -19.259 -11.634 1.00 31.48  ? 807  DA  D C5    1 
ATOM   2846 C  C6    . DA  B 2 5   ? 2.692   -18.612 -12.767 1.00 30.37  ? 807  DA  D C6    1 
ATOM   2847 N  N6    . DA  B 2 5   ? 2.036   -17.701 -13.489 1.00 29.78  ? 807  DA  D N6    1 
ATOM   2848 N  N1    . DA  B 2 5   ? 3.953   -18.933 -13.136 1.00 30.11  ? 807  DA  D N1    1 
ATOM   2849 C  C2    . DA  B 2 5   ? 4.624   -19.839 -12.418 1.00 29.11  ? 807  DA  D C2    1 
ATOM   2850 N  N3    . DA  B 2 5   ? 4.206   -20.506 -11.338 1.00 31.37  ? 807  DA  D N3    1 
ATOM   2851 C  C4    . DA  B 2 5   ? 2.945   -20.180 -10.986 1.00 31.40  ? 807  DA  D C4    1 
ATOM   2852 P  P     . DT  B 2 6   ? 4.362   -22.877 -5.403  1.00 32.87  ? 808  DT  D P     1 
ATOM   2853 O  OP1   . DT  B 2 6   ? 5.144   -24.116 -5.134  1.00 33.25  ? 808  DT  D OP1   1 
ATOM   2854 O  OP2   . DT  B 2 6   ? 3.651   -22.146 -4.333  1.00 30.74  ? 808  DT  D OP2   1 
ATOM   2855 O  "O5'" . DT  B 2 6   ? 5.342   -21.821 -6.105  1.00 31.02  ? 808  DT  D "O5'" 1 
ATOM   2856 C  "C5'" . DT  B 2 6   ? 6.078   -22.197 -7.270  1.00 27.98  ? 808  DT  D "C5'" 1 
ATOM   2857 C  "C4'" . DT  B 2 6   ? 6.973   -21.043 -7.664  1.00 27.58  ? 808  DT  D "C4'" 1 
ATOM   2858 O  "O4'" . DT  B 2 6   ? 6.234   -20.197 -8.568  1.00 27.08  ? 808  DT  D "O4'" 1 
ATOM   2859 C  "C3'" . DT  B 2 6   ? 7.392   -20.130 -6.514  1.00 25.48  ? 808  DT  D "C3'" 1 
ATOM   2860 O  "O3'" . DT  B 2 6   ? 8.772   -20.323 -6.266  1.00 24.51  ? 808  DT  D "O3'" 1 
ATOM   2861 C  "C2'" . DT  B 2 6   ? 7.075   -18.703 -6.979  1.00 26.53  ? 808  DT  D "C2'" 1 
ATOM   2862 C  "C1'" . DT  B 2 6   ? 6.728   -18.890 -8.449  1.00 26.49  ? 808  DT  D "C1'" 1 
ATOM   2863 N  N1    . DT  B 2 6   ? 5.631   -18.083 -8.985  1.00 27.47  ? 808  DT  D N1    1 
ATOM   2864 C  C2    . DT  B 2 6   ? 5.852   -17.436 -10.182 1.00 27.35  ? 808  DT  D C2    1 
ATOM   2865 O  O2    . DT  B 2 6   ? 6.907   -17.501 -10.772 1.00 28.22  ? 808  DT  D O2    1 
ATOM   2866 N  N3    . DT  B 2 6   ? 4.794   -16.704 -10.652 1.00 26.11  ? 808  DT  D N3    1 
ATOM   2867 C  C4    . DT  B 2 6   ? 3.556   -16.575 -10.046 1.00 26.97  ? 808  DT  D C4    1 
ATOM   2868 O  O4    . DT  B 2 6   ? 2.685   -15.893 -10.567 1.00 26.69  ? 808  DT  D O4    1 
ATOM   2869 C  C5    . DT  B 2 6   ? 3.379   -17.278 -8.779  1.00 27.30  ? 808  DT  D C5    1 
ATOM   2870 C  C7    . DT  B 2 6   ? 2.084   -17.216 -8.011  1.00 26.69  ? 808  DT  D C7    1 
ATOM   2871 C  C6    . DT  B 2 6   ? 4.415   -17.997 -8.315  1.00 27.49  ? 808  DT  D C6    1 
ATOM   2872 P  P     . DG  B 2 7   ? 9.489   -19.734 -4.959  1.00 26.78  ? 809  DG  D P     1 
ATOM   2873 O  OP1   . DG  B 2 7   ? 10.600  -20.633 -4.618  1.00 27.83  ? 809  DG  D OP1   1 
ATOM   2874 O  OP2   . DG  B 2 7   ? 8.445   -19.457 -3.962  1.00 26.05  ? 809  DG  D OP2   1 
ATOM   2875 O  "O5'" . DG  B 2 7   ? 10.071  -18.313 -5.428  1.00 29.17  ? 809  DG  D "O5'" 1 
ATOM   2876 C  "C5'" . DG  B 2 7   ? 11.135  -18.217 -6.391  1.00 29.23  ? 809  DG  D "C5'" 1 
ATOM   2877 C  "C4'" . DG  B 2 7   ? 11.211  -16.815 -6.986  1.00 28.79  ? 809  DG  D "C4'" 1 
ATOM   2878 O  "O4'" . DG  B 2 7   ? 9.962   -16.471 -7.647  1.00 28.76  ? 809  DG  D "O4'" 1 
ATOM   2879 C  "C3'" . DG  B 2 7   ? 11.482  -15.688 -5.998  1.00 30.05  ? 809  DG  D "C3'" 1 
ATOM   2880 O  "O3'" . DG  B 2 7   ? 12.490  -14.860 -6.559  1.00 32.32  ? 809  DG  D "O3'" 1 
ATOM   2881 C  "C2'" . DG  B 2 7   ? 10.163  -14.929 -5.892  1.00 29.93  ? 809  DG  D "C2'" 1 
ATOM   2882 C  "C1'" . DG  B 2 7   ? 9.584   -15.166 -7.279  1.00 29.11  ? 809  DG  D "C1'" 1 
ATOM   2883 N  N9    . DG  B 2 7   ? 8.132   -14.972 -7.375  1.00 27.95  ? 809  DG  D N9    1 
ATOM   2884 C  C8    . DG  B 2 7   ? 7.140   -15.351 -6.496  1.00 26.39  ? 809  DG  D C8    1 
ATOM   2885 N  N7    . DG  B 2 7   ? 5.941   -14.996 -6.879  1.00 24.85  ? 809  DG  D N7    1 
ATOM   2886 C  C5    . DG  B 2 7   ? 6.150   -14.346 -8.085  1.00 25.82  ? 809  DG  D C5    1 
ATOM   2887 C  C6    . DG  B 2 7   ? 5.229   -13.743 -8.979  1.00 24.23  ? 809  DG  D C6    1 
ATOM   2888 O  O6    . DG  B 2 7   ? 4.004   -13.679 -8.852  1.00 23.11  ? 809  DG  D O6    1 
ATOM   2889 N  N1    . DG  B 2 7   ? 5.854   -13.187 -10.099 1.00 23.22  ? 809  DG  D N1    1 
ATOM   2890 C  C2    . DG  B 2 7   ? 7.213   -13.210 -10.324 1.00 24.64  ? 809  DG  D C2    1 
ATOM   2891 N  N2    . DG  B 2 7   ? 7.651   -12.630 -11.448 1.00 24.74  ? 809  DG  D N2    1 
ATOM   2892 N  N3    . DG  B 2 7   ? 8.089   -13.776 -9.505  1.00 24.57  ? 809  DG  D N3    1 
ATOM   2893 C  C4    . DG  B 2 7   ? 7.492   -14.318 -8.406  1.00 26.69  ? 809  DG  D C4    1 
ATOM   2894 P  P     . DG  B 2 8   ? 13.345  -13.833 -5.692  1.00 33.22  ? 810  DG  D P     1 
ATOM   2895 O  OP1   . DG  B 2 8   ? 14.734  -14.314 -5.694  1.00 34.96  ? 810  DG  D OP1   1 
ATOM   2896 O  OP2   . DG  B 2 8   ? 12.670  -13.514 -4.420  1.00 33.91  ? 810  DG  D OP2   1 
ATOM   2897 O  "O5'" . DG  B 2 8   ? 13.252  -12.492 -6.556  1.00 35.18  ? 810  DG  D "O5'" 1 
ATOM   2898 C  "C5'" . DG  B 2 8   ? 13.368  -12.519 -7.991  1.00 35.15  ? 810  DG  D "C5'" 1 
ATOM   2899 C  "C4'" . DG  B 2 8   ? 12.485  -11.444 -8.610  1.00 34.46  ? 810  DG  D "C4'" 1 
ATOM   2900 O  "O4'" . DG  B 2 8   ? 11.085  -11.823 -8.521  1.00 34.35  ? 810  DG  D "O4'" 1 
ATOM   2901 C  "C3'" . DG  B 2 8   ? 12.573  -10.069 -7.952  1.00 34.22  ? 810  DG  D "C3'" 1 
ATOM   2902 O  "O3'" . DG  B 2 8   ? 13.273  -9.219  -8.828  1.00 35.32  ? 810  DG  D "O3'" 1 
ATOM   2903 C  "C2'" . DG  B 2 8   ? 11.128  -9.606  -7.799  1.00 32.96  ? 810  DG  D "C2'" 1 
ATOM   2904 C  "C1'" . DG  B 2 8   ? 10.322  -10.643 -8.571  1.00 32.04  ? 810  DG  D "C1'" 1 
ATOM   2905 N  N9    . DG  B 2 8   ? 9.030   -10.865 -7.935  1.00 29.40  ? 810  DG  D N9    1 
ATOM   2906 C  C8    . DG  B 2 8   ? 8.768   -11.586 -6.797  1.00 28.45  ? 810  DG  D C8    1 
ATOM   2907 N  N7    . DG  B 2 8   ? 7.505   -11.586 -6.469  1.00 27.12  ? 810  DG  D N7    1 
ATOM   2908 C  C5    . DG  B 2 8   ? 6.892   -10.818 -7.443  1.00 26.48  ? 810  DG  D C5    1 
ATOM   2909 C  C6    . DG  B 2 8   ? 5.531   -10.460 -7.608  1.00 25.92  ? 810  DG  D C6    1 
ATOM   2910 O  O6    . DG  B 2 8   ? 4.580   -10.768 -6.892  1.00 23.90  ? 810  DG  D O6    1 
ATOM   2911 N  N1    . DG  B 2 8   ? 5.317   -9.662  -8.730  1.00 25.74  ? 810  DG  D N1    1 
ATOM   2912 C  C2    . DG  B 2 8   ? 6.316   -9.255  -9.582  1.00 26.89  ? 810  DG  D C2    1 
ATOM   2913 N  N2    . DG  B 2 8   ? 5.945   -8.475  -10.601 1.00 26.87  ? 810  DG  D N2    1 
ATOM   2914 N  N3    . DG  B 2 8   ? 7.596   -9.575  -9.436  1.00 26.59  ? 810  DG  D N3    1 
ATOM   2915 C  C4    . DG  B 2 8   ? 7.815   -10.361 -8.352  1.00 27.85  ? 810  DG  D C4    1 
ATOM   2916 P  P     . DT  B 2 9   ? 13.417  -7.637  -8.616  1.00 35.08  ? 811  DT  D P     1 
ATOM   2917 O  OP1   . DT  B 2 9   ? 14.533  -7.342  -9.535  1.00 36.68  ? 811  DT  D OP1   1 
ATOM   2918 O  OP2   . DT  B 2 9   ? 13.423  -7.264  -7.186  1.00 34.21  ? 811  DT  D OP2   1 
ATOM   2919 O  "O5'" . DT  B 2 9   ? 12.063  -6.989  -9.173  1.00 34.61  ? 811  DT  D "O5'" 1 
ATOM   2920 C  "C5'" . DT  B 2 9   ? 11.696  -7.059  -10.552 1.00 31.42  ? 811  DT  D "C5'" 1 
ATOM   2921 C  "C4'" . DT  B 2 9   ? 10.634  -6.007  -10.819 1.00 29.94  ? 811  DT  D "C4'" 1 
ATOM   2922 O  "O4'" . DT  B 2 9   ? 9.376   -6.412  -10.229 1.00 29.37  ? 811  DT  D "O4'" 1 
ATOM   2923 C  "C3'" . DT  B 2 9   ? 10.901  -4.605  -10.269 1.00 30.37  ? 811  DT  D "C3'" 1 
ATOM   2924 O  "O3'" . DT  B 2 9   ? 10.424  -3.734  -11.258 1.00 30.34  ? 811  DT  D "O3'" 1 
ATOM   2925 C  "C2'" . DT  B 2 9   ? 10.029  -4.513  -9.011  1.00 29.43  ? 811  DT  D "C2'" 1 
ATOM   2926 C  "C1'" . DT  B 2 9   ? 8.833   -5.347  -9.465  1.00 29.36  ? 811  DT  D "C1'" 1 
ATOM   2927 N  N1    . DT  B 2 9   ? 8.006   -5.986  -8.405  1.00 27.71  ? 811  DT  D N1    1 
ATOM   2928 C  C2    . DT  B 2 9   ? 6.633   -5.838  -8.433  1.00 26.25  ? 811  DT  D C2    1 
ATOM   2929 O  O2    . DT  B 2 9   ? 6.037   -5.196  -9.278  1.00 26.28  ? 811  DT  D O2    1 
ATOM   2930 N  N3    . DT  B 2 9   ? 5.971   -6.483  -7.419  1.00 26.16  ? 811  DT  D N3    1 
ATOM   2931 C  C4    . DT  B 2 9   ? 6.546   -7.233  -6.406  1.00 26.64  ? 811  DT  D C4    1 
ATOM   2932 O  O4    . DT  B 2 9   ? 5.847   -7.762  -5.559  1.00 25.67  ? 811  DT  D O4    1 
ATOM   2933 C  C5    . DT  B 2 9   ? 7.993   -7.344  -6.434  1.00 27.75  ? 811  DT  D C5    1 
ATOM   2934 C  C7    . DT  B 2 9   ? 8.772   -8.124  -5.414  1.00 28.48  ? 811  DT  D C7    1 
ATOM   2935 C  C6    . DT  B 2 9   ? 8.640   -6.730  -7.427  1.00 27.99  ? 811  DT  D C6    1 
ATOM   2936 P  P     . DA  B 2 10  ? 10.771  -2.174  -11.344 1.00 29.95  ? 812  DA  D P     1 
ATOM   2937 O  OP1   . DA  B 2 10  ? 10.921  -1.871  -12.780 1.00 30.28  ? 812  DA  D OP1   1 
ATOM   2938 O  OP2   . DA  B 2 10  ? 11.819  -1.824  -10.359 1.00 29.90  ? 812  DA  D OP2   1 
ATOM   2939 O  "O5'" . DA  B 2 10  ? 9.394   -1.542  -10.849 1.00 28.02  ? 812  DA  D "O5'" 1 
ATOM   2940 C  "C5'" . DA  B 2 10  ? 8.217   -1.588  -11.672 1.00 25.63  ? 812  DA  D "C5'" 1 
ATOM   2941 C  "C4'" . DA  B 2 10  ? 7.073   -0.999  -10.863 1.00 24.32  ? 812  DA  D "C4'" 1 
ATOM   2942 O  "O4'" . DA  B 2 10  ? 6.789   -1.892  -9.780  1.00 22.02  ? 812  DA  D "O4'" 1 
ATOM   2943 C  "C3'" . DA  B 2 10  ? 7.395   0.311   -10.151 1.00 22.87  ? 812  DA  D "C3'" 1 
ATOM   2944 O  "O3'" . DA  B 2 10  ? 6.583   1.281   -10.747 1.00 23.24  ? 812  DA  D "O3'" 1 
ATOM   2945 C  "C2'" . DA  B 2 10  ? 7.053   0.087   -8.667  1.00 24.44  ? 812  DA  D "C2'" 1 
ATOM   2946 C  "C1'" . DA  B 2 10  ? 6.160   -1.144  -8.767  1.00 24.11  ? 812  DA  D "C1'" 1 
ATOM   2947 N  N9    . DA  B 2 10  ? 6.131   -2.047  -7.626  1.00 23.84  ? 812  DA  D N9    1 
ATOM   2948 C  C8    . DA  B 2 10  ? 7.211   -2.652  -7.036  1.00 24.91  ? 812  DA  D C8    1 
ATOM   2949 N  N7    . DA  B 2 10  ? 6.889   -3.454  -6.049  1.00 24.60  ? 812  DA  D N7    1 
ATOM   2950 C  C5    . DA  B 2 10  ? 5.507   -3.386  -6.015  1.00 22.58  ? 812  DA  D C5    1 
ATOM   2951 C  C6    . DA  B 2 10  ? 4.551   -3.993  -5.174  1.00 23.38  ? 812  DA  D C6    1 
ATOM   2952 N  N6    . DA  B 2 10  ? 4.898   -4.833  -4.197  1.00 19.87  ? 812  DA  D N6    1 
ATOM   2953 N  N1    . DA  B 2 10  ? 3.240   -3.697  -5.382  1.00 21.61  ? 812  DA  D N1    1 
ATOM   2954 C  C2    . DA  B 2 10  ? 2.914   -2.856  -6.373  1.00 22.07  ? 812  DA  D C2    1 
ATOM   2955 N  N3    . DA  B 2 10  ? 3.736   -2.213  -7.216  1.00 22.35  ? 812  DA  D N3    1 
ATOM   2956 C  C4    . DA  B 2 10  ? 5.022   -2.526  -6.980  1.00 22.64  ? 812  DA  D C4    1 
ATOM   2957 P  P     . DG  B 2 11  ? 6.554   2.785   -10.245 1.00 24.47  ? 813  DG  D P     1 
ATOM   2958 O  OP1   . DG  B 2 11  ? 6.085   3.608   -11.376 1.00 24.19  ? 813  DG  D OP1   1 
ATOM   2959 O  OP2   . DG  B 2 11  ? 7.801   3.162   -9.553  1.00 26.61  ? 813  DG  D OP2   1 
ATOM   2960 O  "O5'" . DG  B 2 11  ? 5.412   2.696   -9.126  1.00 24.14  ? 813  DG  D "O5'" 1 
ATOM   2961 C  "C5'" . DG  B 2 11  ? 4.072   2.359   -9.499  1.00 24.45  ? 813  DG  D "C5'" 1 
ATOM   2962 C  "C4'" . DG  B 2 11  ? 3.163   2.379   -8.294  1.00 24.52  ? 813  DG  D "C4'" 1 
ATOM   2963 O  "O4'" . DG  B 2 11  ? 3.445   1.231   -7.457  1.00 23.93  ? 813  DG  D "O4'" 1 
ATOM   2964 C  "C3'" . DG  B 2 11  ? 3.353   3.622   -7.430  1.00 25.21  ? 813  DG  D "C3'" 1 
ATOM   2965 O  "O3'" . DG  B 2 11  ? 2.099   4.311   -7.388  1.00 26.99  ? 813  DG  D "O3'" 1 
ATOM   2966 C  "C2'" . DG  B 2 11  ? 3.807   3.094   -6.062  1.00 25.06  ? 813  DG  D "C2'" 1 
ATOM   2967 C  "C1'" . DG  B 2 11  ? 3.316   1.641   -6.106  1.00 24.01  ? 813  DG  D "C1'" 1 
ATOM   2968 N  N9    . DG  B 2 11  ? 4.094   0.760   -5.236  1.00 23.32  ? 813  DG  D N9    1 
ATOM   2969 C  C8    . DG  B 2 11  ? 5.462   0.646   -5.173  1.00 22.18  ? 813  DG  D C8    1 
ATOM   2970 N  N7    . DG  B 2 11  ? 5.847   -0.225  -4.281  1.00 23.47  ? 813  DG  D N7    1 
ATOM   2971 C  C5    . DG  B 2 11  ? 4.684   -0.726  -3.716  1.00 23.10  ? 813  DG  D C5    1 
ATOM   2972 C  C6    . DG  B 2 11  ? 4.482   -1.697  -2.687  1.00 23.67  ? 813  DG  D C6    1 
ATOM   2973 O  O6    . DG  B 2 11  ? 5.343   -2.319  -2.070  1.00 24.34  ? 813  DG  D O6    1 
ATOM   2974 N  N1    . DG  B 2 11  ? 3.128   -1.921  -2.405  1.00 22.25  ? 813  DG  D N1    1 
ATOM   2975 C  C2    . DG  B 2 11  ? 2.087   -1.269  -3.055  1.00 22.62  ? 813  DG  D C2    1 
ATOM   2976 N  N2    . DG  B 2 11  ? 0.826   -1.573  -2.678  1.00 20.31  ? 813  DG  D N2    1 
ATOM   2977 N  N3    . DG  B 2 11  ? 2.270   -0.353  -4.007  1.00 22.36  ? 813  DG  D N3    1 
ATOM   2978 C  C4    . DG  B 2 11  ? 3.585   -0.130  -4.294  1.00 23.25  ? 813  DG  D C4    1 
ATOM   2979 P  P     . DC  B 2 12  ? 1.954   5.710   -6.620  1.00 27.21  ? 814  DC  D P     1 
ATOM   2980 O  OP1   . DC  B 2 12  ? 0.888   6.512   -7.244  1.00 23.83  ? 814  DC  D OP1   1 
ATOM   2981 O  OP2   . DC  B 2 12  ? 3.285   6.298   -6.392  1.00 29.44  ? 814  DC  D OP2   1 
ATOM   2982 O  "O5'" . DC  B 2 12  ? 1.469   5.186   -5.202  1.00 30.86  ? 814  DC  D "O5'" 1 
ATOM   2983 C  "C5'" . DC  B 2 12  ? 0.250   4.439   -5.072  1.00 33.52  ? 814  DC  D "C5'" 1 
ATOM   2984 C  "C4'" . DC  B 2 12  ? 0.161   3.968   -3.638  1.00 37.02  ? 814  DC  D "C4'" 1 
ATOM   2985 O  "O4'" . DC  B 2 12  ? 1.182   2.960   -3.362  1.00 34.59  ? 814  DC  D "O4'" 1 
ATOM   2986 C  "C3'" . DC  B 2 12  ? 0.424   5.125   -2.677  1.00 38.79  ? 814  DC  D "C3'" 1 
ATOM   2987 O  "O3'" . DC  B 2 12  ? -0.533  5.176   -1.660  1.00 44.84  ? 814  DC  D "O3'" 1 
ATOM   2988 C  "C2'" . DC  B 2 12  ? 1.760   4.757   -2.045  1.00 37.31  ? 814  DC  D "C2'" 1 
ATOM   2989 C  "C1'" . DC  B 2 12  ? 1.637   3.240   -2.073  1.00 33.38  ? 814  DC  D "C1'" 1 
ATOM   2990 N  N1    . DC  B 2 12  ? 2.905   2.552   -1.758  1.00 29.99  ? 814  DC  D N1    1 
ATOM   2991 C  C2    . DC  B 2 12  ? 2.846   1.467   -0.872  1.00 26.52  ? 814  DC  D C2    1 
ATOM   2992 O  O2    . DC  B 2 12  ? 1.751   1.113   -0.432  1.00 27.37  ? 814  DC  D O2    1 
ATOM   2993 N  N3    . DC  B 2 12  ? 3.985   0.838   -0.549  1.00 23.92  ? 814  DC  D N3    1 
ATOM   2994 C  C4    . DC  B 2 12  ? 5.140   1.258   -1.038  1.00 25.28  ? 814  DC  D C4    1 
ATOM   2995 N  N4    . DC  B 2 12  ? 6.225   0.583   -0.670  1.00 27.10  ? 814  DC  D N4    1 
ATOM   2996 C  C5    . DC  B 2 12  ? 5.244   2.374   -1.933  1.00 29.20  ? 814  DC  D C5    1 
ATOM   2997 C  C6    . DC  B 2 12  ? 4.095   2.990   -2.269  1.00 29.26  ? 814  DC  D C6    1 
HETATM 2998 P  P     . DDG B 2 13  ? -1.853  6.069   -1.714  1.00 46.96  ? 815  DDG D P     1 
HETATM 2999 O  OP1   . DDG B 2 13  ? -2.789  5.336   -2.598  1.00 46.90  ? 815  DDG D OP1   1 
HETATM 3000 O  OP2   . DDG B 2 13  ? -1.576  7.502   -1.879  1.00 45.27  ? 815  DDG D OP2   1 
HETATM 3001 O  "O5'" . DDG B 2 13  ? -2.257  5.924   -0.168  1.00 46.75  ? 815  DDG D "O5'" 1 
HETATM 3002 C  "C5'" . DDG B 2 13  ? -2.931  4.807   0.312   1.00 44.07  ? 815  DDG D "C5'" 1 
HETATM 3003 C  "C4'" . DDG B 2 13  ? -2.459  4.445   1.705   1.00 42.04  ? 815  DDG D "C4'" 1 
HETATM 3004 O  "O4'" . DDG B 2 13  ? -1.349  3.538   1.563   1.00 39.25  ? 815  DDG D "O4'" 1 
HETATM 3005 C  "C3'" . DDG B 2 13  ? -1.842  5.549   2.551   1.00 42.99  ? 815  DDG D "C3'" 1 
HETATM 3006 C  "C2'" . DDG B 2 13  ? -1.134  4.744   3.622   1.00 40.30  ? 815  DDG D "C2'" 1 
HETATM 3007 C  "C1'" . DDG B 2 13  ? -0.621  3.584   2.779   1.00 39.40  ? 815  DDG D "C1'" 1 
HETATM 3008 N  N9    . DDG B 2 13  ? 0.774   3.604   2.374   1.00 36.96  ? 815  DDG D N9    1 
HETATM 3009 C  C8    . DDG B 2 13  ? 1.370   4.175   1.281   1.00 36.19  ? 815  DDG D C8    1 
HETATM 3010 N  N7    . DDG B 2 13  ? 2.658   3.935   1.215   1.00 36.94  ? 815  DDG D N7    1 
HETATM 3011 C  C5    . DDG B 2 13  ? 2.911   3.161   2.341   1.00 35.67  ? 815  DDG D C5    1 
HETATM 3012 C  C6    . DDG B 2 13  ? 4.102   2.581   2.811   1.00 34.50  ? 815  DDG D C6    1 
HETATM 3013 O  O6    . DDG B 2 13  ? 5.227   2.657   2.307   1.00 35.13  ? 815  DDG D O6    1 
HETATM 3014 N  N1    . DDG B 2 13  ? 3.897   1.866   3.991   1.00 34.73  ? 815  DDG D N1    1 
HETATM 3015 C  C2    . DDG B 2 13  ? 2.679   1.719   4.626   1.00 35.81  ? 815  DDG D C2    1 
HETATM 3016 N  N2    . DDG B 2 13  ? 2.628   1.012   5.755   1.00 37.32  ? 815  DDG D N2    1 
HETATM 3017 N  N3    . DDG B 2 13  ? 1.557   2.250   4.193   1.00 36.58  ? 815  DDG D N3    1 
HETATM 3018 C  C4    . DDG B 2 13  ? 1.758   2.948   3.050   1.00 36.44  ? 815  DDG D C4    1 
ATOM   3019 O  "O5'" . DT  C 3 2   ? 23.273  6.002   10.940  1.00 63.21  ? 902  DT  E "O5'" 1 
ATOM   3020 C  "C5'" . DT  C 3 2   ? 22.934  4.794   10.253  1.00 63.52  ? 902  DT  E "C5'" 1 
ATOM   3021 C  "C4'" . DT  C 3 2   ? 21.481  4.787   9.782   1.00 62.95  ? 902  DT  E "C4'" 1 
ATOM   3022 O  "O4'" . DT  C 3 2   ? 21.339  5.563   8.561   1.00 63.41  ? 902  DT  E "O4'" 1 
ATOM   3023 C  "C3'" . DT  C 3 2   ? 20.909  3.407   9.461   1.00 62.37  ? 902  DT  E "C3'" 1 
ATOM   3024 O  "O3'" . DT  C 3 2   ? 19.522  3.289   9.893   1.00 59.54  ? 902  DT  E "O3'" 1 
ATOM   3025 C  "C2'" . DT  C 3 2   ? 21.115  3.281   7.947   1.00 62.96  ? 902  DT  E "C2'" 1 
ATOM   3026 C  "C1'" . DT  C 3 2   ? 21.063  4.724   7.452   1.00 63.65  ? 902  DT  E "C1'" 1 
ATOM   3027 N  N1    . DT  C 3 2   ? 22.064  4.988   6.361   1.00 64.14  ? 902  DT  E N1    1 
ATOM   3028 C  C2    . DT  C 3 2   ? 21.729  5.784   5.276   1.00 64.08  ? 902  DT  E C2    1 
ATOM   3029 O  O2    . DT  C 3 2   ? 20.639  6.312   5.131   1.00 63.81  ? 902  DT  E O2    1 
ATOM   3030 N  N3    . DT  C 3 2   ? 22.739  5.941   4.351   1.00 64.25  ? 902  DT  E N3    1 
ATOM   3031 C  C4    . DT  C 3 2   ? 24.016  5.390   4.400   1.00 64.07  ? 902  DT  E C4    1 
ATOM   3032 O  O4    . DT  C 3 2   ? 24.843  5.591   3.516   1.00 63.62  ? 902  DT  E O4    1 
ATOM   3033 C  C5    . DT  C 3 2   ? 24.298  4.569   5.559   1.00 64.05  ? 902  DT  E C5    1 
ATOM   3034 C  C7    . DT  C 3 2   ? 25.633  3.908   5.746   1.00 64.15  ? 902  DT  E C7    1 
ATOM   3035 C  C6    . DT  C 3 2   ? 23.324  4.414   6.465   1.00 64.29  ? 902  DT  E C6    1 
ATOM   3036 P  P     . DA  C 3 3   ? 18.477  2.229   9.274   1.00 58.33  ? 903  DA  E P     1 
ATOM   3037 O  OP1   . DA  C 3 3   ? 18.039  1.855   10.650  1.00 57.71  ? 903  DA  E OP1   1 
ATOM   3038 O  OP2   . DA  C 3 3   ? 19.592  1.519   8.595   1.00 58.75  ? 903  DA  E OP2   1 
ATOM   3039 O  "O5'" . DA  C 3 3   ? 17.892  3.553   8.582   1.00 56.62  ? 903  DA  E "O5'" 1 
ATOM   3040 C  "C5'" . DA  C 3 3   ? 16.535  3.565   8.183   1.00 52.67  ? 903  DA  E "C5'" 1 
ATOM   3041 C  "C4'" . DA  C 3 3   ? 16.344  3.409   6.686   1.00 49.99  ? 903  DA  E "C4'" 1 
ATOM   3042 O  "O4'" . DA  C 3 3   ? 17.504  3.815   5.930   1.00 50.75  ? 903  DA  E "O4'" 1 
ATOM   3043 C  "C3'" . DA  C 3 3   ? 16.099  1.992   6.204   1.00 47.71  ? 903  DA  E "C3'" 1 
ATOM   3044 O  "O3'" . DA  C 3 3   ? 14.761  1.656   6.464   1.00 42.77  ? 903  DA  E "O3'" 1 
ATOM   3045 C  "C2'" . DA  C 3 3   ? 16.329  2.145   4.706   1.00 49.53  ? 903  DA  E "C2'" 1 
ATOM   3046 C  "C1'" . DA  C 3 3   ? 17.428  3.207   4.651   1.00 51.44  ? 903  DA  E "C1'" 1 
ATOM   3047 N  N9    . DA  C 3 3   ? 18.746  2.676   4.297   1.00 53.19  ? 903  DA  E N9    1 
ATOM   3048 C  C8    . DA  C 3 3   ? 19.406  1.627   4.883   1.00 53.44  ? 903  DA  E C8    1 
ATOM   3049 N  N7    . DA  C 3 3   ? 20.582  1.380   4.359   1.00 54.13  ? 903  DA  E N7    1 
ATOM   3050 C  C5    . DA  C 3 3   ? 20.705  2.332   3.359   1.00 54.43  ? 903  DA  E C5    1 
ATOM   3051 C  C6    . DA  C 3 3   ? 21.733  2.613   2.428   1.00 54.87  ? 903  DA  E C6    1 
ATOM   3052 N  N6    . DA  C 3 3   ? 22.865  1.903   2.376   1.00 54.36  ? 903  DA  E N6    1 
ATOM   3053 N  N1    . DA  C 3 3   ? 21.553  3.642   1.558   1.00 54.95  ? 903  DA  E N1    1 
ATOM   3054 C  C2    . DA  C 3 3   ? 20.412  4.349   1.618   1.00 54.55  ? 903  DA  E C2    1 
ATOM   3055 N  N3    . DA  C 3 3   ? 19.379  4.179   2.452   1.00 54.87  ? 903  DA  E N3    1 
ATOM   3056 C  C4    . DA  C 3 3   ? 19.585  3.146   3.304   1.00 54.38  ? 903  DA  E C4    1 
ATOM   3057 P  P     . DA  C 3 4   ? 14.288  0.137   6.659   1.00 38.50  ? 904  DA  E P     1 
ATOM   3058 O  OP1   . DA  C 3 4   ? 15.324  -0.582  7.448   1.00 39.50  ? 904  DA  E OP1   1 
ATOM   3059 O  OP2   . DA  C 3 4   ? 13.820  -0.374  5.356   1.00 36.67  ? 904  DA  E OP2   1 
ATOM   3060 O  "O5'" . DA  C 3 4   ? 13.023  0.409   7.579   1.00 33.95  ? 904  DA  E "O5'" 1 
ATOM   3061 C  "C5'" . DA  C 3 4   ? 13.194  0.841   8.926   1.00 29.32  ? 904  DA  E "C5'" 1 
ATOM   3062 C  "C4'" . DA  C 3 4   ? 11.956  0.446   9.706   1.00 26.94  ? 904  DA  E "C4'" 1 
ATOM   3063 O  "O4'" . DA  C 3 4   ? 10.826  1.294   9.367   1.00 26.34  ? 904  DA  E "O4'" 1 
ATOM   3064 C  "C3'" . DA  C 3 4   ? 11.474  -0.964  9.428   1.00 24.99  ? 904  DA  E "C3'" 1 
ATOM   3065 O  "O3'" . DA  C 3 4   ? 10.967  -1.465  10.642  1.00 27.33  ? 904  DA  E "O3'" 1 
ATOM   3066 C  "C2'" . DA  C 3 4   ? 10.384  -0.819  8.360   1.00 25.73  ? 904  DA  E "C2'" 1 
ATOM   3067 C  "C1'" . DA  C 3 4   ? 9.843   0.589   8.640   1.00 22.74  ? 904  DA  E "C1'" 1 
ATOM   3068 N  N9    . DA  C 3 4   ? 9.557   1.418   7.474   1.00 22.60  ? 904  DA  E N9    1 
ATOM   3069 C  C8    . DA  C 3 4   ? 10.381  1.720   6.429   1.00 21.75  ? 904  DA  E C8    1 
ATOM   3070 N  N7    . DA  C 3 4   ? 9.828   2.525   5.545   1.00 20.61  ? 904  DA  E N7    1 
ATOM   3071 C  C5    . DA  C 3 4   ? 8.558   2.763   6.036   1.00 21.10  ? 904  DA  E C5    1 
ATOM   3072 C  C6    . DA  C 3 4   ? 7.458   3.551   5.577   1.00 21.66  ? 904  DA  E C6    1 
ATOM   3073 N  N6    . DA  C 3 4   ? 7.469   4.254   4.434   1.00 19.08  ? 904  DA  E N6    1 
ATOM   3074 N  N1    . DA  C 3 4   ? 6.330   3.577   6.332   1.00 19.29  ? 904  DA  E N1    1 
ATOM   3075 C  C2    . DA  C 3 4   ? 6.296   2.874   7.459   1.00 19.47  ? 904  DA  E C2    1 
ATOM   3076 N  N3    . DA  C 3 4   ? 7.277   2.126   7.988   1.00 21.93  ? 904  DA  E N3    1 
ATOM   3077 C  C4    . DA  C 3 4   ? 8.383   2.104   7.229   1.00 20.44  ? 904  DA  E C4    1 
ATOM   3078 P  P     . DC  C 3 5   ? 10.724  -3.038  10.801  1.00 27.94  ? 905  DC  E P     1 
ATOM   3079 O  OP1   . DC  C 3 5   ? 10.662  -3.313  12.254  1.00 28.35  ? 905  DC  E OP1   1 
ATOM   3080 O  OP2   . DC  C 3 5   ? 11.713  -3.735  9.959   1.00 30.07  ? 905  DC  E OP2   1 
ATOM   3081 O  "O5'" . DC  C 3 5   ? 9.286   -3.231  10.134  1.00 29.37  ? 905  DC  E "O5'" 1 
ATOM   3082 C  "C5'" . DC  C 3 5   ? 8.129   -2.608  10.718  1.00 28.84  ? 905  DC  E "C5'" 1 
ATOM   3083 C  "C4'" . DC  C 3 5   ? 6.951   -2.663  9.758   1.00 29.34  ? 905  DC  E "C4'" 1 
ATOM   3084 O  "O4'" . DC  C 3 5   ? 7.042   -1.574  8.792   1.00 27.47  ? 905  DC  E "O4'" 1 
ATOM   3085 C  "C3'" . DC  C 3 5   ? 6.827   -3.960  8.936   1.00 28.69  ? 905  DC  E "C3'" 1 
ATOM   3086 O  "O3'" . DC  C 3 5   ? 5.471   -4.382  8.773   1.00 29.56  ? 905  DC  E "O3'" 1 
ATOM   3087 C  "C2'" . DC  C 3 5   ? 7.298   -3.513  7.554   1.00 29.14  ? 905  DC  E "C2'" 1 
ATOM   3088 C  "C1'" . DC  C 3 5   ? 6.631   -2.134  7.562   1.00 27.10  ? 905  DC  E "C1'" 1 
ATOM   3089 N  N1    . DC  C 3 5   ? 6.913   -1.309  6.372   1.00 25.65  ? 905  DC  E N1    1 
ATOM   3090 C  C2    . DC  C 3 5   ? 5.903   -0.422  5.935   1.00 26.42  ? 905  DC  E C2    1 
ATOM   3091 O  O2    . DC  C 3 5   ? 4.833   -0.359  6.561   1.00 27.87  ? 905  DC  E O2    1 
ATOM   3092 N  N3    . DC  C 3 5   ? 6.121   0.319   4.825   1.00 24.53  ? 905  DC  E N3    1 
ATOM   3093 C  C4    . DC  C 3 5   ? 7.284   0.219   4.169   1.00 25.31  ? 905  DC  E C4    1 
ATOM   3094 N  N4    . DC  C 3 5   ? 7.444   0.976   3.085   1.00 24.53  ? 905  DC  E N4    1 
ATOM   3095 C  C5    . DC  C 3 5   ? 8.326   -0.672  4.595   1.00 27.48  ? 905  DC  E C5    1 
ATOM   3096 C  C6    . DC  C 3 5   ? 8.084   -1.428  5.681   1.00 25.70  ? 905  DC  E C6    1 
ATOM   3097 P  P     . DG  C 3 6   ? 4.688   -5.306  9.834   1.00 29.62  ? 906  DG  E P     1 
ATOM   3098 O  OP1   . DG  C 3 6   ? 4.495   -4.395  10.983  1.00 30.08  ? 906  DG  E OP1   1 
ATOM   3099 O  OP2   . DG  C 3 6   ? 5.406   -6.577  10.017  1.00 25.39  ? 906  DG  E OP2   1 
ATOM   3100 O  "O5'" . DG  C 3 6   ? 3.279   -5.541  9.139   1.00 29.13  ? 906  DG  E "O5'" 1 
ATOM   3101 C  "C5'" . DG  C 3 6   ? 2.313   -4.477  9.121   1.00 29.90  ? 906  DG  E "C5'" 1 
ATOM   3102 C  "C4'" . DG  C 3 6   ? 1.694   -4.236  7.753   1.00 28.09  ? 906  DG  E "C4'" 1 
ATOM   3103 O  "O4'" . DG  C 3 6   ? 2.644   -3.562  6.904   1.00 27.40  ? 906  DG  E "O4'" 1 
ATOM   3104 C  "C3'" . DG  C 3 6   ? 1.279   -5.463  6.933   1.00 27.61  ? 906  DG  E "C3'" 1 
ATOM   3105 O  "O3'" . DG  C 3 6   ? -0.115  -5.667  7.095   1.00 27.08  ? 906  DG  E "O3'" 1 
ATOM   3106 C  "C2'" . DG  C 3 6   ? 1.563   -5.081  5.472   1.00 26.07  ? 906  DG  E "C2'" 1 
ATOM   3107 C  "C1'" . DG  C 3 6   ? 2.113   -3.657  5.602   1.00 26.63  ? 906  DG  E "C1'" 1 
ATOM   3108 N  N9    . DG  C 3 6   ? 3.209   -3.353  4.699   1.00 27.25  ? 906  DG  E N9    1 
ATOM   3109 C  C8    . DG  C 3 6   ? 4.454   -3.904  4.660   1.00 29.52  ? 906  DG  E C8    1 
ATOM   3110 N  N7    . DG  C 3 6   ? 5.211   -3.404  3.723   1.00 28.04  ? 906  DG  E N7    1 
ATOM   3111 C  C5    . DG  C 3 6   ? 4.421   -2.456  3.101   1.00 27.87  ? 906  DG  E C5    1 
ATOM   3112 C  C6    . DG  C 3 6   ? 4.704   -1.588  1.998   1.00 27.86  ? 906  DG  E C6    1 
ATOM   3113 O  O6    . DG  C 3 6   ? 5.770   -1.494  1.358   1.00 27.13  ? 906  DG  E O6    1 
ATOM   3114 N  N1    . DG  C 3 6   ? 3.602   -0.804  1.681   1.00 25.32  ? 906  DG  E N1    1 
ATOM   3115 C  C2    . DG  C 3 6   ? 2.388   -0.867  2.358   1.00 27.11  ? 906  DG  E C2    1 
ATOM   3116 N  N2    . DG  C 3 6   ? 1.385   -0.065  1.987   1.00 25.13  ? 906  DG  E N2    1 
ATOM   3117 N  N3    . DG  C 3 6   ? 2.132   -1.674  3.376   1.00 26.20  ? 906  DG  E N3    1 
ATOM   3118 C  C4    . DG  C 3 6   ? 3.186   -2.432  3.688   1.00 25.87  ? 906  DG  E C4    1 
ATOM   3119 P  P     . DC  C 3 7   ? -0.894  -6.924  6.472   1.00 27.18  ? 907  DC  E P     1 
ATOM   3120 O  OP1   . DC  C 3 7   ? -2.055  -7.112  7.337   1.00 25.96  ? 907  DC  E OP1   1 
ATOM   3121 O  OP2   . DC  C 3 7   ? 0.044   -8.063  6.298   1.00 24.38  ? 907  DC  E OP2   1 
ATOM   3122 O  "O5'" . DC  C 3 7   ? -1.266  -6.585  4.955   1.00 26.78  ? 907  DC  E "O5'" 1 
ATOM   3123 C  "C5'" . DC  C 3 7   ? -2.225  -5.629  4.580   1.00 30.82  ? 907  DC  E "C5'" 1 
ATOM   3124 C  "C4'" . DC  C 3 7   ? -2.061  -5.220  3.123   1.00 28.19  ? 907  DC  E "C4'" 1 
ATOM   3125 O  "O4'" . DC  C 3 7   ? -0.744  -4.651  2.960   1.00 28.00  ? 907  DC  E "O4'" 1 
ATOM   3126 C  "C3'" . DC  C 3 7   ? -2.098  -6.264  2.008   1.00 28.78  ? 907  DC  E "C3'" 1 
ATOM   3127 O  "O3'" . DC  C 3 7   ? -3.408  -6.507  1.572   1.00 30.30  ? 907  DC  E "O3'" 1 
ATOM   3128 C  "C2'" . DC  C 3 7   ? -1.414  -5.510  0.877   1.00 29.73  ? 907  DC  E "C2'" 1 
ATOM   3129 C  "C1'" . DC  C 3 7   ? -0.601  -4.446  1.579   1.00 26.90  ? 907  DC  E "C1'" 1 
ATOM   3130 N  N1    . DC  C 3 7   ? 0.814   -4.496  1.196   1.00 26.77  ? 907  DC  E N1    1 
ATOM   3131 C  C2    . DC  C 3 7   ? 1.208   -3.572  0.235   1.00 24.71  ? 907  DC  E C2    1 
ATOM   3132 O  O2    . DC  C 3 7   ? 0.362   -2.789  -0.222  1.00 26.66  ? 907  DC  E O2    1 
ATOM   3133 N  N3    . DC  C 3 7   ? 2.497   -3.570  -0.160  1.00 23.15  ? 907  DC  E N3    1 
ATOM   3134 C  C4    . DC  C 3 7   ? 3.374   -4.421  0.368   1.00 22.84  ? 907  DC  E C4    1 
ATOM   3135 N  N4    . DC  C 3 7   ? 4.623   -4.350  -0.083  1.00 22.25  ? 907  DC  E N4    1 
ATOM   3136 C  C5    . DC  C 3 7   ? 2.993   -5.391  1.356   1.00 24.82  ? 907  DC  E C5    1 
ATOM   3137 C  C6    . DC  C 3 7   ? 1.705   -5.387  1.741   1.00 25.36  ? 907  DC  E C6    1 
ATOM   3138 P  P     . DT  C 3 8   ? -3.807  -7.522  0.369   1.00 31.12  ? 908  DT  E P     1 
ATOM   3139 O  OP1   . DT  C 3 8   ? -5.149  -7.965  0.756   1.00 28.12  ? 908  DT  E OP1   1 
ATOM   3140 O  OP2   . DT  C 3 8   ? -2.773  -8.555  0.065   1.00 28.45  ? 908  DT  E OP2   1 
ATOM   3141 O  "O5'" . DT  C 3 8   ? -3.819  -6.571  -0.923  1.00 28.96  ? 908  DT  E "O5'" 1 
ATOM   3142 C  "C5'" . DT  C 3 8   ? -4.667  -5.442  -1.042  1.00 27.45  ? 908  DT  E "C5'" 1 
ATOM   3143 C  "C4'" . DT  C 3 8   ? -4.370  -4.827  -2.400  1.00 27.18  ? 908  DT  E "C4'" 1 
ATOM   3144 O  "O4'" . DT  C 3 8   ? -2.964  -4.481  -2.443  1.00 23.35  ? 908  DT  E "O4'" 1 
ATOM   3145 C  "C3'" . DT  C 3 8   ? -4.633  -5.765  -3.567  1.00 27.47  ? 908  DT  E "C3'" 1 
ATOM   3146 O  "O3'" . DT  C 3 8   ? -5.573  -5.161  -4.454  1.00 31.61  ? 908  DT  E "O3'" 1 
ATOM   3147 C  "C2'" . DT  C 3 8   ? -3.276  -5.991  -4.231  1.00 24.98  ? 908  DT  E "C2'" 1 
ATOM   3148 C  "C1'" . DT  C 3 8   ? -2.415  -4.854  -3.681  1.00 23.69  ? 908  DT  E "C1'" 1 
ATOM   3149 N  N1    . DT  C 3 8   ? -0.978  -5.205  -3.435  1.00 21.81  ? 908  DT  E N1    1 
ATOM   3150 C  C2    . DT  C 3 8   ? -0.014  -4.566  -4.182  1.00 22.74  ? 908  DT  E C2    1 
ATOM   3151 O  O2    . DT  C 3 8   ? -0.292  -3.735  -5.020  1.00 24.57  ? 908  DT  E O2    1 
ATOM   3152 N  N3    . DT  C 3 8   ? 1.283   -4.922  -3.901  1.00 22.08  ? 908  DT  E N3    1 
ATOM   3153 C  C4    . DT  C 3 8   ? 1.698   -5.850  -2.965  1.00 21.85  ? 908  DT  E C4    1 
ATOM   3154 O  O4    . DT  C 3 8   ? 2.882   -6.100  -2.795  1.00 22.84  ? 908  DT  E O4    1 
ATOM   3155 C  C5    . DT  C 3 8   ? 0.647   -6.495  -2.209  1.00 21.80  ? 908  DT  E C5    1 
ATOM   3156 C  C7    . DT  C 3 8   ? 0.966   -7.533  -1.156  1.00 20.58  ? 908  DT  E C7    1 
ATOM   3157 C  C6    . DT  C 3 8   ? -0.625  -6.136  -2.475  1.00 22.01  ? 908  DT  E C6    1 
ATOM   3158 P  P     . DA  C 3 9   ? -6.155  -6.003  -5.697  1.00 34.85  ? 909  DA  E P     1 
ATOM   3159 O  OP1   . DA  C 3 9   ? -7.445  -5.386  -6.030  1.00 35.80  ? 909  DA  E OP1   1 
ATOM   3160 O  OP2   . DA  C 3 9   ? -6.058  -7.465  -5.412  1.00 33.67  ? 909  DA  E OP2   1 
ATOM   3161 O  "O5'" . DA  C 3 9   ? -5.126  -5.733  -6.890  1.00 32.17  ? 909  DA  E "O5'" 1 
ATOM   3162 C  "C5'" . DA  C 3 9   ? -4.783  -4.404  -7.272  1.00 30.22  ? 909  DA  E "C5'" 1 
ATOM   3163 C  "C4'" . DA  C 3 9   ? -3.701  -4.464  -8.332  1.00 28.56  ? 909  DA  E "C4'" 1 
ATOM   3164 O  "O4'" . DA  C 3 9   ? -2.416  -4.700  -7.706  1.00 27.26  ? 909  DA  E "O4'" 1 
ATOM   3165 C  "C3'" . DA  C 3 9   ? -3.902  -5.570  -9.355  1.00 28.66  ? 909  DA  E "C3'" 1 
ATOM   3166 O  "O3'" . DA  C 3 9   ? -4.127  -4.925  -10.606 1.00 29.70  ? 909  DA  E "O3'" 1 
ATOM   3167 C  "C2'" . DA  C 3 9   ? -2.628  -6.427  -9.283  1.00 27.02  ? 909  DA  E "C2'" 1 
ATOM   3168 C  "C1'" . DA  C 3 9   ? -1.650  -5.533  -8.533  1.00 26.22  ? 909  DA  E "C1'" 1 
ATOM   3169 N  N9    . DA  C 3 9   ? -0.733  -6.271  -7.671  1.00 24.89  ? 909  DA  E N9    1 
ATOM   3170 C  C8    . DA  C 3 9   ? -1.028  -7.182  -6.695  1.00 23.17  ? 909  DA  E C8    1 
ATOM   3171 N  N7    . DA  C 3 9   ? 0.028   -7.669  -6.090  1.00 22.29  ? 909  DA  E N7    1 
ATOM   3172 C  C5    . DA  C 3 9   ? 1.088   -7.039  -6.718  1.00 21.92  ? 909  DA  E C5    1 
ATOM   3173 C  C6    . DA  C 3 9   ? 2.481   -7.104  -6.550  1.00 21.60  ? 909  DA  E C6    1 
ATOM   3174 N  N6    . DA  C 3 9   ? 3.088   -7.889  -5.662  1.00 21.86  ? 909  DA  E N6    1 
ATOM   3175 N  N1    . DA  C 3 9   ? 3.250   -6.318  -7.351  1.00 24.02  ? 909  DA  E N1    1 
ATOM   3176 C  C2    . DA  C 3 9   ? 2.660   -5.518  -8.252  1.00 22.56  ? 909  DA  E C2    1 
ATOM   3177 N  N3    . DA  C 3 9   ? 1.356   -5.364  -8.488  1.00 21.20  ? 909  DA  E N3    1 
ATOM   3178 C  C4    . DA  C 3 9   ? 0.631   -6.164  -7.689  1.00 22.97  ? 909  DA  E C4    1 
ATOM   3179 P  P     . DC  C 3 10  ? -4.224  -5.678  -12.006 1.00 31.26  ? 910  DC  E P     1 
ATOM   3180 O  OP1   . DC  C 3 10  ? -4.709  -4.661  -12.957 1.00 31.69  ? 910  DC  E OP1   1 
ATOM   3181 O  OP2   . DC  C 3 10  ? -4.969  -6.943  -11.836 1.00 31.53  ? 910  DC  E OP2   1 
ATOM   3182 O  "O5'" . DC  C 3 10  ? -2.705  -6.023  -12.393 1.00 30.28  ? 910  DC  E "O5'" 1 
ATOM   3183 C  "C5'" . DC  C 3 10  ? -1.868  -4.911  -12.686 1.00 28.94  ? 910  DC  E "C5'" 1 
ATOM   3184 C  "C4'" . DC  C 3 10  ? -0.433  -5.344  -12.884 1.00 26.85  ? 910  DC  E "C4'" 1 
ATOM   3185 O  "O4'" . DC  C 3 10  ? 0.086   -5.975  -11.684 1.00 26.33  ? 910  DC  E "O4'" 1 
ATOM   3186 C  "C3'" . DC  C 3 10  ? -0.275  -6.342  -14.004 1.00 25.93  ? 910  DC  E "C3'" 1 
ATOM   3187 O  "O3'" . DC  C 3 10  ? 0.561   -5.740  -14.980 1.00 24.49  ? 910  DC  E "O3'" 1 
ATOM   3188 C  "C2'" . DC  C 3 10  ? 0.330   -7.570  -13.330 1.00 25.84  ? 910  DC  E "C2'" 1 
ATOM   3189 C  "C1'" . DC  C 3 10  ? 0.975   -6.976  -12.085 1.00 26.49  ? 910  DC  E "C1'" 1 
ATOM   3190 N  N1    . DC  C 3 10  ? 1.153   -7.927  -10.932 1.00 26.18  ? 910  DC  E N1    1 
ATOM   3191 C  C2    . DC  C 3 10  ? 2.461   -8.146  -10.439 1.00 25.52  ? 910  DC  E C2    1 
ATOM   3192 O  O2    . DC  C 3 10  ? 3.413   -7.549  -10.960 1.00 25.24  ? 910  DC  E O2    1 
ATOM   3193 N  N3    . DC  C 3 10  ? 2.642   -9.010  -9.401  1.00 23.81  ? 910  DC  E N3    1 
ATOM   3194 C  C4    . DC  C 3 10  ? 1.593   -9.631  -8.854  1.00 23.69  ? 910  DC  E C4    1 
ATOM   3195 N  N4    . DC  C 3 10  ? 1.842   -10.450 -7.835  1.00 23.50  ? 910  DC  E N4    1 
ATOM   3196 C  C5    . DC  C 3 10  ? 0.252   -9.431  -9.334  1.00 24.79  ? 910  DC  E C5    1 
ATOM   3197 C  C6    . DC  C 3 10  ? 0.077   -8.585  -10.374 1.00 24.88  ? 910  DC  E C6    1 
ATOM   3198 P  P     . DC  C 3 11  ? 0.749   -6.407  -16.409 1.00 26.03  ? 911  DC  E P     1 
ATOM   3199 O  OP1   . DC  C 3 11  ? 0.892   -5.327  -17.410 1.00 25.58  ? 911  DC  E OP1   1 
ATOM   3200 O  OP2   . DC  C 3 11  ? -0.313  -7.422  -16.577 1.00 26.12  ? 911  DC  E OP2   1 
ATOM   3201 O  "O5'" . DC  C 3 11  ? 2.164   -7.131  -16.250 1.00 26.95  ? 911  DC  E "O5'" 1 
ATOM   3202 C  "C5'" . DC  C 3 11  ? 3.365   -6.365  -16.153 1.00 30.40  ? 911  DC  E "C5'" 1 
ATOM   3203 C  "C4'" . DC  C 3 11  ? 4.543   -7.300  -15.983 1.00 33.40  ? 911  DC  E "C4'" 1 
ATOM   3204 O  "O4'" . DC  C 3 11  ? 4.470   -7.893  -14.652 1.00 33.82  ? 911  DC  E "O4'" 1 
ATOM   3205 C  "C3'" . DC  C 3 11  ? 4.537   -8.441  -17.000 1.00 34.63  ? 911  DC  E "C3'" 1 
ATOM   3206 O  "O3'" . DC  C 3 11  ? 5.703   -8.417  -17.852 1.00 38.21  ? 911  DC  E "O3'" 1 
ATOM   3207 C  "C2'" . DC  C 3 11  ? 4.439   -9.712  -16.158 1.00 34.12  ? 911  DC  E "C2'" 1 
ATOM   3208 C  "C1'" . DC  C 3 11  ? 4.812   -9.262  -14.750 1.00 32.98  ? 911  DC  E "C1'" 1 
ATOM   3209 N  N1    . DC  C 3 11  ? 4.133   -10.091 -13.688 1.00 32.20  ? 911  DC  E N1    1 
ATOM   3210 C  C2    . DC  C 3 11  ? 4.926   -10.866 -12.824 1.00 30.95  ? 911  DC  E C2    1 
ATOM   3211 O  O2    . DC  C 3 11  ? 6.161   -10.837 -12.932 1.00 29.19  ? 911  DC  E O2    1 
ATOM   3212 N  N3    . DC  C 3 11  ? 4.314   -11.629 -11.878 1.00 31.52  ? 911  DC  E N3    1 
ATOM   3213 C  C4    . DC  C 3 11  ? 2.989   -11.657 -11.774 1.00 30.83  ? 911  DC  E C4    1 
ATOM   3214 N  N4    . DC  C 3 11  ? 2.472   -12.430 -10.818 1.00 29.19  ? 911  DC  E N4    1 
ATOM   3215 C  C5    . DC  C 3 11  ? 2.160   -10.889 -12.651 1.00 32.05  ? 911  DC  E C5    1 
ATOM   3216 C  C6    . DC  C 3 11  ? 2.768   -10.139 -13.586 1.00 32.13  ? 911  DC  E C6    1 
ATOM   3217 P  P     . DA  C 3 12  ? 5.840   -9.299  -19.199 1.00 38.64  ? 912  DA  E P     1 
ATOM   3218 O  OP1   . DA  C 3 12  ? 6.304   -8.393  -20.271 1.00 39.80  ? 912  DA  E OP1   1 
ATOM   3219 O  OP2   . DA  C 3 12  ? 4.625   -10.122 -19.408 1.00 37.93  ? 912  DA  E OP2   1 
ATOM   3220 O  "O5'" . DA  C 3 12  ? 7.030   -10.309 -18.831 1.00 39.08  ? 912  DA  E "O5'" 1 
ATOM   3221 C  "C5'" . DA  C 3 12  ? 8.092   -9.905  -17.960 1.00 39.87  ? 912  DA  E "C5'" 1 
ATOM   3222 C  "C4'" . DA  C 3 12  ? 8.937   -11.090 -17.518 1.00 40.28  ? 912  DA  E "C4'" 1 
ATOM   3223 O  "O4'" . DA  C 3 12  ? 8.353   -11.724 -16.352 1.00 39.39  ? 912  DA  E "O4'" 1 
ATOM   3224 C  "C3'" . DA  C 3 12  ? 9.103   -12.203 -18.544 1.00 41.11  ? 912  DA  E "C3'" 1 
ATOM   3225 O  "O3'" . DA  C 3 12  ? 10.397  -12.745 -18.380 1.00 43.05  ? 912  DA  E "O3'" 1 
ATOM   3226 C  "C2'" . DA  C 3 12  ? 8.001   -13.194 -18.165 1.00 39.73  ? 912  DA  E "C2'" 1 
ATOM   3227 C  "C1'" . DA  C 3 12  ? 7.970   -13.055 -16.648 1.00 37.91  ? 912  DA  E "C1'" 1 
ATOM   3228 N  N9    . DA  C 3 12  ? 6.667   -13.293 -16.028 1.00 35.91  ? 912  DA  E N9    1 
ATOM   3229 C  C8    . DA  C 3 12  ? 5.437   -12.855 -16.448 1.00 35.17  ? 912  DA  E C8    1 
ATOM   3230 N  N7    . DA  C 3 12  ? 4.441   -13.221 -15.677 1.00 33.66  ? 912  DA  E N7    1 
ATOM   3231 C  C5    . DA  C 3 12  ? 5.064   -13.948 -14.678 1.00 33.25  ? 912  DA  E C5    1 
ATOM   3232 C  C6    . DA  C 3 12  ? 4.573   -14.617 -13.541 1.00 32.13  ? 912  DA  E C6    1 
ATOM   3233 N  N6    . DA  C 3 12  ? 3.277   -14.657 -13.215 1.00 31.05  ? 912  DA  E N6    1 
ATOM   3234 N  N1    . DA  C 3 12  ? 5.472   -15.249 -12.752 1.00 32.83  ? 912  DA  E N1    1 
ATOM   3235 C  C2    . DA  C 3 12  ? 6.771   -15.220 -13.068 1.00 31.61  ? 912  DA  E C2    1 
ATOM   3236 N  N3    . DA  C 3 12  ? 7.344   -14.622 -14.110 1.00 32.95  ? 912  DA  E N3    1 
ATOM   3237 C  C4    . DA  C 3 12  ? 6.434   -14.001 -14.877 1.00 33.86  ? 912  DA  E C4    1 
ATOM   3238 P  P     . DT  C 3 13  ? 11.086  -13.662 -19.495 1.00 45.71  ? 913  DT  E P     1 
ATOM   3239 O  OP1   . DT  C 3 13  ? 12.275  -12.896 -19.926 1.00 46.14  ? 913  DT  E OP1   1 
ATOM   3240 O  OP2   . DT  C 3 13  ? 10.073  -14.091 -20.497 1.00 44.67  ? 913  DT  E OP2   1 
ATOM   3241 O  "O5'" . DT  C 3 13  ? 11.550  -14.973 -18.684 1.00 46.24  ? 913  DT  E "O5'" 1 
ATOM   3242 C  "C5'" . DT  C 3 13  ? 11.389  -15.095 -17.263 1.00 47.19  ? 913  DT  E "C5'" 1 
ATOM   3243 C  "C4'" . DT  C 3 13  ? 10.775  -16.421 -16.835 1.00 48.39  ? 913  DT  E "C4'" 1 
ATOM   3244 O  "O4'" . DT  C 3 13  ? 9.394   -16.241 -16.419 1.00 47.70  ? 913  DT  E "O4'" 1 
ATOM   3245 C  "C3'" . DT  C 3 13  ? 10.750  -17.550 -17.870 1.00 49.84  ? 913  DT  E "C3'" 1 
ATOM   3246 O  "O3'" . DT  C 3 13  ? 11.393  -18.674 -17.282 1.00 53.40  ? 913  DT  E "O3'" 1 
ATOM   3247 C  "C2'" . DT  C 3 13  ? 9.258   -17.806 -18.087 1.00 48.46  ? 913  DT  E "C2'" 1 
ATOM   3248 C  "C1'" . DT  C 3 13  ? 8.741   -17.460 -16.694 1.00 46.95  ? 913  DT  E "C1'" 1 
ATOM   3249 N  N1    . DT  C 3 13  ? 7.252   -17.319 -16.502 1.00 45.06  ? 913  DT  E N1    1 
ATOM   3250 C  C2    . DT  C 3 13  ? 6.671   -17.919 -15.398 1.00 44.44  ? 913  DT  E C2    1 
ATOM   3251 O  O2    . DT  C 3 13  ? 7.288   -18.560 -14.570 1.00 44.62  ? 913  DT  E O2    1 
ATOM   3252 N  N3    . DT  C 3 13  ? 5.316   -17.747 -15.283 1.00 43.88  ? 913  DT  E N3    1 
ATOM   3253 C  C4    . DT  C 3 13  ? 4.492   -17.046 -16.141 1.00 44.12  ? 913  DT  E C4    1 
ATOM   3254 O  O4    . DT  C 3 13  ? 3.283   -16.961 -15.925 1.00 43.41  ? 913  DT  E O4    1 
ATOM   3255 C  C5    . DT  C 3 13  ? 5.158   -16.440 -17.281 1.00 43.88  ? 913  DT  E C5    1 
ATOM   3256 C  C7    . DT  C 3 13  ? 4.387   -15.648 -18.295 1.00 43.89  ? 913  DT  E C7    1 
ATOM   3257 C  C6    . DT  C 3 13  ? 6.485   -16.601 -17.403 1.00 44.23  ? 913  DT  E C6    1 
ATOM   3258 P  P     . DC  C 3 14  ? 12.087  -19.864 -18.110 1.00 56.50  ? 914  DC  E P     1 
ATOM   3259 O  OP1   . DC  C 3 14  ? 13.428  -19.388 -18.523 1.00 56.11  ? 914  DC  E OP1   1 
ATOM   3260 O  OP2   . DC  C 3 14  ? 11.140  -20.393 -19.125 1.00 55.42  ? 914  DC  E OP2   1 
ATOM   3261 O  "O5'" . DC  C 3 14  ? 12.255  -20.971 -16.955 1.00 57.96  ? 914  DC  E "O5'" 1 
ATOM   3262 C  "C5'" . DC  C 3 14  ? 11.501  -20.914 -15.724 1.00 60.37  ? 914  DC  E "C5'" 1 
ATOM   3263 C  "C4'" . DC  C 3 14  ? 10.383  -21.951 -15.664 1.00 62.67  ? 914  DC  E "C4'" 1 
ATOM   3264 O  "O4'" . DC  C 3 14  ? 9.076   -21.304 -15.641 1.00 62.16  ? 914  DC  E "O4'" 1 
ATOM   3265 C  "C3'" . DC  C 3 14  ? 10.325  -22.961 -16.818 1.00 64.55  ? 914  DC  E "C3'" 1 
ATOM   3266 O  "O3'" . DC  C 3 14  ? 10.148  -24.285 -16.314 1.00 68.76  ? 914  DC  E "O3'" 1 
ATOM   3267 C  "C2'" . DC  C 3 14  ? 9.088   -22.518 -17.589 1.00 63.14  ? 914  DC  E "C2'" 1 
ATOM   3268 C  "C1'" . DC  C 3 14  ? 8.209   -22.117 -16.408 1.00 61.31  ? 914  DC  E "C1'" 1 
ATOM   3269 N  N1    . DC  C 3 14  ? 6.910   -21.434 -16.757 1.00 59.55  ? 914  DC  E N1    1 
ATOM   3270 C  C2    . DC  C 3 14  ? 5.766   -21.660 -15.968 1.00 58.89  ? 914  DC  E C2    1 
ATOM   3271 O  O2    . DC  C 3 14  ? 5.832   -22.404 -14.981 1.00 58.79  ? 914  DC  E O2    1 
ATOM   3272 N  N3    . DC  C 3 14  ? 4.599   -21.049 -16.302 1.00 58.03  ? 914  DC  E N3    1 
ATOM   3273 C  C4    . DC  C 3 14  ? 4.546   -20.247 -17.369 1.00 57.78  ? 914  DC  E C4    1 
ATOM   3274 N  N4    . DC  C 3 14  ? 3.379   -19.666 -17.655 1.00 57.25  ? 914  DC  E N4    1 
ATOM   3275 C  C5    . DC  C 3 14  ? 5.689   -20.004 -18.189 1.00 58.27  ? 914  DC  E C5    1 
ATOM   3276 C  C6    . DC  C 3 14  ? 6.834   -20.612 -17.850 1.00 58.92  ? 914  DC  E C6    1 
ATOM   3277 P  P     . DC  C 3 15  ? 10.721  -25.569 -17.090 1.00 72.12  ? 915  DC  E P     1 
ATOM   3278 O  OP1   . DC  C 3 15  ? 12.196  -25.528 -16.964 1.00 72.28  ? 915  DC  E OP1   1 
ATOM   3279 O  OP2   . DC  C 3 15  ? 10.097  -25.644 -18.434 1.00 71.71  ? 915  DC  E OP2   1 
ATOM   3280 O  "O5'" . DC  C 3 15  ? 10.179  -26.802 -16.220 1.00 74.08  ? 915  DC  E "O5'" 1 
ATOM   3281 C  "C5'" . DC  C 3 15  ? 9.918   -26.691 -14.812 1.00 77.42  ? 915  DC  E "C5'" 1 
ATOM   3282 C  "C4'" . DC  C 3 15  ? 8.543   -27.237 -14.450 1.00 79.80  ? 915  DC  E "C4'" 1 
ATOM   3283 O  "O4'" . DC  C 3 15  ? 7.517   -26.295 -14.860 1.00 80.00  ? 915  DC  E "O4'" 1 
ATOM   3284 C  "C3'" . DC  C 3 15  ? 8.188   -28.575 -15.099 1.00 81.70  ? 915  DC  E "C3'" 1 
ATOM   3285 O  "O3'" . DC  C 3 15  ? 7.538   -29.454 -14.168 1.00 84.60  ? 915  DC  E "O3'" 1 
ATOM   3286 C  "C2'" . DC  C 3 15  ? 7.274   -28.179 -16.257 1.00 81.06  ? 915  DC  E "C2'" 1 
ATOM   3287 C  "C1'" . DC  C 3 15  ? 6.593   -26.916 -15.736 1.00 80.22  ? 915  DC  E "C1'" 1 
ATOM   3288 N  N1    . DC  C 3 15  ? 6.167   -25.922 -16.798 1.00 79.89  ? 915  DC  E N1    1 
ATOM   3289 C  C2    . DC  C 3 15  ? 4.870   -25.376 -16.774 1.00 79.39  ? 915  DC  E C2    1 
ATOM   3290 O  O2    . DC  C 3 15  ? 4.076   -25.712 -15.886 1.00 79.13  ? 915  DC  E O2    1 
ATOM   3291 N  N3    . DC  C 3 15  ? 4.509   -24.483 -17.735 1.00 79.14  ? 915  DC  E N3    1 
ATOM   3292 C  C4    . DC  C 3 15  ? 5.373   -24.126 -18.689 1.00 79.00  ? 915  DC  E C4    1 
ATOM   3293 N  N4    . DC  C 3 15  ? 4.965   -23.245 -19.608 1.00 78.51  ? 915  DC  E N4    1 
ATOM   3294 C  C5    . DC  C 3 15  ? 6.694   -24.667 -18.737 1.00 79.33  ? 915  DC  E C5    1 
ATOM   3295 C  C6    . DC  C 3 15  ? 7.043   -25.545 -17.784 1.00 79.74  ? 915  DC  E C6    1 
ATOM   3296 P  P     . DA  C 3 16  ? 7.784   -31.043 -14.196 1.00 86.94  ? 916  DA  E P     1 
ATOM   3297 O  OP1   . DA  C 3 16  ? 8.246   -31.439 -12.844 1.00 86.84  ? 916  DA  E OP1   1 
ATOM   3298 O  OP2   . DA  C 3 16  ? 8.617   -31.382 -15.374 1.00 86.90  ? 916  DA  E OP2   1 
ATOM   3299 O  "O5'" . DA  C 3 16  ? 6.317   -31.634 -14.481 1.00 88.49  ? 916  DA  E "O5'" 1 
ATOM   3300 C  "C5'" . DA  C 3 16  ? 5.388   -31.920 -13.427 1.00 90.60  ? 916  DA  E "C5'" 1 
ATOM   3301 C  "C4'" . DA  C 3 16  ? 3.963   -31.540 -13.813 1.00 92.14  ? 916  DA  E "C4'" 1 
ATOM   3302 O  "O4'" . DA  C 3 16  ? 3.964   -30.369 -14.674 1.00 92.26  ? 916  DA  E "O4'" 1 
ATOM   3303 C  "C3'" . DA  C 3 16  ? 3.159   -32.605 -14.564 1.00 93.36  ? 916  DA  E "C3'" 1 
ATOM   3304 O  "O3'" . DA  C 3 16  ? 1.795   -32.552 -14.107 1.00 95.23  ? 916  DA  E "O3'" 1 
ATOM   3305 C  "C2'" . DA  C 3 16  ? 3.316   -32.150 -16.014 1.00 93.00  ? 916  DA  E "C2'" 1 
ATOM   3306 C  "C1'" . DA  C 3 16  ? 3.178   -30.647 -15.814 1.00 92.47  ? 916  DA  E "C1'" 1 
ATOM   3307 N  N9    . DA  C 3 16  ? 3.644   -29.819 -16.919 1.00 92.28  ? 916  DA  E N9    1 
ATOM   3308 C  C8    . DA  C 3 16  ? 4.871   -29.847 -17.521 1.00 92.14  ? 916  DA  E C8    1 
ATOM   3309 N  N7    . DA  C 3 16  ? 5.002   -28.974 -18.490 1.00 92.13  ? 916  DA  E N7    1 
ATOM   3310 C  C5    . DA  C 3 16  ? 3.776   -28.329 -18.527 1.00 92.13  ? 916  DA  E C5    1 
ATOM   3311 C  C6    . DA  C 3 16  ? 3.261   -27.293 -19.338 1.00 92.12  ? 916  DA  E C6    1 
ATOM   3312 N  N6    . DA  C 3 16  ? 3.967   -26.704 -20.309 1.00 92.11  ? 916  DA  E N6    1 
ATOM   3313 N  N1    . DA  C 3 16  ? 1.990   -26.881 -19.113 1.00 92.05  ? 916  DA  E N1    1 
ATOM   3314 C  C2    . DA  C 3 16  ? 1.277   -27.472 -18.142 1.00 92.02  ? 916  DA  E C2    1 
ATOM   3315 N  N3    . DA  C 3 16  ? 1.655   -28.452 -17.317 1.00 92.11  ? 916  DA  E N3    1 
ATOM   3316 C  C4    . DA  C 3 16  ? 2.924   -28.839 -17.563 1.00 92.18  ? 916  DA  E C4    1 
ATOM   3317 P  P     . DA  C 3 17  ? 0.589   -33.470 -14.652 1.00 96.67  ? 917  DA  E P     1 
ATOM   3318 O  OP1   . DA  C 3 17  ? 0.206   -34.373 -13.543 1.00 96.88  ? 917  DA  E OP1   1 
ATOM   3319 O  OP2   . DA  C 3 17  ? 0.942   -34.046 -15.972 1.00 96.43  ? 917  DA  E OP2   1 
ATOM   3320 O  "O5'" . DA  C 3 17  ? -0.582  -32.389 -14.870 1.00 97.17  ? 917  DA  E "O5'" 1 
ATOM   3321 C  "C5'" . DA  C 3 17  ? -1.929  -32.781 -15.167 1.00 98.00  ? 917  DA  E "C5'" 1 
ATOM   3322 C  "C4'" . DA  C 3 17  ? -2.514  -31.992 -16.334 1.00 98.73  ? 917  DA  E "C4'" 1 
ATOM   3323 O  "O4'" . DA  C 3 17  ? -1.467  -31.264 -17.036 1.00 99.14  ? 917  DA  E "O4'" 1 
ATOM   3324 C  "C3'" . DA  C 3 17  ? -3.227  -32.829 -17.399 1.00 99.04  ? 917  DA  E "C3'" 1 
ATOM   3325 O  "O3'" . DA  C 3 17  ? -4.423  -32.165 -17.847 1.00 99.12  ? 917  DA  E "O3'" 1 
ATOM   3326 C  "C2'" . DA  C 3 17  ? -2.180  -32.930 -18.507 1.00 99.32  ? 917  DA  E "C2'" 1 
ATOM   3327 C  "C1'" . DA  C 3 17  ? -1.548  -31.545 -18.422 1.00 99.53  ? 917  DA  E "C1'" 1 
ATOM   3328 N  N9    . DA  C 3 17  ? -0.225  -31.453 -19.045 1.00 99.94  ? 917  DA  E N9    1 
ATOM   3329 C  C8    . DA  C 3 17  ? 0.908   -32.140 -18.697 1.00 100.00 ? 917  DA  E C8    1 
ATOM   3330 N  N7    . DA  C 3 17  ? 1.954   -31.857 -19.437 1.00 100.08 ? 917  DA  E N7    1 
ATOM   3331 C  C5    . DA  C 3 17  ? 1.476   -30.916 -20.337 1.00 100.22 ? 917  DA  E C5    1 
ATOM   3332 C  C6    . DA  C 3 17  ? 2.089   -30.210 -21.397 1.00 100.29 ? 917  DA  E C6    1 
ATOM   3333 N  N6    . DA  C 3 17  ? 3.376   -30.362 -21.727 1.00 100.38 ? 917  DA  E N6    1 
ATOM   3334 N  N1    . DA  C 3 17  ? 1.331   -29.339 -22.107 1.00 100.24 ? 917  DA  E N1    1 
ATOM   3335 C  C2    . DA  C 3 17  ? 0.040   -29.186 -21.776 1.00 100.19 ? 917  DA  E C2    1 
ATOM   3336 N  N3    . DA  C 3 17  ? -0.645  -29.794 -20.803 1.00 100.17 ? 917  DA  E N3    1 
ATOM   3337 C  C4    . DA  C 3 17  ? 0.133   -30.654 -20.112 1.00 100.14 ? 917  DA  E C4    1 
ATOM   3338 P  P     . DC  C 3 18  ? -5.430  -32.793 -18.933 1.00 99.09  ? 918  DC  E P     1 
ATOM   3339 O  OP1   . DC  C 3 18  ? -6.785  -32.290 -18.613 1.00 99.16  ? 918  DC  E OP1   1 
ATOM   3340 O  OP2   . DC  C 3 18  ? -5.186  -34.253 -19.024 1.00 99.19  ? 918  DC  E OP2   1 
ATOM   3341 O  "O5'" . DC  C 3 18  ? -4.961  -32.137 -20.318 1.00 98.85  ? 918  DC  E "O5'" 1 
ATOM   3342 C  "C5'" . DC  C 3 18  ? -5.711  -32.354 -21.517 1.00 98.32  ? 918  DC  E "C5'" 1 
ATOM   3343 C  "C4'" . DC  C 3 18  ? -4.840  -32.266 -22.762 1.00 98.06  ? 918  DC  E "C4'" 1 
ATOM   3344 O  "O4'" . DC  C 3 18  ? -3.440  -32.196 -22.390 1.00 97.88  ? 918  DC  E "O4'" 1 
ATOM   3345 C  "C3'" . DC  C 3 18  ? -4.974  -33.450 -23.713 1.00 97.99  ? 918  DC  E "C3'" 1 
ATOM   3346 O  "O3'" . DC  C 3 18  ? -5.911  -33.138 -24.740 1.00 97.90  ? 918  DC  E "O3'" 1 
ATOM   3347 C  "C2'" . DC  C 3 18  ? -3.568  -33.647 -24.280 1.00 97.83  ? 918  DC  E "C2'" 1 
ATOM   3348 C  "C1'" . DC  C 3 18  ? -2.648  -33.005 -23.238 1.00 97.84  ? 918  DC  E "C1'" 1 
ATOM   3349 N  N1    . DC  C 3 18  ? -1.838  -33.946 -22.375 1.00 97.70  ? 918  DC  E N1    1 
ATOM   3350 C  C2    . DC  C 3 18  ? -0.496  -33.633 -22.085 1.00 97.46  ? 918  DC  E C2    1 
ATOM   3351 O  O2    . DC  C 3 18  ? 0.008   -32.599 -22.546 1.00 97.10  ? 918  DC  E O2    1 
ATOM   3352 N  N3    . DC  C 3 18  ? 0.224   -34.484 -21.303 1.00 97.44  ? 918  DC  E N3    1 
ATOM   3353 C  C4    . DC  C 3 18  ? -0.339  -35.597 -20.817 1.00 97.55  ? 918  DC  E C4    1 
ATOM   3354 N  N4    . DC  C 3 18  ? 0.411   -36.400 -20.056 1.00 97.42  ? 918  DC  E N4    1 
ATOM   3355 C  C5    . DC  C 3 18  ? -1.700  -35.936 -21.095 1.00 97.66  ? 918  DC  E C5    1 
ATOM   3356 C  C6    . DC  C 3 18  ? -2.401  -35.091 -21.865 1.00 97.75  ? 918  DC  E C6    1 
ATOM   3357 N  N     . GLY D 1 1   ? -12.595 0.430   -40.849 1.00 24.97  ? 1001 GLY B N     1 
ATOM   3358 C  CA    . GLY D 1 1   ? -12.921 0.654   -42.287 1.00 24.30  ? 1001 GLY B CA    1 
ATOM   3359 C  C     . GLY D 1 1   ? -11.700 0.903   -43.151 1.00 24.13  ? 1001 GLY B C     1 
ATOM   3360 O  O     . GLY D 1 1   ? -10.654 1.330   -42.654 1.00 24.26  ? 1001 GLY B O     1 
ATOM   3361 N  N     . ILE D 1 2   ? -11.832 0.636   -44.450 1.00 23.55  ? 1002 ILE B N     1 
ATOM   3362 C  CA    . ILE D 1 2   ? -10.769 0.928   -45.406 1.00 23.42  ? 1002 ILE B CA    1 
ATOM   3363 C  C     . ILE D 1 2   ? -11.255 1.771   -46.595 1.00 23.12  ? 1002 ILE B C     1 
ATOM   3364 O  O     . ILE D 1 2   ? -12.179 1.386   -47.314 1.00 22.69  ? 1002 ILE B O     1 
ATOM   3365 C  CB    . ILE D 1 2   ? -10.043 -0.338  -45.891 1.00 23.13  ? 1002 ILE B CB    1 
ATOM   3366 C  CG1   . ILE D 1 2   ? -9.422  -1.084  -44.707 1.00 23.96  ? 1002 ILE B CG1   1 
ATOM   3367 C  CG2   . ILE D 1 2   ? -8.953  0.044   -46.897 1.00 22.47  ? 1002 ILE B CG2   1 
ATOM   3368 C  CD1   . ILE D 1 2   ? -8.859  -2.476  -45.045 1.00 25.65  ? 1002 ILE B CD1   1 
ATOM   3369 N  N     . VAL D 1 3   ? -10.623 2.933   -46.764 1.00 23.40  ? 1003 VAL B N     1 
ATOM   3370 C  CA    . VAL D 1 3   ? -10.952 3.895   -47.817 1.00 23.31  ? 1003 VAL B CA    1 
ATOM   3371 C  C     . VAL D 1 3   ? -9.796  3.998   -48.802 1.00 23.10  ? 1003 VAL B C     1 
ATOM   3372 O  O     . VAL D 1 3   ? -8.634  4.167   -48.397 1.00 22.72  ? 1003 VAL B O     1 
ATOM   3373 C  CB    . VAL D 1 3   ? -11.194 5.302   -47.225 1.00 23.64  ? 1003 VAL B CB    1 
ATOM   3374 C  CG1   . VAL D 1 3   ? -11.443 6.327   -48.328 1.00 24.28  ? 1003 VAL B CG1   1 
ATOM   3375 C  CG2   . VAL D 1 3   ? -12.369 5.284   -46.255 1.00 24.99  ? 1003 VAL B CG2   1 
ATOM   3376 N  N     . LEU D 1 4   ? -10.112 3.881   -50.090 1.00 22.60  ? 1004 LEU B N     1 
ATOM   3377 C  CA    . LEU D 1 4   ? -9.135  4.089   -51.166 1.00 22.24  ? 1004 LEU B CA    1 
ATOM   3378 C  C     . LEU D 1 4   ? -9.494  5.381   -51.923 1.00 22.22  ? 1004 LEU B C     1 
ATOM   3379 O  O     . LEU D 1 4   ? -10.631 5.545   -52.391 1.00 23.21  ? 1004 LEU B O     1 
ATOM   3380 C  CB    . LEU D 1 4   ? -9.136  2.876   -52.081 1.00 21.59  ? 1004 LEU B CB    1 
ATOM   3381 C  CG    . LEU D 1 4   ? -8.137  2.687   -53.224 1.00 22.01  ? 1004 LEU B CG    1 
ATOM   3382 C  CD1   . LEU D 1 4   ? -8.015  1.210   -53.495 1.00 19.73  ? 1004 LEU B CD1   1 
ATOM   3383 C  CD2   . LEU D 1 4   ? -8.578  3.401   -54.475 1.00 20.23  ? 1004 LEU B CD2   1 
ATOM   3384 N  N     . PHE D 1 5   ? -8.541  6.307   -52.013 1.00 20.84  ? 1005 PHE B N     1 
ATOM   3385 C  CA    . PHE D 1 5   ? -8.742  7.603   -52.673 1.00 19.74  ? 1005 PHE B CA    1 
ATOM   3386 C  C     . PHE D 1 5   ? -7.903  7.642   -53.959 1.00 19.80  ? 1005 PHE B C     1 
ATOM   3387 O  O     . PHE D 1 5   ? -6.736  7.228   -53.959 1.00 18.43  ? 1005 PHE B O     1 
ATOM   3388 C  CB    . PHE D 1 5   ? -8.362  8.731   -51.709 1.00 19.14  ? 1005 PHE B CB    1 
ATOM   3389 C  CG    . PHE D 1 5   ? -8.339  10.130  -52.327 1.00 20.22  ? 1005 PHE B CG    1 
ATOM   3390 C  CD1   . PHE D 1 5   ? -9.515  10.814  -52.604 1.00 20.80  ? 1005 PHE B CD1   1 
ATOM   3391 C  CD2   . PHE D 1 5   ? -7.129  10.775  -52.568 1.00 20.28  ? 1005 PHE B CD2   1 
ATOM   3392 C  CE1   . PHE D 1 5   ? -9.485  12.108  -53.130 1.00 22.12  ? 1005 PHE B CE1   1 
ATOM   3393 C  CE2   . PHE D 1 5   ? -7.091  12.061  -53.108 1.00 21.07  ? 1005 PHE B CE2   1 
ATOM   3394 C  CZ    . PHE D 1 5   ? -8.262  12.726  -53.388 1.00 21.48  ? 1005 PHE B CZ    1 
ATOM   3395 N  N     . VAL D 1 6   ? -8.500  8.112   -55.046 1.00 18.83  ? 1006 VAL B N     1 
ATOM   3396 C  CA    . VAL D 1 6   ? -7.825  8.201   -56.345 1.00 19.57  ? 1006 VAL B CA    1 
ATOM   3397 C  C     . VAL D 1 6   ? -7.792  9.663   -56.748 1.00 20.18  ? 1006 VAL B C     1 
ATOM   3398 O  O     . VAL D 1 6   ? -8.827  10.335  -56.688 1.00 19.59  ? 1006 VAL B O     1 
ATOM   3399 C  CB    . VAL D 1 6   ? -8.588  7.426   -57.444 1.00 20.12  ? 1006 VAL B CB    1 
ATOM   3400 C  CG1   . VAL D 1 6   ? -7.818  7.424   -58.756 1.00 19.88  ? 1006 VAL B CG1   1 
ATOM   3401 C  CG2   . VAL D 1 6   ? -8.897  5.990   -57.006 1.00 20.31  ? 1006 VAL B CG2   1 
ATOM   3402 N  N     . ASP D 1 7   ? -6.623  10.137  -57.170 1.00 19.88  ? 1007 ASP B N     1 
ATOM   3403 C  CA    . ASP D 1 7   ? -6.393  11.543  -57.490 1.00 21.33  ? 1007 ASP B CA    1 
ATOM   3404 C  C     . ASP D 1 7   ? -5.547  11.551  -58.786 1.00 21.15  ? 1007 ASP B C     1 
ATOM   3405 O  O     . ASP D 1 7   ? -4.390  11.073  -58.776 1.00 20.17  ? 1007 ASP B O     1 
ATOM   3406 C  CB    . ASP D 1 7   ? -5.650  12.172  -56.291 1.00 22.12  ? 1007 ASP B CB    1 
ATOM   3407 C  CG    . ASP D 1 7   ? -5.211  13.624  -56.522 1.00 27.41  ? 1007 ASP B CG    1 
ATOM   3408 O  OD1   . ASP D 1 7   ? -4.927  14.005  -57.688 1.00 28.55  ? 1007 ASP B OD1   1 
ATOM   3409 O  OD2   . ASP D 1 7   ? -5.135  14.389  -55.520 1.00 27.76  ? 1007 ASP B OD2   1 
ATOM   3410 N  N     . PHE D 1 8   ? -6.110  12.031  -59.901 1.00 20.66  ? 1008 PHE B N     1 
ATOM   3411 C  CA    . PHE D 1 8   ? -5.424  11.881  -61.193 1.00 21.47  ? 1008 PHE B CA    1 
ATOM   3412 C  C     . PHE D 1 8   ? -4.254  12.849  -61.245 1.00 22.06  ? 1008 PHE B C     1 
ATOM   3413 O  O     . PHE D 1 8   ? -4.354  13.967  -60.737 1.00 24.21  ? 1008 PHE B O     1 
ATOM   3414 C  CB    . PHE D 1 8   ? -6.340  12.086  -62.431 1.00 21.32  ? 1008 PHE B CB    1 
ATOM   3415 C  CG    . PHE D 1 8   ? -7.693  11.397  -62.358 1.00 21.20  ? 1008 PHE B CG    1 
ATOM   3416 C  CD1   . PHE D 1 8   ? -7.895  10.250  -61.588 1.00 22.01  ? 1008 PHE B CD1   1 
ATOM   3417 C  CD2   . PHE D 1 8   ? -8.763  11.898  -63.120 1.00 22.41  ? 1008 PHE B CD2   1 
ATOM   3418 C  CE1   . PHE D 1 8   ? -9.163  9.628   -61.543 1.00 24.37  ? 1008 PHE B CE1   1 
ATOM   3419 C  CE2   . PHE D 1 8   ? -10.021 11.309  -63.103 1.00 23.25  ? 1008 PHE B CE2   1 
ATOM   3420 C  CZ    . PHE D 1 8   ? -10.238 10.161  -62.309 1.00 24.08  ? 1008 PHE B CZ    1 
ATOM   3421 N  N     . ASP D 1 9   ? -3.140  12.435  -61.845 1.00 21.32  ? 1009 ASP B N     1 
ATOM   3422 C  CA    . ASP D 1 9   ? -1.947  13.282  -61.857 1.00 21.31  ? 1009 ASP B CA    1 
ATOM   3423 C  C     . ASP D 1 9   ? -2.036  14.414  -62.893 1.00 20.51  ? 1009 ASP B C     1 
ATOM   3424 O  O     . ASP D 1 9   ? -2.383  14.197  -64.057 1.00 20.28  ? 1009 ASP B O     1 
ATOM   3425 C  CB    . ASP D 1 9   ? -0.660  12.459  -62.106 1.00 21.17  ? 1009 ASP B CB    1 
ATOM   3426 C  CG    . ASP D 1 9   ? -0.480  11.287  -61.123 1.00 22.86  ? 1009 ASP B CG    1 
ATOM   3427 O  OD1   . ASP D 1 9   ? -0.889  11.379  -59.944 1.00 24.26  ? 1009 ASP B OD1   1 
ATOM   3428 O  OD2   . ASP D 1 9   ? 0.104   10.253  -61.542 1.00 24.62  ? 1009 ASP B OD2   1 
ATOM   3429 N  N     . TYR D 1 10  ? -1.669  15.616  -62.469 1.00 20.62  ? 1010 TYR B N     1 
ATOM   3430 C  CA    . TYR D 1 10  ? -1.644  16.792  -63.340 1.00 20.41  ? 1010 TYR B CA    1 
ATOM   3431 C  C     . TYR D 1 10  ? -2.716  16.728  -64.447 1.00 20.26  ? 1010 TYR B C     1 
ATOM   3432 O  O     . TYR D 1 10  ? -2.430  16.890  -65.647 1.00 19.37  ? 1010 TYR B O     1 
ATOM   3433 C  CB    . TYR D 1 10  ? -0.217  17.047  -63.876 1.00 20.95  ? 1010 TYR B CB    1 
ATOM   3434 C  CG    . TYR D 1 10  ? 0.412   15.973  -64.738 1.00 22.85  ? 1010 TYR B CG    1 
ATOM   3435 C  CD1   . TYR D 1 10  ? 0.623   16.189  -66.108 1.00 24.66  ? 1010 TYR B CD1   1 
ATOM   3436 C  CD2   . TYR D 1 10  ? 0.839   14.769  -64.190 1.00 23.89  ? 1010 TYR B CD2   1 
ATOM   3437 C  CE1   . TYR D 1 10  ? 1.237   15.237  -66.899 1.00 25.19  ? 1010 TYR B CE1   1 
ATOM   3438 C  CE2   . TYR D 1 10  ? 1.437   13.796  -64.976 1.00 26.91  ? 1010 TYR B CE2   1 
ATOM   3439 C  CZ    . TYR D 1 10  ? 1.630   14.039  -66.329 1.00 26.51  ? 1010 TYR B CZ    1 
ATOM   3440 O  OH    . TYR D 1 10  ? 2.211   13.069  -67.095 1.00 29.14  ? 1010 TYR B OH    1 
ATOM   3441 N  N     . PHE D 1 11  ? -3.957  16.519  -63.999 1.00 19.14  ? 1011 PHE B N     1 
ATOM   3442 C  CA    . PHE D 1 11  ? -5.017  16.009  -64.868 1.00 18.88  ? 1011 PHE B CA    1 
ATOM   3443 C  C     . PHE D 1 11  ? -5.200  16.655  -66.240 1.00 18.02  ? 1011 PHE B C     1 
ATOM   3444 O  O     . PHE D 1 11  ? -5.066  15.965  -67.252 1.00 18.61  ? 1011 PHE B O     1 
ATOM   3445 C  CB    . PHE D 1 11  ? -6.365  15.836  -64.120 1.00 18.50  ? 1011 PHE B CB    1 
ATOM   3446 C  CG    . PHE D 1 11  ? -7.421  15.114  -64.943 1.00 18.29  ? 1011 PHE B CG    1 
ATOM   3447 C  CD1   . PHE D 1 11  ? -7.117  13.920  -65.593 1.00 17.91  ? 1011 PHE B CD1   1 
ATOM   3448 C  CD2   . PHE D 1 11  ? -8.715  15.633  -65.057 1.00 19.53  ? 1011 PHE B CD2   1 
ATOM   3449 C  CE1   . PHE D 1 11  ? -8.081  13.244  -66.366 1.00 21.13  ? 1011 PHE B CE1   1 
ATOM   3450 C  CE2   . PHE D 1 11  ? -9.709  14.966  -65.823 1.00 20.36  ? 1011 PHE B CE2   1 
ATOM   3451 C  CZ    . PHE D 1 11  ? -9.403  13.784  -66.483 1.00 18.90  ? 1011 PHE B CZ    1 
ATOM   3452 N  N     . TYR D 1 12  ? -5.510  17.955  -66.309 1.00 18.02  ? 1012 TYR B N     1 
ATOM   3453 C  CA    . TYR D 1 12  ? -5.779  18.564  -67.620 1.00 17.62  ? 1012 TYR B CA    1 
ATOM   3454 C  C     . TYR D 1 12  ? -4.570  18.491  -68.564 1.00 18.21  ? 1012 TYR B C     1 
ATOM   3455 O  O     . TYR D 1 12  ? -4.704  18.216  -69.784 1.00 17.30  ? 1012 TYR B O     1 
ATOM   3456 C  CB    . TYR D 1 12  ? -6.230  20.027  -67.476 1.00 17.17  ? 1012 TYR B CB    1 
ATOM   3457 C  CG    . TYR D 1 12  ? -7.572  20.251  -66.779 1.00 17.56  ? 1012 TYR B CG    1 
ATOM   3458 C  CD1   . TYR D 1 12  ? -8.294  19.192  -66.207 1.00 16.70  ? 1012 TYR B CD1   1 
ATOM   3459 C  CD2   . TYR D 1 12  ? -8.111  21.538  -66.709 1.00 16.60  ? 1012 TYR B CD2   1 
ATOM   3460 C  CE1   . TYR D 1 12  ? -9.538  19.419  -65.574 1.00 18.94  ? 1012 TYR B CE1   1 
ATOM   3461 C  CE2   . TYR D 1 12  ? -9.332  21.792  -66.071 1.00 17.88  ? 1012 TYR B CE2   1 
ATOM   3462 C  CZ    . TYR D 1 12  ? -10.040 20.741  -65.513 1.00 20.14  ? 1012 TYR B CZ    1 
ATOM   3463 O  OH    . TYR D 1 12  ? -11.235 21.017  -64.908 1.00 19.14  ? 1012 TYR B OH    1 
ATOM   3464 N  N     . ALA D 1 13  ? -3.397  18.778  -68.003 1.00 18.31  ? 1013 ALA B N     1 
ATOM   3465 C  CA    . ALA D 1 13  ? -2.158  18.780  -68.772 1.00 19.23  ? 1013 ALA B CA    1 
ATOM   3466 C  C     . ALA D 1 13  ? -1.812  17.353  -69.178 1.00 19.50  ? 1013 ALA B C     1 
ATOM   3467 O  O     . ALA D 1 13  ? -1.308  17.129  -70.278 1.00 19.57  ? 1013 ALA B O     1 
ATOM   3468 C  CB    . ALA D 1 13  ? -0.999  19.437  -67.977 1.00 19.29  ? 1013 ALA B CB    1 
ATOM   3469 N  N     . GLN D 1 14  ? -2.147  16.389  -68.331 1.00 19.07  ? 1014 GLN B N     1 
ATOM   3470 C  CA    . GLN D 1 14  ? -1.893  14.992  -68.698 1.00 18.92  ? 1014 GLN B CA    1 
ATOM   3471 C  C     . GLN D 1 14  ? -2.740  14.511  -69.893 1.00 19.40  ? 1014 GLN B C     1 
ATOM   3472 O  O     . GLN D 1 14  ? -2.199  13.904  -70.825 1.00 19.07  ? 1014 GLN B O     1 
ATOM   3473 C  CB    . GLN D 1 14  ? -2.011  14.036  -67.511 1.00 19.38  ? 1014 GLN B CB    1 
ATOM   3474 C  CG    . GLN D 1 14  ? -1.288  12.706  -67.820 1.00 18.66  ? 1014 GLN B CG    1 
ATOM   3475 C  CD    . GLN D 1 14  ? -1.480  11.621  -66.790 1.00 21.07  ? 1014 GLN B CD    1 
ATOM   3476 O  OE1   . GLN D 1 14  ? -2.029  11.840  -65.690 1.00 24.19  ? 1014 GLN B OE1   1 
ATOM   3477 N  NE2   . GLN D 1 14  ? -1.012  10.428  -67.130 1.00 17.23  ? 1014 GLN B NE2   1 
ATOM   3478 N  N     . VAL D 1 15  ? -4.044  14.800  -69.877 1.00 19.14  ? 1015 VAL B N     1 
ATOM   3479 C  CA    . VAL D 1 15  ? -4.933  14.474  -71.007 1.00 18.98  ? 1015 VAL B CA    1 
ATOM   3480 C  C     . VAL D 1 15  ? -4.428  15.087  -72.337 1.00 18.97  ? 1015 VAL B C     1 
ATOM   3481 O  O     . VAL D 1 15  ? -4.389  14.398  -73.384 1.00 18.65  ? 1015 VAL B O     1 
ATOM   3482 C  CB    . VAL D 1 15  ? -6.392  14.946  -70.735 1.00 18.70  ? 1015 VAL B CB    1 
ATOM   3483 C  CG1   . VAL D 1 15  ? -7.291  14.714  -71.976 1.00 19.56  ? 1015 VAL B CG1   1 
ATOM   3484 C  CG2   . VAL D 1 15  ? -6.969  14.239  -69.517 1.00 18.64  ? 1015 VAL B CG2   1 
ATOM   3485 N  N     . GLU D 1 16  ? -4.040  16.367  -72.288 1.00 18.78  ? 1016 GLU B N     1 
ATOM   3486 C  CA    . GLU D 1 16  ? -3.437  17.036  -73.438 1.00 19.73  ? 1016 GLU B CA    1 
ATOM   3487 C  C     . GLU D 1 16  ? -2.181  16.304  -73.959 1.00 20.02  ? 1016 GLU B C     1 
ATOM   3488 O  O     . GLU D 1 16  ? -2.044  16.119  -75.165 1.00 19.22  ? 1016 GLU B O     1 
ATOM   3489 C  CB    . GLU D 1 16  ? -3.155  18.518  -73.147 1.00 19.50  ? 1016 GLU B CB    1 
ATOM   3490 C  CG    . GLU D 1 16  ? -4.432  19.374  -72.831 1.00 19.30  ? 1016 GLU B CG    1 
ATOM   3491 C  CD    . GLU D 1 16  ? -5.350  19.608  -74.042 1.00 21.90  ? 1016 GLU B CD    1 
ATOM   3492 O  OE1   . GLU D 1 16  ? -4.961  19.231  -75.160 1.00 22.94  ? 1016 GLU B OE1   1 
ATOM   3493 O  OE2   . GLU D 1 16  ? -6.464  20.199  -73.886 1.00 21.12  ? 1016 GLU B OE2   1 
ATOM   3494 N  N     . GLU D 1 17  ? -1.295  15.874  -73.062 1.00 20.75  ? 1017 GLU B N     1 
ATOM   3495 C  CA    . GLU D 1 17  ? -0.113  15.071  -73.476 1.00 22.91  ? 1017 GLU B CA    1 
ATOM   3496 C  C     . GLU D 1 17  ? -0.471  13.708  -74.078 1.00 22.98  ? 1017 GLU B C     1 
ATOM   3497 O  O     . GLU D 1 17  ? 0.197   13.238  -74.994 1.00 22.57  ? 1017 GLU B O     1 
ATOM   3498 C  CB    . GLU D 1 17  ? 0.846   14.837  -72.318 1.00 23.49  ? 1017 GLU B CB    1 
ATOM   3499 C  CG    . GLU D 1 17  ? 1.558   16.069  -71.816 1.00 27.48  ? 1017 GLU B CG    1 
ATOM   3500 C  CD    . GLU D 1 17  ? 2.515   15.755  -70.665 1.00 31.53  ? 1017 GLU B CD    1 
ATOM   3501 O  OE1   . GLU D 1 17  ? 2.513   14.609  -70.156 1.00 34.31  ? 1017 GLU B OE1   1 
ATOM   3502 O  OE2   . GLU D 1 17  ? 3.262   16.667  -70.261 1.00 34.75  ? 1017 GLU B OE2   1 
ATOM   3503 N  N     . VAL D 1 18  ? -1.514  13.074  -73.550 1.00 23.24  ? 1018 VAL B N     1 
ATOM   3504 C  CA    . VAL D 1 18  ? -1.989  11.794  -74.097 1.00 23.56  ? 1018 VAL B CA    1 
ATOM   3505 C  C     . VAL D 1 18  ? -2.536  11.992  -75.522 1.00 23.67  ? 1018 VAL B C     1 
ATOM   3506 O  O     . VAL D 1 18  ? -2.213  11.228  -76.436 1.00 23.44  ? 1018 VAL B O     1 
ATOM   3507 C  CB    . VAL D 1 18  ? -3.061  11.141  -73.177 1.00 23.76  ? 1018 VAL B CB    1 
ATOM   3508 C  CG1   . VAL D 1 18  ? -3.761  9.949   -73.881 1.00 22.95  ? 1018 VAL B CG1   1 
ATOM   3509 C  CG2   . VAL D 1 18  ? -2.428  10.708  -71.849 1.00 23.96  ? 1018 VAL B CG2   1 
ATOM   3510 N  N     . LEU D 1 19  ? -3.333  13.043  -75.703 1.00 23.83  ? 1019 LEU B N     1 
ATOM   3511 C  CA    . LEU D 1 19  ? -3.882  13.384  -77.012 1.00 23.83  ? 1019 LEU B CA    1 
ATOM   3512 C  C     . LEU D 1 19  ? -2.806  13.803  -77.994 1.00 24.12  ? 1019 LEU B C     1 
ATOM   3513 O  O     . LEU D 1 19  ? -2.871  13.455  -79.175 1.00 22.42  ? 1019 LEU B O     1 
ATOM   3514 C  CB    . LEU D 1 19  ? -4.899  14.516  -76.875 1.00 23.55  ? 1019 LEU B CB    1 
ATOM   3515 C  CG    . LEU D 1 19  ? -6.409  14.246  -76.849 1.00 25.61  ? 1019 LEU B CG    1 
ATOM   3516 C  CD1   . LEU D 1 19  ? -6.807  12.772  -76.711 1.00 23.84  ? 1019 LEU B CD1   1 
ATOM   3517 C  CD2   . LEU D 1 19  ? -7.139  15.149  -75.851 1.00 23.21  ? 1019 LEU B CD2   1 
ATOM   3518 N  N     . ASN D 1 20  ? -1.844  14.582  -77.508 1.00 24.98  ? 1020 ASN B N     1 
ATOM   3519 C  CA    . ASN D 1 20  ? -0.840  15.201  -78.382 1.00 26.38  ? 1020 ASN B CA    1 
ATOM   3520 C  C     . ASN D 1 20  ? 0.584   14.774  -77.976 1.00 27.27  ? 1020 ASN B C     1 
ATOM   3521 O  O     . ASN D 1 20  ? 1.196   15.397  -77.118 1.00 26.77  ? 1020 ASN B O     1 
ATOM   3522 C  CB    . ASN D 1 20  ? -1.019  16.740  -78.393 1.00 25.95  ? 1020 ASN B CB    1 
ATOM   3523 C  CG    . ASN D 1 20  ? -0.151  17.450  -79.456 1.00 27.07  ? 1020 ASN B CG    1 
ATOM   3524 O  OD1   . ASN D 1 20  ? 0.803   16.888  -79.977 1.00 25.13  ? 1020 ASN B OD1   1 
ATOM   3525 N  ND2   . ASN D 1 20  ? -0.482  18.703  -79.748 1.00 28.76  ? 1020 ASN B ND2   1 
ATOM   3526 N  N     . PRO D 1 21  ? 1.116   13.706  -78.606 1.00 29.03  ? 1021 PRO B N     1 
ATOM   3527 C  CA    . PRO D 1 21  ? 2.458   13.190  -78.278 1.00 30.05  ? 1021 PRO B CA    1 
ATOM   3528 C  C     . PRO D 1 21  ? 3.589   14.233  -78.437 1.00 30.91  ? 1021 PRO B C     1 
ATOM   3529 O  O     . PRO D 1 21  ? 4.605   14.141  -77.732 1.00 31.15  ? 1021 PRO B O     1 
ATOM   3530 C  CB    . PRO D 1 21  ? 2.653   12.058  -79.295 1.00 30.20  ? 1021 PRO B CB    1 
ATOM   3531 C  CG    . PRO D 1 21  ? 1.803   12.467  -80.473 1.00 29.72  ? 1021 PRO B CG    1 
ATOM   3532 C  CD    . PRO D 1 21  ? 0.580   13.078  -79.832 1.00 29.21  ? 1021 PRO B CD    1 
ATOM   3533 N  N     . SER D 1 22  ? 3.388   15.215  -79.325 1.00 31.73  ? 1022 SER B N     1 
ATOM   3534 C  CA    . SER D 1 22  ? 4.344   16.309  -79.573 1.00 32.44  ? 1022 SER B CA    1 
ATOM   3535 C  C     . SER D 1 22  ? 4.691   17.117  -78.320 1.00 33.14  ? 1022 SER B C     1 
ATOM   3536 O  O     . SER D 1 22  ? 5.691   17.838  -78.316 1.00 33.18  ? 1022 SER B O     1 
ATOM   3537 C  CB    . SER D 1 22  ? 3.803   17.276  -80.637 1.00 32.65  ? 1022 SER B CB    1 
ATOM   3538 O  OG    . SER D 1 22  ? 3.732   16.691  -81.928 1.00 32.58  ? 1022 SER B OG    1 
ATOM   3539 N  N     . LEU D 1 23  ? 3.863   16.985  -77.279 1.00 33.34  ? 1023 LEU B N     1 
ATOM   3540 C  CA    . LEU D 1 23  ? 3.996   17.721  -76.014 1.00 34.46  ? 1023 LEU B CA    1 
ATOM   3541 C  C     . LEU D 1 23  ? 4.882   17.058  -74.940 1.00 35.22  ? 1023 LEU B C     1 
ATOM   3542 O  O     . LEU D 1 23  ? 5.557   17.751  -74.172 1.00 34.94  ? 1023 LEU B O     1 
ATOM   3543 C  CB    . LEU D 1 23  ? 2.603   17.966  -75.411 1.00 33.80  ? 1023 LEU B CB    1 
ATOM   3544 C  CG    . LEU D 1 23  ? 1.727   19.161  -75.805 1.00 34.38  ? 1023 LEU B CG    1 
ATOM   3545 C  CD1   . LEU D 1 23  ? 1.855   19.601  -77.244 1.00 34.62  ? 1023 LEU B CD1   1 
ATOM   3546 C  CD2   . LEU D 1 23  ? 0.259   18.866  -75.464 1.00 32.93  ? 1023 LEU B CD2   1 
ATOM   3547 N  N     . LYS D 1 24  ? 4.831   15.730  -74.850 1.00 36.51  ? 1024 LYS B N     1 
ATOM   3548 C  CA    . LYS D 1 24  ? 5.589   14.984  -73.829 1.00 37.51  ? 1024 LYS B CA    1 
ATOM   3549 C  C     . LYS D 1 24  ? 7.060   15.417  -73.834 1.00 37.39  ? 1024 LYS B C     1 
ATOM   3550 O  O     . LYS D 1 24  ? 7.674   15.528  -74.893 1.00 37.15  ? 1024 LYS B O     1 
ATOM   3551 C  CB    . LYS D 1 24  ? 5.477   13.469  -74.064 1.00 38.15  ? 1024 LYS B CB    1 
ATOM   3552 C  CG    . LYS D 1 24  ? 5.451   12.621  -72.773 1.00 39.70  ? 1024 LYS B CG    1 
ATOM   3553 C  CD    . LYS D 1 24  ? 4.880   11.227  -73.049 1.00 41.83  ? 1024 LYS B CD    1 
ATOM   3554 C  CE    . LYS D 1 24  ? 5.211   10.225  -71.939 1.00 42.75  ? 1024 LYS B CE    1 
ATOM   3555 N  NZ    . LYS D 1 24  ? 4.352   10.373  -70.719 1.00 42.35  ? 1024 LYS B NZ    1 
ATOM   3556 N  N     . GLY D 1 25  ? 7.601   15.702  -72.653 1.00 37.32  ? 1025 GLY B N     1 
ATOM   3557 C  CA    . GLY D 1 25  ? 8.999   16.122  -72.541 1.00 37.02  ? 1025 GLY B CA    1 
ATOM   3558 C  C     . GLY D 1 25  ? 9.240   17.615  -72.386 1.00 36.88  ? 1025 GLY B C     1 
ATOM   3559 O  O     . GLY D 1 25  ? 10.370  18.036  -72.115 1.00 37.17  ? 1025 GLY B O     1 
ATOM   3560 N  N     . LYS D 1 26  ? 8.193   18.421  -72.565 1.00 36.17  ? 1026 LYS B N     1 
ATOM   3561 C  CA    . LYS D 1 26  ? 8.303   19.873  -72.392 1.00 35.30  ? 1026 LYS B CA    1 
ATOM   3562 C  C     . LYS D 1 26  ? 7.278   20.427  -71.403 1.00 34.28  ? 1026 LYS B C     1 
ATOM   3563 O  O     . LYS D 1 26  ? 6.303   19.735  -71.065 1.00 33.45  ? 1026 LYS B O     1 
ATOM   3564 C  CB    . LYS D 1 26  ? 8.257   20.649  -73.730 1.00 36.07  ? 1026 LYS B CB    1 
ATOM   3565 C  CG    . LYS D 1 26  ? 7.479   20.045  -74.901 1.00 36.54  ? 1026 LYS B CG    1 
ATOM   3566 C  CD    . LYS D 1 26  ? 8.440   19.344  -75.868 1.00 38.15  ? 1026 LYS B CD    1 
ATOM   3567 C  CE    . LYS D 1 26  ? 8.045   19.570  -77.329 1.00 38.63  ? 1026 LYS B CE    1 
ATOM   3568 N  NZ    . LYS D 1 26  ? 8.602   18.505  -78.214 1.00 38.30  ? 1026 LYS B NZ    1 
ATOM   3569 N  N     . PRO D 1 27  ? 7.514   21.662  -70.908 1.00 32.97  ? 1027 PRO B N     1 
ATOM   3570 C  CA    . PRO D 1 27  ? 6.559   22.266  -69.976 1.00 31.76  ? 1027 PRO B CA    1 
ATOM   3571 C  C     . PRO D 1 27  ? 5.254   22.594  -70.690 1.00 30.18  ? 1027 PRO B C     1 
ATOM   3572 O  O     . PRO D 1 27  ? 5.272   23.209  -71.770 1.00 29.37  ? 1027 PRO B O     1 
ATOM   3573 C  CB    . PRO D 1 27  ? 7.261   23.551  -69.524 1.00 32.10  ? 1027 PRO B CB    1 
ATOM   3574 C  CG    . PRO D 1 27  ? 8.731   23.344  -69.880 1.00 32.55  ? 1027 PRO B CG    1 
ATOM   3575 C  CD    . PRO D 1 27  ? 8.688   22.528  -71.126 1.00 33.16  ? 1027 PRO B CD    1 
ATOM   3576 N  N     . VAL D 1 28  ? 4.142   22.157  -70.089 1.00 28.34  ? 1028 VAL B N     1 
ATOM   3577 C  CA    . VAL D 1 28  ? 2.793   22.385  -70.615 1.00 26.67  ? 1028 VAL B CA    1 
ATOM   3578 C  C     . VAL D 1 28  ? 1.981   23.140  -69.562 1.00 25.82  ? 1028 VAL B C     1 
ATOM   3579 O  O     . VAL D 1 28  ? 1.978   22.754  -68.376 1.00 25.32  ? 1028 VAL B O     1 
ATOM   3580 C  CB    . VAL D 1 28  ? 2.083   21.043  -70.958 1.00 27.03  ? 1028 VAL B CB    1 
ATOM   3581 C  CG1   . VAL D 1 28  ? 0.622   21.269  -71.343 1.00 27.00  ? 1028 VAL B CG1   1 
ATOM   3582 C  CG2   . VAL D 1 28  ? 2.822   20.296  -72.079 1.00 26.38  ? 1028 VAL B CG2   1 
ATOM   3583 N  N     . VAL D 1 29  ? 1.320   24.219  -69.996 1.00 23.87  ? 1029 VAL B N     1 
ATOM   3584 C  CA    . VAL D 1 29  ? 0.506   25.049  -69.117 1.00 22.36  ? 1029 VAL B CA    1 
ATOM   3585 C  C     . VAL D 1 29  ? -0.903  25.149  -69.718 1.00 22.00  ? 1029 VAL B C     1 
ATOM   3586 O  O     . VAL D 1 29  ? -1.055  25.597  -70.852 1.00 21.22  ? 1029 VAL B O     1 
ATOM   3587 C  CB    . VAL D 1 29  ? 1.093   26.470  -68.994 1.00 22.64  ? 1029 VAL B CB    1 
ATOM   3588 C  CG1   . VAL D 1 29  ? 0.284   27.303  -68.011 1.00 21.91  ? 1029 VAL B CG1   1 
ATOM   3589 C  CG2   . VAL D 1 29  ? 2.593   26.427  -68.603 1.00 21.65  ? 1029 VAL B CG2   1 
ATOM   3590 N  N     . VAL D 1 30  ? -1.915  24.733  -68.953 1.00 20.96  ? 1030 VAL B N     1 
ATOM   3591 C  CA    . VAL D 1 30  ? -3.318  24.808  -69.408 1.00 20.21  ? 1030 VAL B CA    1 
ATOM   3592 C  C     . VAL D 1 30  ? -3.970  26.099  -68.896 1.00 20.22  ? 1030 VAL B C     1 
ATOM   3593 O  O     . VAL D 1 30  ? -3.962  26.378  -67.694 1.00 20.51  ? 1030 VAL B O     1 
ATOM   3594 C  CB    . VAL D 1 30  ? -4.096  23.535  -69.019 1.00 20.12  ? 1030 VAL B CB    1 
ATOM   3595 C  CG1   . VAL D 1 30  ? -5.570  23.628  -69.471 1.00 20.68  ? 1030 VAL B CG1   1 
ATOM   3596 C  CG2   . VAL D 1 30  ? -3.411  22.293  -69.664 1.00 20.69  ? 1030 VAL B CG2   1 
ATOM   3597 N  N     . CYS D 1 31  ? -4.508  26.882  -69.820 1.00 19.84  ? 1031 CYS B N     1 
ATOM   3598 C  CA    . CYS D 1 31  ? -4.858  28.275  -69.568 1.00 20.75  ? 1031 CYS B CA    1 
ATOM   3599 C  C     . CYS D 1 31  ? -6.341  28.532  -69.722 1.00 21.12  ? 1031 CYS B C     1 
ATOM   3600 O  O     . CYS D 1 31  ? -6.978  28.016  -70.650 1.00 20.82  ? 1031 CYS B O     1 
ATOM   3601 C  CB    . CYS D 1 31  ? -4.126  29.186  -70.540 1.00 20.08  ? 1031 CYS B CB    1 
ATOM   3602 S  SG    . CYS D 1 31  ? -2.328  29.023  -70.455 1.00 25.26  ? 1031 CYS B SG    1 
ATOM   3603 N  N     . VAL D 1 32  ? -6.874  29.331  -68.804 1.00 21.15  ? 1032 VAL B N     1 
ATOM   3604 C  CA    . VAL D 1 32  ? -8.238  29.858  -68.929 1.00 22.00  ? 1032 VAL B CA    1 
ATOM   3605 C  C     . VAL D 1 32  ? -8.161  31.274  -69.470 1.00 22.77  ? 1032 VAL B C     1 
ATOM   3606 O  O     . VAL D 1 32  ? -7.949  32.218  -68.712 1.00 22.86  ? 1032 VAL B O     1 
ATOM   3607 C  CB    . VAL D 1 32  ? -8.989  29.834  -67.592 1.00 21.33  ? 1032 VAL B CB    1 
ATOM   3608 C  CG1   . VAL D 1 32  ? -10.470 30.219  -67.791 1.00 22.68  ? 1032 VAL B CG1   1 
ATOM   3609 C  CG2   . VAL D 1 32  ? -8.913  28.440  -66.946 1.00 23.74  ? 1032 VAL B CG2   1 
ATOM   3610 N  N     . PHE D 1 33  ? -8.346  31.411  -70.777 1.00 23.98  ? 1033 PHE B N     1 
ATOM   3611 C  CA    . PHE D 1 33  ? -8.293  32.706  -71.445 1.00 26.22  ? 1033 PHE B CA    1 
ATOM   3612 C  C     . PHE D 1 33  ? -9.619  33.437  -71.245 1.00 27.15  ? 1033 PHE B C     1 
ATOM   3613 O  O     . PHE D 1 33  ? -10.689 32.890  -71.534 1.00 27.89  ? 1033 PHE B O     1 
ATOM   3614 C  CB    . PHE D 1 33  ? -7.972  32.548  -72.938 1.00 26.00  ? 1033 PHE B CB    1 
ATOM   3615 C  CG    . PHE D 1 33  ? -6.618  31.956  -73.208 1.00 27.25  ? 1033 PHE B CG    1 
ATOM   3616 C  CD1   . PHE D 1 33  ? -5.464  32.737  -73.103 1.00 27.29  ? 1033 PHE B CD1   1 
ATOM   3617 C  CD2   . PHE D 1 33  ? -6.487  30.619  -73.565 1.00 27.44  ? 1033 PHE B CD2   1 
ATOM   3618 C  CE1   . PHE D 1 33  ? -4.188  32.197  -73.341 1.00 26.92  ? 1033 PHE B CE1   1 
ATOM   3619 C  CE2   . PHE D 1 33  ? -5.221  30.069  -73.811 1.00 27.19  ? 1033 PHE B CE2   1 
ATOM   3620 C  CZ    . PHE D 1 33  ? -4.064  30.874  -73.701 1.00 28.46  ? 1033 PHE B CZ    1 
ATOM   3621 N  N     . SER D 1 34  ? -9.552  34.655  -70.721 1.00 27.85  ? 1034 SER B N     1 
ATOM   3622 C  CA    . SER D 1 34  ? -10.765 35.401  -70.368 1.00 28.48  ? 1034 SER B CA    1 
ATOM   3623 C  C     . SER D 1 34  ? -11.352 36.225  -71.513 1.00 29.42  ? 1034 SER B C     1 
ATOM   3624 O  O     . SER D 1 34  ? -12.498 36.696  -71.422 1.00 29.28  ? 1034 SER B O     1 
ATOM   3625 C  CB    . SER D 1 34  ? -10.489 36.305  -69.174 1.00 28.70  ? 1034 SER B CB    1 
ATOM   3626 O  OG    . SER D 1 34  ? -9.631  37.358  -69.570 1.00 28.04  ? 1034 SER B OG    1 
ATOM   3627 N  N     . GLY D 1 35  ? -10.573 36.427  -72.576 1.00 30.05  ? 1035 GLY B N     1 
ATOM   3628 C  CA    . GLY D 1 35  ? -11.060 37.158  -73.742 1.00 31.25  ? 1035 GLY B CA    1 
ATOM   3629 C  C     . GLY D 1 35  ? -11.100 38.680  -73.618 1.00 32.27  ? 1035 GLY B C     1 
ATOM   3630 O  O     . GLY D 1 35  ? -11.622 39.365  -74.504 1.00 31.66  ? 1035 GLY B O     1 
ATOM   3631 N  N     . ARG D 1 36  ? -10.569 39.205  -72.514 1.00 33.23  ? 1036 ARG B N     1 
ATOM   3632 C  CA    . ARG D 1 36  ? -10.373 40.651  -72.314 1.00 33.99  ? 1036 ARG B CA    1 
ATOM   3633 C  C     . ARG D 1 36  ? -9.441  41.203  -73.392 1.00 34.07  ? 1036 ARG B C     1 
ATOM   3634 O  O     . ARG D 1 36  ? -9.776  42.132  -74.134 1.00 34.26  ? 1036 ARG B O     1 
ATOM   3635 C  CB    . ARG D 1 36  ? -9.712  40.873  -70.945 1.00 34.64  ? 1036 ARG B CB    1 
ATOM   3636 C  CG    . ARG D 1 36  ? -10.574 41.468  -69.859 1.00 36.64  ? 1036 ARG B CG    1 
ATOM   3637 C  CD    . ARG D 1 36  ? -10.329 42.972  -69.723 1.00 39.84  ? 1036 ARG B CD    1 
ATOM   3638 N  NE    . ARG D 1 36  ? -11.542 43.631  -69.251 1.00 43.57  ? 1036 ARG B NE    1 
ATOM   3639 C  CZ    . ARG D 1 36  ? -11.801 43.927  -67.981 1.00 45.93  ? 1036 ARG B CZ    1 
ATOM   3640 N  NH1   . ARG D 1 36  ? -10.920 43.659  -67.020 1.00 47.22  ? 1036 ARG B NH1   1 
ATOM   3641 N  NH2   . ARG D 1 36  ? -12.952 44.501  -67.676 1.00 47.80  ? 1036 ARG B NH2   1 
ATOM   3642 N  N     . PHE D 1 37  ? -8.257  40.612  -73.457 1.00 33.82  ? 1037 PHE B N     1 
ATOM   3643 C  CA    . PHE D 1 37  ? -7.212  41.009  -74.386 1.00 33.76  ? 1037 PHE B CA    1 
ATOM   3644 C  C     . PHE D 1 37  ? -6.327  39.781  -74.620 1.00 33.29  ? 1037 PHE B C     1 
ATOM   3645 O  O     . PHE D 1 37  ? -6.601  38.715  -74.080 1.00 32.29  ? 1037 PHE B O     1 
ATOM   3646 C  CB    . PHE D 1 37  ? -6.403  42.187  -73.825 1.00 33.80  ? 1037 PHE B CB    1 
ATOM   3647 C  CG    . PHE D 1 37  ? -5.833  41.942  -72.455 1.00 34.74  ? 1037 PHE B CG    1 
ATOM   3648 C  CD1   . PHE D 1 37  ? -4.625  41.277  -72.298 1.00 34.58  ? 1037 PHE B CD1   1 
ATOM   3649 C  CD2   . PHE D 1 37  ? -6.494  42.398  -71.318 1.00 35.21  ? 1037 PHE B CD2   1 
ATOM   3650 C  CE1   . PHE D 1 37  ? -4.089  41.053  -71.031 1.00 34.37  ? 1037 PHE B CE1   1 
ATOM   3651 C  CE2   . PHE D 1 37  ? -5.959  42.172  -70.046 1.00 35.04  ? 1037 PHE B CE2   1 
ATOM   3652 C  CZ    . PHE D 1 37  ? -4.756  41.501  -69.910 1.00 34.04  ? 1037 PHE B CZ    1 
ATOM   3653 N  N     . GLU D 1 38  ? -5.279  39.924  -75.428 1.00 33.41  ? 1038 GLU B N     1 
ATOM   3654 C  CA    . GLU D 1 38  ? -4.400  38.791  -75.702 1.00 33.24  ? 1038 GLU B CA    1 
ATOM   3655 C  C     . GLU D 1 38  ? -3.792  38.285  -74.403 1.00 33.08  ? 1038 GLU B C     1 
ATOM   3656 O  O     . GLU D 1 38  ? -3.131  39.043  -73.688 1.00 33.39  ? 1038 GLU B O     1 
ATOM   3657 C  CB    . GLU D 1 38  ? -3.301  39.182  -76.686 1.00 33.68  ? 1038 GLU B CB    1 
ATOM   3658 C  CG    . GLU D 1 38  ? -2.228  38.115  -76.869 1.00 34.44  ? 1038 GLU B CG    1 
ATOM   3659 C  CD    . GLU D 1 38  ? -1.463  38.312  -78.155 1.00 36.83  ? 1038 GLU B CD    1 
ATOM   3660 O  OE1   . GLU D 1 38  ? -0.377  38.933  -78.116 1.00 37.63  ? 1038 GLU B OE1   1 
ATOM   3661 O  OE2   . GLU D 1 38  ? -1.972  37.880  -79.209 1.00 37.64  ? 1038 GLU B OE2   1 
ATOM   3662 N  N     . ASP D 1 39  ? -4.033  37.011  -74.095 1.00 31.94  ? 1039 ASP B N     1 
ATOM   3663 C  CA    . ASP D 1 39  ? -3.429  36.360  -72.918 1.00 31.40  ? 1039 ASP B CA    1 
ATOM   3664 C  C     . ASP D 1 39  ? -3.965  36.793  -71.539 1.00 29.80  ? 1039 ASP B C     1 
ATOM   3665 O  O     . ASP D 1 39  ? -3.316  36.554  -70.515 1.00 29.27  ? 1039 ASP B O     1 
ATOM   3666 C  CB    . ASP D 1 39  ? -1.905  36.485  -72.950 1.00 31.83  ? 1039 ASP B CB    1 
ATOM   3667 C  CG    . ASP D 1 39  ? -1.282  35.752  -74.134 1.00 34.77  ? 1039 ASP B CG    1 
ATOM   3668 O  OD1   . ASP D 1 39  ? -1.901  34.789  -74.652 1.00 37.51  ? 1039 ASP B OD1   1 
ATOM   3669 O  OD2   . ASP D 1 39  ? -0.166  36.140  -74.537 1.00 37.31  ? 1039 ASP B OD2   1 
ATOM   3670 N  N     . SER D 1 40  ? -5.129  37.439  -71.501 1.00 28.57  ? 1040 SER B N     1 
ATOM   3671 C  CA    . SER D 1 40  ? -5.756  37.709  -70.211 1.00 27.08  ? 1040 SER B CA    1 
ATOM   3672 C  C     . SER D 1 40  ? -6.293  36.381  -69.676 1.00 26.13  ? 1040 SER B C     1 
ATOM   3673 O  O     . SER D 1 40  ? -6.714  35.517  -70.450 1.00 25.75  ? 1040 SER B O     1 
ATOM   3674 C  CB    . SER D 1 40  ? -6.882  38.744  -70.333 1.00 27.43  ? 1040 SER B CB    1 
ATOM   3675 O  OG    . SER D 1 40  ? -7.886  38.313  -71.239 1.00 29.57  ? 1040 SER B OG    1 
ATOM   3676 N  N     . GLY D 1 41  ? -6.252  36.207  -68.363 1.00 25.21  ? 1041 GLY B N     1 
ATOM   3677 C  CA    . GLY D 1 41  ? -6.766  34.983  -67.742 1.00 24.17  ? 1041 GLY B CA    1 
ATOM   3678 C  C     . GLY D 1 41  ? -5.777  34.356  -66.787 1.00 23.51  ? 1041 GLY B C     1 
ATOM   3679 O  O     . GLY D 1 41  ? -4.779  34.974  -66.400 1.00 24.19  ? 1041 GLY B O     1 
ATOM   3680 N  N     . ALA D 1 42  ? -6.030  33.104  -66.435 1.00 21.91  ? 1042 ALA B N     1 
ATOM   3681 C  CA    . ALA D 1 42  ? -5.294  32.467  -65.380 1.00 21.43  ? 1042 ALA B CA    1 
ATOM   3682 C  C     . ALA D 1 42  ? -4.990  31.025  -65.771 1.00 21.11  ? 1042 ALA B C     1 
ATOM   3683 O  O     . ALA D 1 42  ? -5.665  30.462  -66.639 1.00 20.26  ? 1042 ALA B O     1 
ATOM   3684 C  CB    . ALA D 1 42  ? -6.116  32.496  -64.088 1.00 20.92  ? 1042 ALA B CB    1 
ATOM   3685 N  N     . VAL D 1 43  ? -3.996  30.449  -65.105 1.00 19.97  ? 1043 VAL B N     1 
ATOM   3686 C  CA    . VAL D 1 43  ? -3.596  29.045  -65.274 1.00 20.13  ? 1043 VAL B CA    1 
ATOM   3687 C  C     . VAL D 1 43  ? -4.542  28.059  -64.556 1.00 19.85  ? 1043 VAL B C     1 
ATOM   3688 O  O     . VAL D 1 43  ? -4.844  28.216  -63.364 1.00 19.77  ? 1043 VAL B O     1 
ATOM   3689 C  CB    . VAL D 1 43  ? -2.146  28.842  -64.782 1.00 20.18  ? 1043 VAL B CB    1 
ATOM   3690 C  CG1   . VAL D 1 43  ? -1.747  27.362  -64.816 1.00 18.45  ? 1043 VAL B CG1   1 
ATOM   3691 C  CG2   . VAL D 1 43  ? -1.202  29.698  -65.628 1.00 19.72  ? 1043 VAL B CG2   1 
ATOM   3692 N  N     . ALA D 1 44  ? -5.034  27.050  -65.274 1.00 19.54  ? 1044 ALA B N     1 
ATOM   3693 C  CA    . ALA D 1 44  ? -5.869  26.006  -64.631 1.00 19.70  ? 1044 ALA B CA    1 
ATOM   3694 C  C     . ALA D 1 44  ? -4.984  24.964  -63.923 1.00 20.03  ? 1044 ALA B C     1 
ATOM   3695 O  O     . ALA D 1 44  ? -5.242  24.528  -62.791 1.00 20.19  ? 1044 ALA B O     1 
ATOM   3696 C  CB    . ALA D 1 44  ? -6.782  25.323  -65.686 1.00 19.79  ? 1044 ALA B CB    1 
ATOM   3697 N  N     . THR D 1 45  ? -3.950  24.541  -64.630 1.00 20.37  ? 1045 THR B N     1 
ATOM   3698 C  CA    . THR D 1 45  ? -2.927  23.656  -64.079 1.00 21.41  ? 1045 THR B CA    1 
ATOM   3699 C  C     . THR D 1 45  ? -1.729  23.677  -65.012 1.00 21.19  ? 1045 THR B C     1 
ATOM   3700 O  O     . THR D 1 45  ? -1.782  24.275  -66.074 1.00 21.13  ? 1045 THR B O     1 
ATOM   3701 C  CB    . THR D 1 45  ? -3.403  22.207  -63.926 1.00 21.86  ? 1045 THR B CB    1 
ATOM   3702 O  OG1   . THR D 1 45  ? -2.522  21.542  -63.021 1.00 22.78  ? 1045 THR B OG1   1 
ATOM   3703 C  CG2   . THR D 1 45  ? -3.390  21.447  -65.277 1.00 21.96  ? 1045 THR B CG2   1 
ATOM   3704 N  N     . ALA D 1 46  ? -0.664  22.993  -64.622 1.00 21.88  ? 1046 ALA B N     1 
ATOM   3705 C  CA    . ALA D 1 46  ? 0.512   22.871  -65.467 1.00 22.32  ? 1046 ALA B CA    1 
ATOM   3706 C  C     . ALA D 1 46  ? 1.146   21.532  -65.137 1.00 22.28  ? 1046 ALA B C     1 
ATOM   3707 O  O     . ALA D 1 46  ? 0.929   21.017  -64.040 1.00 22.14  ? 1046 ALA B O     1 
ATOM   3708 C  CB    . ALA D 1 46  ? 1.472   24.006  -65.189 1.00 22.15  ? 1046 ALA B CB    1 
ATOM   3709 N  N     . ASN D 1 47  ? 1.894   20.950  -66.077 1.00 22.22  ? 1047 ASN B N     1 
ATOM   3710 C  CA    . ASN D 1 47  ? 2.564   19.684  -65.781 1.00 23.39  ? 1047 ASN B CA    1 
ATOM   3711 C  C     . ASN D 1 47  ? 3.746   19.896  -64.798 1.00 24.14  ? 1047 ASN B C     1 
ATOM   3712 O  O     . ASN D 1 47  ? 4.081   21.036  -64.472 1.00 24.01  ? 1047 ASN B O     1 
ATOM   3713 C  CB    . ASN D 1 47  ? 2.946   18.907  -67.056 1.00 23.46  ? 1047 ASN B CB    1 
ATOM   3714 C  CG    . ASN D 1 47  ? 4.048   19.584  -67.884 1.00 23.39  ? 1047 ASN B CG    1 
ATOM   3715 O  OD1   . ASN D 1 47  ? 4.636   20.598  -67.485 1.00 22.32  ? 1047 ASN B OD1   1 
ATOM   3716 N  ND2   . ASN D 1 47  ? 4.300   19.031  -69.077 1.00 22.48  ? 1047 ASN B ND2   1 
ATOM   3717 N  N     . TYR D 1 48  ? 4.338   18.820  -64.299 1.00 24.88  ? 1048 TYR B N     1 
ATOM   3718 C  CA    . TYR D 1 48  ? 5.305   18.948  -63.222 1.00 27.08  ? 1048 TYR B CA    1 
ATOM   3719 C  C     . TYR D 1 48  ? 6.561   19.713  -63.625 1.00 28.00  ? 1048 TYR B C     1 
ATOM   3720 O  O     . TYR D 1 48  ? 7.158   20.390  -62.792 1.00 28.56  ? 1048 TYR B O     1 
ATOM   3721 C  CB    . TYR D 1 48  ? 5.664   17.580  -62.656 1.00 27.65  ? 1048 TYR B CB    1 
ATOM   3722 C  CG    . TYR D 1 48  ? 4.482   16.874  -62.037 1.00 28.09  ? 1048 TYR B CG    1 
ATOM   3723 C  CD1   . TYR D 1 48  ? 4.313   15.505  -62.196 1.00 29.63  ? 1048 TYR B CD1   1 
ATOM   3724 C  CD2   . TYR D 1 48  ? 3.520   17.578  -61.305 1.00 28.35  ? 1048 TYR B CD2   1 
ATOM   3725 C  CE1   . TYR D 1 48  ? 3.225   14.855  -61.641 1.00 28.78  ? 1048 TYR B CE1   1 
ATOM   3726 C  CE2   . TYR D 1 48  ? 2.424   16.929  -60.738 1.00 27.27  ? 1048 TYR B CE2   1 
ATOM   3727 C  CZ    . TYR D 1 48  ? 2.290   15.572  -60.911 1.00 28.53  ? 1048 TYR B CZ    1 
ATOM   3728 O  OH    . TYR D 1 48  ? 1.233   14.901  -60.362 1.00 27.71  ? 1048 TYR B OH    1 
ATOM   3729 N  N     . GLU D 1 49  ? 6.936   19.638  -64.896 1.00 28.91  ? 1049 GLU B N     1 
ATOM   3730 C  CA    . GLU D 1 49  ? 8.073   20.407  -65.380 1.00 30.00  ? 1049 GLU B CA    1 
ATOM   3731 C  C     . GLU D 1 49  ? 7.813   21.888  -65.087 1.00 30.28  ? 1049 GLU B C     1 
ATOM   3732 O  O     . GLU D 1 49  ? 8.601   22.538  -64.383 1.00 30.10  ? 1049 GLU B O     1 
ATOM   3733 C  CB    . GLU D 1 49  ? 8.289   20.208  -66.886 1.00 30.52  ? 1049 GLU B CB    1 
ATOM   3734 C  CG    . GLU D 1 49  ? 8.701   18.810  -67.314 1.00 32.90  ? 1049 GLU B CG    1 
ATOM   3735 C  CD    . GLU D 1 49  ? 7.523   17.953  -67.758 1.00 36.35  ? 1049 GLU B CD    1 
ATOM   3736 O  OE1   . GLU D 1 49  ? 6.612   17.653  -66.929 1.00 36.18  ? 1049 GLU B OE1   1 
ATOM   3737 O  OE2   . GLU D 1 49  ? 7.525   17.568  -68.951 1.00 38.04  ? 1049 GLU B OE2   1 
ATOM   3738 N  N     . ALA D 1 50  ? 6.690   22.400  -65.608 1.00 29.46  ? 1050 ALA B N     1 
ATOM   3739 C  CA    . ALA D 1 50  ? 6.333   23.820  -65.496 1.00 29.47  ? 1050 ALA B CA    1 
ATOM   3740 C  C     . ALA D 1 50  ? 6.278   24.311  -64.048 1.00 29.39  ? 1050 ALA B C     1 
ATOM   3741 O  O     . ALA D 1 50  ? 6.649   25.454  -63.751 1.00 28.35  ? 1050 ALA B O     1 
ATOM   3742 C  CB    . ALA D 1 50  ? 4.990   24.097  -66.221 1.00 29.53  ? 1050 ALA B CB    1 
ATOM   3743 N  N     . ARG D 1 51  ? 5.829   23.431  -63.157 1.00 30.00  ? 1051 ARG B N     1 
ATOM   3744 C  CA    . ARG D 1 51  ? 5.639   23.757  -61.738 1.00 31.16  ? 1051 ARG B CA    1 
ATOM   3745 C  C     . ARG D 1 51  ? 6.936   23.989  -60.991 1.00 31.69  ? 1051 ARG B C     1 
ATOM   3746 O  O     . ARG D 1 51  ? 6.979   24.803  -60.065 1.00 32.39  ? 1051 ARG B O     1 
ATOM   3747 C  CB    . ARG D 1 51  ? 4.880   22.643  -61.014 1.00 30.87  ? 1051 ARG B CB    1 
ATOM   3748 C  CG    . ARG D 1 51  ? 3.464   22.488  -61.437 1.00 32.10  ? 1051 ARG B CG    1 
ATOM   3749 C  CD    . ARG D 1 51  ? 2.750   21.531  -60.499 1.00 31.69  ? 1051 ARG B CD    1 
ATOM   3750 N  NE    . ARG D 1 51  ? 1.502   21.112  -61.109 1.00 29.59  ? 1051 ARG B NE    1 
ATOM   3751 C  CZ    . ARG D 1 51  ? 0.661   20.229  -60.591 1.00 28.37  ? 1051 ARG B CZ    1 
ATOM   3752 N  NH1   . ARG D 1 51  ? 0.917   19.644  -59.419 1.00 25.96  ? 1051 ARG B NH1   1 
ATOM   3753 N  NH2   . ARG D 1 51  ? -0.446  19.946  -61.261 1.00 28.21  ? 1051 ARG B NH2   1 
ATOM   3754 N  N     . LYS D 1 52  ? 7.975   23.254  -61.374 1.00 31.89  ? 1052 LYS B N     1 
ATOM   3755 C  CA    . LYS D 1 52  ? 9.300   23.443  -60.798 1.00 32.63  ? 1052 LYS B CA    1 
ATOM   3756 C  C     . LYS D 1 52  ? 9.685   24.919  -60.879 1.00 32.61  ? 1052 LYS B C     1 
ATOM   3757 O  O     . LYS D 1 52  ? 10.419  25.418  -60.028 1.00 32.43  ? 1052 LYS B O     1 
ATOM   3758 C  CB    . LYS D 1 52  ? 10.358  22.573  -61.500 1.00 32.86  ? 1052 LYS B CB    1 
ATOM   3759 C  CG    . LYS D 1 52  ? 9.935   21.123  -61.747 1.00 34.81  ? 1052 LYS B CG    1 
ATOM   3760 C  CD    . LYS D 1 52  ? 10.969  20.083  -61.339 1.00 38.05  ? 1052 LYS B CD    1 
ATOM   3761 C  CE    . LYS D 1 52  ? 11.976  19.765  -62.451 1.00 41.09  ? 1052 LYS B CE    1 
ATOM   3762 N  NZ    . LYS D 1 52  ? 11.333  19.373  -63.755 1.00 43.23  ? 1052 LYS B NZ    1 
ATOM   3763 N  N     . PHE D 1 53  ? 9.154   25.612  -61.889 1.00 32.20  ? 1053 PHE B N     1 
ATOM   3764 C  CA    . PHE D 1 53  ? 9.505   27.006  -62.148 1.00 31.78  ? 1053 PHE B CA    1 
ATOM   3765 C  C     . PHE D 1 53  ? 8.489   27.989  -61.587 1.00 32.09  ? 1053 PHE B C     1 
ATOM   3766 O  O     . PHE D 1 53  ? 8.592   29.193  -61.810 1.00 32.35  ? 1053 PHE B O     1 
ATOM   3767 C  CB    . PHE D 1 53  ? 9.755   27.232  -63.645 1.00 31.44  ? 1053 PHE B CB    1 
ATOM   3768 C  CG    . PHE D 1 53  ? 10.924  26.449  -64.188 1.00 30.54  ? 1053 PHE B CG    1 
ATOM   3769 C  CD1   . PHE D 1 53  ? 12.230  26.940  -64.069 1.00 30.27  ? 1053 PHE B CD1   1 
ATOM   3770 C  CD2   . PHE D 1 53  ? 10.727  25.215  -64.798 1.00 29.13  ? 1053 PHE B CD2   1 
ATOM   3771 C  CE1   . PHE D 1 53  ? 13.310  26.214  -64.564 1.00 29.22  ? 1053 PHE B CE1   1 
ATOM   3772 C  CE2   . PHE D 1 53  ? 11.784  24.484  -65.289 1.00 29.72  ? 1053 PHE B CE2   1 
ATOM   3773 C  CZ    . PHE D 1 53  ? 13.090  24.983  -65.178 1.00 29.63  ? 1053 PHE B CZ    1 
ATOM   3774 N  N     . GLY D 1 54  ? 7.526   27.469  -60.829 1.00 32.46  ? 1054 GLY B N     1 
ATOM   3775 C  CA    . GLY D 1 54  ? 6.525   28.297  -60.163 1.00 32.78  ? 1054 GLY B CA    1 
ATOM   3776 C  C     . GLY D 1 54  ? 5.250   28.555  -60.958 1.00 32.66  ? 1054 GLY B C     1 
ATOM   3777 O  O     . GLY D 1 54  ? 4.431   29.387  -60.571 1.00 32.62  ? 1054 GLY B O     1 
ATOM   3778 N  N     . VAL D 1 55  ? 5.078   27.866  -62.081 1.00 33.10  ? 1055 VAL B N     1 
ATOM   3779 C  CA    . VAL D 1 55  ? 3.837   28.022  -62.849 1.00 32.94  ? 1055 VAL B CA    1 
ATOM   3780 C  C     . VAL D 1 55  ? 2.849   27.032  -62.263 1.00 33.44  ? 1055 VAL B C     1 
ATOM   3781 O  O     . VAL D 1 55  ? 3.079   25.820  -62.299 1.00 33.62  ? 1055 VAL B O     1 
ATOM   3782 C  CB    . VAL D 1 55  ? 4.023   27.811  -64.369 1.00 33.18  ? 1055 VAL B CB    1 
ATOM   3783 C  CG1   . VAL D 1 55  ? 2.683   28.007  -65.102 1.00 32.94  ? 1055 VAL B CG1   1 
ATOM   3784 C  CG2   . VAL D 1 55  ? 5.046   28.784  -64.911 1.00 32.28  ? 1055 VAL B CG2   1 
ATOM   3785 N  N     . LYS D 1 56  ? 1.782   27.569  -61.679 1.00 33.08  ? 1056 LYS B N     1 
ATOM   3786 C  CA    . LYS D 1 56  ? 0.821   26.777  -60.939 1.00 33.07  ? 1056 LYS B CA    1 
ATOM   3787 C  C     . LYS D 1 56  ? -0.574  27.362  -61.052 1.00 32.36  ? 1056 LYS B C     1 
ATOM   3788 O  O     . LYS D 1 56  ? -0.740  28.526  -61.440 1.00 31.81  ? 1056 LYS B O     1 
ATOM   3789 C  CB    . LYS D 1 56  ? 1.216   26.717  -59.464 1.00 33.53  ? 1056 LYS B CB    1 
ATOM   3790 C  CG    . LYS D 1 56  ? 1.443   28.084  -58.860 1.00 34.60  ? 1056 LYS B CG    1 
ATOM   3791 C  CD    . LYS D 1 56  ? 2.582   28.048  -57.826 1.00 36.38  ? 1056 LYS B CD    1 
ATOM   3792 C  CE    . LYS D 1 56  ? 2.044   28.058  -56.415 1.00 37.00  ? 1056 LYS B CE    1 
ATOM   3793 N  NZ    . LYS D 1 56  ? 1.027   29.148  -56.278 1.00 40.16  ? 1056 LYS B NZ    1 
ATOM   3794 N  N     . ALA D 1 57  ? -1.554  26.548  -60.657 1.00 32.07  ? 1057 ALA B N     1 
ATOM   3795 C  CA    . ALA D 1 57  ? -2.977  26.885  -60.732 1.00 32.30  ? 1057 ALA B CA    1 
ATOM   3796 C  C     . ALA D 1 57  ? -3.273  28.254  -60.136 1.00 32.37  ? 1057 ALA B C     1 
ATOM   3797 O  O     . ALA D 1 57  ? -2.851  28.550  -59.022 1.00 33.21  ? 1057 ALA B O     1 
ATOM   3798 C  CB    . ALA D 1 57  ? -3.791  25.806  -60.025 1.00 31.45  ? 1057 ALA B CB    1 
ATOM   3799 N  N     . GLY D 1 58  ? -3.956  29.106  -60.889 1.00 32.56  ? 1058 GLY B N     1 
ATOM   3800 C  CA    . GLY D 1 58  ? -4.445  30.378  -60.349 1.00 32.51  ? 1058 GLY B CA    1 
ATOM   3801 C  C     . GLY D 1 58  ? -3.634  31.623  -60.685 1.00 32.35  ? 1058 GLY B C     1 
ATOM   3802 O  O     . GLY D 1 58  ? -4.164  32.746  -60.634 1.00 32.11  ? 1058 GLY B O     1 
ATOM   3803 N  N     . ILE D 1 59  ? -2.362  31.448  -61.044 1.00 32.33  ? 1059 ILE B N     1 
ATOM   3804 C  CA    . ILE D 1 59  ? -1.524  32.600  -61.434 1.00 31.92  ? 1059 ILE B CA    1 
ATOM   3805 C  C     . ILE D 1 59  ? -1.919  33.164  -62.797 1.00 31.30  ? 1059 ILE B C     1 
ATOM   3806 O  O     . ILE D 1 59  ? -2.421  32.425  -63.666 1.00 31.05  ? 1059 ILE B O     1 
ATOM   3807 C  CB    . ILE D 1 59  ? 0.020   32.323  -61.355 1.00 32.27  ? 1059 ILE B CB    1 
ATOM   3808 C  CG1   . ILE D 1 59  ? 0.517   31.457  -62.526 1.00 32.88  ? 1059 ILE B CG1   1 
ATOM   3809 C  CG2   . ILE D 1 59  ? 0.401   31.770  -59.973 1.00 32.79  ? 1059 ILE B CG2   1 
ATOM   3810 C  CD1   . ILE D 1 59  ? 2.008   31.599  -62.802 1.00 34.31  ? 1059 ILE B CD1   1 
ATOM   3811 N  N     . PRO D 1 60  ? -1.724  34.481  -62.984 1.00 30.48  ? 1060 PRO B N     1 
ATOM   3812 C  CA    . PRO D 1 60  ? -2.022  35.073  -64.279 1.00 29.63  ? 1060 PRO B CA    1 
ATOM   3813 C  C     . PRO D 1 60  ? -1.215  34.412  -65.400 1.00 28.86  ? 1060 PRO B C     1 
ATOM   3814 O  O     . PRO D 1 60  ? -0.058  34.030  -65.193 1.00 28.33  ? 1060 PRO B O     1 
ATOM   3815 C  CB    . PRO D 1 60  ? -1.596  36.536  -64.090 1.00 29.91  ? 1060 PRO B CB    1 
ATOM   3816 C  CG    . PRO D 1 60  ? -1.866  36.781  -62.622 1.00 30.45  ? 1060 PRO B CG    1 
ATOM   3817 C  CD    . PRO D 1 60  ? -1.376  35.511  -61.980 1.00 30.49  ? 1060 PRO B CD    1 
ATOM   3818 N  N     . ILE D 1 61  ? -1.839  34.272  -66.567 1.00 27.75  ? 1061 ILE B N     1 
ATOM   3819 C  CA    . ILE D 1 61  ? -1.160  33.776  -67.760 1.00 27.11  ? 1061 ILE B CA    1 
ATOM   3820 C  C     . ILE D 1 61  ? 0.057   34.653  -68.110 1.00 27.81  ? 1061 ILE B C     1 
ATOM   3821 O  O     . ILE D 1 61  ? 1.146   34.141  -68.368 1.00 26.64  ? 1061 ILE B O     1 
ATOM   3822 C  CB    . ILE D 1 61  ? -2.128  33.664  -68.963 1.00 26.58  ? 1061 ILE B CB    1 
ATOM   3823 C  CG1   . ILE D 1 61  ? -3.205  32.584  -68.687 1.00 25.44  ? 1061 ILE B CG1   1 
ATOM   3824 C  CG2   . ILE D 1 61  ? -1.350  33.348  -70.258 1.00 26.32  ? 1061 ILE B CG2   1 
ATOM   3825 C  CD1   . ILE D 1 61  ? -4.442  32.680  -69.616 1.00 21.29  ? 1061 ILE B CD1   1 
ATOM   3826 N  N     . VAL D 1 62  ? -0.137  35.969  -68.104 1.00 28.84  ? 1062 VAL B N     1 
ATOM   3827 C  CA    . VAL D 1 62  ? 0.959   36.910  -68.393 1.00 29.91  ? 1062 VAL B CA    1 
ATOM   3828 C  C     . VAL D 1 62  ? 2.159   36.684  -67.443 1.00 30.60  ? 1062 VAL B C     1 
ATOM   3829 O  O     . VAL D 1 62  ? 3.313   36.717  -67.874 1.00 30.53  ? 1062 VAL B O     1 
ATOM   3830 C  CB    . VAL D 1 62  ? 0.493   38.387  -68.370 1.00 29.88  ? 1062 VAL B CB    1 
ATOM   3831 C  CG1   . VAL D 1 62  ? -0.505  38.679  -69.513 1.00 29.89  ? 1062 VAL B CG1   1 
ATOM   3832 C  CG2   . VAL D 1 62  ? -0.095  38.763  -67.003 1.00 30.14  ? 1062 VAL B CG2   1 
ATOM   3833 N  N     . GLU D 1 63  ? 1.871   36.428  -66.166 1.00 31.66  ? 1063 GLU B N     1 
ATOM   3834 C  CA    . GLU D 1 63  ? 2.898   36.139  -65.167 1.00 32.87  ? 1063 GLU B CA    1 
ATOM   3835 C  C     . GLU D 1 63  ? 3.612   34.812  -65.476 1.00 32.65  ? 1063 GLU B C     1 
ATOM   3836 O  O     . GLU D 1 63  ? 4.837   34.713  -65.342 1.00 32.44  ? 1063 GLU B O     1 
ATOM   3837 C  CB    . GLU D 1 63  ? 2.276   36.126  -63.765 1.00 33.46  ? 1063 GLU B CB    1 
ATOM   3838 C  CG    . GLU D 1 63  ? 3.166   36.657  -62.636 1.00 37.32  ? 1063 GLU B CG    1 
ATOM   3839 C  CD    . GLU D 1 63  ? 3.982   35.566  -61.933 1.00 42.00  ? 1063 GLU B CD    1 
ATOM   3840 O  OE1   . GLU D 1 63  ? 3.467   34.432  -61.770 1.00 43.77  ? 1063 GLU B OE1   1 
ATOM   3841 O  OE2   . GLU D 1 63  ? 5.138   35.848  -61.532 1.00 42.59  ? 1063 GLU B OE2   1 
ATOM   3842 N  N     . ALA D 1 64  ? 2.850   33.804  -65.907 1.00 32.20  ? 1064 ALA B N     1 
ATOM   3843 C  CA    . ALA D 1 64  ? 3.428   32.515  -66.277 1.00 32.05  ? 1064 ALA B CA    1 
ATOM   3844 C  C     . ALA D 1 64  ? 4.361   32.660  -67.478 1.00 32.06  ? 1064 ALA B C     1 
ATOM   3845 O  O     . ALA D 1 64  ? 5.454   32.087  -67.488 1.00 31.32  ? 1064 ALA B O     1 
ATOM   3846 C  CB    . ALA D 1 64  ? 2.342   31.475  -66.557 1.00 32.02  ? 1064 ALA B CB    1 
ATOM   3847 N  N     . LYS D 1 65  ? 3.929   33.433  -68.474 1.00 32.36  ? 1065 LYS B N     1 
ATOM   3848 C  CA    . LYS D 1 65  ? 4.733   33.693  -69.663 1.00 33.25  ? 1065 LYS B CA    1 
ATOM   3849 C  C     . LYS D 1 65  ? 6.024   34.464  -69.357 1.00 33.66  ? 1065 LYS B C     1 
ATOM   3850 O  O     . LYS D 1 65  ? 7.033   34.264  -70.033 1.00 33.54  ? 1065 LYS B O     1 
ATOM   3851 C  CB    . LYS D 1 65  ? 3.923   34.402  -70.740 1.00 33.58  ? 1065 LYS B CB    1 
ATOM   3852 C  CG    . LYS D 1 65  ? 2.956   33.479  -71.463 1.00 35.22  ? 1065 LYS B CG    1 
ATOM   3853 C  CD    . LYS D 1 65  ? 2.249   34.189  -72.601 1.00 37.22  ? 1065 LYS B CD    1 
ATOM   3854 C  CE    . LYS D 1 65  ? 1.191   33.280  -73.204 1.00 39.01  ? 1065 LYS B CE    1 
ATOM   3855 N  NZ    . LYS D 1 65  ? 1.825   32.137  -73.920 1.00 39.94  ? 1065 LYS B NZ    1 
ATOM   3856 N  N     . LYS D 1 66  ? 5.986   35.335  -68.349 1.00 33.84  ? 1066 LYS B N     1 
ATOM   3857 C  CA    . LYS D 1 66  ? 7.192   35.998  -67.866 1.00 34.53  ? 1066 LYS B CA    1 
ATOM   3858 C  C     . LYS D 1 66  ? 8.256   34.944  -67.557 1.00 34.45  ? 1066 LYS B C     1 
ATOM   3859 O  O     . LYS D 1 66  ? 9.385   35.007  -68.069 1.00 34.05  ? 1066 LYS B O     1 
ATOM   3860 C  CB    . LYS D 1 66  ? 6.903   36.783  -66.589 1.00 34.75  ? 1066 LYS B CB    1 
ATOM   3861 C  CG    . LYS D 1 66  ? 6.354   38.171  -66.776 1.00 36.52  ? 1066 LYS B CG    1 
ATOM   3862 C  CD    . LYS D 1 66  ? 6.402   38.905  -65.441 1.00 39.28  ? 1066 LYS B CD    1 
ATOM   3863 C  CE    . LYS D 1 66  ? 5.711   40.254  -65.516 1.00 40.78  ? 1066 LYS B CE    1 
ATOM   3864 N  NZ    . LYS D 1 66  ? 4.821   40.447  -64.335 1.00 42.06  ? 1066 LYS B NZ    1 
ATOM   3865 N  N     . ILE D 1 67  ? 7.862   33.968  -66.739 1.00 34.34  ? 1067 ILE B N     1 
ATOM   3866 C  CA    . ILE D 1 67  ? 8.754   32.946  -66.192 1.00 34.65  ? 1067 ILE B CA    1 
ATOM   3867 C  C     . ILE D 1 67  ? 9.188   31.917  -67.233 1.00 34.41  ? 1067 ILE B C     1 
ATOM   3868 O  O     . ILE D 1 67  ? 10.390  31.707  -67.447 1.00 34.30  ? 1067 ILE B O     1 
ATOM   3869 C  CB    . ILE D 1 67  ? 8.086   32.198  -65.012 1.00 35.17  ? 1067 ILE B CB    1 
ATOM   3870 C  CG1   . ILE D 1 67  ? 7.705   33.175  -63.892 1.00 35.17  ? 1067 ILE B CG1   1 
ATOM   3871 C  CG2   . ILE D 1 67  ? 9.009   31.072  -64.503 1.00 35.60  ? 1067 ILE B CG2   1 
ATOM   3872 C  CD1   . ILE D 1 67  ? 6.484   32.725  -63.072 1.00 35.74  ? 1067 ILE B CD1   1 
ATOM   3873 N  N     . LEU D 1 68  ? 8.215   31.260  -67.860 1.00 33.74  ? 1068 LEU B N     1 
ATOM   3874 C  CA    . LEU D 1 68  ? 8.501   30.295  -68.904 1.00 33.59  ? 1068 LEU B CA    1 
ATOM   3875 C  C     . LEU D 1 68  ? 7.897   30.747  -70.212 1.00 33.84  ? 1068 LEU B C     1 
ATOM   3876 O  O     . LEU D 1 68  ? 6.804   30.302  -70.572 1.00 34.23  ? 1068 LEU B O     1 
ATOM   3877 C  CB    . LEU D 1 68  ? 7.960   28.912  -68.562 1.00 33.18  ? 1068 LEU B CB    1 
ATOM   3878 C  CG    . LEU D 1 68  ? 8.434   28.126  -67.355 1.00 32.64  ? 1068 LEU B CG    1 
ATOM   3879 C  CD1   . LEU D 1 68  ? 7.577   26.872  -67.264 1.00 31.61  ? 1068 LEU B CD1   1 
ATOM   3880 C  CD2   . LEU D 1 68  ? 9.921   27.775  -67.428 1.00 30.08  ? 1068 LEU B CD2   1 
ATOM   3881 N  N     . PRO D 1 69  ? 8.601   31.628  -70.937 1.00 33.52  ? 1069 PRO B N     1 
ATOM   3882 C  CA    . PRO D 1 69  ? 8.089   32.064  -72.229 1.00 33.54  ? 1069 PRO B CA    1 
ATOM   3883 C  C     . PRO D 1 69  ? 8.063   30.943  -73.269 1.00 33.62  ? 1069 PRO B C     1 
ATOM   3884 O  O     . PRO D 1 69  ? 7.251   30.989  -74.194 1.00 33.71  ? 1069 PRO B O     1 
ATOM   3885 C  CB    . PRO D 1 69  ? 9.093   33.154  -72.648 1.00 33.92  ? 1069 PRO B CB    1 
ATOM   3886 C  CG    . PRO D 1 69  ? 10.329  32.856  -71.884 1.00 33.00  ? 1069 PRO B CG    1 
ATOM   3887 C  CD    . PRO D 1 69  ? 9.840   32.341  -70.574 1.00 33.56  ? 1069 PRO B CD    1 
ATOM   3888 N  N     . ASN D 1 70  ? 8.949   29.955  -73.124 1.00 33.15  ? 1070 ASN B N     1 
ATOM   3889 C  CA    . ASN D 1 70  ? 9.050   28.881  -74.116 1.00 32.84  ? 1070 ASN B CA    1 
ATOM   3890 C  C     . ASN D 1 70  ? 8.185   27.633  -73.856 1.00 31.80  ? 1070 ASN B C     1 
ATOM   3891 O  O     . ASN D 1 70  ? 8.145   26.729  -74.690 1.00 31.67  ? 1070 ASN B O     1 
ATOM   3892 C  CB    . ASN D 1 70  ? 10.522  28.541  -74.401 1.00 33.01  ? 1070 ASN B CB    1 
ATOM   3893 C  CG    . ASN D 1 70  ? 11.306  29.745  -74.936 1.00 34.81  ? 1070 ASN B CG    1 
ATOM   3894 O  OD1   . ASN D 1 70  ? 12.474  29.940  -74.596 1.00 37.77  ? 1070 ASN B OD1   1 
ATOM   3895 N  ND2   . ASN D 1 70  ? 10.659  30.562  -75.768 1.00 35.58  ? 1070 ASN B ND2   1 
ATOM   3896 N  N     . ALA D 1 71  ? 7.472   27.611  -72.728 1.00 31.05  ? 1071 ALA B N     1 
ATOM   3897 C  CA    . ALA D 1 71  ? 6.468   26.563  -72.424 1.00 29.82  ? 1071 ALA B CA    1 
ATOM   3898 C  C     . ALA D 1 71  ? 5.359   26.485  -73.478 1.00 29.47  ? 1071 ALA B C     1 
ATOM   3899 O  O     . ALA D 1 71  ? 5.132   27.435  -74.225 1.00 29.16  ? 1071 ALA B O     1 
ATOM   3900 C  CB    . ALA D 1 71  ? 5.864   26.774  -71.030 1.00 28.95  ? 1071 ALA B CB    1 
ATOM   3901 N  N     . VAL D 1 72  ? 4.700   25.333  -73.548 1.00 29.16  ? 1072 VAL B N     1 
ATOM   3902 C  CA    . VAL D 1 72  ? 3.556   25.148  -74.426 1.00 29.54  ? 1072 VAL B CA    1 
ATOM   3903 C  C     . VAL D 1 72  ? 2.292   25.602  -73.684 1.00 28.59  ? 1072 VAL B C     1 
ATOM   3904 O  O     . VAL D 1 72  ? 1.978   25.078  -72.621 1.00 28.61  ? 1072 VAL B O     1 
ATOM   3905 C  CB    . VAL D 1 72  ? 3.414   23.674  -74.864 1.00 29.75  ? 1072 VAL B CB    1 
ATOM   3906 C  CG1   . VAL D 1 72  ? 2.151   23.496  -75.710 1.00 31.34  ? 1072 VAL B CG1   1 
ATOM   3907 C  CG2   . VAL D 1 72  ? 4.641   23.232  -75.657 1.00 30.61  ? 1072 VAL B CG2   1 
ATOM   3908 N  N     . TYR D 1 73  ? 1.593   26.588  -74.239 1.00 28.06  ? 1073 TYR B N     1 
ATOM   3909 C  CA    . TYR D 1 73  ? 0.399   27.155  -73.595 1.00 27.22  ? 1073 TYR B CA    1 
ATOM   3910 C  C     . TYR D 1 73  ? -0.845  26.691  -74.335 1.00 27.27  ? 1073 TYR B C     1 
ATOM   3911 O  O     . TYR D 1 73  ? -0.990  26.958  -75.523 1.00 27.73  ? 1073 TYR B O     1 
ATOM   3912 C  CB    . TYR D 1 73  ? 0.489   28.695  -73.535 1.00 27.46  ? 1073 TYR B CB    1 
ATOM   3913 C  CG    . TYR D 1 73  ? 1.518   29.164  -72.520 1.00 27.08  ? 1073 TYR B CG    1 
ATOM   3914 C  CD1   . TYR D 1 73  ? 1.154   29.397  -71.192 1.00 26.85  ? 1073 TYR B CD1   1 
ATOM   3915 C  CD2   . TYR D 1 73  ? 2.870   29.307  -72.876 1.00 28.43  ? 1073 TYR B CD2   1 
ATOM   3916 C  CE1   . TYR D 1 73  ? 2.096   29.787  -70.239 1.00 26.52  ? 1073 TYR B CE1   1 
ATOM   3917 C  CE2   . TYR D 1 73  ? 3.827   29.710  -71.936 1.00 27.76  ? 1073 TYR B CE2   1 
ATOM   3918 C  CZ    . TYR D 1 73  ? 3.430   29.937  -70.621 1.00 28.91  ? 1073 TYR B CZ    1 
ATOM   3919 O  OH    . TYR D 1 73  ? 4.347   30.317  -69.671 1.00 26.77  ? 1073 TYR B OH    1 
ATOM   3920 N  N     . LEU D 1 74  ? -1.711  25.957  -73.640 1.00 25.69  ? 1074 LEU B N     1 
ATOM   3921 C  CA    . LEU D 1 74  ? -2.899  25.395  -74.267 1.00 25.49  ? 1074 LEU B CA    1 
ATOM   3922 C  C     . LEU D 1 74  ? -4.163  25.965  -73.630 1.00 24.95  ? 1074 LEU B C     1 
ATOM   3923 O  O     . LEU D 1 74  ? -4.229  26.122  -72.404 1.00 24.97  ? 1074 LEU B O     1 
ATOM   3924 C  CB    . LEU D 1 74  ? -2.922  23.863  -74.126 1.00 24.96  ? 1074 LEU B CB    1 
ATOM   3925 C  CG    . LEU D 1 74  ? -1.706  23.034  -74.570 1.00 25.91  ? 1074 LEU B CG    1 
ATOM   3926 C  CD1   . LEU D 1 74  ? -1.914  21.556  -74.274 1.00 26.69  ? 1074 LEU B CD1   1 
ATOM   3927 C  CD2   . LEU D 1 74  ? -1.430  23.199  -76.034 1.00 26.27  ? 1074 LEU B CD2   1 
ATOM   3928 N  N     . PRO D 1 75  ? -5.176  26.246  -74.455 1.00 24.58  ? 1075 PRO B N     1 
ATOM   3929 C  CA    . PRO D 1 75  ? -6.451  26.616  -73.878 1.00 24.23  ? 1075 PRO B CA    1 
ATOM   3930 C  C     . PRO D 1 75  ? -7.115  25.402  -73.218 1.00 24.05  ? 1075 PRO B C     1 
ATOM   3931 O  O     . PRO D 1 75  ? -7.050  24.292  -73.747 1.00 24.01  ? 1075 PRO B O     1 
ATOM   3932 C  CB    . PRO D 1 75  ? -7.259  27.108  -75.080 1.00 24.49  ? 1075 PRO B CB    1 
ATOM   3933 C  CG    . PRO D 1 75  ? -6.649  26.421  -76.274 1.00 25.20  ? 1075 PRO B CG    1 
ATOM   3934 C  CD    . PRO D 1 75  ? -5.220  26.130  -75.929 1.00 24.76  ? 1075 PRO B CD    1 
ATOM   3935 N  N     . MET D 1 76  ? -7.715  25.621  -72.056 1.00 22.77  ? 1076 MET B N     1 
ATOM   3936 C  CA    . MET D 1 76  ? -8.463  24.603  -71.359 1.00 23.11  ? 1076 MET B CA    1 
ATOM   3937 C  C     . MET D 1 76  ? -9.608  24.104  -72.254 1.00 23.11  ? 1076 MET B C     1 
ATOM   3938 O  O     . MET D 1 76  ? -10.367 24.906  -72.814 1.00 22.30  ? 1076 MET B O     1 
ATOM   3939 C  CB    . MET D 1 76  ? -9.051  25.190  -70.083 1.00 23.80  ? 1076 MET B CB    1 
ATOM   3940 C  CG    . MET D 1 76  ? -9.756  24.166  -69.199 1.00 25.36  ? 1076 MET B CG    1 
ATOM   3941 S  SD    . MET D 1 76  ? -10.524 24.879  -67.737 1.00 29.83  ? 1076 MET B SD    1 
ATOM   3942 C  CE    . MET D 1 76  ? -11.733 26.013  -68.468 1.00 26.89  ? 1076 MET B CE    1 
ATOM   3943 N  N     . ARG D 1 77  ? -9.715  22.792  -72.401 1.00 21.80  ? 1077 ARG B N     1 
ATOM   3944 C  CA    . ARG D 1 77  ? -10.854 22.231  -73.109 1.00 22.39  ? 1077 ARG B CA    1 
ATOM   3945 C  C     . ARG D 1 77  ? -11.580 21.365  -72.104 1.00 21.98  ? 1077 ARG B C     1 
ATOM   3946 O  O     . ARG D 1 77  ? -11.392 20.157  -72.085 1.00 21.24  ? 1077 ARG B O     1 
ATOM   3947 C  CB    . ARG D 1 77  ? -10.370 21.402  -74.291 1.00 22.19  ? 1077 ARG B CB    1 
ATOM   3948 C  CG    . ARG D 1 77  ? -9.590  22.209  -75.305 1.00 23.68  ? 1077 ARG B CG    1 
ATOM   3949 C  CD    . ARG D 1 77  ? -9.360  21.417  -76.584 1.00 23.57  ? 1077 ARG B CD    1 
ATOM   3950 N  NE    . ARG D 1 77  ? -8.268  20.450  -76.448 1.00 23.18  ? 1077 ARG B NE    1 
ATOM   3951 C  CZ    . ARG D 1 77  ? -7.862  19.674  -77.449 1.00 24.08  ? 1077 ARG B CZ    1 
ATOM   3952 N  NH1   . ARG D 1 77  ? -8.478  19.759  -78.626 1.00 25.19  ? 1077 ARG B NH1   1 
ATOM   3953 N  NH2   . ARG D 1 77  ? -6.845  18.838  -77.291 1.00 21.68  ? 1077 ARG B NH2   1 
ATOM   3954 N  N     . LYS D 1 78  ? -12.385 21.978  -71.243 1.00 22.10  ? 1078 LYS B N     1 
ATOM   3955 C  CA    . LYS D 1 78  ? -12.944 21.229  -70.101 1.00 23.72  ? 1078 LYS B CA    1 
ATOM   3956 C  C     . LYS D 1 78  ? -13.850 20.043  -70.511 1.00 24.01  ? 1078 LYS B C     1 
ATOM   3957 O  O     . LYS D 1 78  ? -13.872 18.995  -69.840 1.00 24.03  ? 1078 LYS B O     1 
ATOM   3958 C  CB    . LYS D 1 78  ? -13.665 22.176  -69.126 1.00 24.90  ? 1078 LYS B CB    1 
ATOM   3959 C  CG    . LYS D 1 78  ? -13.736 21.612  -67.695 1.00 28.39  ? 1078 LYS B CG    1 
ATOM   3960 C  CD    . LYS D 1 78  ? -14.273 22.649  -66.726 1.00 34.87  ? 1078 LYS B CD    1 
ATOM   3961 C  CE    . LYS D 1 78  ? -14.828 21.993  -65.478 1.00 37.25  ? 1078 LYS B CE    1 
ATOM   3962 N  NZ    . LYS D 1 78  ? -15.563 23.014  -64.669 1.00 40.68  ? 1078 LYS B NZ    1 
ATOM   3963 N  N     . GLU D 1 79  ? -14.551 20.196  -71.636 1.00 24.14  ? 1079 GLU B N     1 
ATOM   3964 C  CA    . GLU D 1 79  ? -15.442 19.158  -72.192 1.00 24.78  ? 1079 GLU B CA    1 
ATOM   3965 C  C     . GLU D 1 79  ? -14.703 17.848  -72.512 1.00 23.13  ? 1079 GLU B C     1 
ATOM   3966 O  O     . GLU D 1 79  ? -15.227 16.758  -72.270 1.00 22.82  ? 1079 GLU B O     1 
ATOM   3967 C  CB    . GLU D 1 79  ? -16.143 19.656  -73.472 1.00 25.62  ? 1079 GLU B CB    1 
ATOM   3968 C  CG    . GLU D 1 79  ? -16.379 21.174  -73.532 1.00 31.17  ? 1079 GLU B CG    1 
ATOM   3969 C  CD    . GLU D 1 79  ? -15.079 22.008  -73.715 1.00 35.84  ? 1079 GLU B CD    1 
ATOM   3970 O  OE1   . GLU D 1 79  ? -14.213 21.650  -74.563 1.00 34.97  ? 1079 GLU B OE1   1 
ATOM   3971 O  OE2   . GLU D 1 79  ? -14.938 23.027  -72.996 1.00 37.20  ? 1079 GLU B OE2   1 
ATOM   3972 N  N     . VAL D 1 80  ? -13.495 17.973  -73.044 1.00 21.48  ? 1080 VAL B N     1 
ATOM   3973 C  CA    . VAL D 1 80  ? -12.609 16.834  -73.282 1.00 20.56  ? 1080 VAL B CA    1 
ATOM   3974 C  C     . VAL D 1 80  ? -12.224 16.149  -71.961 1.00 20.07  ? 1080 VAL B C     1 
ATOM   3975 O  O     . VAL D 1 80  ? -12.377 14.931  -71.813 1.00 19.51  ? 1080 VAL B O     1 
ATOM   3976 C  CB    . VAL D 1 80  ? -11.321 17.265  -74.054 1.00 20.40  ? 1080 VAL B CB    1 
ATOM   3977 C  CG1   . VAL D 1 80  ? -10.389 16.050  -74.254 1.00 20.38  ? 1080 VAL B CG1   1 
ATOM   3978 C  CG2   . VAL D 1 80  ? -11.673 17.897  -75.404 1.00 21.22  ? 1080 VAL B CG2   1 
ATOM   3979 N  N     . TYR D 1 81  ? -11.754 16.940  -70.988 1.00 19.45  ? 1081 TYR B N     1 
ATOM   3980 C  CA    . TYR D 1 81  ? -11.327 16.372  -69.701 1.00 19.40  ? 1081 TYR B CA    1 
ATOM   3981 C  C     . TYR D 1 81  ? -12.493 15.738  -68.981 1.00 19.16  ? 1081 TYR B C     1 
ATOM   3982 O  O     . TYR D 1 81  ? -12.319 14.727  -68.291 1.00 18.68  ? 1081 TYR B O     1 
ATOM   3983 C  CB    . TYR D 1 81  ? -10.632 17.406  -68.795 1.00 19.56  ? 1081 TYR B CB    1 
ATOM   3984 C  CG    . TYR D 1 81  ? -9.733  18.344  -69.553 1.00 18.51  ? 1081 TYR B CG    1 
ATOM   3985 C  CD1   . TYR D 1 81  ? -8.904  17.888  -70.585 1.00 19.35  ? 1081 TYR B CD1   1 
ATOM   3986 C  CD2   . TYR D 1 81  ? -9.735  19.704  -69.256 1.00 21.38  ? 1081 TYR B CD2   1 
ATOM   3987 C  CE1   . TYR D 1 81  ? -8.102  18.773  -71.290 1.00 20.21  ? 1081 TYR B CE1   1 
ATOM   3988 C  CE2   . TYR D 1 81  ? -8.949  20.586  -69.939 1.00 19.31  ? 1081 TYR B CE2   1 
ATOM   3989 C  CZ    . TYR D 1 81  ? -8.148  20.130  -70.962 1.00 21.04  ? 1081 TYR B CZ    1 
ATOM   3990 O  OH    . TYR D 1 81  ? -7.377  21.046  -71.634 1.00 22.52  ? 1081 TYR B OH    1 
ATOM   3991 N  N     . GLN D 1 82  ? -13.682 16.317  -69.145 1.00 19.11  ? 1082 GLN B N     1 
ATOM   3992 C  CA    . GLN D 1 82  ? -14.871 15.760  -68.517 1.00 19.98  ? 1082 GLN B CA    1 
ATOM   3993 C  C     . GLN D 1 82  ? -15.264 14.380  -69.099 1.00 19.87  ? 1082 GLN B C     1 
ATOM   3994 O  O     . GLN D 1 82  ? -15.653 13.477  -68.354 1.00 19.37  ? 1082 GLN B O     1 
ATOM   3995 C  CB    . GLN D 1 82  ? -16.046 16.766  -68.524 1.00 20.39  ? 1082 GLN B CB    1 
ATOM   3996 C  CG    . GLN D 1 82  ? -17.320 16.200  -67.833 1.00 23.23  ? 1082 GLN B CG    1 
ATOM   3997 C  CD    . GLN D 1 82  ? -17.090 15.907  -66.357 1.00 26.68  ? 1082 GLN B CD    1 
ATOM   3998 O  OE1   . GLN D 1 82  ? -16.909 16.831  -65.561 1.00 27.70  ? 1082 GLN B OE1   1 
ATOM   3999 N  NE2   . GLN D 1 82  ? -17.080 14.613  -65.986 1.00 24.00  ? 1082 GLN B NE2   1 
ATOM   4000 N  N     . GLN D 1 83  ? -15.141 14.194  -70.415 1.00 19.54  ? 1083 GLN B N     1 
ATOM   4001 C  CA    . GLN D 1 83  ? -15.387 12.864  -70.975 1.00 20.09  ? 1083 GLN B CA    1 
ATOM   4002 C  C     . GLN D 1 83  ? -14.388 11.834  -70.408 1.00 19.50  ? 1083 GLN B C     1 
ATOM   4003 O  O     . GLN D 1 83  ? -14.794 10.748  -69.990 1.00 18.85  ? 1083 GLN B O     1 
ATOM   4004 C  CB    . GLN D 1 83  ? -15.315 12.870  -72.519 1.00 20.29  ? 1083 GLN B CB    1 
ATOM   4005 C  CG    . GLN D 1 83  ? -16.260 13.840  -73.228 1.00 23.44  ? 1083 GLN B CG    1 
ATOM   4006 C  CD    . GLN D 1 83  ? -16.258 13.654  -74.757 1.00 30.79  ? 1083 GLN B CD    1 
ATOM   4007 O  OE1   . GLN D 1 83  ? -17.224 13.138  -75.339 1.00 33.29  ? 1083 GLN B OE1   1 
ATOM   4008 N  NE2   . GLN D 1 83  ? -15.170 14.073  -75.411 1.00 31.34  ? 1083 GLN B NE2   1 
ATOM   4009 N  N     . VAL D 1 84  ? -13.091 12.168  -70.407 1.00 18.92  ? 1084 VAL B N     1 
ATOM   4010 C  CA    . VAL D 1 84  ? -12.056 11.280  -69.836 1.00 19.03  ? 1084 VAL B CA    1 
ATOM   4011 C  C     . VAL D 1 84  ? -12.396 10.979  -68.369 1.00 19.06  ? 1084 VAL B C     1 
ATOM   4012 O  O     . VAL D 1 84  ? -12.386 9.820   -67.932 1.00 18.18  ? 1084 VAL B O     1 
ATOM   4013 C  CB    . VAL D 1 84  ? -10.634 11.907  -69.868 1.00 18.65  ? 1084 VAL B CB    1 
ATOM   4014 C  CG1   . VAL D 1 84  ? -9.638  10.999  -69.144 1.00 19.67  ? 1084 VAL B CG1   1 
ATOM   4015 C  CG2   . VAL D 1 84  ? -10.162 12.193  -71.317 1.00 19.00  ? 1084 VAL B CG2   1 
ATOM   4016 N  N     . SER D 1 85  ? -12.699 12.034  -67.612 1.00 19.49  ? 1085 SER B N     1 
ATOM   4017 C  CA    . SER D 1 85  ? -13.041 11.860  -66.215 1.00 20.44  ? 1085 SER B CA    1 
ATOM   4018 C  C     . SER D 1 85  ? -14.262 10.938  -66.050 1.00 20.62  ? 1085 SER B C     1 
ATOM   4019 O  O     . SER D 1 85  ? -14.262 10.038  -65.203 1.00 20.74  ? 1085 SER B O     1 
ATOM   4020 C  CB    . SER D 1 85  ? -13.271 13.212  -65.540 1.00 20.23  ? 1085 SER B CB    1 
ATOM   4021 O  OG    . SER D 1 85  ? -13.722 13.004  -64.210 1.00 20.62  ? 1085 SER B OG    1 
ATOM   4022 N  N     . SER D 1 86  ? -15.299 11.158  -66.856 1.00 20.80  ? 1086 SER B N     1 
ATOM   4023 C  CA    . SER D 1 86  ? -16.508 10.317  -66.747 1.00 20.91  ? 1086 SER B CA    1 
ATOM   4024 C  C     . SER D 1 86  ? -16.195 8.836   -67.001 1.00 20.80  ? 1086 SER B C     1 
ATOM   4025 O  O     . SER D 1 86  ? -16.717 7.969   -66.324 1.00 20.44  ? 1086 SER B O     1 
ATOM   4026 C  CB    . SER D 1 86  ? -17.610 10.812  -67.686 1.00 21.77  ? 1086 SER B CB    1 
ATOM   4027 O  OG    . SER D 1 86  ? -18.112 12.055  -67.199 1.00 22.16  ? 1086 SER B OG    1 
ATOM   4028 N  N     . ARG D 1 87  ? -15.327 8.556   -67.965 1.00 20.24  ? 1087 ARG B N     1 
ATOM   4029 C  CA    . ARG D 1 87  ? -14.938 7.171   -68.247 1.00 20.75  ? 1087 ARG B CA    1 
ATOM   4030 C  C     . ARG D 1 87  ? -14.147 6.539   -67.096 1.00 21.15  ? 1087 ARG B C     1 
ATOM   4031 O  O     . ARG D 1 87  ? -14.349 5.359   -66.778 1.00 21.14  ? 1087 ARG B O     1 
ATOM   4032 C  CB    . ARG D 1 87  ? -14.157 7.075   -69.553 1.00 20.50  ? 1087 ARG B CB    1 
ATOM   4033 C  CG    . ARG D 1 87  ? -14.965 7.540   -70.773 1.00 18.89  ? 1087 ARG B CG    1 
ATOM   4034 C  CD    . ARG D 1 87  ? -14.358 7.053   -72.069 1.00 18.80  ? 1087 ARG B CD    1 
ATOM   4035 N  NE    . ARG D 1 87  ? -13.001 7.549   -72.292 1.00 16.77  ? 1087 ARG B NE    1 
ATOM   4036 C  CZ    . ARG D 1 87  ? -12.702 8.642   -73.001 1.00 18.96  ? 1087 ARG B CZ    1 
ATOM   4037 N  NH1   . ARG D 1 87  ? -13.666 9.386   -73.558 1.00 15.66  ? 1087 ARG B NH1   1 
ATOM   4038 N  NH2   . ARG D 1 87  ? -11.434 8.991   -73.157 1.00 17.59  ? 1087 ARG B NH2   1 
ATOM   4039 N  N     . ILE D 1 88  ? -13.259 7.313   -66.477 1.00 20.86  ? 1088 ILE B N     1 
ATOM   4040 C  CA    . ILE D 1 88  ? -12.458 6.787   -65.378 1.00 21.25  ? 1088 ILE B CA    1 
ATOM   4041 C  C     . ILE D 1 88  ? -13.337 6.487   -64.156 1.00 21.74  ? 1088 ILE B C     1 
ATOM   4042 O  O     . ILE D 1 88  ? -13.203 5.424   -63.535 1.00 21.84  ? 1088 ILE B O     1 
ATOM   4043 C  CB    . ILE D 1 88  ? -11.275 7.701   -65.010 1.00 21.36  ? 1088 ILE B CB    1 
ATOM   4044 C  CG1   . ILE D 1 88  ? -10.271 7.768   -66.167 1.00 21.36  ? 1088 ILE B CG1   1 
ATOM   4045 C  CG2   . ILE D 1 88  ? -10.581 7.171   -63.759 1.00 20.14  ? 1088 ILE B CG2   1 
ATOM   4046 C  CD1   . ILE D 1 88  ? -9.208  8.874   -66.003 1.00 20.44  ? 1088 ILE B CD1   1 
ATOM   4047 N  N     . MET D 1 89  ? -14.256 7.395   -63.834 1.00 22.39  ? 1089 MET B N     1 
ATOM   4048 C  CA    . MET D 1 89  ? -15.165 7.179   -62.706 1.00 23.29  ? 1089 MET B CA    1 
ATOM   4049 C  C     . MET D 1 89  ? -15.977 5.894   -62.899 1.00 24.15  ? 1089 MET B C     1 
ATOM   4050 O  O     . MET D 1 89  ? -16.183 5.154   -61.933 1.00 23.98  ? 1089 MET B O     1 
ATOM   4051 C  CB    . MET D 1 89  ? -16.086 8.387   -62.470 1.00 23.71  ? 1089 MET B CB    1 
ATOM   4052 C  CG    . MET D 1 89  ? -15.341 9.710   -62.160 1.00 24.44  ? 1089 MET B CG    1 
ATOM   4053 S  SD    . MET D 1 89  ? -14.137 9.612   -60.815 1.00 24.38  ? 1089 MET B SD    1 
ATOM   4054 C  CE    . MET D 1 89  ? -13.580 11.328  -60.741 1.00 21.99  ? 1089 MET B CE    1 
ATOM   4055 N  N     . ASN D 1 90  ? -16.416 5.639   -64.142 1.00 24.19  ? 1090 ASN B N     1 
ATOM   4056 C  CA    . ASN D 1 90  ? -17.102 4.400   -64.505 1.00 25.85  ? 1090 ASN B CA    1 
ATOM   4057 C  C     . ASN D 1 90  ? -16.263 3.160   -64.247 1.00 25.56  ? 1090 ASN B C     1 
ATOM   4058 O  O     . ASN D 1 90  ? -16.783 2.152   -63.796 1.00 26.19  ? 1090 ASN B O     1 
ATOM   4059 C  CB    . ASN D 1 90  ? -17.522 4.404   -65.981 1.00 26.11  ? 1090 ASN B CB    1 
ATOM   4060 C  CG    . ASN D 1 90  ? -18.680 5.327   -66.250 1.00 29.26  ? 1090 ASN B CG    1 
ATOM   4061 O  OD1   . ASN D 1 90  ? -19.459 5.641   -65.352 1.00 33.43  ? 1090 ASN B OD1   1 
ATOM   4062 N  ND2   . ASN D 1 90  ? -18.801 5.777   -67.496 1.00 32.50  ? 1090 ASN B ND2   1 
ATOM   4063 N  N     . LEU D 1 91  ? -14.972 3.237   -64.541 1.00 25.45  ? 1091 LEU B N     1 
ATOM   4064 C  CA    . LEU D 1 91  ? -14.073 2.124   -64.269 1.00 25.83  ? 1091 LEU B CA    1 
ATOM   4065 C  C     . LEU D 1 91  ? -13.994 1.906   -62.766 1.00 26.12  ? 1091 LEU B C     1 
ATOM   4066 O  O     . LEU D 1 91  ? -14.059 0.766   -62.313 1.00 26.13  ? 1091 LEU B O     1 
ATOM   4067 C  CB    . LEU D 1 91  ? -12.672 2.376   -64.845 1.00 25.76  ? 1091 LEU B CB    1 
ATOM   4068 C  CG    . LEU D 1 91  ? -12.496 2.510   -66.367 1.00 27.10  ? 1091 LEU B CG    1 
ATOM   4069 C  CD1   . LEU D 1 91  ? -11.046 2.890   -66.693 1.00 27.74  ? 1091 LEU B CD1   1 
ATOM   4070 C  CD2   . LEU D 1 91  ? -12.918 1.247   -67.127 1.00 28.01  ? 1091 LEU B CD2   1 
ATOM   4071 N  N     . LEU D 1 92  ? -13.887 2.997   -62.004 1.00 25.83  ? 1092 LEU B N     1 
ATOM   4072 C  CA    . LEU D 1 92  ? -13.800 2.938   -60.546 1.00 27.12  ? 1092 LEU B CA    1 
ATOM   4073 C  C     . LEU D 1 92  ? -15.030 2.311   -59.915 1.00 28.72  ? 1092 LEU B C     1 
ATOM   4074 O  O     . LEU D 1 92  ? -14.943 1.681   -58.859 1.00 28.24  ? 1092 LEU B O     1 
ATOM   4075 C  CB    . LEU D 1 92  ? -13.569 4.331   -59.936 1.00 26.14  ? 1092 LEU B CB    1 
ATOM   4076 C  CG    . LEU D 1 92  ? -12.219 4.980   -60.226 1.00 26.11  ? 1092 LEU B CG    1 
ATOM   4077 C  CD1   . LEU D 1 92  ? -12.109 6.371   -59.575 1.00 24.21  ? 1092 LEU B CD1   1 
ATOM   4078 C  CD2   . LEU D 1 92  ? -11.079 4.071   -59.794 1.00 24.85  ? 1092 LEU B CD2   1 
ATOM   4079 N  N     . ARG D 1 93  ? -16.174 2.474   -60.571 1.00 30.76  ? 1093 ARG B N     1 
ATOM   4080 C  CA    . ARG D 1 93  ? -17.416 1.859   -60.100 1.00 32.34  ? 1093 ARG B CA    1 
ATOM   4081 C  C     . ARG D 1 93  ? -17.356 0.346   -60.048 1.00 32.82  ? 1093 ARG B C     1 
ATOM   4082 O  O     . ARG D 1 93  ? -18.048 -0.243  -59.225 1.00 32.74  ? 1093 ARG B O     1 
ATOM   4083 C  CB    . ARG D 1 93  ? -18.627 2.294   -60.930 1.00 32.87  ? 1093 ARG B CB    1 
ATOM   4084 C  CG    . ARG D 1 93  ? -19.138 3.681   -60.587 1.00 35.60  ? 1093 ARG B CG    1 
ATOM   4085 C  CD    . ARG D 1 93  ? -20.301 4.055   -61.506 1.00 40.32  ? 1093 ARG B CD    1 
ATOM   4086 N  NE    . ARG D 1 93  ? -20.055 5.308   -62.219 1.00 44.02  ? 1093 ARG B NE    1 
ATOM   4087 C  CZ    . ARG D 1 93  ? -20.300 6.518   -61.731 1.00 45.03  ? 1093 ARG B CZ    1 
ATOM   4088 N  NH1   . ARG D 1 93  ? -20.811 6.658   -60.518 1.00 46.79  ? 1093 ARG B NH1   1 
ATOM   4089 N  NH2   . ARG D 1 93  ? -20.037 7.590   -62.462 1.00 45.96  ? 1093 ARG B NH2   1 
ATOM   4090 N  N     . GLU D 1 94  ? -16.532 -0.276  -60.899 1.00 33.53  ? 1094 GLU B N     1 
ATOM   4091 C  CA    . GLU D 1 94  ? -16.376 -1.743  -60.903 1.00 34.38  ? 1094 GLU B CA    1 
ATOM   4092 C  C     . GLU D 1 94  ? -15.756 -2.258  -59.617 1.00 34.20  ? 1094 GLU B C     1 
ATOM   4093 O  O     . GLU D 1 94  ? -15.926 -3.425  -59.271 1.00 34.05  ? 1094 GLU B O     1 
ATOM   4094 C  CB    . GLU D 1 94  ? -15.497 -2.276  -62.050 1.00 34.87  ? 1094 GLU B CB    1 
ATOM   4095 C  CG    . GLU D 1 94  ? -15.154 -1.346  -63.188 1.00 37.73  ? 1094 GLU B CG    1 
ATOM   4096 C  CD    . GLU D 1 94  ? -16.196 -1.315  -64.267 1.00 40.93  ? 1094 GLU B CD    1 
ATOM   4097 O  OE1   . GLU D 1 94  ? -15.882 -1.744  -65.401 1.00 41.64  ? 1094 GLU B OE1   1 
ATOM   4098 O  OE2   . GLU D 1 94  ? -17.324 -0.853  -63.978 1.00 43.16  ? 1094 GLU B OE2   1 
ATOM   4099 N  N     . TYR D 1 95  ? -15.004 -1.401  -58.933 1.00 33.62  ? 1095 TYR B N     1 
ATOM   4100 C  CA    . TYR D 1 95  ? -14.247 -1.830  -57.772 1.00 33.41  ? 1095 TYR B CA    1 
ATOM   4101 C  C     . TYR D 1 95  ? -15.016 -1.645  -56.464 1.00 33.93  ? 1095 TYR B C     1 
ATOM   4102 O  O     . TYR D 1 95  ? -14.717 -2.307  -55.469 1.00 33.18  ? 1095 TYR B O     1 
ATOM   4103 C  CB    . TYR D 1 95  ? -12.851 -1.184  -57.773 1.00 33.21  ? 1095 TYR B CB    1 
ATOM   4104 C  CG    . TYR D 1 95  ? -12.041 -1.641  -58.975 1.00 31.80  ? 1095 TYR B CG    1 
ATOM   4105 C  CD1   . TYR D 1 95  ? -11.340 -2.848  -58.948 1.00 30.43  ? 1095 TYR B CD1   1 
ATOM   4106 C  CD2   . TYR D 1 95  ? -12.020 -0.894  -60.154 1.00 31.26  ? 1095 TYR B CD2   1 
ATOM   4107 C  CE1   . TYR D 1 95  ? -10.614 -3.295  -60.061 1.00 30.59  ? 1095 TYR B CE1   1 
ATOM   4108 C  CE2   . TYR D 1 95  ? -11.301 -1.333  -61.276 1.00 31.24  ? 1095 TYR B CE2   1 
ATOM   4109 C  CZ    . TYR D 1 95  ? -10.601 -2.536  -61.215 1.00 31.10  ? 1095 TYR B CZ    1 
ATOM   4110 O  OH    . TYR D 1 95  ? -9.887  -2.965  -62.307 1.00 31.79  ? 1095 TYR B OH    1 
ATOM   4111 N  N     . SER D 1 96  ? -16.022 -0.767  -56.487 1.00 34.38  ? 1096 SER B N     1 
ATOM   4112 C  CA    . SER D 1 96  ? -16.924 -0.571  -55.353 1.00 35.21  ? 1096 SER B CA    1 
ATOM   4113 C  C     . SER D 1 96  ? -18.191 0.184   -55.766 1.00 36.06  ? 1096 SER B C     1 
ATOM   4114 O  O     . SER D 1 96  ? -18.136 1.118   -56.578 1.00 36.92  ? 1096 SER B O     1 
ATOM   4115 C  CB    . SER D 1 96  ? -16.209 0.195   -54.233 1.00 35.05  ? 1096 SER B CB    1 
ATOM   4116 O  OG    . SER D 1 96  ? -16.963 0.186   -53.029 1.00 35.14  ? 1096 SER B OG    1 
ATOM   4117 N  N     . GLU D 1 97  ? -19.325 -0.204  -55.190 1.00 37.02  ? 1097 GLU B N     1 
ATOM   4118 C  CA    . GLU D 1 97  ? -20.578 0.550   -55.353 1.00 37.53  ? 1097 GLU B CA    1 
ATOM   4119 C  C     . GLU D 1 97  ? -20.577 1.819   -54.507 1.00 36.96  ? 1097 GLU B C     1 
ATOM   4120 O  O     . GLU D 1 97  ? -21.049 2.877   -54.949 1.00 38.07  ? 1097 GLU B O     1 
ATOM   4121 C  CB    . GLU D 1 97  ? -21.792 -0.314  -54.995 1.00 38.06  ? 1097 GLU B CB    1 
ATOM   4122 C  CG    . GLU D 1 97  ? -22.412 -1.043  -56.193 1.00 40.72  ? 1097 GLU B CG    1 
ATOM   4123 C  CD    . GLU D 1 97  ? -21.656 -2.306  -56.591 1.00 43.93  ? 1097 GLU B CD    1 
ATOM   4124 O  OE1   . GLU D 1 97  ? -20.872 -2.821  -55.760 1.00 45.71  ? 1097 GLU B OE1   1 
ATOM   4125 O  OE2   . GLU D 1 97  ? -21.856 -2.787  -57.735 1.00 45.15  ? 1097 GLU B OE2   1 
ATOM   4126 N  N     . LYS D 1 98  ? -20.042 1.709   -53.294 1.00 35.59  ? 1098 LYS B N     1 
ATOM   4127 C  CA    . LYS D 1 98  ? -19.883 2.846   -52.400 1.00 33.99  ? 1098 LYS B CA    1 
ATOM   4128 C  C     . LYS D 1 98  ? -18.736 3.735   -52.886 1.00 33.01  ? 1098 LYS B C     1 
ATOM   4129 O  O     . LYS D 1 98  ? -17.561 3.493   -52.578 1.00 32.57  ? 1098 LYS B O     1 
ATOM   4130 C  CB    . LYS D 1 98  ? -19.655 2.365   -50.959 1.00 34.16  ? 1098 LYS B CB    1 
ATOM   4131 C  CG    . LYS D 1 98  ? -20.673 1.326   -50.496 1.00 34.81  ? 1098 LYS B CG    1 
ATOM   4132 C  CD    . LYS D 1 98  ? -20.300 0.697   -49.154 1.00 36.66  ? 1098 LYS B CD    1 
ATOM   4133 C  CE    . LYS D 1 98  ? -21.085 -0.599  -48.929 1.00 38.56  ? 1098 LYS B CE    1 
ATOM   4134 N  NZ    . LYS D 1 98  ? -20.840 -1.211  -47.589 1.00 39.92  ? 1098 LYS B NZ    1 
ATOM   4135 N  N     . ILE D 1 99  ? -19.091 4.755   -53.661 1.00 31.29  ? 1099 ILE B N     1 
ATOM   4136 C  CA    . ILE D 1 99  ? -18.122 5.670   -54.242 1.00 30.01  ? 1099 ILE B CA    1 
ATOM   4137 C  C     . ILE D 1 99  ? -18.570 7.114   -54.040 1.00 29.22  ? 1099 ILE B C     1 
ATOM   4138 O  O     . ILE D 1 99  ? -19.749 7.422   -54.148 1.00 29.32  ? 1099 ILE B O     1 
ATOM   4139 C  CB    . ILE D 1 99  ? -17.889 5.371   -55.753 1.00 30.08  ? 1099 ILE B CB    1 
ATOM   4140 C  CG1   . ILE D 1 99  ? -16.791 6.276   -56.321 1.00 29.51  ? 1099 ILE B CG1   1 
ATOM   4141 C  CG2   . ILE D 1 99  ? -19.212 5.477   -56.563 1.00 30.38  ? 1099 ILE B CG2   1 
ATOM   4142 C  CD1   . ILE D 1 99  ? -16.346 5.897   -57.734 1.00 32.66  ? 1099 ILE B CD1   1 
ATOM   4143 N  N     . GLU D 1 100 ? -17.626 7.984   -53.709 1.00 27.94  ? 1100 GLU B N     1 
ATOM   4144 C  CA    . GLU D 1 100 ? -17.885 9.407   -53.606 1.00 26.77  ? 1100 GLU B CA    1 
ATOM   4145 C  C     . GLU D 1 100 ? -16.985 10.125  -54.599 1.00 26.96  ? 1100 GLU B C     1 
ATOM   4146 O  O     . GLU D 1 100 ? -15.746 10.149  -54.456 1.00 26.11  ? 1100 GLU B O     1 
ATOM   4147 C  CB    . GLU D 1 100 ? -17.656 9.889   -52.169 1.00 26.21  ? 1100 GLU B CB    1 
ATOM   4148 C  CG    . GLU D 1 100 ? -17.814 11.377  -51.958 1.00 26.61  ? 1100 GLU B CG    1 
ATOM   4149 C  CD    . GLU D 1 100 ? -17.796 11.777  -50.473 1.00 28.86  ? 1100 GLU B CD    1 
ATOM   4150 O  OE1   . GLU D 1 100 ? -18.036 10.933  -49.582 1.00 27.97  ? 1100 GLU B OE1   1 
ATOM   4151 O  OE2   . GLU D 1 100 ? -17.541 12.957  -50.207 1.00 31.32  ? 1100 GLU B OE2   1 
ATOM   4152 N  N     . ILE D 1 101 ? -17.609 10.693  -55.627 1.00 26.97  ? 1101 ILE B N     1 
ATOM   4153 C  CA    . ILE D 1 101 ? -16.880 11.459  -56.636 1.00 26.95  ? 1101 ILE B CA    1 
ATOM   4154 C  C     . ILE D 1 101 ? -16.737 12.876  -56.098 1.00 26.94  ? 1101 ILE B C     1 
ATOM   4155 O  O     . ILE D 1 101 ? -17.733 13.578  -55.923 1.00 27.95  ? 1101 ILE B O     1 
ATOM   4156 C  CB    . ILE D 1 101 ? -17.601 11.414  -58.007 1.00 26.82  ? 1101 ILE B CB    1 
ATOM   4157 C  CG1   . ILE D 1 101 ? -17.588 9.983   -58.545 1.00 27.48  ? 1101 ILE B CG1   1 
ATOM   4158 C  CG2   . ILE D 1 101 ? -16.956 12.397  -59.007 1.00 26.98  ? 1101 ILE B CG2   1 
ATOM   4159 C  CD1   . ILE D 1 101 ? -18.608 9.711   -59.674 1.00 28.05  ? 1101 ILE B CD1   1 
ATOM   4160 N  N     . ALA D 1 102 ? -15.511 13.286  -55.793 1.00 26.10  ? 1102 ALA B N     1 
ATOM   4161 C  CA    . ALA D 1 102 ? -15.309 14.534  -55.068 1.00 25.95  ? 1102 ALA B CA    1 
ATOM   4162 C  C     . ALA D 1 102 ? -15.047 15.752  -55.957 1.00 26.22  ? 1102 ALA B C     1 
ATOM   4163 O  O     . ALA D 1 102 ? -15.230 16.889  -55.533 1.00 27.08  ? 1102 ALA B O     1 
ATOM   4164 C  CB    . ALA D 1 102 ? -14.216 14.368  -54.036 1.00 25.95  ? 1102 ALA B CB    1 
ATOM   4165 N  N     . SER D 1 103 ? -14.608 15.512  -57.188 1.00 25.35  ? 1103 SER B N     1 
ATOM   4166 C  CA    . SER D 1 103 ? -14.321 16.574  -58.132 1.00 24.04  ? 1103 SER B CA    1 
ATOM   4167 C  C     . SER D 1 103 ? -14.120 15.897  -59.473 1.00 22.75  ? 1103 SER B C     1 
ATOM   4168 O  O     . SER D 1 103 ? -14.314 14.676  -59.594 1.00 22.23  ? 1103 SER B O     1 
ATOM   4169 C  CB    . SER D 1 103 ? -13.050 17.339  -57.735 1.00 24.37  ? 1103 SER B CB    1 
ATOM   4170 O  OG    . SER D 1 103 ? -11.890 16.552  -57.945 1.00 25.43  ? 1103 SER B OG    1 
ATOM   4171 N  N     . ILE D 1 104 ? -13.666 16.673  -60.444 1.00 21.52  ? 1104 ILE B N     1 
ATOM   4172 C  CA    . ILE D 1 104 ? -13.424 16.153  -61.784 1.00 21.60  ? 1104 ILE B CA    1 
ATOM   4173 C  C     . ILE D 1 104 ? -12.294 15.091  -61.774 1.00 21.51  ? 1104 ILE B C     1 
ATOM   4174 O  O     . ILE D 1 104 ? -12.217 14.241  -62.669 1.00 20.69  ? 1104 ILE B O     1 
ATOM   4175 C  CB    . ILE D 1 104 ? -13.132 17.287  -62.794 1.00 22.05  ? 1104 ILE B CB    1 
ATOM   4176 C  CG1   . ILE D 1 104 ? -13.314 16.770  -64.242 1.00 22.69  ? 1104 ILE B CG1   1 
ATOM   4177 C  CG2   . ILE D 1 104 ? -11.755 17.927  -62.536 1.00 21.52  ? 1104 ILE B CG2   1 
ATOM   4178 C  CD1   . ILE D 1 104 ? -13.483 17.841  -65.301 1.00 26.30  ? 1104 ILE B CD1   1 
ATOM   4179 N  N     . ASP D 1 105 ? -11.439 15.106  -60.762 1.00 20.43  ? 1105 ASP B N     1 
ATOM   4180 C  CA    . ASP D 1 105 ? -10.346 14.109  -60.799 1.00 22.91  ? 1105 ASP B CA    1 
ATOM   4181 C  C     . ASP D 1 105 ? -10.018 13.359  -59.496 1.00 22.53  ? 1105 ASP B C     1 
ATOM   4182 O  O     . ASP D 1 105 ? -8.875  12.857  -59.321 1.00 22.82  ? 1105 ASP B O     1 
ATOM   4183 C  CB    . ASP D 1 105 ? -9.092  14.749  -61.394 1.00 22.75  ? 1105 ASP B CB    1 
ATOM   4184 C  CG    . ASP D 1 105 ? -8.280  15.460  -60.349 1.00 26.13  ? 1105 ASP B CG    1 
ATOM   4185 O  OD1   . ASP D 1 105 ? -8.930  16.089  -59.479 1.00 28.15  ? 1105 ASP B OD1   1 
ATOM   4186 O  OD2   . ASP D 1 105 ? -7.028  15.361  -60.383 1.00 26.26  ? 1105 ASP B OD2   1 
ATOM   4187 N  N     . GLU D 1 106 ? -11.004 13.276  -58.594 1.00 22.23  ? 1106 GLU B N     1 
ATOM   4188 C  CA    . GLU D 1 106 ? -10.861 12.529  -57.332 1.00 23.45  ? 1106 GLU B CA    1 
ATOM   4189 C  C     . GLU D 1 106 ? -12.105 11.735  -57.017 1.00 22.40  ? 1106 GLU B C     1 
ATOM   4190 O  O     . GLU D 1 106 ? -13.247 12.221  -57.179 1.00 19.98  ? 1106 GLU B O     1 
ATOM   4191 C  CB    . GLU D 1 106 ? -10.694 13.453  -56.126 1.00 25.17  ? 1106 GLU B CB    1 
ATOM   4192 C  CG    . GLU D 1 106 ? -9.714  14.557  -56.244 1.00 31.69  ? 1106 GLU B CG    1 
ATOM   4193 C  CD    . GLU D 1 106 ? -9.966  15.586  -55.186 1.00 40.80  ? 1106 GLU B CD    1 
ATOM   4194 O  OE1   . GLU D 1 106 ? -11.031 16.241  -55.256 1.00 45.70  ? 1106 GLU B OE1   1 
ATOM   4195 O  OE2   . GLU D 1 106 ? -9.115  15.747  -54.287 1.00 50.72  ? 1106 GLU B OE2   1 
ATOM   4196 N  N     . ALA D 1 107 ? -11.884 10.541  -56.504 1.00 21.41  ? 1107 ALA B N     1 
ATOM   4197 C  CA    . ALA D 1 107 ? -12.977 9.762   -55.948 1.00 21.60  ? 1107 ALA B CA    1 
ATOM   4198 C  C     . ALA D 1 107 ? -12.505 8.977   -54.735 1.00 21.85  ? 1107 ALA B C     1 
ATOM   4199 O  O     . ALA D 1 107 ? -11.335 8.519   -54.689 1.00 21.01  ? 1107 ALA B O     1 
ATOM   4200 C  CB    . ALA D 1 107 ? -13.539 8.823   -56.996 1.00 21.12  ? 1107 ALA B CB    1 
ATOM   4201 N  N     . TYR D 1 108 ? -13.424 8.792   -53.784 1.00 21.21  ? 1108 TYR B N     1 
ATOM   4202 C  CA    . TYR D 1 108 ? -13.209 7.954   -52.612 1.00 21.39  ? 1108 TYR B CA    1 
ATOM   4203 C  C     . TYR D 1 108 ? -14.010 6.658   -52.762 1.00 21.82  ? 1108 TYR B C     1 
ATOM   4204 O  O     . TYR D 1 108 ? -15.216 6.697   -53.043 1.00 22.04  ? 1108 TYR B O     1 
ATOM   4205 C  CB    . TYR D 1 108 ? -13.674 8.654   -51.317 1.00 21.48  ? 1108 TYR B CB    1 
ATOM   4206 C  CG    . TYR D 1 108 ? -12.966 9.920   -50.943 1.00 22.30  ? 1108 TYR B CG    1 
ATOM   4207 C  CD1   . TYR D 1 108 ? -11.883 9.908   -50.064 1.00 23.48  ? 1108 TYR B CD1   1 
ATOM   4208 C  CD2   . TYR D 1 108 ? -13.386 11.151  -51.453 1.00 23.52  ? 1108 TYR B CD2   1 
ATOM   4209 C  CE1   . TYR D 1 108 ? -11.227 11.089  -49.715 1.00 22.68  ? 1108 TYR B CE1   1 
ATOM   4210 C  CE2   . TYR D 1 108 ? -12.744 12.334  -51.114 1.00 23.02  ? 1108 TYR B CE2   1 
ATOM   4211 C  CZ    . TYR D 1 108 ? -11.670 12.301  -50.237 1.00 24.46  ? 1108 TYR B CZ    1 
ATOM   4212 O  OH    . TYR D 1 108 ? -11.030 13.484  -49.913 1.00 24.25  ? 1108 TYR B OH    1 
ATOM   4213 N  N     . LEU D 1 109 ? -13.349 5.516   -52.593 1.00 21.74  ? 1109 LEU B N     1 
ATOM   4214 C  CA    . LEU D 1 109 ? -14.029 4.222   -52.603 1.00 22.68  ? 1109 LEU B CA    1 
ATOM   4215 C  C     . LEU D 1 109 ? -13.955 3.600   -51.220 1.00 23.77  ? 1109 LEU B C     1 
ATOM   4216 O  O     . LEU D 1 109 ? -12.867 3.491   -50.645 1.00 23.58  ? 1109 LEU B O     1 
ATOM   4217 C  CB    . LEU D 1 109 ? -13.395 3.263   -53.616 1.00 22.62  ? 1109 LEU B CB    1 
ATOM   4218 C  CG    . LEU D 1 109 ? -13.611 3.456   -55.122 1.00 22.25  ? 1109 LEU B CG    1 
ATOM   4219 C  CD1   . LEU D 1 109 ? -13.067 4.780   -55.652 1.00 23.15  ? 1109 LEU B CD1   1 
ATOM   4220 C  CD2   . LEU D 1 109 ? -12.966 2.293   -55.850 1.00 25.01  ? 1109 LEU B CD2   1 
ATOM   4221 N  N     . ASP D 1 110 ? -15.105 3.186   -50.696 1.00 24.15  ? 1110 ASP B N     1 
ATOM   4222 C  CA    . ASP D 1 110 ? -15.136 2.424   -49.458 1.00 25.73  ? 1110 ASP B CA    1 
ATOM   4223 C  C     . ASP D 1 110 ? -14.997 0.964   -49.867 1.00 26.30  ? 1110 ASP B C     1 
ATOM   4224 O  O     . ASP D 1 110 ? -15.917 0.379   -50.445 1.00 26.08  ? 1110 ASP B O     1 
ATOM   4225 C  CB    . ASP D 1 110 ? -16.443 2.663   -48.691 1.00 25.46  ? 1110 ASP B CB    1 
ATOM   4226 C  CG    . ASP D 1 110 ? -16.432 2.057   -47.285 1.00 27.99  ? 1110 ASP B CG    1 
ATOM   4227 O  OD1   . ASP D 1 110 ? -15.762 1.020   -47.067 1.00 29.02  ? 1110 ASP B OD1   1 
ATOM   4228 O  OD2   . ASP D 1 110 ? -17.132 2.602   -46.399 1.00 28.08  ? 1110 ASP B OD2   1 
ATOM   4229 N  N     . ILE D 1 111 ? -13.831 0.398   -49.590 1.00 26.47  ? 1111 ILE B N     1 
ATOM   4230 C  CA    . ILE D 1 111 ? -13.554 -0.972  -49.971 1.00 27.27  ? 1111 ILE B CA    1 
ATOM   4231 C  C     . ILE D 1 111 ? -13.508 -1.895  -48.747 1.00 28.23  ? 1111 ILE B C     1 
ATOM   4232 O  O     . ILE D 1 111 ? -12.945 -2.992  -48.811 1.00 28.36  ? 1111 ILE B O     1 
ATOM   4233 C  CB    . ILE D 1 111 ? -12.264 -1.077  -50.822 1.00 26.99  ? 1111 ILE B CB    1 
ATOM   4234 C  CG1   . ILE D 1 111 ? -11.075 -0.441  -50.095 1.00 26.27  ? 1111 ILE B CG1   1 
ATOM   4235 C  CG2   . ILE D 1 111 ? -12.484 -0.408  -52.186 1.00 26.76  ? 1111 ILE B CG2   1 
ATOM   4236 C  CD1   . ILE D 1 111 ? -9.726  -0.890  -50.625 1.00 25.13  ? 1111 ILE B CD1   1 
ATOM   4237 N  N     . SER D 1 112 ? -14.119 -1.448  -47.645 1.00 29.21  ? 1112 SER B N     1 
ATOM   4238 C  CA    . SER D 1 112 ? -14.218 -2.244  -46.406 1.00 30.24  ? 1112 SER B CA    1 
ATOM   4239 C  C     . SER D 1 112 ? -14.750 -3.659  -46.642 1.00 31.00  ? 1112 SER B C     1 
ATOM   4240 O  O     . SER D 1 112 ? -14.281 -4.607  -46.019 1.00 31.17  ? 1112 SER B O     1 
ATOM   4241 C  CB    . SER D 1 112 ? -15.092 -1.543  -45.364 1.00 29.91  ? 1112 SER B CB    1 
ATOM   4242 O  OG    . SER D 1 112 ? -14.562 -0.285  -44.989 1.00 29.96  ? 1112 SER B OG    1 
ATOM   4243 N  N     . ASP D 1 113 ? -15.720 -3.800  -47.539 1.00 32.02  ? 1113 ASP B N     1 
ATOM   4244 C  CA    . ASP D 1 113 ? -16.314 -5.111  -47.808 1.00 33.33  ? 1113 ASP B CA    1 
ATOM   4245 C  C     . ASP D 1 113 ? -15.720 -5.805  -49.032 1.00 33.40  ? 1113 ASP B C     1 
ATOM   4246 O  O     . ASP D 1 113 ? -16.209 -6.857  -49.456 1.00 33.44  ? 1113 ASP B O     1 
ATOM   4247 C  CB    . ASP D 1 113 ? -17.835 -4.989  -47.942 1.00 33.95  ? 1113 ASP B CB    1 
ATOM   4248 C  CG    . ASP D 1 113 ? -18.502 -4.524  -46.655 1.00 36.06  ? 1113 ASP B CG    1 
ATOM   4249 O  OD1   . ASP D 1 113 ? -18.017 -4.885  -45.553 1.00 38.38  ? 1113 ASP B OD1   1 
ATOM   4250 O  OD2   . ASP D 1 113 ? -19.515 -3.790  -46.747 1.00 38.31  ? 1113 ASP B OD2   1 
ATOM   4251 N  N     . LYS D 1 114 ? -14.653 -5.231  -49.583 1.00 33.46  ? 1114 LYS B N     1 
ATOM   4252 C  CA    . LYS D 1 114 ? -14.029 -5.782  -50.786 1.00 33.45  ? 1114 LYS B CA    1 
ATOM   4253 C  C     . LYS D 1 114 ? -12.664 -6.417  -50.522 1.00 33.03  ? 1114 LYS B C     1 
ATOM   4254 O  O     . LYS D 1 114 ? -12.179 -7.216  -51.322 1.00 32.79  ? 1114 LYS B O     1 
ATOM   4255 C  CB    . LYS D 1 114 ? -13.911 -4.705  -51.871 1.00 33.77  ? 1114 LYS B CB    1 
ATOM   4256 C  CG    . LYS D 1 114 ? -15.242 -4.119  -52.339 1.00 35.32  ? 1114 LYS B CG    1 
ATOM   4257 C  CD    . LYS D 1 114 ? -16.102 -5.166  -53.045 1.00 38.19  ? 1114 LYS B CD    1 
ATOM   4258 C  CE    . LYS D 1 114 ? -17.527 -4.669  -53.234 1.00 40.06  ? 1114 LYS B CE    1 
ATOM   4259 N  NZ    . LYS D 1 114 ? -17.677 -3.832  -54.454 1.00 42.21  ? 1114 LYS B NZ    1 
ATOM   4260 N  N     . VAL D 1 115 ? -12.043 -6.039  -49.410 1.00 32.70  ? 1115 VAL B N     1 
ATOM   4261 C  CA    . VAL D 1 115 ? -10.707 -6.523  -49.056 1.00 32.36  ? 1115 VAL B CA    1 
ATOM   4262 C  C     . VAL D 1 115 ? -10.629 -6.770  -47.560 1.00 32.28  ? 1115 VAL B C     1 
ATOM   4263 O  O     . VAL D 1 115 ? -11.310 -6.098  -46.783 1.00 32.27  ? 1115 VAL B O     1 
ATOM   4264 C  CB    . VAL D 1 115 ? -9.582  -5.524  -49.468 1.00 32.38  ? 1115 VAL B CB    1 
ATOM   4265 C  CG1   . VAL D 1 115 ? -9.535  -5.333  -50.988 1.00 31.58  ? 1115 VAL B CG1   1 
ATOM   4266 C  CG2   . VAL D 1 115 ? -9.729  -4.187  -48.745 1.00 32.11  ? 1115 VAL B CG2   1 
ATOM   4267 N  N     . ARG D 1 116 ? -9.784  -7.712  -47.155 1.00 31.85  ? 1116 ARG B N     1 
ATOM   4268 C  CA    . ARG D 1 116 ? -9.717  -8.112  -45.751 1.00 31.78  ? 1116 ARG B CA    1 
ATOM   4269 C  C     . ARG D 1 116 ? -8.714  -7.317  -44.910 1.00 30.99  ? 1116 ARG B C     1 
ATOM   4270 O  O     . ARG D 1 116 ? -8.846  -7.264  -43.687 1.00 31.39  ? 1116 ARG B O     1 
ATOM   4271 C  CB    . ARG D 1 116 ? -9.468  -9.625  -45.632 1.00 32.18  ? 1116 ARG B CB    1 
ATOM   4272 C  CG    . ARG D 1 116 ? -10.602 -10.459 -46.237 1.00 34.45  ? 1116 ARG B CG    1 
ATOM   4273 C  CD    . ARG D 1 116 ? -10.545 -11.951 -45.890 1.00 38.77  ? 1116 ARG B CD    1 
ATOM   4274 N  NE    . ARG D 1 116 ? -9.821  -12.761 -46.880 1.00 42.01  ? 1116 ARG B NE    1 
ATOM   4275 C  CZ    . ARG D 1 116 ? -10.133 -12.863 -48.179 1.00 43.95  ? 1116 ARG B CZ    1 
ATOM   4276 N  NH1   . ARG D 1 116 ? -11.157 -12.185 -48.698 1.00 43.97  ? 1116 ARG B NH1   1 
ATOM   4277 N  NH2   . ARG D 1 116 ? -9.400  -13.641 -48.974 1.00 44.73  ? 1116 ARG B NH2   1 
ATOM   4278 N  N     . ASP D 1 117 ? -7.727  -6.695  -45.558 1.00 29.52  ? 1117 ASP B N     1 
ATOM   4279 C  CA    . ASP D 1 117 ? -6.687  -5.939  -44.853 1.00 28.39  ? 1117 ASP B CA    1 
ATOM   4280 C  C     . ASP D 1 117 ? -5.952  -5.021  -45.822 1.00 27.40  ? 1117 ASP B C     1 
ATOM   4281 O  O     . ASP D 1 117 ? -6.313  -4.942  -46.999 1.00 26.76  ? 1117 ASP B O     1 
ATOM   4282 C  CB    . ASP D 1 117 ? -5.702  -6.890  -44.131 1.00 28.83  ? 1117 ASP B CB    1 
ATOM   4283 C  CG    . ASP D 1 117 ? -5.013  -7.866  -45.078 1.00 29.76  ? 1117 ASP B CG    1 
ATOM   4284 O  OD1   . ASP D 1 117 ? -4.466  -8.878  -44.597 1.00 32.93  ? 1117 ASP B OD1   1 
ATOM   4285 O  OD2   . ASP D 1 117 ? -5.004  -7.637  -46.305 1.00 31.82  ? 1117 ASP B OD2   1 
ATOM   4286 N  N     . TYR D 1 118 ? -4.921  -4.336  -45.334 1.00 26.54  ? 1118 TYR B N     1 
ATOM   4287 C  CA    . TYR D 1 118 ? -4.187  -3.365  -46.161 1.00 25.70  ? 1118 TYR B CA    1 
ATOM   4288 C  C     . TYR D 1 118 ? -3.337  -3.960  -47.279 1.00 25.19  ? 1118 TYR B C     1 
ATOM   4289 O  O     . TYR D 1 118 ? -3.103  -3.292  -48.293 1.00 25.31  ? 1118 TYR B O     1 
ATOM   4290 C  CB    . TYR D 1 118 ? -3.343  -2.422  -45.304 1.00 25.83  ? 1118 TYR B CB    1 
ATOM   4291 C  CG    . TYR D 1 118 ? -4.130  -1.320  -44.634 1.00 25.22  ? 1118 TYR B CG    1 
ATOM   4292 C  CD1   . TYR D 1 118 ? -5.058  -0.552  -45.352 1.00 25.18  ? 1118 TYR B CD1   1 
ATOM   4293 C  CD2   . TYR D 1 118 ? -3.925  -1.020  -43.296 1.00 25.17  ? 1118 TYR B CD2   1 
ATOM   4294 C  CE1   . TYR D 1 118 ? -5.784  0.473   -44.732 1.00 23.95  ? 1118 TYR B CE1   1 
ATOM   4295 C  CE2   . TYR D 1 118 ? -4.637  -0.005  -42.671 1.00 24.96  ? 1118 TYR B CE2   1 
ATOM   4296 C  CZ    . TYR D 1 118 ? -5.556  0.744   -43.392 1.00 25.10  ? 1118 TYR B CZ    1 
ATOM   4297 O  OH    . TYR D 1 118 ? -6.246  1.746   -42.745 1.00 24.08  ? 1118 TYR B OH    1 
ATOM   4298 N  N     A ARG D 1 119 ? -2.877  -5.198  -47.104 0.50 24.71  ? 1119 ARG B N     1 
ATOM   4299 N  N     B ARG D 1 119 ? -2.868  -5.196  -47.093 0.50 24.77  ? 1119 ARG B N     1 
ATOM   4300 C  CA    A ARG D 1 119 ? -2.114  -5.882  -48.149 0.50 24.22  ? 1119 ARG B CA    1 
ATOM   4301 C  CA    B ARG D 1 119 ? -2.119  -5.906  -48.135 0.50 24.37  ? 1119 ARG B CA    1 
ATOM   4302 C  C     A ARG D 1 119 ? -2.965  -6.102  -49.404 0.50 24.07  ? 1119 ARG B C     1 
ATOM   4303 C  C     B ARG D 1 119 ? -2.966  -6.098  -49.396 0.50 24.14  ? 1119 ARG B C     1 
ATOM   4304 O  O     A ARG D 1 119 ? -2.515  -5.833  -50.521 0.50 23.79  ? 1119 ARG B O     1 
ATOM   4305 O  O     B ARG D 1 119 ? -2.514  -5.809  -50.507 0.50 23.87  ? 1119 ARG B O     1 
ATOM   4306 C  CB    A ARG D 1 119 ? -1.541  -7.209  -47.634 0.50 24.21  ? 1119 ARG B CB    1 
ATOM   4307 C  CB    B ARG D 1 119 ? -1.601  -7.261  -47.624 0.50 24.36  ? 1119 ARG B CB    1 
ATOM   4308 C  CG    A ARG D 1 119 ? -0.556  -7.869  -48.588 0.50 23.96  ? 1119 ARG B CG    1 
ATOM   4309 C  CG    B ARG D 1 119 ? -0.376  -7.179  -46.718 0.50 24.70  ? 1119 ARG B CG    1 
ATOM   4310 C  CD    A ARG D 1 119 ? -0.098  -9.230  -48.063 0.50 24.56  ? 1119 ARG B CD    1 
ATOM   4311 C  CD    B ARG D 1 119 ? 0.319   -8.552  -46.575 0.50 24.45  ? 1119 ARG B CD    1 
ATOM   4312 N  NE    A ARG D 1 119 ? -1.229  -9.984  -47.534 0.50 24.29  ? 1119 ARG B NE    1 
ATOM   4313 N  NE    B ARG D 1 119 ? 0.851   -9.017  -47.856 0.50 24.80  ? 1119 ARG B NE    1 
ATOM   4314 C  CZ    A ARG D 1 119 ? -2.212  -10.470 -48.285 0.50 24.66  ? 1119 ARG B CZ    1 
ATOM   4315 C  CZ    B ARG D 1 119 ? 2.142   -9.039  -48.175 0.50 24.95  ? 1119 ARG B CZ    1 
ATOM   4316 N  NH1   A ARG D 1 119 ? -2.198  -10.284 -49.602 0.50 24.47  ? 1119 ARG B NH1   1 
ATOM   4317 N  NH1   B ARG D 1 119 ? 3.051   -8.642  -47.296 0.50 24.21  ? 1119 ARG B NH1   1 
ATOM   4318 N  NH2   A ARG D 1 119 ? -3.211  -11.138 -47.720 0.50 23.89  ? 1119 ARG B NH2   1 
ATOM   4319 N  NH2   B ARG D 1 119 ? 2.526   -9.467  -49.373 0.50 24.66  ? 1119 ARG B NH2   1 
ATOM   4320 N  N     . GLU D 1 120 ? -4.194  -6.582  -49.211 1.00 24.07  ? 1120 GLU B N     1 
ATOM   4321 C  CA    . GLU D 1 120 ? -5.156  -6.735  -50.309 1.00 24.42  ? 1120 GLU B CA    1 
ATOM   4322 C  C     . GLU D 1 120 ? -5.646  -5.364  -50.840 1.00 24.12  ? 1120 GLU B C     1 
ATOM   4323 O  O     . GLU D 1 120 ? -5.989  -5.243  -52.011 1.00 23.68  ? 1120 GLU B O     1 
ATOM   4324 C  CB    . GLU D 1 120 ? -6.362  -7.575  -49.875 1.00 24.61  ? 1120 GLU B CB    1 
ATOM   4325 C  CG    . GLU D 1 120 ? -6.099  -9.076  -49.702 1.00 27.09  ? 1120 GLU B CG    1 
ATOM   4326 C  CD    . GLU D 1 120 ? -7.362  -9.866  -49.338 1.00 29.13  ? 1120 GLU B CD    1 
ATOM   4327 O  OE1   . GLU D 1 120 ? -8.450  -9.258  -49.209 1.00 29.91  ? 1120 GLU B OE1   1 
ATOM   4328 O  OE2   . GLU D 1 120 ? -7.272  -11.105 -49.196 1.00 30.61  ? 1120 GLU B OE2   1 
ATOM   4329 N  N     . ALA D 1 121 ? -5.688  -4.354  -49.976 1.00 24.01  ? 1121 ALA B N     1 
ATOM   4330 C  CA    . ALA D 1 121 ? -6.104  -3.007  -50.392 1.00 24.78  ? 1121 ALA B CA    1 
ATOM   4331 C  C     . ALA D 1 121 ? -5.048  -2.394  -51.298 1.00 24.85  ? 1121 ALA B C     1 
ATOM   4332 O  O     . ALA D 1 121 ? -5.369  -1.788  -52.318 1.00 25.18  ? 1121 ALA B O     1 
ATOM   4333 C  CB    . ALA D 1 121 ? -6.365  -2.119  -49.183 1.00 24.35  ? 1121 ALA B CB    1 
ATOM   4334 N  N     . TYR D 1 122 ? -3.786  -2.599  -50.925 1.00 25.59  ? 1122 TYR B N     1 
ATOM   4335 C  CA    . TYR D 1 122 ? -2.637  -2.214  -51.735 1.00 25.89  ? 1122 TYR B CA    1 
ATOM   4336 C  C     . TYR D 1 122 ? -2.700  -2.893  -53.105 1.00 26.28  ? 1122 TYR B C     1 
ATOM   4337 O  O     . TYR D 1 122 ? -2.533  -2.230  -54.138 1.00 26.11  ? 1122 TYR B O     1 
ATOM   4338 C  CB    . TYR D 1 122 ? -1.324  -2.544  -50.996 1.00 25.88  ? 1122 TYR B CB    1 
ATOM   4339 C  CG    . TYR D 1 122 ? -0.075  -1.986  -51.651 1.00 25.70  ? 1122 TYR B CG    1 
ATOM   4340 C  CD1   . TYR D 1 122 ? 0.372   -0.685  -51.387 1.00 25.41  ? 1122 TYR B CD1   1 
ATOM   4341 C  CD2   . TYR D 1 122 ? 0.654   -2.756  -52.536 1.00 27.05  ? 1122 TYR B CD2   1 
ATOM   4342 C  CE1   . TYR D 1 122 ? 1.526   -0.170  -52.012 1.00 24.78  ? 1122 TYR B CE1   1 
ATOM   4343 C  CE2   . TYR D 1 122 ? 1.794   -2.262  -53.162 1.00 26.16  ? 1122 TYR B CE2   1 
ATOM   4344 C  CZ    . TYR D 1 122 ? 2.229   -0.980  -52.900 1.00 25.87  ? 1122 TYR B CZ    1 
ATOM   4345 O  OH    . TYR D 1 122 ? 3.380   -0.546  -53.536 1.00 25.43  ? 1122 TYR B OH    1 
ATOM   4346 N  N     . ASN D 1 123 ? -2.963  -4.202  -53.116 1.00 26.47  ? 1123 ASN B N     1 
ATOM   4347 C  CA    . ASN D 1 123 ? -3.141  -4.957  -54.364 1.00 26.89  ? 1123 ASN B CA    1 
ATOM   4348 C  C     . ASN D 1 123 ? -4.228  -4.346  -55.238 1.00 26.31  ? 1123 ASN B C     1 
ATOM   4349 O  O     . ASN D 1 123 ? -4.052  -4.194  -56.448 1.00 26.29  ? 1123 ASN B O     1 
ATOM   4350 C  CB    . ASN D 1 123 ? -3.487  -6.435  -54.077 1.00 27.54  ? 1123 ASN B CB    1 
ATOM   4351 C  CG    . ASN D 1 123 ? -3.674  -7.268  -55.359 1.00 30.38  ? 1123 ASN B CG    1 
ATOM   4352 O  OD1   . ASN D 1 123 ? -2.698  -7.695  -55.997 1.00 33.21  ? 1123 ASN B OD1   1 
ATOM   4353 N  ND2   . ASN D 1 123 ? -4.936  -7.514  -55.728 1.00 32.07  ? 1123 ASN B ND2   1 
ATOM   4354 N  N     . LEU D 1 124 ? -5.356  -4.018  -54.614 1.00 26.00  ? 1124 LEU B N     1 
ATOM   4355 C  CA    . LEU D 1 124 ? -6.500  -3.427  -55.311 1.00 25.40  ? 1124 LEU B CA    1 
ATOM   4356 C  C     . LEU D 1 124 ? -6.153  -2.070  -55.899 1.00 24.67  ? 1124 LEU B C     1 
ATOM   4357 O  O     . LEU D 1 124 ? -6.582  -1.735  -56.997 1.00 24.77  ? 1124 LEU B O     1 
ATOM   4358 C  CB    . LEU D 1 124 ? -7.690  -3.288  -54.355 1.00 25.78  ? 1124 LEU B CB    1 
ATOM   4359 C  CG    . LEU D 1 124 ? -9.043  -2.959  -54.984 1.00 26.66  ? 1124 LEU B CG    1 
ATOM   4360 C  CD1   . LEU D 1 124 ? -9.414  -3.998  -56.028 1.00 27.98  ? 1124 LEU B CD1   1 
ATOM   4361 C  CD2   . LEU D 1 124 ? -10.101 -2.909  -53.910 1.00 28.63  ? 1124 LEU B CD2   1 
ATOM   4362 N  N     . GLY D 1 125 ? -5.380  -1.290  -55.154 1.00 24.54  ? 1125 GLY B N     1 
ATOM   4363 C  CA    . GLY D 1 125 ? -4.914  0.024   -55.618 1.00 23.94  ? 1125 GLY B CA    1 
ATOM   4364 C  C     . GLY D 1 125 ? -4.060  -0.107  -56.860 1.00 23.88  ? 1125 GLY B C     1 
ATOM   4365 O  O     . GLY D 1 125 ? -4.179  0.705   -57.774 1.00 23.62  ? 1125 GLY B O     1 
ATOM   4366 N  N     . LEU D 1 126 ? -3.218  -1.148  -56.910 1.00 23.56  ? 1126 LEU B N     1 
ATOM   4367 C  CA    . LEU D 1 126 ? -2.389  -1.409  -58.089 1.00 23.62  ? 1126 LEU B CA    1 
ATOM   4368 C  C     . LEU D 1 126 ? -3.230  -1.827  -59.291 1.00 23.80  ? 1126 LEU B C     1 
ATOM   4369 O  O     . LEU D 1 126 ? -2.975  -1.389  -60.410 1.00 24.03  ? 1126 LEU B O     1 
ATOM   4370 C  CB    . LEU D 1 126 ? -1.331  -2.502  -57.814 1.00 23.83  ? 1126 LEU B CB    1 
ATOM   4371 C  CG    . LEU D 1 126 ? -0.116  -2.180  -56.933 1.00 23.77  ? 1126 LEU B CG    1 
ATOM   4372 C  CD1   . LEU D 1 126 ? 0.810   -3.413  -56.817 1.00 22.44  ? 1126 LEU B CD1   1 
ATOM   4373 C  CD2   . LEU D 1 126 ? 0.656   -0.963  -57.443 1.00 23.90  ? 1126 LEU B CD2   1 
ATOM   4374 N  N     . GLU D 1 127 ? -4.224  -2.681  -59.058 1.00 23.69  ? 1127 GLU B N     1 
ATOM   4375 C  CA    . GLU D 1 127 ? -5.131  -3.120  -60.122 1.00 24.56  ? 1127 GLU B CA    1 
ATOM   4376 C  C     . GLU D 1 127 ? -5.915  -1.945  -60.734 1.00 24.38  ? 1127 GLU B C     1 
ATOM   4377 O  O     . GLU D 1 127 ? -6.150  -1.903  -61.954 1.00 24.22  ? 1127 GLU B O     1 
ATOM   4378 C  CB    . GLU D 1 127 ? -6.093  -4.180  -59.593 1.00 24.84  ? 1127 GLU B CB    1 
ATOM   4379 C  CG    . GLU D 1 127 ? -6.856  -4.908  -60.690 1.00 28.87  ? 1127 GLU B CG    1 
ATOM   4380 C  CD    . GLU D 1 127 ? -7.548  -6.166  -60.201 1.00 33.12  ? 1127 GLU B CD    1 
ATOM   4381 O  OE1   . GLU D 1 127 ? -7.600  -6.403  -58.969 1.00 34.29  ? 1127 GLU B OE1   1 
ATOM   4382 O  OE2   . GLU D 1 127 ? -8.033  -6.931  -61.064 1.00 35.74  ? 1127 GLU B OE2   1 
ATOM   4383 N  N     . ILE D 1 128 ? -6.300  -1.008  -59.869 1.00 23.47  ? 1128 ILE B N     1 
ATOM   4384 C  CA    . ILE D 1 128 ? -6.991  0.209   -60.270 1.00 23.51  ? 1128 ILE B CA    1 
ATOM   4385 C  C     . ILE D 1 128 ? -6.083  1.127   -61.116 1.00 23.39  ? 1128 ILE B C     1 
ATOM   4386 O  O     . ILE D 1 128 ? -6.488  1.578   -62.190 1.00 23.52  ? 1128 ILE B O     1 
ATOM   4387 C  CB    . ILE D 1 128 ? -7.586  0.937   -59.036 1.00 22.98  ? 1128 ILE B CB    1 
ATOM   4388 C  CG1   . ILE D 1 128 ? -8.806  0.163   -58.518 1.00 22.43  ? 1128 ILE B CG1   1 
ATOM   4389 C  CG2   . ILE D 1 128 ? -7.974  2.386   -59.376 1.00 22.93  ? 1128 ILE B CG2   1 
ATOM   4390 C  CD1   . ILE D 1 128 ? -9.344  0.655   -57.144 1.00 22.27  ? 1128 ILE B CD1   1 
ATOM   4391 N  N     . LYS D 1 129 ? -4.868  1.397   -60.632 1.00 23.35  ? 1129 LYS B N     1 
ATOM   4392 C  CA    . LYS D 1 129 ? -3.882  2.139   -61.421 1.00 23.54  ? 1129 LYS B CA    1 
ATOM   4393 C  C     . LYS D 1 129 ? -3.663  1.516   -62.794 1.00 23.82  ? 1129 LYS B C     1 
ATOM   4394 O  O     . LYS D 1 129 ? -3.756  2.210   -63.799 1.00 23.35  ? 1129 LYS B O     1 
ATOM   4395 C  CB    . LYS D 1 129 ? -2.558  2.280   -60.682 1.00 22.99  ? 1129 LYS B CB    1 
ATOM   4396 C  CG    . LYS D 1 129 ? -2.611  3.345   -59.621 1.00 23.01  ? 1129 LYS B CG    1 
ATOM   4397 C  CD    . LYS D 1 129 ? -1.568  3.141   -58.546 1.00 22.89  ? 1129 LYS B CD    1 
ATOM   4398 C  CE    . LYS D 1 129 ? -0.169  3.435   -59.063 1.00 22.70  ? 1129 LYS B CE    1 
ATOM   4399 N  NZ    . LYS D 1 129 ? -0.003  4.830   -59.545 1.00 23.10  ? 1129 LYS B NZ    1 
ATOM   4400 N  N     . ASN D 1 130 ? -3.391  0.206   -62.819 1.00 24.05  ? 1130 ASN B N     1 
ATOM   4401 C  CA    . ASN D 1 130 ? -3.152  -0.525  -64.061 1.00 24.43  ? 1130 ASN B CA    1 
ATOM   4402 C  C     . ASN D 1 130 ? -4.305  -0.482  -65.050 1.00 24.62  ? 1130 ASN B C     1 
ATOM   4403 O  O     . ASN D 1 130 ? -4.081  -0.382  -66.251 1.00 24.61  ? 1130 ASN B O     1 
ATOM   4404 C  CB    . ASN D 1 130 ? -2.791  -1.991  -63.778 1.00 24.46  ? 1130 ASN B CB    1 
ATOM   4405 C  CG    . ASN D 1 130 ? -1.441  -2.135  -63.117 1.00 25.70  ? 1130 ASN B CG    1 
ATOM   4406 O  OD1   . ASN D 1 130 ? -0.693  -1.165  -63.007 1.00 26.01  ? 1130 ASN B OD1   1 
ATOM   4407 N  ND2   . ASN D 1 130 ? -1.118  -3.357  -62.663 1.00 25.49  ? 1130 ASN B ND2   1 
ATOM   4408 N  N     . LYS D 1 131 ? -5.533  -0.592  -64.549 1.00 24.71  ? 1131 LYS B N     1 
ATOM   4409 C  CA    . LYS D 1 131 ? -6.708  -0.572  -65.413 1.00 24.80  ? 1131 LYS B CA    1 
ATOM   4410 C  C     . LYS D 1 131 ? -6.885  0.816   -66.028 1.00 24.37  ? 1131 LYS B C     1 
ATOM   4411 O  O     . LYS D 1 131 ? -7.162  0.936   -67.223 1.00 24.55  ? 1131 LYS B O     1 
ATOM   4412 C  CB    . LYS D 1 131 ? -7.970  -0.971  -64.631 1.00 25.22  ? 1131 LYS B CB    1 
ATOM   4413 C  CG    . LYS D 1 131 ? -9.236  -1.110  -65.488 1.00 26.58  ? 1131 LYS B CG    1 
ATOM   4414 C  CD    . LYS D 1 131 ? -9.146  -2.295  -66.437 1.00 29.52  ? 1131 LYS B CD    1 
ATOM   4415 C  CE    . LYS D 1 131 ? -9.149  -3.616  -65.660 1.00 30.97  ? 1131 LYS B CE    1 
ATOM   4416 N  NZ    . LYS D 1 131 ? -8.757  -4.791  -66.503 1.00 32.96  ? 1131 LYS B NZ    1 
ATOM   4417 N  N     . ILE D 1 132 ? -6.723  1.851   -65.212 1.00 23.85  ? 1132 ILE B N     1 
ATOM   4418 C  CA    . ILE D 1 132 ? -6.860  3.238   -65.684 1.00 23.62  ? 1132 ILE B CA    1 
ATOM   4419 C  C     . ILE D 1 132 ? -5.796  3.550   -66.746 1.00 24.31  ? 1132 ILE B C     1 
ATOM   4420 O  O     . ILE D 1 132 ? -6.091  4.176   -67.779 1.00 23.76  ? 1132 ILE B O     1 
ATOM   4421 C  CB    . ILE D 1 132 ? -6.838  4.251   -64.507 1.00 23.27  ? 1132 ILE B CB    1 
ATOM   4422 C  CG1   . ILE D 1 132 ? -8.088  4.055   -63.632 1.00 21.85  ? 1132 ILE B CG1   1 
ATOM   4423 C  CG2   . ILE D 1 132 ? -6.726  5.708   -65.010 1.00 23.08  ? 1132 ILE B CG2   1 
ATOM   4424 C  CD1   . ILE D 1 132 ? -7.992  4.706   -62.258 1.00 21.00  ? 1132 ILE B CD1   1 
ATOM   4425 N  N     . LEU D 1 133 ? -4.571  3.080   -66.506 1.00 24.91  ? 1133 LEU B N     1 
ATOM   4426 C  CA    . LEU D 1 133 ? -3.496  3.218   -67.486 1.00 25.63  ? 1133 LEU B CA    1 
ATOM   4427 C  C     . LEU D 1 133 ? -3.788  2.456   -68.791 1.00 26.27  ? 1133 LEU B C     1 
ATOM   4428 O  O     . LEU D 1 133 ? -3.585  3.001   -69.871 1.00 26.13  ? 1133 LEU B O     1 
ATOM   4429 C  CB    . LEU D 1 133 ? -2.150  2.785   -66.880 1.00 25.82  ? 1133 LEU B CB    1 
ATOM   4430 C  CG    . LEU D 1 133 ? -0.897  3.094   -67.704 1.00 25.57  ? 1133 LEU B CG    1 
ATOM   4431 C  CD1   . LEU D 1 133 ? -0.624  4.600   -67.871 1.00 24.63  ? 1133 LEU B CD1   1 
ATOM   4432 C  CD2   . LEU D 1 133 ? 0.326   2.367   -67.126 1.00 25.81  ? 1133 LEU B CD2   1 
ATOM   4433 N  N     . GLU D 1 134 ? -4.281  1.216   -68.697 1.00 26.86  ? 1134 GLU B N     1 
ATOM   4434 C  CA    . GLU D 1 134 ? -4.575  0.414   -69.900 1.00 27.97  ? 1134 GLU B CA    1 
ATOM   4435 C  C     . GLU D 1 134 ? -5.631  1.094   -70.743 1.00 27.81  ? 1134 GLU B C     1 
ATOM   4436 O  O     . GLU D 1 134 ? -5.529  1.139   -71.966 1.00 27.96  ? 1134 GLU B O     1 
ATOM   4437 C  CB    . GLU D 1 134 ? -5.133  -0.983  -69.571 1.00 28.20  ? 1134 GLU B CB    1 
ATOM   4438 C  CG    . GLU D 1 134 ? -4.317  -1.898  -68.659 1.00 31.02  ? 1134 GLU B CG    1 
ATOM   4439 C  CD    . GLU D 1 134 ? -5.145  -3.120  -68.184 1.00 34.20  ? 1134 GLU B CD    1 
ATOM   4440 O  OE1   . GLU D 1 134 ? -5.755  -3.778  -69.060 1.00 34.82  ? 1134 GLU B OE1   1 
ATOM   4441 O  OE2   . GLU D 1 134 ? -5.197  -3.410  -66.950 1.00 33.57  ? 1134 GLU B OE2   1 
ATOM   4442 N  N     . LYS D 1 135 ? -6.663  1.595   -70.073 1.00 27.39  ? 1135 LYS B N     1 
ATOM   4443 C  CA    . LYS D 1 135 ? -7.855  2.046   -70.749 1.00 27.76  ? 1135 LYS B CA    1 
ATOM   4444 C  C     . LYS D 1 135 ? -7.738  3.485   -71.200 1.00 27.32  ? 1135 LYS B C     1 
ATOM   4445 O  O     . LYS D 1 135 ? -8.251  3.838   -72.259 1.00 27.43  ? 1135 LYS B O     1 
ATOM   4446 C  CB    . LYS D 1 135 ? -9.070  1.897   -69.838 1.00 28.28  ? 1135 LYS B CB    1 
ATOM   4447 C  CG    . LYS D 1 135 ? -9.502  0.462   -69.572 1.00 30.84  ? 1135 LYS B CG    1 
ATOM   4448 C  CD    . LYS D 1 135 ? -10.300 -0.129  -70.725 1.00 33.93  ? 1135 LYS B CD    1 
ATOM   4449 C  CE    . LYS D 1 135 ? -9.562  -1.293  -71.356 1.00 36.33  ? 1135 LYS B CE    1 
ATOM   4450 N  NZ    . LYS D 1 135 ? -9.419  -2.418  -70.382 1.00 37.91  ? 1135 LYS B NZ    1 
ATOM   4451 N  N     . GLU D 1 136 ? -7.060  4.308   -70.402 1.00 26.38  ? 1136 GLU B N     1 
ATOM   4452 C  CA    . GLU D 1 136 ? -7.068  5.761   -70.621 1.00 26.02  ? 1136 GLU B CA    1 
ATOM   4453 C  C     . GLU D 1 136 ? -5.685  6.388   -70.801 1.00 25.38  ? 1136 GLU B C     1 
ATOM   4454 O  O     . GLU D 1 136 ? -5.573  7.542   -71.232 1.00 24.92  ? 1136 GLU B O     1 
ATOM   4455 C  CB    . GLU D 1 136 ? -7.823  6.455   -69.485 1.00 25.96  ? 1136 GLU B CB    1 
ATOM   4456 C  CG    . GLU D 1 136 ? -9.319  6.193   -69.482 1.00 27.31  ? 1136 GLU B CG    1 
ATOM   4457 C  CD    . GLU D 1 136 ? -10.002 6.593   -70.794 1.00 29.19  ? 1136 GLU B CD    1 
ATOM   4458 O  OE1   . GLU D 1 136 ? -9.535  7.555   -71.462 1.00 30.04  ? 1136 GLU B OE1   1 
ATOM   4459 O  OE2   . GLU D 1 136 ? -11.010 5.940   -71.149 1.00 27.92  ? 1136 GLU B OE2   1 
ATOM   4460 N  N     . LYS D 1 137 ? -4.643  5.624   -70.473 1.00 24.78  ? 1137 LYS B N     1 
ATOM   4461 C  CA    . LYS D 1 137 ? -3.246  6.076   -70.586 1.00 24.93  ? 1137 LYS B CA    1 
ATOM   4462 C  C     . LYS D 1 137 ? -2.936  7.202   -69.602 1.00 24.08  ? 1137 LYS B C     1 
ATOM   4463 O  O     . LYS D 1 137 ? -1.993  7.974   -69.783 1.00 23.83  ? 1137 LYS B O     1 
ATOM   4464 C  CB    . LYS D 1 137 ? -2.895  6.464   -72.035 1.00 25.20  ? 1137 LYS B CB    1 
ATOM   4465 C  CG    . LYS D 1 137 ? -2.609  5.259   -72.933 1.00 27.14  ? 1137 LYS B CG    1 
ATOM   4466 C  CD    . LYS D 1 137 ? -1.157  4.773   -72.753 1.00 30.32  ? 1137 LYS B CD    1 
ATOM   4467 C  CE    . LYS D 1 137 ? -1.030  3.242   -72.762 1.00 32.81  ? 1137 LYS B CE    1 
ATOM   4468 N  NZ    . LYS D 1 137 ? -1.307  2.611   -71.414 1.00 31.45  ? 1137 LYS B NZ    1 
ATOM   4469 N  N     . ILE D 1 138 ? -3.721  7.239   -68.533 1.00 23.54  ? 1138 ILE B N     1 
ATOM   4470 C  CA    . ILE D 1 138 ? -3.627  8.260   -67.504 1.00 23.80  ? 1138 ILE B CA    1 
ATOM   4471 C  C     . ILE D 1 138 ? -3.022  7.654   -66.232 1.00 23.29  ? 1138 ILE B C     1 
ATOM   4472 O  O     . ILE D 1 138 ? -3.519  6.643   -65.729 1.00 23.29  ? 1138 ILE B O     1 
ATOM   4473 C  CB    . ILE D 1 138 ? -5.047  8.826   -67.204 1.00 23.94  ? 1138 ILE B CB    1 
ATOM   4474 C  CG1   . ILE D 1 138 ? -5.602  9.590   -68.422 1.00 24.68  ? 1138 ILE B CG1   1 
ATOM   4475 C  CG2   . ILE D 1 138 ? -5.084  9.668   -65.919 1.00 23.24  ? 1138 ILE B CG2   1 
ATOM   4476 C  CD1   . ILE D 1 138 ? -4.739  10.791  -68.902 1.00 25.42  ? 1138 ILE B CD1   1 
ATOM   4477 N  N     . THR D 1 139 ? -1.964  8.281   -65.718 1.00 22.85  ? 1139 THR B N     1 
ATOM   4478 C  CA    . THR D 1 139 ? -1.388  7.915   -64.423 1.00 22.60  ? 1139 THR B CA    1 
ATOM   4479 C  C     . THR D 1 139 ? -2.160  8.605   -63.296 1.00 22.38  ? 1139 THR B C     1 
ATOM   4480 O  O     . THR D 1 139 ? -2.531  9.776   -63.415 1.00 22.46  ? 1139 THR B O     1 
ATOM   4481 C  CB    . THR D 1 139 ? 0.137   8.264   -64.305 1.00 23.08  ? 1139 THR B CB    1 
ATOM   4482 O  OG1   . THR D 1 139 ? 0.311   9.671   -64.086 1.00 22.90  ? 1139 THR B OG1   1 
ATOM   4483 C  CG2   . THR D 1 139 ? 0.931   7.828   -65.553 1.00 23.42  ? 1139 THR B CG2   1 
ATOM   4484 N  N     . VAL D 1 140 ? -2.412  7.863   -62.220 1.00 21.77  ? 1140 VAL B N     1 
ATOM   4485 C  CA    . VAL D 1 140 ? -3.106  8.377   -61.031 1.00 21.41  ? 1140 VAL B CA    1 
ATOM   4486 C  C     . VAL D 1 140 ? -2.321  8.031   -59.765 1.00 21.53  ? 1140 VAL B C     1 
ATOM   4487 O  O     . VAL D 1 140 ? -1.437  7.162   -59.785 1.00 21.85  ? 1140 VAL B O     1 
ATOM   4488 C  CB    . VAL D 1 140 ? -4.578  7.843   -60.916 1.00 20.81  ? 1140 VAL B CB    1 
ATOM   4489 C  CG1   . VAL D 1 140 ? -5.342  8.023   -62.243 1.00 22.01  ? 1140 VAL B CG1   1 
ATOM   4490 C  CG2   . VAL D 1 140 ? -4.615  6.399   -60.496 1.00 20.26  ? 1140 VAL B CG2   1 
ATOM   4491 N  N     . THR D 1 141 ? -2.628  8.723   -58.675 1.00 21.62  ? 1141 THR B N     1 
ATOM   4492 C  CA    . THR D 1 141 ? -1.995  8.460   -57.384 1.00 21.40  ? 1141 THR B CA    1 
ATOM   4493 C  C     . THR D 1 141 ? -3.096  7.950   -56.473 1.00 20.83  ? 1141 THR B C     1 
ATOM   4494 O  O     . THR D 1 141 ? -4.214  8.480   -56.489 1.00 20.54  ? 1141 THR B O     1 
ATOM   4495 C  CB    . THR D 1 141 ? -1.325  9.734   -56.826 1.00 21.63  ? 1141 THR B CB    1 
ATOM   4496 O  OG1   . THR D 1 141 ? -0.248  10.105  -57.693 1.00 22.98  ? 1141 THR B OG1   1 
ATOM   4497 C  CG2   . THR D 1 141 ? -0.767  9.505   -55.434 1.00 21.13  ? 1141 THR B CG2   1 
ATOM   4498 N  N     . VAL D 1 142 ? -2.799  6.884   -55.731 1.00 20.22  ? 1142 VAL B N     1 
ATOM   4499 C  CA    . VAL D 1 142 ? -3.767  6.267   -54.832 1.00 19.73  ? 1142 VAL B CA    1 
ATOM   4500 C  C     . VAL D 1 142 ? -3.284  6.402   -53.383 1.00 19.71  ? 1142 VAL B C     1 
ATOM   4501 O  O     . VAL D 1 142 ? -2.114  6.091   -53.074 1.00 18.81  ? 1142 VAL B O     1 
ATOM   4502 C  CB    . VAL D 1 142 ? -3.988  4.756   -55.193 1.00 20.53  ? 1142 VAL B CB    1 
ATOM   4503 C  CG1   . VAL D 1 142 ? -4.841  4.022   -54.124 1.00 20.15  ? 1142 VAL B CG1   1 
ATOM   4504 C  CG2   . VAL D 1 142 ? -4.585  4.593   -56.596 1.00 21.01  ? 1142 VAL B CG2   1 
ATOM   4505 N  N     . GLY D 1 143 ? -4.177  6.849   -52.501 1.00 18.21  ? 1143 GLY B N     1 
ATOM   4506 C  CA    . GLY D 1 143 ? -3.932  6.808   -51.057 1.00 18.83  ? 1143 GLY B CA    1 
ATOM   4507 C  C     . GLY D 1 143 ? -4.939  5.872   -50.383 1.00 19.62  ? 1143 GLY B C     1 
ATOM   4508 O  O     . GLY D 1 143 ? -6.117  5.828   -50.765 1.00 18.69  ? 1143 GLY B O     1 
ATOM   4509 N  N     . ILE D 1 144 ? -4.474  5.109   -49.397 1.00 19.13  ? 1144 ILE B N     1 
ATOM   4510 C  CA    . ILE D 1 144 ? -5.314  4.133   -48.699 1.00 19.04  ? 1144 ILE B CA    1 
ATOM   4511 C  C     . ILE D 1 144 ? -5.124  4.318   -47.202 1.00 19.80  ? 1144 ILE B C     1 
ATOM   4512 O  O     . ILE D 1 144 ? -3.990  4.317   -46.709 1.00 19.73  ? 1144 ILE B O     1 
ATOM   4513 C  CB    . ILE D 1 144 ? -4.967  2.676   -49.094 1.00 19.49  ? 1144 ILE B CB    1 
ATOM   4514 C  CG1   . ILE D 1 144 ? -5.335  2.405   -50.562 1.00 18.49  ? 1144 ILE B CG1   1 
ATOM   4515 C  CG2   . ILE D 1 144 ? -5.664  1.658   -48.145 1.00 19.11  ? 1144 ILE B CG2   1 
ATOM   4516 C  CD1   . ILE D 1 144 ? -4.504  1.290   -51.222 1.00 20.15  ? 1144 ILE B CD1   1 
ATOM   4517 N  N     . SER D 1 145 ? -6.226  4.506   -46.483 1.00 19.18  ? 1145 SER B N     1 
ATOM   4518 C  CA    . SER D 1 145 ? -6.157  4.566   -45.030 1.00 19.90  ? 1145 SER B CA    1 
ATOM   4519 C  C     . SER D 1 145 ? -7.504  4.232   -44.391 1.00 19.85  ? 1145 SER B C     1 
ATOM   4520 O  O     . SER D 1 145 ? -8.393  3.684   -45.052 1.00 19.95  ? 1145 SER B O     1 
ATOM   4521 C  CB    . SER D 1 145 ? -5.609  5.925   -44.546 1.00 19.19  ? 1145 SER B CB    1 
ATOM   4522 O  OG    . SER D 1 145 ? -5.135  5.799   -43.203 1.00 20.96  ? 1145 SER B OG    1 
ATOM   4523 N  N     . LYS D 1 146 ? -7.653  4.583   -43.119 1.00 19.77  ? 1146 LYS B N     1 
ATOM   4524 C  CA    . LYS D 1 146 ? -8.809  4.194   -42.346 1.00 21.00  ? 1146 LYS B CA    1 
ATOM   4525 C  C     . LYS D 1 146 ? -10.013 5.141   -42.507 1.00 21.60  ? 1146 LYS B C     1 
ATOM   4526 O  O     . LYS D 1 146 ? -11.151 4.771   -42.185 1.00 22.43  ? 1146 LYS B O     1 
ATOM   4527 C  CB    . LYS D 1 146 ? -8.419  4.045   -40.867 1.00 20.95  ? 1146 LYS B CB    1 
ATOM   4528 C  CG    . LYS D 1 146 ? -7.956  5.343   -40.180 1.00 21.92  ? 1146 LYS B CG    1 
ATOM   4529 C  CD    . LYS D 1 146 ? -7.266  5.068   -38.834 1.00 23.69  ? 1146 LYS B CD    1 
ATOM   4530 C  CE    . LYS D 1 146 ? -8.220  4.454   -37.831 1.00 24.83  ? 1146 LYS B CE    1 
ATOM   4531 N  NZ    . LYS D 1 146 ? -7.623  4.407   -36.463 1.00 26.51  ? 1146 LYS B NZ    1 
ATOM   4532 N  N     . ASN D 1 147 ? -9.763  6.351   -42.994 1.00 21.53  ? 1147 ASN B N     1 
ATOM   4533 C  CA    . ASN D 1 147 ? -10.831 7.312   -43.256 1.00 21.92  ? 1147 ASN B CA    1 
ATOM   4534 C  C     . ASN D 1 147 ? -10.509 8.186   -44.476 1.00 21.64  ? 1147 ASN B C     1 
ATOM   4535 O  O     . ASN D 1 147 ? -9.420  8.065   -45.061 1.00 20.70  ? 1147 ASN B O     1 
ATOM   4536 C  CB    . ASN D 1 147 ? -11.120 8.149   -41.996 1.00 21.83  ? 1147 ASN B CB    1 
ATOM   4537 C  CG    . ASN D 1 147 ? -9.932  8.995   -41.558 1.00 22.41  ? 1147 ASN B CG    1 
ATOM   4538 O  OD1   . ASN D 1 147 ? -9.191  9.535   -42.387 1.00 21.71  ? 1147 ASN B OD1   1 
ATOM   4539 N  ND2   . ASN D 1 147 ? -9.762  9.133   -40.240 1.00 19.00  ? 1147 ASN B ND2   1 
ATOM   4540 N  N     . LYS D 1 148 ? -11.437 9.060   -44.862 1.00 21.19  ? 1148 LYS B N     1 
ATOM   4541 C  CA    . LYS D 1 148 ? -11.260 9.854   -46.082 1.00 21.39  ? 1148 LYS B CA    1 
ATOM   4542 C  C     . LYS D 1 148 ? -10.095 10.843  -46.017 1.00 21.11  ? 1148 LYS B C     1 
ATOM   4543 O  O     . LYS D 1 148 ? -9.430  11.092  -47.026 1.00 21.11  ? 1148 LYS B O     1 
ATOM   4544 C  CB    . LYS D 1 148 ? -12.547 10.606  -46.447 1.00 21.45  ? 1148 LYS B CB    1 
ATOM   4545 C  CG    . LYS D 1 148 ? -13.722 9.690   -46.819 1.00 22.87  ? 1148 LYS B CG    1 
ATOM   4546 C  CD    . LYS D 1 148 ? -14.846 10.438  -47.566 1.00 26.04  ? 1148 LYS B CD    1 
ATOM   4547 C  CE    . LYS D 1 148 ? -15.840 11.127  -46.623 1.00 26.96  ? 1148 LYS B CE    1 
ATOM   4548 N  NZ    . LYS D 1 148 ? -16.705 12.113  -47.362 1.00 26.41  ? 1148 LYS B NZ    1 
ATOM   4549 N  N     . VAL D 1 149 ? -9.893  11.447  -44.850 1.00 20.31  ? 1149 VAL B N     1 
ATOM   4550 C  CA    . VAL D 1 149 ? -8.892  12.492  -44.699 1.00 21.06  ? 1149 VAL B CA    1 
ATOM   4551 C  C     . VAL D 1 149 ? -7.491  11.890  -44.783 1.00 20.96  ? 1149 VAL B C     1 
ATOM   4552 O  O     . VAL D 1 149 ? -6.631  12.403  -45.497 1.00 21.91  ? 1149 VAL B O     1 
ATOM   4553 C  CB    . VAL D 1 149 ? -9.103  13.327  -43.386 1.00 21.49  ? 1149 VAL B CB    1 
ATOM   4554 C  CG1   . VAL D 1 149 ? -7.910  14.261  -43.106 1.00 21.31  ? 1149 VAL B CG1   1 
ATOM   4555 C  CG2   . VAL D 1 149 ? -10.362 14.148  -43.496 1.00 20.00  ? 1149 VAL B CG2   1 
ATOM   4556 N  N     . PHE D 1 150 ? -7.269  10.770  -44.120 1.00 20.63  ? 1150 PHE B N     1 
ATOM   4557 C  CA    . PHE D 1 150 ? -5.943  10.167  -44.179 1.00 20.58  ? 1150 PHE B CA    1 
ATOM   4558 C  C     . PHE D 1 150 ? -5.658  9.475   -45.497 1.00 19.93  ? 1150 PHE B C     1 
ATOM   4559 O  O     . PHE D 1 150 ? -4.519  9.448   -45.920 1.00 19.48  ? 1150 PHE B O     1 
ATOM   4560 C  CB    . PHE D 1 150 ? -5.690  9.271   -42.988 1.00 20.75  ? 1150 PHE B CB    1 
ATOM   4561 C  CG    . PHE D 1 150 ? -5.193  10.023  -41.804 1.00 24.18  ? 1150 PHE B CG    1 
ATOM   4562 C  CD1   . PHE D 1 150 ? -3.849  10.391  -41.716 1.00 26.75  ? 1150 PHE B CD1   1 
ATOM   4563 C  CD2   . PHE D 1 150 ? -6.063  10.408  -40.799 1.00 27.07  ? 1150 PHE B CD2   1 
ATOM   4564 C  CE1   . PHE D 1 150 ? -3.377  11.112  -40.631 1.00 27.40  ? 1150 PHE B CE1   1 
ATOM   4565 C  CE2   . PHE D 1 150 ? -5.598  11.124  -39.699 1.00 28.62  ? 1150 PHE B CE2   1 
ATOM   4566 C  CZ    . PHE D 1 150 ? -4.248  11.480  -39.623 1.00 28.19  ? 1150 PHE B CZ    1 
ATOM   4567 N  N     . ALA D 1 151 ? -6.701  8.944   -46.144 1.00 19.22  ? 1151 ALA B N     1 
ATOM   4568 C  CA    . ALA D 1 151 ? -6.589  8.475   -47.538 1.00 19.33  ? 1151 ALA B CA    1 
ATOM   4569 C  C     . ALA D 1 151 ? -6.103  9.593   -48.477 1.00 19.37  ? 1151 ALA B C     1 
ATOM   4570 O  O     . ALA D 1 151 ? -5.237  9.368   -49.319 1.00 19.25  ? 1151 ALA B O     1 
ATOM   4571 C  CB    . ALA D 1 151 ? -7.918  7.880   -48.034 1.00 18.87  ? 1151 ALA B CB    1 
ATOM   4572 N  N     . LYS D 1 152 ? -6.644  10.803  -48.325 1.00 19.95  ? 1152 LYS B N     1 
ATOM   4573 C  CA    . LYS D 1 152 ? -6.193  11.922  -49.150 1.00 20.49  ? 1152 LYS B CA    1 
ATOM   4574 C  C     . LYS D 1 152 ? -4.754  12.353  -48.855 1.00 20.86  ? 1152 LYS B C     1 
ATOM   4575 O  O     . LYS D 1 152 ? -3.982  12.626  -49.780 1.00 20.59  ? 1152 LYS B O     1 
ATOM   4576 C  CB    . LYS D 1 152 ? -7.135  13.123  -49.022 1.00 20.80  ? 1152 LYS B CB    1 
ATOM   4577 C  CG    . LYS D 1 152 ? -6.789  14.247  -49.971 1.00 22.50  ? 1152 LYS B CG    1 
ATOM   4578 C  CD    . LYS D 1 152 ? -7.597  15.479  -49.652 1.00 27.19  ? 1152 LYS B CD    1 
ATOM   4579 C  CE    . LYS D 1 152 ? -7.383  16.525  -50.710 1.00 29.63  ? 1152 LYS B CE    1 
ATOM   4580 N  NZ    . LYS D 1 152 ? -8.342  16.271  -51.793 1.00 32.75  ? 1152 LYS B NZ    1 
ATOM   4581 N  N     . ILE D 1 153 ? -4.410  12.460  -47.571 1.00 21.64  ? 1153 ILE B N     1 
ATOM   4582 C  CA    . ILE D 1 153 ? -3.033  12.770  -47.164 1.00 21.79  ? 1153 ILE B CA    1 
ATOM   4583 C  C     . ILE D 1 153 ? -2.070  11.736  -47.736 1.00 21.83  ? 1153 ILE B C     1 
ATOM   4584 O  O     . ILE D 1 153 ? -0.990  12.085  -48.230 1.00 22.33  ? 1153 ILE B O     1 
ATOM   4585 C  CB    . ILE D 1 153 ? -2.880  12.828  -45.614 1.00 22.39  ? 1153 ILE B CB    1 
ATOM   4586 C  CG1   . ILE D 1 153 ? -3.656  14.035  -45.062 1.00 22.54  ? 1153 ILE B CG1   1 
ATOM   4587 C  CG2   . ILE D 1 153 ? -1.376  12.910  -45.225 1.00 21.48  ? 1153 ILE B CG2   1 
ATOM   4588 C  CD1   . ILE D 1 153 ? -3.893  14.038  -43.565 1.00 23.23  ? 1153 ILE B CD1   1 
ATOM   4589 N  N     . ALA D 1 154 ? -2.460  10.464  -47.670 1.00 21.54  ? 1154 ALA B N     1 
ATOM   4590 C  CA    . ALA D 1 154 ? -1.661  9.385   -48.247 1.00 21.99  ? 1154 ALA B CA    1 
ATOM   4591 C  C     . ALA D 1 154 ? -1.344  9.645   -49.721 1.00 22.97  ? 1154 ALA B C     1 
ATOM   4592 O  O     . ALA D 1 154 ? -0.188  9.492   -50.143 1.00 22.35  ? 1154 ALA B O     1 
ATOM   4593 C  CB    . ALA D 1 154 ? -2.369  8.054   -48.076 1.00 21.68  ? 1154 ALA B CB    1 
ATOM   4594 N  N     . ALA D 1 155 ? -2.365  10.036  -50.499 1.00 22.62  ? 1155 ALA B N     1 
ATOM   4595 C  CA    . ALA D 1 155 ? -2.161  10.422  -51.899 1.00 23.99  ? 1155 ALA B CA    1 
ATOM   4596 C  C     . ALA D 1 155 ? -1.197  11.606  -52.043 1.00 24.43  ? 1155 ALA B C     1 
ATOM   4597 O  O     . ALA D 1 155 ? -0.283  11.544  -52.855 1.00 24.61  ? 1155 ALA B O     1 
ATOM   4598 C  CB    . ALA D 1 155 ? -3.506  10.735  -52.599 1.00 23.91  ? 1155 ALA B CB    1 
ATOM   4599 N  N     . ASP D 1 156 ? -1.388  12.661  -51.253 1.00 25.50  ? 1156 ASP B N     1 
ATOM   4600 C  CA    . ASP D 1 156 ? -0.495  13.831  -51.318 1.00 27.24  ? 1156 ASP B CA    1 
ATOM   4601 C  C     . ASP D 1 156 ? 0.980   13.445  -51.072 1.00 27.06  ? 1156 ASP B C     1 
ATOM   4602 O  O     . ASP D 1 156 ? 1.879   13.990  -51.708 1.00 27.01  ? 1156 ASP B O     1 
ATOM   4603 C  CB    . ASP D 1 156 ? -0.889  14.916  -50.318 1.00 27.78  ? 1156 ASP B CB    1 
ATOM   4604 C  CG    . ASP D 1 156 ? -2.327  15.370  -50.460 1.00 30.73  ? 1156 ASP B CG    1 
ATOM   4605 O  OD1   . ASP D 1 156 ? -2.883  15.396  -51.588 1.00 32.82  ? 1156 ASP B OD1   1 
ATOM   4606 O  OD2   . ASP D 1 156 ? -2.906  15.715  -49.410 1.00 35.28  ? 1156 ASP B OD2   1 
ATOM   4607 N  N     . MET D 1 157 ? 1.204   12.493  -50.173 1.00 27.26  ? 1157 MET B N     1 
ATOM   4608 C  CA    . MET D 1 157 ? 2.555   12.012  -49.853 1.00 27.81  ? 1157 MET B CA    1 
ATOM   4609 C  C     . MET D 1 157 ? 3.142   11.201  -51.000 1.00 28.08  ? 1157 MET B C     1 
ATOM   4610 O  O     . MET D 1 157 ? 4.367   11.085  -51.131 1.00 28.18  ? 1157 MET B O     1 
ATOM   4611 C  CB    . MET D 1 157 ? 2.532   11.153  -48.586 1.00 27.60  ? 1157 MET B CB    1 
ATOM   4612 C  CG    . MET D 1 157 ? 2.250   11.927  -47.312 1.00 29.49  ? 1157 MET B CG    1 
ATOM   4613 S  SD    . MET D 1 157 ? 1.982   10.853  -45.882 1.00 33.09  ? 1157 MET B SD    1 
ATOM   4614 C  CE    . MET D 1 157 ? 3.678   10.491  -45.419 1.00 32.10  ? 1157 MET B CE    1 
ATOM   4615 N  N     . ALA D 1 158 ? 2.269   10.636  -51.826 1.00 27.47  ? 1158 ALA B N     1 
ATOM   4616 C  CA    . ALA D 1 158 ? 2.695   9.683   -52.832 1.00 27.44  ? 1158 ALA B CA    1 
ATOM   4617 C  C     . ALA D 1 158 ? 2.775   10.245  -54.257 1.00 27.54  ? 1158 ALA B C     1 
ATOM   4618 O  O     . ALA D 1 158 ? 3.302   9.570   -55.145 1.00 27.27  ? 1158 ALA B O     1 
ATOM   4619 C  CB    . ALA D 1 158 ? 1.795   8.459   -52.791 1.00 26.73  ? 1158 ALA B CB    1 
ATOM   4620 N  N     . LYS D 1 159 ? 2.248   11.449  -54.498 1.00 28.47  ? 1159 LYS B N     1 
ATOM   4621 C  CA    . LYS D 1 159 ? 2.316   12.029  -55.867 1.00 28.99  ? 1159 LYS B CA    1 
ATOM   4622 C  C     . LYS D 1 159 ? 3.777   12.233  -56.353 1.00 29.78  ? 1159 LYS B C     1 
ATOM   4623 O  O     . LYS D 1 159 ? 4.691   12.427  -55.531 1.00 29.41  ? 1159 LYS B O     1 
ATOM   4624 C  CB    . LYS D 1 159 ? 1.376   13.257  -56.115 1.00 30.12  ? 1159 LYS B CB    1 
ATOM   4625 C  CG    . LYS D 1 159 ? 0.589   13.845  -54.946 1.00 30.79  ? 1159 LYS B CG    1 
ATOM   4626 C  CD    . LYS D 1 159 ? -0.366  15.021  -55.383 1.00 35.29  ? 1159 LYS B CD    1 
ATOM   4627 C  CE    . LYS D 1 159 ? -1.853  14.607  -55.532 1.00 34.37  ? 1159 LYS B CE    1 
ATOM   4628 N  NZ    . LYS D 1 159 ? -2.875  15.779  -55.709 1.00 34.68  ? 1159 LYS B NZ    1 
ATOM   4629 N  N     . PRO D 1 160 ? 4.019   12.113  -57.679 1.00 29.68  ? 1160 PRO B N     1 
ATOM   4630 C  CA    . PRO D 1 160 ? 3.064   11.708  -58.715 1.00 29.08  ? 1160 PRO B CA    1 
ATOM   4631 C  C     . PRO D 1 160 ? 3.072   10.203  -58.939 1.00 28.23  ? 1160 PRO B C     1 
ATOM   4632 O  O     . PRO D 1 160 ? 4.028   9.535   -58.545 1.00 27.60  ? 1160 PRO B O     1 
ATOM   4633 C  CB    . PRO D 1 160 ? 3.619   12.391  -59.965 1.00 29.75  ? 1160 PRO B CB    1 
ATOM   4634 C  CG    . PRO D 1 160 ? 5.120   12.402  -59.752 1.00 29.16  ? 1160 PRO B CG    1 
ATOM   4635 C  CD    . PRO D 1 160 ? 5.352   12.408  -58.248 1.00 30.12  ? 1160 PRO B CD    1 
ATOM   4636 N  N     . ASN D 1 161 ? 2.030   9.685   -59.593 1.00 27.16  ? 1161 ASN B N     1 
ATOM   4637 C  CA    . ASN D 1 161 ? 2.008   8.294   -60.036 1.00 26.93  ? 1161 ASN B CA    1 
ATOM   4638 C  C     . ASN D 1 161 ? 2.443   7.342   -58.913 1.00 26.63  ? 1161 ASN B C     1 
ATOM   4639 O  O     . ASN D 1 161 ? 3.337   6.501   -59.083 1.00 26.74  ? 1161 ASN B O     1 
ATOM   4640 C  CB    . ASN D 1 161 ? 2.882   8.140   -61.293 1.00 27.65  ? 1161 ASN B CB    1 
ATOM   4641 C  CG    . ASN D 1 161 ? 2.670   6.822   -61.998 1.00 28.76  ? 1161 ASN B CG    1 
ATOM   4642 O  OD1   . ASN D 1 161 ? 1.658   6.154   -61.807 1.00 31.54  ? 1161 ASN B OD1   1 
ATOM   4643 N  ND2   . ASN D 1 161 ? 3.630   6.440   -62.823 1.00 30.32  ? 1161 ASN B ND2   1 
ATOM   4644 N  N     . GLY D 1 162 ? 1.821   7.514   -57.747 1.00 25.64  ? 1162 GLY B N     1 
ATOM   4645 C  CA    . GLY D 1 162 ? 2.211   6.774   -56.566 1.00 25.11  ? 1162 GLY B CA    1 
ATOM   4646 C  C     . GLY D 1 162 ? 1.089   5.941   -55.984 1.00 24.51  ? 1162 GLY B C     1 
ATOM   4647 O  O     . GLY D 1 162 ? -0.059  5.979   -56.450 1.00 23.91  ? 1162 GLY B O     1 
ATOM   4648 N  N     . ILE D 1 163 ? 1.435   5.183   -54.957 1.00 23.67  ? 1163 ILE B N     1 
ATOM   4649 C  CA    . ILE D 1 163 ? 0.448   4.502   -54.131 1.00 23.15  ? 1163 ILE B CA    1 
ATOM   4650 C  C     . ILE D 1 163 ? 1.026   4.439   -52.720 1.00 23.33  ? 1163 ILE B C     1 
ATOM   4651 O  O     . ILE D 1 163 ? 2.193   4.098   -52.542 1.00 22.44  ? 1163 ILE B O     1 
ATOM   4652 C  CB    . ILE D 1 163 ? 0.091   3.102   -54.708 1.00 23.29  ? 1163 ILE B CB    1 
ATOM   4653 C  CG1   . ILE D 1 163 ? -0.983  2.408   -53.864 1.00 23.58  ? 1163 ILE B CG1   1 
ATOM   4654 C  CG2   . ILE D 1 163 ? 1.355   2.222   -54.899 1.00 22.12  ? 1163 ILE B CG2   1 
ATOM   4655 C  CD1   . ILE D 1 163 ? -1.461  1.077   -54.463 1.00 25.43  ? 1163 ILE B CD1   1 
ATOM   4656 N  N     . LYS D 1 164 ? 0.218   4.796   -51.728 1.00 23.06  ? 1164 LYS B N     1 
ATOM   4657 C  CA    . LYS D 1 164 ? 0.659   4.810   -50.339 1.00 23.40  ? 1164 LYS B CA    1 
ATOM   4658 C  C     . LYS D 1 164 ? -0.453  4.323   -49.423 1.00 23.43  ? 1164 LYS B C     1 
ATOM   4659 O  O     . LYS D 1 164 ? -1.604  4.795   -49.532 1.00 22.76  ? 1164 LYS B O     1 
ATOM   4660 C  CB    . LYS D 1 164 ? 1.116   6.230   -49.938 1.00 24.05  ? 1164 LYS B CB    1 
ATOM   4661 C  CG    . LYS D 1 164 ? 1.334   6.491   -48.432 1.00 24.66  ? 1164 LYS B CG    1 
ATOM   4662 C  CD    . LYS D 1 164 ? 2.672   5.957   -47.930 1.00 27.33  ? 1164 LYS B CD    1 
ATOM   4663 C  CE    . LYS D 1 164 ? 2.868   6.227   -46.420 1.00 26.74  ? 1164 LYS B CE    1 
ATOM   4664 N  NZ    . LYS D 1 164 ? 4.092   5.538   -45.893 1.00 27.94  ? 1164 LYS B NZ    1 
ATOM   4665 N  N     . VAL D 1 165 ? -0.104  3.366   -48.548 1.00 22.80  ? 1165 VAL B N     1 
ATOM   4666 C  CA    . VAL D 1 165 ? -0.938  2.969   -47.409 1.00 22.58  ? 1165 VAL B CA    1 
ATOM   4667 C  C     . VAL D 1 165 ? -0.487  3.729   -46.154 1.00 22.78  ? 1165 VAL B C     1 
ATOM   4668 O  O     . VAL D 1 165 ? 0.691   3.702   -45.804 1.00 21.97  ? 1165 VAL B O     1 
ATOM   4669 C  CB    . VAL D 1 165 ? -0.836  1.438   -47.116 1.00 22.73  ? 1165 VAL B CB    1 
ATOM   4670 C  CG1   . VAL D 1 165 ? -1.385  1.102   -45.724 1.00 21.62  ? 1165 VAL B CG1   1 
ATOM   4671 C  CG2   . VAL D 1 165 ? -1.557  0.631   -48.178 1.00 21.94  ? 1165 VAL B CG2   1 
ATOM   4672 N  N     . ILE D 1 166 ? -1.418  4.403   -45.480 1.00 22.24  ? 1166 ILE B N     1 
ATOM   4673 C  CA    . ILE D 1 166 ? -1.141  4.908   -44.143 1.00 22.44  ? 1166 ILE B CA    1 
ATOM   4674 C  C     . ILE D 1 166 ? -1.876  4.027   -43.144 1.00 22.89  ? 1166 ILE B C     1 
ATOM   4675 O  O     . ILE D 1 166 ? -3.096  4.137   -42.991 1.00 22.23  ? 1166 ILE B O     1 
ATOM   4676 C  CB    . ILE D 1 166 ? -1.556  6.398   -43.962 1.00 22.34  ? 1166 ILE B CB    1 
ATOM   4677 C  CG1   . ILE D 1 166 ? -0.684  7.320   -44.819 1.00 22.53  ? 1166 ILE B CG1   1 
ATOM   4678 C  CG2   . ILE D 1 166 ? -1.448  6.815   -42.510 1.00 20.54  ? 1166 ILE B CG2   1 
ATOM   4679 C  CD1   . ILE D 1 166 ? -1.165  8.774   -44.816 1.00 21.37  ? 1166 ILE B CD1   1 
ATOM   4680 N  N     . ASP D 1 167 ? -1.125  3.146   -42.478 1.00 24.12  ? 1167 ASP B N     1 
ATOM   4681 C  CA    . ASP D 1 167 ? -1.699  2.235   -41.487 1.00 25.01  ? 1167 ASP B CA    1 
ATOM   4682 C  C     . ASP D 1 167 ? -1.861  2.911   -40.127 1.00 25.30  ? 1167 ASP B C     1 
ATOM   4683 O  O     . ASP D 1 167 ? -1.479  4.071   -39.962 1.00 25.42  ? 1167 ASP B O     1 
ATOM   4684 C  CB    . ASP D 1 167 ? -0.903  0.909   -41.401 1.00 25.25  ? 1167 ASP B CB    1 
ATOM   4685 C  CG    . ASP D 1 167 ? 0.497   1.067   -40.788 1.00 26.93  ? 1167 ASP B CG    1 
ATOM   4686 O  OD1   . ASP D 1 167 ? 0.815   2.105   -40.164 1.00 29.16  ? 1167 ASP B OD1   1 
ATOM   4687 O  OD2   . ASP D 1 167 ? 1.291   0.112   -40.921 1.00 28.60  ? 1167 ASP B OD2   1 
ATOM   4688 N  N     . ASP D 1 168 ? -2.424  2.189   -39.162 1.00 26.02  ? 1168 ASP B N     1 
ATOM   4689 C  CA    . ASP D 1 168 ? -2.719  2.742   -37.833 1.00 26.81  ? 1168 ASP B CA    1 
ATOM   4690 C  C     . ASP D 1 168 ? -1.531  3.375   -37.099 1.00 26.75  ? 1168 ASP B C     1 
ATOM   4691 O  O     . ASP D 1 168 ? -1.673  4.445   -36.511 1.00 26.86  ? 1168 ASP B O     1 
ATOM   4692 C  CB    . ASP D 1 168 ? -3.411  1.696   -36.955 1.00 26.84  ? 1168 ASP B CB    1 
ATOM   4693 C  CG    . ASP D 1 168 ? -4.835  1.427   -37.397 1.00 28.54  ? 1168 ASP B CG    1 
ATOM   4694 O  OD1   . ASP D 1 168 ? -5.354  2.168   -38.263 1.00 31.09  ? 1168 ASP B OD1   1 
ATOM   4695 O  OD2   . ASP D 1 168 ? -5.449  0.477   -36.877 1.00 31.87  ? 1168 ASP B OD2   1 
ATOM   4696 N  N     . GLU D 1 169 ? -0.366  2.740   -37.143 1.00 26.81  ? 1169 GLU B N     1 
ATOM   4697 C  CA    . GLU D 1 169 ? 0.808   3.333   -36.508 1.00 27.20  ? 1169 GLU B CA    1 
ATOM   4698 C  C     . GLU D 1 169 ? 1.219   4.641   -37.198 1.00 26.35  ? 1169 GLU B C     1 
ATOM   4699 O  O     . GLU D 1 169 ? 1.567   5.617   -36.531 1.00 25.75  ? 1169 GLU B O     1 
ATOM   4700 C  CB    . GLU D 1 169 ? 2.000   2.359   -36.449 1.00 27.70  ? 1169 GLU B CB    1 
ATOM   4701 C  CG    . GLU D 1 169 ? 1.680   0.881   -36.115 1.00 31.38  ? 1169 GLU B CG    1 
ATOM   4702 C  CD    . GLU D 1 169 ? 0.605   0.671   -35.034 1.00 35.33  ? 1169 GLU B CD    1 
ATOM   4703 O  OE1   . GLU D 1 169 ? 0.884   0.911   -33.838 1.00 36.17  ? 1169 GLU B OE1   1 
ATOM   4704 O  OE2   . GLU D 1 169 ? -0.519  0.235   -35.383 1.00 37.44  ? 1169 GLU B OE2   1 
ATOM   4705 N  N     . GLU D 1 170 ? 1.188   4.676   -38.528 1.00 25.82  ? 1170 GLU B N     1 
ATOM   4706 C  CA    . GLU D 1 170 ? 1.568   5.910   -39.211 1.00 25.77  ? 1170 GLU B CA    1 
ATOM   4707 C  C     . GLU D 1 170 ? 0.506   7.021   -39.081 1.00 24.86  ? 1170 GLU B C     1 
ATOM   4708 O  O     . GLU D 1 170 ? 0.846   8.205   -39.117 1.00 24.45  ? 1170 GLU B O     1 
ATOM   4709 C  CB    . GLU D 1 170 ? 1.991   5.684   -40.665 1.00 26.05  ? 1170 GLU B CB    1 
ATOM   4710 C  CG    . GLU D 1 170 ? 2.548   6.959   -41.311 1.00 28.57  ? 1170 GLU B CG    1 
ATOM   4711 C  CD    . GLU D 1 170 ? 3.261   6.728   -42.631 1.00 32.19  ? 1170 GLU B CD    1 
ATOM   4712 O  OE1   . GLU D 1 170 ? 3.216   5.600   -43.165 1.00 34.73  ? 1170 GLU B OE1   1 
ATOM   4713 O  OE2   . GLU D 1 170 ? 3.875   7.691   -43.139 1.00 34.75  ? 1170 GLU B OE2   1 
ATOM   4714 N  N     . VAL D 1 171 ? -0.760  6.640   -38.918 1.00 24.63  ? 1171 VAL B N     1 
ATOM   4715 C  CA    . VAL D 1 171 ? -1.819  7.611   -38.587 1.00 24.11  ? 1171 VAL B CA    1 
ATOM   4716 C  C     . VAL D 1 171 ? -1.407  8.349   -37.302 1.00 23.75  ? 1171 VAL B C     1 
ATOM   4717 O  O     . VAL D 1 171 ? -1.427  9.584   -37.256 1.00 23.00  ? 1171 VAL B O     1 
ATOM   4718 C  CB    . VAL D 1 171 ? -3.221  6.938   -38.442 1.00 24.53  ? 1171 VAL B CB    1 
ATOM   4719 C  CG1   . VAL D 1 171 ? -4.212  7.846   -37.699 1.00 24.44  ? 1171 VAL B CG1   1 
ATOM   4720 C  CG2   . VAL D 1 171 ? -3.782  6.577   -39.807 1.00 23.92  ? 1171 VAL B CG2   1 
ATOM   4721 N  N     . LYS D 1 172 ? -0.991  7.582   -36.293 1.00 23.41  ? 1172 LYS B N     1 
ATOM   4722 C  CA    . LYS D 1 172 ? -0.508  8.122   -35.014 1.00 23.44  ? 1172 LYS B CA    1 
ATOM   4723 C  C     . LYS D 1 172 ? 0.702   9.040   -35.169 1.00 22.94  ? 1172 LYS B C     1 
ATOM   4724 O  O     . LYS D 1 172 ? 0.754   10.107  -34.562 1.00 22.79  ? 1172 LYS B O     1 
ATOM   4725 C  CB    . LYS D 1 172 ? -0.150  6.994   -34.028 1.00 23.91  ? 1172 LYS B CB    1 
ATOM   4726 C  CG    . LYS D 1 172 ? -1.313  6.128   -33.540 1.00 25.70  ? 1172 LYS B CG    1 
ATOM   4727 C  CD    . LYS D 1 172 ? -2.387  6.936   -32.830 1.00 27.79  ? 1172 LYS B CD    1 
ATOM   4728 C  CE    . LYS D 1 172 ? -3.215  6.049   -31.898 1.00 28.34  ? 1172 LYS B CE    1 
ATOM   4729 N  NZ    . LYS D 1 172 ? -4.577  6.621   -31.710 1.00 27.28  ? 1172 LYS B NZ    1 
ATOM   4730 N  N     . ARG D 1 173 ? 1.682   8.614   -35.964 1.00 22.77  ? 1173 ARG B N     1 
ATOM   4731 C  CA    . ARG D 1 173 ? 2.891   9.405   -36.182 1.00 22.24  ? 1173 ARG B CA    1 
ATOM   4732 C  C     . ARG D 1 173 ? 2.510   10.721  -36.850 1.00 21.53  ? 1173 ARG B C     1 
ATOM   4733 O  O     . ARG D 1 173 ? 3.012   11.773  -36.468 1.00 20.59  ? 1173 ARG B O     1 
ATOM   4734 C  CB    . ARG D 1 173 ? 3.923   8.644   -37.023 1.00 22.70  ? 1173 ARG B CB    1 
ATOM   4735 C  CG    . ARG D 1 173 ? 5.273   9.372   -37.181 1.00 24.74  ? 1173 ARG B CG    1 
ATOM   4736 C  CD    . ARG D 1 173 ? 6.178   8.763   -38.270 1.00 27.81  ? 1173 ARG B CD    1 
ATOM   4737 N  NE    . ARG D 1 173 ? 5.611   8.848   -39.621 1.00 31.01  ? 1173 ARG B NE    1 
ATOM   4738 C  CZ    . ARG D 1 173 ? 5.736   9.890   -40.451 1.00 32.84  ? 1173 ARG B CZ    1 
ATOM   4739 N  NH1   . ARG D 1 173 ? 6.422   10.970  -40.086 1.00 34.34  ? 1173 ARG B NH1   1 
ATOM   4740 N  NH2   . ARG D 1 173 ? 5.186   9.850   -41.662 1.00 31.83  ? 1173 ARG B NH2   1 
ATOM   4741 N  N     . LEU D 1 174 ? 1.610   10.653  -37.836 1.00 20.97  ? 1174 LEU B N     1 
ATOM   4742 C  CA    . LEU D 1 174 ? 1.190   11.844  -38.574 1.00 20.74  ? 1174 LEU B CA    1 
ATOM   4743 C  C     . LEU D 1 174 ? 0.402   12.827  -37.725 1.00 20.16  ? 1174 LEU B C     1 
ATOM   4744 O  O     . LEU D 1 174 ? 0.576   14.030  -37.875 1.00 19.63  ? 1174 LEU B O     1 
ATOM   4745 C  CB    . LEU D 1 174 ? 0.410   11.483  -39.849 1.00 21.36  ? 1174 LEU B CB    1 
ATOM   4746 C  CG    . LEU D 1 174 ? 1.252   10.991  -41.039 1.00 22.93  ? 1174 LEU B CG    1 
ATOM   4747 C  CD1   . LEU D 1 174 ? 0.347   10.638  -42.197 1.00 23.69  ? 1174 LEU B CD1   1 
ATOM   4748 C  CD2   . LEU D 1 174 ? 2.312   12.021  -41.495 1.00 25.39  ? 1174 LEU B CD2   1 
ATOM   4749 N  N     . ILE D 1 175 ? -0.455  12.314  -36.835 1.00 19.87  ? 1175 ILE B N     1 
ATOM   4750 C  CA    . ILE D 1 175 ? -1.175  13.157  -35.872 1.00 19.62  ? 1175 ILE B CA    1 
ATOM   4751 C  C     . ILE D 1 175 ? -0.162  13.967  -35.044 1.00 19.66  ? 1175 ILE B C     1 
ATOM   4752 O  O     . ILE D 1 175 ? -0.367  15.150  -34.773 1.00 18.95  ? 1175 ILE B O     1 
ATOM   4753 C  CB    . ILE D 1 175 ? -2.141  12.317  -34.956 1.00 19.77  ? 1175 ILE B CB    1 
ATOM   4754 C  CG1   . ILE D 1 175 ? -3.378  11.895  -35.763 1.00 19.46  ? 1175 ILE B CG1   1 
ATOM   4755 C  CG2   . ILE D 1 175 ? -2.553  13.108  -33.706 1.00 17.75  ? 1175 ILE B CG2   1 
ATOM   4756 C  CD1   . ILE D 1 175 ? -4.185  10.731  -35.180 1.00 19.54  ? 1175 ILE B CD1   1 
ATOM   4757 N  N     . ARG D 1 176 ? 0.950   13.326  -34.704 1.00 20.30  ? 1176 ARG B N     1 
ATOM   4758 C  CA    . ARG D 1 176 ? 2.027   13.965  -33.964 1.00 21.58  ? 1176 ARG B CA    1 
ATOM   4759 C  C     . ARG D 1 176 ? 2.932   14.842  -34.825 1.00 22.05  ? 1176 ARG B C     1 
ATOM   4760 O  O     . ARG D 1 176 ? 3.417   15.870  -34.365 1.00 21.40  ? 1176 ARG B O     1 
ATOM   4761 C  CB    . ARG D 1 176 ? 2.891   12.908  -33.257 1.00 21.87  ? 1176 ARG B CB    1 
ATOM   4762 C  CG    . ARG D 1 176 ? 2.266   12.320  -32.015 1.00 23.39  ? 1176 ARG B CG    1 
ATOM   4763 C  CD    . ARG D 1 176 ? 3.223   11.366  -31.303 1.00 25.54  ? 1176 ARG B CD    1 
ATOM   4764 N  NE    . ARG D 1 176 ? 3.086   9.997   -31.805 1.00 27.12  ? 1176 ARG B NE    1 
ATOM   4765 C  CZ    . ARG D 1 176 ? 4.011   9.321   -32.482 1.00 26.12  ? 1176 ARG B CZ    1 
ATOM   4766 N  NH1   . ARG D 1 176 ? 5.195   9.854   -32.760 1.00 26.71  ? 1176 ARG B NH1   1 
ATOM   4767 N  NH2   . ARG D 1 176 ? 3.749   8.085   -32.865 1.00 25.88  ? 1176 ARG B NH2   1 
ATOM   4768 N  N     . GLU D 1 177 ? 3.172   14.443  -36.070 1.00 23.35  ? 1177 GLU B N     1 
ATOM   4769 C  CA    . GLU D 1 177 ? 4.271   15.053  -36.821 1.00 25.08  ? 1177 GLU B CA    1 
ATOM   4770 C  C     . GLU D 1 177 ? 3.865   15.889  -38.029 1.00 25.82  ? 1177 GLU B C     1 
ATOM   4771 O  O     . GLU D 1 177 ? 4.642   16.738  -38.480 1.00 25.93  ? 1177 GLU B O     1 
ATOM   4772 C  CB    . GLU D 1 177 ? 5.307   14.002  -37.237 1.00 25.15  ? 1177 GLU B CB    1 
ATOM   4773 C  CG    . GLU D 1 177 ? 6.128   13.450  -36.102 1.00 26.77  ? 1177 GLU B CG    1 
ATOM   4774 C  CD    . GLU D 1 177 ? 7.112   12.380  -36.552 1.00 28.56  ? 1177 GLU B CD    1 
ATOM   4775 O  OE1   . GLU D 1 177 ? 7.220   12.109  -37.775 1.00 30.91  ? 1177 GLU B OE1   1 
ATOM   4776 O  OE2   . GLU D 1 177 ? 7.774   11.799  -35.681 1.00 28.66  ? 1177 GLU B OE2   1 
ATOM   4777 N  N     . LEU D 1 178 ? 2.674   15.654  -38.567 1.00 26.66  ? 1178 LEU B N     1 
ATOM   4778 C  CA    . LEU D 1 178 ? 2.259   16.407  -39.738 1.00 27.63  ? 1178 LEU B CA    1 
ATOM   4779 C  C     . LEU D 1 178 ? 1.897   17.854  -39.406 1.00 27.77  ? 1178 LEU B C     1 
ATOM   4780 O  O     . LEU D 1 178 ? 1.084   18.124  -38.518 1.00 27.83  ? 1178 LEU B O     1 
ATOM   4781 C  CB    . LEU D 1 178 ? 1.121   15.721  -40.497 1.00 28.12  ? 1178 LEU B CB    1 
ATOM   4782 C  CG    . LEU D 1 178 ? 0.774   16.381  -41.843 1.00 29.00  ? 1178 LEU B CG    1 
ATOM   4783 C  CD1   . LEU D 1 178 ? 1.908   16.200  -42.879 1.00 29.64  ? 1178 LEU B CD1   1 
ATOM   4784 C  CD2   . LEU D 1 178 ? -0.537  15.852  -42.368 1.00 30.87  ? 1178 LEU B CD2   1 
ATOM   4785 N  N     . ASP D 1 179 ? 2.542   18.770  -40.124 1.00 27.73  ? 1179 ASP B N     1 
ATOM   4786 C  CA    . ASP D 1 179 ? 2.210   20.184  -40.100 1.00 28.31  ? 1179 ASP B CA    1 
ATOM   4787 C  C     . ASP D 1 179 ? 0.708   20.347  -40.312 1.00 28.11  ? 1179 ASP B C     1 
ATOM   4788 O  O     . ASP D 1 179 ? 0.141   19.808  -41.271 1.00 27.62  ? 1179 ASP B O     1 
ATOM   4789 C  CB    . ASP D 1 179 ? 2.988   20.896  -41.212 1.00 28.88  ? 1179 ASP B CB    1 
ATOM   4790 C  CG    . ASP D 1 179 ? 2.836   22.403  -41.179 1.00 30.89  ? 1179 ASP B CG    1 
ATOM   4791 O  OD1   . ASP D 1 179 ? 3.741   23.076  -41.710 1.00 34.92  ? 1179 ASP B OD1   1 
ATOM   4792 O  OD2   . ASP D 1 179 ? 1.836   22.927  -40.638 1.00 33.35  ? 1179 ASP B OD2   1 
ATOM   4793 N  N     . ILE D 1 180 ? 0.071   21.087  -39.412 1.00 28.00  ? 1180 ILE B N     1 
ATOM   4794 C  CA    . ILE D 1 180 ? -1.384  21.237  -39.423 1.00 28.55  ? 1180 ILE B CA    1 
ATOM   4795 C  C     . ILE D 1 180 ? -1.893  21.953  -40.685 1.00 28.83  ? 1180 ILE B C     1 
ATOM   4796 O  O     . ILE D 1 180 ? -3.035  21.747  -41.107 1.00 28.22  ? 1180 ILE B O     1 
ATOM   4797 C  CB    . ILE D 1 180 ? -1.891  21.886  -38.106 1.00 28.56  ? 1180 ILE B CB    1 
ATOM   4798 C  CG1   . ILE D 1 180 ? -3.395  21.643  -37.914 1.00 28.81  ? 1180 ILE B CG1   1 
ATOM   4799 C  CG2   . ILE D 1 180 ? -1.471  23.344  -37.995 1.00 29.12  ? 1180 ILE B CG2   1 
ATOM   4800 C  CD1   . ILE D 1 180 ? -3.809  21.565  -36.469 1.00 27.32  ? 1180 ILE B CD1   1 
ATOM   4801 N  N     . ALA D 1 181 ? -1.024  22.763  -41.287 1.00 29.11  ? 1181 ALA B N     1 
ATOM   4802 C  CA    . ALA D 1 181 ? -1.297  23.390  -42.576 1.00 30.30  ? 1181 ALA B CA    1 
ATOM   4803 C  C     . ALA D 1 181 ? -1.455  22.357  -43.695 1.00 30.29  ? 1181 ALA B C     1 
ATOM   4804 O  O     . ALA D 1 181 ? -2.052  22.656  -44.707 1.00 34.12  ? 1181 ALA B O     1 
ATOM   4805 C  CB    . ALA D 1 181 ? -0.212  24.397  -42.934 1.00 29.68  ? 1181 ALA B CB    1 
ATOM   4806 N  N     . ASP D 1 182 ? -0.929  21.150  -43.511 1.00 29.35  ? 1182 ASP B N     1 
ATOM   4807 C  CA    . ASP D 1 182 ? -1.076  20.107  -44.526 1.00 28.74  ? 1182 ASP B CA    1 
ATOM   4808 C  C     . ASP D 1 182 ? -2.379  19.314  -44.415 1.00 27.74  ? 1182 ASP B C     1 
ATOM   4809 O  O     . ASP D 1 182 ? -2.667  18.495  -45.283 1.00 27.42  ? 1182 ASP B O     1 
ATOM   4810 C  CB    . ASP D 1 182 ? 0.127   19.166  -44.557 1.00 29.08  ? 1182 ASP B CB    1 
ATOM   4811 C  CG    . ASP D 1 182 ? 1.401   19.866  -44.985 1.00 31.58  ? 1182 ASP B CG    1 
ATOM   4812 O  OD1   . ASP D 1 182 ? 1.325   20.837  -45.763 1.00 35.73  ? 1182 ASP B OD1   1 
ATOM   4813 O  OD2   . ASP D 1 182 ? 2.480   19.449  -44.540 1.00 34.77  ? 1182 ASP B OD2   1 
ATOM   4814 N  N     . VAL D 1 183 ? -3.149  19.552  -43.356 1.00 26.47  ? 1183 VAL B N     1 
ATOM   4815 C  CA    . VAL D 1 183 ? -4.458  18.924  -43.188 1.00 26.20  ? 1183 VAL B CA    1 
ATOM   4816 C  C     . VAL D 1 183 ? -5.471  19.500  -44.192 1.00 25.88  ? 1183 VAL B C     1 
ATOM   4817 O  O     . VAL D 1 183 ? -5.608  20.716  -44.292 1.00 24.54  ? 1183 VAL B O     1 
ATOM   4818 C  CB    . VAL D 1 183 ? -4.978  19.104  -41.738 1.00 26.59  ? 1183 VAL B CB    1 
ATOM   4819 C  CG1   . VAL D 1 183 ? -6.361  18.515  -41.568 1.00 26.18  ? 1183 VAL B CG1   1 
ATOM   4820 C  CG2   . VAL D 1 183 ? -4.001  18.455  -40.751 1.00 26.08  ? 1183 VAL B CG2   1 
ATOM   4821 N  N     . PRO D 1 184 ? -6.171  18.619  -44.946 1.00 25.95  ? 1184 PRO B N     1 
ATOM   4822 C  CA    . PRO D 1 184 ? -7.240  19.060  -45.853 1.00 25.91  ? 1184 PRO B CA    1 
ATOM   4823 C  C     . PRO D 1 184 ? -8.243  19.933  -45.118 1.00 25.69  ? 1184 PRO B C     1 
ATOM   4824 O  O     . PRO D 1 184 ? -8.663  19.584  -44.015 1.00 25.55  ? 1184 PRO B O     1 
ATOM   4825 C  CB    . PRO D 1 184 ? -7.898  17.744  -46.292 1.00 25.67  ? 1184 PRO B CB    1 
ATOM   4826 C  CG    . PRO D 1 184 ? -6.777  16.765  -46.260 1.00 26.55  ? 1184 PRO B CG    1 
ATOM   4827 C  CD    . PRO D 1 184 ? -5.887  17.180  -45.095 1.00 25.77  ? 1184 PRO B CD    1 
ATOM   4828 N  N     . GLY D 1 185 ? -8.571  21.082  -45.707 1.00 25.41  ? 1185 GLY B N     1 
ATOM   4829 C  CA    . GLY D 1 185 ? -9.560  21.999  -45.136 1.00 25.45  ? 1185 GLY B CA    1 
ATOM   4830 C  C     . GLY D 1 185 ? -8.919  23.100  -44.311 1.00 25.63  ? 1185 GLY B C     1 
ATOM   4831 O  O     . GLY D 1 185 ? -9.608  24.008  -43.833 1.00 25.24  ? 1185 GLY B O     1 
ATOM   4832 N  N     . ILE D 1 186 ? -7.600  23.012  -44.129 1.00 25.40  ? 1186 ILE B N     1 
ATOM   4833 C  CA    . ILE D 1 186 ? -6.845  24.039  -43.420 1.00 25.58  ? 1186 ILE B CA    1 
ATOM   4834 C  C     . ILE D 1 186 ? -6.047  24.848  -44.427 1.00 25.31  ? 1186 ILE B C     1 
ATOM   4835 O  O     . ILE D 1 186 ? -5.082  24.349  -45.007 1.00 25.48  ? 1186 ILE B O     1 
ATOM   4836 C  CB    . ILE D 1 186 ? -5.900  23.439  -42.326 1.00 26.07  ? 1186 ILE B CB    1 
ATOM   4837 C  CG1   . ILE D 1 186 ? -6.693  22.603  -41.312 1.00 26.26  ? 1186 ILE B CG1   1 
ATOM   4838 C  CG2   . ILE D 1 186 ? -5.110  24.543  -41.598 1.00 27.60  ? 1186 ILE B CG2   1 
ATOM   4839 C  CD1   . ILE D 1 186 ? -7.864  23.344  -40.648 1.00 27.32  ? 1186 ILE B CD1   1 
ATOM   4840 N  N     . GLY D 1 187 ? -6.479  26.086  -44.657 1.00 24.95  ? 1187 GLY B N     1 
ATOM   4841 C  CA    . GLY D 1 187 ? -5.761  26.998  -45.537 1.00 26.04  ? 1187 GLY B CA    1 
ATOM   4842 C  C     . GLY D 1 187 ? -4.899  27.971  -44.761 1.00 26.68  ? 1187 GLY B C     1 
ATOM   4843 O  O     . GLY D 1 187 ? -4.712  27.813  -43.549 1.00 26.77  ? 1187 GLY B O     1 
ATOM   4844 N  N     . ASN D 1 188 ? -4.393  28.991  -45.450 1.00 27.29  ? 1188 ASN B N     1 
ATOM   4845 C  CA    . ASN D 1 188 ? -3.473  29.963  -44.835 1.00 28.08  ? 1188 ASN B CA    1 
ATOM   4846 C  C     . ASN D 1 188 ? -4.085  30.735  -43.680 1.00 27.18  ? 1188 ASN B C     1 
ATOM   4847 O  O     . ASN D 1 188 ? -3.419  30.977  -42.676 1.00 26.93  ? 1188 ASN B O     1 
ATOM   4848 C  CB    . ASN D 1 188 ? -2.936  30.976  -45.860 1.00 29.32  ? 1188 ASN B CB    1 
ATOM   4849 C  CG    . ASN D 1 188 ? -2.231  30.322  -47.035 1.00 33.14  ? 1188 ASN B CG    1 
ATOM   4850 O  OD1   . ASN D 1 188 ? -2.248  30.862  -48.148 1.00 38.43  ? 1188 ASN B OD1   1 
ATOM   4851 N  ND2   . ASN D 1 188 ? -1.605  29.166  -46.804 1.00 35.39  ? 1188 ASN B ND2   1 
ATOM   4852 N  N     . ILE D 1 189 ? -5.346  31.133  -43.831 1.00 26.43  ? 1189 ILE B N     1 
ATOM   4853 C  CA    . ILE D 1 189 ? -6.021  31.943  -42.811 1.00 26.09  ? 1189 ILE B CA    1 
ATOM   4854 C  C     . ILE D 1 189 ? -6.176  31.181  -41.495 1.00 26.01  ? 1189 ILE B C     1 
ATOM   4855 O  O     . ILE D 1 189 ? -5.838  31.706  -40.424 1.00 26.14  ? 1189 ILE B O     1 
ATOM   4856 C  CB    . ILE D 1 189 ? -7.404  32.488  -43.305 1.00 26.08  ? 1189 ILE B CB    1 
ATOM   4857 C  CG1   . ILE D 1 189 ? -7.249  33.406  -44.533 1.00 26.38  ? 1189 ILE B CG1   1 
ATOM   4858 C  CG2   . ILE D 1 189 ? -8.151  33.195  -42.174 1.00 25.05  ? 1189 ILE B CG2   1 
ATOM   4859 C  CD1   . ILE D 1 189 ? -6.188  34.504  -44.409 1.00 28.21  ? 1189 ILE B CD1   1 
ATOM   4860 N  N     . THR D 1 190 ? -6.679  29.950  -41.575 1.00 25.73  ? 1190 THR B N     1 
ATOM   4861 C  CA    . THR D 1 190 ? -6.777  29.085  -40.392 1.00 26.23  ? 1190 THR B CA    1 
ATOM   4862 C  C     . THR D 1 190 ? -5.392  28.691  -39.832 1.00 26.09  ? 1190 THR B C     1 
ATOM   4863 O  O     . THR D 1 190 ? -5.191  28.697  -38.610 1.00 26.13  ? 1190 THR B O     1 
ATOM   4864 C  CB    . THR D 1 190 ? -7.635  27.839  -40.682 1.00 26.04  ? 1190 THR B CB    1 
ATOM   4865 O  OG1   . THR D 1 190 ? -8.865  28.264  -41.271 1.00 27.63  ? 1190 THR B OG1   1 
ATOM   4866 C  CG2   . THR D 1 190 ? -7.947  27.057  -39.407 1.00 25.93  ? 1190 THR B CG2   1 
ATOM   4867 N  N     . ALA D 1 191 ? -4.448  28.373  -40.716 1.00 26.24  ? 1191 ALA B N     1 
ATOM   4868 C  CA    . ALA D 1 191 ? -3.080  27.999  -40.290 1.00 26.64  ? 1191 ALA B CA    1 
ATOM   4869 C  C     . ALA D 1 191 ? -2.406  29.086  -39.472 1.00 27.24  ? 1191 ALA B C     1 
ATOM   4870 O  O     . ALA D 1 191 ? -1.678  28.777  -38.533 1.00 26.91  ? 1191 ALA B O     1 
ATOM   4871 C  CB    . ALA D 1 191 ? -2.212  27.626  -41.474 1.00 26.36  ? 1191 ALA B CB    1 
ATOM   4872 N  N     . GLU D 1 192 ? -2.656  30.348  -39.829 1.00 27.92  ? 1192 GLU B N     1 
ATOM   4873 C  CA    . GLU D 1 192 ? -2.096  31.488  -39.109 1.00 28.75  ? 1192 GLU B CA    1 
ATOM   4874 C  C     . GLU D 1 192 ? -2.790  31.717  -37.773 1.00 28.53  ? 1192 GLU B C     1 
ATOM   4875 O  O     . GLU D 1 192 ? -2.163  32.147  -36.816 1.00 28.06  ? 1192 GLU B O     1 
ATOM   4876 C  CB    . GLU D 1 192 ? -2.136  32.772  -39.957 1.00 29.26  ? 1192 GLU B CB    1 
ATOM   4877 C  CG    . GLU D 1 192 ? -1.275  32.733  -41.236 1.00 32.33  ? 1192 GLU B CG    1 
ATOM   4878 C  CD    . GLU D 1 192 ? 0.103   32.097  -41.029 1.00 35.55  ? 1192 GLU B CD    1 
ATOM   4879 O  OE1   . GLU D 1 192 ? 0.925   32.663  -40.276 1.00 35.87  ? 1192 GLU B OE1   1 
ATOM   4880 O  OE2   . GLU D 1 192 ? 0.352   31.024  -41.624 1.00 38.31  ? 1192 GLU B OE2   1 
ATOM   4881 N  N     . LYS D 1 193 ? -4.088  31.439  -37.715 1.00 28.54  ? 1193 LYS B N     1 
ATOM   4882 C  CA    . LYS D 1 193 ? -4.828  31.586  -36.473 1.00 28.92  ? 1193 LYS B CA    1 
ATOM   4883 C  C     . LYS D 1 193 ? -4.380  30.515  -35.480 1.00 28.90  ? 1193 LYS B C     1 
ATOM   4884 O  O     . LYS D 1 193 ? -4.260  30.782  -34.282 1.00 29.03  ? 1193 LYS B O     1 
ATOM   4885 C  CB    . LYS D 1 193 ? -6.330  31.502  -36.722 1.00 28.90  ? 1193 LYS B CB    1 
ATOM   4886 C  CG    . LYS D 1 193 ? -6.947  32.779  -37.256 1.00 29.62  ? 1193 LYS B CG    1 
ATOM   4887 C  CD    . LYS D 1 193 ? -8.438  32.586  -37.460 1.00 31.01  ? 1193 LYS B CD    1 
ATOM   4888 C  CE    . LYS D 1 193 ? -9.003  33.589  -38.455 1.00 32.07  ? 1193 LYS B CE    1 
ATOM   4889 N  NZ    . LYS D 1 193 ? -10.324 33.135  -38.988 1.00 34.48  ? 1193 LYS B NZ    1 
ATOM   4890 N  N     . LEU D 1 194 ? -4.102  29.324  -36.006 1.00 28.99  ? 1194 LEU B N     1 
ATOM   4891 C  CA    . LEU D 1 194 ? -3.644  28.186  -35.218 1.00 29.40  ? 1194 LEU B CA    1 
ATOM   4892 C  C     . LEU D 1 194 ? -2.235  28.412  -34.668 1.00 29.84  ? 1194 LEU B C     1 
ATOM   4893 O  O     . LEU D 1 194 ? -1.944  28.018  -33.540 1.00 29.68  ? 1194 LEU B O     1 
ATOM   4894 C  CB    . LEU D 1 194 ? -3.718  26.876  -36.031 1.00 28.83  ? 1194 LEU B CB    1 
ATOM   4895 C  CG    . LEU D 1 194 ? -5.111  26.272  -36.261 1.00 28.91  ? 1194 LEU B CG    1 
ATOM   4896 C  CD1   . LEU D 1 194 ? -5.139  25.275  -37.422 1.00 28.81  ? 1194 LEU B CD1   1 
ATOM   4897 C  CD2   . LEU D 1 194 ? -5.682  25.644  -34.997 1.00 29.50  ? 1194 LEU B CD2   1 
ATOM   4898 N  N     . LYS D 1 195 ? -1.375  29.053  -35.465 1.00 30.44  ? 1195 LYS B N     1 
ATOM   4899 C  CA    . LYS D 1 195 ? -0.032  29.424  -35.011 1.00 31.27  ? 1195 LYS B CA    1 
ATOM   4900 C  C     . LYS D 1 195 ? -0.066  30.349  -33.802 1.00 31.33  ? 1195 LYS B C     1 
ATOM   4901 O  O     . LYS D 1 195 ? 0.762   30.216  -32.901 1.00 31.67  ? 1195 LYS B O     1 
ATOM   4902 C  CB    . LYS D 1 195 ? 0.774   30.079  -36.132 1.00 31.55  ? 1195 LYS B CB    1 
ATOM   4903 C  CG    . LYS D 1 195 ? 1.296   29.112  -37.179 1.00 32.71  ? 1195 LYS B CG    1 
ATOM   4904 C  CD    . LYS D 1 195 ? 2.387   29.759  -38.042 1.00 35.53  ? 1195 LYS B CD    1 
ATOM   4905 C  CE    . LYS D 1 195 ? 3.741   29.747  -37.341 1.00 36.09  ? 1195 LYS B CE    1 
ATOM   4906 N  NZ    . LYS D 1 195 ? 4.793   30.549  -38.051 1.00 37.23  ? 1195 LYS B NZ    1 
ATOM   4907 N  N     . LYS D 1 196 ? -1.026  31.276  -33.782 1.00 31.46  ? 1196 LYS B N     1 
ATOM   4908 C  CA    . LYS D 1 196 ? -1.149  32.254  -32.686 1.00 31.26  ? 1196 LYS B CA    1 
ATOM   4909 C  C     . LYS D 1 196 ? -1.569  31.572  -31.395 1.00 30.86  ? 1196 LYS B C     1 
ATOM   4910 O  O     . LYS D 1 196 ? -1.355  32.102  -30.300 1.00 30.86  ? 1196 LYS B O     1 
ATOM   4911 C  CB    . LYS D 1 196 ? -2.150  33.370  -33.028 1.00 31.50  ? 1196 LYS B CB    1 
ATOM   4912 C  CG    . LYS D 1 196 ? -1.870  34.137  -34.330 1.00 33.04  ? 1196 LYS B CG    1 
ATOM   4913 C  CD    . LYS D 1 196 ? -0.581  34.939  -34.243 1.00 34.54  ? 1196 LYS B CD    1 
ATOM   4914 C  CE    . LYS D 1 196 ? -0.367  35.814  -35.464 1.00 34.70  ? 1196 LYS B CE    1 
ATOM   4915 N  NZ    . LYS D 1 196 ? 0.841   36.676  -35.253 1.00 35.77  ? 1196 LYS B NZ    1 
ATOM   4916 N  N     . LEU D 1 197 ? -2.174  30.397  -31.535 1.00 30.33  ? 1197 LEU B N     1 
ATOM   4917 C  CA    . LEU D 1 197 ? -2.555  29.584  -30.391 1.00 30.06  ? 1197 LEU B CA    1 
ATOM   4918 C  C     . LEU D 1 197 ? -1.454  28.592  -30.000 1.00 29.74  ? 1197 LEU B C     1 
ATOM   4919 O  O     . LEU D 1 197 ? -1.644  27.767  -29.105 1.00 29.73  ? 1197 LEU B O     1 
ATOM   4920 C  CB    . LEU D 1 197 ? -3.864  28.845  -30.684 1.00 30.27  ? 1197 LEU B CB    1 
ATOM   4921 C  CG    . LEU D 1 197 ? -5.137  29.670  -30.892 1.00 29.87  ? 1197 LEU B CG    1 
ATOM   4922 C  CD1   . LEU D 1 197 ? -6.270  28.734  -31.270 1.00 31.01  ? 1197 LEU B CD1   1 
ATOM   4923 C  CD2   . LEU D 1 197 ? -5.513  30.501  -29.666 1.00 30.03  ? 1197 LEU B CD2   1 
ATOM   4924 N  N     . GLY D 1 198 ? -0.306  28.685  -30.670 1.00 29.08  ? 1198 GLY B N     1 
ATOM   4925 C  CA    . GLY D 1 198 ? 0.783   27.728  -30.497 1.00 28.30  ? 1198 GLY B CA    1 
ATOM   4926 C  C     . GLY D 1 198 ? 0.483   26.352  -31.071 1.00 27.90  ? 1198 GLY B C     1 
ATOM   4927 O  O     . GLY D 1 198 ? 1.181   25.388  -30.758 1.00 27.58  ? 1198 GLY B O     1 
ATOM   4928 N  N     . ILE D 1 199 ? -0.549  26.255  -31.912 1.00 27.50  ? 1199 ILE B N     1 
ATOM   4929 C  CA    . ILE D 1 199 ? -0.961  24.971  -32.495 1.00 27.35  ? 1199 ILE B CA    1 
ATOM   4930 C  C     . ILE D 1 199 ? -0.302  24.728  -33.856 1.00 27.23  ? 1199 ILE B C     1 
ATOM   4931 O  O     . ILE D 1 199 ? -0.629  25.391  -34.843 1.00 27.45  ? 1199 ILE B O     1 
ATOM   4932 C  CB    . ILE D 1 199 ? -2.512  24.836  -32.602 1.00 27.45  ? 1199 ILE B CB    1 
ATOM   4933 C  CG1   . ILE D 1 199 ? -3.146  24.785  -31.205 1.00 27.83  ? 1199 ILE B CG1   1 
ATOM   4934 C  CG2   . ILE D 1 199 ? -2.887  23.598  -33.414 1.00 27.88  ? 1199 ILE B CG2   1 
ATOM   4935 C  CD1   . ILE D 1 199 ? -4.659  24.985  -31.183 1.00 28.72  ? 1199 ILE B CD1   1 
ATOM   4936 N  N     . ASN D 1 200 ? 0.608   23.756  -33.897 1.00 26.87  ? 1200 ASN B N     1 
ATOM   4937 C  CA    . ASN D 1 200 ? 1.452   23.497  -35.073 1.00 26.37  ? 1200 ASN B CA    1 
ATOM   4938 C  C     . ASN D 1 200 ? 1.239   22.136  -35.741 1.00 25.65  ? 1200 ASN B C     1 
ATOM   4939 O  O     . ASN D 1 200 ? 1.513   21.966  -36.936 1.00 25.09  ? 1200 ASN B O     1 
ATOM   4940 C  CB    . ASN D 1 200 ? 2.921   23.638  -34.677 1.00 26.59  ? 1200 ASN B CB    1 
ATOM   4941 C  CG    . ASN D 1 200 ? 3.240   25.011  -34.156 1.00 27.69  ? 1200 ASN B CG    1 
ATOM   4942 O  OD1   . ASN D 1 200 ? 3.016   26.005  -34.846 1.00 30.72  ? 1200 ASN B OD1   1 
ATOM   4943 N  ND2   . ASN D 1 200 ? 3.753   25.083  -32.932 1.00 27.64  ? 1200 ASN B ND2   1 
ATOM   4944 N  N     . LYS D 1 201 ? 0.796   21.165  -34.946 1.00 24.62  ? 1201 LYS B N     1 
ATOM   4945 C  CA    . LYS D 1 201 ? 0.545   19.812  -35.409 1.00 23.51  ? 1201 LYS B CA    1 
ATOM   4946 C  C     . LYS D 1 201 ? -0.854  19.457  -34.957 1.00 22.85  ? 1201 LYS B C     1 
ATOM   4947 O  O     . LYS D 1 201 ? -1.352  20.064  -34.005 1.00 22.65  ? 1201 LYS B O     1 
ATOM   4948 C  CB    . LYS D 1 201 ? 1.535   18.825  -34.781 1.00 23.39  ? 1201 LYS B CB    1 
ATOM   4949 C  CG    . LYS D 1 201 ? 3.000   19.234  -34.811 1.00 24.11  ? 1201 LYS B CG    1 
ATOM   4950 C  CD    . LYS D 1 201 ? 3.623   19.066  -36.187 1.00 25.85  ? 1201 LYS B CD    1 
ATOM   4951 C  CE    . LYS D 1 201 ? 5.141   19.056  -36.099 1.00 26.62  ? 1201 LYS B CE    1 
ATOM   4952 N  NZ    . LYS D 1 201 ? 5.759   19.242  -37.435 1.00 28.56  ? 1201 LYS B NZ    1 
ATOM   4953 N  N     . LEU D 1 202 ? -1.468  18.468  -35.608 1.00 21.72  ? 1202 LEU B N     1 
ATOM   4954 C  CA    . LEU D 1 202 ? -2.818  18.009  -35.248 1.00 21.85  ? 1202 LEU B CA    1 
ATOM   4955 C  C     . LEU D 1 202 ? -2.945  17.711  -33.757 1.00 20.94  ? 1202 LEU B C     1 
ATOM   4956 O  O     . LEU D 1 202 ? -3.919  18.109  -33.125 1.00 20.72  ? 1202 LEU B O     1 
ATOM   4957 C  CB    . LEU D 1 202 ? -3.213  16.749  -36.028 1.00 21.61  ? 1202 LEU B CB    1 
ATOM   4958 C  CG    . LEU D 1 202 ? -4.094  16.829  -37.259 1.00 24.25  ? 1202 LEU B CG    1 
ATOM   4959 C  CD1   . LEU D 1 202 ? -4.282  15.433  -37.860 1.00 24.49  ? 1202 LEU B CD1   1 
ATOM   4960 C  CD2   . LEU D 1 202 ? -5.440  17.472  -36.916 1.00 25.11  ? 1202 LEU B CD2   1 
ATOM   4961 N  N     . VAL D 1 203 ? -1.943  17.017  -33.218 1.00 20.35  ? 1203 VAL B N     1 
ATOM   4962 C  CA    . VAL D 1 203 ? -1.887  16.633  -31.806 1.00 20.07  ? 1203 VAL B CA    1 
ATOM   4963 C  C     . VAL D 1 203 ? -2.041  17.813  -30.856 1.00 19.66  ? 1203 VAL B C     1 
ATOM   4964 O  O     . VAL D 1 203 ? -2.615  17.668  -29.783 1.00 19.48  ? 1203 VAL B O     1 
ATOM   4965 C  CB    . VAL D 1 203 ? -0.605  15.805  -31.470 1.00 19.71  ? 1203 VAL B CB    1 
ATOM   4966 C  CG1   . VAL D 1 203 ? 0.645   16.694  -31.368 1.00 19.60  ? 1203 VAL B CG1   1 
ATOM   4967 C  CG2   . VAL D 1 203 ? -0.793  15.018  -30.171 1.00 20.74  ? 1203 VAL B CG2   1 
ATOM   4968 N  N     . ASP D 1 204 ? -1.541  18.979  -31.262 1.00 19.84  ? 1204 ASP B N     1 
ATOM   4969 C  CA    . ASP D 1 204 ? -1.629  20.181  -30.439 1.00 19.95  ? 1204 ASP B CA    1 
ATOM   4970 C  C     . ASP D 1 204 ? -3.083  20.585  -30.158 1.00 19.78  ? 1204 ASP B C     1 
ATOM   4971 O  O     . ASP D 1 204 ? -3.347  21.212  -29.130 1.00 19.97  ? 1204 ASP B O     1 
ATOM   4972 C  CB    . ASP D 1 204 ? -0.871  21.355  -31.067 1.00 20.04  ? 1204 ASP B CB    1 
ATOM   4973 C  CG    . ASP D 1 204 ? 0.609   21.068  -31.269 1.00 21.14  ? 1204 ASP B CG    1 
ATOM   4974 O  OD1   . ASP D 1 204 ? 1.154   20.163  -30.600 1.00 21.78  ? 1204 ASP B OD1   1 
ATOM   4975 O  OD2   . ASP D 1 204 ? 1.233   21.759  -32.101 1.00 20.42  ? 1204 ASP B OD2   1 
ATOM   4976 N  N     . THR D 1 205 ? -4.016  20.213  -31.041 1.00 19.60  ? 1205 THR B N     1 
ATOM   4977 C  CA    . THR D 1 205 ? -5.433  20.545  -30.829 1.00 19.59  ? 1205 THR B CA    1 
ATOM   4978 C  C     . THR D 1 205 ? -6.043  19.839  -29.605 1.00 19.88  ? 1205 THR B C     1 
ATOM   4979 O  O     . THR D 1 205 ? -7.099  20.248  -29.122 1.00 19.56  ? 1205 THR B O     1 
ATOM   4980 C  CB    . THR D 1 205 ? -6.333  20.299  -32.060 1.00 20.19  ? 1205 THR B CB    1 
ATOM   4981 O  OG1   . THR D 1 205 ? -6.529  18.893  -32.257 1.00 20.23  ? 1205 THR B OG1   1 
ATOM   4982 C  CG2   . THR D 1 205 ? -5.746  20.947  -33.327 1.00 19.42  ? 1205 THR B CG2   1 
ATOM   4983 N  N     . LEU D 1 206 ? -5.377  18.791  -29.114 1.00 19.62  ? 1206 LEU B N     1 
ATOM   4984 C  CA    . LEU D 1 206 ? -5.836  18.080  -27.904 1.00 20.00  ? 1206 LEU B CA    1 
ATOM   4985 C  C     . LEU D 1 206 ? -5.388  18.747  -26.612 1.00 19.82  ? 1206 LEU B C     1 
ATOM   4986 O  O     . LEU D 1 206 ? -5.865  18.400  -25.523 1.00 20.17  ? 1206 LEU B O     1 
ATOM   4987 C  CB    . LEU D 1 206 ? -5.393  16.608  -27.927 1.00 19.99  ? 1206 LEU B CB    1 
ATOM   4988 C  CG    . LEU D 1 206 ? -5.794  15.803  -29.174 1.00 20.87  ? 1206 LEU B CG    1 
ATOM   4989 C  CD1   . LEU D 1 206 ? -5.219  14.383  -29.105 1.00 19.63  ? 1206 LEU B CD1   1 
ATOM   4990 C  CD2   . LEU D 1 206 ? -7.326  15.786  -29.375 1.00 20.04  ? 1206 LEU B CD2   1 
ATOM   4991 N  N     . SER D 1 207 ? -4.478  19.708  -26.726 1.00 19.61  ? 1207 SER B N     1 
ATOM   4992 C  CA    . SER D 1 207 ? -3.903  20.350  -25.553 1.00 19.77  ? 1207 SER B CA    1 
ATOM   4993 C  C     . SER D 1 207 ? -4.377  21.783  -25.362 1.00 19.82  ? 1207 SER B C     1 
ATOM   4994 O  O     . SER D 1 207 ? -3.816  22.535  -24.567 1.00 18.95  ? 1207 SER B O     1 
ATOM   4995 C  CB    . SER D 1 207 ? -2.381  20.275  -25.609 1.00 19.92  ? 1207 SER B CB    1 
ATOM   4996 O  OG    . SER D 1 207 ? -1.957  18.943  -25.365 1.00 20.30  ? 1207 SER B OG    1 
ATOM   4997 N  N     . ILE D 1 208 ? -5.427  22.147  -26.086 1.00 20.05  ? 1208 ILE B N     1 
ATOM   4998 C  CA    . ILE D 1 208 ? -6.022  23.463  -25.945 1.00 20.83  ? 1208 ILE B CA    1 
ATOM   4999 C  C     . ILE D 1 208 ? -7.472  23.299  -25.515 1.00 21.22  ? 1208 ILE B C     1 
ATOM   5000 O  O     . ILE D 1 208 ? -8.156  22.371  -25.955 1.00 21.65  ? 1208 ILE B O     1 
ATOM   5001 C  CB    . ILE D 1 208 ? -5.934  24.263  -27.271 1.00 20.84  ? 1208 ILE B CB    1 
ATOM   5002 C  CG1   . ILE D 1 208 ? -6.255  25.747  -27.032 1.00 21.57  ? 1208 ILE B CG1   1 
ATOM   5003 C  CG2   . ILE D 1 208 ? -6.815  23.634  -28.345 1.00 21.06  ? 1208 ILE B CG2   1 
ATOM   5004 C  CD1   . ILE D 1 208 ? -6.610  26.527  -28.306 1.00 20.84  ? 1208 ILE B CD1   1 
ATOM   5005 N  N     . GLU D 1 209 ? -7.941  24.201  -24.662 1.00 21.54  ? 1209 GLU B N     1 
ATOM   5006 C  CA    . GLU D 1 209 ? -9.333  24.194  -24.242 1.00 22.41  ? 1209 GLU B CA    1 
ATOM   5007 C  C     . GLU D 1 209 ? -10.225 24.378  -25.459 1.00 22.44  ? 1209 GLU B C     1 
ATOM   5008 O  O     . GLU D 1 209 ? -9.927  25.208  -26.312 1.00 22.07  ? 1209 GLU B O     1 
ATOM   5009 C  CB    . GLU D 1 209 ? -9.594  25.315  -23.250 1.00 22.68  ? 1209 GLU B CB    1 
ATOM   5010 C  CG    . GLU D 1 209 ? -10.670 24.958  -22.263 1.00 24.80  ? 1209 GLU B CG    1 
ATOM   5011 C  CD    . GLU D 1 209 ? -11.799 25.947  -22.258 1.00 27.11  ? 1209 GLU B CD    1 
ATOM   5012 O  OE1   . GLU D 1 209 ? -12.606 25.907  -23.201 1.00 27.45  ? 1209 GLU B OE1   1 
ATOM   5013 O  OE2   . GLU D 1 209 ? -11.887 26.748  -21.302 1.00 28.12  ? 1209 GLU B OE2   1 
ATOM   5014 N  N     . PHE D 1 210 ? -11.302 23.595  -25.531 1.00 22.88  ? 1210 PHE B N     1 
ATOM   5015 C  CA    . PHE D 1 210 ? -12.142 23.529  -26.718 1.00 23.92  ? 1210 PHE B CA    1 
ATOM   5016 C  C     . PHE D 1 210 ? -12.859 24.834  -27.058 1.00 24.22  ? 1210 PHE B C     1 
ATOM   5017 O  O     . PHE D 1 210 ? -12.954 25.173  -28.233 1.00 24.13  ? 1210 PHE B O     1 
ATOM   5018 C  CB    . PHE D 1 210 ? -13.156 22.389  -26.627 1.00 24.02  ? 1210 PHE B CB    1 
ATOM   5019 C  CG    . PHE D 1 210 ? -14.021 22.260  -27.847 1.00 25.28  ? 1210 PHE B CG    1 
ATOM   5020 C  CD1   . PHE D 1 210 ? -13.529 21.676  -29.008 1.00 27.36  ? 1210 PHE B CD1   1 
ATOM   5021 C  CD2   . PHE D 1 210 ? -15.322 22.739  -27.843 1.00 26.60  ? 1210 PHE B CD2   1 
ATOM   5022 C  CE1   . PHE D 1 210 ? -14.327 21.557  -30.142 1.00 27.32  ? 1210 PHE B CE1   1 
ATOM   5023 C  CE2   . PHE D 1 210 ? -16.132 22.628  -28.963 1.00 26.94  ? 1210 PHE B CE2   1 
ATOM   5024 C  CZ    . PHE D 1 210 ? -15.634 22.039  -30.119 1.00 28.34  ? 1210 PHE B CZ    1 
ATOM   5025 N  N     . ASP D 1 211 ? -13.375 25.540  -26.043 1.00 24.71  ? 1211 ASP B N     1 
ATOM   5026 C  CA    . ASP D 1 211 ? -14.046 26.832  -26.260 1.00 25.16  ? 1211 ASP B CA    1 
ATOM   5027 C  C     . ASP D 1 211 ? -13.094 27.881  -26.836 1.00 25.09  ? 1211 ASP B C     1 
ATOM   5028 O  O     . ASP D 1 211 ? -13.482 28.650  -27.711 1.00 25.25  ? 1211 ASP B O     1 
ATOM   5029 C  CB    . ASP D 1 211 ? -14.693 27.369  -24.977 1.00 25.36  ? 1211 ASP B CB    1 
ATOM   5030 C  CG    . ASP D 1 211 ? -15.949 26.606  -24.579 1.00 26.46  ? 1211 ASP B CG    1 
ATOM   5031 O  OD1   . ASP D 1 211 ? -16.669 26.092  -25.461 1.00 28.99  ? 1211 ASP B OD1   1 
ATOM   5032 O  OD2   . ASP D 1 211 ? -16.225 26.534  -23.365 1.00 29.93  ? 1211 ASP B OD2   1 
ATOM   5033 N  N     . LYS D 1 212 ? -11.856 27.892  -26.343 1.00 24.68  ? 1212 LYS B N     1 
ATOM   5034 C  CA    . LYS D 1 212 ? -10.786 28.743  -26.869 1.00 24.90  ? 1212 LYS B CA    1 
ATOM   5035 C  C     . LYS D 1 212 ? -10.481 28.460  -28.353 1.00 25.00  ? 1212 LYS B C     1 
ATOM   5036 O  O     . LYS D 1 212 ? -10.307 29.391  -29.147 1.00 24.80  ? 1212 LYS B O     1 
ATOM   5037 C  CB    . LYS D 1 212 ? -9.535  28.540  -26.017 1.00 25.02  ? 1212 LYS B CB    1 
ATOM   5038 C  CG    . LYS D 1 212 ? -8.364  29.469  -26.287 1.00 25.98  ? 1212 LYS B CG    1 
ATOM   5039 C  CD    . LYS D 1 212 ? -7.341  29.324  -25.149 1.00 27.39  ? 1212 LYS B CD    1 
ATOM   5040 C  CE    . LYS D 1 212 ? -5.965  29.872  -25.513 1.00 28.30  ? 1212 LYS B CE    1 
ATOM   5041 N  NZ    . LYS D 1 212 ? -5.926  31.356  -25.457 1.00 29.25  ? 1212 LYS B NZ    1 
ATOM   5042 N  N     . LEU D 1 213 ? -10.403 27.183  -28.722 1.00 24.85  ? 1213 LEU B N     1 
ATOM   5043 C  CA    . LEU D 1 213 ? -10.128 26.807  -30.110 1.00 24.91  ? 1213 LEU B CA    1 
ATOM   5044 C  C     . LEU D 1 213 ? -11.302 27.205  -31.016 1.00 25.48  ? 1213 LEU B C     1 
ATOM   5045 O  O     . LEU D 1 213 ? -11.107 27.812  -32.070 1.00 25.70  ? 1213 LEU B O     1 
ATOM   5046 C  CB    . LEU D 1 213 ? -9.827  25.307  -30.215 1.00 24.43  ? 1213 LEU B CB    1 
ATOM   5047 C  CG    . LEU D 1 213 ? -9.584  24.705  -31.609 1.00 22.77  ? 1213 LEU B CG    1 
ATOM   5048 C  CD1   . LEU D 1 213 ? -8.325  25.259  -32.259 1.00 19.24  ? 1213 LEU B CD1   1 
ATOM   5049 C  CD2   . LEU D 1 213 ? -9.499  23.207  -31.489 1.00 21.26  ? 1213 LEU B CD2   1 
ATOM   5050 N  N     . LYS D 1 214 ? -12.507 26.853  -30.577 1.00 26.20  ? 1214 LYS B N     1 
ATOM   5051 C  CA    . LYS D 1 214 ? -13.774 27.224  -31.204 1.00 27.27  ? 1214 LYS B CA    1 
ATOM   5052 C  C     . LYS D 1 214 ? -13.923 28.751  -31.369 1.00 27.62  ? 1214 LYS B C     1 
ATOM   5053 O  O     . LYS D 1 214 ? -14.318 29.226  -32.431 1.00 27.94  ? 1214 LYS B O     1 
ATOM   5054 C  CB    . LYS D 1 214 ? -14.923 26.632  -30.374 1.00 27.49  ? 1214 LYS B CB    1 
ATOM   5055 C  CG    . LYS D 1 214 ? -16.330 27.023  -30.770 1.00 29.84  ? 1214 LYS B CG    1 
ATOM   5056 C  CD    . LYS D 1 214 ? -17.347 26.392  -29.819 1.00 33.50  ? 1214 LYS B CD    1 
ATOM   5057 C  CE    . LYS D 1 214 ? -18.775 26.695  -30.247 1.00 35.12  ? 1214 LYS B CE    1 
ATOM   5058 N  NZ    . LYS D 1 214 ? -19.215 28.057  -29.809 1.00 37.11  ? 1214 LYS B NZ    1 
ATOM   5059 N  N     . GLY D 1 215 ? -13.595 29.510  -30.327 1.00 27.74  ? 1215 GLY B N     1 
ATOM   5060 C  CA    . GLY D 1 215 ? -13.592 30.973  -30.404 1.00 28.46  ? 1215 GLY B CA    1 
ATOM   5061 C  C     . GLY D 1 215 ? -12.684 31.552  -31.487 1.00 29.01  ? 1215 GLY B C     1 
ATOM   5062 O  O     . GLY D 1 215 ? -12.989 32.599  -32.063 1.00 29.08  ? 1215 GLY B O     1 
ATOM   5063 N  N     . MET D 1 216 ? -11.576 30.867  -31.770 1.00 29.09  ? 1216 MET B N     1 
ATOM   5064 C  CA    . MET D 1 216 ? -10.595 31.329  -32.749 1.00 29.42  ? 1216 MET B CA    1 
ATOM   5065 C  C     . MET D 1 216 ? -10.897 30.925  -34.191 1.00 28.85  ? 1216 MET B C     1 
ATOM   5066 O  O     . MET D 1 216 ? -10.804 31.753  -35.100 1.00 29.17  ? 1216 MET B O     1 
ATOM   5067 C  CB    . MET D 1 216 ? -9.196  30.834  -32.370 1.00 30.13  ? 1216 MET B CB    1 
ATOM   5068 C  CG    . MET D 1 216 ? -8.061  31.405  -33.223 1.00 32.21  ? 1216 MET B CG    1 
ATOM   5069 S  SD    . MET D 1 216 ? -7.959  33.222  -33.211 1.00 38.52  ? 1216 MET B SD    1 
ATOM   5070 C  CE    . MET D 1 216 ? -8.093  33.614  -31.450 1.00 34.76  ? 1216 MET B CE    1 
ATOM   5071 N  N     . ILE D 1 217 ? -11.241 29.656  -34.403 1.00 27.93  ? 1217 ILE B N     1 
ATOM   5072 C  CA    . ILE D 1 217 ? -11.391 29.112  -35.759 1.00 27.11  ? 1217 ILE B CA    1 
ATOM   5073 C  C     . ILE D 1 217 ? -12.796 28.618  -36.079 1.00 26.77  ? 1217 ILE B C     1 
ATOM   5074 O  O     . ILE D 1 217 ? -13.063 28.175  -37.199 1.00 26.19  ? 1217 ILE B O     1 
ATOM   5075 C  CB    . ILE D 1 217 ? -10.380 27.962  -36.051 1.00 27.13  ? 1217 ILE B CB    1 
ATOM   5076 C  CG1   . ILE D 1 217 ? -10.668 26.732  -35.157 1.00 26.80  ? 1217 ILE B CG1   1 
ATOM   5077 C  CG2   . ILE D 1 217 ? -8.945  28.468  -35.927 1.00 26.93  ? 1217 ILE B CG2   1 
ATOM   5078 C  CD1   . ILE D 1 217 ? -10.070 25.396  -35.657 1.00 25.46  ? 1217 ILE B CD1   1 
ATOM   5079 N  N     . GLY D 1 218 ? -13.678 28.654  -35.086 1.00 26.72  ? 1218 GLY B N     1 
ATOM   5080 C  CA    . GLY D 1 218 ? -15.072 28.275  -35.297 1.00 26.76  ? 1218 GLY B CA    1 
ATOM   5081 C  C     . GLY D 1 218 ? -15.387 26.839  -34.933 1.00 26.83  ? 1218 GLY B C     1 
ATOM   5082 O  O     . GLY D 1 218 ? -14.512 25.972  -34.948 1.00 25.83  ? 1218 GLY B O     1 
ATOM   5083 N  N     . GLU D 1 219 ? -16.660 26.606  -34.623 1.00 26.92  ? 1219 GLU B N     1 
ATOM   5084 C  CA    . GLU D 1 219 ? -17.159 25.330  -34.119 1.00 27.51  ? 1219 GLU B CA    1 
ATOM   5085 C  C     . GLU D 1 219 ? -16.878 24.149  -35.044 1.00 27.13  ? 1219 GLU B C     1 
ATOM   5086 O  O     . GLU D 1 219 ? -16.376 23.108  -34.587 1.00 27.03  ? 1219 GLU B O     1 
ATOM   5087 C  CB    . GLU D 1 219 ? -18.662 25.459  -33.847 1.00 27.88  ? 1219 GLU B CB    1 
ATOM   5088 C  CG    . GLU D 1 219 ? -19.306 24.307  -33.109 1.00 31.10  ? 1219 GLU B CG    1 
ATOM   5089 C  CD    . GLU D 1 219 ? -20.812 24.506  -32.961 1.00 36.50  ? 1219 GLU B CD    1 
ATOM   5090 O  OE1   . GLU D 1 219 ? -21.430 25.161  -33.843 1.00 38.10  ? 1219 GLU B OE1   1 
ATOM   5091 O  OE2   . GLU D 1 219 ? -21.376 24.023  -31.955 1.00 39.25  ? 1219 GLU B OE2   1 
ATOM   5092 N  N     . ALA D 1 220 ? -17.192 24.309  -36.334 1.00 26.49  ? 1220 ALA B N     1 
ATOM   5093 C  CA    . ALA D 1 220 ? -17.053 23.224  -37.305 1.00 26.38  ? 1220 ALA B CA    1 
ATOM   5094 C  C     . ALA D 1 220 ? -15.606 22.786  -37.520 1.00 26.20  ? 1220 ALA B C     1 
ATOM   5095 O  O     . ALA D 1 220 ? -15.333 21.598  -37.577 1.00 26.31  ? 1220 ALA B O     1 
ATOM   5096 C  CB    . ALA D 1 220 ? -17.694 23.597  -38.642 1.00 26.08  ? 1220 ALA B CB    1 
ATOM   5097 N  N     . LYS D 1 221 ? -14.686 23.741  -37.643 1.00 26.05  ? 1221 LYS B N     1 
ATOM   5098 C  CA    . LYS D 1 221 ? -13.281 23.397  -37.874 1.00 26.17  ? 1221 LYS B CA    1 
ATOM   5099 C  C     . LYS D 1 221 ? -12.605 22.862  -36.613 1.00 25.27  ? 1221 LYS B C     1 
ATOM   5100 O  O     . LYS D 1 221 ? -11.695 22.030  -36.701 1.00 25.34  ? 1221 LYS B O     1 
ATOM   5101 C  CB    . LYS D 1 221 ? -12.501 24.567  -38.483 1.00 26.12  ? 1221 LYS B CB    1 
ATOM   5102 C  CG    . LYS D 1 221 ? -12.742 24.672  -40.010 1.00 29.61  ? 1221 LYS B CG    1 
ATOM   5103 C  CD    . LYS D 1 221 ? -11.566 25.308  -40.737 1.00 32.13  ? 1221 LYS B CD    1 
ATOM   5104 C  CE    . LYS D 1 221 ? -11.857 25.456  -42.207 1.00 33.97  ? 1221 LYS B CE    1 
ATOM   5105 N  NZ    . LYS D 1 221 ? -12.779 26.617  -42.458 1.00 36.68  ? 1221 LYS B NZ    1 
ATOM   5106 N  N     . ALA D 1 222 ? -13.069 23.338  -35.454 1.00 24.38  ? 1222 ALA B N     1 
ATOM   5107 C  CA    . ALA D 1 222 ? -12.588 22.873  -34.152 1.00 23.10  ? 1222 ALA B CA    1 
ATOM   5108 C  C     . ALA D 1 222 ? -12.947 21.400  -33.962 1.00 22.40  ? 1222 ALA B C     1 
ATOM   5109 O  O     . ALA D 1 222 ? -12.072 20.581  -33.678 1.00 21.41  ? 1222 ALA B O     1 
ATOM   5110 C  CB    . ALA D 1 222 ? -13.165 23.722  -33.039 1.00 23.09  ? 1222 ALA B CB    1 
ATOM   5111 N  N     . LYS D 1 223 ? -14.223 21.068  -34.171 1.00 21.32  ? 1223 LYS B N     1 
ATOM   5112 C  CA    . LYS D 1 223 ? -14.703 19.691  -34.040 1.00 21.68  ? 1223 LYS B CA    1 
ATOM   5113 C  C     . LYS D 1 223 ? -13.965 18.757  -34.989 1.00 21.19  ? 1223 LYS B C     1 
ATOM   5114 O  O     . LYS D 1 223 ? -13.650 17.616  -34.640 1.00 20.32  ? 1223 LYS B O     1 
ATOM   5115 C  CB    . LYS D 1 223 ? -16.208 19.593  -34.333 1.00 21.60  ? 1223 LYS B CB    1 
ATOM   5116 C  CG    . LYS D 1 223 ? -17.144 20.151  -33.259 1.00 24.46  ? 1223 LYS B CG    1 
ATOM   5117 C  CD    . LYS D 1 223 ? -18.595 19.934  -33.716 1.00 27.97  ? 1223 LYS B CD    1 
ATOM   5118 C  CE    . LYS D 1 223 ? -19.607 20.664  -32.846 1.00 30.41  ? 1223 LYS B CE    1 
ATOM   5119 N  NZ    . LYS D 1 223 ? -19.771 20.109  -31.481 1.00 31.86  ? 1223 LYS B NZ    1 
ATOM   5120 N  N     . TYR D 1 224 ? -13.706 19.253  -36.195 1.00 21.16  ? 1224 TYR B N     1 
ATOM   5121 C  CA    . TYR D 1 224 ? -13.055 18.466  -37.252 1.00 21.47  ? 1224 TYR B CA    1 
ATOM   5122 C  C     . TYR D 1 224 ? -11.618 18.135  -36.877 1.00 20.93  ? 1224 TYR B C     1 
ATOM   5123 O  O     . TYR D 1 224 ? -11.225 16.966  -36.880 1.00 21.20  ? 1224 TYR B O     1 
ATOM   5124 C  CB    . TYR D 1 224 ? -13.132 19.240  -38.567 1.00 21.21  ? 1224 TYR B CB    1 
ATOM   5125 C  CG    . TYR D 1 224 ? -12.280 18.758  -39.722 1.00 22.69  ? 1224 TYR B CG    1 
ATOM   5126 C  CD1   . TYR D 1 224 ? -12.649 17.649  -40.466 1.00 24.38  ? 1224 TYR B CD1   1 
ATOM   5127 C  CD2   . TYR D 1 224 ? -11.136 19.464  -40.110 1.00 23.62  ? 1224 TYR B CD2   1 
ATOM   5128 C  CE1   . TYR D 1 224 ? -11.893 17.238  -41.556 1.00 26.57  ? 1224 TYR B CE1   1 
ATOM   5129 C  CE2   . TYR D 1 224 ? -10.365 19.059  -41.193 1.00 24.46  ? 1224 TYR B CE2   1 
ATOM   5130 C  CZ    . TYR D 1 224 ? -10.743 17.941  -41.914 1.00 26.81  ? 1224 TYR B CZ    1 
ATOM   5131 O  OH    . TYR D 1 224 ? -10.001 17.516  -43.016 1.00 26.91  ? 1224 TYR B OH    1 
ATOM   5132 N  N     . LEU D 1 225 ? -10.841 19.150  -36.524 1.00 20.90  ? 1225 LEU B N     1 
ATOM   5133 C  CA    . LEU D 1 225 ? -9.448  18.911  -36.135 1.00 20.75  ? 1225 LEU B CA    1 
ATOM   5134 C  C     . LEU D 1 225 ? -9.350  18.007  -34.901 1.00 20.83  ? 1225 LEU B C     1 
ATOM   5135 O  O     . LEU D 1 225 ? -8.564  17.049  -34.874 1.00 20.34  ? 1225 LEU B O     1 
ATOM   5136 C  CB    . LEU D 1 225 ? -8.715  20.231  -35.886 1.00 20.86  ? 1225 LEU B CB    1 
ATOM   5137 C  CG    . LEU D 1 225 ? -8.489  21.133  -37.098 1.00 20.09  ? 1225 LEU B CG    1 
ATOM   5138 C  CD1   . LEU D 1 225 ? -7.805  22.416  -36.675 1.00 20.49  ? 1225 LEU B CD1   1 
ATOM   5139 C  CD2   . LEU D 1 225 ? -7.668  20.427  -38.191 1.00 19.61  ? 1225 LEU B CD2   1 
ATOM   5140 N  N     . ILE D 1 226 ? -10.156 18.296  -33.882 1.00 21.01  ? 1226 ILE B N     1 
ATOM   5141 C  CA    . ILE D 1 226 ? -10.123 17.473  -32.667 1.00 21.35  ? 1226 ILE B CA    1 
ATOM   5142 C  C     . ILE D 1 226 ? -10.461 16.016  -32.998 1.00 21.48  ? 1226 ILE B C     1 
ATOM   5143 O  O     . ILE D 1 226 ? -9.763  15.094  -32.564 1.00 21.40  ? 1226 ILE B O     1 
ATOM   5144 C  CB    . ILE D 1 226 ? -11.040 18.031  -31.580 1.00 21.13  ? 1226 ILE B CB    1 
ATOM   5145 C  CG1   . ILE D 1 226 ? -10.439 19.339  -31.058 1.00 21.92  ? 1226 ILE B CG1   1 
ATOM   5146 C  CG2   . ILE D 1 226 ? -11.241 16.994  -30.463 1.00 21.09  ? 1226 ILE B CG2   1 
ATOM   5147 C  CD1   . ILE D 1 226 ? -11.079 19.884  -29.832 1.00 23.68  ? 1226 ILE B CD1   1 
ATOM   5148 N  N     . SER D 1 227 ? -11.509 15.831  -33.794 1.00 21.66  ? 1227 SER B N     1 
ATOM   5149 C  CA    . SER D 1 227 ? -11.949 14.508  -34.230 1.00 22.72  ? 1227 SER B CA    1 
ATOM   5150 C  C     . SER D 1 227 ? -10.834 13.741  -34.958 1.00 22.04  ? 1227 SER B C     1 
ATOM   5151 O  O     . SER D 1 227 ? -10.586 12.550  -34.695 1.00 22.05  ? 1227 SER B O     1 
ATOM   5152 C  CB    . SER D 1 227 ? -13.156 14.654  -35.152 1.00 22.97  ? 1227 SER B CB    1 
ATOM   5153 O  OG    . SER D 1 227 ? -13.690 13.385  -35.444 1.00 27.73  ? 1227 SER B OG    1 
ATOM   5154 N  N     . LEU D 1 228 ? -10.163 14.429  -35.875 1.00 21.68  ? 1228 LEU B N     1 
ATOM   5155 C  CA    . LEU D 1 228 ? -9.012  13.850  -36.554 1.00 21.28  ? 1228 LEU B CA    1 
ATOM   5156 C  C     . LEU D 1 228 ? -7.893  13.525  -35.567 1.00 20.43  ? 1228 LEU B C     1 
ATOM   5157 O  O     . LEU D 1 228 ? -7.358  12.412  -35.584 1.00 20.32  ? 1228 LEU B O     1 
ATOM   5158 C  CB    . LEU D 1 228 ? -8.497  14.787  -37.646 1.00 20.89  ? 1228 LEU B CB    1 
ATOM   5159 C  CG    . LEU D 1 228 ? -9.193  14.740  -39.005 1.00 23.16  ? 1228 LEU B CG    1 
ATOM   5160 C  CD1   . LEU D 1 228 ? -8.771  15.969  -39.766 1.00 22.63  ? 1228 LEU B CD1   1 
ATOM   5161 C  CD2   . LEU D 1 228 ? -8.852  13.465  -39.768 1.00 21.64  ? 1228 LEU B CD2   1 
ATOM   5162 N  N     . ALA D 1 229 ? -7.548  14.484  -34.703 1.00 20.30  ? 1229 ALA B N     1 
ATOM   5163 C  CA    . ALA D 1 229 ? -6.467  14.295  -33.715 1.00 20.82  ? 1229 ALA B CA    1 
ATOM   5164 C  C     . ALA D 1 229 ? -6.704  13.113  -32.781 1.00 21.55  ? 1229 ALA B C     1 
ATOM   5165 O  O     . ALA D 1 229 ? -5.756  12.432  -32.388 1.00 20.82  ? 1229 ALA B O     1 
ATOM   5166 C  CB    . ALA D 1 229 ? -6.233  15.563  -32.896 1.00 20.16  ? 1229 ALA B CB    1 
ATOM   5167 N  N     . ARG D 1 230 ? -7.970  12.878  -32.440 1.00 22.59  ? 1230 ARG B N     1 
ATOM   5168 C  CA    . ARG D 1 230 ? -8.354  11.776  -31.555 1.00 24.09  ? 1230 ARG B CA    1 
ATOM   5169 C  C     . ARG D 1 230 ? -8.401  10.440  -32.269 1.00 24.67  ? 1230 ARG B C     1 
ATOM   5170 O  O     . ARG D 1 230 ? -8.711  9.426   -31.651 1.00 24.51  ? 1230 ARG B O     1 
ATOM   5171 C  CB    . ARG D 1 230 ? -9.724  12.045  -30.930 1.00 23.96  ? 1230 ARG B CB    1 
ATOM   5172 C  CG    . ARG D 1 230 ? -9.680  13.047  -29.807 1.00 26.19  ? 1230 ARG B CG    1 
ATOM   5173 C  CD    . ARG D 1 230 ? -11.065 13.369  -29.271 1.00 29.47  ? 1230 ARG B CD    1 
ATOM   5174 N  NE    . ARG D 1 230 ? -10.959 14.269  -28.126 1.00 32.23  ? 1230 ARG B NE    1 
ATOM   5175 C  CZ    . ARG D 1 230 ? -11.978 14.931  -27.588 1.00 33.92  ? 1230 ARG B CZ    1 
ATOM   5176 N  NH1   . ARG D 1 230 ? -13.201 14.807  -28.089 1.00 34.30  ? 1230 ARG B NH1   1 
ATOM   5177 N  NH2   . ARG D 1 230 ? -11.766 15.726  -26.549 1.00 35.33  ? 1230 ARG B NH2   1 
ATOM   5178 N  N     . ASP D 1 231 ? -8.135  10.442  -33.576 1.00 26.08  ? 1231 ASP B N     1 
ATOM   5179 C  CA    . ASP D 1 231 ? -8.137  9.208   -34.360 1.00 27.48  ? 1231 ASP B CA    1 
ATOM   5180 C  C     . ASP D 1 231 ? -9.579  8.653   -34.435 1.00 27.93  ? 1231 ASP B C     1 
ATOM   5181 O  O     . ASP D 1 231 ? -9.810  7.435   -34.339 1.00 27.50  ? 1231 ASP B O     1 
ATOM   5182 C  CB    . ASP D 1 231 ? -7.158  8.209   -33.699 1.00 27.97  ? 1231 ASP B CB    1 
ATOM   5183 C  CG    . ASP D 1 231 ? -6.621  7.162   -34.658 1.00 29.99  ? 1231 ASP B CG    1 
ATOM   5184 O  OD1   . ASP D 1 231 ? -7.192  6.975   -35.751 1.00 32.09  ? 1231 ASP B OD1   1 
ATOM   5185 O  OD2   . ASP D 1 231 ? -5.613  6.501   -34.293 1.00 33.05  ? 1231 ASP B OD2   1 
ATOM   5186 N  N     . GLU D 1 232 ? -10.538 9.568   -34.604 1.00 28.41  ? 1232 GLU B N     1 
ATOM   5187 C  CA    . GLU D 1 232 ? -11.967 9.250   -34.523 1.00 29.47  ? 1232 GLU B CA    1 
ATOM   5188 C  C     . GLU D 1 232 ? -12.802 9.695   -35.723 1.00 30.05  ? 1232 GLU B C     1 
ATOM   5189 O  O     . GLU D 1 232 ? -13.987 9.346   -35.820 1.00 30.25  ? 1232 GLU B O     1 
ATOM   5190 C  CB    . GLU D 1 232 ? -12.580 9.856   -33.264 1.00 29.81  ? 1232 GLU B CB    1 
ATOM   5191 C  CG    . GLU D 1 232 ? -12.236 9.103   -32.000 1.00 30.00  ? 1232 GLU B CG    1 
ATOM   5192 C  CD    . GLU D 1 232 ? -12.970 9.630   -30.792 1.00 33.16  ? 1232 GLU B CD    1 
ATOM   5193 O  OE1   . GLU D 1 232 ? -13.616 10.697  -30.896 1.00 34.64  ? 1232 GLU B OE1   1 
ATOM   5194 O  OE2   . GLU D 1 232 ? -12.898 8.976   -29.728 1.00 33.89  ? 1232 GLU B OE2   1 
ATOM   5195 N  N     . TYR D 1 233 ? -12.204 10.475  -36.621 1.00 30.16  ? 1233 TYR B N     1 
ATOM   5196 C  CA    . TYR D 1 233 ? -12.911 10.925  -37.814 1.00 30.85  ? 1233 TYR B CA    1 
ATOM   5197 C  C     . TYR D 1 233 ? -13.364 9.695   -38.600 1.00 31.23  ? 1233 TYR B C     1 
ATOM   5198 O  O     . TYR D 1 233 ? -12.563 8.809   -38.897 1.00 31.01  ? 1233 TYR B O     1 
ATOM   5199 C  CB    . TYR D 1 233 ? -12.023 11.850  -38.660 1.00 30.28  ? 1233 TYR B CB    1 
ATOM   5200 C  CG    . TYR D 1 233 ? -12.661 12.332  -39.949 1.00 30.78  ? 1233 TYR B CG    1 
ATOM   5201 C  CD1   . TYR D 1 233 ? -13.286 13.583  -40.024 1.00 28.13  ? 1233 TYR B CD1   1 
ATOM   5202 C  CD2   . TYR D 1 233 ? -12.636 11.539  -41.093 1.00 30.83  ? 1233 TYR B CD2   1 
ATOM   5203 C  CE1   . TYR D 1 233 ? -13.851 14.034  -41.220 1.00 28.73  ? 1233 TYR B CE1   1 
ATOM   5204 C  CE2   . TYR D 1 233 ? -13.210 11.970  -42.286 1.00 30.58  ? 1233 TYR B CE2   1 
ATOM   5205 C  CZ    . TYR D 1 233 ? -13.810 13.216  -42.343 1.00 30.08  ? 1233 TYR B CZ    1 
ATOM   5206 O  OH    . TYR D 1 233 ? -14.385 13.614  -43.524 1.00 30.72  ? 1233 TYR B OH    1 
ATOM   5207 N  N     . ASN D 1 234 ? -14.654 9.637   -38.906 1.00 32.06  ? 1234 ASN B N     1 
ATOM   5208 C  CA    . ASN D 1 234 ? -15.228 8.472   -39.578 1.00 33.23  ? 1234 ASN B CA    1 
ATOM   5209 C  C     . ASN D 1 234 ? -16.372 8.772   -40.570 1.00 33.21  ? 1234 ASN B C     1 
ATOM   5210 O  O     . ASN D 1 234 ? -17.307 7.973   -40.704 1.00 33.49  ? 1234 ASN B O     1 
ATOM   5211 C  CB    . ASN D 1 234 ? -15.715 7.473   -38.529 1.00 33.79  ? 1234 ASN B CB    1 
ATOM   5212 C  CG    . ASN D 1 234 ? -15.730 6.049   -39.046 1.00 36.05  ? 1234 ASN B CG    1 
ATOM   5213 O  OD1   . ASN D 1 234 ? -15.131 5.743   -40.082 1.00 38.45  ? 1234 ASN B OD1   1 
ATOM   5214 N  ND2   . ASN D 1 234 ? -16.406 5.158   -38.316 1.00 38.19  ? 1234 ASN B ND2   1 
ATOM   5215 N  N     . GLU D 1 235 ? -16.295 9.902   -41.270 1.00 32.49  ? 1235 GLU B N     1 
ATOM   5216 C  CA    . GLU D 1 235 ? -17.394 10.321  -42.153 1.00 32.39  ? 1235 GLU B CA    1 
ATOM   5217 C  C     . GLU D 1 235 ? -17.568 9.355   -43.337 1.00 31.70  ? 1235 GLU B C     1 
ATOM   5218 O  O     . GLU D 1 235 ? -16.588 8.977   -43.989 1.00 30.11  ? 1235 GLU B O     1 
ATOM   5219 C  CB    . GLU D 1 235 ? -17.215 11.766  -42.639 1.00 32.81  ? 1235 GLU B CB    1 
ATOM   5220 C  CG    . GLU D 1 235 ? -16.968 12.803  -41.533 1.00 35.28  ? 1235 GLU B CG    1 
ATOM   5221 C  CD    . GLU D 1 235 ? -18.202 13.131  -40.692 1.00 38.78  ? 1235 GLU B CD    1 
ATOM   5222 O  OE1   . GLU D 1 235 ? -18.790 14.216  -40.904 1.00 42.06  ? 1235 GLU B OE1   1 
ATOM   5223 O  OE2   . GLU D 1 235 ? -18.573 12.319  -39.816 1.00 39.90  ? 1235 GLU B OE2   1 
ATOM   5224 N  N     . PRO D 1 236 ? -18.817 8.937   -43.591 1.00 31.41  ? 1236 PRO B N     1 
ATOM   5225 C  CA    . PRO D 1 236 ? -19.130 7.908   -44.586 1.00 31.20  ? 1236 PRO B CA    1 
ATOM   5226 C  C     . PRO D 1 236 ? -18.872 8.361   -46.016 1.00 30.99  ? 1236 PRO B C     1 
ATOM   5227 O  O     . PRO D 1 236 ? -18.967 9.537   -46.318 1.00 30.39  ? 1236 PRO B O     1 
ATOM   5228 C  CB    . PRO D 1 236 ? -20.629 7.669   -44.381 1.00 31.64  ? 1236 PRO B CB    1 
ATOM   5229 C  CG    . PRO D 1 236 ? -20.882 8.115   -42.957 1.00 31.80  ? 1236 PRO B CG    1 
ATOM   5230 C  CD    . PRO D 1 236 ? -20.011 9.324   -42.820 1.00 31.75  ? 1236 PRO B CD    1 
ATOM   5231 N  N     . ILE D 1 237 ? -18.534 7.418   -46.881 1.00 31.23  ? 1237 ILE B N     1 
ATOM   5232 C  CA    . ILE D 1 237 ? -18.454 7.690   -48.300 1.00 31.91  ? 1237 ILE B CA    1 
ATOM   5233 C  C     . ILE D 1 237 ? -19.899 7.773   -48.786 1.00 32.54  ? 1237 ILE B C     1 
ATOM   5234 O  O     . ILE D 1 237 ? -20.672 6.842   -48.595 1.00 32.41  ? 1237 ILE B O     1 
ATOM   5235 C  CB    . ILE D 1 237 ? -17.668 6.574   -49.033 1.00 31.84  ? 1237 ILE B CB    1 
ATOM   5236 C  CG1   . ILE D 1 237 ? -16.158 6.768   -48.862 1.00 31.91  ? 1237 ILE B CG1   1 
ATOM   5237 C  CG2   . ILE D 1 237 ? -17.961 6.557   -50.511 1.00 31.85  ? 1237 ILE B CG2   1 
ATOM   5238 C  CD1   . ILE D 1 237 ? -15.642 6.522   -47.469 1.00 30.47  ? 1237 ILE B CD1   1 
ATOM   5239 N  N     . ARG D 1 238 ? -20.273 8.909   -49.363 1.00 33.00  ? 1238 ARG B N     1 
ATOM   5240 C  CA    . ARG D 1 238 ? -21.598 9.026   -49.980 1.00 34.10  ? 1238 ARG B CA    1 
ATOM   5241 C  C     . ARG D 1 238 ? -21.645 9.832   -51.271 1.00 33.47  ? 1238 ARG B C     1 
ATOM   5242 O  O     . ARG D 1 238 ? -20.804 10.693  -51.525 1.00 31.78  ? 1238 ARG B O     1 
ATOM   5243 C  CB    . ARG D 1 238 ? -22.643 9.545   -48.988 1.00 34.63  ? 1238 ARG B CB    1 
ATOM   5244 C  CG    . ARG D 1 238 ? -22.143 10.543  -47.952 1.00 37.73  ? 1238 ARG B CG    1 
ATOM   5245 C  CD    . ARG D 1 238 ? -23.344 11.125  -47.201 1.00 42.45  ? 1238 ARG B CD    1 
ATOM   5246 N  NE    . ARG D 1 238 ? -23.086 11.357  -45.779 1.00 45.10  ? 1238 ARG B NE    1 
ATOM   5247 C  CZ    . ARG D 1 238 ? -23.606 10.632  -44.788 1.00 46.55  ? 1238 ARG B CZ    1 
ATOM   5248 N  NH1   . ARG D 1 238 ? -23.309 10.927  -43.528 1.00 46.24  ? 1238 ARG B NH1   1 
ATOM   5249 N  NH2   . ARG D 1 238 ? -24.423 9.612   -45.053 1.00 47.73  ? 1238 ARG B NH2   1 
ATOM   5250 N  N     . THR D 1 239 ? -22.672 9.551   -52.065 1.00 33.62  ? 1239 THR B N     1 
ATOM   5251 C  CA    . THR D 1 239 ? -22.855 10.193  -53.363 1.00 34.35  ? 1239 THR B CA    1 
ATOM   5252 C  C     . THR D 1 239 ? -23.058 11.686  -53.148 1.00 33.93  ? 1239 THR B C     1 
ATOM   5253 O  O     . THR D 1 239 ? -23.864 12.096  -52.325 1.00 34.79  ? 1239 THR B O     1 
ATOM   5254 C  CB    . THR D 1 239 ? -24.066 9.581   -54.099 1.00 34.47  ? 1239 THR B CB    1 
ATOM   5255 O  OG1   . THR D 1 239 ? -23.980 8.154   -54.011 1.00 35.39  ? 1239 THR B OG1   1 
ATOM   5256 C  CG2   . THR D 1 239 ? -24.091 9.994   -55.568 1.00 35.09  ? 1239 THR B CG2   1 
ATOM   5257 N  N     . ARG D 1 240 ? -22.292 12.503  -53.846 1.00 34.23  ? 1240 ARG B N     1 
ATOM   5258 C  CA    . ARG D 1 240 ? -22.489 13.934  -53.724 1.00 34.45  ? 1240 ARG B CA    1 
ATOM   5259 C  C     . ARG D 1 240 ? -23.627 14.356  -54.651 1.00 33.59  ? 1240 ARG B C     1 
ATOM   5260 O  O     . ARG D 1 240 ? -23.760 13.849  -55.754 1.00 33.13  ? 1240 ARG B O     1 
ATOM   5261 C  CB    . ARG D 1 240 ? -21.193 14.698  -53.988 1.00 35.50  ? 1240 ARG B CB    1 
ATOM   5262 C  CG    . ARG D 1 240 ? -20.109 14.324  -52.962 1.00 37.06  ? 1240 ARG B CG    1 
ATOM   5263 C  CD    . ARG D 1 240 ? -19.085 15.414  -52.786 1.00 39.90  ? 1240 ARG B CD    1 
ATOM   5264 N  NE    . ARG D 1 240 ? -17.999 15.008  -51.875 1.00 41.35  ? 1240 ARG B NE    1 
ATOM   5265 C  CZ    . ARG D 1 240 ? -16.942 15.760  -51.583 1.00 41.62  ? 1240 ARG B CZ    1 
ATOM   5266 N  NH1   . ARG D 1 240 ? -16.812 16.967  -52.120 1.00 42.37  ? 1240 ARG B NH1   1 
ATOM   5267 N  NH2   . ARG D 1 240 ? -16.011 15.306  -50.753 1.00 43.54  ? 1240 ARG B NH2   1 
ATOM   5268 N  N     . VAL D 1 241 ? -24.490 15.223  -54.149 1.00 33.30  ? 1241 VAL B N     1 
ATOM   5269 C  CA    . VAL D 1 241 ? -25.555 15.793  -54.958 1.00 32.89  ? 1241 VAL B CA    1 
ATOM   5270 C  C     . VAL D 1 241 ? -25.164 17.231  -55.258 1.00 31.87  ? 1241 VAL B C     1 
ATOM   5271 O  O     . VAL D 1 241 ? -24.894 18.003  -54.351 1.00 31.05  ? 1241 VAL B O     1 
ATOM   5272 C  CB    . VAL D 1 241 ? -26.929 15.766  -54.237 1.00 33.09  ? 1241 VAL B CB    1 
ATOM   5273 C  CG1   . VAL D 1 241 ? -28.054 16.040  -55.229 1.00 33.57  ? 1241 VAL B CG1   1 
ATOM   5274 C  CG2   . VAL D 1 241 ? -27.162 14.428  -53.544 1.00 34.76  ? 1241 VAL B CG2   1 
ATOM   5275 N  N     . ARG D 1 242 ? -25.148 17.577  -56.540 1.00 31.80  ? 1242 ARG B N     1 
ATOM   5276 C  CA    . ARG D 1 242 ? -24.883 18.938  -56.988 1.00 32.15  ? 1242 ARG B CA    1 
ATOM   5277 C  C     . ARG D 1 242 ? -25.917 19.863  -56.316 1.00 31.21  ? 1242 ARG B C     1 
ATOM   5278 O  O     . ARG D 1 242 ? -27.110 19.551  -56.297 1.00 30.58  ? 1242 ARG B O     1 
ATOM   5279 C  CB    . ARG D 1 242 ? -25.007 18.982  -58.522 1.00 33.11  ? 1242 ARG B CB    1 
ATOM   5280 C  CG    . ARG D 1 242 ? -23.819 19.537  -59.273 1.00 37.58  ? 1242 ARG B CG    1 
ATOM   5281 C  CD    . ARG D 1 242 ? -22.755 18.496  -59.653 1.00 45.18  ? 1242 ARG B CD    1 
ATOM   5282 N  NE    . ARG D 1 242 ? -21.698 19.080  -60.498 1.00 49.95  ? 1242 ARG B NE    1 
ATOM   5283 C  CZ    . ARG D 1 242 ? -20.699 18.393  -61.069 1.00 52.97  ? 1242 ARG B CZ    1 
ATOM   5284 N  NH1   . ARG D 1 242 ? -20.591 17.078  -60.907 1.00 53.90  ? 1242 ARG B NH1   1 
ATOM   5285 N  NH2   . ARG D 1 242 ? -19.794 19.020  -61.815 1.00 53.99  ? 1242 ARG B NH2   1 
ATOM   5286 N  N     . LYS D 1 243 ? -25.460 20.976  -55.739 1.00 29.71  ? 1243 LYS B N     1 
ATOM   5287 C  CA    . LYS D 1 243 ? -26.341 21.883  -54.987 1.00 28.72  ? 1243 LYS B CA    1 
ATOM   5288 C  C     . LYS D 1 243 ? -26.533 23.238  -55.662 1.00 27.29  ? 1243 LYS B C     1 
ATOM   5289 O  O     . LYS D 1 243 ? -27.497 23.940  -55.393 1.00 26.61  ? 1243 LYS B O     1 
ATOM   5290 C  CB    . LYS D 1 243 ? -25.791 22.101  -53.574 1.00 28.97  ? 1243 LYS B CB    1 
ATOM   5291 C  CG    . LYS D 1 243 ? -26.111 20.996  -52.584 1.00 31.70  ? 1243 LYS B CG    1 
ATOM   5292 C  CD    . LYS D 1 243 ? -25.457 21.303  -51.238 1.00 35.82  ? 1243 LYS B CD    1 
ATOM   5293 C  CE    . LYS D 1 243 ? -26.044 20.459  -50.134 1.00 37.78  ? 1243 LYS B CE    1 
ATOM   5294 N  NZ    . LYS D 1 243 ? -25.509 19.082  -50.189 1.00 38.37  ? 1243 LYS B NZ    1 
ATOM   5295 N  N     . SER D 1 244 ? -25.592 23.626  -56.511 1.00 25.68  ? 1244 SER B N     1 
ATOM   5296 C  CA    . SER D 1 244 ? -25.746 24.839  -57.289 1.00 24.88  ? 1244 SER B CA    1 
ATOM   5297 C  C     . SER D 1 244 ? -25.092 24.652  -58.662 1.00 24.51  ? 1244 SER B C     1 
ATOM   5298 O  O     . SER D 1 244 ? -24.183 23.844  -58.806 1.00 24.57  ? 1244 SER B O     1 
ATOM   5299 C  CB    . SER D 1 244 ? -25.120 26.024  -56.556 1.00 23.79  ? 1244 SER B CB    1 
ATOM   5300 O  OG    . SER D 1 244 ? -23.714 25.853  -56.537 1.00 23.85  ? 1244 SER B OG    1 
ATOM   5301 N  N     . ILE D 1 245 ? -25.585 25.388  -59.653 1.00 23.88  ? 1245 ILE B N     1 
ATOM   5302 C  CA    . ILE D 1 245 ? -25.087 25.363  -61.035 1.00 24.15  ? 1245 ILE B CA    1 
ATOM   5303 C  C     . ILE D 1 245 ? -25.013 26.807  -61.506 1.00 23.47  ? 1245 ILE B C     1 
ATOM   5304 O  O     . ILE D 1 245 ? -26.010 27.527  -61.464 1.00 22.81  ? 1245 ILE B O     1 
ATOM   5305 C  CB    . ILE D 1 245 ? -26.015 24.543  -61.978 1.00 24.51  ? 1245 ILE B CB    1 
ATOM   5306 C  CG1   . ILE D 1 245 ? -26.021 23.049  -61.627 1.00 26.53  ? 1245 ILE B CG1   1 
ATOM   5307 C  CG2   . ILE D 1 245 ? -25.658 24.755  -63.470 1.00 26.50  ? 1245 ILE B CG2   1 
ATOM   5308 C  CD1   . ILE D 1 245 ? -24.677 22.354  -61.768 1.00 32.48  ? 1245 ILE B CD1   1 
ATOM   5309 N  N     . GLY D 1 246 ? -23.837 27.234  -61.951 1.00 23.56  ? 1246 GLY B N     1 
ATOM   5310 C  CA    . GLY D 1 246 ? -23.666 28.601  -62.333 1.00 24.12  ? 1246 GLY B CA    1 
ATOM   5311 C  C     . GLY D 1 246 ? -22.598 28.847  -63.369 1.00 25.48  ? 1246 GLY B C     1 
ATOM   5312 O  O     . GLY D 1 246 ? -21.865 27.937  -63.774 1.00 25.66  ? 1246 GLY B O     1 
ATOM   5313 N  N     . ARG D 1 247 ? -22.497 30.110  -63.754 1.00 25.68  ? 1247 ARG B N     1 
ATOM   5314 C  CA    . ARG D 1 247 ? -21.598 30.545  -64.803 1.00 26.07  ? 1247 ARG B CA    1 
ATOM   5315 C  C     . ARG D 1 247 ? -21.126 31.959  -64.478 1.00 25.91  ? 1247 ARG B C     1 
ATOM   5316 O  O     . ARG D 1 247 ? -21.926 32.816  -64.066 1.00 25.12  ? 1247 ARG B O     1 
ATOM   5317 C  CB    . ARG D 1 247 ? -22.341 30.531  -66.149 1.00 26.62  ? 1247 ARG B CB    1 
ATOM   5318 C  CG    . ARG D 1 247 ? -21.474 30.801  -67.368 1.00 29.28  ? 1247 ARG B CG    1 
ATOM   5319 C  CD    . ARG D 1 247 ? -20.713 29.555  -67.793 1.00 32.02  ? 1247 ARG B CD    1 
ATOM   5320 N  NE    . ARG D 1 247 ? -20.079 29.786  -69.090 1.00 36.02  ? 1247 ARG B NE    1 
ATOM   5321 C  CZ    . ARG D 1 247 ? -18.918 30.410  -69.257 1.00 35.31  ? 1247 ARG B CZ    1 
ATOM   5322 N  NH1   . ARG D 1 247 ? -18.241 30.850  -68.204 1.00 34.48  ? 1247 ARG B NH1   1 
ATOM   5323 N  NH2   . ARG D 1 247 ? -18.439 30.591  -70.482 1.00 36.51  ? 1247 ARG B NH2   1 
ATOM   5324 N  N     . ILE D 1 248 ? -19.828 32.203  -64.659 1.00 25.15  ? 1248 ILE B N     1 
ATOM   5325 C  CA    . ILE D 1 248 ? -19.278 33.537  -64.471 1.00 25.63  ? 1248 ILE B CA    1 
ATOM   5326 C  C     . ILE D 1 248 ? -18.392 33.889  -65.666 1.00 26.76  ? 1248 ILE B C     1 
ATOM   5327 O  O     . ILE D 1 248 ? -17.683 33.029  -66.215 1.00 26.99  ? 1248 ILE B O     1 
ATOM   5328 C  CB    . ILE D 1 248 ? -18.533 33.683  -63.131 1.00 25.40  ? 1248 ILE B CB    1 
ATOM   5329 C  CG1   . ILE D 1 248 ? -18.157 35.144  -62.876 1.00 25.55  ? 1248 ILE B CG1   1 
ATOM   5330 C  CG2   . ILE D 1 248 ? -17.318 32.721  -63.047 1.00 24.23  ? 1248 ILE B CG2   1 
ATOM   5331 C  CD1   . ILE D 1 248 ? -17.872 35.433  -61.424 1.00 26.53  ? 1248 ILE B CD1   1 
ATOM   5332 N  N     . VAL D 1 249 ? -18.452 35.141  -66.087 1.00 27.54  ? 1249 VAL B N     1 
ATOM   5333 C  CA    . VAL D 1 249 ? -17.709 35.553  -67.275 1.00 28.47  ? 1249 VAL B CA    1 
ATOM   5334 C  C     . VAL D 1 249 ? -17.013 36.878  -67.044 1.00 29.33  ? 1249 VAL B C     1 
ATOM   5335 O  O     . VAL D 1 249 ? -17.450 37.683  -66.227 1.00 29.86  ? 1249 VAL B O     1 
ATOM   5336 C  CB    . VAL D 1 249 ? -18.609 35.640  -68.547 1.00 28.81  ? 1249 VAL B CB    1 
ATOM   5337 C  CG1   . VAL D 1 249 ? -19.253 34.284  -68.878 1.00 28.50  ? 1249 VAL B CG1   1 
ATOM   5338 C  CG2   . VAL D 1 249 ? -19.667 36.758  -68.418 1.00 28.40  ? 1249 VAL B CG2   1 
ATOM   5339 N  N     . THR D 1 250 ? -15.919 37.102  -67.764 1.00 29.55  ? 1250 THR B N     1 
ATOM   5340 C  CA    . THR D 1 250 ? -15.249 38.384  -67.709 1.00 30.31  ? 1250 THR B CA    1 
ATOM   5341 C  C     . THR D 1 250 ? -15.739 39.291  -68.842 1.00 31.31  ? 1250 THR B C     1 
ATOM   5342 O  O     . THR D 1 250 ? -15.920 38.850  -69.980 1.00 31.48  ? 1250 THR B O     1 
ATOM   5343 C  CB    . THR D 1 250 ? -13.717 38.216  -67.772 1.00 29.64  ? 1250 THR B CB    1 
ATOM   5344 O  OG1   . THR D 1 250 ? -13.288 37.416  -66.659 1.00 29.32  ? 1250 THR B OG1   1 
ATOM   5345 C  CG2   . THR D 1 250 ? -13.045 39.568  -67.716 1.00 29.85  ? 1250 THR B CG2   1 
ATOM   5346 N  N     . MET D 1 251 ? -15.957 40.555  -68.511 1.00 32.69  ? 1251 MET B N     1 
ATOM   5347 C  CA    . MET D 1 251 ? -16.420 41.535  -69.480 1.00 34.22  ? 1251 MET B CA    1 
ATOM   5348 C  C     . MET D 1 251 ? -15.242 42.097  -70.263 1.00 35.28  ? 1251 MET B C     1 
ATOM   5349 O  O     . MET D 1 251 ? -14.158 42.287  -69.699 1.00 34.98  ? 1251 MET B O     1 
ATOM   5350 C  CB    . MET D 1 251 ? -17.143 42.681  -68.777 1.00 33.84  ? 1251 MET B CB    1 
ATOM   5351 C  CG    . MET D 1 251 ? -18.128 42.234  -67.709 1.00 35.01  ? 1251 MET B CG    1 
ATOM   5352 S  SD    . MET D 1 251 ? -19.385 43.478  -67.382 1.00 35.02  ? 1251 MET B SD    1 
ATOM   5353 C  CE    . MET D 1 251 ? -18.419 44.791  -66.625 1.00 35.45  ? 1251 MET B CE    1 
ATOM   5354 N  N     . LYS D 1 252 ? -15.466 42.366  -71.551 1.00 36.69  ? 1252 LYS B N     1 
ATOM   5355 C  CA    . LYS D 1 252 ? -14.446 42.995  -72.401 1.00 38.55  ? 1252 LYS B CA    1 
ATOM   5356 C  C     . LYS D 1 252 ? -13.885 44.264  -71.760 1.00 39.51  ? 1252 LYS B C     1 
ATOM   5357 O  O     . LYS D 1 252 ? -12.671 44.430  -71.745 1.00 40.39  ? 1252 LYS B O     1 
ATOM   5358 C  CB    . LYS D 1 252 ? -14.970 43.258  -73.813 1.00 38.17  ? 1252 LYS B CB    1 
ATOM   5359 C  CG    . LYS D 1 252 ? -15.032 42.008  -74.703 1.00 39.43  ? 1252 LYS B CG    1 
ATOM   5360 C  CD    . LYS D 1 252 ? -16.290 41.979  -75.598 1.00 41.82  ? 1252 LYS B CD    1 
ATOM   5361 C  CE    . LYS D 1 252 ? -16.194 42.839  -76.860 1.00 43.70  ? 1252 LYS B CE    1 
ATOM   5362 N  NZ    . LYS D 1 252 ? -16.510 44.293  -76.667 1.00 45.75  ? 1252 LYS B NZ    1 
ATOM   5363 N  N     . ARG D 1 253 ? -14.750 45.126  -71.204 1.00 40.62  ? 1253 ARG B N     1 
ATOM   5364 C  CA    . ARG D 1 253 ? -14.303 46.297  -70.413 1.00 41.60  ? 1253 ARG B CA    1 
ATOM   5365 C  C     . ARG D 1 253 ? -15.075 46.546  -69.103 1.00 41.85  ? 1253 ARG B C     1 
ATOM   5366 O  O     . ARG D 1 253 ? -16.266 46.230  -68.999 1.00 42.17  ? 1253 ARG B O     1 
ATOM   5367 C  CB    . ARG D 1 253 ? -14.252 47.581  -71.272 1.00 42.07  ? 1253 ARG B CB    1 
ATOM   5368 C  CG    . ARG D 1 253 ? -15.522 47.904  -72.064 1.00 43.57  ? 1253 ARG B CG    1 
ATOM   5369 C  CD    . ARG D 1 253 ? -15.664 49.422  -72.312 1.00 46.69  ? 1253 ARG B CD    1 
ATOM   5370 N  NE    . ARG D 1 253 ? -16.012 50.138  -71.076 1.00 49.10  ? 1253 ARG B NE    1 
ATOM   5371 C  CZ    . ARG D 1 253 ? -16.657 51.304  -71.006 1.00 50.01  ? 1253 ARG B CZ    1 
ATOM   5372 N  NH1   . ARG D 1 253 ? -17.054 51.935  -72.107 1.00 50.41  ? 1253 ARG B NH1   1 
ATOM   5373 N  NH2   . ARG D 1 253 ? -16.917 51.838  -69.817 1.00 50.54  ? 1253 ARG B NH2   1 
ATOM   5374 N  N     . ASN D 1 254 ? -14.375 47.101  -68.109 1.00 42.13  ? 1254 ASN B N     1 
ATOM   5375 C  CA    . ASN D 1 254 ? -14.945 47.440  -66.795 1.00 42.26  ? 1254 ASN B CA    1 
ATOM   5376 C  C     . ASN D 1 254 ? -16.104 48.425  -66.880 1.00 42.37  ? 1254 ASN B C     1 
ATOM   5377 O  O     . ASN D 1 254 ? -16.112 49.304  -67.743 1.00 42.56  ? 1254 ASN B O     1 
ATOM   5378 C  CB    . ASN D 1 254 ? -13.870 48.035  -65.886 1.00 42.56  ? 1254 ASN B CB    1 
ATOM   5379 C  CG    . ASN D 1 254 ? -12.997 46.986  -65.234 1.00 42.98  ? 1254 ASN B CG    1 
ATOM   5380 O  OD1   . ASN D 1 254 ? -12.964 45.842  -65.655 1.00 44.17  ? 1254 ASN B OD1   1 
ATOM   5381 N  ND2   . ASN D 1 254 ? -12.283 47.380  -64.188 1.00 44.39  ? 1254 ASN B ND2   1 
ATOM   5382 N  N     . SER D 1 255 ? -17.074 48.300  -65.972 1.00 42.18  ? 1255 SER B N     1 
ATOM   5383 C  CA    . SER D 1 255 ? -18.307 49.077  -66.085 1.00 41.93  ? 1255 SER B CA    1 
ATOM   5384 C  C     . SER D 1 255 ? -19.149 49.217  -64.802 1.00 41.79  ? 1255 SER B C     1 
ATOM   5385 O  O     . SER D 1 255 ? -19.024 48.438  -63.847 1.00 41.87  ? 1255 SER B O     1 
ATOM   5386 C  CB    . SER D 1 255 ? -19.179 48.509  -67.220 1.00 41.99  ? 1255 SER B CB    1 
ATOM   5387 O  OG    . SER D 1 255 ? -20.399 49.227  -67.354 1.00 42.06  ? 1255 SER B OG    1 
ATOM   5388 N  N     . ARG D 1 256 ? -19.996 50.244  -64.819 1.00 41.48  ? 1256 ARG B N     1 
ATOM   5389 C  CA    . ARG D 1 256 ? -21.066 50.454  -63.850 1.00 41.23  ? 1256 ARG B CA    1 
ATOM   5390 C  C     . ARG D 1 256 ? -22.372 50.733  -64.592 1.00 40.88  ? 1256 ARG B C     1 
ATOM   5391 O  O     . ARG D 1 256 ? -23.372 51.101  -63.978 1.00 40.90  ? 1256 ARG B O     1 
ATOM   5392 C  CB    . ARG D 1 256 ? -20.735 51.618  -62.916 1.00 41.39  ? 1256 ARG B CB    1 
ATOM   5393 C  CG    . ARG D 1 256 ? -19.808 51.252  -61.765 1.00 42.10  ? 1256 ARG B CG    1 
ATOM   5394 C  CD    . ARG D 1 256 ? -19.657 52.411  -60.773 1.00 42.35  ? 1256 ARG B CD    1 
ATOM   5395 N  NE    . ARG D 1 256 ? -20.938 52.853  -60.222 1.00 42.15  ? 1256 ARG B NE    1 
ATOM   5396 C  CZ    . ARG D 1 256 ? -21.614 52.222  -59.264 1.00 41.95  ? 1256 ARG B CZ    1 
ATOM   5397 N  NH1   . ARG D 1 256 ? -21.149 51.100  -58.731 1.00 41.81  ? 1256 ARG B NH1   1 
ATOM   5398 N  NH2   . ARG D 1 256 ? -22.770 52.713  -58.840 1.00 41.35  ? 1256 ARG B NH2   1 
ATOM   5399 N  N     . ASN D 1 257 ? -22.351 50.546  -65.911 1.00 40.52  ? 1257 ASN B N     1 
ATOM   5400 C  CA    . ASN D 1 257 ? -23.499 50.802  -66.775 1.00 40.70  ? 1257 ASN B CA    1 
ATOM   5401 C  C     . ASN D 1 257 ? -24.325 49.548  -67.040 1.00 40.49  ? 1257 ASN B C     1 
ATOM   5402 O  O     . ASN D 1 257 ? -23.804 48.567  -67.558 1.00 40.63  ? 1257 ASN B O     1 
ATOM   5403 C  CB    . ASN D 1 257 ? -23.035 51.406  -68.106 1.00 40.75  ? 1257 ASN B CB    1 
ATOM   5404 C  CG    . ASN D 1 257 ? -24.194 51.717  -69.045 1.00 41.48  ? 1257 ASN B CG    1 
ATOM   5405 O  OD1   . ASN D 1 257 ? -24.432 50.994  -70.017 1.00 42.16  ? 1257 ASN B OD1   1 
ATOM   5406 N  ND2   . ASN D 1 257 ? -24.925 52.790  -68.753 1.00 40.88  ? 1257 ASN B ND2   1 
ATOM   5407 N  N     . LEU D 1 258 ? -25.618 49.605  -66.718 1.00 40.43  ? 1258 LEU B N     1 
ATOM   5408 C  CA    . LEU D 1 258 ? -26.514 48.434  -66.769 1.00 40.19  ? 1258 LEU B CA    1 
ATOM   5409 C  C     . LEU D 1 258 ? -26.715 47.796  -68.157 1.00 39.84  ? 1258 LEU B C     1 
ATOM   5410 O  O     . LEU D 1 258 ? -26.702 46.575  -68.279 1.00 39.71  ? 1258 LEU B O     1 
ATOM   5411 C  CB    . LEU D 1 258 ? -27.868 48.755  -66.111 1.00 40.49  ? 1258 LEU B CB    1 
ATOM   5412 C  CG    . LEU D 1 258 ? -29.009 47.725  -66.124 1.00 40.74  ? 1258 LEU B CG    1 
ATOM   5413 C  CD1   . LEU D 1 258 ? -28.626 46.440  -65.396 1.00 42.12  ? 1258 LEU B CD1   1 
ATOM   5414 C  CD2   . LEU D 1 258 ? -30.269 48.314  -65.520 1.00 41.32  ? 1258 LEU B CD2   1 
ATOM   5415 N  N     . GLU D 1 259 ? -26.901 48.605  -69.193 1.00 39.36  ? 1259 GLU B N     1 
ATOM   5416 C  CA    . GLU D 1 259 ? -27.097 48.062  -70.542 1.00 39.26  ? 1259 GLU B CA    1 
ATOM   5417 C  C     . GLU D 1 259 ? -25.810 47.475  -71.107 1.00 38.92  ? 1259 GLU B C     1 
ATOM   5418 O  O     . GLU D 1 259 ? -25.842 46.663  -72.038 1.00 38.62  ? 1259 GLU B O     1 
ATOM   5419 C  CB    . GLU D 1 259 ? -27.657 49.126  -71.495 1.00 39.35  ? 1259 GLU B CB    1 
ATOM   5420 C  CG    . GLU D 1 259 ? -29.134 49.460  -71.254 1.00 39.84  ? 1259 GLU B CG    1 
ATOM   5421 C  CD    . GLU D 1 259 ? -30.057 48.260  -71.449 1.00 41.31  ? 1259 GLU B CD    1 
ATOM   5422 O  OE1   . GLU D 1 259 ? -30.123 47.733  -72.583 1.00 41.41  ? 1259 GLU B OE1   1 
ATOM   5423 O  OE2   . GLU D 1 259 ? -30.721 47.848  -70.466 1.00 41.93  ? 1259 GLU B OE2   1 
ATOM   5424 N  N     . GLU D 1 260 ? -24.682 47.906  -70.548 1.00 38.69  ? 1260 GLU B N     1 
ATOM   5425 C  CA    . GLU D 1 260 ? -23.372 47.354  -70.913 1.00 38.84  ? 1260 GLU B CA    1 
ATOM   5426 C  C     . GLU D 1 260 ? -23.182 45.955  -70.292 1.00 38.31  ? 1260 GLU B C     1 
ATOM   5427 O  O     . GLU D 1 260 ? -22.744 45.022  -70.967 1.00 38.38  ? 1260 GLU B O     1 
ATOM   5428 C  CB    . GLU D 1 260 ? -22.245 48.312  -70.494 1.00 38.79  ? 1260 GLU B CB    1 
ATOM   5429 C  CG    . GLU D 1 260 ? -20.872 47.926  -71.016 1.00 40.28  ? 1260 GLU B CG    1 
ATOM   5430 C  CD    . GLU D 1 260 ? -19.924 49.112  -71.192 1.00 41.96  ? 1260 GLU B CD    1 
ATOM   5431 O  OE1   . GLU D 1 260 ? -20.394 50.254  -71.409 1.00 41.79  ? 1260 GLU B OE1   1 
ATOM   5432 O  OE2   . GLU D 1 260 ? -18.695 48.886  -71.128 1.00 42.45  ? 1260 GLU B OE2   1 
ATOM   5433 N  N     . ILE D 1 261 ? -23.549 45.825  -69.017 1.00 37.79  ? 1261 ILE B N     1 
ATOM   5434 C  CA    . ILE D 1 261 ? -23.388 44.584  -68.260 1.00 37.19  ? 1261 ILE B CA    1 
ATOM   5435 C  C     . ILE D 1 261 ? -24.427 43.523  -68.655 1.00 36.94  ? 1261 ILE B C     1 
ATOM   5436 O  O     . ILE D 1 261 ? -24.107 42.340  -68.711 1.00 36.84  ? 1261 ILE B O     1 
ATOM   5437 C  CB    . ILE D 1 261 ? -23.434 44.868  -66.739 1.00 37.06  ? 1261 ILE B CB    1 
ATOM   5438 C  CG1   . ILE D 1 261 ? -22.262 45.771  -66.341 1.00 36.98  ? 1261 ILE B CG1   1 
ATOM   5439 C  CG2   . ILE D 1 261 ? -23.419 43.565  -65.928 1.00 37.38  ? 1261 ILE B CG2   1 
ATOM   5440 C  CD1   . ILE D 1 261 ? -22.356 46.337  -64.928 1.00 36.98  ? 1261 ILE B CD1   1 
ATOM   5441 N  N     . LYS D 1 262 ? -25.656 43.961  -68.941 1.00 36.73  ? 1262 LYS B N     1 
ATOM   5442 C  CA    . LYS D 1 262 ? -26.784 43.065  -69.252 1.00 36.47  ? 1262 LYS B CA    1 
ATOM   5443 C  C     . LYS D 1 262 ? -26.533 41.925  -70.264 1.00 36.44  ? 1262 LYS B C     1 
ATOM   5444 O  O     . LYS D 1 262 ? -26.980 40.800  -70.036 1.00 36.39  ? 1262 LYS B O     1 
ATOM   5445 C  CB    . LYS D 1 262 ? -28.036 43.869  -69.637 1.00 36.68  ? 1262 LYS B CB    1 
ATOM   5446 C  CG    . LYS D 1 262 ? -28.972 44.140  -68.455 1.00 36.50  ? 1262 LYS B CG    1 
ATOM   5447 C  CD    . LYS D 1 262 ? -30.061 45.184  -68.770 1.00 37.18  ? 1262 LYS B CD    1 
ATOM   5448 C  CE    . LYS D 1 262 ? -31.233 44.595  -69.562 1.00 38.09  ? 1262 LYS B CE    1 
ATOM   5449 N  NZ    . LYS D 1 262 ? -32.407 45.531  -69.633 1.00 38.17  ? 1262 LYS B NZ    1 
ATOM   5450 N  N     . PRO D 1 263 ? -25.821 42.193  -71.377 1.00 36.35  ? 1263 PRO B N     1 
ATOM   5451 C  CA    . PRO D 1 263 ? -25.579 41.072  -72.307 1.00 36.11  ? 1263 PRO B CA    1 
ATOM   5452 C  C     . PRO D 1 263 ? -24.645 39.979  -71.754 1.00 35.60  ? 1263 PRO B C     1 
ATOM   5453 O  O     . PRO D 1 263 ? -24.729 38.820  -72.179 1.00 35.05  ? 1263 PRO B O     1 
ATOM   5454 C  CB    . PRO D 1 263 ? -24.939 41.760  -73.521 1.00 36.31  ? 1263 PRO B CB    1 
ATOM   5455 C  CG    . PRO D 1 263 ? -25.429 43.149  -73.447 1.00 36.58  ? 1263 PRO B CG    1 
ATOM   5456 C  CD    . PRO D 1 263 ? -25.417 43.471  -71.984 1.00 36.41  ? 1263 PRO B CD    1 
ATOM   5457 N  N     . TYR D 1 264 ? -23.774 40.344  -70.815 1.00 35.32  ? 1264 TYR B N     1 
ATOM   5458 C  CA    . TYR D 1 264 ? -22.857 39.372  -70.196 1.00 34.67  ? 1264 TYR B CA    1 
ATOM   5459 C  C     . TYR D 1 264 ? -23.647 38.496  -69.234 1.00 34.26  ? 1264 TYR B C     1 
ATOM   5460 O  O     . TYR D 1 264 ? -23.507 37.259  -69.229 1.00 33.63  ? 1264 TYR B O     1 
ATOM   5461 C  CB    . TYR D 1 264 ? -21.743 40.083  -69.436 1.00 34.61  ? 1264 TYR B CB    1 
ATOM   5462 C  CG    . TYR D 1 264 ? -20.732 40.766  -70.323 1.00 36.54  ? 1264 TYR B CG    1 
ATOM   5463 C  CD1   . TYR D 1 264 ? -19.657 40.058  -70.866 1.00 36.74  ? 1264 TYR B CD1   1 
ATOM   5464 C  CD2   . TYR D 1 264 ? -20.848 42.126  -70.617 1.00 36.93  ? 1264 TYR B CD2   1 
ATOM   5465 C  CE1   . TYR D 1 264 ? -18.728 40.699  -71.704 1.00 39.04  ? 1264 TYR B CE1   1 
ATOM   5466 C  CE2   . TYR D 1 264 ? -19.927 42.772  -71.432 1.00 37.90  ? 1264 TYR B CE2   1 
ATOM   5467 C  CZ    . TYR D 1 264 ? -18.871 42.056  -71.971 1.00 37.77  ? 1264 TYR B CZ    1 
ATOM   5468 O  OH    . TYR D 1 264 ? -17.966 42.711  -72.775 1.00 39.68  ? 1264 TYR B OH    1 
ATOM   5469 N  N     . LEU D 1 265 ? -24.465 39.165  -68.421 1.00 33.31  ? 1265 LEU B N     1 
ATOM   5470 C  CA    . LEU D 1 265 ? -25.330 38.519  -67.453 1.00 33.21  ? 1265 LEU B CA    1 
ATOM   5471 C  C     . LEU D 1 265 ? -26.272 37.539  -68.140 1.00 33.09  ? 1265 LEU B C     1 
ATOM   5472 O  O     . LEU D 1 265 ? -26.449 36.417  -67.685 1.00 32.57  ? 1265 LEU B O     1 
ATOM   5473 C  CB    . LEU D 1 265 ? -26.118 39.580  -66.677 1.00 33.43  ? 1265 LEU B CB    1 
ATOM   5474 C  CG    . LEU D 1 265 ? -27.060 39.144  -65.552 1.00 32.92  ? 1265 LEU B CG    1 
ATOM   5475 C  CD1   . LEU D 1 265 ? -26.312 38.395  -64.467 1.00 31.62  ? 1265 LEU B CD1   1 
ATOM   5476 C  CD2   . LEU D 1 265 ? -27.757 40.368  -64.980 1.00 33.95  ? 1265 LEU B CD2   1 
ATOM   5477 N  N     . PHE D 1 266 ? -26.844 37.962  -69.260 1.00 33.63  ? 1266 PHE B N     1 
ATOM   5478 C  CA    . PHE D 1 266 ? -27.811 37.143  -69.986 1.00 33.78  ? 1266 PHE B CA    1 
ATOM   5479 C  C     . PHE D 1 266 ? -27.215 35.871  -70.621 1.00 33.26  ? 1266 PHE B C     1 
ATOM   5480 O  O     . PHE D 1 266 ? -27.861 34.823  -70.632 1.00 33.84  ? 1266 PHE B O     1 
ATOM   5481 C  CB    . PHE D 1 266 ? -28.591 37.992  -70.999 1.00 34.11  ? 1266 PHE B CB    1 
ATOM   5482 C  CG    . PHE D 1 266 ? -29.509 39.010  -70.368 1.00 35.75  ? 1266 PHE B CG    1 
ATOM   5483 C  CD1   . PHE D 1 266 ? -29.792 38.977  -68.997 1.00 37.79  ? 1266 PHE B CD1   1 
ATOM   5484 C  CD2   . PHE D 1 266 ? -30.125 39.988  -71.152 1.00 38.32  ? 1266 PHE B CD2   1 
ATOM   5485 C  CE1   . PHE D 1 266 ? -30.646 39.907  -68.412 1.00 38.51  ? 1266 PHE B CE1   1 
ATOM   5486 C  CE2   . PHE D 1 266 ? -30.989 40.925  -70.581 1.00 38.19  ? 1266 PHE B CE2   1 
ATOM   5487 C  CZ    . PHE D 1 266 ? -31.251 40.883  -69.207 1.00 39.42  ? 1266 PHE B CZ    1 
ATOM   5488 N  N     . ARG D 1 267 ? -25.990 35.949  -71.129 1.00 32.60  ? 1267 ARG B N     1 
ATOM   5489 C  CA    . ARG D 1 267 ? -25.305 34.743  -71.622 1.00 32.39  ? 1267 ARG B CA    1 
ATOM   5490 C  C     . ARG D 1 267 ? -24.941 33.788  -70.468 1.00 30.76  ? 1267 ARG B C     1 
ATOM   5491 O  O     . ARG D 1 267 ? -25.039 32.565  -70.602 1.00 30.05  ? 1267 ARG B O     1 
ATOM   5492 C  CB    . ARG D 1 267 ? -24.045 35.095  -72.439 1.00 33.11  ? 1267 ARG B CB    1 
ATOM   5493 C  CG    . ARG D 1 267 ? -23.548 33.935  -73.326 1.00 35.67  ? 1267 ARG B CG    1 
ATOM   5494 C  CD    . ARG D 1 267 ? -22.017 33.847  -73.432 1.00 39.94  ? 1267 ARG B CD    1 
ATOM   5495 N  NE    . ARG D 1 267 ? -21.345 35.152  -73.432 1.00 41.19  ? 1267 ARG B NE    1 
ATOM   5496 C  CZ    . ARG D 1 267 ? -20.077 35.333  -73.063 1.00 41.68  ? 1267 ARG B CZ    1 
ATOM   5497 N  NH1   . ARG D 1 267 ? -19.341 34.306  -72.674 1.00 41.41  ? 1267 ARG B NH1   1 
ATOM   5498 N  NH2   . ARG D 1 267 ? -19.544 36.544  -73.075 1.00 42.90  ? 1267 ARG B NH2   1 
ATOM   5499 N  N     . ALA D 1 268 ? -24.519 34.349  -69.336 1.00 30.13  ? 1268 ALA B N     1 
ATOM   5500 C  CA    . ALA D 1 268 ? -24.272 33.539  -68.134 1.00 29.29  ? 1268 ALA B CA    1 
ATOM   5501 C  C     . ALA D 1 268 ? -25.540 32.749  -67.773 1.00 29.30  ? 1268 ALA B C     1 
ATOM   5502 O  O     . ALA D 1 268 ? -25.471 31.542  -67.508 1.00 29.10  ? 1268 ALA B O     1 
ATOM   5503 C  CB    . ALA D 1 268 ? -23.834 34.417  -66.970 1.00 29.04  ? 1268 ALA B CB    1 
ATOM   5504 N  N     . ILE D 1 269 ? -26.691 33.426  -67.785 1.00 28.87  ? 1269 ILE B N     1 
ATOM   5505 C  CA    . ILE D 1 269 ? -27.976 32.780  -67.494 1.00 29.34  ? 1269 ILE B CA    1 
ATOM   5506 C  C     . ILE D 1 269 ? -28.233 31.687  -68.516 1.00 29.66  ? 1269 ILE B C     1 
ATOM   5507 O  O     . ILE D 1 269 ? -28.547 30.560  -68.148 1.00 28.97  ? 1269 ILE B O     1 
ATOM   5508 C  CB    . ILE D 1 269 ? -29.164 33.793  -67.464 1.00 29.18  ? 1269 ILE B CB    1 
ATOM   5509 C  CG1   . ILE D 1 269 ? -29.036 34.733  -66.262 1.00 29.46  ? 1269 ILE B CG1   1 
ATOM   5510 C  CG2   . ILE D 1 269 ? -30.492 33.064  -67.392 1.00 29.42  ? 1269 ILE B CG2   1 
ATOM   5511 C  CD1   . ILE D 1 269 ? -29.946 35.954  -66.353 1.00 34.25  ? 1269 ILE B CD1   1 
ATOM   5512 N  N     . GLU D 1 270 ? -28.068 32.022  -69.799 1.00 30.78  ? 1270 GLU B N     1 
ATOM   5513 C  CA    . GLU D 1 270 ? -28.330 31.069  -70.877 1.00 31.84  ? 1270 GLU B CA    1 
ATOM   5514 C  C     . GLU D 1 270 ? -27.567 29.764  -70.686 1.00 31.88  ? 1270 GLU B C     1 
ATOM   5515 O  O     . GLU D 1 270 ? -28.150 28.679  -70.689 1.00 31.80  ? 1270 GLU B O     1 
ATOM   5516 C  CB    . GLU D 1 270 ? -27.992 31.678  -72.245 1.00 32.04  ? 1270 GLU B CB    1 
ATOM   5517 C  CG    . GLU D 1 270 ? -29.130 32.429  -72.908 1.00 35.55  ? 1270 GLU B CG    1 
ATOM   5518 C  CD    . GLU D 1 270 ? -30.327 31.542  -73.267 1.00 38.18  ? 1270 GLU B CD    1 
ATOM   5519 O  OE1   . GLU D 1 270 ? -31.409 32.094  -73.537 1.00 38.74  ? 1270 GLU B OE1   1 
ATOM   5520 O  OE2   . GLU D 1 270 ? -30.197 30.297  -73.279 1.00 41.37  ? 1270 GLU B OE2   1 
ATOM   5521 N  N     . GLU D 1 271 ? -26.252 29.875  -70.519 1.00 32.22  ? 1271 GLU B N     1 
ATOM   5522 C  CA    . GLU D 1 271 ? -25.401 28.701  -70.333 1.00 32.70  ? 1271 GLU B CA    1 
ATOM   5523 C  C     . GLU D 1 271 ? -25.644 27.980  -68.998 1.00 32.73  ? 1271 GLU B C     1 
ATOM   5524 O  O     . GLU D 1 271 ? -25.632 26.738  -68.935 1.00 31.43  ? 1271 GLU B O     1 
ATOM   5525 C  CB    . GLU D 1 271 ? -23.925 29.082  -70.534 1.00 33.03  ? 1271 GLU B CB    1 
ATOM   5526 C  CG    . GLU D 1 271 ? -23.614 29.384  -72.009 1.00 35.68  ? 1271 GLU B CG    1 
ATOM   5527 C  CD    . GLU D 1 271 ? -22.152 29.748  -72.290 1.00 39.56  ? 1271 GLU B CD    1 
ATOM   5528 O  OE1   . GLU D 1 271 ? -21.258 29.318  -71.535 1.00 41.18  ? 1271 GLU B OE1   1 
ATOM   5529 O  OE2   . GLU D 1 271 ? -21.906 30.453  -73.293 1.00 40.48  ? 1271 GLU B OE2   1 
ATOM   5530 N  N     . SER D 1 272 ? -25.886 28.756  -67.939 1.00 33.17  ? 1272 SER B N     1 
ATOM   5531 C  CA    . SER D 1 272 ? -26.251 28.170  -66.655 1.00 34.09  ? 1272 SER B CA    1 
ATOM   5532 C  C     . SER D 1 272 ? -27.503 27.305  -66.796 1.00 34.66  ? 1272 SER B C     1 
ATOM   5533 O  O     . SER D 1 272 ? -27.530 26.154  -66.341 1.00 34.51  ? 1272 SER B O     1 
ATOM   5534 C  CB    . SER D 1 272 ? -26.484 29.262  -65.619 1.00 34.15  ? 1272 SER B CB    1 
ATOM   5535 O  OG    . SER D 1 272 ? -25.283 29.557  -64.947 1.00 36.23  ? 1272 SER B OG    1 
ATOM   5536 N  N     . TYR D 1 273 ? -28.530 27.857  -67.445 1.00 35.65  ? 1273 TYR B N     1 
ATOM   5537 C  CA    . TYR D 1 273 ? -29.816 27.163  -67.555 1.00 36.96  ? 1273 TYR B CA    1 
ATOM   5538 C  C     . TYR D 1 273 ? -29.704 25.897  -68.405 1.00 37.76  ? 1273 TYR B C     1 
ATOM   5539 O  O     . TYR D 1 273 ? -30.301 24.873  -68.078 1.00 37.60  ? 1273 TYR B O     1 
ATOM   5540 C  CB    . TYR D 1 273 ? -30.913 28.099  -68.062 1.00 36.93  ? 1273 TYR B CB    1 
ATOM   5541 C  CG    . TYR D 1 273 ? -32.243 27.853  -67.392 1.00 37.23  ? 1273 TYR B CG    1 
ATOM   5542 C  CD1   . TYR D 1 273 ? -33.124 26.901  -67.894 1.00 37.81  ? 1273 TYR B CD1   1 
ATOM   5543 C  CD2   . TYR D 1 273 ? -32.620 28.567  -66.247 1.00 38.61  ? 1273 TYR B CD2   1 
ATOM   5544 C  CE1   . TYR D 1 273 ? -34.356 26.660  -67.286 1.00 38.16  ? 1273 TYR B CE1   1 
ATOM   5545 C  CE2   . TYR D 1 273 ? -33.861 28.332  -65.617 1.00 36.92  ? 1273 TYR B CE2   1 
ATOM   5546 C  CZ    . TYR D 1 273 ? -34.719 27.367  -66.147 1.00 38.80  ? 1273 TYR B CZ    1 
ATOM   5547 O  OH    . TYR D 1 273 ? -35.959 27.101  -65.565 1.00 39.26  ? 1273 TYR B OH    1 
ATOM   5548 N  N     . TYR D 1 274 ? -28.886 25.956  -69.456 1.00 39.21  ? 1274 TYR B N     1 
ATOM   5549 C  CA    . TYR D 1 274 ? -28.537 24.761  -70.229 1.00 40.60  ? 1274 TYR B CA    1 
ATOM   5550 C  C     . TYR D 1 274 ? -28.004 23.608  -69.360 1.00 40.76  ? 1274 TYR B C     1 
ATOM   5551 O  O     . TYR D 1 274 ? -28.407 22.457  -69.550 1.00 40.83  ? 1274 TYR B O     1 
ATOM   5552 C  CB    . TYR D 1 274 ? -27.520 25.099  -71.326 1.00 41.29  ? 1274 TYR B CB    1 
ATOM   5553 C  CG    . TYR D 1 274 ? -27.186 23.907  -72.200 1.00 43.86  ? 1274 TYR B CG    1 
ATOM   5554 C  CD1   . TYR D 1 274 ? -27.912 23.650  -73.368 1.00 46.50  ? 1274 TYR B CD1   1 
ATOM   5555 C  CD2   . TYR D 1 274 ? -26.162 23.019  -71.845 1.00 46.03  ? 1274 TYR B CD2   1 
ATOM   5556 C  CE1   . TYR D 1 274 ? -27.614 22.550  -74.169 1.00 48.73  ? 1274 TYR B CE1   1 
ATOM   5557 C  CE2   . TYR D 1 274 ? -25.865 21.912  -72.630 1.00 48.04  ? 1274 TYR B CE2   1 
ATOM   5558 C  CZ    . TYR D 1 274 ? -26.591 21.685  -73.791 1.00 49.13  ? 1274 TYR B CZ    1 
ATOM   5559 O  OH    . TYR D 1 274 ? -26.296 20.592  -74.575 1.00 51.58  ? 1274 TYR B OH    1 
ATOM   5560 N  N     . LYS D 1 275 ? -27.106 23.927  -68.421 1.00 40.98  ? 1275 LYS B N     1 
ATOM   5561 C  CA    . LYS D 1 275 ? -26.430 22.939  -67.559 1.00 41.29  ? 1275 LYS B CA    1 
ATOM   5562 C  C     . LYS D 1 275 ? -27.360 22.298  -66.515 1.00 41.49  ? 1275 LYS B C     1 
ATOM   5563 O  O     . LYS D 1 275 ? -27.047 21.237  -65.965 1.00 41.48  ? 1275 LYS B O     1 
ATOM   5564 C  CB    . LYS D 1 275 ? -25.230 23.582  -66.824 1.00 41.17  ? 1275 LYS B CB    1 
ATOM   5565 C  CG    . LYS D 1 275 ? -23.957 23.865  -67.660 1.00 42.44  ? 1275 LYS B CG    1 
ATOM   5566 C  CD    . LYS D 1 275 ? -22.847 24.539  -66.800 1.00 42.65  ? 1275 LYS B CD    1 
ATOM   5567 C  CE    . LYS D 1 275 ? -21.654 25.012  -67.656 1.00 45.36  ? 1275 LYS B CE    1 
ATOM   5568 N  NZ    . LYS D 1 275 ? -20.604 25.816  -66.897 1.00 45.28  ? 1275 LYS B NZ    1 
ATOM   5569 N  N     . LEU D 1 276 ? -28.487 22.947  -66.232 1.00 41.57  ? 1276 LEU B N     1 
ATOM   5570 C  CA    . LEU D 1 276 ? -29.454 22.446  -65.250 1.00 41.98  ? 1276 LEU B CA    1 
ATOM   5571 C  C     . LEU D 1 276 ? -29.939 21.031  -65.533 1.00 42.77  ? 1276 LEU B C     1 
ATOM   5572 O  O     . LEU D 1 276 ? -30.256 20.281  -64.602 1.00 42.59  ? 1276 LEU B O     1 
ATOM   5573 C  CB    . LEU D 1 276 ? -30.639 23.401  -65.117 1.00 41.59  ? 1276 LEU B CB    1 
ATOM   5574 C  CG    . LEU D 1 276 ? -30.341 24.719  -64.405 1.00 40.38  ? 1276 LEU B CG    1 
ATOM   5575 C  CD1   . LEU D 1 276 ? -31.525 25.651  -64.504 1.00 40.17  ? 1276 LEU B CD1   1 
ATOM   5576 C  CD2   . LEU D 1 276 ? -29.973 24.481  -62.958 1.00 38.55  ? 1276 LEU B CD2   1 
ATOM   5577 N  N     . ASP D 1 277 ? -29.990 20.668  -66.818 1.00 44.07  ? 1277 ASP B N     1 
ATOM   5578 C  CA    . ASP D 1 277 ? -30.251 19.282  -67.230 1.00 44.57  ? 1277 ASP B CA    1 
ATOM   5579 C  C     . ASP D 1 277 ? -31.522 18.725  -66.559 1.00 44.37  ? 1277 ASP B C     1 
ATOM   5580 O  O     . ASP D 1 277 ? -31.461 17.752  -65.790 1.00 44.53  ? 1277 ASP B O     1 
ATOM   5581 C  CB    . ASP D 1 277 ? -29.013 18.420  -66.915 1.00 44.94  ? 1277 ASP B CB    1 
ATOM   5582 C  CG    . ASP D 1 277 ? -29.240 16.940  -67.152 1.00 46.38  ? 1277 ASP B CG    1 
ATOM   5583 O  OD1   . ASP D 1 277 ? -28.914 16.157  -66.236 1.00 48.47  ? 1277 ASP B OD1   1 
ATOM   5584 O  OD2   . ASP D 1 277 ? -29.749 16.559  -68.234 1.00 47.81  ? 1277 ASP B OD2   1 
ATOM   5585 N  N     . LYS D 1 278 ? -32.655 19.374  -66.831 1.00 43.63  ? 1278 LYS B N     1 
ATOM   5586 C  CA    . LYS D 1 278 ? -33.967 18.997  -66.269 1.00 43.31  ? 1278 LYS B CA    1 
ATOM   5587 C  C     . LYS D 1 278 ? -34.265 19.525  -64.851 1.00 42.24  ? 1278 LYS B C     1 
ATOM   5588 O  O     . LYS D 1 278 ? -35.431 19.664  -64.478 1.00 42.15  ? 1278 LYS B O     1 
ATOM   5589 C  CB    . LYS D 1 278 ? -34.206 17.475  -66.337 1.00 43.82  ? 1278 LYS B CB    1 
ATOM   5590 C  CG    . LYS D 1 278 ? -34.370 16.914  -67.746 1.00 44.69  ? 1278 LYS B CG    1 
ATOM   5591 C  CD    . LYS D 1 278 ? -35.822 16.919  -68.190 1.00 46.73  ? 1278 LYS B CD    1 
ATOM   5592 C  CE    . LYS D 1 278 ? -35.992 16.184  -69.510 1.00 47.41  ? 1278 LYS B CE    1 
ATOM   5593 N  NZ    . LYS D 1 278 ? -37.427 15.909  -69.813 1.00 48.58  ? 1278 LYS B NZ    1 
ATOM   5594 N  N     . ARG D 1 279 ? -33.227 19.819  -64.072 1.00 40.89  ? 1279 ARG B N     1 
ATOM   5595 C  CA    . ARG D 1 279 ? -33.401 20.361  -62.718 1.00 39.61  ? 1279 ARG B CA    1 
ATOM   5596 C  C     . ARG D 1 279 ? -34.120 21.702  -62.732 1.00 38.31  ? 1279 ARG B C     1 
ATOM   5597 O  O     . ARG D 1 279 ? -33.884 22.535  -63.609 1.00 38.45  ? 1279 ARG B O     1 
ATOM   5598 C  CB    . ARG D 1 279 ? -32.053 20.539  -62.039 1.00 39.82  ? 1279 ARG B CB    1 
ATOM   5599 C  CG    . ARG D 1 279 ? -31.453 19.278  -61.510 1.00 40.78  ? 1279 ARG B CG    1 
ATOM   5600 C  CD    . ARG D 1 279 ? -30.092 19.592  -60.938 1.00 44.00  ? 1279 ARG B CD    1 
ATOM   5601 N  NE    . ARG D 1 279 ? -29.008 19.219  -61.839 1.00 46.59  ? 1279 ARG B NE    1 
ATOM   5602 C  CZ    . ARG D 1 279 ? -28.052 18.357  -61.516 1.00 47.29  ? 1279 ARG B CZ    1 
ATOM   5603 N  NH1   . ARG D 1 279 ? -28.049 17.784  -60.324 1.00 48.37  ? 1279 ARG B NH1   1 
ATOM   5604 N  NH2   . ARG D 1 279 ? -27.094 18.070  -62.376 1.00 48.79  ? 1279 ARG B NH2   1 
ATOM   5605 N  N     . ILE D 1 280 ? -34.999 21.913  -61.759 1.00 36.71  ? 1280 ILE B N     1 
ATOM   5606 C  CA    . ILE D 1 280 ? -35.739 23.169  -61.683 1.00 35.11  ? 1280 ILE B CA    1 
ATOM   5607 C  C     . ILE D 1 280 ? -35.344 23.911  -60.409 1.00 33.31  ? 1280 ILE B C     1 
ATOM   5608 O  O     . ILE D 1 280 ? -35.566 23.404  -59.315 1.00 32.82  ? 1280 ILE B O     1 
ATOM   5609 C  CB    . ILE D 1 280 ? -37.278 22.953  -61.728 1.00 35.28  ? 1280 ILE B CB    1 
ATOM   5610 C  CG1   . ILE D 1 280 ? -37.681 22.024  -62.886 1.00 36.35  ? 1280 ILE B CG1   1 
ATOM   5611 C  CG2   . ILE D 1 280 ? -38.010 24.291  -61.790 1.00 34.93  ? 1280 ILE B CG2   1 
ATOM   5612 C  CD1   . ILE D 1 280 ? -37.271 22.509  -64.295 1.00 37.81  ? 1280 ILE B CD1   1 
ATOM   5613 N  N     . PRO D 1 281 ? -34.749 25.111  -60.556 1.00 31.85  ? 1281 PRO B N     1 
ATOM   5614 C  CA    . PRO D 1 281 ? -34.256 25.872  -59.402 1.00 30.54  ? 1281 PRO B CA    1 
ATOM   5615 C  C     . PRO D 1 281 ? -35.296 26.808  -58.780 1.00 29.36  ? 1281 PRO B C     1 
ATOM   5616 O  O     . PRO D 1 281 ? -36.105 27.427  -59.493 1.00 28.66  ? 1281 PRO B O     1 
ATOM   5617 C  CB    . PRO D 1 281 ? -33.110 26.683  -59.997 1.00 30.32  ? 1281 PRO B CB    1 
ATOM   5618 C  CG    . PRO D 1 281 ? -33.560 26.939  -61.419 1.00 31.05  ? 1281 PRO B CG    1 
ATOM   5619 C  CD    . PRO D 1 281 ? -34.446 25.788  -61.829 1.00 31.23  ? 1281 PRO B CD    1 
ATOM   5620 N  N     . LYS D 1 282 ? -35.260 26.910  -57.453 1.00 27.87  ? 1282 LYS B N     1 
ATOM   5621 C  CA    . LYS D 1 282 ? -36.127 27.846  -56.744 1.00 26.87  ? 1282 LYS B CA    1 
ATOM   5622 C  C     . LYS D 1 282 ? -35.353 29.078  -56.275 1.00 25.61  ? 1282 LYS B C     1 
ATOM   5623 O  O     . LYS D 1 282 ? -35.951 30.016  -55.763 1.00 25.41  ? 1282 LYS B O     1 
ATOM   5624 C  CB    . LYS D 1 282 ? -36.814 27.160  -55.563 1.00 26.75  ? 1282 LYS B CB    1 
ATOM   5625 C  CG    . LYS D 1 282 ? -37.865 26.136  -55.971 1.00 28.81  ? 1282 LYS B CG    1 
ATOM   5626 C  CD    . LYS D 1 282 ? -38.475 25.449  -54.749 1.00 32.28  ? 1282 LYS B CD    1 
ATOM   5627 C  CE    . LYS D 1 282 ? -37.513 24.378  -54.214 1.00 35.44  ? 1282 LYS B CE    1 
ATOM   5628 N  NZ    . LYS D 1 282 ? -37.517 24.316  -52.730 1.00 38.67  ? 1282 LYS B NZ    1 
ATOM   5629 N  N     . ALA D 1 283 ? -34.033 29.075  -56.455 1.00 23.93  ? 1283 ALA B N     1 
ATOM   5630 C  CA    . ALA D 1 283 ? -33.206 30.231  -56.076 1.00 23.10  ? 1283 ALA B CA    1 
ATOM   5631 C  C     . ALA D 1 283 ? -32.212 30.634  -57.161 1.00 22.48  ? 1283 ALA B C     1 
ATOM   5632 O  O     . ALA D 1 283 ? -31.684 29.792  -57.881 1.00 21.67  ? 1283 ALA B O     1 
ATOM   5633 C  CB    . ALA D 1 283 ? -32.465 29.978  -54.750 1.00 23.20  ? 1283 ALA B CB    1 
ATOM   5634 N  N     . ILE D 1 284 ? -31.981 31.938  -57.265 1.00 22.01  ? 1284 ILE B N     1 
ATOM   5635 C  CA    . ILE D 1 284 ? -31.016 32.501  -58.207 1.00 22.05  ? 1284 ILE B CA    1 
ATOM   5636 C  C     . ILE D 1 284 ? -30.160 33.527  -57.472 1.00 21.84  ? 1284 ILE B C     1 
ATOM   5637 O  O     . ILE D 1 284 ? -30.655 34.264  -56.625 1.00 22.03  ? 1284 ILE B O     1 
ATOM   5638 C  CB    . ILE D 1 284 ? -31.726 33.132  -59.468 1.00 21.99  ? 1284 ILE B CB    1 
ATOM   5639 C  CG1   . ILE D 1 284 ? -30.741 33.907  -60.366 1.00 22.26  ? 1284 ILE B CG1   1 
ATOM   5640 C  CG2   . ILE D 1 284 ? -32.928 33.991  -59.058 1.00 21.70  ? 1284 ILE B CG2   1 
ATOM   5641 C  CD1   . ILE D 1 284 ? -31.364 34.350  -61.717 1.00 25.03  ? 1284 ILE B CD1   1 
ATOM   5642 N  N     . HIS D 1 285 ? -28.868 33.551  -57.779 1.00 22.02  ? 1285 HIS B N     1 
ATOM   5643 C  CA    . HIS D 1 285 ? -27.974 34.545  -57.215 1.00 22.19  ? 1285 HIS B CA    1 
ATOM   5644 C  C     . HIS D 1 285 ? -27.161 35.146  -58.338 1.00 22.52  ? 1285 HIS B C     1 
ATOM   5645 O  O     . HIS D 1 285 ? -26.811 34.444  -59.274 1.00 22.29  ? 1285 HIS B O     1 
ATOM   5646 C  CB    . HIS D 1 285 ? -27.040 33.904  -56.202 1.00 22.20  ? 1285 HIS B CB    1 
ATOM   5647 C  CG    . HIS D 1 285 ? -27.722 33.486  -54.946 1.00 23.54  ? 1285 HIS B CG    1 
ATOM   5648 N  ND1   . HIS D 1 285 ? -27.596 34.182  -53.767 1.00 25.57  ? 1285 HIS B ND1   1 
ATOM   5649 C  CD2   . HIS D 1 285 ? -28.547 32.446  -54.687 1.00 23.12  ? 1285 HIS B CD2   1 
ATOM   5650 C  CE1   . HIS D 1 285 ? -28.311 33.585  -52.829 1.00 26.56  ? 1285 HIS B CE1   1 
ATOM   5651 N  NE2   . HIS D 1 285 ? -28.898 32.529  -53.364 1.00 26.35  ? 1285 HIS B NE2   1 
ATOM   5652 N  N     . VAL D 1 286 ? -26.876 36.440  -58.238 1.00 22.67  ? 1286 VAL B N     1 
ATOM   5653 C  CA    . VAL D 1 286 ? -26.001 37.128  -59.184 1.00 22.97  ? 1286 VAL B CA    1 
ATOM   5654 C  C     . VAL D 1 286 ? -24.732 37.528  -58.454 1.00 23.67  ? 1286 VAL B C     1 
ATOM   5655 O  O     . VAL D 1 286 ? -24.793 37.942  -57.307 1.00 23.30  ? 1286 VAL B O     1 
ATOM   5656 C  CB    . VAL D 1 286 ? -26.654 38.404  -59.771 1.00 23.09  ? 1286 VAL B CB    1 
ATOM   5657 C  CG1   . VAL D 1 286 ? -25.712 39.101  -60.770 1.00 22.48  ? 1286 VAL B CG1   1 
ATOM   5658 C  CG2   . VAL D 1 286 ? -27.965 38.068  -60.456 1.00 22.68  ? 1286 VAL B CG2   1 
ATOM   5659 N  N     . VAL D 1 287 ? -23.579 37.410  -59.123 1.00 24.78  ? 1287 VAL B N     1 
ATOM   5660 C  CA    . VAL D 1 287 ? -22.321 37.844  -58.520 1.00 25.01  ? 1287 VAL B CA    1 
ATOM   5661 C  C     . VAL D 1 287 ? -21.674 38.923  -59.368 1.00 26.01  ? 1287 VAL B C     1 
ATOM   5662 O  O     . VAL D 1 287 ? -21.700 38.850  -60.577 1.00 25.05  ? 1287 VAL B O     1 
ATOM   5663 C  CB    . VAL D 1 287 ? -21.322 36.656  -58.322 1.00 25.49  ? 1287 VAL B CB    1 
ATOM   5664 C  CG1   . VAL D 1 287 ? -20.938 36.025  -59.661 1.00 24.51  ? 1287 VAL B CG1   1 
ATOM   5665 C  CG2   . VAL D 1 287 ? -20.087 37.108  -57.549 1.00 23.26  ? 1287 VAL B CG2   1 
ATOM   5666 N  N     . ALA D 1 288 ? -21.099 39.923  -58.717 1.00 28.02  ? 1288 ALA B N     1 
ATOM   5667 C  CA    . ALA D 1 288 ? -20.261 40.890  -59.410 1.00 30.17  ? 1288 ALA B CA    1 
ATOM   5668 C  C     . ALA D 1 288 ? -18.908 40.907  -58.741 1.00 31.78  ? 1288 ALA B C     1 
ATOM   5669 O  O     . ALA D 1 288 ? -18.806 41.023  -57.517 1.00 32.11  ? 1288 ALA B O     1 
ATOM   5670 C  CB    . ALA D 1 288 ? -20.898 42.279  -59.397 1.00 30.09  ? 1288 ALA B CB    1 
ATOM   5671 N  N     . VAL D 1 289 ? -17.863 40.730  -59.539 1.00 33.84  ? 1289 VAL B N     1 
ATOM   5672 C  CA    . VAL D 1 289 ? -16.512 40.900  -59.029 1.00 35.69  ? 1289 VAL B CA    1 
ATOM   5673 C  C     . VAL D 1 289 ? -16.138 42.334  -59.372 1.00 36.79  ? 1289 VAL B C     1 
ATOM   5674 O  O     . VAL D 1 289 ? -16.354 42.784  -60.498 1.00 36.59  ? 1289 VAL B O     1 
ATOM   5675 C  CB    . VAL D 1 289 ? -15.521 39.862  -59.627 1.00 35.78  ? 1289 VAL B CB    1 
ATOM   5676 C  CG1   . VAL D 1 289 ? -14.133 39.974  -58.980 1.00 36.56  ? 1289 VAL B CG1   1 
ATOM   5677 C  CG2   . VAL D 1 289 ? -16.045 38.465  -59.417 1.00 35.41  ? 1289 VAL B CG2   1 
ATOM   5678 N  N     . THR D 1 290 ? -15.623 43.063  -58.386 1.00 38.56  ? 1290 THR B N     1 
ATOM   5679 C  CA    . THR D 1 290 ? -15.217 44.457  -58.599 1.00 40.39  ? 1290 THR B CA    1 
ATOM   5680 C  C     . THR D 1 290 ? -13.760 44.576  -59.053 1.00 41.51  ? 1290 THR B C     1 
ATOM   5681 O  O     . THR D 1 290 ? -13.019 43.586  -59.050 1.00 41.58  ? 1290 THR B O     1 
ATOM   5682 C  CB    . THR D 1 290 ? -15.396 45.298  -57.324 1.00 40.36  ? 1290 THR B CB    1 
ATOM   5683 O  OG1   . THR D 1 290 ? -14.592 44.747  -56.269 1.00 40.13  ? 1290 THR B OG1   1 
ATOM   5684 C  CG2   . THR D 1 290 ? -16.863 45.304  -56.897 1.00 41.18  ? 1290 THR B CG2   1 
ATOM   5685 N  N     . GLU D 1 291 ? -13.365 45.794  -59.431 1.00 42.86  ? 1291 GLU B N     1 
ATOM   5686 C  CA    . GLU D 1 291 ? -11.984 46.120  -59.795 1.00 44.25  ? 1291 GLU B CA    1 
ATOM   5687 C  C     . GLU D 1 291 ? -10.951 45.528  -58.840 1.00 45.04  ? 1291 GLU B C     1 
ATOM   5688 O  O     . GLU D 1 291 ? -9.993  44.884  -59.289 1.00 45.31  ? 1291 GLU B O     1 
ATOM   5689 C  CB    . GLU D 1 291 ? -11.787 47.628  -59.844 1.00 44.49  ? 1291 GLU B CB    1 
ATOM   5690 C  CG    . GLU D 1 291 ? -12.391 48.306  -61.048 1.00 46.03  ? 1291 GLU B CG    1 
ATOM   5691 C  CD    . GLU D 1 291 ? -11.820 49.693  -61.258 1.00 47.98  ? 1291 GLU B CD    1 
ATOM   5692 O  OE1   . GLU D 1 291 ? -11.978 50.547  -60.357 1.00 49.26  ? 1291 GLU B OE1   1 
ATOM   5693 O  OE2   . GLU D 1 291 ? -11.206 49.926  -62.324 1.00 49.01  ? 1291 GLU B OE2   1 
ATOM   5694 N  N     . ASP D 1 292 ? -11.137 45.744  -57.535 1.00 45.68  ? 1292 ASP B N     1 
ATOM   5695 C  CA    . ASP D 1 292 ? -10.193 45.234  -56.535 1.00 46.68  ? 1292 ASP B CA    1 
ATOM   5696 C  C     . ASP D 1 292 ? -10.475 43.781  -56.134 1.00 47.03  ? 1292 ASP B C     1 
ATOM   5697 O  O     . ASP D 1 292 ? -10.173 43.358  -55.007 1.00 47.23  ? 1292 ASP B O     1 
ATOM   5698 C  CB    . ASP D 1 292 ? -10.092 46.161  -55.309 1.00 46.70  ? 1292 ASP B CB    1 
ATOM   5699 C  CG    . ASP D 1 292 ? -11.434 46.405  -54.622 1.00 48.13  ? 1292 ASP B CG    1 
ATOM   5700 O  OD1   . ASP D 1 292 ? -11.519 47.385  -53.848 1.00 49.16  ? 1292 ASP B OD1   1 
ATOM   5701 O  OD2   . ASP D 1 292 ? -12.397 45.634  -54.840 1.00 49.22  ? 1292 ASP B OD2   1 
ATOM   5702 N  N     . LEU D 1 293 ? -11.062 43.036  -57.072 1.00 47.32  ? 1293 LEU B N     1 
ATOM   5703 C  CA    . LEU D 1 293 ? -11.298 41.589  -56.947 1.00 47.57  ? 1293 LEU B CA    1 
ATOM   5704 C  C     . LEU D 1 293 ? -12.239 41.173  -55.814 1.00 47.44  ? 1293 LEU B C     1 
ATOM   5705 O  O     . LEU D 1 293 ? -12.374 39.978  -55.522 1.00 47.91  ? 1293 LEU B O     1 
ATOM   5706 C  CB    . LEU D 1 293 ? -9.969  40.816  -56.876 1.00 47.59  ? 1293 LEU B CB    1 
ATOM   5707 C  CG    . LEU D 1 293 ? -9.368  40.432  -58.233 1.00 48.22  ? 1293 LEU B CG    1 
ATOM   5708 C  CD1   . LEU D 1 293 ? -8.845  41.658  -59.002 1.00 48.00  ? 1293 LEU B CD1   1 
ATOM   5709 C  CD2   . LEU D 1 293 ? -8.273  39.381  -58.068 1.00 47.92  ? 1293 LEU B CD2   1 
ATOM   5710 N  N     . ASP D 1 294 ? -12.894 42.156  -55.196 1.00 46.92  ? 1294 ASP B N     1 
ATOM   5711 C  CA    . ASP D 1 294 ? -13.874 41.908  -54.138 1.00 46.48  ? 1294 ASP B CA    1 
ATOM   5712 C  C     . ASP D 1 294 ? -15.148 41.268  -54.711 1.00 45.44  ? 1294 ASP B C     1 
ATOM   5713 O  O     . ASP D 1 294 ? -15.768 41.796  -55.641 1.00 45.82  ? 1294 ASP B O     1 
ATOM   5714 C  CB    . ASP D 1 294 ? -14.213 43.217  -53.407 1.00 46.71  ? 1294 ASP B CB    1 
ATOM   5715 C  CG    . ASP D 1 294 ? -14.344 43.042  -51.891 1.00 47.82  ? 1294 ASP B CG    1 
ATOM   5716 O  OD1   . ASP D 1 294 ? -13.548 42.270  -51.312 1.00 49.25  ? 1294 ASP B OD1   1 
ATOM   5717 O  OD2   . ASP D 1 294 ? -15.228 43.695  -51.274 1.00 47.96  ? 1294 ASP B OD2   1 
ATOM   5718 N  N     . ILE D 1 295 ? -15.532 40.138  -54.136 1.00 44.00  ? 1295 ILE B N     1 
ATOM   5719 C  CA    . ILE D 1 295 ? -16.703 39.381  -54.575 1.00 42.32  ? 1295 ILE B CA    1 
ATOM   5720 C  C     . ILE D 1 295 ? -17.991 39.866  -53.873 1.00 41.00  ? 1295 ILE B C     1 
ATOM   5721 O  O     . ILE D 1 295 ? -18.097 39.796  -52.648 1.00 41.08  ? 1295 ILE B O     1 
ATOM   5722 C  CB    . ILE D 1 295 ? -16.474 37.863  -54.334 1.00 42.54  ? 1295 ILE B CB    1 
ATOM   5723 C  CG1   . ILE D 1 295 ? -15.125 37.421  -54.937 1.00 42.24  ? 1295 ILE B CG1   1 
ATOM   5724 C  CG2   . ILE D 1 295 ? -17.648 37.041  -54.878 1.00 42.30  ? 1295 ILE B CG2   1 
ATOM   5725 C  CD1   . ILE D 1 295 ? -14.773 35.946  -54.710 1.00 41.72  ? 1295 ILE B CD1   1 
ATOM   5726 N  N     . VAL D 1 296 ? -18.950 40.354  -54.665 1.00 39.14  ? 1296 VAL B N     1 
ATOM   5727 C  CA    . VAL D 1 296 ? -20.241 40.883  -54.182 1.00 37.11  ? 1296 VAL B CA    1 
ATOM   5728 C  C     . VAL D 1 296 ? -21.435 40.139  -54.829 1.00 35.10  ? 1296 VAL B C     1 
ATOM   5729 O  O     . VAL D 1 296 ? -21.464 39.954  -56.052 1.00 35.29  ? 1296 VAL B O     1 
ATOM   5730 C  CB    . VAL D 1 296 ? -20.340 42.416  -54.462 1.00 37.25  ? 1296 VAL B CB    1 
ATOM   5731 C  CG1   . VAL D 1 296 ? -21.784 42.903  -54.471 1.00 37.78  ? 1296 VAL B CG1   1 
ATOM   5732 C  CG2   . VAL D 1 296 ? -19.525 43.203  -53.435 1.00 37.83  ? 1296 VAL B CG2   1 
ATOM   5733 N  N     . SER D 1 297 ? -22.414 39.722  -54.024 1.00 32.17  ? 1297 SER B N     1 
ATOM   5734 C  CA    . SER D 1 297 ? -23.554 38.967  -54.567 1.00 29.60  ? 1297 SER B CA    1 
ATOM   5735 C  C     . SER D 1 297 ? -24.932 39.334  -53.995 1.00 27.79  ? 1297 SER B C     1 
ATOM   5736 O  O     . SER D 1 297 ? -25.054 39.775  -52.845 1.00 27.51  ? 1297 SER B O     1 
ATOM   5737 C  CB    . SER D 1 297 ? -23.318 37.455  -54.423 1.00 29.90  ? 1297 SER B CB    1 
ATOM   5738 O  OG    . SER D 1 297 ? -23.543 37.041  -53.088 1.00 29.03  ? 1297 SER B OG    1 
ATOM   5739 N  N     . ARG D 1 298 ? -25.964 39.122  -54.807 1.00 25.62  ? 1298 ARG B N     1 
ATOM   5740 C  CA    . ARG D 1 298 ? -27.361 39.280  -54.357 1.00 24.26  ? 1298 ARG B CA    1 
ATOM   5741 C  C     . ARG D 1 298 ? -28.192 38.128  -54.899 1.00 23.37  ? 1298 ARG B C     1 
ATOM   5742 O  O     . ARG D 1 298 ? -27.966 37.685  -56.021 1.00 23.18  ? 1298 ARG B O     1 
ATOM   5743 C  CB    . ARG D 1 298 ? -27.957 40.610  -54.839 1.00 23.47  ? 1298 ARG B CB    1 
ATOM   5744 C  CG    . ARG D 1 298 ? -27.328 41.862  -54.239 1.00 23.70  ? 1298 ARG B CG    1 
ATOM   5745 C  CD    . ARG D 1 298 ? -27.514 41.967  -52.740 1.00 24.12  ? 1298 ARG B CD    1 
ATOM   5746 N  NE    . ARG D 1 298 ? -26.950 43.210  -52.217 1.00 26.76  ? 1298 ARG B NE    1 
ATOM   5747 C  CZ    . ARG D 1 298 ? -25.685 43.375  -51.833 1.00 27.21  ? 1298 ARG B CZ    1 
ATOM   5748 N  NH1   . ARG D 1 298 ? -24.820 42.379  -51.914 1.00 25.97  ? 1298 ARG B NH1   1 
ATOM   5749 N  NH2   . ARG D 1 298 ? -25.285 44.555  -51.375 1.00 28.39  ? 1298 ARG B NH2   1 
ATOM   5750 N  N     . GLY D 1 299 ? -29.156 37.653  -54.115 1.00 22.76  ? 1299 GLY B N     1 
ATOM   5751 C  CA    . GLY D 1 299 ? -29.992 36.524  -54.542 1.00 22.16  ? 1299 GLY B CA    1 
ATOM   5752 C  C     . GLY D 1 299 ? -31.463 36.661  -54.185 1.00 22.54  ? 1299 GLY B C     1 
ATOM   5753 O  O     . GLY D 1 299 ? -31.854 37.587  -53.476 1.00 21.45  ? 1299 GLY B O     1 
ATOM   5754 N  N     . ARG D 1 300 ? -32.268 35.727  -54.682 1.00 22.58  ? 1300 ARG B N     1 
ATOM   5755 C  CA    . ARG D 1 300 ? -33.678 35.637  -54.331 1.00 23.65  ? 1300 ARG B CA    1 
ATOM   5756 C  C     . ARG D 1 300 ? -34.123 34.181  -54.395 1.00 23.67  ? 1300 ARG B C     1 
ATOM   5757 O  O     . ARG D 1 300 ? -33.687 33.434  -55.272 1.00 23.34  ? 1300 ARG B O     1 
ATOM   5758 C  CB    . ARG D 1 300 ? -34.536 36.496  -55.268 1.00 23.50  ? 1300 ARG B CB    1 
ATOM   5759 C  CG    . ARG D 1 300 ? -35.980 36.633  -54.803 1.00 25.25  ? 1300 ARG B CG    1 
ATOM   5760 C  CD    . ARG D 1 300 ? -36.778 37.474  -55.748 1.00 27.47  ? 1300 ARG B CD    1 
ATOM   5761 N  NE    . ARG D 1 300 ? -38.147 37.656  -55.271 1.00 28.75  ? 1300 ARG B NE    1 
ATOM   5762 C  CZ    . ARG D 1 300 ? -39.084 38.346  -55.912 1.00 29.00  ? 1300 ARG B CZ    1 
ATOM   5763 N  NH1   . ARG D 1 300 ? -38.822 38.914  -57.078 1.00 27.95  ? 1300 ARG B NH1   1 
ATOM   5764 N  NH2   . ARG D 1 300 ? -40.301 38.456  -55.386 1.00 29.99  ? 1300 ARG B NH2   1 
ATOM   5765 N  N     . THR D 1 301 ? -34.984 33.795  -53.454 1.00 23.91  ? 1301 THR B N     1 
ATOM   5766 C  CA    . THR D 1 301 ? -35.580 32.469  -53.413 1.00 24.22  ? 1301 THR B CA    1 
ATOM   5767 C  C     . THR D 1 301 ? -37.071 32.620  -53.675 1.00 24.57  ? 1301 THR B C     1 
ATOM   5768 O  O     . THR D 1 301 ? -37.702 33.533  -53.160 1.00 24.64  ? 1301 THR B O     1 
ATOM   5769 C  CB    . THR D 1 301 ? -35.341 31.807  -52.037 1.00 24.41  ? 1301 THR B CB    1 
ATOM   5770 O  OG1   . THR D 1 301 ? -33.935 31.657  -51.841 1.00 24.35  ? 1301 THR B OG1   1 
ATOM   5771 C  CG2   . THR D 1 301 ? -36.016 30.426  -51.935 1.00 23.93  ? 1301 THR B CG2   1 
ATOM   5772 N  N     . PHE D 1 302 ? -37.619 31.743  -54.504 1.00 25.14  ? 1302 PHE B N     1 
ATOM   5773 C  CA    . PHE D 1 302 ? -39.039 31.782  -54.841 1.00 26.01  ? 1302 PHE B CA    1 
ATOM   5774 C  C     . PHE D 1 302 ? -39.735 30.568  -54.249 1.00 26.03  ? 1302 PHE B C     1 
ATOM   5775 O  O     . PHE D 1 302 ? -39.090 29.531  -54.066 1.00 26.11  ? 1302 PHE B O     1 
ATOM   5776 C  CB    . PHE D 1 302 ? -39.232 31.780  -56.356 1.00 26.07  ? 1302 PHE B CB    1 
ATOM   5777 C  CG    . PHE D 1 302 ? -38.661 32.981  -57.042 1.00 28.50  ? 1302 PHE B CG    1 
ATOM   5778 C  CD1   . PHE D 1 302 ? -37.318 33.015  -57.409 1.00 29.00  ? 1302 PHE B CD1   1 
ATOM   5779 C  CD2   . PHE D 1 302 ? -39.464 34.082  -57.324 1.00 29.72  ? 1302 PHE B CD2   1 
ATOM   5780 C  CE1   . PHE D 1 302 ? -36.782 34.133  -58.047 1.00 30.28  ? 1302 PHE B CE1   1 
ATOM   5781 C  CE2   . PHE D 1 302 ? -38.934 35.206  -57.968 1.00 30.89  ? 1302 PHE B CE2   1 
ATOM   5782 C  CZ    . PHE D 1 302 ? -37.597 35.227  -58.330 1.00 31.42  ? 1302 PHE B CZ    1 
ATOM   5783 N  N     . PRO D 1 303 ? -41.055 30.679  -53.978 1.00 26.36  ? 1303 PRO B N     1 
ATOM   5784 C  CA    . PRO D 1 303 ? -41.805 29.511  -53.512 1.00 26.61  ? 1303 PRO B CA    1 
ATOM   5785 C  C     . PRO D 1 303 ? -41.862 28.380  -54.543 1.00 26.71  ? 1303 PRO B C     1 
ATOM   5786 O  O     . PRO D 1 303 ? -42.103 27.226  -54.180 1.00 27.38  ? 1303 PRO B O     1 
ATOM   5787 C  CB    . PRO D 1 303 ? -43.212 30.063  -53.226 1.00 26.68  ? 1303 PRO B CB    1 
ATOM   5788 C  CG    . PRO D 1 303 ? -43.294 31.354  -53.947 1.00 26.96  ? 1303 PRO B CG    1 
ATOM   5789 C  CD    . PRO D 1 303 ? -41.894 31.891  -54.045 1.00 26.09  ? 1303 PRO B CD    1 
ATOM   5790 N  N     A HIS D 1 304 ? -41.652 28.715  -55.815 0.50 26.46  ? 1304 HIS B N     1 
ATOM   5791 N  N     B HIS D 1 304 ? -41.590 28.714  -55.802 0.50 26.20  ? 1304 HIS B N     1 
ATOM   5792 C  CA    A HIS D 1 304 ? -41.723 27.744  -56.899 0.50 26.18  ? 1304 HIS B CA    1 
ATOM   5793 C  CA    B HIS D 1 304 ? -41.708 27.784  -56.912 0.50 25.70  ? 1304 HIS B CA    1 
ATOM   5794 C  C     A HIS D 1 304 ? -40.495 27.876  -57.804 0.50 26.07  ? 1304 HIS B C     1 
ATOM   5795 C  C     B HIS D 1 304 ? -40.447 27.839  -57.772 0.50 25.81  ? 1304 HIS B C     1 
ATOM   5796 O  O     A HIS D 1 304 ? -39.648 28.748  -57.588 0.50 26.02  ? 1304 HIS B O     1 
ATOM   5797 O  O     B HIS D 1 304 ? -39.531 28.620  -57.494 0.50 25.79  ? 1304 HIS B O     1 
ATOM   5798 C  CB    A HIS D 1 304 ? -43.012 27.943  -57.717 0.50 26.22  ? 1304 HIS B CB    1 
ATOM   5799 C  CB    B HIS D 1 304 ? -42.927 28.169  -57.756 0.50 25.49  ? 1304 HIS B CB    1 
ATOM   5800 C  CG    A HIS D 1 304 ? -44.274 27.848  -56.912 0.50 26.63  ? 1304 HIS B CG    1 
ATOM   5801 C  CG    B HIS D 1 304 ? -42.908 29.595  -58.210 0.50 24.51  ? 1304 HIS B CG    1 
ATOM   5802 N  ND1   A HIS D 1 304 ? -44.669 26.690  -56.276 0.50 26.91  ? 1304 HIS B ND1   1 
ATOM   5803 N  ND1   B HIS D 1 304 ? -43.656 30.582  -57.604 0.50 24.62  ? 1304 HIS B ND1   1 
ATOM   5804 C  CD2   A HIS D 1 304 ? -45.244 28.761  -56.665 0.50 26.81  ? 1304 HIS B CD2   1 
ATOM   5805 C  CD2   B HIS D 1 304 ? -42.216 30.203  -59.202 0.50 23.44  ? 1304 HIS B CD2   1 
ATOM   5806 C  CE1   A HIS D 1 304 ? -45.821 26.898  -55.660 0.50 26.25  ? 1304 HIS B CE1   1 
ATOM   5807 C  CE1   B HIS D 1 304 ? -43.432 31.735  -58.210 0.50 24.37  ? 1304 HIS B CE1   1 
ATOM   5808 N  NE2   A HIS D 1 304 ? -46.191 28.147  -55.880 0.50 26.58  ? 1304 HIS B NE2   1 
ATOM   5809 N  NE2   B HIS D 1 304 ? -42.556 31.533  -59.178 0.50 24.08  ? 1304 HIS B NE2   1 
ATOM   5810 N  N     . GLY D 1 305 ? -40.407 27.002  -58.808 1.00 25.91  ? 1305 GLY B N     1 
ATOM   5811 C  CA    . GLY D 1 305 ? -39.305 27.005  -59.784 1.00 25.31  ? 1305 GLY B CA    1 
ATOM   5812 C  C     . GLY D 1 305 ? -39.188 28.264  -60.627 1.00 25.28  ? 1305 GLY B C     1 
ATOM   5813 O  O     . GLY D 1 305 ? -40.161 28.989  -60.840 1.00 24.99  ? 1305 GLY B O     1 
ATOM   5814 N  N     . ILE D 1 306 ? -37.979 28.503  -61.120 1.00 24.78  ? 1306 ILE B N     1 
ATOM   5815 C  CA    . ILE D 1 306 ? -37.641 29.694  -61.876 1.00 24.77  ? 1306 ILE B CA    1 
ATOM   5816 C  C     . ILE D 1 306 ? -37.499 29.260  -63.316 1.00 24.81  ? 1306 ILE B C     1 
ATOM   5817 O  O     . ILE D 1 306 ? -36.605 28.455  -63.647 1.00 24.47  ? 1306 ILE B O     1 
ATOM   5818 C  CB    . ILE D 1 306 ? -36.254 30.285  -61.411 1.00 24.67  ? 1306 ILE B CB    1 
ATOM   5819 C  CG1   . ILE D 1 306 ? -36.295 30.672  -59.930 1.00 25.49  ? 1306 ILE B CG1   1 
ATOM   5820 C  CG2   . ILE D 1 306 ? -35.840 31.480  -62.241 1.00 23.86  ? 1306 ILE B CG2   1 
ATOM   5821 C  CD1   . ILE D 1 306 ? -34.914 30.750  -59.280 1.00 26.87  ? 1306 ILE B CD1   1 
ATOM   5822 N  N     . SER D 1 307 ? -38.357 29.799  -64.174 1.00 24.86  ? 1307 SER B N     1 
ATOM   5823 C  CA    . SER D 1 307 ? -38.157 29.658  -65.615 1.00 25.68  ? 1307 SER B CA    1 
ATOM   5824 C  C     . SER D 1 307 ? -37.000 30.557  -66.096 1.00 26.27  ? 1307 SER B C     1 
ATOM   5825 O  O     . SER D 1 307 ? -36.541 31.458  -65.385 1.00 25.31  ? 1307 SER B O     1 
ATOM   5826 C  CB    . SER D 1 307 ? -39.444 29.963  -66.389 1.00 24.97  ? 1307 SER B CB    1 
ATOM   5827 O  OG    . SER D 1 307 ? -39.699 31.351  -66.385 1.00 23.97  ? 1307 SER B OG    1 
ATOM   5828 N  N     . LYS D 1 308 ? -36.546 30.320  -67.319 1.00 28.21  ? 1308 LYS B N     1 
ATOM   5829 C  CA    . LYS D 1 308 ? -35.478 31.124  -67.909 1.00 29.18  ? 1308 LYS B CA    1 
ATOM   5830 C  C     . LYS D 1 308 ? -35.912 32.603  -68.018 1.00 29.67  ? 1308 LYS B C     1 
ATOM   5831 O  O     . LYS D 1 308 ? -35.136 33.510  -67.684 1.00 29.63  ? 1308 LYS B O     1 
ATOM   5832 C  CB    . LYS D 1 308 ? -35.080 30.526  -69.258 1.00 29.95  ? 1308 LYS B CB    1 
ATOM   5833 C  CG    . LYS D 1 308 ? -33.726 30.993  -69.821 1.00 32.12  ? 1308 LYS B CG    1 
ATOM   5834 C  CD    . LYS D 1 308 ? -32.951 29.821  -70.469 1.00 35.81  ? 1308 LYS B CD    1 
ATOM   5835 C  CE    . LYS D 1 308 ? -33.610 29.295  -71.751 1.00 37.93  ? 1308 LYS B CE    1 
ATOM   5836 N  NZ    . LYS D 1 308 ? -32.745 29.510  -72.941 1.00 38.87  ? 1308 LYS B NZ    1 
ATOM   5837 N  N     . GLU D 1 309 ? -37.165 32.831  -68.427 1.00 29.73  ? 1309 GLU B N     1 
ATOM   5838 C  CA    . GLU D 1 309 ? -37.726 34.185  -68.536 1.00 30.03  ? 1309 GLU B CA    1 
ATOM   5839 C  C     . GLU D 1 309 ? -37.575 34.940  -67.219 1.00 29.32  ? 1309 GLU B C     1 
ATOM   5840 O  O     . GLU D 1 309 ? -36.946 36.005  -67.168 1.00 29.44  ? 1309 GLU B O     1 
ATOM   5841 C  CB    . GLU D 1 309 ? -39.204 34.145  -68.977 1.00 30.45  ? 1309 GLU B CB    1 
ATOM   5842 C  CG    . GLU D 1 309 ? -39.408 33.753  -70.443 1.00 33.05  ? 1309 GLU B CG    1 
ATOM   5843 C  CD    . GLU D 1 309 ? -38.709 32.437  -70.812 1.00 37.06  ? 1309 GLU B CD    1 
ATOM   5844 O  OE1   . GLU D 1 309 ? -38.930 31.404  -70.118 1.00 35.60  ? 1309 GLU B OE1   1 
ATOM   5845 O  OE2   . GLU D 1 309 ? -37.921 32.454  -71.789 1.00 38.82  ? 1309 GLU B OE2   1 
ATOM   5846 N  N     . THR D 1 310 ? -38.118 34.349  -66.159 1.00 28.58  ? 1310 THR B N     1 
ATOM   5847 C  CA    . THR D 1 310 ? -38.020 34.888  -64.803 1.00 28.40  ? 1310 THR B CA    1 
ATOM   5848 C  C     . THR D 1 310 ? -36.550 35.152  -64.388 1.00 27.87  ? 1310 THR B C     1 
ATOM   5849 O  O     . THR D 1 310 ? -36.227 36.215  -63.835 1.00 27.60  ? 1310 THR B O     1 
ATOM   5850 C  CB    . THR D 1 310 ? -38.749 33.958  -63.802 1.00 28.31  ? 1310 THR B CB    1 
ATOM   5851 O  OG1   . THR D 1 310 ? -40.117 33.795  -64.219 1.00 29.28  ? 1310 THR B OG1   1 
ATOM   5852 C  CG2   . THR D 1 310 ? -38.719 34.537  -62.395 1.00 29.25  ? 1310 THR B CG2   1 
ATOM   5853 N  N     . ALA D 1 311 ? -35.666 34.206  -64.689 1.00 27.48  ? 1311 ALA B N     1 
ATOM   5854 C  CA    . ALA D 1 311 ? -34.230 34.388  -64.399 1.00 27.88  ? 1311 ALA B CA    1 
ATOM   5855 C  C     . ALA D 1 311 ? -33.706 35.730  -64.934 1.00 27.92  ? 1311 ALA B C     1 
ATOM   5856 O  O     . ALA D 1 311 ? -33.111 36.513  -64.185 1.00 27.25  ? 1311 ALA B O     1 
ATOM   5857 C  CB    . ALA D 1 311 ? -33.423 33.214  -64.911 1.00 27.43  ? 1311 ALA B CB    1 
ATOM   5858 N  N     . TYR D 1 312 ? -34.000 36.020  -66.203 1.00 29.02  ? 1312 TYR B N     1 
ATOM   5859 C  CA    . TYR D 1 312 ? -33.612 37.283  -66.828 1.00 29.99  ? 1312 TYR B CA    1 
ATOM   5860 C  C     . TYR D 1 312 ? -33.971 38.510  -65.995 1.00 29.63  ? 1312 TYR B C     1 
ATOM   5861 O  O     . TYR D 1 312 ? -33.076 39.237  -65.549 1.00 29.35  ? 1312 TYR B O     1 
ATOM   5862 C  CB    . TYR D 1 312 ? -34.204 37.416  -68.241 1.00 31.26  ? 1312 TYR B CB    1 
ATOM   5863 C  CG    . TYR D 1 312 ? -33.546 36.526  -69.276 1.00 34.72  ? 1312 TYR B CG    1 
ATOM   5864 C  CD1   . TYR D 1 312 ? -32.208 36.698  -69.616 1.00 39.08  ? 1312 TYR B CD1   1 
ATOM   5865 C  CD2   . TYR D 1 312 ? -34.267 35.527  -69.926 1.00 37.99  ? 1312 TYR B CD2   1 
ATOM   5866 C  CE1   . TYR D 1 312 ? -31.601 35.889  -70.564 1.00 41.90  ? 1312 TYR B CE1   1 
ATOM   5867 C  CE2   . TYR D 1 312 ? -33.672 34.714  -70.879 1.00 40.51  ? 1312 TYR B CE2   1 
ATOM   5868 C  CZ    . TYR D 1 312 ? -32.339 34.901  -71.193 1.00 42.23  ? 1312 TYR B CZ    1 
ATOM   5869 O  OH    . TYR D 1 312 ? -31.727 34.107  -72.133 1.00 44.62  ? 1312 TYR B OH    1 
ATOM   5870 N  N     . SER D 1 313 ? -35.269 38.728  -65.772 1.00 29.18  ? 1313 SER B N     1 
ATOM   5871 C  CA    . SER D 1 313 ? -35.717 39.936  -65.103 1.00 29.17  ? 1313 SER B CA    1 
ATOM   5872 C  C     . SER D 1 313 ? -35.288 39.979  -63.646 1.00 29.15  ? 1313 SER B C     1 
ATOM   5873 O  O     . SER D 1 313 ? -34.929 41.043  -63.127 1.00 29.41  ? 1313 SER B O     1 
ATOM   5874 C  CB    . SER D 1 313 ? -37.231 40.170  -65.277 1.00 28.92  ? 1313 SER B CB    1 
ATOM   5875 O  OG    . SER D 1 313 ? -37.983 39.042  -64.857 1.00 29.12  ? 1313 SER B OG    1 
ATOM   5876 N  N     . GLU D 1 314 ? -35.289 38.823  -62.987 1.00 29.30  ? 1314 GLU B N     1 
ATOM   5877 C  CA    . GLU D 1 314 ? -34.813 38.777  -61.603 1.00 29.11  ? 1314 GLU B CA    1 
ATOM   5878 C  C     . GLU D 1 314 ? -33.317 39.140  -61.494 1.00 28.11  ? 1314 GLU B C     1 
ATOM   5879 O  O     . GLU D 1 314 ? -32.915 39.895  -60.609 1.00 28.09  ? 1314 GLU B O     1 
ATOM   5880 C  CB    . GLU D 1 314 ? -35.131 37.434  -60.937 1.00 29.41  ? 1314 GLU B CB    1 
ATOM   5881 C  CG    . GLU D 1 314 ? -34.939 37.470  -59.416 1.00 31.69  ? 1314 GLU B CG    1 
ATOM   5882 C  CD    . GLU D 1 314 ? -35.704 38.621  -58.749 1.00 34.85  ? 1314 GLU B CD    1 
ATOM   5883 O  OE1   . GLU D 1 314 ? -35.067 39.397  -57.985 1.00 35.67  ? 1314 GLU B OE1   1 
ATOM   5884 O  OE2   . GLU D 1 314 ? -36.931 38.754  -58.997 1.00 32.18  ? 1314 GLU B OE2   1 
ATOM   5885 N  N     . SER D 1 315 ? -32.510 38.659  -62.424 1.00 27.51  ? 1315 SER B N     1 
ATOM   5886 C  CA    . SER D 1 315 ? -31.073 38.989  -62.421 1.00 26.90  ? 1315 SER B CA    1 
ATOM   5887 C  C     . SER D 1 315 ? -30.767 40.497  -62.534 1.00 25.86  ? 1315 SER B C     1 
ATOM   5888 O  O     . SER D 1 315 ? -29.834 41.011  -61.898 1.00 24.79  ? 1315 SER B O     1 
ATOM   5889 C  CB    . SER D 1 315 ? -30.364 38.222  -63.522 1.00 27.54  ? 1315 SER B CB    1 
ATOM   5890 O  OG    . SER D 1 315 ? -30.690 38.771  -64.778 1.00 30.07  ? 1315 SER B OG    1 
ATOM   5891 N  N     . VAL D 1 316 ? -31.582 41.210  -63.313 1.00 25.43  ? 1316 VAL B N     1 
ATOM   5892 C  CA    . VAL D 1 316 ? -31.399 42.652  -63.495 1.00 24.14  ? 1316 VAL B CA    1 
ATOM   5893 C  C     . VAL D 1 316 ? -31.541 43.371  -62.157 1.00 24.29  ? 1316 VAL B C     1 
ATOM   5894 O  O     . VAL D 1 316 ? -30.695 44.210  -61.795 1.00 23.84  ? 1316 VAL B O     1 
ATOM   5895 C  CB    . VAL D 1 316 ? -32.352 43.202  -64.555 1.00 24.61  ? 1316 VAL B CB    1 
ATOM   5896 C  CG1   . VAL D 1 316 ? -32.253 44.724  -64.635 1.00 24.56  ? 1316 VAL B CG1   1 
ATOM   5897 C  CG2   . VAL D 1 316 ? -32.038 42.567  -65.907 1.00 24.07  ? 1316 VAL B CG2   1 
ATOM   5898 N  N     . LYS D 1 317 ? -32.576 42.988  -61.404 1.00 24.06  ? 1317 LYS B N     1 
ATOM   5899 C  CA    . LYS D 1 317 ? -32.876 43.617  -60.143 1.00 24.45  ? 1317 LYS B CA    1 
ATOM   5900 C  C     . LYS D 1 317 ? -31.782 43.366  -59.126 1.00 24.85  ? 1317 LYS B C     1 
ATOM   5901 O  O     . LYS D 1 317 ? -31.373 44.289  -58.404 1.00 24.85  ? 1317 LYS B O     1 
ATOM   5902 C  CB    . LYS D 1 317 ? -34.258 43.188  -59.631 1.00 24.48  ? 1317 LYS B CB    1 
ATOM   5903 C  CG    . LYS D 1 317 ? -35.406 43.774  -60.455 1.00 23.90  ? 1317 LYS B CG    1 
ATOM   5904 C  CD    . LYS D 1 317 ? -36.782 43.384  -59.893 1.00 24.08  ? 1317 LYS B CD    1 
ATOM   5905 C  CE    . LYS D 1 317 ? -37.271 42.043  -60.427 1.00 23.90  ? 1317 LYS B CE    1 
ATOM   5906 N  NZ    . LYS D 1 317 ? -38.233 41.427  -59.486 1.00 25.02  ? 1317 LYS B NZ    1 
ATOM   5907 N  N     . LEU D 1 318 ? -31.280 42.127  -59.099 1.00 25.59  ? 1318 LEU B N     1 
ATOM   5908 C  CA    . LEU D 1 318 ? -30.188 41.755  -58.206 1.00 25.81  ? 1318 LEU B CA    1 
ATOM   5909 C  C     . LEU D 1 318 ? -28.951 42.582  -58.554 1.00 25.96  ? 1318 LEU B C     1 
ATOM   5910 O  O     . LEU D 1 318 ? -28.284 43.132  -57.672 1.00 26.12  ? 1318 LEU B O     1 
ATOM   5911 C  CB    . LEU D 1 318 ? -29.923 40.232  -58.264 1.00 25.28  ? 1318 LEU B CB    1 
ATOM   5912 C  CG    . LEU D 1 318 ? -31.137 39.395  -57.819 1.00 25.91  ? 1318 LEU B CG    1 
ATOM   5913 C  CD1   . LEU D 1 318 ? -31.084 37.943  -58.288 1.00 26.86  ? 1318 LEU B CD1   1 
ATOM   5914 C  CD2   . LEU D 1 318 ? -31.341 39.467  -56.318 1.00 25.76  ? 1318 LEU B CD2   1 
ATOM   5915 N  N     . LEU D 1 319 ? -28.666 42.685  -59.840 1.00 26.59  ? 1319 LEU B N     1 
ATOM   5916 C  CA    . LEU D 1 319 ? -27.561 43.511  -60.314 1.00 28.32  ? 1319 LEU B CA    1 
ATOM   5917 C  C     . LEU D 1 319 ? -27.764 44.999  -59.945 1.00 29.37  ? 1319 LEU B C     1 
ATOM   5918 O  O     . LEU D 1 319 ? -26.844 45.663  -59.445 1.00 29.69  ? 1319 LEU B O     1 
ATOM   5919 C  CB    . LEU D 1 319 ? -27.371 43.314  -61.820 1.00 28.08  ? 1319 LEU B CB    1 
ATOM   5920 C  CG    . LEU D 1 319 ? -26.382 44.208  -62.579 1.00 28.58  ? 1319 LEU B CG    1 
ATOM   5921 C  CD1   . LEU D 1 319 ? -24.945 44.019  -62.106 1.00 28.21  ? 1319 LEU B CD1   1 
ATOM   5922 C  CD2   . LEU D 1 319 ? -26.510 43.915  -64.052 1.00 28.02  ? 1319 LEU B CD2   1 
ATOM   5923 N  N     . GLN D 1 320 ? -28.978 45.510  -60.141 1.00 30.61  ? 1320 GLN B N     1 
ATOM   5924 C  CA    . GLN D 1 320 ? -29.256 46.888  -59.757 1.00 31.14  ? 1320 GLN B CA    1 
ATOM   5925 C  C     . GLN D 1 320 ? -29.014 47.093  -58.264 1.00 31.99  ? 1320 GLN B C     1 
ATOM   5926 O  O     . GLN D 1 320 ? -28.462 48.112  -57.850 1.00 32.22  ? 1320 GLN B O     1 
ATOM   5927 C  CB    . GLN D 1 320 ? -30.673 47.270  -60.126 1.00 31.54  ? 1320 GLN B CB    1 
ATOM   5928 C  CG    . GLN D 1 320 ? -30.950 47.270  -61.615 1.00 31.65  ? 1320 GLN B CG    1 
ATOM   5929 C  CD    . GLN D 1 320 ? -32.382 47.661  -61.901 1.00 33.18  ? 1320 GLN B CD    1 
ATOM   5930 O  OE1   . GLN D 1 320 ? -33.316 47.039  -61.401 1.00 33.59  ? 1320 GLN B OE1   1 
ATOM   5931 N  NE2   . GLN D 1 320 ? -32.563 48.706  -62.695 1.00 32.76  ? 1320 GLN B NE2   1 
ATOM   5932 N  N     . LYS D 1 321 ? -29.403 46.112  -57.458 1.00 32.56  ? 1321 LYS B N     1 
ATOM   5933 C  CA    . LYS D 1 321 ? -29.181 46.200  -56.024 1.00 33.87  ? 1321 LYS B CA    1 
ATOM   5934 C  C     . LYS D 1 321 ? -27.679 46.277  -55.713 1.00 34.53  ? 1321 LYS B C     1 
ATOM   5935 O  O     . LYS D 1 321 ? -27.266 47.037  -54.827 1.00 34.55  ? 1321 LYS B O     1 
ATOM   5936 C  CB    . LYS D 1 321 ? -29.862 45.036  -55.294 1.00 33.79  ? 1321 LYS B CB    1 
ATOM   5937 C  CG    . LYS D 1 321 ? -29.893 45.165  -53.776 1.00 35.11  ? 1321 LYS B CG    1 
ATOM   5938 C  CD    . LYS D 1 321 ? -30.757 44.079  -53.136 1.00 36.43  ? 1321 LYS B CD    1 
ATOM   5939 C  CE    . LYS D 1 321 ? -30.828 44.240  -51.623 1.00 36.83  ? 1321 LYS B CE    1 
ATOM   5940 N  NZ    . LYS D 1 321 ? -31.967 43.475  -51.021 1.00 36.98  ? 1321 LYS B NZ    1 
ATOM   5941 N  N     . ILE D 1 322 ? -26.879 45.504  -56.455 1.00 35.28  ? 1322 ILE B N     1 
ATOM   5942 C  CA    . ILE D 1 322 ? -25.420 45.530  -56.333 1.00 36.01  ? 1322 ILE B CA    1 
ATOM   5943 C  C     . ILE D 1 322 ? -24.912 46.920  -56.704 1.00 37.12  ? 1322 ILE B C     1 
ATOM   5944 O  O     . ILE D 1 322 ? -24.127 47.523  -55.963 1.00 37.55  ? 1322 ILE B O     1 
ATOM   5945 C  CB    . ILE D 1 322 ? -24.737 44.444  -57.226 1.00 35.71  ? 1322 ILE B CB    1 
ATOM   5946 C  CG1   . ILE D 1 322 ? -25.023 43.040  -56.694 1.00 34.44  ? 1322 ILE B CG1   1 
ATOM   5947 C  CG2   . ILE D 1 322 ? -23.233 44.684  -57.331 1.00 35.15  ? 1322 ILE B CG2   1 
ATOM   5948 C  CD1   . ILE D 1 322 ? -24.605 41.924  -57.633 1.00 32.78  ? 1322 ILE B CD1   1 
ATOM   5949 N  N     . LEU D 1 323 ? -25.386 47.416  -57.844 1.00 38.14  ? 1323 LEU B N     1 
ATOM   5950 C  CA    . LEU D 1 323 ? -25.062 48.748  -58.336 1.00 39.93  ? 1323 LEU B CA    1 
ATOM   5951 C  C     . LEU D 1 323 ? -25.339 49.843  -57.301 1.00 41.09  ? 1323 LEU B C     1 
ATOM   5952 O  O     . LEU D 1 323 ? -24.479 50.687  -57.045 1.00 41.32  ? 1323 LEU B O     1 
ATOM   5953 C  CB    . LEU D 1 323 ? -25.847 49.038  -59.626 1.00 39.74  ? 1323 LEU B CB    1 
ATOM   5954 C  CG    . LEU D 1 323 ? -25.239 48.738  -61.007 1.00 39.86  ? 1323 LEU B CG    1 
ATOM   5955 C  CD1   . LEU D 1 323 ? -24.004 47.874  -60.970 1.00 39.86  ? 1323 LEU B CD1   1 
ATOM   5956 C  CD2   . LEU D 1 323 ? -26.282 48.167  -61.955 1.00 39.60  ? 1323 LEU B CD2   1 
ATOM   5957 N  N     . GLU D 1 324 ? -26.527 49.821  -56.700 1.00 42.22  ? 1324 GLU B N     1 
ATOM   5958 C  CA    . GLU D 1 324 ? -26.939 50.910  -55.817 1.00 43.58  ? 1324 GLU B CA    1 
ATOM   5959 C  C     . GLU D 1 324 ? -26.450 50.763  -54.370 1.00 44.45  ? 1324 GLU B C     1 
ATOM   5960 O  O     . GLU D 1 324 ? -26.776 51.587  -53.514 1.00 44.65  ? 1324 GLU B O     1 
ATOM   5961 C  CB    . GLU D 1 324 ? -28.459 51.123  -55.877 1.00 43.56  ? 1324 GLU B CB    1 
ATOM   5962 C  CG    . GLU D 1 324 ? -28.978 51.433  -57.286 1.00 44.15  ? 1324 GLU B CG    1 
ATOM   5963 C  CD    . GLU D 1 324 ? -29.984 52.578  -57.330 1.00 43.94  ? 1324 GLU B CD    1 
ATOM   5964 O  OE1   . GLU D 1 324 ? -30.577 52.803  -58.408 1.00 42.84  ? 1324 GLU B OE1   1 
ATOM   5965 O  OE2   . GLU D 1 324 ? -30.178 53.257  -56.296 1.00 44.45  ? 1324 GLU B OE2   1 
ATOM   5966 N  N     . GLU D 1 325 ? -25.656 49.725  -54.108 1.00 45.51  ? 1325 GLU B N     1 
ATOM   5967 C  CA    . GLU D 1 325 ? -25.109 49.476  -52.767 1.00 46.59  ? 1325 GLU B CA    1 
ATOM   5968 C  C     . GLU D 1 325 ? -23.575 49.382  -52.763 1.00 47.27  ? 1325 GLU B C     1 
ATOM   5969 O  O     . GLU D 1 325 ? -22.956 49.264  -51.703 1.00 47.54  ? 1325 GLU B O     1 
ATOM   5970 C  CB    . GLU D 1 325 ? -25.743 48.222  -52.143 1.00 46.47  ? 1325 GLU B CB    1 
ATOM   5971 C  CG    . GLU D 1 325 ? -27.202 48.417  -51.708 1.00 47.03  ? 1325 GLU B CG    1 
ATOM   5972 C  CD    . GLU D 1 325 ? -27.915 47.122  -51.302 1.00 47.74  ? 1325 GLU B CD    1 
ATOM   5973 O  OE1   . GLU D 1 325 ? -27.382 46.011  -51.534 1.00 47.65  ? 1325 GLU B OE1   1 
ATOM   5974 O  OE2   . GLU D 1 325 ? -29.032 47.220  -50.750 1.00 47.50  ? 1325 GLU B OE2   1 
ATOM   5975 N  N     . ASP D 1 326 ? -22.975 49.433  -53.951 1.00 48.05  ? 1326 ASP B N     1 
ATOM   5976 C  CA    . ASP D 1 326 ? -21.520 49.459  -54.101 1.00 48.69  ? 1326 ASP B CA    1 
ATOM   5977 C  C     . ASP D 1 326 ? -21.144 50.454  -55.196 1.00 48.82  ? 1326 ASP B C     1 
ATOM   5978 O  O     . ASP D 1 326 ? -21.636 50.353  -56.324 1.00 48.89  ? 1326 ASP B O     1 
ATOM   5979 C  CB    . ASP D 1 326 ? -20.991 48.064  -54.444 1.00 49.02  ? 1326 ASP B CB    1 
ATOM   5980 C  CG    . ASP D 1 326 ? -19.488 47.952  -54.276 1.00 50.07  ? 1326 ASP B CG    1 
ATOM   5981 O  OD1   . ASP D 1 326 ? -18.768 48.032  -55.290 1.00 51.14  ? 1326 ASP B OD1   1 
ATOM   5982 O  OD2   . ASP D 1 326 ? -19.023 47.793  -53.128 1.00 51.40  ? 1326 ASP B OD2   1 
ATOM   5983 N  N     . GLU D 1 327 ? -20.286 51.417  -54.854 1.00 48.86  ? 1327 GLU B N     1 
ATOM   5984 C  CA    . GLU D 1 327 ? -19.876 52.475  -55.789 1.00 48.92  ? 1327 GLU B CA    1 
ATOM   5985 C  C     . GLU D 1 327 ? -18.776 52.050  -56.761 1.00 48.63  ? 1327 GLU B C     1 
ATOM   5986 O  O     . GLU D 1 327 ? -18.464 52.787  -57.702 1.00 48.84  ? 1327 GLU B O     1 
ATOM   5987 C  CB    . GLU D 1 327 ? -19.423 53.730  -55.036 1.00 49.04  ? 1327 GLU B CB    1 
ATOM   5988 C  CG    . GLU D 1 327 ? -20.540 54.711  -54.707 1.00 50.02  ? 1327 GLU B CG    1 
ATOM   5989 C  CD    . GLU D 1 327 ? -21.100 54.523  -53.309 1.00 51.14  ? 1327 GLU B CD    1 
ATOM   5990 O  OE1   . GLU D 1 327 ? -21.274 53.364  -52.876 1.00 52.29  ? 1327 GLU B OE1   1 
ATOM   5991 O  OE2   . GLU D 1 327 ? -21.372 55.541  -52.640 1.00 51.81  ? 1327 GLU B OE2   1 
ATOM   5992 N  N     . ARG D 1 328 ? -18.196 50.872  -56.530 1.00 48.17  ? 1328 ARG B N     1 
ATOM   5993 C  CA    . ARG D 1 328 ? -17.076 50.367  -57.332 1.00 47.48  ? 1328 ARG B CA    1 
ATOM   5994 C  C     . ARG D 1 328 ? -17.513 49.903  -58.726 1.00 46.98  ? 1328 ARG B C     1 
ATOM   5995 O  O     . ARG D 1 328 ? -18.687 49.621  -58.953 1.00 47.14  ? 1328 ARG B O     1 
ATOM   5996 C  CB    . ARG D 1 328 ? -16.351 49.242  -56.585 1.00 47.31  ? 1328 ARG B CB    1 
ATOM   5997 C  CG    . ARG D 1 328 ? -15.750 49.673  -55.253 1.00 47.25  ? 1328 ARG B CG    1 
ATOM   5998 C  CD    . ARG D 1 328 ? -15.041 48.529  -54.557 1.00 47.17  ? 1328 ARG B CD    1 
ATOM   5999 N  NE    . ARG D 1 328 ? -15.967 47.655  -53.841 1.00 47.16  ? 1328 ARG B NE    1 
ATOM   6000 C  CZ    . ARG D 1 328 ? -15.595 46.631  -53.073 1.00 48.17  ? 1328 ARG B CZ    1 
ATOM   6001 N  NH1   . ARG D 1 328 ? -14.308 46.343  -52.911 1.00 48.58  ? 1328 ARG B NH1   1 
ATOM   6002 N  NH2   . ARG D 1 328 ? -16.507 45.889  -52.461 1.00 48.16  ? 1328 ARG B NH2   1 
ATOM   6003 N  N     . LYS D 1 329 ? -16.559 49.840  -59.652 1.00 46.46  ? 1329 LYS B N     1 
ATOM   6004 C  CA    . LYS D 1 329 ? -16.796 49.352  -61.018 1.00 45.62  ? 1329 LYS B CA    1 
ATOM   6005 C  C     . LYS D 1 329 ? -16.742 47.817  -61.050 1.00 44.84  ? 1329 LYS B C     1 
ATOM   6006 O  O     . LYS D 1 329 ? -16.159 47.197  -60.150 1.00 45.15  ? 1329 LYS B O     1 
ATOM   6007 C  CB    . LYS D 1 329 ? -15.764 49.959  -61.978 1.00 45.87  ? 1329 LYS B CB    1 
ATOM   6008 C  CG    . LYS D 1 329 ? -15.593 51.473  -61.831 1.00 45.86  ? 1329 LYS B CG    1 
ATOM   6009 C  CD    . LYS D 1 329 ? -14.372 52.002  -62.577 1.00 46.76  ? 1329 LYS B CD    1 
ATOM   6010 C  CE    . LYS D 1 329 ? -14.677 52.296  -64.042 1.00 47.09  ? 1329 LYS B CE    1 
ATOM   6011 N  NZ    . LYS D 1 329 ? -13.746 53.313  -64.619 1.00 46.85  ? 1329 LYS B NZ    1 
ATOM   6012 N  N     . ILE D 1 330 ? -17.349 47.204  -62.068 1.00 43.51  ? 1330 ILE B N     1 
ATOM   6013 C  CA    . ILE D 1 330 ? -17.441 45.734  -62.134 1.00 42.65  ? 1330 ILE B CA    1 
ATOM   6014 C  C     . ILE D 1 330 ? -16.571 45.149  -63.244 1.00 41.85  ? 1330 ILE B C     1 
ATOM   6015 O  O     . ILE D 1 330 ? -16.626 45.598  -64.385 1.00 42.10  ? 1330 ILE B O     1 
ATOM   6016 C  CB    . ILE D 1 330 ? -18.909 45.246  -62.321 1.00 42.68  ? 1330 ILE B CB    1 
ATOM   6017 C  CG1   . ILE D 1 330 ? -19.813 45.830  -61.233 1.00 42.82  ? 1330 ILE B CG1   1 
ATOM   6018 C  CG2   . ILE D 1 330 ? -18.988 43.721  -62.315 1.00 42.48  ? 1330 ILE B CG2   1 
ATOM   6019 C  CD1   . ILE D 1 330 ? -21.281 45.545  -61.434 1.00 44.20  ? 1330 ILE B CD1   1 
ATOM   6020 N  N     . ARG D 1 331 ? -15.781 44.136  -62.901 1.00 41.04  ? 1331 ARG B N     1 
ATOM   6021 C  CA    . ARG D 1 331 ? -14.952 43.429  -63.878 1.00 39.85  ? 1331 ARG B CA    1 
ATOM   6022 C  C     . ARG D 1 331 ? -15.619 42.148  -64.422 1.00 38.03  ? 1331 ARG B C     1 
ATOM   6023 O  O     . ARG D 1 331 ? -15.562 41.872  -65.636 1.00 37.49  ? 1331 ARG B O     1 
ATOM   6024 C  CB    . ARG D 1 331 ? -13.591 43.100  -63.260 1.00 40.69  ? 1331 ARG B CB    1 
ATOM   6025 C  CG    . ARG D 1 331 ? -12.492 42.914  -64.279 1.00 43.51  ? 1331 ARG B CG    1 
ATOM   6026 C  CD    . ARG D 1 331 ? -11.155 42.639  -63.613 1.00 48.44  ? 1331 ARG B CD    1 
ATOM   6027 N  NE    . ARG D 1 331 ? -11.266 41.540  -62.661 1.00 52.22  ? 1331 ARG B NE    1 
ATOM   6028 C  CZ    . ARG D 1 331 ? -10.288 40.692  -62.368 1.00 54.02  ? 1331 ARG B CZ    1 
ATOM   6029 N  NH1   . ARG D 1 331 ? -10.503 39.723  -61.489 1.00 55.57  ? 1331 ARG B NH1   1 
ATOM   6030 N  NH2   . ARG D 1 331 ? -9.102  40.805  -62.954 1.00 55.35  ? 1331 ARG B NH2   1 
ATOM   6031 N  N     . ARG D 1 332 ? -16.239 41.375  -63.523 1.00 35.40  ? 1332 ARG B N     1 
ATOM   6032 C  CA    . ARG D 1 332 ? -16.888 40.105  -63.887 1.00 32.96  ? 1332 ARG B CA    1 
ATOM   6033 C  C     . ARG D 1 332 ? -18.330 39.992  -63.351 1.00 31.48  ? 1332 ARG B C     1 
ATOM   6034 O  O     . ARG D 1 332 ? -18.669 40.571  -62.320 1.00 30.79  ? 1332 ARG B O     1 
ATOM   6035 C  CB    . ARG D 1 332 ? -16.060 38.916  -63.390 1.00 33.14  ? 1332 ARG B CB    1 
ATOM   6036 C  CG    . ARG D 1 332 ? -14.635 38.849  -63.943 1.00 31.97  ? 1332 ARG B CG    1 
ATOM   6037 C  CD    . ARG D 1 332 ? -13.766 37.927  -63.101 1.00 32.52  ? 1332 ARG B CD    1 
ATOM   6038 N  NE    . ARG D 1 332 ? -14.066 36.504  -63.273 1.00 31.10  ? 1332 ARG B NE    1 
ATOM   6039 C  CZ    . ARG D 1 332 ? -13.992 35.601  -62.295 1.00 33.34  ? 1332 ARG B CZ    1 
ATOM   6040 N  NH1   . ARG D 1 332 ? -14.268 34.330  -62.528 1.00 32.35  ? 1332 ARG B NH1   1 
ATOM   6041 N  NH2   . ARG D 1 332 ? -13.651 35.965  -61.064 1.00 36.20  ? 1332 ARG B NH2   1 
ATOM   6042 N  N     . ILE D 1 333 ? -19.151 39.231  -64.062 1.00 29.24  ? 1333 ILE B N     1 
ATOM   6043 C  CA    . ILE D 1 333 ? -20.553 39.055  -63.714 1.00 28.56  ? 1333 ILE B CA    1 
ATOM   6044 C  C     . ILE D 1 333 ? -20.948 37.591  -63.934 1.00 27.46  ? 1333 ILE B C     1 
ATOM   6045 O  O     . ILE D 1 333 ? -20.536 36.964  -64.915 1.00 28.01  ? 1333 ILE B O     1 
ATOM   6046 C  CB    . ILE D 1 333 ? -21.479 40.048  -64.525 1.00 27.78  ? 1333 ILE B CB    1 
ATOM   6047 C  CG1   . ILE D 1 333 ? -22.911 40.081  -63.989 1.00 28.76  ? 1333 ILE B CG1   1 
ATOM   6048 C  CG2   . ILE D 1 333 ? -21.511 39.706  -66.009 1.00 27.52  ? 1333 ILE B CG2   1 
ATOM   6049 C  CD1   . ILE D 1 333 ? -23.089 40.928  -62.750 1.00 28.79  ? 1333 ILE B CD1   1 
ATOM   6050 N  N     . GLY D 1 334 ? -21.748 37.057  -63.020 1.00 26.90  ? 1334 GLY B N     1 
ATOM   6051 C  CA    . GLY D 1 334 ? -22.218 35.690  -63.134 1.00 25.47  ? 1334 GLY B CA    1 
ATOM   6052 C  C     . GLY D 1 334 ? -23.507 35.415  -62.382 1.00 25.02  ? 1334 GLY B C     1 
ATOM   6053 O  O     . GLY D 1 334 ? -24.059 36.283  -61.690 1.00 24.88  ? 1334 GLY B O     1 
ATOM   6054 N  N     . VAL D 1 335 ? -23.988 34.190  -62.528 1.00 24.23  ? 1335 VAL B N     1 
ATOM   6055 C  CA    . VAL D 1 335 ? -25.268 33.800  -61.979 1.00 23.84  ? 1335 VAL B CA    1 
ATOM   6056 C  C     . VAL D 1 335 ? -25.136 32.347  -61.563 1.00 23.36  ? 1335 VAL B C     1 
ATOM   6057 O  O     . VAL D 1 335 ? -24.364 31.609  -62.169 1.00 23.41  ? 1335 VAL B O     1 
ATOM   6058 C  CB    . VAL D 1 335 ? -26.391 34.014  -63.042 1.00 24.08  ? 1335 VAL B CB    1 
ATOM   6059 C  CG1   . VAL D 1 335 ? -26.180 33.138  -64.255 1.00 23.43  ? 1335 VAL B CG1   1 
ATOM   6060 C  CG2   . VAL D 1 335 ? -27.780 33.823  -62.446 1.00 24.32  ? 1335 VAL B CG2   1 
ATOM   6061 N  N     . ARG D 1 336 ? -25.839 31.951  -60.511 1.00 22.43  ? 1336 ARG B N     1 
ATOM   6062 C  CA    . ARG D 1 336 ? -25.940 30.540  -60.175 1.00 23.16  ? 1336 ARG B CA    1 
ATOM   6063 C  C     . ARG D 1 336 ? -27.355 30.215  -59.711 1.00 22.12  ? 1336 ARG B C     1 
ATOM   6064 O  O     . ARG D 1 336 ? -28.035 31.065  -59.144 1.00 22.62  ? 1336 ARG B O     1 
ATOM   6065 C  CB    . ARG D 1 336 ? -24.904 30.150  -59.108 1.00 23.36  ? 1336 ARG B CB    1 
ATOM   6066 C  CG    . ARG D 1 336 ? -25.490 29.803  -57.749 1.00 27.41  ? 1336 ARG B CG    1 
ATOM   6067 C  CD    . ARG D 1 336 ? -24.758 30.432  -56.556 1.00 31.81  ? 1336 ARG B CD    1 
ATOM   6068 N  NE    . ARG D 1 336 ? -23.359 30.066  -56.488 1.00 29.25  ? 1336 ARG B NE    1 
ATOM   6069 C  CZ    . ARG D 1 336 ? -22.583 30.185  -55.401 1.00 28.98  ? 1336 ARG B CZ    1 
ATOM   6070 N  NH1   . ARG D 1 336 ? -23.052 30.624  -54.242 1.00 32.67  ? 1336 ARG B NH1   1 
ATOM   6071 N  NH2   . ARG D 1 336 ? -21.323 29.827  -55.482 1.00 25.48  ? 1336 ARG B NH2   1 
ATOM   6072 N  N     . PHE D 1 337 ? -27.782 28.986  -59.958 1.00 21.65  ? 1337 PHE B N     1 
ATOM   6073 C  CA    . PHE D 1 337 ? -29.103 28.512  -59.556 1.00 21.86  ? 1337 PHE B CA    1 
ATOM   6074 C  C     . PHE D 1 337 ? -28.965 27.437  -58.514 1.00 22.04  ? 1337 PHE B C     1 
ATOM   6075 O  O     . PHE D 1 337 ? -28.002 26.653  -58.534 1.00 21.90  ? 1337 PHE B O     1 
ATOM   6076 C  CB    . PHE D 1 337 ? -29.864 27.971  -60.761 1.00 21.51  ? 1337 PHE B CB    1 
ATOM   6077 C  CG    . PHE D 1 337 ? -30.104 29.010  -61.800 1.00 24.54  ? 1337 PHE B CG    1 
ATOM   6078 C  CD1   . PHE D 1 337 ? -31.228 29.821  -61.732 1.00 23.10  ? 1337 PHE B CD1   1 
ATOM   6079 C  CD2   . PHE D 1 337 ? -29.175 29.216  -62.816 1.00 24.82  ? 1337 PHE B CD2   1 
ATOM   6080 C  CE1   . PHE D 1 337 ? -31.444 30.806  -62.676 1.00 25.55  ? 1337 PHE B CE1   1 
ATOM   6081 C  CE2   . PHE D 1 337 ? -29.375 30.201  -63.763 1.00 26.49  ? 1337 PHE B CE2   1 
ATOM   6082 C  CZ    . PHE D 1 337 ? -30.518 30.999  -63.698 1.00 26.70  ? 1337 PHE B CZ    1 
ATOM   6083 N  N     . SER D 1 338 ? -29.908 27.413  -57.584 1.00 21.68  ? 1338 SER B N     1 
ATOM   6084 C  CA    . SER D 1 338 ? -29.831 26.453  -56.494 1.00 22.39  ? 1338 SER B CA    1 
ATOM   6085 C  C     . SER D 1 338 ? -31.229 26.130  -55.995 1.00 22.50  ? 1338 SER B C     1 
ATOM   6086 O  O     . SER D 1 338 ? -32.214 26.563  -56.591 1.00 22.45  ? 1338 SER B O     1 
ATOM   6087 C  CB    . SER D 1 338 ? -28.943 26.984  -55.351 1.00 21.96  ? 1338 SER B CB    1 
ATOM   6088 O  OG    . SER D 1 338 ? -29.461 28.211  -54.875 1.00 21.55  ? 1338 SER B OG    1 
ATOM   6089 N  N     . LYS D 1 339 ? -31.282 25.348  -54.922 1.00 23.58  ? 1339 LYS B N     1 
ATOM   6090 C  CA    . LYS D 1 339 ? -32.519 24.897  -54.282 1.00 25.86  ? 1339 LYS B CA    1 
ATOM   6091 C  C     . LYS D 1 339 ? -33.393 24.205  -55.315 1.00 25.89  ? 1339 LYS B C     1 
ATOM   6092 O  O     . LYS D 1 339 ? -34.447 24.716  -55.698 1.00 25.99  ? 1339 LYS B O     1 
ATOM   6093 C  CB    . LYS D 1 339 ? -33.251 26.063  -53.603 1.00 26.01  ? 1339 LYS B CB    1 
ATOM   6094 C  CG    . LYS D 1 339 ? -32.475 26.644  -52.412 1.00 30.12  ? 1339 LYS B CG    1 
ATOM   6095 C  CD    . LYS D 1 339 ? -33.279 27.743  -51.731 1.00 33.63  ? 1339 LYS B CD    1 
ATOM   6096 C  CE    . LYS D 1 339 ? -32.630 28.217  -50.430 1.00 35.94  ? 1339 LYS B CE    1 
ATOM   6097 N  NZ    . LYS D 1 339 ? -33.685 28.754  -49.504 1.00 37.79  ? 1339 LYS B NZ    1 
ATOM   6098 N  N     . PHE D 1 340 ? -32.910 23.055  -55.775 1.00 26.37  ? 1340 PHE B N     1 
ATOM   6099 C  CA    . PHE D 1 340 ? -33.539 22.317  -56.862 1.00 27.55  ? 1340 PHE B CA    1 
ATOM   6100 C  C     . PHE D 1 340 ? -34.741 21.515  -56.370 1.00 28.34  ? 1340 PHE B C     1 
ATOM   6101 O  O     . PHE D 1 340 ? -34.685 20.882  -55.318 1.00 28.72  ? 1340 PHE B O     1 
ATOM   6102 C  CB    . PHE D 1 340 ? -32.514 21.402  -57.549 1.00 27.32  ? 1340 PHE B CB    1 
ATOM   6103 C  CG    . PHE D 1 340 ? -31.292 22.130  -58.064 1.00 26.58  ? 1340 PHE B CG    1 
ATOM   6104 C  CD1   . PHE D 1 340 ? -31.421 23.249  -58.880 1.00 27.04  ? 1340 PHE B CD1   1 
ATOM   6105 C  CD2   . PHE D 1 340 ? -30.017 21.691  -57.739 1.00 27.46  ? 1340 PHE B CD2   1 
ATOM   6106 C  CE1   . PHE D 1 340 ? -30.294 23.934  -59.375 1.00 25.88  ? 1340 PHE B CE1   1 
ATOM   6107 C  CE2   . PHE D 1 340 ? -28.877 22.371  -58.223 1.00 26.29  ? 1340 PHE B CE2   1 
ATOM   6108 C  CZ    . PHE D 1 340 ? -29.028 23.496  -59.039 1.00 25.66  ? 1340 PHE B CZ    1 
ATOM   6109 N  N     . ILE D 1 341 ? -35.828 21.568  -57.130 1.00 29.70  ? 1341 ILE B N     1 
ATOM   6110 C  CA    . ILE D 1 341 ? -37.061 20.843  -56.800 1.00 31.16  ? 1341 ILE B CA    1 
ATOM   6111 C  C     . ILE D 1 341 ? -36.778 19.335  -56.712 1.00 32.00  ? 1341 ILE B C     1 
ATOM   6112 O  O     . ILE D 1 341 ? -36.030 18.795  -57.538 1.00 33.19  ? 1341 ILE B O     1 
ATOM   6113 C  CB    . ILE D 1 341 ? -38.194 21.193  -57.797 1.00 31.27  ? 1341 ILE B CB    1 
ATOM   6114 C  CG1   . ILE D 1 341 ? -38.467 22.701  -57.743 1.00 31.78  ? 1341 ILE B CG1   1 
ATOM   6115 C  CG2   . ILE D 1 341 ? -39.500 20.387  -57.501 1.00 31.27  ? 1341 ILE B CG2   1 
ATOM   6116 C  CD1   . ILE D 1 341 ? -39.708 23.170  -58.502 1.00 32.69  ? 1341 ILE B CD1   1 
ATOM   6117 O  OXT   . ILE D 1 341 ? -37.228 18.633  -55.794 1.00 32.33  ? 1341 ILE B OXT   1 
ATOM   6118 O  "O5'" . DT  E 2 1   ? -34.812 30.847  -21.615 1.00 99.86  ? 1803 DT  H "O5'" 1 
ATOM   6119 C  "C5'" . DT  E 2 1   ? -33.917 30.625  -22.702 1.00 100.14 ? 1803 DT  H "C5'" 1 
ATOM   6120 C  "C4'" . DT  E 2 1   ? -34.632 30.774  -24.038 1.00 100.24 ? 1803 DT  H "C4'" 1 
ATOM   6121 O  "O4'" . DT  E 2 1   ? -35.339 32.042  -24.093 1.00 100.42 ? 1803 DT  H "O4'" 1 
ATOM   6122 C  "C3'" . DT  E 2 1   ? -33.746 30.741  -25.280 1.00 100.23 ? 1803 DT  H "C3'" 1 
ATOM   6123 O  "O3'" . DT  E 2 1   ? -34.446 30.032  -26.324 1.00 100.19 ? 1803 DT  H "O3'" 1 
ATOM   6124 C  "C2'" . DT  E 2 1   ? -33.516 32.229  -25.556 1.00 100.29 ? 1803 DT  H "C2'" 1 
ATOM   6125 C  "C1'" . DT  E 2 1   ? -34.862 32.838  -25.167 1.00 100.35 ? 1803 DT  H "C1'" 1 
ATOM   6126 N  N1    . DT  E 2 1   ? -34.807 34.297  -24.750 1.00 100.26 ? 1803 DT  H N1    1 
ATOM   6127 C  C2    . DT  E 2 1   ? -34.429 35.282  -25.656 1.00 100.12 ? 1803 DT  H C2    1 
ATOM   6128 O  O2    . DT  E 2 1   ? -34.117 35.072  -26.819 1.00 100.05 ? 1803 DT  H O2    1 
ATOM   6129 N  N3    . DT  E 2 1   ? -34.425 36.559  -25.140 1.00 99.95  ? 1803 DT  H N3    1 
ATOM   6130 C  C4    . DT  E 2 1   ? -34.752 36.951  -23.850 1.00 99.84  ? 1803 DT  H C4    1 
ATOM   6131 O  O4    . DT  E 2 1   ? -34.712 38.127  -23.501 1.00 99.76  ? 1803 DT  H O4    1 
ATOM   6132 C  C5    . DT  E 2 1   ? -35.139 35.883  -22.954 1.00 99.87  ? 1803 DT  H C5    1 
ATOM   6133 C  C7    . DT  E 2 1   ? -35.518 36.166  -21.527 1.00 99.53  ? 1803 DT  H C7    1 
ATOM   6134 C  C6    . DT  E 2 1   ? -35.146 34.633  -23.445 1.00 100.12 ? 1803 DT  H C6    1 
ATOM   6135 P  P     . DT  E 2 2   ? -34.205 30.206  -27.907 1.00 100.20 ? 1804 DT  H P     1 
ATOM   6136 O  OP1   . DT  E 2 2   ? -34.619 28.933  -28.547 1.00 100.14 ? 1804 DT  H OP1   1 
ATOM   6137 O  OP2   . DT  E 2 2   ? -32.834 30.713  -28.156 1.00 100.15 ? 1804 DT  H OP2   1 
ATOM   6138 O  "O5'" . DT  E 2 2   ? -35.245 31.372  -28.283 1.00 99.39  ? 1804 DT  H "O5'" 1 
ATOM   6139 C  "C5'" . DT  E 2 2   ? -36.228 31.202  -29.311 1.00 98.11  ? 1804 DT  H "C5'" 1 
ATOM   6140 C  "C4'" . DT  E 2 2   ? -35.823 31.884  -30.609 1.00 97.11  ? 1804 DT  H "C4'" 1 
ATOM   6141 O  "O4'" . DT  E 2 2   ? -34.773 32.861  -30.374 1.00 97.12  ? 1804 DT  H "O4'" 1 
ATOM   6142 C  "C3'" . DT  E 2 2   ? -35.200 30.990  -31.671 1.00 96.34  ? 1804 DT  H "C3'" 1 
ATOM   6143 O  "O3'" . DT  E 2 2   ? -36.149 30.157  -32.344 1.00 94.93  ? 1804 DT  H "O3'" 1 
ATOM   6144 C  "C2'" . DT  E 2 2   ? -34.635 32.068  -32.589 1.00 96.56  ? 1804 DT  H "C2'" 1 
ATOM   6145 C  "C1'" . DT  E 2 2   ? -34.011 33.016  -31.562 1.00 96.88  ? 1804 DT  H "C1'" 1 
ATOM   6146 N  N1    . DT  E 2 2   ? -32.528 32.801  -31.284 1.00 97.08  ? 1804 DT  H N1    1 
ATOM   6147 C  C2    . DT  E 2 2   ? -31.840 33.689  -30.471 1.00 97.14  ? 1804 DT  H C2    1 
ATOM   6148 O  O2    . DT  E 2 2   ? -32.350 34.658  -29.933 1.00 97.25  ? 1804 DT  H O2    1 
ATOM   6149 N  N3    . DT  E 2 2   ? -30.503 33.398  -30.298 1.00 97.12  ? 1804 DT  H N3    1 
ATOM   6150 C  C4    . DT  E 2 2   ? -29.788 32.338  -30.840 1.00 97.09  ? 1804 DT  H C4    1 
ATOM   6151 O  O4    . DT  E 2 2   ? -28.590 32.177  -30.616 1.00 97.00  ? 1804 DT  H O4    1 
ATOM   6152 C  C5    . DT  E 2 2   ? -30.557 31.447  -31.682 1.00 97.09  ? 1804 DT  H C5    1 
ATOM   6153 C  C7    . DT  E 2 2   ? -29.915 30.256  -32.337 1.00 96.87  ? 1804 DT  H C7    1 
ATOM   6154 C  C6    . DT  E 2 2   ? -31.860 31.723  -31.853 1.00 97.14  ? 1804 DT  H C6    1 
ATOM   6155 P  P     . DG  E 2 3   ? -35.712 28.740  -32.975 1.00 93.66  ? 1805 DG  H P     1 
ATOM   6156 O  OP1   . DG  E 2 3   ? -36.080 27.694  -31.990 1.00 93.72  ? 1805 DG  H OP1   1 
ATOM   6157 O  OP2   . DG  E 2 3   ? -34.313 28.831  -33.465 1.00 93.30  ? 1805 DG  H OP2   1 
ATOM   6158 O  "O5'" . DG  E 2 3   ? -36.683 28.615  -34.248 1.00 91.45  ? 1805 DG  H "O5'" 1 
ATOM   6159 C  "C5'" . DG  E 2 3   ? -36.550 27.549  -35.188 1.00 87.86  ? 1805 DG  H "C5'" 1 
ATOM   6160 C  "C4'" . DG  E 2 3   ? -35.732 27.979  -36.393 1.00 85.27  ? 1805 DG  H "C4'" 1 
ATOM   6161 O  "O4'" . DG  E 2 3   ? -35.318 29.359  -36.241 1.00 84.59  ? 1805 DG  H "O4'" 1 
ATOM   6162 C  "C3'" . DG  E 2 3   ? -34.455 27.168  -36.597 1.00 83.61  ? 1805 DG  H "C3'" 1 
ATOM   6163 O  "O3'" . DG  E 2 3   ? -34.678 26.151  -37.615 1.00 81.33  ? 1805 DG  H "O3'" 1 
ATOM   6164 C  "C2'" . DG  E 2 3   ? -33.351 28.198  -36.881 1.00 83.47  ? 1805 DG  H "C2'" 1 
ATOM   6165 C  "C1'" . DG  E 2 3   ? -34.064 29.554  -36.860 1.00 83.66  ? 1805 DG  H "C1'" 1 
ATOM   6166 N  N9    . DG  E 2 3   ? -33.358 30.634  -36.155 1.00 83.01  ? 1805 DG  H N9    1 
ATOM   6167 C  C8    . DG  E 2 3   ? -32.266 30.510  -35.324 1.00 82.75  ? 1805 DG  H C8    1 
ATOM   6168 N  N7    . DG  E 2 3   ? -31.845 31.644  -34.836 1.00 82.41  ? 1805 DG  H N7    1 
ATOM   6169 C  C5    . DG  E 2 3   ? -32.708 32.593  -35.369 1.00 82.11  ? 1805 DG  H C5    1 
ATOM   6170 C  C6    . DG  E 2 3   ? -32.743 34.004  -35.190 1.00 81.62  ? 1805 DG  H C6    1 
ATOM   6171 O  O6    . DG  E 2 3   ? -31.990 34.707  -34.502 1.00 81.23  ? 1805 DG  H O6    1 
ATOM   6172 N  N1    . DG  E 2 3   ? -33.778 34.605  -35.908 1.00 81.16  ? 1805 DG  H N1    1 
ATOM   6173 C  C2    . DG  E 2 3   ? -34.671 33.921  -36.701 1.00 81.18  ? 1805 DG  H C2    1 
ATOM   6174 N  N2    . DG  E 2 3   ? -35.600 34.665  -37.317 1.00 80.71  ? 1805 DG  H N2    1 
ATOM   6175 N  N3    . DG  E 2 3   ? -34.652 32.601  -36.877 1.00 81.73  ? 1805 DG  H N3    1 
ATOM   6176 C  C4    . DG  E 2 3   ? -33.649 31.991  -36.184 1.00 82.35  ? 1805 DG  H C4    1 
ATOM   6177 P  P     . DG  E 2 4   ? -34.314 26.242  -39.183 1.00 79.67  ? 1806 DG  H P     1 
ATOM   6178 O  OP1   . DG  E 2 4   ? -35.182 25.276  -39.900 1.00 79.48  ? 1806 DG  H OP1   1 
ATOM   6179 O  OP2   . DG  E 2 4   ? -32.844 26.093  -39.302 1.00 79.54  ? 1806 DG  H OP2   1 
ATOM   6180 O  "O5'" . DG  E 2 4   ? -34.700 27.747  -39.609 1.00 77.45  ? 1806 DG  H "O5'" 1 
ATOM   6181 C  "C5'" . DG  E 2 4   ? -35.993 28.129  -40.105 1.00 73.20  ? 1806 DG  H "C5'" 1 
ATOM   6182 C  "C4'" . DG  E 2 4   ? -35.900 29.306  -41.072 1.00 69.95  ? 1806 DG  H "C4'" 1 
ATOM   6183 O  "O4'" . DG  E 2 4   ? -35.275 30.459  -40.442 1.00 69.00  ? 1806 DG  H "O4'" 1 
ATOM   6184 C  "C3'" . DG  E 2 4   ? -35.109 29.042  -42.352 1.00 67.79  ? 1806 DG  H "C3'" 1 
ATOM   6185 O  "O3'" . DG  E 2 4   ? -35.884 29.484  -43.469 1.00 65.28  ? 1806 DG  H "O3'" 1 
ATOM   6186 C  "C2'" . DG  E 2 4   ? -33.807 29.831  -42.169 1.00 67.39  ? 1806 DG  H "C2'" 1 
ATOM   6187 C  "C1'" . DG  E 2 4   ? -34.221 30.969  -41.246 1.00 67.45  ? 1806 DG  H "C1'" 1 
ATOM   6188 N  N9    . DG  E 2 4   ? -33.189 31.424  -40.316 1.00 66.34  ? 1806 DG  H N9    1 
ATOM   6189 C  C8    . DG  E 2 4   ? -32.360 30.621  -39.569 1.00 65.92  ? 1806 DG  H C8    1 
ATOM   6190 N  N7    . DG  E 2 4   ? -31.544 31.282  -38.797 1.00 65.73  ? 1806 DG  H N7    1 
ATOM   6191 C  C5    . DG  E 2 4   ? -31.848 32.617  -39.039 1.00 65.47  ? 1806 DG  H C5    1 
ATOM   6192 C  C6    . DG  E 2 4   ? -31.281 33.799  -38.486 1.00 65.00  ? 1806 DG  H C6    1 
ATOM   6193 O  O6    . DG  E 2 4   ? -30.370 33.892  -37.649 1.00 64.42  ? 1806 DG  H O6    1 
ATOM   6194 N  N1    . DG  E 2 4   ? -31.868 34.959  -38.999 1.00 64.61  ? 1806 DG  H N1    1 
ATOM   6195 C  C2    . DG  E 2 4   ? -32.882 34.968  -39.931 1.00 64.47  ? 1806 DG  H C2    1 
ATOM   6196 N  N2    . DG  E 2 4   ? -33.322 36.177  -40.303 1.00 64.04  ? 1806 DG  H N2    1 
ATOM   6197 N  N3    . DG  E 2 4   ? -33.423 33.869  -40.457 1.00 64.95  ? 1806 DG  H N3    1 
ATOM   6198 C  C4    . DG  E 2 4   ? -32.864 32.725  -39.971 1.00 65.66  ? 1806 DG  H C4    1 
ATOM   6199 P  P     . DA  E 2 5   ? -35.388 29.337  -44.989 1.00 63.71  ? 1807 DA  H P     1 
ATOM   6200 O  OP1   . DA  E 2 5   ? -36.593 29.135  -45.827 1.00 63.83  ? 1807 DA  H OP1   1 
ATOM   6201 O  OP2   . DA  E 2 5   ? -34.276 28.358  -45.067 1.00 63.67  ? 1807 DA  H OP2   1 
ATOM   6202 O  "O5'" . DA  E 2 5   ? -34.776 30.789  -45.295 1.00 61.20  ? 1807 DA  H "O5'" 1 
ATOM   6203 C  "C5'" . DA  E 2 5   ? -35.535 31.977  -45.008 1.00 56.14  ? 1807 DA  H "C5'" 1 
ATOM   6204 C  "C4'" . DA  E 2 5   ? -34.802 33.267  -45.371 1.00 51.63  ? 1807 DA  H "C4'" 1 
ATOM   6205 O  "O4'" . DA  E 2 5   ? -33.836 33.631  -44.347 1.00 50.35  ? 1807 DA  H "O4'" 1 
ATOM   6206 C  "C3'" . DA  E 2 5   ? -34.029 33.313  -46.683 1.00 48.64  ? 1807 DA  H "C3'" 1 
ATOM   6207 O  "O3'" . DA  E 2 5   ? -34.196 34.641  -47.189 1.00 44.96  ? 1807 DA  H "O3'" 1 
ATOM   6208 C  "C2'" . DA  E 2 5   ? -32.593 33.005  -46.241 1.00 48.18  ? 1807 DA  H "C2'" 1 
ATOM   6209 C  "C1'" . DA  E 2 5   ? -32.537 33.742  -44.904 1.00 47.95  ? 1807 DA  H "C1'" 1 
ATOM   6210 N  N9    . DA  E 2 5   ? -31.633 33.230  -43.874 1.00 46.09  ? 1807 DA  H N9    1 
ATOM   6211 C  C8    . DA  E 2 5   ? -31.363 31.926  -43.565 1.00 45.58  ? 1807 DA  H C8    1 
ATOM   6212 N  N7    . DA  E 2 5   ? -30.522 31.786  -42.565 1.00 45.55  ? 1807 DA  H N7    1 
ATOM   6213 C  C5    . DA  E 2 5   ? -30.224 33.086  -42.181 1.00 45.12  ? 1807 DA  H C5    1 
ATOM   6214 C  C6    . DA  E 2 5   ? -29.385 33.638  -41.177 1.00 44.75  ? 1807 DA  H C6    1 
ATOM   6215 N  N6    . DA  E 2 5   ? -28.662 32.912  -40.322 1.00 44.53  ? 1807 DA  H N6    1 
ATOM   6216 N  N1    . DA  E 2 5   ? -29.321 34.984  -41.067 1.00 44.76  ? 1807 DA  H N1    1 
ATOM   6217 C  C2    . DA  E 2 5   ? -30.043 35.732  -41.911 1.00 44.80  ? 1807 DA  H C2    1 
ATOM   6218 N  N3    . DA  E 2 5   ? -30.855 35.329  -42.891 1.00 44.64  ? 1807 DA  H N3    1 
ATOM   6219 C  C4    . DA  E 2 5   ? -30.909 33.988  -42.977 1.00 45.14  ? 1807 DA  H C4    1 
ATOM   6220 P  P     . DT  E 2 6   ? -33.869 35.081  -48.693 1.00 42.48  ? 1808 DT  H P     1 
ATOM   6221 O  OP1   . DT  E 2 6   ? -34.857 36.134  -49.009 1.00 42.47  ? 1808 DT  H OP1   1 
ATOM   6222 O  OP2   . DT  E 2 6   ? -33.732 33.896  -49.572 1.00 42.71  ? 1808 DT  H OP2   1 
ATOM   6223 O  "O5'" . DT  E 2 6   ? -32.423 35.761  -48.571 1.00 38.52  ? 1808 DT  H "O5'" 1 
ATOM   6224 C  "C5'" . DT  E 2 6   ? -32.326 36.977  -47.826 1.00 32.63  ? 1808 DT  H "C5'" 1 
ATOM   6225 C  "C4'" . DT  E 2 6   ? -30.899 37.359  -47.494 1.00 28.22  ? 1808 DT  H "C4'" 1 
ATOM   6226 O  "O4'" . DT  E 2 6   ? -30.383 36.512  -46.445 1.00 26.14  ? 1808 DT  H "O4'" 1 
ATOM   6227 C  "C3'" . DT  E 2 6   ? -29.907 37.264  -48.651 1.00 26.21  ? 1808 DT  H "C3'" 1 
ATOM   6228 O  "O3'" . DT  E 2 6   ? -29.632 38.593  -49.090 1.00 23.33  ? 1808 DT  H "O3'" 1 
ATOM   6229 C  "C2'" . DT  E 2 6   ? -28.672 36.603  -48.037 1.00 25.90  ? 1808 DT  H "C2'" 1 
ATOM   6230 C  "C1'" . DT  E 2 6   ? -28.980 36.535  -46.541 1.00 26.88  ? 1808 DT  H "C1'" 1 
ATOM   6231 N  N1    . DT  E 2 6   ? -28.518 35.308  -45.832 1.00 27.81  ? 1808 DT  H N1    1 
ATOM   6232 C  C2    . DT  E 2 6   ? -27.734 35.421  -44.697 1.00 27.35  ? 1808 DT  H C2    1 
ATOM   6233 O  O2    . DT  E 2 6   ? -27.359 36.477  -44.231 1.00 26.41  ? 1808 DT  H O2    1 
ATOM   6234 N  N3    . DT  E 2 6   ? -27.386 34.231  -44.113 1.00 28.34  ? 1808 DT  H N3    1 
ATOM   6235 C  C4    . DT  E 2 6   ? -27.736 32.961  -44.546 1.00 30.49  ? 1808 DT  H C4    1 
ATOM   6236 O  O4    . DT  E 2 6   ? -27.368 31.960  -43.945 1.00 31.12  ? 1808 DT  H O4    1 
ATOM   6237 C  C5    . DT  E 2 6   ? -28.559 32.908  -45.738 1.00 31.05  ? 1808 DT  H C5    1 
ATOM   6238 C  C7    . DT  E 2 6   ? -29.009 31.594  -46.313 1.00 31.80  ? 1808 DT  H C7    1 
ATOM   6239 C  C6    . DT  E 2 6   ? -28.908 34.069  -46.316 1.00 29.27  ? 1808 DT  H C6    1 
ATOM   6240 P  P     . DG  E 2 7   ? -28.793 38.960  -50.405 1.00 24.01  ? 1809 DG  H P     1 
ATOM   6241 O  OP1   . DG  E 2 7   ? -29.312 40.267  -50.865 1.00 21.91  ? 1809 DG  H OP1   1 
ATOM   6242 O  OP2   . DG  E 2 7   ? -28.763 37.811  -51.336 1.00 23.44  ? 1809 DG  H OP2   1 
ATOM   6243 O  "O5'" . DG  E 2 7   ? -27.301 39.125  -49.870 1.00 22.88  ? 1809 DG  H "O5'" 1 
ATOM   6244 C  "C5'" . DG  E 2 7   ? -26.986 40.021  -48.800 1.00 26.32  ? 1809 DG  H "C5'" 1 
ATOM   6245 C  "C4'" . DG  E 2 7   ? -25.551 39.808  -48.344 1.00 28.28  ? 1809 DG  H "C4'" 1 
ATOM   6246 O  "O4'" . DG  E 2 7   ? -25.447 38.567  -47.597 1.00 28.36  ? 1809 DG  H "O4'" 1 
ATOM   6247 C  "C3'" . DG  E 2 7   ? -24.500 39.701  -49.448 1.00 29.70  ? 1809 DG  H "C3'" 1 
ATOM   6248 O  "O3'" . DG  E 2 7   ? -23.324 40.351  -48.966 1.00 31.43  ? 1809 DG  H "O3'" 1 
ATOM   6249 C  "C2'" . DG  E 2 7   ? -24.302 38.188  -49.600 1.00 29.23  ? 1809 DG  H "C2'" 1 
ATOM   6250 C  "C1'" . DG  E 2 7   ? -24.405 37.773  -48.135 1.00 28.99  ? 1809 DG  H "C1'" 1 
ATOM   6251 N  N9    . DG  E 2 7   ? -24.702 36.369  -47.852 1.00 28.40  ? 1809 DG  H N9    1 
ATOM   6252 C  C8    . DG  E 2 7   ? -25.466 35.485  -48.576 1.00 28.52  ? 1809 DG  H C8    1 
ATOM   6253 N  N7    . DG  E 2 7   ? -25.552 34.300  -48.038 1.00 27.30  ? 1809 DG  H N7    1 
ATOM   6254 C  C5    . DG  E 2 7   ? -24.793 34.400  -46.884 1.00 26.63  ? 1809 DG  H C5    1 
ATOM   6255 C  C6    . DG  E 2 7   ? -24.499 33.437  -45.886 1.00 26.08  ? 1809 DG  H C6    1 
ATOM   6256 O  O6    . DG  E 2 7   ? -24.878 32.271  -45.832 1.00 25.83  ? 1809 DG  H O6    1 
ATOM   6257 N  N1    . DG  E 2 7   ? -23.686 33.944  -44.874 1.00 25.45  ? 1809 DG  H N1    1 
ATOM   6258 C  C2    . DG  E 2 7   ? -23.207 35.234  -44.836 1.00 25.55  ? 1809 DG  H C2    1 
ATOM   6259 N  N2    . DG  E 2 7   ? -22.435 35.574  -43.794 1.00 24.40  ? 1809 DG  H N2    1 
ATOM   6260 N  N3    . DG  E 2 7   ? -23.477 36.147  -45.759 1.00 26.80  ? 1809 DG  H N3    1 
ATOM   6261 C  C4    . DG  E 2 7   ? -24.267 35.666  -46.755 1.00 27.44  ? 1809 DG  H C4    1 
ATOM   6262 P  P     . DG  E 2 8   ? -21.998 40.570  -49.836 1.00 32.99  ? 1810 DG  H P     1 
ATOM   6263 O  OP1   . DG  E 2 8   ? -21.819 42.039  -49.903 1.00 32.75  ? 1810 DG  H OP1   1 
ATOM   6264 O  OP2   . DG  E 2 8   ? -22.073 39.791  -51.091 1.00 30.04  ? 1810 DG  H OP2   1 
ATOM   6265 O  "O5'" . DG  E 2 8   ? -20.860 39.957  -48.889 1.00 31.94  ? 1810 DG  H "O5'" 1 
ATOM   6266 C  "C5'" . DG  E 2 8   ? -20.743 40.415  -47.545 1.00 32.45  ? 1810 DG  H "C5'" 1 
ATOM   6267 C  "C4'" . DG  E 2 8   ? -19.866 39.462  -46.757 1.00 32.31  ? 1810 DG  H "C4'" 1 
ATOM   6268 O  "O4'" . DG  E 2 8   ? -20.556 38.196  -46.592 1.00 32.09  ? 1810 DG  H "O4'" 1 
ATOM   6269 C  "C3'" . DG  E 2 8   ? -18.537 39.155  -47.440 1.00 32.25  ? 1810 DG  H "C3'" 1 
ATOM   6270 O  "O3'" . DG  E 2 8   ? -17.491 39.328  -46.507 1.00 32.92  ? 1810 DG  H "O3'" 1 
ATOM   6271 C  "C2'" . DG  E 2 8   ? -18.664 37.701  -47.884 1.00 30.86  ? 1810 DG  H "C2'" 1 
ATOM   6272 C  "C1'" . DG  E 2 8   ? -19.671 37.142  -46.890 1.00 30.28  ? 1810 DG  H "C1'" 1 
ATOM   6273 N  N9    . DG  E 2 8   ? -20.412 36.002  -47.429 1.00 28.29  ? 1810 DG  H N9    1 
ATOM   6274 C  C8    . DG  E 2 8   ? -21.233 35.957  -48.529 1.00 27.36  ? 1810 DG  H C8    1 
ATOM   6275 N  N7    . DG  E 2 8   ? -21.730 34.766  -48.754 1.00 27.31  ? 1810 DG  H N7    1 
ATOM   6276 C  C5    . DG  E 2 8   ? -21.207 33.971  -47.738 1.00 27.37  ? 1810 DG  H C5    1 
ATOM   6277 C  C6    . DG  E 2 8   ? -21.387 32.593  -47.442 1.00 25.43  ? 1810 DG  H C6    1 
ATOM   6278 O  O6    . DG  E 2 8   ? -22.067 31.751  -48.043 1.00 24.26  ? 1810 DG  H O6    1 
ATOM   6279 N  N1    . DG  E 2 8   ? -20.667 32.208  -46.311 1.00 25.96  ? 1810 DG  H N1    1 
ATOM   6280 C  C2    . DG  E 2 8   ? -19.870 33.040  -45.558 1.00 25.63  ? 1810 DG  H C2    1 
ATOM   6281 N  N2    . DG  E 2 8   ? -19.243 32.499  -44.513 1.00 24.95  ? 1810 DG  H N2    1 
ATOM   6282 N  N3    . DG  E 2 8   ? -19.690 34.318  -45.820 1.00 25.57  ? 1810 DG  H N3    1 
ATOM   6283 C  C4    . DG  E 2 8   ? -20.387 34.720  -46.917 1.00 27.58  ? 1810 DG  H C4    1 
ATOM   6284 P  P     . DT  E 2 9   ? -15.969 39.027  -46.893 1.00 33.87  ? 1811 DT  H P     1 
ATOM   6285 O  OP1   . DT  E 2 9   ? -15.176 39.949  -46.054 1.00 34.35  ? 1811 DT  H OP1   1 
ATOM   6286 O  OP2   . DT  E 2 9   ? -15.790 39.012  -48.357 1.00 33.61  ? 1811 DT  H OP2   1 
ATOM   6287 O  "O5'" . DT  E 2 9   ? -15.761 37.521  -46.405 1.00 32.48  ? 1811 DT  H "O5'" 1 
ATOM   6288 C  "C5'" . DT  E 2 9   ? -16.177 37.153  -45.093 1.00 31.10  ? 1811 DT  H "C5'" 1 
ATOM   6289 C  "C4'" . DT  E 2 9   ? -15.498 35.882  -44.615 1.00 30.51  ? 1811 DT  H "C4'" 1 
ATOM   6290 O  "O4'" . DT  E 2 9   ? -16.256 34.717  -45.040 1.00 29.36  ? 1811 DT  H "O4'" 1 
ATOM   6291 C  "C3'" . DT  E 2 9   ? -14.071 35.658  -45.106 1.00 30.32  ? 1811 DT  H "C3'" 1 
ATOM   6292 O  "O3'" . DT  E 2 9   ? -13.326 35.133  -44.008 1.00 30.68  ? 1811 DT  H "O3'" 1 
ATOM   6293 C  "C2'" . DT  E 2 9   ? -14.257 34.690  -46.279 1.00 28.36  ? 1811 DT  H "C2'" 1 
ATOM   6294 C  "C1'" . DT  E 2 9   ? -15.448 33.854  -45.809 1.00 29.49  ? 1811 DT  H "C1'" 1 
ATOM   6295 N  N1    . DT  E 2 9   ? -16.362 33.276  -46.862 1.00 28.98  ? 1811 DT  H N1    1 
ATOM   6296 C  C2    . DT  E 2 9   ? -16.732 31.944  -46.788 1.00 29.58  ? 1811 DT  H C2    1 
ATOM   6297 O  O2    . DT  E 2 9   ? -16.341 31.185  -45.935 1.00 30.37  ? 1811 DT  H O2    1 
ATOM   6298 N  N3    . DT  E 2 9   ? -17.577 31.502  -47.780 1.00 29.02  ? 1811 DT  H N3    1 
ATOM   6299 C  C4    . DT  E 2 9   ? -18.098 32.243  -48.827 1.00 28.52  ? 1811 DT  H C4    1 
ATOM   6300 O  O4    . DT  E 2 9   ? -18.860 31.729  -49.656 1.00 25.00  ? 1811 DT  H O4    1 
ATOM   6301 C  C5    . DT  E 2 9   ? -17.679 33.635  -48.854 1.00 28.74  ? 1811 DT  H C5    1 
ATOM   6302 C  C7    . DT  E 2 9   ? -18.166 34.572  -49.923 1.00 29.23  ? 1811 DT  H C7    1 
ATOM   6303 C  C6    . DT  E 2 9   ? -16.852 34.076  -47.883 1.00 28.62  ? 1811 DT  H C6    1 
ATOM   6304 P  P     . DA  E 2 10  ? -11.730 34.930  -44.066 1.00 32.04  ? 1812 DA  H P     1 
ATOM   6305 O  OP1   . DA  E 2 10  ? -11.205 35.051  -42.693 1.00 30.47  ? 1812 DA  H OP1   1 
ATOM   6306 O  OP2   . DA  E 2 10  ? -11.187 35.735  -45.192 1.00 31.31  ? 1812 DA  H OP2   1 
ATOM   6307 O  "O5'" . DA  E 2 10  ? -11.625 33.404  -44.500 1.00 27.04  ? 1812 DA  H "O5'" 1 
ATOM   6308 C  "C5'" . DA  E 2 10  ? -12.148 32.376  -43.660 1.00 23.49  ? 1812 DA  H "C5'" 1 
ATOM   6309 C  "C4'" . DA  E 2 10  ? -12.027 31.035  -44.367 1.00 21.07  ? 1812 DA  H "C4'" 1 
ATOM   6310 O  "O4'" . DA  E 2 10  ? -13.022 30.941  -45.417 1.00 21.34  ? 1812 DA  H "O4'" 1 
ATOM   6311 C  "C3'" . DA  E 2 10  ? -10.697 30.782  -45.060 1.00 20.30  ? 1812 DA  H "C3'" 1 
ATOM   6312 O  "O3'" . DA  E 2 10  ? -10.062 29.731  -44.359 1.00 19.76  ? 1812 DA  H "O3'" 1 
ATOM   6313 C  "C2'" . DA  E 2 10  ? -11.076 30.386  -46.505 1.00 20.49  ? 1812 DA  H "C2'" 1 
ATOM   6314 C  "C1'" . DA  E 2 10  ? -12.544 30.026  -46.379 1.00 20.31  ? 1812 DA  H "C1'" 1 
ATOM   6315 N  N9    . DA  E 2 10  ? -13.375 30.298  -47.549 1.00 19.53  ? 1812 DA  H N9    1 
ATOM   6316 C  C8    . DA  E 2 10  ? -13.505 31.493  -48.210 1.00 21.49  ? 1812 DA  H C8    1 
ATOM   6317 N  N7    . DA  E 2 10  ? -14.380 31.467  -49.192 1.00 21.50  ? 1812 DA  H N7    1 
ATOM   6318 C  C5    . DA  E 2 10  ? -14.837 30.168  -49.172 1.00 20.50  ? 1812 DA  H C5    1 
ATOM   6319 C  C6    . DA  E 2 10  ? -15.782 29.497  -49.961 1.00 21.43  ? 1812 DA  H C6    1 
ATOM   6320 N  N6    . DA  E 2 10  ? -16.405 30.111  -50.964 1.00 21.97  ? 1812 DA  H N6    1 
ATOM   6321 N  N1    . DA  E 2 10  ? -16.046 28.192  -49.678 1.00 20.43  ? 1812 DA  H N1    1 
ATOM   6322 C  C2    . DA  E 2 10  ? -15.391 27.614  -48.661 1.00 20.40  ? 1812 DA  H C2    1 
ATOM   6323 N  N3    . DA  E 2 10  ? -14.482 28.150  -47.847 1.00 19.47  ? 1812 DA  H N3    1 
ATOM   6324 C  C4    . DA  E 2 10  ? -14.240 29.436  -48.160 1.00 20.20  ? 1812 DA  H C4    1 
ATOM   6325 P  P     . DG  E 2 11  ? -8.667  29.113  -44.829 1.00 21.99  ? 1813 DG  H P     1 
ATOM   6326 O  OP1   . DG  E 2 11  ? -8.038  28.459  -43.680 1.00 22.42  ? 1813 DG  H OP1   1 
ATOM   6327 O  OP2   . DG  E 2 11  ? -7.884  30.147  -45.546 1.00 24.25  ? 1813 DG  H OP2   1 
ATOM   6328 O  "O5'" . DG  E 2 11  ? -9.104  27.995  -45.875 1.00 20.17  ? 1813 DG  H "O5'" 1 
ATOM   6329 C  "C5'" . DG  E 2 11  ? -9.905  26.904  -45.474 1.00 20.25  ? 1813 DG  H "C5'" 1 
ATOM   6330 C  "C4'" . DG  E 2 11  ? -10.252 26.086  -46.695 1.00 20.77  ? 1813 DG  H "C4'" 1 
ATOM   6331 O  "O4'" . DG  E 2 11  ? -11.160 26.857  -47.530 1.00 22.06  ? 1813 DG  H "O4'" 1 
ATOM   6332 C  "C3'" . DG  E 2 11  ? -9.037  25.765  -47.570 1.00 20.42  ? 1813 DG  H "C3'" 1 
ATOM   6333 O  "O3'" . DG  E 2 11  ? -8.750  24.364  -47.555 1.00 19.25  ? 1813 DG  H "O3'" 1 
ATOM   6334 C  "C2'" . DG  E 2 11  ? -9.414  26.273  -48.959 1.00 21.83  ? 1813 DG  H "C2'" 1 
ATOM   6335 C  "C1'" . DG  E 2 11  ? -10.933 26.412  -48.854 1.00 22.64  ? 1813 DG  H "C1'" 1 
ATOM   6336 N  N9    . DG  E 2 11  ? -11.459 27.395  -49.790 1.00 22.20  ? 1813 DG  H N9    1 
ATOM   6337 C  C8    . DG  E 2 11  ? -11.030 28.699  -49.955 1.00 24.26  ? 1813 DG  H C8    1 
ATOM   6338 N  N7    . DG  E 2 11  ? -11.701 29.338  -50.880 1.00 24.49  ? 1813 DG  H N7    1 
ATOM   6339 C  C5    . DG  E 2 11  ? -12.627 28.411  -51.350 1.00 22.72  ? 1813 DG  H C5    1 
ATOM   6340 C  C6    . DG  E 2 11  ? -13.605 28.536  -52.368 1.00 23.49  ? 1813 DG  H C6    1 
ATOM   6341 O  O6    . DG  E 2 11  ? -13.836 29.548  -53.045 1.00 25.41  ? 1813 DG  H O6    1 
ATOM   6342 N  N1    . DG  E 2 11  ? -14.337 27.359  -52.573 1.00 20.67  ? 1813 DG  H N1    1 
ATOM   6343 C  C2    . DG  E 2 11  ? -14.144 26.196  -51.849 1.00 20.53  ? 1813 DG  H C2    1 
ATOM   6344 N  N2    . DG  E 2 11  ? -14.938 25.157  -52.150 1.00 16.11  ? 1813 DG  H N2    1 
ATOM   6345 N  N3    . DG  E 2 11  ? -13.215 26.062  -50.892 1.00 22.11  ? 1813 DG  H N3    1 
ATOM   6346 C  C4    . DG  E 2 11  ? -12.490 27.207  -50.698 1.00 22.55  ? 1813 DG  H C4    1 
ATOM   6347 P  P     . DC  E 2 12  ? -7.502  23.754  -48.361 1.00 20.59  ? 1814 DC  H P     1 
ATOM   6348 O  OP1   . DC  E 2 12  ? -7.120  22.498  -47.678 1.00 18.37  ? 1814 DC  H OP1   1 
ATOM   6349 O  OP2   . DC  E 2 12  ? -6.439  24.771  -48.581 1.00 22.47  ? 1814 DC  H OP2   1 
ATOM   6350 O  "O5'" . DC  E 2 12  ? -8.153  23.434  -49.775 1.00 22.86  ? 1814 DC  H "O5'" 1 
ATOM   6351 C  "C5'" . DC  E 2 12  ? -9.301  22.582  -49.825 1.00 23.38  ? 1814 DC  H "C5'" 1 
ATOM   6352 C  "C4'" . DC  E 2 12  ? -9.811  22.556  -51.246 1.00 25.26  ? 1814 DC  H "C4'" 1 
ATOM   6353 O  "O4'" . DC  E 2 12  ? -10.397 23.844  -51.565 1.00 23.57  ? 1814 DC  H "O4'" 1 
ATOM   6354 C  "C3'" . DC  E 2 12  ? -8.675  22.335  -52.243 1.00 27.79  ? 1814 DC  H "C3'" 1 
ATOM   6355 O  "O3'" . DC  E 2 12  ? -9.098  21.382  -53.169 1.00 33.96  ? 1814 DC  H "O3'" 1 
ATOM   6356 C  "C2'" . DC  E 2 12  ? -8.506  23.690  -52.911 1.00 25.47  ? 1814 DC  H "C2'" 1 
ATOM   6357 C  "C1'" . DC  E 2 12  ? -9.964  24.154  -52.865 1.00 24.09  ? 1814 DC  H "C1'" 1 
ATOM   6358 N  N1    . DC  E 2 12  ? -10.193 25.586  -53.242 1.00 22.59  ? 1814 DC  H N1    1 
ATOM   6359 C  C2    . DC  E 2 12  ? -11.305 25.853  -54.050 1.00 20.58  ? 1814 DC  H C2    1 
ATOM   6360 O  O2    . DC  E 2 12  ? -12.045 24.923  -54.361 1.00 22.03  ? 1814 DC  H O2    1 
ATOM   6361 N  N3    . DC  E 2 12  ? -11.553 27.116  -54.451 1.00 19.98  ? 1814 DC  H N3    1 
ATOM   6362 C  C4    . DC  E 2 12  ? -10.739 28.097  -54.104 1.00 20.68  ? 1814 DC  H C4    1 
ATOM   6363 N  N4    . DC  E 2 12  ? -11.055 29.315  -54.567 1.00 20.81  ? 1814 DC  H N4    1 
ATOM   6364 C  C5    . DC  E 2 12  ? -9.564  27.861  -53.296 1.00 21.48  ? 1814 DC  H C5    1 
ATOM   6365 C  C6    . DC  E 2 12  ? -9.335  26.597  -52.889 1.00 20.86  ? 1814 DC  H C6    1 
HETATM 6366 P  P     . DDG E 2 13  ? -8.807  19.826  -52.973 1.00 39.88  ? 1815 DDG H P     1 
HETATM 6367 O  OP1   . DDG E 2 13  ? -9.802  19.296  -52.010 1.00 36.24  ? 1815 DDG H OP1   1 
HETATM 6368 O  OP2   . DDG E 2 13  ? -7.360  19.612  -52.812 1.00 39.39  ? 1815 DDG H OP2   1 
HETATM 6369 O  "O5'" . DDG E 2 13  ? -9.114  19.273  -54.456 1.00 40.26  ? 1815 DDG H "O5'" 1 
HETATM 6370 C  "C5'" . DDG E 2 13  ? -10.413 19.144  -54.960 1.00 41.25  ? 1815 DDG H "C5'" 1 
HETATM 6371 C  "C4'" . DDG E 2 13  ? -10.502 19.454  -56.451 1.00 38.26  ? 1815 DDG H "C4'" 1 
HETATM 6372 O  "O4'" . DDG E 2 13  ? -10.951 20.817  -56.534 1.00 35.87  ? 1815 DDG H "O4'" 1 
HETATM 6373 C  "C3'" . DDG E 2 13  ? -9.204  19.408  -57.254 1.00 39.28  ? 1815 DDG H "C3'" 1 
HETATM 6374 C  "C2'" . DDG E 2 13  ? -9.328  20.514  -58.286 1.00 36.63  ? 1815 DDG H "C2'" 1 
HETATM 6375 C  "C1'" . DDG E 2 13  ? -10.482 21.357  -57.750 1.00 36.47  ? 1815 DDG H "C1'" 1 
HETATM 6376 N  N9    . DDG E 2 13  ? -10.138 22.723  -57.431 1.00 34.28  ? 1815 DDG H N9    1 
HETATM 6377 C  C8    . DDG E 2 13  ? -9.449  23.229  -56.357 1.00 33.41  ? 1815 DDG H C8    1 
HETATM 6378 N  N7    . DDG E 2 13  ? -9.361  24.533  -56.384 1.00 33.26  ? 1815 DDG H N7    1 
HETATM 6379 C  C5    . DDG E 2 13  ? -10.049 24.905  -57.547 1.00 32.09  ? 1815 DDG H C5    1 
HETATM 6380 C  C6    . DDG E 2 13  ? -10.319 26.165  -58.143 1.00 30.96  ? 1815 DDG H C6    1 
HETATM 6381 O  O6    . DDG E 2 13  ? -9.991  27.270  -57.753 1.00 31.76  ? 1815 DDG H O6    1 
HETATM 6382 N  N1    . DDG E 2 13  ? -11.060 26.080  -59.322 1.00 32.02  ? 1815 DDG H N1    1 
HETATM 6383 C  C2    . DDG E 2 13  ? -11.490 24.894  -59.869 1.00 30.90  ? 1815 DDG H C2    1 
HETATM 6384 N  N2    . DDG E 2 13  ? -12.193 24.936  -61.012 1.00 30.47  ? 1815 DDG H N2    1 
HETATM 6385 N  N3    . DDG E 2 13  ? -11.232 23.713  -59.331 1.00 31.63  ? 1815 DDG H N3    1 
HETATM 6386 C  C4    . DDG E 2 13  ? -10.524 23.797  -58.189 1.00 32.68  ? 1815 DDG H C4    1 
ATOM   6387 O  "O5'" . DC  F 3 1   ? -1.331  50.783  -67.393 1.00 64.76  ? 1901 DC  J "O5'" 1 
ATOM   6388 C  "C5'" . DC  F 3 1   ? -2.479  49.956  -67.578 1.00 64.85  ? 1901 DC  J "C5'" 1 
ATOM   6389 C  "C4'" . DC  F 3 1   ? -2.255  48.548  -67.042 1.00 64.96  ? 1901 DC  J "C4'" 1 
ATOM   6390 O  "O4'" . DC  F 3 1   ? -1.716  48.602  -65.689 1.00 65.80  ? 1901 DC  J "O4'" 1 
ATOM   6391 C  "C3'" . DC  F 3 1   ? -3.511  47.668  -66.949 1.00 64.59  ? 1901 DC  J "C3'" 1 
ATOM   6392 O  "O3'" . DC  F 3 1   ? -3.242  46.316  -67.357 1.00 62.28  ? 1901 DC  J "O3'" 1 
ATOM   6393 C  "C2'" . DC  F 3 1   ? -3.821  47.710  -65.456 1.00 65.53  ? 1901 DC  J "C2'" 1 
ATOM   6394 C  "C1'" . DC  F 3 1   ? -2.390  47.609  -64.938 1.00 66.28  ? 1901 DC  J "C1'" 1 
ATOM   6395 N  N1    . DC  F 3 1   ? -2.254  47.758  -63.441 1.00 66.91  ? 1901 DC  J N1    1 
ATOM   6396 C  C2    . DC  F 3 1   ? -1.638  46.732  -62.692 1.00 67.17  ? 1901 DC  J C2    1 
ATOM   6397 O  O2    . DC  F 3 1   ? -1.195  45.719  -63.255 1.00 66.84  ? 1901 DC  J O2    1 
ATOM   6398 N  N3    . DC  F 3 1   ? -1.542  46.879  -61.342 1.00 67.47  ? 1901 DC  J N3    1 
ATOM   6399 C  C4    . DC  F 3 1   ? -2.028  47.976  -60.742 1.00 67.52  ? 1901 DC  J C4    1 
ATOM   6400 N  N4    . DC  F 3 1   ? -1.906  48.072  -59.411 1.00 67.27  ? 1901 DC  J N4    1 
ATOM   6401 C  C5    . DC  F 3 1   ? -2.657  49.027  -61.484 1.00 67.41  ? 1901 DC  J C5    1 
ATOM   6402 C  C6    . DC  F 3 1   ? -2.750  48.875  -62.813 1.00 67.07  ? 1901 DC  J C6    1 
ATOM   6403 P  P     . DT  F 3 2   ? -4.405  45.307  -67.822 1.00 61.22  ? 1902 DT  J P     1 
ATOM   6404 O  OP1   . DT  F 3 2   ? -4.149  45.061  -69.263 1.00 61.11  ? 1902 DT  J OP1   1 
ATOM   6405 O  OP2   . DT  F 3 2   ? -5.722  45.827  -67.381 1.00 60.78  ? 1902 DT  J OP2   1 
ATOM   6406 O  "O5'" . DT  F 3 2   ? -4.133  43.954  -66.987 1.00 57.87  ? 1902 DT  J "O5'" 1 
ATOM   6407 C  "C5'" . DT  F 3 2   ? -2.817  43.383  -66.936 1.00 53.79  ? 1902 DT  J "C5'" 1 
ATOM   6408 C  "C4'" . DT  F 3 2   ? -2.720  41.958  -66.400 1.00 50.02  ? 1902 DT  J "C4'" 1 
ATOM   6409 O  "O4'" . DT  F 3 2   ? -1.662  41.919  -65.405 1.00 50.54  ? 1902 DT  J "O4'" 1 
ATOM   6410 C  "C3'" . DT  F 3 2   ? -3.920  41.335  -65.690 1.00 46.89  ? 1902 DT  J "C3'" 1 
ATOM   6411 O  "O3'" . DT  F 3 2   ? -4.788  40.777  -66.657 1.00 40.87  ? 1902 DT  J "O3'" 1 
ATOM   6412 C  "C2'" . DT  F 3 2   ? -3.220  40.257  -64.865 1.00 48.91  ? 1902 DT  J "C2'" 1 
ATOM   6413 C  "C1'" . DT  F 3 2   ? -1.946  40.954  -64.413 1.00 50.96  ? 1902 DT  J "C1'" 1 
ATOM   6414 N  N1    . DT  F 3 2   ? -2.069  41.615  -63.066 1.00 53.12  ? 1902 DT  J N1    1 
ATOM   6415 C  C2    . DT  F 3 2   ? -1.383  41.084  -61.991 1.00 54.39  ? 1902 DT  J C2    1 
ATOM   6416 O  O2    . DT  F 3 2   ? -0.666  40.098  -62.075 1.00 55.03  ? 1902 DT  J O2    1 
ATOM   6417 N  N3    . DT  F 3 2   ? -1.568  41.764  -60.805 1.00 55.14  ? 1902 DT  J N3    1 
ATOM   6418 C  C4    . DT  F 3 2   ? -2.353  42.894  -60.591 1.00 55.15  ? 1902 DT  J C4    1 
ATOM   6419 O  O4    . DT  F 3 2   ? -2.444  43.426  -59.485 1.00 55.87  ? 1902 DT  J O4    1 
ATOM   6420 C  C5    . DT  F 3 2   ? -3.049  43.397  -61.758 1.00 54.66  ? 1902 DT  J C5    1 
ATOM   6421 C  C7    . DT  F 3 2   ? -3.938  44.607  -61.689 1.00 54.16  ? 1902 DT  J C7    1 
ATOM   6422 C  C6    . DT  F 3 2   ? -2.870  42.740  -62.912 1.00 54.12  ? 1902 DT  J C6    1 
ATOM   6423 P  P     . DA  F 3 3   ? -6.023  39.797  -66.344 1.00 34.21  ? 1903 DA  J P     1 
ATOM   6424 O  OP1   . DA  F 3 3   ? -5.863  38.689  -67.296 1.00 36.87  ? 1903 DA  J OP1   1 
ATOM   6425 O  OP2   . DA  F 3 3   ? -7.238  40.622  -66.416 1.00 35.18  ? 1903 DA  J OP2   1 
ATOM   6426 O  "O5'" . DA  F 3 3   ? -5.871  39.241  -64.845 1.00 33.89  ? 1903 DA  J "O5'" 1 
ATOM   6427 C  "C5'" . DA  F 3 3   ? -5.541  37.875  -64.617 1.00 34.59  ? 1903 DA  J "C5'" 1 
ATOM   6428 C  "C4'" . DA  F 3 3   ? -5.620  37.451  -63.159 1.00 35.10  ? 1903 DA  J "C4'" 1 
ATOM   6429 O  "O4'" . DA  F 3 3   ? -4.705  38.239  -62.365 1.00 37.58  ? 1903 DA  J "O4'" 1 
ATOM   6430 C  "C3'" . DA  F 3 3   ? -6.965  37.616  -62.461 1.00 33.43  ? 1903 DA  J "C3'" 1 
ATOM   6431 O  "O3'" . DA  F 3 3   ? -7.676  36.472  -62.720 1.00 29.15  ? 1903 DA  J "O3'" 1 
ATOM   6432 C  "C2'" . DA  F 3 3   ? -6.533  37.591  -61.003 1.00 36.61  ? 1903 DA  J "C2'" 1 
ATOM   6433 C  "C1'" . DA  F 3 3   ? -5.250  38.412  -61.077 1.00 39.28  ? 1903 DA  J "C1'" 1 
ATOM   6434 N  N9    . DA  F 3 3   ? -5.507  39.832  -60.898 1.00 42.57  ? 1903 DA  J N9    1 
ATOM   6435 C  C8    . DA  F 3 3   ? -6.111  40.695  -61.771 1.00 43.29  ? 1903 DA  J C8    1 
ATOM   6436 N  N7    . DA  F 3 3   ? -6.202  41.926  -61.324 1.00 44.89  ? 1903 DA  J N7    1 
ATOM   6437 C  C5    . DA  F 3 3   ? -5.612  41.859  -60.070 1.00 45.78  ? 1903 DA  J C5    1 
ATOM   6438 C  C6    . DA  F 3 3   ? -5.396  42.827  -59.063 1.00 46.78  ? 1903 DA  J C6    1 
ATOM   6439 N  N6    . DA  F 3 3   ? -5.763  44.106  -59.197 1.00 47.58  ? 1903 DA  J N6    1 
ATOM   6440 N  N1    . DA  F 3 3   ? -4.773  42.429  -57.921 1.00 47.40  ? 1903 DA  J N1    1 
ATOM   6441 C  C2    . DA  F 3 3   ? -4.403  41.142  -57.789 1.00 46.99  ? 1903 DA  J C2    1 
ATOM   6442 N  N3    . DA  F 3 3   ? -4.560  40.142  -58.664 1.00 46.50  ? 1903 DA  J N3    1 
ATOM   6443 C  C4    . DA  F 3 3   ? -5.176  40.573  -59.790 1.00 45.12  ? 1903 DA  J C4    1 
ATOM   6444 P  P     . DA  F 3 4   ? -9.254  36.365  -62.510 1.00 25.69  ? 1904 DA  J P     1 
ATOM   6445 O  OP1   . DA  F 3 4   ? -9.922  37.562  -63.060 1.00 24.48  ? 1904 DA  J OP1   1 
ATOM   6446 O  OP2   . DA  F 3 4   ? -9.512  35.943  -61.122 1.00 26.06  ? 1904 DA  J OP2   1 
ATOM   6447 O  "O5'" . DA  F 3 4   ? -9.454  35.097  -63.458 1.00 24.41  ? 1904 DA  J "O5'" 1 
ATOM   6448 C  "C5'" . DA  F 3 4   ? -9.157  35.195  -64.843 1.00 21.62  ? 1904 DA  J "C5'" 1 
ATOM   6449 C  "C4'" . DA  F 3 4   ? -9.842  34.042  -65.552 1.00 21.88  ? 1904 DA  J "C4'" 1 
ATOM   6450 O  "O4'" . DA  F 3 4   ? -9.340  32.757  -65.078 1.00 18.32  ? 1904 DA  J "O4'" 1 
ATOM   6451 C  "C3'" . DA  F 3 4   ? -11.355 34.006  -65.343 1.00 19.38  ? 1904 DA  J "C3'" 1 
ATOM   6452 O  "O3'" . DA  F 3 4   ? -11.949 33.536  -66.544 1.00 21.47  ? 1904 DA  J "O3'" 1 
ATOM   6453 C  "C2'" . DA  F 3 4   ? -11.517 33.053  -64.161 1.00 19.74  ? 1904 DA  J "C2'" 1 
ATOM   6454 C  "C1'" . DA  F 3 4   ? -10.374 32.055  -64.391 1.00 20.48  ? 1904 DA  J "C1'" 1 
ATOM   6455 N  N9    . DA  F 3 4   ? -9.721  31.526  -63.191 1.00 20.72  ? 1904 DA  J N9    1 
ATOM   6456 C  C8    . DA  F 3 4   ? -9.216  32.240  -62.144 1.00 19.49  ? 1904 DA  J C8    1 
ATOM   6457 N  N7    . DA  F 3 4   ? -8.673  31.493  -61.224 1.00 18.76  ? 1904 DA  J N7    1 
ATOM   6458 C  C5    . DA  F 3 4   ? -8.774  30.215  -61.695 1.00 18.92  ? 1904 DA  J C5    1 
ATOM   6459 C  C6    . DA  F 3 4   ? -8.370  28.957  -61.180 1.00 19.12  ? 1904 DA  J C6    1 
ATOM   6460 N  N6    . DA  F 3 4   ? -7.728  28.786  -60.023 1.00 14.77  ? 1904 DA  J N6    1 
ATOM   6461 N  N1    . DA  F 3 4   ? -8.668  27.868  -61.923 1.00 19.01  ? 1904 DA  J N1    1 
ATOM   6462 C  C2    . DA  F 3 4   ? -9.299  28.006  -63.095 1.00 18.68  ? 1904 DA  J C2    1 
ATOM   6463 N  N3    . DA  F 3 4   ? -9.714  29.133  -63.664 1.00 19.79  ? 1904 DA  J N3    1 
ATOM   6464 C  C4    . DA  F 3 4   ? -9.420  30.210  -62.915 1.00 19.96  ? 1904 DA  J C4    1 
ATOM   6465 P  P     . DC  F 3 5   ? -13.531 33.750  -66.769 1.00 22.83  ? 1905 DC  J P     1 
ATOM   6466 O  OP1   . DC  F 3 5   ? -13.766 33.675  -68.217 1.00 22.96  ? 1905 DC  J OP1   1 
ATOM   6467 O  OP2   . DC  F 3 5   ? -13.944 34.923  -65.993 1.00 24.42  ? 1905 DC  J OP2   1 
ATOM   6468 O  "O5'" . DC  F 3 5   ? -14.135 32.441  -66.045 1.00 23.09  ? 1905 DC  J "O5'" 1 
ATOM   6469 C  "C5'" . DC  F 3 5   ? -13.817 31.196  -66.607 1.00 23.22  ? 1905 DC  J "C5'" 1 
ATOM   6470 C  "C4'" . DC  F 3 5   ? -14.122 30.011  -65.709 1.00 20.09  ? 1905 DC  J "C4'" 1 
ATOM   6471 O  "O4'" . DC  F 3 5   ? -13.206 30.022  -64.608 1.00 19.26  ? 1905 DC  J "O4'" 1 
ATOM   6472 C  "C3'" . DC  F 3 5   ? -15.529 29.976  -65.106 1.00 21.27  ? 1905 DC  J "C3'" 1 
ATOM   6473 O  "O3'" . DC  F 3 5   ? -16.193 28.857  -65.661 1.00 20.38  ? 1905 DC  J "O3'" 1 
ATOM   6474 C  "C2'" . DC  F 3 5   ? -15.319 29.805  -63.607 1.00 18.45  ? 1905 DC  J "C2'" 1 
ATOM   6475 C  "C1'" . DC  F 3 5   ? -13.873 29.281  -63.624 1.00 20.41  ? 1905 DC  J "C1'" 1 
ATOM   6476 N  N1    . DC  F 3 5   ? -13.116 29.462  -62.396 1.00 22.13  ? 1905 DC  J N1    1 
ATOM   6477 C  C2    . DC  F 3 5   ? -12.523 28.308  -61.827 1.00 22.37  ? 1905 DC  J C2    1 
ATOM   6478 O  O2    . DC  F 3 5   ? -12.671 27.211  -62.365 1.00 22.52  ? 1905 DC  J O2    1 
ATOM   6479 N  N3    . DC  F 3 5   ? -11.827 28.438  -60.677 1.00 20.95  ? 1905 DC  J N3    1 
ATOM   6480 C  C4    . DC  F 3 5   ? -11.653 29.634  -60.114 1.00 20.93  ? 1905 DC  J C4    1 
ATOM   6481 N  N4    . DC  F 3 5   ? -10.931 29.665  -58.986 1.00 20.67  ? 1905 DC  J N4    1 
ATOM   6482 C  C5    . DC  F 3 5   ? -12.226 30.827  -60.675 1.00 21.58  ? 1905 DC  J C5    1 
ATOM   6483 C  C6    . DC  F 3 5   ? -12.949 30.692  -61.808 1.00 21.76  ? 1905 DC  J C6    1 
ATOM   6484 P  P     . DG  F 3 6   ? -17.739 28.620  -65.464 1.00 21.16  ? 1906 DG  J P     1 
ATOM   6485 O  OP1   . DG  F 3 6   ? -18.124 27.676  -66.527 1.00 23.71  ? 1906 DG  J OP1   1 
ATOM   6486 O  OP2   . DG  F 3 6   ? -18.463 29.928  -65.373 1.00 22.78  ? 1906 DG  J OP2   1 
ATOM   6487 O  "O5'" . DG  F 3 6   ? -17.876 27.888  -64.079 1.00 20.17  ? 1906 DG  J "O5'" 1 
ATOM   6488 C  "C5'" . DG  F 3 6   ? -17.444 26.521  -64.021 1.00 22.74  ? 1906 DG  J "C5'" 1 
ATOM   6489 C  "C4'" . DG  F 3 6   ? -17.338 26.071  -62.587 1.00 22.81  ? 1906 DG  J "C4'" 1 
ATOM   6490 O  "O4'" . DG  F 3 6   ? -16.357 26.852  -61.894 1.00 25.20  ? 1906 DG  J "O4'" 1 
ATOM   6491 C  "C3'" . DG  F 3 6   ? -18.612 26.230  -61.765 1.00 24.19  ? 1906 DG  J "C3'" 1 
ATOM   6492 O  "O3'" . DG  F 3 6   ? -19.248 24.956  -61.764 1.00 25.14  ? 1906 DG  J "O3'" 1 
ATOM   6493 C  "C2'" . DG  F 3 6   ? -18.135 26.651  -60.371 1.00 23.84  ? 1906 DG  J "C2'" 1 
ATOM   6494 C  "C1'" . DG  F 3 6   ? -16.615 26.641  -60.518 1.00 24.47  ? 1906 DG  J "C1'" 1 
ATOM   6495 N  N9    . DG  F 3 6   ? -15.927 27.659  -59.729 1.00 24.80  ? 1906 DG  J N9    1 
ATOM   6496 C  C8    . DG  F 3 6   ? -16.026 29.023  -59.768 1.00 27.45  ? 1906 DG  J C8    1 
ATOM   6497 N  N7    . DG  F 3 6   ? -15.243 29.618  -58.899 1.00 24.93  ? 1906 DG  J N7    1 
ATOM   6498 C  C5    . DG  F 3 6   ? -14.617 28.581  -58.217 1.00 22.99  ? 1906 DG  J C5    1 
ATOM   6499 C  C6    . DG  F 3 6   ? -13.675 28.579  -57.140 1.00 22.48  ? 1906 DG  J C6    1 
ATOM   6500 O  O6    . DG  F 3 6   ? -13.213 29.569  -56.569 1.00 20.84  ? 1906 DG  J O6    1 
ATOM   6501 N  N1    . DG  F 3 6   ? -13.289 27.283  -56.739 1.00 20.70  ? 1906 DG  J N1    1 
ATOM   6502 C  C2    . DG  F 3 6   ? -13.794 26.143  -57.336 1.00 23.04  ? 1906 DG  J C2    1 
ATOM   6503 N  N2    . DG  F 3 6   ? -13.402 24.948  -56.890 1.00 20.98  ? 1906 DG  J N2    1 
ATOM   6504 N  N3    . DG  F 3 6   ? -14.684 26.144  -58.327 1.00 24.17  ? 1906 DG  J N3    1 
ATOM   6505 C  C4    . DG  F 3 6   ? -15.037 27.382  -58.723 1.00 23.69  ? 1906 DG  J C4    1 
ATOM   6506 P  P     . DC  F 3 7   ? -20.674 24.689  -61.095 1.00 25.26  ? 1907 DC  J P     1 
ATOM   6507 O  OP1   . DC  F 3 7   ? -21.211 23.433  -61.653 1.00 29.33  ? 1907 DC  J OP1   1 
ATOM   6508 O  OP2   . DC  F 3 7   ? -21.483 25.921  -61.139 1.00 23.08  ? 1907 DC  J OP2   1 
ATOM   6509 O  "O5'" . DC  F 3 7   ? -20.345 24.398  -59.567 1.00 26.44  ? 1907 DC  J "O5'" 1 
ATOM   6510 C  "C5'" . DC  F 3 7   ? -19.530 23.307  -59.147 1.00 29.40  ? 1907 DC  J "C5'" 1 
ATOM   6511 C  "C4'" . DC  F 3 7   ? -19.326 23.422  -57.653 1.00 29.41  ? 1907 DC  J "C4'" 1 
ATOM   6512 O  "O4'" . DC  F 3 7   ? -18.318 24.443  -57.383 1.00 29.35  ? 1907 DC  J "O4'" 1 
ATOM   6513 C  "C3'" . DC  F 3 7   ? -20.591 23.815  -56.876 1.00 29.20  ? 1907 DC  J "C3'" 1 
ATOM   6514 O  "O3'" . DC  F 3 7   ? -20.820 22.913  -55.817 1.00 29.85  ? 1907 DC  J "O3'" 1 
ATOM   6515 C  "C2'" . DC  F 3 7   ? -20.226 25.178  -56.318 1.00 30.46  ? 1907 DC  J "C2'" 1 
ATOM   6516 C  "C1'" . DC  F 3 7   ? -18.707 24.984  -56.158 1.00 27.91  ? 1907 DC  J "C1'" 1 
ATOM   6517 N  N1    . DC  F 3 7   ? -17.987 26.254  -55.898 1.00 27.00  ? 1907 DC  J N1    1 
ATOM   6518 C  C2    . DC  F 3 7   ? -16.913 26.257  -54.983 1.00 24.92  ? 1907 DC  J C2    1 
ATOM   6519 O  O2    . DC  F 3 7   ? -16.567 25.206  -54.418 1.00 25.41  ? 1907 DC  J O2    1 
ATOM   6520 N  N3    . DC  F 3 7   ? -16.292 27.420  -54.747 1.00 21.82  ? 1907 DC  J N3    1 
ATOM   6521 C  C4    . DC  F 3 7   ? -16.664 28.544  -55.348 1.00 22.05  ? 1907 DC  J C4    1 
ATOM   6522 N  N4    . DC  F 3 7   ? -15.993 29.667  -55.061 1.00 20.39  ? 1907 DC  J N4    1 
ATOM   6523 C  C5    . DC  F 3 7   ? -17.743 28.564  -56.288 1.00 24.69  ? 1907 DC  J C5    1 
ATOM   6524 C  C6    . DC  F 3 7   ? -18.369 27.407  -56.519 1.00 25.01  ? 1907 DC  J C6    1 
ATOM   6525 P  P     . DT  F 3 8   ? -22.167 22.845  -54.933 1.00 28.89  ? 1908 DT  J P     1 
ATOM   6526 O  OP1   . DT  F 3 8   ? -22.974 21.763  -55.509 1.00 27.33  ? 1908 DT  J OP1   1 
ATOM   6527 O  OP2   . DT  F 3 8   ? -22.780 24.185  -54.725 1.00 26.80  ? 1908 DT  J OP2   1 
ATOM   6528 O  "O5'" . DT  F 3 8   ? -21.552 22.365  -53.531 1.00 27.73  ? 1908 DT  J "O5'" 1 
ATOM   6529 C  "C5'" . DT  F 3 8   ? -20.536 21.335  -53.486 1.00 26.44  ? 1908 DT  J "C5'" 1 
ATOM   6530 C  "C4'" . DT  F 3 8   ? -19.834 21.371  -52.137 1.00 26.42  ? 1908 DT  J "C4'" 1 
ATOM   6531 O  "O4'" . DT  F 3 8   ? -18.880 22.455  -52.110 1.00 26.09  ? 1908 DT  J "O4'" 1 
ATOM   6532 C  "C3'" . DT  F 3 8   ? -20.789 21.600  -50.971 1.00 26.18  ? 1908 DT  J "C3'" 1 
ATOM   6533 O  "O3'" . DT  F 3 8   ? -20.720 20.475  -50.149 1.00 29.48  ? 1908 DT  J "O3'" 1 
ATOM   6534 C  "C2'" . DT  F 3 8   ? -20.308 22.842  -50.248 1.00 24.54  ? 1908 DT  J "C2'" 1 
ATOM   6535 C  "C1'" . DT  F 3 8   ? -18.992 23.188  -50.914 1.00 25.59  ? 1908 DT  J "C1'" 1 
ATOM   6536 N  N1    . DT  F 3 8   ? -18.892 24.622  -51.278 1.00 23.01  ? 1908 DT  J N1    1 
ATOM   6537 C  C2    . DT  F 3 8   ? -17.895 25.349  -50.662 1.00 23.90  ? 1908 DT  J C2    1 
ATOM   6538 O  O2    . DT  F 3 8   ? -17.121 24.885  -49.835 1.00 24.50  ? 1908 DT  J O2    1 
ATOM   6539 N  N3    . DT  F 3 8   ? -17.838 26.652  -51.047 1.00 20.38  ? 1908 DT  J N3    1 
ATOM   6540 C  C4    . DT  F 3 8   ? -18.666 27.295  -51.943 1.00 20.50  ? 1908 DT  J C4    1 
ATOM   6541 O  O4    . DT  F 3 8   ? -18.495 28.476  -52.200 1.00 20.61  ? 1908 DT  J O4    1 
ATOM   6542 C  C5    . DT  F 3 8   ? -19.685 26.478  -52.569 1.00 21.33  ? 1908 DT  J C5    1 
ATOM   6543 C  C7    . DT  F 3 8   ? -20.631 27.079  -53.566 1.00 19.74  ? 1908 DT  J C7    1 
ATOM   6544 C  C6    . DT  F 3 8   ? -19.756 25.183  -52.204 1.00 22.11  ? 1908 DT  J C6    1 
ATOM   6545 P  P     . DA  F 3 9   ? -21.678 20.326  -48.873 1.00 33.36  ? 1909 DA  J P     1 
ATOM   6546 O  OP1   . DA  F 3 9   ? -21.661 18.880  -48.577 1.00 33.29  ? 1909 DA  J OP1   1 
ATOM   6547 O  OP2   . DA  F 3 9   ? -22.942 21.062  -49.080 1.00 32.20  ? 1909 DA  J OP2   1 
ATOM   6548 O  "O5'" . DA  F 3 9   ? -20.901 21.150  -47.728 1.00 30.68  ? 1909 DA  J "O5'" 1 
ATOM   6549 C  "C5'" . DA  F 3 9   ? -19.573 20.820  -47.341 1.00 28.71  ? 1909 DA  J "C5'" 1 
ATOM   6550 C  "C4'" . DA  F 3 9   ? -19.130 21.762  -46.232 1.00 28.19  ? 1909 DA  J "C4'" 1 
ATOM   6551 O  "O4'" . DA  F 3 9   ? -18.815 23.062  -46.798 1.00 26.54  ? 1909 DA  J "O4'" 1 
ATOM   6552 C  "C3'" . DA  F 3 9   ? -20.186 22.005  -45.150 1.00 28.36  ? 1909 DA  J "C3'" 1 
ATOM   6553 O  "O3'" . DA  F 3 9   ? -19.535 21.804  -43.910 1.00 30.24  ? 1909 DA  J "O3'" 1 
ATOM   6554 C  "C2'" . DA  F 3 9   ? -20.665 23.444  -45.383 1.00 27.09  ? 1909 DA  J "C2'" 1 
ATOM   6555 C  "C1'" . DA  F 3 9   ? -19.470 24.085  -46.085 1.00 26.78  ? 1909 DA  J "C1'" 1 
ATOM   6556 N  N9    . DA  F 3 9   ? -19.818 25.175  -47.004 1.00 25.74  ? 1909 DA  J N9    1 
ATOM   6557 C  C8    . DA  F 3 9   ? -20.812 25.200  -47.951 1.00 24.33  ? 1909 DA  J C8    1 
ATOM   6558 N  N7    . DA  F 3 9   ? -20.901 26.329  -48.610 1.00 23.62  ? 1909 DA  J N7    1 
ATOM   6559 C  C5    . DA  F 3 9   ? -19.884 27.092  -48.073 1.00 24.16  ? 1909 DA  J C5    1 
ATOM   6560 C  C6    . DA  F 3 9   ? -19.424 28.386  -48.355 1.00 24.88  ? 1909 DA  J C6    1 
ATOM   6561 N  N6    . DA  F 3 9   ? -19.989 29.162  -49.283 1.00 26.66  ? 1909 DA  J N6    1 
ATOM   6562 N  N1    . DA  F 3 9   ? -18.385 28.869  -47.629 1.00 24.83  ? 1909 DA  J N1    1 
ATOM   6563 C  C2    . DA  F 3 9   ? -17.837 28.090  -46.695 1.00 23.94  ? 1909 DA  J C2    1 
ATOM   6564 N  N3    . DA  F 3 9   ? -18.173 26.847  -46.360 1.00 25.00  ? 1909 DA  J N3    1 
ATOM   6565 C  C4    . DA  F 3 9   ? -19.214 26.405  -47.079 1.00 24.91  ? 1909 DA  J C4    1 
ATOM   6566 P  P     . DC  F 3 10  ? -20.225 21.983  -42.480 1.00 31.42  ? 1910 DC  J P     1 
ATOM   6567 O  OP1   . DC  F 3 10  ? -19.478 21.042  -41.626 1.00 32.60  ? 1910 DC  J OP1   1 
ATOM   6568 O  OP2   . DC  F 3 10  ? -21.701 21.903  -42.600 1.00 31.15  ? 1910 DC  J OP2   1 
ATOM   6569 O  "O5'" . DC  F 3 10  ? -19.908 23.485  -42.052 1.00 30.31  ? 1910 DC  J "O5'" 1 
ATOM   6570 C  "C5'" . DC  F 3 10  ? -18.565 23.947  -41.983 1.00 28.39  ? 1910 DC  J "C5'" 1 
ATOM   6571 C  "C4'" . DC  F 3 10  ? -18.529 25.464  -41.890 1.00 27.01  ? 1910 DC  J "C4'" 1 
ATOM   6572 O  "O4'" . DC  F 3 10  ? -19.010 26.053  -43.121 1.00 25.82  ? 1910 DC  J "O4'" 1 
ATOM   6573 C  "C3'" . DC  F 3 10  ? -19.375 26.068  -40.774 1.00 26.83  ? 1910 DC  J "C3'" 1 
ATOM   6574 O  "O3'" . DC  F 3 10  ? -18.506 26.637  -39.813 1.00 25.26  ? 1910 DC  J "O3'" 1 
ATOM   6575 C  "C2'" . DC  F 3 10  ? -20.244 27.123  -41.469 1.00 26.03  ? 1910 DC  J "C2'" 1 
ATOM   6576 C  "C1'" . DC  F 3 10  ? -19.521 27.328  -42.793 1.00 26.23  ? 1910 DC  J "C1'" 1 
ATOM   6577 N  N1    . DC  F 3 10  ? -20.405 27.810  -43.913 1.00 25.31  ? 1910 DC  J N1    1 
ATOM   6578 C  C2    . DC  F 3 10  ? -20.187 29.086  -44.467 1.00 24.89  ? 1910 DC  J C2    1 
ATOM   6579 O  O2    . DC  F 3 10  ? -19.277 29.809  -44.041 1.00 24.37  ? 1910 DC  J O2    1 
ATOM   6580 N  N3    . DC  F 3 10  ? -21.000 29.511  -45.472 1.00 23.97  ? 1910 DC  J N3    1 
ATOM   6581 C  C4    . DC  F 3 10  ? -21.989 28.724  -45.926 1.00 24.09  ? 1910 DC  J C4    1 
ATOM   6582 N  N4    . DC  F 3 10  ? -22.738 29.201  -46.935 1.00 22.71  ? 1910 DC  J N4    1 
ATOM   6583 C  C5    . DC  F 3 10  ? -22.232 27.417  -45.377 1.00 23.21  ? 1910 DC  J C5    1 
ATOM   6584 C  C6    . DC  F 3 10  ? -21.423 27.009  -44.380 1.00 24.26  ? 1910 DC  J C6    1 
ATOM   6585 P  P     . DC  F 3 11  ? -19.034 27.168  -38.398 1.00 25.83  ? 1911 DC  J P     1 
ATOM   6586 O  OP1   . DC  F 3 11  ? -17.996 26.850  -37.396 1.00 26.49  ? 1911 DC  J OP1   1 
ATOM   6587 O  OP2   . DC  F 3 11  ? -20.413 26.697  -38.183 1.00 25.86  ? 1911 DC  J OP2   1 
ATOM   6588 O  "O5'" . DC  F 3 11  ? -19.095 28.753  -38.532 1.00 28.90  ? 1911 DC  J "O5'" 1 
ATOM   6589 C  "C5'" . DC  F 3 11  ? -18.017 29.543  -39.033 1.00 32.21  ? 1911 DC  J "C5'" 1 
ATOM   6590 C  "C4'" . DC  F 3 11  ? -18.511 30.974  -39.217 1.00 35.78  ? 1911 DC  J "C4'" 1 
ATOM   6591 O  "O4'" . DC  F 3 11  ? -19.272 31.079  -40.453 1.00 35.89  ? 1911 DC  J "O4'" 1 
ATOM   6592 C  "C3'" . DC  F 3 11  ? -19.451 31.481  -38.124 1.00 37.70  ? 1911 DC  J "C3'" 1 
ATOM   6593 O  "O3'" . DC  F 3 11  ? -19.163 32.827  -37.833 1.00 41.94  ? 1911 DC  J "O3'" 1 
ATOM   6594 C  "C2'" . DC  F 3 11  ? -20.839 31.383  -38.742 1.00 36.72  ? 1911 DC  J "C2'" 1 
ATOM   6595 C  "C1'" . DC  F 3 11  ? -20.487 31.736  -40.180 1.00 35.11  ? 1911 DC  J "C1'" 1 
ATOM   6596 N  N1    . DC  F 3 11  ? -21.502 31.339  -41.190 1.00 33.45  ? 1911 DC  J N1    1 
ATOM   6597 C  C2    . DC  F 3 11  ? -21.923 32.277  -42.147 1.00 32.06  ? 1911 DC  J C2    1 
ATOM   6598 O  O2    . DC  F 3 11  ? -21.438 33.416  -42.142 1.00 29.72  ? 1911 DC  J O2    1 
ATOM   6599 N  N3    . DC  F 3 11  ? -22.849 31.895  -43.065 1.00 31.49  ? 1911 DC  J N3    1 
ATOM   6600 C  C4    . DC  F 3 11  ? -23.349 30.661  -43.043 1.00 30.85  ? 1911 DC  J C4    1 
ATOM   6601 N  N4    . DC  F 3 11  ? -24.254 30.343  -43.962 1.00 30.58  ? 1911 DC  J N4    1 
ATOM   6602 C  C5    . DC  F 3 11  ? -22.938 29.696  -42.077 1.00 32.13  ? 1911 DC  J C5    1 
ATOM   6603 C  C6    . DC  F 3 11  ? -22.023 30.077  -41.180 1.00 33.05  ? 1911 DC  J C6    1 
ATOM   6604 P  P     . DA  F 3 12  ? -19.332 33.384  -36.348 1.00 44.38  ? 1912 DA  J P     1 
ATOM   6605 O  OP1   . DA  F 3 12  ? -17.992 33.296  -35.736 1.00 44.71  ? 1912 DA  J OP1   1 
ATOM   6606 O  OP2   . DA  F 3 12  ? -20.530 32.774  -35.702 1.00 43.01  ? 1912 DA  J OP2   1 
ATOM   6607 O  "O5'" . DA  F 3 12  ? -19.635 34.937  -36.548 1.00 45.91  ? 1912 DA  J "O5'" 1 
ATOM   6608 C  "C5'" . DA  F 3 12  ? -19.245 35.649  -37.717 1.00 47.62  ? 1912 DA  J "C5'" 1 
ATOM   6609 C  "C4'" . DA  F 3 12  ? -20.361 36.611  -38.096 1.00 48.97  ? 1912 DA  J "C4'" 1 
ATOM   6610 O  "O4'" . DA  F 3 12  ? -21.327 35.951  -38.958 1.00 48.55  ? 1912 DA  J "O4'" 1 
ATOM   6611 C  "C3'" . DA  F 3 12  ? -21.197 37.173  -36.951 1.00 50.40  ? 1912 DA  J "C3'" 1 
ATOM   6612 O  "O3'" . DA  F 3 12  ? -21.597 38.459  -37.347 1.00 53.74  ? 1912 DA  J "O3'" 1 
ATOM   6613 C  "C2'" . DA  F 3 12  ? -22.400 36.235  -36.894 1.00 49.19  ? 1912 DA  J "C2'" 1 
ATOM   6614 C  "C1'" . DA  F 3 12  ? -22.620 36.072  -38.394 1.00 47.77  ? 1912 DA  J "C1'" 1 
ATOM   6615 N  N9    . DA  F 3 12  ? -23.367 34.915  -38.864 1.00 45.96  ? 1912 DA  J N9    1 
ATOM   6616 C  C8    . DA  F 3 12  ? -23.459 33.662  -38.319 1.00 45.48  ? 1912 DA  J C8    1 
ATOM   6617 N  N7    . DA  F 3 12  ? -24.206 32.843  -39.022 1.00 44.79  ? 1912 DA  J N7    1 
ATOM   6618 C  C5    . DA  F 3 12  ? -24.617 33.612  -40.104 1.00 44.03  ? 1912 DA  J C5    1 
ATOM   6619 C  C6    . DA  F 3 12  ? -25.431 33.347  -41.225 1.00 42.23  ? 1912 DA  J C6    1 
ATOM   6620 N  N6    . DA  F 3 12  ? -25.996 32.165  -41.456 1.00 41.25  ? 1912 DA  J N6    1 
ATOM   6621 N  N1    . DA  F 3 12  ? -25.647 34.348  -42.107 1.00 42.19  ? 1912 DA  J N1    1 
ATOM   6622 C  C2    . DA  F 3 12  ? -25.081 35.541  -41.897 1.00 42.94  ? 1912 DA  J C2    1 
ATOM   6623 N  N3    . DA  F 3 12  ? -24.296 35.912  -40.885 1.00 43.92  ? 1912 DA  J N3    1 
ATOM   6624 C  C4    . DA  F 3 12  ? -24.104 34.893  -40.021 1.00 44.70  ? 1912 DA  J C4    1 
ATOM   6625 P  P     . DT  F 3 13  ? -21.810 39.619  -36.279 1.00 56.31  ? 1913 DT  J P     1 
ATOM   6626 O  OP1   . DT  F 3 13  ? -20.470 39.932  -35.723 1.00 56.39  ? 1913 DT  J OP1   1 
ATOM   6627 O  OP2   . DT  F 3 13  ? -22.934 39.242  -35.382 1.00 55.75  ? 1913 DT  J OP2   1 
ATOM   6628 O  "O5'" . DT  F 3 13  ? -22.289 40.834  -37.205 1.00 57.27  ? 1913 DT  J "O5'" 1 
ATOM   6629 C  "C5'" . DT  F 3 13  ? -22.441 40.686  -38.619 1.00 58.76  ? 1913 DT  J "C5'" 1 
ATOM   6630 C  "C4'" . DT  F 3 13  ? -23.904 40.663  -39.034 1.00 60.04  ? 1913 DT  J "C4'" 1 
ATOM   6631 O  "O4'" . DT  F 3 13  ? -24.365 39.294  -39.123 1.00 59.62  ? 1913 DT  J "O4'" 1 
ATOM   6632 C  "C3'" . DT  F 3 13  ? -24.904 41.369  -38.113 1.00 61.71  ? 1913 DT  J "C3'" 1 
ATOM   6633 O  "O3'" . DT  F 3 13  ? -25.669 42.285  -38.903 1.00 64.81  ? 1913 DT  J "O3'" 1 
ATOM   6634 C  "C2'" . DT  F 3 13  ? -25.759 40.221  -37.567 1.00 60.75  ? 1913 DT  J "C2'" 1 
ATOM   6635 C  "C1'" . DT  F 3 13  ? -25.729 39.293  -38.774 1.00 59.40  ? 1913 DT  J "C1'" 1 
ATOM   6636 N  N1    . DT  F 3 13  ? -26.206 37.870  -38.615 1.00 58.57  ? 1913 DT  J N1    1 
ATOM   6637 C  C2    . DT  F 3 13  ? -27.026 37.333  -39.596 1.00 57.81  ? 1913 DT  J C2    1 
ATOM   6638 O  O2    . DT  F 3 13  ? -27.398 37.946  -40.580 1.00 57.60  ? 1913 DT  J O2    1 
ATOM   6639 N  N3    . DT  F 3 13  ? -27.410 36.030  -39.388 1.00 57.24  ? 1913 DT  J N3    1 
ATOM   6640 C  C4    . DT  F 3 13  ? -27.066 35.216  -38.324 1.00 57.43  ? 1913 DT  J C4    1 
ATOM   6641 O  O4    . DT  F 3 13  ? -27.472 34.059  -38.245 1.00 57.04  ? 1913 DT  J O4    1 
ATOM   6642 C  C5    . DT  F 3 13  ? -26.203 35.829  -37.331 1.00 57.87  ? 1913 DT  J C5    1 
ATOM   6643 C  C7    . DT  F 3 13  ? -25.756 35.058  -36.122 1.00 57.72  ? 1913 DT  J C7    1 
ATOM   6644 C  C6    . DT  F 3 13  ? -25.820 37.106  -37.523 1.00 58.35  ? 1913 DT  J C6    1 
ATOM   6645 P  P     . DC  F 3 14  ? -26.374 43.601  -38.308 1.00 67.34  ? 1914 DC  J P     1 
ATOM   6646 O  OP1   . DC  F 3 14  ? -25.481 44.748  -38.591 1.00 66.93  ? 1914 DC  J OP1   1 
ATOM   6647 O  OP2   . DC  F 3 14  ? -26.786 43.329  -36.910 1.00 66.91  ? 1914 DC  J OP2   1 
ATOM   6648 O  "O5'" . DC  F 3 14  ? -27.710 43.735  -39.199 1.00 69.17  ? 1914 DC  J "O5'" 1 
ATOM   6649 C  "C5'" . DC  F 3 14  ? -28.036 42.812  -40.260 1.00 71.85  ? 1914 DC  J "C5'" 1 
ATOM   6650 C  "C4'" . DC  F 3 14  ? -29.415 42.170  -40.121 1.00 74.10  ? 1914 DC  J "C4'" 1 
ATOM   6651 O  "O4'" . DC  F 3 14  ? -29.263 40.777  -39.732 1.00 74.24  ? 1914 DC  J "O4'" 1 
ATOM   6652 C  "C3'" . DC  F 3 14  ? -30.389 42.787  -39.109 1.00 75.82  ? 1914 DC  J "C3'" 1 
ATOM   6653 O  "O3'" . DC  F 3 14  ? -31.635 43.107  -39.746 1.00 78.69  ? 1914 DC  J "O3'" 1 
ATOM   6654 C  "C2'" . DC  F 3 14  ? -30.575 41.697  -38.050 1.00 75.11  ? 1914 DC  J "C2'" 1 
ATOM   6655 C  "C1'" . DC  F 3 14  ? -30.333 40.435  -38.872 1.00 74.37  ? 1914 DC  J "C1'" 1 
ATOM   6656 N  N1    . DC  F 3 14  ? -29.996 39.202  -38.071 1.00 73.82  ? 1914 DC  J N1    1 
ATOM   6657 C  C2    . DC  F 3 14  ? -30.617 37.969  -38.357 1.00 73.27  ? 1914 DC  J C2    1 
ATOM   6658 O  O2    . DC  F 3 14  ? -31.446 37.883  -39.272 1.00 72.59  ? 1914 DC  J O2    1 
ATOM   6659 N  N3    . DC  F 3 14  ? -30.285 36.883  -37.608 1.00 73.24  ? 1914 DC  J N3    1 
ATOM   6660 C  C4    . DC  F 3 14  ? -29.385 36.983  -36.621 1.00 73.48  ? 1914 DC  J C4    1 
ATOM   6661 N  N4    . DC  F 3 14  ? -29.098 35.884  -35.915 1.00 73.41  ? 1914 DC  J N4    1 
ATOM   6662 C  C5    . DC  F 3 14  ? -28.747 38.223  -36.310 1.00 73.63  ? 1914 DC  J C5    1 
ATOM   6663 C  C6    . DC  F 3 14  ? -29.080 39.284  -37.055 1.00 73.84  ? 1914 DC  J C6    1 
ATOM   6664 P  P     . DC  F 3 15  ? -32.662 44.193  -39.150 1.00 80.73  ? 1915 DC  J P     1 
ATOM   6665 O  OP1   . DC  F 3 15  ? -32.851 45.207  -40.213 1.00 80.75  ? 1915 DC  J OP1   1 
ATOM   6666 O  OP2   . DC  F 3 15  ? -32.196 44.623  -37.808 1.00 80.51  ? 1915 DC  J OP2   1 
ATOM   6667 O  "O5'" . DC  F 3 15  ? -34.022 43.361  -38.940 1.00 81.93  ? 1915 DC  J "O5'" 1 
ATOM   6668 C  "C5'" . DC  F 3 15  ? -34.935 43.096  -40.015 1.00 83.85  ? 1915 DC  J "C5'" 1 
ATOM   6669 C  "C4'" . DC  F 3 15  ? -35.745 41.831  -39.764 1.00 85.49  ? 1915 DC  J "C4'" 1 
ATOM   6670 O  "O4'" . DC  F 3 15  ? -34.877 40.776  -39.263 1.00 85.78  ? 1915 DC  J "O4'" 1 
ATOM   6671 C  "C3'" . DC  F 3 15  ? -36.886 41.958  -38.752 1.00 86.77  ? 1915 DC  J "C3'" 1 
ATOM   6672 O  "O3'" . DC  F 3 15  ? -38.056 41.282  -39.242 1.00 88.61  ? 1915 DC  J "O3'" 1 
ATOM   6673 C  "C2'" . DC  F 3 15  ? -36.309 41.271  -37.516 1.00 86.52  ? 1915 DC  J "C2'" 1 
ATOM   6674 C  "C1'" . DC  F 3 15  ? -35.522 40.146  -38.177 1.00 86.17  ? 1915 DC  J "C1'" 1 
ATOM   6675 N  N1    . DC  F 3 15  ? -34.540 39.451  -37.269 1.00 86.26  ? 1915 DC  J N1    1 
ATOM   6676 C  C2    . DC  F 3 15  ? -34.595 38.049  -37.114 1.00 86.13  ? 1915 DC  J C2    1 
ATOM   6677 O  O2    . DC  F 3 15  ? -35.441 37.383  -37.728 1.00 85.90  ? 1915 DC  J O2    1 
ATOM   6678 N  N3    . DC  F 3 15  ? -33.705 37.445  -36.282 1.00 86.10  ? 1915 DC  J N3    1 
ATOM   6679 C  C4    . DC  F 3 15  ? -32.798 38.175  -35.623 1.00 86.24  ? 1915 DC  J C4    1 
ATOM   6680 N  N4    . DC  F 3 15  ? -31.947 37.530  -34.818 1.00 86.32  ? 1915 DC  J N4    1 
ATOM   6681 C  C5    . DC  F 3 15  ? -32.723 39.597  -35.761 1.00 86.23  ? 1915 DC  J C5    1 
ATOM   6682 C  C6    . DC  F 3 15  ? -33.605 40.185  -36.584 1.00 86.26  ? 1915 DC  J C6    1 
ATOM   6683 P  P     . DA  F 3 16  ? -39.468 41.323  -38.471 1.00 89.84  ? 1916 DA  J P     1 
ATOM   6684 O  OP1   . DA  F 3 16  ? -40.020 42.682  -38.665 1.00 90.01  ? 1916 DA  J OP1   1 
ATOM   6685 O  OP2   . DA  F 3 16  ? -39.295 40.801  -37.096 1.00 89.66  ? 1916 DA  J OP2   1 
ATOM   6686 O  "O5'" . DA  F 3 16  ? -40.395 40.263  -39.249 1.00 90.76  ? 1916 DA  J "O5'" 1 
ATOM   6687 C  "C5'" . DA  F 3 16  ? -39.867 39.268  -40.146 1.00 91.96  ? 1916 DA  J "C5'" 1 
ATOM   6688 C  "C4'" . DA  F 3 16  ? -40.153 37.827  -39.723 1.00 92.85  ? 1916 DA  J "C4'" 1 
ATOM   6689 O  "O4'" . DA  F 3 16  ? -39.118 37.365  -38.812 1.00 92.94  ? 1916 DA  J "O4'" 1 
ATOM   6690 C  "C3'" . DA  F 3 16  ? -41.486 37.530  -39.028 1.00 93.48  ? 1916 DA  J "C3'" 1 
ATOM   6691 O  "O3'" . DA  F 3 16  ? -42.037 36.305  -39.536 1.00 94.36  ? 1916 DA  J "O3'" 1 
ATOM   6692 C  "C2'" . DA  F 3 16  ? -41.083 37.396  -37.559 1.00 93.29  ? 1916 DA  J "C2'" 1 
ATOM   6693 C  "C1'" . DA  F 3 16  ? -39.720 36.725  -37.704 1.00 92.96  ? 1916 DA  J "C1'" 1 
ATOM   6694 N  N9    . DA  F 3 16  ? -38.820 36.837  -36.553 1.00 92.77  ? 1916 DA  J N9    1 
ATOM   6695 C  C8    . DA  F 3 16  ? -38.318 37.986  -36.002 1.00 92.55  ? 1916 DA  J C8    1 
ATOM   6696 N  N7    . DA  F 3 16  ? -37.523 37.781  -34.978 1.00 92.53  ? 1916 DA  J N7    1 
ATOM   6697 C  C5    . DA  F 3 16  ? -37.495 36.401  -34.845 1.00 92.65  ? 1916 DA  J C5    1 
ATOM   6698 C  C6    . DA  F 3 16  ? -36.830 35.536  -33.942 1.00 92.53  ? 1916 DA  J C6    1 
ATOM   6699 N  N6    . DA  F 3 16  ? -36.031 35.970  -32.960 1.00 92.22  ? 1916 DA  J N6    1 
ATOM   6700 N  N1    . DA  F 3 16  ? -37.016 34.202  -34.085 1.00 92.59  ? 1916 DA  J N1    1 
ATOM   6701 C  C2    . DA  F 3 16  ? -37.816 33.759  -35.069 1.00 92.64  ? 1916 DA  J C2    1 
ATOM   6702 N  N3    . DA  F 3 16  ? -38.490 34.474  -35.977 1.00 92.71  ? 1916 DA  J N3    1 
ATOM   6703 C  C4    . DA  F 3 16  ? -38.289 35.800  -35.812 1.00 92.78  ? 1916 DA  J C4    1 
ATOM   6704 P  P     . DA  F 3 17  ? -43.609 36.089  -39.781 1.00 95.05  ? 1917 DA  J P     1 
ATOM   6705 O  OP1   . DA  F 3 17  ? -43.745 35.177  -40.939 1.00 94.99  ? 1917 DA  J OP1   1 
ATOM   6706 O  OP2   . DA  F 3 17  ? -44.276 37.412  -39.813 1.00 94.80  ? 1917 DA  J OP2   1 
ATOM   6707 O  "O5'" . DA  F 3 17  ? -44.096 35.329  -38.457 1.00 95.68  ? 1917 DA  J "O5'" 1 
ATOM   6708 C  "C5'" . DA  F 3 17  ? -43.802 33.946  -38.221 1.00 96.59  ? 1917 DA  J "C5'" 1 
ATOM   6709 C  "C4'" . DA  F 3 17  ? -43.621 33.673  -36.732 1.00 97.30  ? 1917 DA  J "C4'" 1 
ATOM   6710 O  "O4'" . DA  F 3 17  ? -42.894 34.774  -36.121 1.00 97.67  ? 1917 DA  J "O4'" 1 
ATOM   6711 C  "C3'" . DA  F 3 17  ? -44.903 33.514  -35.912 1.00 97.61  ? 1917 DA  J "C3'" 1 
ATOM   6712 O  "O3'" . DA  F 3 17  ? -44.710 32.531  -34.887 1.00 97.87  ? 1917 DA  J "O3'" 1 
ATOM   6713 C  "C2'" . DA  F 3 17  ? -45.091 34.906  -35.313 1.00 97.75  ? 1917 DA  J "C2'" 1 
ATOM   6714 C  "C1'" . DA  F 3 17  ? -43.639 35.291  -35.033 1.00 97.90  ? 1917 DA  J "C1'" 1 
ATOM   6715 N  N9    . DA  F 3 17  ? -43.377 36.728  -34.888 1.00 98.09  ? 1917 DA  J N9    1 
ATOM   6716 C  C8    . DA  F 3 17  ? -44.153 37.768  -35.327 1.00 98.10  ? 1917 DA  J C8    1 
ATOM   6717 N  N7    . DA  F 3 17  ? -43.665 38.953  -35.049 1.00 98.15  ? 1917 DA  J N7    1 
ATOM   6718 C  C5    . DA  F 3 17  ? -42.484 38.679  -34.380 1.00 98.18  ? 1917 DA  J C5    1 
ATOM   6719 C  C6    . DA  F 3 17  ? -41.491 39.511  -33.814 1.00 98.17  ? 1917 DA  J C6    1 
ATOM   6720 N  N6    . DA  F 3 17  ? -41.547 40.847  -33.845 1.00 98.19  ? 1917 DA  J N6    1 
ATOM   6721 N  N1    . DA  F 3 17  ? -40.432 38.919  -33.213 1.00 98.08  ? 1917 DA  J N1    1 
ATOM   6722 C  C2    . DA  F 3 17  ? -40.374 37.579  -33.179 1.00 98.03  ? 1917 DA  J C2    1 
ATOM   6723 N  N3    . DA  F 3 17  ? -41.246 36.697  -33.676 1.00 98.11  ? 1917 DA  J N3    1 
ATOM   6724 C  C4    . DA  F 3 17  ? -42.291 37.312  -34.267 1.00 98.15  ? 1917 DA  J C4    1 
ATOM   6725 P  P     . DC  F 3 18  ? -45.911 31.661  -34.268 1.00 98.15  ? 1918 DC  J P     1 
ATOM   6726 O  OP1   . DC  F 3 18  ? -45.384 30.993  -33.057 1.00 98.12  ? 1918 DC  J OP1   1 
ATOM   6727 O  OP2   . DC  F 3 18  ? -46.463 30.834  -35.362 1.00 98.25  ? 1918 DC  J OP2   1 
ATOM   6728 O  "O5'" . DC  F 3 18  ? -47.025 32.732  -33.832 1.00 98.08  ? 1918 DC  J "O5'" 1 
ATOM   6729 C  "C5'" . DC  F 3 18  ? -48.175 32.339  -33.068 1.00 97.97  ? 1918 DC  J "C5'" 1 
ATOM   6730 C  "C4'" . DC  F 3 18  ? -48.465 33.294  -31.918 1.00 97.89  ? 1918 DC  J "C4'" 1 
ATOM   6731 O  "O4'" . DC  F 3 18  ? -47.332 34.161  -31.676 1.00 98.07  ? 1918 DC  J "O4'" 1 
ATOM   6732 C  "C3'" . DC  F 3 18  ? -49.617 34.259  -32.146 1.00 97.81  ? 1918 DC  J "C3'" 1 
ATOM   6733 O  "O3'" . DC  F 3 18  ? -50.823 33.657  -31.712 1.00 97.71  ? 1918 DC  J "O3'" 1 
ATOM   6734 C  "C2'" . DC  F 3 18  ? -49.262 35.468  -31.277 1.00 97.87  ? 1918 DC  J "C2'" 1 
ATOM   6735 C  "C1'" . DC  F 3 18  ? -47.766 35.314  -30.978 1.00 98.02  ? 1918 DC  J "C1'" 1 
ATOM   6736 N  N1    . DC  F 3 18  ? -46.898 36.528  -31.328 1.00 98.10  ? 1918 DC  J N1    1 
ATOM   6737 C  C2    . DC  F 3 18  ? -45.571 36.401  -31.811 1.00 98.06  ? 1918 DC  J C2    1 
ATOM   6738 O  O2    . DC  F 3 18  ? -45.051 35.291  -31.978 1.00 97.95  ? 1918 DC  J O2    1 
ATOM   6739 N  N3    . DC  F 3 18  ? -44.859 37.525  -32.097 1.00 98.01  ? 1918 DC  J N3    1 
ATOM   6740 C  C4    . DC  F 3 18  ? -45.399 38.735  -31.923 1.00 98.04  ? 1918 DC  J C4    1 
ATOM   6741 N  N4    . DC  F 3 18  ? -44.651 39.802  -32.221 1.00 97.90  ? 1918 DC  J N4    1 
ATOM   6742 C  C5    . DC  F 3 18  ? -46.733 38.896  -31.433 1.00 98.05  ? 1918 DC  J C5    1 
ATOM   6743 C  C6    . DC  F 3 18  ? -47.428 37.783  -31.152 1.00 98.08  ? 1918 DC  J C6    1 
HETATM 6744 P  PA    . TTP G 4 .   ? -1.259  9.220   3.836   1.00 23.81  ? 414  TTP A PA    1 
HETATM 6745 O  O1A   . TTP G 4 .   ? -2.724  9.472   3.551   1.00 32.86  ? 414  TTP A O1A   1 
HETATM 6746 O  O2A   . TTP G 4 .   ? -0.374  9.037   2.646   1.00 25.32  ? 414  TTP A O2A   1 
HETATM 6747 O  O3A   . TTP G 4 .   ? -0.506  10.368  4.683   1.00 21.25  ? 414  TTP A O3A   1 
HETATM 6748 P  PB    . TTP G 4 .   ? -1.117  11.263  5.868   1.00 19.98  ? 414  TTP A PB    1 
HETATM 6749 O  O1B   . TTP G 4 .   ? -2.570  11.020  6.198   1.00 21.96  ? 414  TTP A O1B   1 
HETATM 6750 O  O2B   . TTP G 4 .   ? -0.189  11.166  7.047   1.00 19.18  ? 414  TTP A O2B   1 
HETATM 6751 O  O3B   . TTP G 4 .   ? -0.863  12.728  5.269   1.00 20.67  ? 414  TTP A O3B   1 
HETATM 6752 P  PG    . TTP G 4 .   ? -1.785  13.527  4.226   1.00 21.02  ? 414  TTP A PG    1 
HETATM 6753 O  O1G   . TTP G 4 .   ? -2.410  14.726  4.887   1.00 21.42  ? 414  TTP A O1G   1 
HETATM 6754 O  O2G   . TTP G 4 .   ? -0.842  14.121  3.229   1.00 18.91  ? 414  TTP A O2G   1 
HETATM 6755 O  O3G   . TTP G 4 .   ? -2.858  12.679  3.614   1.00 19.59  ? 414  TTP A O3G   1 
HETATM 6756 O  "O5'" . TTP G 4 .   ? -1.033  7.940   4.768   1.00 20.59  ? 414  TTP A "O5'" 1 
HETATM 6757 C  "C5'" . TTP G 4 .   ? -1.952  7.637   5.826   1.00 19.09  ? 414  TTP A "C5'" 1 
HETATM 6758 C  "C4'" . TTP G 4 .   ? -1.185  7.044   6.983   1.00 21.36  ? 414  TTP A "C4'" 1 
HETATM 6759 O  "O4'" . TTP G 4 .   ? -0.507  5.844   6.589   1.00 20.43  ? 414  TTP A "O4'" 1 
HETATM 6760 C  "C3'" . TTP G 4 .   ? -0.111  7.989   7.512   1.00 18.05  ? 414  TTP A "C3'" 1 
HETATM 6761 O  "O3'" . TTP G 4 .   ? -0.639  8.939   8.452   1.00 18.95  ? 414  TTP A "O3'" 1 
HETATM 6762 C  "C2'" . TTP G 4 .   ? 0.892   7.015   8.139   1.00 19.92  ? 414  TTP A "C2'" 1 
HETATM 6763 C  "C1'" . TTP G 4 .   ? 0.743   5.747   7.275   1.00 20.61  ? 414  TTP A "C1'" 1 
HETATM 6764 N  N1    . TTP G 4 .   ? 1.860   5.720   6.313   1.00 20.34  ? 414  TTP A N1    1 
HETATM 6765 C  C2    . TTP G 4 .   ? 3.002   4.933   6.598   1.00 21.09  ? 414  TTP A C2    1 
HETATM 6766 O  O2    . TTP G 4 .   ? 3.057   4.275   7.668   1.00 19.75  ? 414  TTP A O2    1 
HETATM 6767 N  N3    . TTP G 4 .   ? 4.033   4.903   5.740   1.00 22.85  ? 414  TTP A N3    1 
HETATM 6768 C  C4    . TTP G 4 .   ? 4.026   5.614   4.595   1.00 21.58  ? 414  TTP A C4    1 
HETATM 6769 O  O4    . TTP G 4 .   ? 4.997   5.568   3.820   1.00 21.74  ? 414  TTP A O4    1 
HETATM 6770 C  C5    . TTP G 4 .   ? 2.840   6.439   4.265   1.00 20.69  ? 414  TTP A C5    1 
HETATM 6771 C  C5M   . TTP G 4 .   ? 2.749   7.253   3.001   1.00 19.08  ? 414  TTP A C5M   1 
HETATM 6772 C  C6    . TTP G 4 .   ? 1.791   6.436   5.176   1.00 21.41  ? 414  TTP A C6    1 
HETATM 6773 CA CA    . CA  H 5 .   ? -4.210  8.063   2.400   1.00 48.12  ? 415  CA  A CA    1 
HETATM 6774 CA CA    . CA  I 5 .   ? -4.208  10.943  4.566   1.00 28.06  ? 416  CA  A CA    1 
HETATM 6775 CA CA    . CA  J 5 .   ? 3.453   9.714   -8.559  1.00 40.46  ? 417  CA  A CA    1 
HETATM 6776 N  N     . AF  K 6 .   ? 4.903   -4.956  5.549   1.00 31.86  ? 926  AF  E N     1 
HETATM 6777 C  C2    . AF  K 6 .   ? 5.225   -6.224  5.071   1.00 31.91  ? 926  AF  E C2    1 
HETATM 6778 C  C3    . AF  K 6 .   ? 5.130   -7.299  5.964   1.00 33.24  ? 926  AF  E C3    1 
HETATM 6779 C  C4    . AF  K 6 .   ? 5.430   -8.565  5.554   1.00 30.20  ? 926  AF  E C4    1 
HETATM 6780 C  C4A   . AF  K 6 .   ? 5.813   -8.780  4.223   1.00 33.53  ? 926  AF  E C4A   1 
HETATM 6781 C  C4B   . AF  K 6 .   ? 6.190   -10.029 3.536   1.00 35.34  ? 926  AF  E C4B   1 
HETATM 6782 C  C5    . AF  K 6 .   ? 6.253   -11.345 4.018   1.00 37.29  ? 926  AF  E C5    1 
HETATM 6783 C  C6    . AF  K 6 .   ? 6.631   -12.359 3.153   1.00 35.34  ? 926  AF  E C6    1 
HETATM 6784 C  C7    . AF  K 6 .   ? 6.925   -12.081 1.830   1.00 37.76  ? 926  AF  E C7    1 
HETATM 6785 C  C8    . AF  K 6 .   ? 6.878   -10.773 1.355   1.00 35.81  ? 926  AF  E C8    1 
HETATM 6786 C  C8A   . AF  K 6 .   ? 6.508   -9.756  2.205   1.00 34.52  ? 926  AF  E C8A   1 
HETATM 6787 C  C9    . AF  K 6 .   ? 6.346   -8.270  1.990   1.00 34.67  ? 926  AF  E C9    1 
HETATM 6788 C  C9A   . AF  K 6 .   ? 5.907   -7.718  3.328   1.00 34.24  ? 926  AF  E C9A   1 
HETATM 6789 C  C1    . AF  K 6 .   ? 5.594   -6.438  3.749   1.00 33.22  ? 926  AF  E C1    1 
HETATM 6790 P  PA    . TTP L 4 .   ? -5.594  19.148  -58.819 1.00 20.84  ? 1414 TTP B PA    1 
HETATM 6791 O  O1A   . TTP L 4 .   ? -5.818  17.720  -58.413 1.00 21.74  ? 1414 TTP B O1A   1 
HETATM 6792 O  O2A   . TTP L 4 .   ? -5.541  20.136  -57.678 1.00 22.35  ? 1414 TTP B O2A   1 
HETATM 6793 O  O3A   . TTP L 4 .   ? -4.212  19.302  -59.632 1.00 20.35  ? 1414 TTP B O3A   1 
HETATM 6794 P  PB    . TTP L 4 .   ? -3.631  18.362  -60.792 1.00 16.95  ? 1414 TTP B PB    1 
HETATM 6795 O  O1B   . TTP L 4 .   ? -4.335  17.045  -61.008 1.00 21.03  ? 1414 TTP B O1B   1 
HETATM 6796 O  O2B   . TTP L 4 .   ? -3.432  19.183  -62.032 1.00 16.64  ? 1414 TTP B O2B   1 
HETATM 6797 O  O3B   . TTP L 4 .   ? -2.162  18.064  -60.188 1.00 18.69  ? 1414 TTP B O3B   1 
HETATM 6798 P  PG    . TTP L 4 .   ? -1.692  16.964  -59.093 1.00 19.69  ? 1414 TTP B PG    1 
HETATM 6799 O  O1G   . TTP L 4 .   ? -0.846  15.909  -59.752 1.00 20.47  ? 1414 TTP B O1G   1 
HETATM 6800 O  O2G   . TTP L 4 .   ? -0.831  17.702  -58.127 1.00 18.78  ? 1414 TTP B O2G   1 
HETATM 6801 O  O3G   . TTP L 4 .   ? -2.856  16.369  -58.376 1.00 18.98  ? 1414 TTP B O3G   1 
HETATM 6802 O  "O5'" . TTP L 4 .   ? -6.682  19.644  -59.875 1.00 20.76  ? 1414 TTP B "O5'" 1 
HETATM 6803 C  "C5'" . TTP L 4 .   ? -7.273  18.755  -60.824 1.00 19.92  ? 1414 TTP B "C5'" 1 
HETATM 6804 C  "C4'" . TTP L 4 .   ? -7.633  19.572  -62.044 1.00 19.15  ? 1414 TTP B "C4'" 1 
HETATM 6805 O  "O4'" . TTP L 4 .   ? -8.579  20.607  -61.726 1.00 18.98  ? 1414 TTP B "O4'" 1 
HETATM 6806 C  "C3'" . TTP L 4 .   ? -6.415  20.272  -62.628 1.00 16.88  ? 1414 TTP B "C3'" 1 
HETATM 6807 O  "O3'" . TTP L 4 .   ? -5.687  19.417  -63.508 1.00 15.93  ? 1414 TTP B "O3'" 1 
HETATM 6808 C  "C2'" . TTP L 4 .   ? -7.040  21.486  -63.323 1.00 17.73  ? 1414 TTP B "C2'" 1 
HETATM 6809 C  "C1'" . TTP L 4 .   ? -8.295  21.791  -62.484 1.00 17.65  ? 1414 TTP B "C1'" 1 
HETATM 6810 N  N1    . TTP L 4 .   ? -7.996  22.911  -61.574 1.00 18.34  ? 1414 TTP B N1    1 
HETATM 6811 C  C2    . TTP L 4 .   ? -8.368  24.228  -61.921 1.00 17.34  ? 1414 TTP B C2    1 
HETATM 6812 O  O2    . TTP L 4 .   ? -8.932  24.438  -63.010 1.00 14.78  ? 1414 TTP B O2    1 
HETATM 6813 N  N3    . TTP L 4 .   ? -8.095  25.279  -61.123 1.00 16.88  ? 1414 TTP B N3    1 
HETATM 6814 C  C4    . TTP L 4 .   ? -7.472  25.100  -59.961 1.00 19.15  ? 1414 TTP B C4    1 
HETATM 6815 O  O4    . TTP L 4 .   ? -7.232  26.098  -59.251 1.00 19.45  ? 1414 TTP B O4    1 
HETATM 6816 C  C5    . TTP L 4 .   ? -7.037  23.730  -59.554 1.00 17.54  ? 1414 TTP B C5    1 
HETATM 6817 C  C5M   . TTP L 4 .   ? -6.325  23.462  -58.240 1.00 18.81  ? 1414 TTP B C5M   1 
HETATM 6818 C  C6    . TTP L 4 .   ? -7.341  22.681  -60.404 1.00 18.62  ? 1414 TTP B C6    1 
HETATM 6819 CA CA    . CA  M 5 .   ? -7.003  16.347  -55.061 1.00 56.66  ? 1415 CA  B CA    1 
HETATM 6820 CA CA    . CA  N 5 .   ? -4.979  15.645  -59.294 1.00 27.39  ? 1416 CA  B CA    1 
HETATM 6821 CA CA    . CA  O 5 .   ? -2.952  23.951  -46.392 1.00 43.49  ? 1417 CA  B CA    1 
HETATM 6822 N  N     . AF  P 6 .   ? -16.930 29.717  -60.661 1.00 30.56  ? 1926 AF  J N     1 
HETATM 6823 C  C2    . AF  P 6 .   ? -18.053 30.419  -60.222 1.00 31.38  ? 1926 AF  J C2    1 
HETATM 6824 C  C3    . AF  P 6 .   ? -19.154 30.563  -61.089 1.00 32.17  ? 1926 AF  J C3    1 
HETATM 6825 C  C4    . AF  P 6 .   ? -20.268 31.254  -60.655 1.00 32.19  ? 1926 AF  J C4    1 
HETATM 6826 C  C4A   . AF  P 6 .   ? -20.323 31.800  -59.364 1.00 34.10  ? 1926 AF  J C4A   1 
HETATM 6827 C  C4B   . AF  P 6 .   ? -21.386 32.559  -58.653 1.00 35.50  ? 1926 AF  J C4B   1 
HETATM 6828 C  C5    . AF  P 6 .   ? -22.671 32.965  -59.073 1.00 36.15  ? 1926 AF  J C5    1 
HETATM 6829 C  C6    . AF  P 6 .   ? -23.473 33.673  -58.208 1.00 35.25  ? 1926 AF  J C6    1 
HETATM 6830 C  C7    . AF  P 6 .   ? -23.039 33.988  -56.922 1.00 37.70  ? 1926 AF  J C7    1 
HETATM 6831 C  C8    . AF  P 6 .   ? -21.772 33.589  -56.501 1.00 37.01  ? 1926 AF  J C8    1 
HETATM 6832 C  C8A   . AF  P 6 .   ? -20.954 32.877  -57.363 1.00 35.90  ? 1926 AF  J C8A   1 
HETATM 6833 C  C9    . AF  P 6 .   ? -19.557 32.321  -57.188 1.00 34.53  ? 1926 AF  J C9    1 
HETATM 6834 C  C9A   . AF  P 6 .   ? -19.224 31.639  -58.501 1.00 35.67  ? 1926 AF  J C9A   1 
HETATM 6835 C  C1    . AF  P 6 .   ? -18.104 30.950  -58.935 1.00 32.05  ? 1926 AF  J C1    1 
HETATM 6836 O  O     . HOH Q 7 .   ? -22.035 0.934   3.813   1.00 74.59  ? 349  HOH A O     1 
HETATM 6837 O  O     . HOH Q 7 .   ? 3.473   7.577   22.465  1.00 49.55  ? 350  HOH A O     1 
HETATM 6838 O  O     . HOH Q 7 .   ? 0.546   -7.796  -19.434 1.00 56.32  ? 351  HOH A O     1 
HETATM 6839 O  O     . HOH Q 7 .   ? 7.106   -9.989  14.563  1.00 65.82  ? 352  HOH A O     1 
HETATM 6840 O  O     . HOH Q 7 .   ? 16.096  -5.086  15.558  1.00 31.71  ? 353  HOH A O     1 
HETATM 6841 O  O     . HOH Q 7 .   ? 9.072   1.700   19.077  1.00 56.43  ? 354  HOH A O     1 
HETATM 6842 O  O     . HOH Q 7 .   ? 8.098   -0.040  -26.015 1.00 42.61  ? 355  HOH A O     1 
HETATM 6843 O  O     . HOH Q 7 .   ? 8.339   -31.054 7.904   1.00 42.75  ? 357  HOH A O     1 
HETATM 6844 O  O     . HOH Q 7 .   ? -1.464  17.731  26.996  1.00 47.37  ? 358  HOH A O     1 
HETATM 6845 O  O     . HOH Q 7 .   ? -15.252 8.405   -16.101 1.00 43.82  ? 365  HOH A O     1 
HETATM 6846 O  O     . HOH Q 7 .   ? -16.089 23.228  -10.093 1.00 47.32  ? 366  HOH A O     1 
HETATM 6847 O  O     . HOH Q 7 .   ? -3.079  21.666  13.091  1.00 52.25  ? 367  HOH A O     1 
HETATM 6848 O  O     . HOH Q 7 .   ? -15.306 20.760  9.015   1.00 44.02  ? 369  HOH A O     1 
HETATM 6849 O  O     . HOH Q 7 .   ? -2.615  24.618  14.015  1.00 52.54  ? 373  HOH A O     1 
HETATM 6850 O  O     . HOH Q 7 .   ? 0.218   19.192  28.473  1.00 58.41  ? 374  HOH A O     1 
HETATM 6851 O  O     . HOH Q 7 .   ? 11.119  -27.898 9.537   1.00 29.22  ? 378  HOH A O     1 
HETATM 6852 O  O     . HOH Q 7 .   ? -24.849 14.182  7.994   1.00 58.99  ? 381  HOH A O     1 
HETATM 6853 O  O     . HOH Q 7 .   ? -13.245 -2.332  -8.484  1.00 48.75  ? 382  HOH A O     1 
HETATM 6854 O  O     . HOH Q 7 .   ? -2.488  8.714   24.788  1.00 48.97  ? 383  HOH A O     1 
HETATM 6855 O  O     . HOH Q 7 .   ? -19.895 -1.617  -1.023  1.00 44.15  ? 386  HOH A O     1 
HETATM 6856 O  O     . HOH Q 7 .   ? 10.973  -9.702  16.789  1.00 45.83  ? 388  HOH A O     1 
HETATM 6857 O  O     . HOH Q 7 .   ? 6.347   13.325  -15.648 1.00 47.56  ? 389  HOH A O     1 
HETATM 6858 O  O     . HOH Q 7 .   ? 12.334  3.732   -15.150 1.00 36.42  ? 395  HOH A O     1 
HETATM 6859 O  O     . HOH Q 7 .   ? -8.957  0.392   7.002   1.00 41.71  ? 396  HOH A O     1 
HETATM 6860 O  O     . HOH Q 7 .   ? 22.277  -23.004 10.636  1.00 44.19  ? 407  HOH A O     1 
HETATM 6861 O  O     . HOH Q 7 .   ? -4.467  -22.031 10.442  1.00 42.01  ? 408  HOH A O     1 
HETATM 6862 O  O     . HOH Q 7 .   ? -0.386  17.022  1.628   1.00 43.63  ? 411  HOH A O     1 
HETATM 6863 O  O     . HOH Q 7 .   ? -0.635  19.171  -0.168  1.00 47.47  ? 420  HOH A O     1 
HETATM 6864 O  O     . HOH Q 7 .   ? 8.670   22.050  2.512   1.00 41.98  ? 421  HOH A O     1 
HETATM 6865 O  O     . HOH Q 7 .   ? -0.380  15.110  -26.775 1.00 28.41  ? 423  HOH A O     1 
HETATM 6866 O  O     . HOH Q 7 .   ? -16.954 20.259  15.954  1.00 47.68  ? 424  HOH A O     1 
HETATM 6867 O  O     . HOH Q 7 .   ? -6.595  -14.922 17.442  1.00 41.68  ? 426  HOH A O     1 
HETATM 6868 O  O     . HOH Q 7 .   ? 9.430   24.938  18.561  1.00 45.14  ? 432  HOH A O     1 
HETATM 6869 O  O     . HOH Q 7 .   ? 6.311   23.237  2.596   1.00 44.99  ? 433  HOH A O     1 
HETATM 6870 O  O     . HOH Q 7 .   ? -10.254 12.834  -23.637 1.00 24.17  ? 435  HOH A O     1 
HETATM 6871 O  O     . HOH Q 7 .   ? 2.800   -0.208  15.712  1.00 49.44  ? 436  HOH A O     1 
HETATM 6872 O  O     . HOH Q 7 .   ? -34.291 13.488  -3.305  1.00 42.89  ? 437  HOH A O     1 
HETATM 6873 O  O     . HOH Q 7 .   ? 2.632   -28.117 -1.338  1.00 38.53  ? 440  HOH A O     1 
HETATM 6874 O  O     . HOH Q 7 .   ? -24.367 20.852  -9.623  1.00 26.59  ? 445  HOH A O     1 
HETATM 6875 O  O     . HOH Q 7 .   ? -13.630 14.342  -22.402 1.00 64.98  ? 446  HOH A O     1 
HETATM 6876 O  O     . HOH Q 7 .   ? -6.919  20.805  19.723  1.00 53.14  ? 447  HOH A O     1 
HETATM 6877 O  O     . HOH Q 7 .   ? -23.440 22.617  -2.007  1.00 27.98  ? 449  HOH A O     1 
HETATM 6878 O  O     . HOH Q 7 .   ? 20.059  10.436  19.066  1.00 63.42  ? 456  HOH A O     1 
HETATM 6879 O  O     . HOH Q 7 .   ? 8.341   11.411  -10.832 1.00 55.71  ? 458  HOH A O     1 
HETATM 6880 O  O     . HOH Q 7 .   ? 15.422  1.532   16.552  1.00 43.35  ? 460  HOH A O     1 
HETATM 6881 O  O     . HOH Q 7 .   ? -4.393  8.761   0.253   1.00 37.21  ? 510  HOH A O     1 
HETATM 6882 O  O     . HOH Q 7 .   ? 3.243   7.507   20.086  1.00 26.71  ? 511  HOH A O     1 
HETATM 6883 O  O     . HOH Q 7 .   ? -13.491 16.055  9.404   1.00 25.42  ? 512  HOH A O     1 
HETATM 6884 O  O     . HOH Q 7 .   ? 5.301   9.968   -9.221  1.00 42.73  ? 513  HOH A O     1 
HETATM 6885 O  O     . HOH Q 7 .   ? -14.706 4.755   -10.645 1.00 24.79  ? 514  HOH A O     1 
HETATM 6886 O  O     . HOH Q 7 .   ? 17.449  5.990   11.165  1.00 29.04  ? 515  HOH A O     1 
HETATM 6887 O  O     . HOH Q 7 .   ? 12.853  18.313  22.160  1.00 22.00  ? 516  HOH A O     1 
HETATM 6888 O  O     . HOH Q 7 .   ? -0.605  20.557  13.972  1.00 33.21  ? 517  HOH A O     1 
HETATM 6889 O  O     . HOH Q 7 .   ? -4.147  -23.540 13.347  1.00 29.50  ? 518  HOH A O     1 
HETATM 6890 O  O     . HOH Q 7 .   ? -0.473  19.528  10.642  1.00 30.18  ? 519  HOH A O     1 
HETATM 6891 O  O     . HOH Q 7 .   ? -3.160  -27.953 14.449  1.00 16.10  ? 520  HOH A O     1 
HETATM 6892 O  O     . HOH Q 7 .   ? -6.342  -14.873 0.180   1.00 31.34  ? 521  HOH A O     1 
HETATM 6893 O  O     . HOH Q 7 .   ? -0.719  -16.695 17.327  1.00 25.16  ? 522  HOH A O     1 
HETATM 6894 O  O     . HOH Q 7 .   ? -3.737  -24.676 16.104  1.00 21.35  ? 523  HOH A O     1 
HETATM 6895 O  O     . HOH Q 7 .   ? -5.440  14.140  3.614   1.00 42.43  ? 524  HOH A O     1 
HETATM 6896 O  O     . HOH Q 7 .   ? -4.227  -24.349 -3.031  1.00 37.84  ? 525  HOH A O     1 
HETATM 6897 O  O     . HOH Q 7 .   ? -14.297 21.517  -11.143 1.00 24.29  ? 526  HOH A O     1 
HETATM 6898 O  O     . HOH Q 7 .   ? 2.414   -6.395  -20.542 1.00 41.13  ? 527  HOH A O     1 
HETATM 6899 O  O     . HOH Q 7 .   ? -0.066  12.053  21.823  1.00 26.51  ? 528  HOH A O     1 
HETATM 6900 O  O     . HOH Q 7 .   ? -16.699 14.979  -13.259 1.00 18.90  ? 529  HOH A O     1 
HETATM 6901 O  O     . HOH Q 7 .   ? 3.831   21.595  5.223   1.00 30.70  ? 530  HOH A O     1 
HETATM 6902 O  O     . HOH Q 7 .   ? 16.242  22.076  8.200   1.00 16.93  ? 531  HOH A O     1 
HETATM 6903 O  O     . HOH Q 7 .   ? -14.367 -1.949  1.409   1.00 29.00  ? 532  HOH A O     1 
HETATM 6904 O  O     . HOH Q 7 .   ? -26.410 18.377  1.838   1.00 41.16  ? 533  HOH A O     1 
HETATM 6905 O  O     . HOH Q 7 .   ? 2.169   17.384  2.187   1.00 35.05  ? 534  HOH A O     1 
HETATM 6906 O  O     . HOH Q 7 .   ? -6.681  -0.760  8.186   1.00 47.57  ? 535  HOH A O     1 
HETATM 6907 O  O     . HOH Q 7 .   ? 13.998  4.904   5.238   1.00 44.66  ? 536  HOH A O     1 
HETATM 6908 O  O     . HOH Q 7 .   ? -12.765 1.520   -16.390 1.00 41.00  ? 537  HOH A O     1 
HETATM 6909 O  O     . HOH Q 7 .   ? -4.923  10.522  -1.827  1.00 36.64  ? 538  HOH A O     1 
HETATM 6910 O  O     . HOH Q 7 .   ? -10.400 10.714  17.851  1.00 29.25  ? 539  HOH A O     1 
HETATM 6911 O  O     . HOH Q 7 .   ? 0.328   -11.011 18.771  1.00 41.54  ? 540  HOH A O     1 
HETATM 6912 O  O     . HOH Q 7 .   ? -5.867  -19.677 10.850  1.00 40.22  ? 541  HOH A O     1 
HETATM 6913 O  O     . HOH Q 7 .   ? 1.384   -2.680  -16.527 1.00 27.29  ? 542  HOH A O     1 
HETATM 6914 O  O     . HOH Q 7 .   ? 3.076   19.533  3.036   1.00 50.59  ? 543  HOH A O     1 
HETATM 6915 O  O     . HOH Q 7 .   ? -17.230 5.686   -11.882 1.00 34.79  ? 544  HOH A O     1 
HETATM 6916 O  O     . HOH Q 7 .   ? -4.319  -14.736 -1.484  1.00 25.57  ? 545  HOH A O     1 
HETATM 6917 O  O     . HOH Q 7 .   ? -5.692  -1.911  -16.432 1.00 29.36  ? 546  HOH A O     1 
HETATM 6918 O  O     . HOH Q 7 .   ? 4.713   19.298  18.858  1.00 32.52  ? 547  HOH A O     1 
HETATM 6919 O  O     . HOH Q 7 .   ? -5.334  18.211  16.338  1.00 46.69  ? 548  HOH A O     1 
HETATM 6920 O  O     . HOH Q 7 .   ? 10.953  14.004  20.861  1.00 22.65  ? 549  HOH A O     1 
HETATM 6921 O  O     . HOH Q 7 .   ? -3.268  1.302   5.352   1.00 32.75  ? 550  HOH A O     1 
HETATM 6922 O  O     . HOH Q 7 .   ? 6.418   24.702  10.916  1.00 41.61  ? 551  HOH A O     1 
HETATM 6923 O  O     . HOH Q 7 .   ? 9.243   11.502  22.285  1.00 40.17  ? 552  HOH A O     1 
HETATM 6924 O  O     . HOH Q 7 .   ? 6.075   6.625   1.670   1.00 38.18  ? 553  HOH A O     1 
HETATM 6925 O  O     . HOH Q 7 .   ? -2.140  12.962  -27.604 1.00 24.04  ? 554  HOH A O     1 
HETATM 6926 O  O     . HOH Q 7 .   ? 8.274   2.306   16.544  1.00 36.59  ? 555  HOH A O     1 
HETATM 6927 O  O     . HOH Q 7 .   ? -9.634  -11.627 4.595   1.00 40.94  ? 556  HOH A O     1 
HETATM 6928 O  O     . HOH Q 7 .   ? 15.161  -26.881 12.137  1.00 36.77  ? 557  HOH A O     1 
HETATM 6929 O  O     . HOH Q 7 .   ? -2.602  14.569  -17.364 1.00 29.91  ? 558  HOH A O     1 
HETATM 6930 O  O     . HOH Q 7 .   ? -10.166 0.885   9.083   1.00 34.07  ? 559  HOH A O     1 
HETATM 6931 O  O     . HOH Q 7 .   ? -12.770 18.146  7.919   1.00 52.84  ? 560  HOH A O     1 
HETATM 6932 O  O     . HOH Q 7 .   ? -0.925  -9.932  15.888  1.00 40.95  ? 561  HOH A O     1 
HETATM 6933 O  O     . HOH Q 7 .   ? 2.297   12.879  23.261  1.00 27.40  ? 562  HOH A O     1 
HETATM 6934 O  O     . HOH Q 7 .   ? 4.022   12.298  5.513   1.00 39.02  ? 563  HOH A O     1 
HETATM 6935 O  O     . HOH Q 7 .   ? -5.759  23.453  -1.370  1.00 59.00  ? 564  HOH A O     1 
HETATM 6936 O  O     . HOH Q 7 .   ? -7.898  5.847   -7.230  1.00 36.63  ? 565  HOH A O     1 
HETATM 6937 O  O     . HOH Q 7 .   ? -3.263  -18.224 17.379  1.00 34.42  ? 566  HOH A O     1 
HETATM 6938 O  O     . HOH Q 7 .   ? 2.353   10.751  4.477   1.00 46.79  ? 567  HOH A O     1 
HETATM 6939 O  O     . HOH Q 7 .   ? 1.615   -16.257 1.355   1.00 29.01  ? 568  HOH A O     1 
HETATM 6940 O  O     . HOH Q 7 .   ? -9.030  -13.573 0.782   1.00 39.21  ? 569  HOH A O     1 
HETATM 6941 O  O     . HOH Q 7 .   ? 12.990  -25.283 16.412  1.00 31.72  ? 570  HOH A O     1 
HETATM 6942 O  O     . HOH Q 7 .   ? -11.612 22.163  -20.103 1.00 30.08  ? 571  HOH A O     1 
HETATM 6943 O  O     . HOH Q 7 .   ? 1.066   17.366  -23.767 1.00 35.83  ? 572  HOH A O     1 
HETATM 6944 O  O     . HOH Q 7 .   ? 13.037  23.888  13.566  1.00 36.13  ? 573  HOH A O     1 
HETATM 6945 O  O     . HOH Q 7 .   ? -12.466 -0.397  9.133   1.00 40.63  ? 574  HOH A O     1 
HETATM 6946 O  O     . HOH Q 7 .   ? 10.966  23.221  14.954  1.00 24.33  ? 575  HOH A O     1 
HETATM 6947 O  O     . HOH Q 7 .   ? 12.630  15.874  20.419  1.00 27.65  ? 576  HOH A O     1 
HETATM 6948 O  O     . HOH Q 7 .   ? -15.126 15.746  20.358  1.00 55.99  ? 577  HOH A O     1 
HETATM 6949 O  O     . HOH Q 7 .   ? -15.415 15.087  -18.504 1.00 28.14  ? 578  HOH A O     1 
HETATM 6950 O  O     . HOH Q 7 .   ? 22.508  -4.623  6.612   1.00 48.52  ? 579  HOH A O     1 
HETATM 6951 O  O     . HOH Q 7 .   ? -23.224 19.554  8.906   1.00 27.36  ? 580  HOH A O     1 
HETATM 6952 O  O     . HOH Q 7 .   ? -2.372  14.369  26.737  1.00 42.02  ? 581  HOH A O     1 
HETATM 6953 O  O     . HOH Q 7 .   ? -2.076  4.364   -26.994 1.00 48.28  ? 582  HOH A O     1 
HETATM 6954 O  O     . HOH Q 7 .   ? -14.615 23.420  -14.451 1.00 31.59  ? 583  HOH A O     1 
HETATM 6955 O  O     . HOH Q 7 .   ? 3.984   15.228  26.792  1.00 32.46  ? 584  HOH A O     1 
HETATM 6956 O  O     . HOH Q 7 .   ? 3.004   11.672  -7.678  1.00 46.13  ? 585  HOH A O     1 
HETATM 6957 O  O     . HOH Q 7 .   ? -15.126 0.284   10.491  1.00 54.99  ? 586  HOH A O     1 
HETATM 6958 O  O     . HOH Q 7 .   ? 1.662   2.263   8.857   1.00 41.78  ? 587  HOH A O     1 
HETATM 6959 O  O     . HOH Q 7 .   ? 27.776  -7.722  8.584   1.00 54.96  ? 588  HOH A O     1 
HETATM 6960 O  O     . HOH Q 7 .   ? -11.348 8.796   -16.906 1.00 28.33  ? 589  HOH A O     1 
HETATM 6961 O  O     . HOH Q 7 .   ? -8.926  16.602  -22.474 1.00 30.24  ? 590  HOH A O     1 
HETATM 6962 O  O     . HOH Q 7 .   ? 2.505   -10.034 -3.244  1.00 46.63  ? 591  HOH A O     1 
HETATM 6963 O  O     . HOH Q 7 .   ? -7.702  -6.940  -1.163  1.00 45.36  ? 592  HOH A O     1 
HETATM 6964 O  O     . HOH Q 7 .   ? -19.652 1.806   -8.210  1.00 28.90  ? 593  HOH A O     1 
HETATM 6965 O  O     . HOH Q 7 .   ? 6.224   11.123  -17.499 1.00 41.66  ? 594  HOH A O     1 
HETATM 6966 O  O     . HOH Q 7 .   ? -2.718  -7.849  15.956  1.00 42.87  ? 595  HOH A O     1 
HETATM 6967 O  O     . HOH Q 7 .   ? -27.506 21.006  -2.174  1.00 24.71  ? 596  HOH A O     1 
HETATM 6968 O  O     . HOH Q 7 .   ? 0.510   13.018  1.529   1.00 39.94  ? 597  HOH A O     1 
HETATM 6969 O  O     . HOH Q 7 .   ? -6.073  -2.306  16.745  1.00 47.49  ? 598  HOH A O     1 
HETATM 6970 O  O     . HOH Q 7 .   ? -5.544  18.609  18.991  1.00 37.94  ? 599  HOH A O     1 
HETATM 6971 O  O     . HOH Q 7 .   ? -1.266  2.916   23.462  1.00 45.06  ? 600  HOH A O     1 
HETATM 6972 O  O     . HOH Q 7 .   ? -25.194 5.324   -4.545  1.00 38.98  ? 601  HOH A O     1 
HETATM 6973 O  O     . HOH Q 7 .   ? 12.207  -5.175  13.596  1.00 49.11  ? 602  HOH A O     1 
HETATM 6974 O  O     . HOH Q 7 .   ? -12.478 20.221  9.524   1.00 47.86  ? 603  HOH A O     1 
HETATM 6975 O  O     . HOH Q 7 .   ? -11.187 -21.036 12.035  1.00 45.81  ? 604  HOH A O     1 
HETATM 6976 O  O     . HOH Q 7 .   ? -18.384 19.875  13.143  1.00 52.12  ? 605  HOH A O     1 
HETATM 6977 O  O     . HOH Q 7 .   ? -4.450  -19.671 15.422  1.00 36.32  ? 606  HOH A O     1 
HETATM 6978 O  O     . HOH Q 7 .   ? -7.121  -3.950  1.036   1.00 43.86  ? 607  HOH A O     1 
HETATM 6979 O  O     . HOH Q 7 .   ? -8.141  -19.962 12.320  1.00 55.73  ? 608  HOH A O     1 
HETATM 6980 O  O     . HOH Q 7 .   ? -16.919 4.907   -23.514 1.00 44.03  ? 609  HOH A O     1 
HETATM 6981 O  O     . HOH Q 7 .   ? 9.927   -22.184 -2.429  1.00 28.30  ? 610  HOH A O     1 
HETATM 6982 O  O     . HOH Q 7 .   ? -5.625  -17.835 13.288  1.00 29.98  ? 611  HOH A O     1 
HETATM 6983 O  O     . HOH Q 7 .   ? -15.404 24.553  -3.197  1.00 63.34  ? 612  HOH A O     1 
HETATM 6984 O  O     . HOH Q 7 .   ? -2.827  13.758  -7.625  1.00 36.07  ? 613  HOH A O     1 
HETATM 6985 O  O     . HOH Q 7 .   ? -26.036 9.453   1.837   1.00 51.85  ? 614  HOH A O     1 
HETATM 6986 O  O     . HOH Q 7 .   ? 10.272  -16.746 18.899  1.00 46.00  ? 615  HOH A O     1 
HETATM 6987 O  O     . HOH Q 7 .   ? 0.281   1.020   -9.806  1.00 50.77  ? 616  HOH A O     1 
HETATM 6988 O  O     . HOH Q 7 .   ? -8.543  9.893   19.632  1.00 46.80  ? 617  HOH A O     1 
HETATM 6989 O  O     . HOH Q 7 .   ? -22.811 16.688  9.736   1.00 31.93  ? 618  HOH A O     1 
HETATM 6990 O  O     . HOH Q 7 .   ? -10.160 24.278  -13.784 1.00 51.07  ? 619  HOH A O     1 
HETATM 6991 O  O     . HOH Q 7 .   ? -17.647 23.881  -15.340 1.00 45.42  ? 620  HOH A O     1 
HETATM 6992 O  O     . HOH Q 7 .   ? 7.327   -24.575 -2.818  1.00 30.77  ? 621  HOH A O     1 
HETATM 6993 O  O     . HOH Q 7 .   ? -19.305 19.916  17.087  1.00 60.61  ? 622  HOH A O     1 
HETATM 6994 O  O     . HOH Q 7 .   ? 23.764  -26.610 -2.927  1.00 31.42  ? 623  HOH A O     1 
HETATM 6995 O  O     . HOH Q 7 .   ? -1.441  22.696  11.189  1.00 50.32  ? 624  HOH A O     1 
HETATM 6996 O  O     . HOH Q 7 .   ? 6.376   0.640   -14.818 1.00 50.25  ? 625  HOH A O     1 
HETATM 6997 O  O     . HOH Q 7 .   ? -7.092  4.157   -3.888  1.00 41.51  ? 626  HOH A O     1 
HETATM 6998 O  O     . HOH Q 7 .   ? -0.814  10.525  24.069  1.00 48.98  ? 627  HOH A O     1 
HETATM 6999 O  O     . HOH Q 7 .   ? 1.024   25.850  12.576  1.00 46.36  ? 628  HOH A O     1 
HETATM 7000 O  O     . HOH Q 7 .   ? -14.029 10.490  20.721  1.00 48.28  ? 629  HOH A O     1 
HETATM 7001 O  O     . HOH Q 7 .   ? -11.079 -14.128 3.895   1.00 47.55  ? 630  HOH A O     1 
HETATM 7002 O  O     . HOH Q 7 .   ? 17.558  -14.919 18.111  1.00 38.96  ? 631  HOH A O     1 
HETATM 7003 O  O     . HOH Q 7 .   ? -18.982 -4.010  -7.701  1.00 50.55  ? 632  HOH A O     1 
HETATM 7004 O  O     . HOH Q 7 .   ? -7.528  17.359  14.974  1.00 40.05  ? 633  HOH A O     1 
HETATM 7005 O  O     . HOH Q 7 .   ? 16.130  4.396   19.467  1.00 47.25  ? 634  HOH A O     1 
HETATM 7006 O  O     . HOH Q 7 .   ? 8.394   17.597  3.583   1.00 34.82  ? 635  HOH A O     1 
HETATM 7007 O  O     . HOH R 7 .   ? 4.621   5.142   -0.023  1.00 43.41  ? 82   HOH D O     1 
HETATM 7008 O  O     . HOH R 7 .   ? 6.924   -12.137 -3.978  1.00 33.73  ? 88   HOH D O     1 
HETATM 7009 O  O     . HOH R 7 .   ? -0.173  0.097   -5.634  1.00 33.33  ? 120  HOH D O     1 
HETATM 7010 O  O     . HOH R 7 .   ? -3.053  5.666   -5.297  1.00 50.68  ? 158  HOH D O     1 
HETATM 7011 O  O     . HOH R 7 .   ? -2.129  -0.422  -3.515  1.00 40.90  ? 193  HOH D O     1 
HETATM 7012 O  O     . HOH R 7 .   ? -1.398  7.645   -5.678  1.00 42.93  ? 194  HOH D O     1 
HETATM 7013 O  O     . HOH R 7 .   ? 2.098   -0.913  -9.156  1.00 32.77  ? 198  HOH D O     1 
HETATM 7014 O  O     . HOH R 7 .   ? 10.554  -1.285  -7.666  1.00 41.01  ? 213  HOH D O     1 
HETATM 7015 O  O     . HOH R 7 .   ? -2.632  -25.930 -4.999  1.00 36.54  ? 235  HOH D O     1 
HETATM 7016 O  O     . HOH R 7 .   ? 4.521   -5.028  -11.615 1.00 45.15  ? 237  HOH D O     1 
HETATM 7017 O  O     . HOH R 7 .   ? 2.418   -13.789 -6.717  1.00 35.38  ? 306  HOH D O     1 
HETATM 7018 O  O     . HOH R 7 .   ? 0.435   -25.677 -14.380 1.00 41.12  ? 392  HOH D O     1 
HETATM 7019 O  O     . HOH R 7 .   ? 1.264   8.907   -8.371  1.00 25.70  ? 514  HOH D O     1 
HETATM 7020 O  O     . HOH S 7 .   ? -0.056  -9.569  -4.298  1.00 24.91  ? 17   HOH E O     1 
HETATM 7021 O  O     . HOH S 7 .   ? 4.487   -7.569  -1.385  1.00 31.45  ? 33   HOH E O     1 
HETATM 7022 O  O     . HOH S 7 .   ? 0.438   -3.181  -9.955  1.00 31.92  ? 45   HOH E O     1 
HETATM 7023 O  O     . HOH S 7 .   ? 7.592   -3.762  3.291   1.00 33.86  ? 46   HOH E O     1 
HETATM 7024 O  O     . HOH S 7 .   ? 2.760   -0.975  8.406   1.00 48.87  ? 69   HOH E O     1 
HETATM 7025 O  O     . HOH S 7 .   ? 9.518   4.171   2.347   1.00 43.01  ? 108  HOH E O     1 
HETATM 7026 O  O     . HOH S 7 .   ? 8.347   -6.928  -18.214 1.00 37.21  ? 121  HOH E O     1 
HETATM 7027 O  O     . HOH S 7 .   ? -0.492  -1.450  4.686   1.00 45.10  ? 127  HOH E O     1 
HETATM 7028 O  O     . HOH S 7 .   ? -1.992  -9.877  -2.275  1.00 34.14  ? 156  HOH E O     1 
HETATM 7029 O  O     . HOH S 7 .   ? -0.375  -12.683 -10.772 1.00 34.17  ? 159  HOH E O     1 
HETATM 7030 O  O     . HOH S 7 .   ? 16.794  6.103   3.149   1.00 55.36  ? 163  HOH E O     1 
HETATM 7031 O  O     . HOH S 7 .   ? 12.526  -25.132 -13.829 1.00 36.55  ? 179  HOH E O     1 
HETATM 7032 O  O     . HOH S 7 .   ? -3.247  -7.828  -16.208 1.00 36.71  ? 223  HOH E O     1 
HETATM 7033 O  O     . HOH S 7 .   ? -4.461  -5.634  -18.481 1.00 39.43  ? 231  HOH E O     1 
HETATM 7034 O  O     . HOH S 7 .   ? 8.883   -1.871  14.154  1.00 38.10  ? 242  HOH E O     1 
HETATM 7035 O  O     . HOH S 7 .   ? 8.863   -5.343  12.948  1.00 43.76  ? 253  HOH E O     1 
HETATM 7036 O  O     . HOH S 7 .   ? 0.019   -9.932  -15.192 1.00 38.56  ? 308  HOH E O     1 
HETATM 7037 O  O     . HOH S 7 .   ? -1.474  -2.139  -6.725  1.00 38.68  ? 312  HOH E O     1 
HETATM 7038 O  O     . HOH S 7 .   ? -3.213  -9.086  -11.308 1.00 47.07  ? 313  HOH E O     1 
HETATM 7039 O  O     . HOH S 7 .   ? -3.410  -0.702  -7.251  1.00 48.38  ? 380  HOH E O     1 
HETATM 7040 O  O     . HOH S 7 .   ? 11.657  -1.411  4.331   1.00 44.36  ? 406  HOH E O     1 
HETATM 7041 O  O     . HOH S 7 .   ? 7.592   -22.275 -20.574 1.00 47.64  ? 412  HOH E O     1 
HETATM 7042 O  O     . HOH S 7 .   ? 14.379  -19.220 -15.788 1.00 63.69  ? 444  HOH E O     1 
HETATM 7043 O  O     . HOH S 7 .   ? 0.570   -9.146  3.717   1.00 41.51  ? 463  HOH E O     1 
HETATM 7044 O  O     . HOH T 7 .   ? -16.327 13.110  -63.433 1.00 29.15  ? 3    HOH B O     1 
HETATM 7045 O  O     . HOH T 7 .   ? 4.046   16.143  -65.279 1.00 22.12  ? 13   HOH B O     1 
HETATM 7046 O  O     . HOH T 7 .   ? -28.588 30.359  -56.482 1.00 24.69  ? 14   HOH B O     1 
HETATM 7047 O  O     . HOH T 7 .   ? 3.866   5.441   -31.687 1.00 32.89  ? 16   HOH B O     1 
HETATM 7048 O  O     . HOH T 7 .   ? -14.872 14.038  -48.052 1.00 39.02  ? 18   HOH B O     1 
HETATM 7049 O  O     . HOH T 7 .   ? -19.505 30.587  -53.623 1.00 27.17  ? 19   HOH B O     1 
HETATM 7050 O  O     . HOH T 7 .   ? -11.602 23.749  -64.099 1.00 29.77  ? 21   HOH B O     1 
HETATM 7051 O  O     . HOH T 7 .   ? -1.888  13.432  -58.365 1.00 41.35  ? 25   HOH B O     1 
HETATM 7052 O  O     . HOH T 7 .   ? -15.223 3.512   -68.544 1.00 36.75  ? 27   HOH B O     1 
HETATM 7053 O  O     . HOH T 7 .   ? 10.866  29.143  -71.302 1.00 36.18  ? 28   HOH B O     1 
HETATM 7054 O  O     . HOH T 7 .   ? -13.085 14.253  -46.116 1.00 31.32  ? 29   HOH B O     1 
HETATM 7055 O  O     . HOH T 7 .   ? -6.141  22.381  -75.410 1.00 35.50  ? 32   HOH B O     1 
HETATM 7056 O  O     . HOH T 7 .   ? -1.176  17.800  -27.497 1.00 15.63  ? 35   HOH B O     1 
HETATM 7057 O  O     . HOH T 7 .   ? -11.461 21.310  -61.203 1.00 27.72  ? 39   HOH B O     1 
HETATM 7058 O  O     . HOH T 7 .   ? 1.866   3.132   -43.462 1.00 34.30  ? 43   HOH B O     1 
HETATM 7059 O  O     . HOH T 7 .   ? 4.300   5.585   -54.329 1.00 23.09  ? 48   HOH B O     1 
HETATM 7060 O  O     . HOH T 7 .   ? -20.691 28.846  -58.385 1.00 35.66  ? 51   HOH B O     1 
HETATM 7061 O  O     . HOH T 7 .   ? -29.598 19.521  -54.708 1.00 35.00  ? 52   HOH B O     1 
HETATM 7062 O  O     . HOH T 7 .   ? -18.370 12.084  -72.651 1.00 34.15  ? 54   HOH B O     1 
HETATM 7063 O  O     . HOH T 7 .   ? -18.530 11.249  -63.681 1.00 38.61  ? 55   HOH B O     1 
HETATM 7064 O  O     . HOH T 7 .   ? -9.709  29.521  -72.399 1.00 35.27  ? 57   HOH B O     1 
HETATM 7065 O  O     . HOH T 7 .   ? -2.952  -0.753  -39.319 1.00 30.41  ? 59   HOH B O     1 
HETATM 7066 O  O     . HOH T 7 .   ? -13.583 19.596  -60.225 1.00 32.43  ? 61   HOH B O     1 
HETATM 7067 O  O     . HOH T 7 .   ? -15.219 16.495  -32.485 1.00 23.89  ? 63   HOH B O     1 
HETATM 7068 O  O     . HOH T 7 .   ? -17.060 14.886  -61.551 1.00 31.19  ? 64   HOH B O     1 
HETATM 7069 O  O     . HOH T 7 .   ? -6.147  21.502  -55.338 1.00 23.84  ? 65   HOH B O     1 
HETATM 7070 O  O     . HOH T 7 .   ? -13.981 8.668   -43.400 1.00 25.92  ? 68   HOH B O     1 
HETATM 7071 O  O     . HOH T 7 .   ? -30.992 40.371  -52.916 1.00 19.95  ? 70   HOH B O     1 
HETATM 7072 O  O     . HOH T 7 .   ? -3.283  4.805   -63.670 1.00 20.43  ? 75   HOH B O     1 
HETATM 7073 O  O     . HOH T 7 .   ? -4.540  17.762  -52.450 1.00 32.36  ? 76   HOH B O     1 
HETATM 7074 O  O     . HOH T 7 .   ? -7.721  35.950  -73.085 1.00 27.20  ? 77   HOH B O     1 
HETATM 7075 O  O     . HOH T 7 .   ? -40.766 30.885  -63.027 1.00 25.54  ? 78   HOH B O     1 
HETATM 7076 O  O     . HOH T 7 .   ? -16.378 9.476   -73.182 1.00 25.24  ? 85   HOH B O     1 
HETATM 7077 O  O     . HOH T 7 .   ? -12.155 3.593   -70.480 1.00 33.30  ? 89   HOH B O     1 
HETATM 7078 O  O     . HOH T 7 .   ? -22.663 27.141  -58.759 1.00 30.41  ? 91   HOH B O     1 
HETATM 7079 O  O     . HOH T 7 .   ? -16.912 17.096  -62.827 1.00 45.51  ? 94   HOH B O     1 
HETATM 7080 O  O     . HOH T 7 .   ? -6.762  5.168   -30.696 1.00 46.96  ? 96   HOH B O     1 
HETATM 7081 O  O     . HOH T 7 .   ? -30.036 51.598  -53.014 1.00 27.19  ? 102  HOH B O     1 
HETATM 7082 O  O     . HOH T 7 .   ? -17.888 6.824   -73.146 1.00 23.79  ? 104  HOH B O     1 
HETATM 7083 O  O     . HOH T 7 .   ? -5.343  34.438  -40.261 1.00 32.85  ? 106  HOH B O     1 
HETATM 7084 O  O     . HOH T 7 .   ? -11.143 25.760  -75.119 1.00 42.34  ? 109  HOH B O     1 
HETATM 7085 O  O     . HOH T 7 .   ? -2.794  36.994  -67.711 1.00 27.78  ? 111  HOH B O     1 
HETATM 7086 O  O     . HOH T 7 .   ? -1.367  16.413  -47.044 1.00 30.60  ? 118  HOH B O     1 
HETATM 7087 O  O     . HOH T 7 .   ? 0.228   9.654   -69.160 1.00 29.09  ? 123  HOH B O     1 
HETATM 7088 O  O     . HOH T 7 .   ? -5.110  3.164   -40.971 1.00 32.01  ? 125  HOH B O     1 
HETATM 7089 O  O     . HOH T 7 .   ? -17.812 16.511  -71.764 1.00 30.01  ? 129  HOH B O     1 
HETATM 7090 O  O     . HOH T 7 .   ? 2.415   2.037   -48.647 1.00 19.79  ? 135  HOH B O     1 
HETATM 7091 O  O     . HOH T 7 .   ? -29.304 24.048  -53.558 1.00 25.57  ? 137  HOH B O     1 
HETATM 7092 O  O     . HOH T 7 .   ? -13.322 24.693  -71.539 1.00 34.87  ? 138  HOH B O     1 
HETATM 7093 O  O     . HOH T 7 .   ? -35.448 19.588  -59.998 1.00 43.66  ? 139  HOH B O     1 
HETATM 7094 O  O     . HOH T 7 .   ? -4.924  15.163  -52.850 1.00 38.65  ? 140  HOH B O     1 
HETATM 7095 O  O     . HOH T 7 .   ? -18.546 15.706  -57.155 1.00 49.32  ? 147  HOH B O     1 
HETATM 7096 O  O     . HOH T 7 .   ? -18.611 28.819  -34.492 1.00 40.07  ? 151  HOH B O     1 
HETATM 7097 O  O     . HOH T 7 .   ? 2.775   19.918  -57.304 1.00 42.91  ? 153  HOH B O     1 
HETATM 7098 O  O     . HOH T 7 .   ? -17.348 -1.377  -48.645 1.00 43.13  ? 162  HOH B O     1 
HETATM 7099 O  O     . HOH T 7 .   ? -2.985  21.783  -58.031 1.00 35.14  ? 167  HOH B O     1 
HETATM 7100 O  O     . HOH T 7 .   ? -11.961 -4.885  -43.941 1.00 44.25  ? 169  HOH B O     1 
HETATM 7101 O  O     . HOH T 7 .   ? -12.451 17.183  -45.147 1.00 57.35  ? 172  HOH B O     1 
HETATM 7102 O  O     . HOH T 7 .   ? -13.845 5.663   -42.354 1.00 32.41  ? 175  HOH B O     1 
HETATM 7103 O  O     . HOH T 7 .   ? 3.192   24.612  -29.130 1.00 26.23  ? 183  HOH B O     1 
HETATM 7104 O  O     . HOH T 7 .   ? -28.752 18.115  -57.876 1.00 43.21  ? 184  HOH B O     1 
HETATM 7105 O  O     . HOH T 7 .   ? -1.384  -6.006  -63.914 1.00 31.66  ? 191  HOH B O     1 
HETATM 7106 O  O     . HOH T 7 .   ? 5.545   8.213   -55.066 1.00 42.36  ? 192  HOH B O     1 
HETATM 7107 O  O     . HOH T 7 .   ? -10.631 30.262  -40.151 1.00 42.34  ? 195  HOH B O     1 
HETATM 7108 O  O     . HOH T 7 .   ? -8.508  9.081   -28.774 1.00 37.62  ? 199  HOH B O     1 
HETATM 7109 O  O     . HOH T 7 .   ? -2.386  -6.191  -44.100 1.00 24.98  ? 200  HOH B O     1 
HETATM 7110 O  O     . HOH T 7 .   ? -29.307 20.115  -73.870 1.00 51.77  ? 201  HOH B O     1 
HETATM 7111 O  O     . HOH T 7 .   ? -20.591 10.429  -55.951 1.00 45.40  ? 203  HOH B O     1 
HETATM 7112 O  O     . HOH T 7 .   ? -0.812  -6.575  -52.466 1.00 22.12  ? 204  HOH B O     1 
HETATM 7113 O  O     . HOH T 7 .   ? -7.818  0.720   -39.110 1.00 29.63  ? 205  HOH B O     1 
HETATM 7114 O  O     . HOH T 7 .   ? -9.710  8.030   -37.508 1.00 36.36  ? 208  HOH B O     1 
HETATM 7115 O  O     . HOH T 7 .   ? -25.381 17.184  -48.307 1.00 50.24  ? 209  HOH B O     1 
HETATM 7116 O  O     . HOH T 7 .   ? -5.984  35.226  -76.056 1.00 38.22  ? 210  HOH B O     1 
HETATM 7117 O  O     . HOH T 7 .   ? -11.043 38.381  -65.494 1.00 34.57  ? 219  HOH B O     1 
HETATM 7118 O  O     . HOH T 7 .   ? -15.424 30.043  -27.534 1.00 30.59  ? 222  HOH B O     1 
HETATM 7119 O  O     . HOH T 7 .   ? 3.042   6.039   -34.497 1.00 28.08  ? 224  HOH B O     1 
HETATM 7120 O  O     . HOH T 7 .   ? -26.456 29.833  -54.568 1.00 39.03  ? 229  HOH B O     1 
HETATM 7121 O  O     . HOH T 7 .   ? -7.361  10.960  -74.053 1.00 32.10  ? 232  HOH B O     1 
HETATM 7122 O  O     . HOH T 7 .   ? -1.134  19.174  -22.925 1.00 34.20  ? 234  HOH B O     1 
HETATM 7123 O  O     . HOH T 7 .   ? -38.485 28.007  -51.844 1.00 33.16  ? 236  HOH B O     1 
HETATM 7124 O  O     . HOH T 7 .   ? -9.023  38.375  -67.239 1.00 32.84  ? 241  HOH B O     1 
HETATM 7125 O  O     . HOH T 7 .   ? -0.503  -0.512  -37.862 1.00 31.71  ? 244  HOH B O     1 
HETATM 7126 O  O     . HOH T 7 .   ? -13.031 24.033  -75.998 1.00 34.56  ? 245  HOH B O     1 
HETATM 7127 O  O     . HOH T 7 .   ? 5.420   32.929  -74.297 1.00 46.85  ? 246  HOH B O     1 
HETATM 7128 O  O     . HOH T 7 .   ? -31.113 17.707  -56.884 1.00 52.47  ? 252  HOH B O     1 
HETATM 7129 O  O     . HOH T 7 .   ? 5.755   5.806   -57.648 1.00 42.92  ? 259  HOH B O     1 
HETATM 7130 O  O     . HOH T 7 .   ? -0.743  26.518  -37.583 1.00 42.56  ? 266  HOH B O     1 
HETATM 7131 O  O     . HOH T 7 .   ? -5.539  3.101   -74.130 1.00 40.24  ? 270  HOH B O     1 
HETATM 7132 O  O     . HOH T 7 .   ? -16.652 11.215  -38.084 1.00 34.68  ? 271  HOH B O     1 
HETATM 7133 O  O     . HOH T 7 .   ? -15.246 4.149   -43.944 1.00 46.75  ? 273  HOH B O     1 
HETATM 7134 O  O     . HOH T 7 .   ? -21.966 9.720   -58.548 1.00 49.24  ? 274  HOH B O     1 
HETATM 7135 O  O     . HOH T 7 .   ? -7.557  9.386   -71.836 1.00 30.49  ? 276  HOH B O     1 
HETATM 7136 O  O     . HOH T 7 .   ? -26.350 15.728  -58.644 1.00 40.11  ? 279  HOH B O     1 
HETATM 7137 O  O     . HOH T 7 .   ? -29.632 29.104  -52.361 1.00 34.75  ? 281  HOH B O     1 
HETATM 7138 O  O     . HOH T 7 .   ? -16.206 32.220  -69.002 1.00 38.86  ? 282  HOH B O     1 
HETATM 7139 O  O     . HOH T 7 .   ? -18.373 24.046  -25.711 1.00 44.93  ? 285  HOH B O     1 
HETATM 7140 O  O     . HOH T 7 .   ? 0.943   15.716  -82.384 1.00 37.10  ? 286  HOH B O     1 
HETATM 7141 O  O     . HOH T 7 .   ? 4.255   20.897  -31.880 1.00 29.03  ? 289  HOH B O     1 
HETATM 7142 O  O     . HOH T 7 .   ? 6.785   12.414  -32.680 1.00 31.24  ? 291  HOH B O     1 
HETATM 7143 O  O     . HOH T 7 .   ? -22.102 18.273  -52.989 1.00 48.45  ? 297  HOH B O     1 
HETATM 7144 O  O     . HOH T 7 .   ? -18.675 -4.127  -57.035 1.00 58.31  ? 300  HOH B O     1 
HETATM 7145 O  O     . HOH T 7 .   ? -5.992  -3.960  -63.859 1.00 30.05  ? 304  HOH B O     1 
HETATM 7146 O  O     . HOH T 7 .   ? -22.700 44.566  -50.586 1.00 38.89  ? 310  HOH B O     1 
HETATM 7147 O  O     . HOH T 7 .   ? -17.390 14.525  -44.455 1.00 63.93  ? 318  HOH B O     1 
HETATM 7148 O  O     . HOH T 7 .   ? -1.750  23.152  -59.941 1.00 61.57  ? 322  HOH B O     1 
HETATM 7149 O  O     . HOH T 7 .   ? -25.581 31.728  -52.664 1.00 40.74  ? 324  HOH B O     1 
HETATM 7150 O  O     . HOH T 7 .   ? -15.515 14.139  -37.731 1.00 45.03  ? 326  HOH B O     1 
HETATM 7151 O  O     . HOH T 7 .   ? -11.601 37.722  -59.818 1.00 38.26  ? 328  HOH B O     1 
HETATM 7152 O  O     . HOH T 7 .   ? 5.796   16.283  -70.683 1.00 48.82  ? 332  HOH B O     1 
HETATM 7153 O  O     . HOH T 7 .   ? -6.828  -7.130  -53.593 1.00 39.88  ? 336  HOH B O     1 
HETATM 7154 O  O     . HOH T 7 .   ? -17.275 19.173  -66.502 1.00 45.97  ? 340  HOH B O     1 
HETATM 7155 O  O     . HOH T 7 .   ? -9.048  10.567  -37.382 1.00 30.59  ? 342  HOH B O     1 
HETATM 7156 O  O     . HOH T 7 .   ? -2.152  22.408  -47.625 1.00 32.11  ? 344  HOH B O     1 
HETATM 7157 O  O     . HOH T 7 .   ? -11.798 21.308  -23.687 1.00 20.79  ? 345  HOH B O     1 
HETATM 7158 O  O     . HOH T 7 .   ? -7.405  36.253  -40.585 1.00 38.23  ? 348  HOH B O     1 
HETATM 7159 O  O     . HOH T 7 .   ? -3.584  19.698  -47.789 1.00 40.31  ? 359  HOH B O     1 
HETATM 7160 O  O     . HOH T 7 .   ? -37.549 28.214  -68.518 1.00 34.86  ? 360  HOH B O     1 
HETATM 7161 O  O     . HOH T 7 .   ? -11.983 3.635   -39.373 1.00 49.98  ? 361  HOH B O     1 
HETATM 7162 O  O     . HOH T 7 .   ? -27.984 51.279  -68.493 1.00 42.63  ? 362  HOH B O     1 
HETATM 7163 O  O     . HOH T 7 .   ? -14.914 35.591  -69.651 1.00 30.75  ? 368  HOH B O     1 
HETATM 7164 O  O     . HOH T 7 .   ? -11.666 15.511  -51.339 1.00 51.59  ? 370  HOH B O     1 
HETATM 7165 O  O     . HOH T 7 .   ? -15.436 26.258  -40.845 1.00 54.25  ? 379  HOH B O     1 
HETATM 7166 O  O     . HOH T 7 .   ? 6.777   35.297  -73.641 1.00 40.44  ? 384  HOH B O     1 
HETATM 7167 O  O     . HOH T 7 .   ? -23.811 7.188   -46.226 1.00 44.60  ? 385  HOH B O     1 
HETATM 7168 O  O     . HOH T 7 .   ? -30.887 21.655  -54.196 1.00 35.47  ? 391  HOH B O     1 
HETATM 7169 O  O     . HOH T 7 .   ? 1.387   25.383  -39.917 1.00 43.63  ? 394  HOH B O     1 
HETATM 7170 O  O     . HOH T 7 .   ? -18.711 4.683   -45.896 1.00 33.85  ? 398  HOH B O     1 
HETATM 7171 O  O     . HOH T 7 .   ? -5.614  26.878  -57.226 1.00 37.65  ? 400  HOH B O     1 
HETATM 7172 O  O     . HOH T 7 .   ? -0.979  8.681   -76.096 1.00 37.61  ? 401  HOH B O     1 
HETATM 7173 O  O     . HOH T 7 .   ? -11.113 43.113  -51.506 1.00 61.55  ? 402  HOH B O     1 
HETATM 7174 O  O     . HOH T 7 .   ? 0.754   28.446  -77.269 1.00 26.97  ? 403  HOH B O     1 
HETATM 7175 O  O     . HOH T 7 .   ? -5.008  29.539  -48.353 1.00 34.56  ? 405  HOH B O     1 
HETATM 7176 O  O     . HOH T 7 .   ? 4.384   2.469   -42.733 1.00 45.71  ? 413  HOH B O     1 
HETATM 7177 O  O     . HOH T 7 .   ? -11.558 6.391   -37.947 1.00 42.89  ? 414  HOH B O     1 
HETATM 7178 O  O     . HOH T 7 .   ? -17.010 19.777  -37.854 1.00 27.85  ? 418  HOH B O     1 
HETATM 7179 O  O     . HOH T 7 .   ? -1.606  24.357  -50.061 1.00 54.36  ? 425  HOH B O     1 
HETATM 7180 O  O     . HOH T 7 .   ? 1.624   16.253  -52.763 1.00 54.78  ? 430  HOH B O     1 
HETATM 7181 O  O     . HOH T 7 .   ? -4.956  10.034  -31.313 1.00 33.17  ? 431  HOH B O     1 
HETATM 7182 O  O     . HOH T 7 .   ? -36.191 26.924  -51.002 1.00 49.38  ? 453  HOH B O     1 
HETATM 7183 O  O     . HOH T 7 .   ? -32.228 21.578  -68.431 1.00 55.03  ? 455  HOH B O     1 
HETATM 7184 O  O     . HOH T 7 .   ? -22.187 5.014   -54.403 1.00 42.52  ? 457  HOH B O     1 
HETATM 7185 O  O     . HOH T 7 .   ? -18.438 18.284  -54.118 1.00 56.32  ? 459  HOH B O     1 
HETATM 7186 O  O     . HOH T 7 .   ? -17.689 4.854   -69.603 1.00 34.52  ? 462  HOH B O     1 
HETATM 7187 O  O     . HOH T 7 .   ? -4.561  22.124  -46.498 1.00 24.16  ? 1511 HOH B O     1 
HETATM 7188 O  O     . HOH T 7 .   ? -2.240  26.077  -45.419 1.00 36.42  ? 1512 HOH B O     1 
HETATM 7189 O  O     . HOH T 7 .   ? -1.043  24.590  -47.344 1.00 48.09  ? 1513 HOH B O     1 
HETATM 7190 O  O     . HOH T 7 .   ? -7.273  15.052  -57.780 1.00 64.90  ? 1519 HOH B O     1 
HETATM 7191 O  O     . HOH U 7 .   ? -7.306  26.080  -55.340 1.00 29.60  ? 7    HOH H O     1 
HETATM 7192 O  O     . HOH U 7 .   ? -13.552 23.944  -49.218 1.00 28.08  ? 23   HOH H O     1 
HETATM 7193 O  O     . HOH U 7 .   ? -9.515  19.295  -49.123 1.00 36.46  ? 34   HOH H O     1 
HETATM 7194 O  O     . HOH U 7 .   ? -5.403  24.145  -54.971 1.00 26.23  ? 53   HOH H O     1 
HETATM 7195 O  O     . HOH U 7 .   ? -14.421 21.864  -51.599 1.00 45.37  ? 62   HOH H O     1 
HETATM 7196 O  O     . HOH U 7 .   ? -13.669 21.880  -54.135 1.00 42.56  ? 66   HOH H O     1 
HETATM 7197 O  O     . HOH U 7 .   ? -6.556  26.532  -50.700 1.00 30.28  ? 107  HOH H O     1 
HETATM 7198 O  O     . HOH U 7 .   ? -7.044  19.809  -49.012 1.00 29.94  ? 114  HOH H O     1 
HETATM 7199 O  O     . HOH U 7 .   ? -11.990 17.739  -51.917 1.00 48.63  ? 133  HOH H O     1 
HETATM 7200 O  O     . HOH U 7 .   ? -23.889 32.227  -49.769 1.00 42.24  ? 141  HOH H O     1 
HETATM 7201 O  O     . HOH U 7 .   ? -27.282 35.927  -51.164 1.00 52.33  ? 144  HOH H O     1 
HETATM 7202 O  O     . HOH U 7 .   ? -35.629 30.032  -48.034 1.00 49.37  ? 145  HOH H O     1 
HETATM 7203 O  O     . HOH U 7 .   ? -36.699 32.222  -39.338 1.00 45.75  ? 148  HOH H O     1 
HETATM 7204 O  O     . HOH U 7 .   ? -25.799 30.966  -50.179 1.00 28.83  ? 149  HOH H O     1 
HETATM 7205 O  O     . HOH U 7 .   ? -11.425 20.414  -47.745 1.00 49.86  ? 166  HOH H O     1 
HETATM 7206 O  O     . HOH U 7 .   ? -13.673 26.123  -45.946 1.00 36.23  ? 168  HOH H O     1 
HETATM 7207 O  O     . HOH U 7 .   ? -13.486 32.042  -53.367 1.00 34.98  ? 178  HOH H O     1 
HETATM 7208 O  O     . HOH U 7 .   ? -3.206  24.417  -56.225 1.00 28.55  ? 189  HOH H O     1 
HETATM 7209 O  O     . HOH U 7 .   ? -15.670 32.780  -52.033 1.00 28.92  ? 206  HOH H O     1 
HETATM 7210 O  O     . HOH U 7 .   ? -28.017 29.650  -42.711 1.00 45.86  ? 269  HOH H O     1 
HETATM 7211 O  O     . HOH U 7 .   ? -9.111  31.552  -53.678 1.00 31.90  ? 305  HOH H O     1 
HETATM 7212 O  O     . HOH U 7 .   ? -3.860  25.047  -48.256 1.00 25.91  ? 331  HOH H O     1 
HETATM 7213 O  O     . HOH U 7 .   ? -11.168 34.229  -47.734 1.00 41.84  ? 419  HOH H O     1 
HETATM 7214 O  O     . HOH V 7 .   ? -15.491 26.530  -38.269 1.00 21.62  ? 20   HOH J O     1 
HETATM 7215 O  O     . HOH V 7 .   ? -22.620 27.137  -50.483 1.00 22.97  ? 24   HOH J O     1 
HETATM 7216 O  O     . HOH V 7 .   ? -16.541 32.269  -55.873 1.00 26.62  ? 30   HOH J O     1 
HETATM 7217 O  O     . HOH V 7 .   ? -16.179 25.754  -44.953 1.00 23.21  ? 40   HOH J O     1 
HETATM 7218 O  O     . HOH V 7 .   ? -22.476 21.833  -59.904 1.00 43.24  ? 50   HOH J O     1 
HETATM 7219 O  O     . HOH V 7 .   ? -10.013 32.288  -58.047 1.00 40.25  ? 117  HOH J O     1 
HETATM 7220 O  O     . HOH V 7 .   ? -16.477 31.527  -35.172 1.00 37.16  ? 131  HOH J O     1 
HETATM 7221 O  O     . HOH V 7 .   ? -13.484 25.495  -64.430 1.00 37.39  ? 161  HOH J O     1 
HETATM 7222 O  O     . HOH V 7 .   ? -14.743 26.306  -66.547 1.00 40.79  ? 188  HOH J O     1 
HETATM 7223 O  O     . HOH V 7 .   ? -15.930 23.296  -48.186 1.00 34.23  ? 197  HOH J O     1 
HETATM 7224 O  O     . HOH V 7 .   ? -4.566  44.772  -64.596 1.00 37.90  ? 251  HOH J O     1 
HETATM 7225 O  O     . HOH V 7 .   ? -25.971 26.910  -52.746 1.00 38.80  ? 256  HOH J O     1 
HETATM 7226 O  O     . HOH V 7 .   ? -14.912 32.487  -59.199 1.00 33.25  ? 278  HOH J O     1 
HETATM 7227 O  O     . HOH V 7 .   ? -28.251 41.667  -35.531 1.00 24.95  ? 319  HOH J O     1 
HETATM 7228 O  O     . HOH V 7 .   ? -21.050 24.478  -37.267 1.00 49.13  ? 329  HOH J O     1 
HETATM 7229 O  O     . HOH V 7 .   ? -11.500 33.895  -59.672 1.00 33.23  ? 338  HOH J O     1 
HETATM 7230 O  O     . HOH V 7 .   ? -23.714 25.515  -52.308 1.00 30.69  ? 346  HOH J O     1 
HETATM 7231 O  O     . HOH V 7 .   ? -12.906 31.797  -70.146 1.00 35.11  ? 364  HOH J O     1 
HETATM 7232 O  O     . HOH V 7 .   ? -13.656 32.143  -56.170 1.00 42.32  ? 387  HOH J O     1 
HETATM 7233 O  O     . HOH V 7 .   ? -24.394 24.385  -50.240 1.00 40.46  ? 397  HOH J O     1 
HETATM 7234 O  O     . HOH V 7 .   ? -24.861 27.161  -42.891 1.00 45.94  ? 399  HOH J O     1 
HETATM 7235 O  O     . HOH V 7 .   ? -16.170 34.662  -58.011 1.00 38.06  ? 409  HOH J O     1 
HETATM 7236 O  O     . HOH V 7 .   ? -30.257 46.536  -40.346 1.00 26.65  ? 443  HOH J O     1 
HETATM 7237 O  O     . HOH V 7 .   ? -22.828 27.729  -39.226 1.00 33.55  ? 454  HOH J O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1    1    GLY GLY A . n 
A 1 2   ILE 2   2    2    ILE ILE A . n 
A 1 3   VAL 3   3    3    VAL VAL A . n 
A 1 4   LEU 4   4    4    LEU LEU A . n 
A 1 5   PHE 5   5    5    PHE PHE A . n 
A 1 6   VAL 6   6    6    VAL VAL A . n 
A 1 7   ASP 7   7    7    ASP ASP A . n 
A 1 8   PHE 8   8    8    PHE PHE A . n 
A 1 9   ASP 9   9    9    ASP ASP A . n 
A 1 10  TYR 10  10   10   TYR TYR A . n 
A 1 11  PHE 11  11   11   PHE PHE A . n 
A 1 12  TYR 12  12   12   TYR TYR A . n 
A 1 13  ALA 13  13   13   ALA ALA A . n 
A 1 14  GLN 14  14   14   GLN GLN A . n 
A 1 15  VAL 15  15   15   VAL VAL A . n 
A 1 16  GLU 16  16   16   GLU GLU A . n 
A 1 17  GLU 17  17   17   GLU GLU A . n 
A 1 18  VAL 18  18   18   VAL VAL A . n 
A 1 19  LEU 19  19   19   LEU LEU A . n 
A 1 20  ASN 20  20   20   ASN ASN A . n 
A 1 21  PRO 21  21   21   PRO PRO A . n 
A 1 22  SER 22  22   22   SER SER A . n 
A 1 23  LEU 23  23   23   LEU LEU A . n 
A 1 24  LYS 24  24   24   LYS LYS A . n 
A 1 25  GLY 25  25   25   GLY GLY A . n 
A 1 26  LYS 26  26   26   LYS LYS A . n 
A 1 27  PRO 27  27   27   PRO PRO A . n 
A 1 28  VAL 28  28   28   VAL VAL A . n 
A 1 29  VAL 29  29   29   VAL VAL A . n 
A 1 30  VAL 30  30   30   VAL VAL A . n 
A 1 31  CYS 31  31   31   CYS CYS A . n 
A 1 32  VAL 32  32   32   VAL VAL A . n 
A 1 33  PHE 33  33   33   PHE PHE A . n 
A 1 34  SER 34  34   34   SER SER A . n 
A 1 35  GLY 35  35   35   GLY GLY A . n 
A 1 36  ARG 36  36   36   ARG ARG A . n 
A 1 37  PHE 37  37   37   PHE PHE A . n 
A 1 38  GLU 38  38   38   GLU GLU A . n 
A 1 39  ASP 39  39   39   ASP ASP A . n 
A 1 40  SER 40  40   40   SER SER A . n 
A 1 41  GLY 41  41   41   GLY GLY A . n 
A 1 42  ALA 42  42   42   ALA ALA A . n 
A 1 43  VAL 43  43   43   VAL VAL A . n 
A 1 44  ALA 44  44   44   ALA ALA A . n 
A 1 45  THR 45  45   45   THR THR A . n 
A 1 46  ALA 46  46   46   ALA ALA A . n 
A 1 47  ASN 47  47   47   ASN ASN A . n 
A 1 48  TYR 48  48   48   TYR TYR A . n 
A 1 49  GLU 49  49   49   GLU GLU A . n 
A 1 50  ALA 50  50   50   ALA ALA A . n 
A 1 51  ARG 51  51   51   ARG ARG A . n 
A 1 52  LYS 52  52   52   LYS LYS A . n 
A 1 53  PHE 53  53   53   PHE PHE A . n 
A 1 54  GLY 54  54   54   GLY GLY A . n 
A 1 55  VAL 55  55   55   VAL VAL A . n 
A 1 56  LYS 56  56   56   LYS LYS A . n 
A 1 57  ALA 57  57   57   ALA ALA A . n 
A 1 58  GLY 58  58   58   GLY GLY A . n 
A 1 59  ILE 59  59   59   ILE ILE A . n 
A 1 60  PRO 60  60   60   PRO PRO A . n 
A 1 61  ILE 61  61   61   ILE ILE A . n 
A 1 62  VAL 62  62   62   VAL VAL A . n 
A 1 63  GLU 63  63   63   GLU GLU A . n 
A 1 64  ALA 64  64   64   ALA ALA A . n 
A 1 65  LYS 65  65   65   LYS LYS A . n 
A 1 66  LYS 66  66   66   LYS LYS A . n 
A 1 67  ILE 67  67   67   ILE ILE A . n 
A 1 68  LEU 68  68   68   LEU LEU A . n 
A 1 69  PRO 69  69   69   PRO PRO A . n 
A 1 70  ASN 70  70   70   ASN ASN A . n 
A 1 71  ALA 71  71   71   ALA ALA A . n 
A 1 72  VAL 72  72   72   VAL VAL A . n 
A 1 73  TYR 73  73   73   TYR TYR A . n 
A 1 74  LEU 74  74   74   LEU LEU A . n 
A 1 75  PRO 75  75   75   PRO PRO A . n 
A 1 76  MET 76  76   76   MET MET A . n 
A 1 77  ARG 77  77   77   ARG ARG A . n 
A 1 78  LYS 78  78   78   LYS LYS A . n 
A 1 79  GLU 79  79   79   GLU GLU A . n 
A 1 80  VAL 80  80   80   VAL VAL A . n 
A 1 81  TYR 81  81   81   TYR TYR A . n 
A 1 82  GLN 82  82   82   GLN GLN A . n 
A 1 83  GLN 83  83   83   GLN GLN A . n 
A 1 84  VAL 84  84   84   VAL VAL A . n 
A 1 85  SER 85  85   85   SER SER A . n 
A 1 86  SER 86  86   86   SER SER A . n 
A 1 87  ARG 87  87   87   ARG ARG A . n 
A 1 88  ILE 88  88   88   ILE ILE A . n 
A 1 89  MET 89  89   89   MET MET A . n 
A 1 90  ASN 90  90   90   ASN ASN A . n 
A 1 91  LEU 91  91   91   LEU LEU A . n 
A 1 92  LEU 92  92   92   LEU LEU A . n 
A 1 93  ARG 93  93   93   ARG ARG A . n 
A 1 94  GLU 94  94   94   GLU GLU A . n 
A 1 95  TYR 95  95   95   TYR TYR A . n 
A 1 96  SER 96  96   96   SER SER A . n 
A 1 97  GLU 97  97   97   GLU GLU A . n 
A 1 98  LYS 98  98   98   LYS LYS A . n 
A 1 99  ILE 99  99   99   ILE ILE A . n 
A 1 100 GLU 100 100  100  GLU GLU A . n 
A 1 101 ILE 101 101  101  ILE ILE A . n 
A 1 102 ALA 102 102  102  ALA ALA A . n 
A 1 103 SER 103 103  103  SER SER A . n 
A 1 104 ILE 104 104  104  ILE ILE A . n 
A 1 105 ASP 105 105  105  ASP ASP A . n 
A 1 106 GLU 106 106  106  GLU GLU A . n 
A 1 107 ALA 107 107  107  ALA ALA A . n 
A 1 108 TYR 108 108  108  TYR TYR A . n 
A 1 109 LEU 109 109  109  LEU LEU A . n 
A 1 110 ASP 110 110  110  ASP ASP A . n 
A 1 111 ILE 111 111  111  ILE ILE A . n 
A 1 112 SER 112 112  112  SER SER A . n 
A 1 113 ASP 113 113  113  ASP ASP A . n 
A 1 114 LYS 114 114  114  LYS LYS A . n 
A 1 115 VAL 115 115  115  VAL VAL A . n 
A 1 116 ARG 116 116  116  ARG ARG A . n 
A 1 117 ASP 117 117  117  ASP ASP A . n 
A 1 118 TYR 118 118  118  TYR TYR A . n 
A 1 119 ARG 119 119  119  ARG ARG A . n 
A 1 120 GLU 120 120  120  GLU GLU A . n 
A 1 121 ALA 121 121  121  ALA ALA A . n 
A 1 122 TYR 122 122  122  TYR TYR A . n 
A 1 123 ASN 123 123  123  ASN ASN A . n 
A 1 124 LEU 124 124  124  LEU LEU A . n 
A 1 125 GLY 125 125  125  GLY GLY A . n 
A 1 126 LEU 126 126  126  LEU LEU A . n 
A 1 127 GLU 127 127  127  GLU GLU A . n 
A 1 128 ILE 128 128  128  ILE ILE A . n 
A 1 129 LYS 129 129  129  LYS LYS A . n 
A 1 130 ASN 130 130  130  ASN ASN A . n 
A 1 131 LYS 131 131  131  LYS LYS A . n 
A 1 132 ILE 132 132  132  ILE ILE A . n 
A 1 133 LEU 133 133  133  LEU LEU A . n 
A 1 134 GLU 134 134  134  GLU GLU A . n 
A 1 135 LYS 135 135  135  LYS LYS A . n 
A 1 136 GLU 136 136  136  GLU GLU A . n 
A 1 137 LYS 137 137  137  LYS LYS A . n 
A 1 138 ILE 138 138  138  ILE ILE A . n 
A 1 139 THR 139 139  139  THR THR A . n 
A 1 140 VAL 140 140  140  VAL VAL A . n 
A 1 141 THR 141 141  141  THR THR A . n 
A 1 142 VAL 142 142  142  VAL VAL A . n 
A 1 143 GLY 143 143  143  GLY GLY A . n 
A 1 144 ILE 144 144  144  ILE ILE A . n 
A 1 145 SER 145 145  145  SER SER A . n 
A 1 146 LYS 146 146  146  LYS LYS A . n 
A 1 147 ASN 147 147  147  ASN ASN A . n 
A 1 148 LYS 148 148  148  LYS LYS A . n 
A 1 149 VAL 149 149  149  VAL VAL A . n 
A 1 150 PHE 150 150  150  PHE PHE A . n 
A 1 151 ALA 151 151  151  ALA ALA A . n 
A 1 152 LYS 152 152  152  LYS LYS A . n 
A 1 153 ILE 153 153  153  ILE ILE A . n 
A 1 154 ALA 154 154  154  ALA ALA A . n 
A 1 155 ALA 155 155  155  ALA ALA A . n 
A 1 156 ASP 156 156  156  ASP ASP A . n 
A 1 157 MET 157 157  157  MET MET A . n 
A 1 158 ALA 158 158  158  ALA ALA A . n 
A 1 159 LYS 159 159  159  LYS LYS A . n 
A 1 160 PRO 160 160  160  PRO PRO A . n 
A 1 161 ASN 161 161  161  ASN ASN A . n 
A 1 162 GLY 162 162  162  GLY GLY A . n 
A 1 163 ILE 163 163  163  ILE ILE A . n 
A 1 164 LYS 164 164  164  LYS LYS A . n 
A 1 165 VAL 165 165  165  VAL VAL A . n 
A 1 166 ILE 166 166  166  ILE ILE A . n 
A 1 167 ASP 167 167  167  ASP ASP A . n 
A 1 168 ASP 168 168  168  ASP ASP A . n 
A 1 169 GLU 169 169  169  GLU GLU A . n 
A 1 170 GLU 170 170  170  GLU GLU A . n 
A 1 171 VAL 171 171  171  VAL VAL A . n 
A 1 172 LYS 172 172  172  LYS LYS A . n 
A 1 173 ARG 173 173  173  ARG ARG A . n 
A 1 174 LEU 174 174  174  LEU LEU A . n 
A 1 175 ILE 175 175  175  ILE ILE A . n 
A 1 176 ARG 176 176  176  ARG ARG A . n 
A 1 177 GLU 177 177  177  GLU GLU A . n 
A 1 178 LEU 178 178  178  LEU LEU A . n 
A 1 179 ASP 179 179  179  ASP ASP A . n 
A 1 180 ILE 180 180  180  ILE ILE A . n 
A 1 181 ALA 181 181  181  ALA ALA A . n 
A 1 182 ASP 182 182  182  ASP ASP A . n 
A 1 183 VAL 183 183  183  VAL VAL A . n 
A 1 184 PRO 184 184  184  PRO PRO A . n 
A 1 185 GLY 185 185  185  GLY GLY A . n 
A 1 186 ILE 186 186  186  ILE ILE A . n 
A 1 187 GLY 187 187  187  GLY GLY A . n 
A 1 188 ASN 188 188  188  ASN ASN A . n 
A 1 189 ILE 189 189  189  ILE ILE A . n 
A 1 190 THR 190 190  190  THR THR A . n 
A 1 191 ALA 191 191  191  ALA ALA A . n 
A 1 192 GLU 192 192  192  GLU GLU A . n 
A 1 193 LYS 193 193  193  LYS LYS A . n 
A 1 194 LEU 194 194  194  LEU LEU A . n 
A 1 195 LYS 195 195  195  LYS LYS A . n 
A 1 196 LYS 196 196  196  LYS LYS A . n 
A 1 197 LEU 197 197  197  LEU LEU A . n 
A 1 198 GLY 198 198  198  GLY GLY A . n 
A 1 199 ILE 199 199  199  ILE ILE A . n 
A 1 200 ASN 200 200  200  ASN ASN A . n 
A 1 201 LYS 201 201  201  LYS LYS A . n 
A 1 202 LEU 202 202  202  LEU LEU A . n 
A 1 203 VAL 203 203  203  VAL VAL A . n 
A 1 204 ASP 204 204  204  ASP ASP A . n 
A 1 205 THR 205 205  205  THR THR A . n 
A 1 206 LEU 206 206  206  LEU LEU A . n 
A 1 207 SER 207 207  207  SER SER A . n 
A 1 208 ILE 208 208  208  ILE ILE A . n 
A 1 209 GLU 209 209  209  GLU GLU A . n 
A 1 210 PHE 210 210  210  PHE PHE A . n 
A 1 211 ASP 211 211  211  ASP ASP A . n 
A 1 212 LYS 212 212  212  LYS LYS A . n 
A 1 213 LEU 213 213  213  LEU LEU A . n 
A 1 214 LYS 214 214  214  LYS LYS A . n 
A 1 215 GLY 215 215  215  GLY GLY A . n 
A 1 216 MET 216 216  216  MET MET A . n 
A 1 217 ILE 217 217  217  ILE ILE A . n 
A 1 218 GLY 218 218  218  GLY GLY A . n 
A 1 219 GLU 219 219  219  GLU GLU A . n 
A 1 220 ALA 220 220  220  ALA ALA A . n 
A 1 221 LYS 221 221  221  LYS LYS A . n 
A 1 222 ALA 222 222  222  ALA ALA A . n 
A 1 223 LYS 223 223  223  LYS LYS A . n 
A 1 224 TYR 224 224  224  TYR TYR A . n 
A 1 225 LEU 225 225  225  LEU LEU A . n 
A 1 226 ILE 226 226  226  ILE ILE A . n 
A 1 227 SER 227 227  227  SER SER A . n 
A 1 228 LEU 228 228  228  LEU LEU A . n 
A 1 229 ALA 229 229  229  ALA ALA A . n 
A 1 230 ARG 230 230  230  ARG ARG A . n 
A 1 231 ASP 231 231  231  ASP ASP A . n 
A 1 232 GLU 232 232  232  GLU GLU A . n 
A 1 233 TYR 233 233  233  TYR TYR A . n 
A 1 234 ASN 234 234  234  ASN ASN A . n 
A 1 235 GLU 235 235  235  GLU GLU A . n 
A 1 236 PRO 236 236  236  PRO PRO A . n 
A 1 237 ILE 237 237  237  ILE ILE A . n 
A 1 238 ARG 238 238  238  ARG ARG A . n 
A 1 239 THR 239 239  239  THR THR A . n 
A 1 240 ARG 240 240  240  ARG ARG A . n 
A 1 241 VAL 241 241  241  VAL VAL A . n 
A 1 242 ARG 242 242  242  ARG ARG A . n 
A 1 243 LYS 243 243  243  LYS LYS A . n 
A 1 244 SER 244 244  244  SER SER A . n 
A 1 245 ILE 245 245  245  ILE ILE A . n 
A 1 246 GLY 246 246  246  GLY GLY A . n 
A 1 247 ARG 247 247  247  ARG ARG A . n 
A 1 248 ILE 248 248  248  ILE ILE A . n 
A 1 249 VAL 249 249  249  VAL VAL A . n 
A 1 250 THR 250 250  250  THR THR A . n 
A 1 251 MET 251 251  251  MET MET A . n 
A 1 252 LYS 252 252  252  LYS LYS A . n 
A 1 253 ARG 253 253  253  ARG ARG A . n 
A 1 254 ASN 254 254  254  ASN ASN A . n 
A 1 255 SER 255 255  255  SER SER A . n 
A 1 256 ARG 256 256  256  ARG ARG A . n 
A 1 257 ASN 257 257  257  ASN ASN A . n 
A 1 258 LEU 258 258  258  LEU LEU A . n 
A 1 259 GLU 259 259  259  GLU GLU A . n 
A 1 260 GLU 260 260  260  GLU GLU A . n 
A 1 261 ILE 261 261  261  ILE ILE A . n 
A 1 262 LYS 262 262  262  LYS LYS A . n 
A 1 263 PRO 263 263  263  PRO PRO A . n 
A 1 264 TYR 264 264  264  TYR TYR A . n 
A 1 265 LEU 265 265  265  LEU LEU A . n 
A 1 266 PHE 266 266  266  PHE PHE A . n 
A 1 267 ARG 267 267  267  ARG ARG A . n 
A 1 268 ALA 268 268  268  ALA ALA A . n 
A 1 269 ILE 269 269  269  ILE ILE A . n 
A 1 270 GLU 270 270  270  GLU GLU A . n 
A 1 271 GLU 271 271  271  GLU GLU A . n 
A 1 272 SER 272 272  272  SER SER A . n 
A 1 273 TYR 273 273  273  TYR TYR A . n 
A 1 274 TYR 274 274  274  TYR TYR A . n 
A 1 275 LYS 275 275  275  LYS LYS A . n 
A 1 276 LEU 276 276  276  LEU LEU A . n 
A 1 277 ASP 277 277  277  ASP ASP A . n 
A 1 278 LYS 278 278  278  LYS LYS A . n 
A 1 279 ARG 279 279  279  ARG ARG A . n 
A 1 280 ILE 280 280  280  ILE ILE A . n 
A 1 281 PRO 281 281  281  PRO PRO A . n 
A 1 282 LYS 282 282  282  LYS LYS A . n 
A 1 283 ALA 283 283  283  ALA ALA A . n 
A 1 284 ILE 284 284  284  ILE ILE A . n 
A 1 285 HIS 285 285  285  HIS HIS A . n 
A 1 286 VAL 286 286  286  VAL VAL A . n 
A 1 287 VAL 287 287  287  VAL VAL A . n 
A 1 288 ALA 288 288  288  ALA ALA A . n 
A 1 289 VAL 289 289  289  VAL VAL A . n 
A 1 290 THR 290 290  290  THR THR A . n 
A 1 291 GLU 291 291  291  GLU GLU A . n 
A 1 292 ASP 292 292  292  ASP ASP A . n 
A 1 293 LEU 293 293  293  LEU LEU A . n 
A 1 294 ASP 294 294  294  ASP ASP A . n 
A 1 295 ILE 295 295  295  ILE ILE A . n 
A 1 296 VAL 296 296  296  VAL VAL A . n 
A 1 297 SER 297 297  297  SER SER A . n 
A 1 298 ARG 298 298  298  ARG ARG A . n 
A 1 299 GLY 299 299  299  GLY GLY A . n 
A 1 300 ARG 300 300  300  ARG ARG A . n 
A 1 301 THR 301 301  301  THR THR A . n 
A 1 302 PHE 302 302  302  PHE PHE A . n 
A 1 303 PRO 303 303  303  PRO PRO A . n 
A 1 304 HIS 304 304  304  HIS HIS A . n 
A 1 305 GLY 305 305  305  GLY GLY A . n 
A 1 306 ILE 306 306  306  ILE ILE A . n 
A 1 307 SER 307 307  307  SER SER A . n 
A 1 308 LYS 308 308  308  LYS LYS A . n 
A 1 309 GLU 309 309  309  GLU GLU A . n 
A 1 310 THR 310 310  310  THR THR A . n 
A 1 311 ALA 311 311  311  ALA ALA A . n 
A 1 312 TYR 312 312  312  TYR TYR A . n 
A 1 313 SER 313 313  313  SER SER A . n 
A 1 314 GLU 314 314  314  GLU GLU A . n 
A 1 315 SER 315 315  315  SER SER A . n 
A 1 316 VAL 316 316  316  VAL VAL A . n 
A 1 317 LYS 317 317  317  LYS LYS A . n 
A 1 318 LEU 318 318  318  LEU LEU A . n 
A 1 319 LEU 319 319  319  LEU LEU A . n 
A 1 320 GLN 320 320  320  GLN GLN A . n 
A 1 321 LYS 321 321  321  LYS LYS A . n 
A 1 322 ILE 322 322  322  ILE ILE A . n 
A 1 323 LEU 323 323  323  LEU LEU A . n 
A 1 324 GLU 324 324  324  GLU GLU A . n 
A 1 325 GLU 325 325  325  GLU GLU A . n 
A 1 326 ASP 326 326  326  ASP ASP A . n 
A 1 327 GLU 327 327  327  GLU GLU A . n 
A 1 328 ARG 328 328  328  ARG ARG A . n 
A 1 329 LYS 329 329  329  LYS LYS A . n 
A 1 330 ILE 330 330  330  ILE ILE A . n 
A 1 331 ARG 331 331  331  ARG ARG A . n 
A 1 332 ARG 332 332  332  ARG ARG A . n 
A 1 333 ILE 333 333  333  ILE ILE A . n 
A 1 334 GLY 334 334  334  GLY GLY A . n 
A 1 335 VAL 335 335  335  VAL VAL A . n 
A 1 336 ARG 336 336  336  ARG ARG A . n 
A 1 337 PHE 337 337  337  PHE PHE A . n 
A 1 338 SER 338 338  338  SER SER A . n 
A 1 339 LYS 339 339  339  LYS LYS A . n 
A 1 340 PHE 340 340  340  PHE PHE A . n 
A 1 341 ILE 341 341  341  ILE ILE A . n 
B 2 1   DT  1   803  803  DT  T   D . n 
B 2 2   DT  2   804  804  DT  T   D . n 
B 2 3   DG  3   805  805  DG  G   D . n 
B 2 4   DG  4   806  806  DG  G   D . n 
B 2 5   DA  5   807  807  DA  A   D . n 
B 2 6   DT  6   808  808  DT  T   D . n 
B 2 7   DG  7   809  809  DG  G   D . n 
B 2 8   DG  8   810  810  DG  G   D . n 
B 2 9   DT  9   811  811  DT  T   D . n 
B 2 10  DA  10  812  812  DA  A   D . n 
B 2 11  DG  11  813  813  DG  G   D . n 
B 2 12  DC  12  814  814  DC  C   D . n 
B 2 13  DDG 13  815  815  DDG DDG D . n 
C 3 1   DC  1   901  ?    ?   ?   E . n 
C 3 2   DT  2   902  902  DT  T   E . n 
C 3 3   DA  3   903  903  DA  A   E . n 
C 3 4   DA  4   904  904  DA  A   E . n 
C 3 5   DC  5   905  905  DC  C   E . n 
C 3 6   DG  6   906  906  DG  G   E . n 
C 3 7   DC  7   907  907  DC  C   E . n 
C 3 8   DT  8   908  908  DT  T   E . n 
C 3 9   DA  9   909  909  DA  A   E . n 
C 3 10  DC  10  910  910  DC  C   E . n 
C 3 11  DC  11  911  911  DC  C   E . n 
C 3 12  DA  12  912  912  DA  A   E . n 
C 3 13  DT  13  913  913  DT  T   E . n 
C 3 14  DC  14  914  914  DC  C   E . n 
C 3 15  DC  15  915  915  DC  C   E . n 
C 3 16  DA  16  916  916  DA  A   E . n 
C 3 17  DA  17  917  917  DA  A   E . n 
C 3 18  DC  18  918  918  DC  C   E . n 
C 3 19  DC  19  919  ?    ?   ?   E . n 
D 1 1   GLY 1   1001 1001 GLY GLY B . n 
D 1 2   ILE 2   1002 1002 ILE ILE B . n 
D 1 3   VAL 3   1003 1003 VAL VAL B . n 
D 1 4   LEU 4   1004 1004 LEU LEU B . n 
D 1 5   PHE 5   1005 1005 PHE PHE B . n 
D 1 6   VAL 6   1006 1006 VAL VAL B . n 
D 1 7   ASP 7   1007 1007 ASP ASP B . n 
D 1 8   PHE 8   1008 1008 PHE PHE B . n 
D 1 9   ASP 9   1009 1009 ASP ASP B . n 
D 1 10  TYR 10  1010 1010 TYR TYR B . n 
D 1 11  PHE 11  1011 1011 PHE PHE B . n 
D 1 12  TYR 12  1012 1012 TYR TYR B . n 
D 1 13  ALA 13  1013 1013 ALA ALA B . n 
D 1 14  GLN 14  1014 1014 GLN GLN B . n 
D 1 15  VAL 15  1015 1015 VAL VAL B . n 
D 1 16  GLU 16  1016 1016 GLU GLU B . n 
D 1 17  GLU 17  1017 1017 GLU GLU B . n 
D 1 18  VAL 18  1018 1018 VAL VAL B . n 
D 1 19  LEU 19  1019 1019 LEU LEU B . n 
D 1 20  ASN 20  1020 1020 ASN ASN B . n 
D 1 21  PRO 21  1021 1021 PRO PRO B . n 
D 1 22  SER 22  1022 1022 SER SER B . n 
D 1 23  LEU 23  1023 1023 LEU LEU B . n 
D 1 24  LYS 24  1024 1024 LYS LYS B . n 
D 1 25  GLY 25  1025 1025 GLY GLY B . n 
D 1 26  LYS 26  1026 1026 LYS LYS B . n 
D 1 27  PRO 27  1027 1027 PRO PRO B . n 
D 1 28  VAL 28  1028 1028 VAL VAL B . n 
D 1 29  VAL 29  1029 1029 VAL VAL B . n 
D 1 30  VAL 30  1030 1030 VAL VAL B . n 
D 1 31  CYS 31  1031 1031 CYS CYS B . n 
D 1 32  VAL 32  1032 1032 VAL VAL B . n 
D 1 33  PHE 33  1033 1033 PHE PHE B . n 
D 1 34  SER 34  1034 1034 SER SER B . n 
D 1 35  GLY 35  1035 1035 GLY GLY B . n 
D 1 36  ARG 36  1036 1036 ARG ARG B . n 
D 1 37  PHE 37  1037 1037 PHE PHE B . n 
D 1 38  GLU 38  1038 1038 GLU GLU B . n 
D 1 39  ASP 39  1039 1039 ASP ASP B . n 
D 1 40  SER 40  1040 1040 SER SER B . n 
D 1 41  GLY 41  1041 1041 GLY GLY B . n 
D 1 42  ALA 42  1042 1042 ALA ALA B . n 
D 1 43  VAL 43  1043 1043 VAL VAL B . n 
D 1 44  ALA 44  1044 1044 ALA ALA B . n 
D 1 45  THR 45  1045 1045 THR THR B . n 
D 1 46  ALA 46  1046 1046 ALA ALA B . n 
D 1 47  ASN 47  1047 1047 ASN ASN B . n 
D 1 48  TYR 48  1048 1048 TYR TYR B . n 
D 1 49  GLU 49  1049 1049 GLU GLU B . n 
D 1 50  ALA 50  1050 1050 ALA ALA B . n 
D 1 51  ARG 51  1051 1051 ARG ARG B . n 
D 1 52  LYS 52  1052 1052 LYS LYS B . n 
D 1 53  PHE 53  1053 1053 PHE PHE B . n 
D 1 54  GLY 54  1054 1054 GLY GLY B . n 
D 1 55  VAL 55  1055 1055 VAL VAL B . n 
D 1 56  LYS 56  1056 1056 LYS LYS B . n 
D 1 57  ALA 57  1057 1057 ALA ALA B . n 
D 1 58  GLY 58  1058 1058 GLY GLY B . n 
D 1 59  ILE 59  1059 1059 ILE ILE B . n 
D 1 60  PRO 60  1060 1060 PRO PRO B . n 
D 1 61  ILE 61  1061 1061 ILE ILE B . n 
D 1 62  VAL 62  1062 1062 VAL VAL B . n 
D 1 63  GLU 63  1063 1063 GLU GLU B . n 
D 1 64  ALA 64  1064 1064 ALA ALA B . n 
D 1 65  LYS 65  1065 1065 LYS LYS B . n 
D 1 66  LYS 66  1066 1066 LYS LYS B . n 
D 1 67  ILE 67  1067 1067 ILE ILE B . n 
D 1 68  LEU 68  1068 1068 LEU LEU B . n 
D 1 69  PRO 69  1069 1069 PRO PRO B . n 
D 1 70  ASN 70  1070 1070 ASN ASN B . n 
D 1 71  ALA 71  1071 1071 ALA ALA B . n 
D 1 72  VAL 72  1072 1072 VAL VAL B . n 
D 1 73  TYR 73  1073 1073 TYR TYR B . n 
D 1 74  LEU 74  1074 1074 LEU LEU B . n 
D 1 75  PRO 75  1075 1075 PRO PRO B . n 
D 1 76  MET 76  1076 1076 MET MET B . n 
D 1 77  ARG 77  1077 1077 ARG ARG B . n 
D 1 78  LYS 78  1078 1078 LYS LYS B . n 
D 1 79  GLU 79  1079 1079 GLU GLU B . n 
D 1 80  VAL 80  1080 1080 VAL VAL B . n 
D 1 81  TYR 81  1081 1081 TYR TYR B . n 
D 1 82  GLN 82  1082 1082 GLN GLN B . n 
D 1 83  GLN 83  1083 1083 GLN GLN B . n 
D 1 84  VAL 84  1084 1084 VAL VAL B . n 
D 1 85  SER 85  1085 1085 SER SER B . n 
D 1 86  SER 86  1086 1086 SER SER B . n 
D 1 87  ARG 87  1087 1087 ARG ARG B . n 
D 1 88  ILE 88  1088 1088 ILE ILE B . n 
D 1 89  MET 89  1089 1089 MET MET B . n 
D 1 90  ASN 90  1090 1090 ASN ASN B . n 
D 1 91  LEU 91  1091 1091 LEU LEU B . n 
D 1 92  LEU 92  1092 1092 LEU LEU B . n 
D 1 93  ARG 93  1093 1093 ARG ARG B . n 
D 1 94  GLU 94  1094 1094 GLU GLU B . n 
D 1 95  TYR 95  1095 1095 TYR TYR B . n 
D 1 96  SER 96  1096 1096 SER SER B . n 
D 1 97  GLU 97  1097 1097 GLU GLU B . n 
D 1 98  LYS 98  1098 1098 LYS LYS B . n 
D 1 99  ILE 99  1099 1099 ILE ILE B . n 
D 1 100 GLU 100 1100 1100 GLU GLU B . n 
D 1 101 ILE 101 1101 1101 ILE ILE B . n 
D 1 102 ALA 102 1102 1102 ALA ALA B . n 
D 1 103 SER 103 1103 1103 SER SER B . n 
D 1 104 ILE 104 1104 1104 ILE ILE B . n 
D 1 105 ASP 105 1105 1105 ASP ASP B . n 
D 1 106 GLU 106 1106 1106 GLU GLU B . n 
D 1 107 ALA 107 1107 1107 ALA ALA B . n 
D 1 108 TYR 108 1108 1108 TYR TYR B . n 
D 1 109 LEU 109 1109 1109 LEU LEU B . n 
D 1 110 ASP 110 1110 1110 ASP ASP B . n 
D 1 111 ILE 111 1111 1111 ILE ILE B . n 
D 1 112 SER 112 1112 1112 SER SER B . n 
D 1 113 ASP 113 1113 1113 ASP ASP B . n 
D 1 114 LYS 114 1114 1114 LYS LYS B . n 
D 1 115 VAL 115 1115 1115 VAL VAL B . n 
D 1 116 ARG 116 1116 1116 ARG ARG B . n 
D 1 117 ASP 117 1117 1117 ASP ASP B . n 
D 1 118 TYR 118 1118 1118 TYR TYR B . n 
D 1 119 ARG 119 1119 1119 ARG ARG B . n 
D 1 120 GLU 120 1120 1120 GLU GLU B . n 
D 1 121 ALA 121 1121 1121 ALA ALA B . n 
D 1 122 TYR 122 1122 1122 TYR TYR B . n 
D 1 123 ASN 123 1123 1123 ASN ASN B . n 
D 1 124 LEU 124 1124 1124 LEU LEU B . n 
D 1 125 GLY 125 1125 1125 GLY GLY B . n 
D 1 126 LEU 126 1126 1126 LEU LEU B . n 
D 1 127 GLU 127 1127 1127 GLU GLU B . n 
D 1 128 ILE 128 1128 1128 ILE ILE B . n 
D 1 129 LYS 129 1129 1129 LYS LYS B . n 
D 1 130 ASN 130 1130 1130 ASN ASN B . n 
D 1 131 LYS 131 1131 1131 LYS LYS B . n 
D 1 132 ILE 132 1132 1132 ILE ILE B . n 
D 1 133 LEU 133 1133 1133 LEU LEU B . n 
D 1 134 GLU 134 1134 1134 GLU GLU B . n 
D 1 135 LYS 135 1135 1135 LYS LYS B . n 
D 1 136 GLU 136 1136 1136 GLU GLU B . n 
D 1 137 LYS 137 1137 1137 LYS LYS B . n 
D 1 138 ILE 138 1138 1138 ILE ILE B . n 
D 1 139 THR 139 1139 1139 THR THR B . n 
D 1 140 VAL 140 1140 1140 VAL VAL B . n 
D 1 141 THR 141 1141 1141 THR THR B . n 
D 1 142 VAL 142 1142 1142 VAL VAL B . n 
D 1 143 GLY 143 1143 1143 GLY GLY B . n 
D 1 144 ILE 144 1144 1144 ILE ILE B . n 
D 1 145 SER 145 1145 1145 SER SER B . n 
D 1 146 LYS 146 1146 1146 LYS LYS B . n 
D 1 147 ASN 147 1147 1147 ASN ASN B . n 
D 1 148 LYS 148 1148 1148 LYS LYS B . n 
D 1 149 VAL 149 1149 1149 VAL VAL B . n 
D 1 150 PHE 150 1150 1150 PHE PHE B . n 
D 1 151 ALA 151 1151 1151 ALA ALA B . n 
D 1 152 LYS 152 1152 1152 LYS LYS B . n 
D 1 153 ILE 153 1153 1153 ILE ILE B . n 
D 1 154 ALA 154 1154 1154 ALA ALA B . n 
D 1 155 ALA 155 1155 1155 ALA ALA B . n 
D 1 156 ASP 156 1156 1156 ASP ASP B . n 
D 1 157 MET 157 1157 1157 MET MET B . n 
D 1 158 ALA 158 1158 1158 ALA ALA B . n 
D 1 159 LYS 159 1159 1159 LYS LYS B . n 
D 1 160 PRO 160 1160 1160 PRO PRO B . n 
D 1 161 ASN 161 1161 1161 ASN ASN B . n 
D 1 162 GLY 162 1162 1162 GLY GLY B . n 
D 1 163 ILE 163 1163 1163 ILE ILE B . n 
D 1 164 LYS 164 1164 1164 LYS LYS B . n 
D 1 165 VAL 165 1165 1165 VAL VAL B . n 
D 1 166 ILE 166 1166 1166 ILE ILE B . n 
D 1 167 ASP 167 1167 1167 ASP ASP B . n 
D 1 168 ASP 168 1168 1168 ASP ASP B . n 
D 1 169 GLU 169 1169 1169 GLU GLU B . n 
D 1 170 GLU 170 1170 1170 GLU GLU B . n 
D 1 171 VAL 171 1171 1171 VAL VAL B . n 
D 1 172 LYS 172 1172 1172 LYS LYS B . n 
D 1 173 ARG 173 1173 1173 ARG ARG B . n 
D 1 174 LEU 174 1174 1174 LEU LEU B . n 
D 1 175 ILE 175 1175 1175 ILE ILE B . n 
D 1 176 ARG 176 1176 1176 ARG ARG B . n 
D 1 177 GLU 177 1177 1177 GLU GLU B . n 
D 1 178 LEU 178 1178 1178 LEU LEU B . n 
D 1 179 ASP 179 1179 1179 ASP ASP B . n 
D 1 180 ILE 180 1180 1180 ILE ILE B . n 
D 1 181 ALA 181 1181 1181 ALA ALA B . n 
D 1 182 ASP 182 1182 1182 ASP ASP B . n 
D 1 183 VAL 183 1183 1183 VAL VAL B . n 
D 1 184 PRO 184 1184 1184 PRO PRO B . n 
D 1 185 GLY 185 1185 1185 GLY GLY B . n 
D 1 186 ILE 186 1186 1186 ILE ILE B . n 
D 1 187 GLY 187 1187 1187 GLY GLY B . n 
D 1 188 ASN 188 1188 1188 ASN ASN B . n 
D 1 189 ILE 189 1189 1189 ILE ILE B . n 
D 1 190 THR 190 1190 1190 THR THR B . n 
D 1 191 ALA 191 1191 1191 ALA ALA B . n 
D 1 192 GLU 192 1192 1192 GLU GLU B . n 
D 1 193 LYS 193 1193 1193 LYS LYS B . n 
D 1 194 LEU 194 1194 1194 LEU LEU B . n 
D 1 195 LYS 195 1195 1195 LYS LYS B . n 
D 1 196 LYS 196 1196 1196 LYS LYS B . n 
D 1 197 LEU 197 1197 1197 LEU LEU B . n 
D 1 198 GLY 198 1198 1198 GLY GLY B . n 
D 1 199 ILE 199 1199 1199 ILE ILE B . n 
D 1 200 ASN 200 1200 1200 ASN ASN B . n 
D 1 201 LYS 201 1201 1201 LYS LYS B . n 
D 1 202 LEU 202 1202 1202 LEU LEU B . n 
D 1 203 VAL 203 1203 1203 VAL VAL B . n 
D 1 204 ASP 204 1204 1204 ASP ASP B . n 
D 1 205 THR 205 1205 1205 THR THR B . n 
D 1 206 LEU 206 1206 1206 LEU LEU B . n 
D 1 207 SER 207 1207 1207 SER SER B . n 
D 1 208 ILE 208 1208 1208 ILE ILE B . n 
D 1 209 GLU 209 1209 1209 GLU GLU B . n 
D 1 210 PHE 210 1210 1210 PHE PHE B . n 
D 1 211 ASP 211 1211 1211 ASP ASP B . n 
D 1 212 LYS 212 1212 1212 LYS LYS B . n 
D 1 213 LEU 213 1213 1213 LEU LEU B . n 
D 1 214 LYS 214 1214 1214 LYS LYS B . n 
D 1 215 GLY 215 1215 1215 GLY GLY B . n 
D 1 216 MET 216 1216 1216 MET MET B . n 
D 1 217 ILE 217 1217 1217 ILE ILE B . n 
D 1 218 GLY 218 1218 1218 GLY GLY B . n 
D 1 219 GLU 219 1219 1219 GLU GLU B . n 
D 1 220 ALA 220 1220 1220 ALA ALA B . n 
D 1 221 LYS 221 1221 1221 LYS LYS B . n 
D 1 222 ALA 222 1222 1222 ALA ALA B . n 
D 1 223 LYS 223 1223 1223 LYS LYS B . n 
D 1 224 TYR 224 1224 1224 TYR TYR B . n 
D 1 225 LEU 225 1225 1225 LEU LEU B . n 
D 1 226 ILE 226 1226 1226 ILE ILE B . n 
D 1 227 SER 227 1227 1227 SER SER B . n 
D 1 228 LEU 228 1228 1228 LEU LEU B . n 
D 1 229 ALA 229 1229 1229 ALA ALA B . n 
D 1 230 ARG 230 1230 1230 ARG ARG B . n 
D 1 231 ASP 231 1231 1231 ASP ASP B . n 
D 1 232 GLU 232 1232 1232 GLU GLU B . n 
D 1 233 TYR 233 1233 1233 TYR TYR B . n 
D 1 234 ASN 234 1234 1234 ASN ASN B . n 
D 1 235 GLU 235 1235 1235 GLU GLU B . n 
D 1 236 PRO 236 1236 1236 PRO PRO B . n 
D 1 237 ILE 237 1237 1237 ILE ILE B . n 
D 1 238 ARG 238 1238 1238 ARG ARG B . n 
D 1 239 THR 239 1239 1239 THR THR B . n 
D 1 240 ARG 240 1240 1240 ARG ARG B . n 
D 1 241 VAL 241 1241 1241 VAL VAL B . n 
D 1 242 ARG 242 1242 1242 ARG ARG B . n 
D 1 243 LYS 243 1243 1243 LYS LYS B . n 
D 1 244 SER 244 1244 1244 SER SER B . n 
D 1 245 ILE 245 1245 1245 ILE ILE B . n 
D 1 246 GLY 246 1246 1246 GLY GLY B . n 
D 1 247 ARG 247 1247 1247 ARG ARG B . n 
D 1 248 ILE 248 1248 1248 ILE ILE B . n 
D 1 249 VAL 249 1249 1249 VAL VAL B . n 
D 1 250 THR 250 1250 1250 THR THR B . n 
D 1 251 MET 251 1251 1251 MET MET B . n 
D 1 252 LYS 252 1252 1252 LYS LYS B . n 
D 1 253 ARG 253 1253 1253 ARG ARG B . n 
D 1 254 ASN 254 1254 1254 ASN ASN B . n 
D 1 255 SER 255 1255 1255 SER SER B . n 
D 1 256 ARG 256 1256 1256 ARG ARG B . n 
D 1 257 ASN 257 1257 1257 ASN ASN B . n 
D 1 258 LEU 258 1258 1258 LEU LEU B . n 
D 1 259 GLU 259 1259 1259 GLU GLU B . n 
D 1 260 GLU 260 1260 1260 GLU GLU B . n 
D 1 261 ILE 261 1261 1261 ILE ILE B . n 
D 1 262 LYS 262 1262 1262 LYS LYS B . n 
D 1 263 PRO 263 1263 1263 PRO PRO B . n 
D 1 264 TYR 264 1264 1264 TYR TYR B . n 
D 1 265 LEU 265 1265 1265 LEU LEU B . n 
D 1 266 PHE 266 1266 1266 PHE PHE B . n 
D 1 267 ARG 267 1267 1267 ARG ARG B . n 
D 1 268 ALA 268 1268 1268 ALA ALA B . n 
D 1 269 ILE 269 1269 1269 ILE ILE B . n 
D 1 270 GLU 270 1270 1270 GLU GLU B . n 
D 1 271 GLU 271 1271 1271 GLU GLU B . n 
D 1 272 SER 272 1272 1272 SER SER B . n 
D 1 273 TYR 273 1273 1273 TYR TYR B . n 
D 1 274 TYR 274 1274 1274 TYR TYR B . n 
D 1 275 LYS 275 1275 1275 LYS LYS B . n 
D 1 276 LEU 276 1276 1276 LEU LEU B . n 
D 1 277 ASP 277 1277 1277 ASP ASP B . n 
D 1 278 LYS 278 1278 1278 LYS LYS B . n 
D 1 279 ARG 279 1279 1279 ARG ARG B . n 
D 1 280 ILE 280 1280 1280 ILE ILE B . n 
D 1 281 PRO 281 1281 1281 PRO PRO B . n 
D 1 282 LYS 282 1282 1282 LYS LYS B . n 
D 1 283 ALA 283 1283 1283 ALA ALA B . n 
D 1 284 ILE 284 1284 1284 ILE ILE B . n 
D 1 285 HIS 285 1285 1285 HIS HIS B . n 
D 1 286 VAL 286 1286 1286 VAL VAL B . n 
D 1 287 VAL 287 1287 1287 VAL VAL B . n 
D 1 288 ALA 288 1288 1288 ALA ALA B . n 
D 1 289 VAL 289 1289 1289 VAL VAL B . n 
D 1 290 THR 290 1290 1290 THR THR B . n 
D 1 291 GLU 291 1291 1291 GLU GLU B . n 
D 1 292 ASP 292 1292 1292 ASP ASP B . n 
D 1 293 LEU 293 1293 1293 LEU LEU B . n 
D 1 294 ASP 294 1294 1294 ASP ASP B . n 
D 1 295 ILE 295 1295 1295 ILE ILE B . n 
D 1 296 VAL 296 1296 1296 VAL VAL B . n 
D 1 297 SER 297 1297 1297 SER SER B . n 
D 1 298 ARG 298 1298 1298 ARG ARG B . n 
D 1 299 GLY 299 1299 1299 GLY GLY B . n 
D 1 300 ARG 300 1300 1300 ARG ARG B . n 
D 1 301 THR 301 1301 1301 THR THR B . n 
D 1 302 PHE 302 1302 1302 PHE PHE B . n 
D 1 303 PRO 303 1303 1303 PRO PRO B . n 
D 1 304 HIS 304 1304 1304 HIS HIS B . n 
D 1 305 GLY 305 1305 1305 GLY GLY B . n 
D 1 306 ILE 306 1306 1306 ILE ILE B . n 
D 1 307 SER 307 1307 1307 SER SER B . n 
D 1 308 LYS 308 1308 1308 LYS LYS B . n 
D 1 309 GLU 309 1309 1309 GLU GLU B . n 
D 1 310 THR 310 1310 1310 THR THR B . n 
D 1 311 ALA 311 1311 1311 ALA ALA B . n 
D 1 312 TYR 312 1312 1312 TYR TYR B . n 
D 1 313 SER 313 1313 1313 SER SER B . n 
D 1 314 GLU 314 1314 1314 GLU GLU B . n 
D 1 315 SER 315 1315 1315 SER SER B . n 
D 1 316 VAL 316 1316 1316 VAL VAL B . n 
D 1 317 LYS 317 1317 1317 LYS LYS B . n 
D 1 318 LEU 318 1318 1318 LEU LEU B . n 
D 1 319 LEU 319 1319 1319 LEU LEU B . n 
D 1 320 GLN 320 1320 1320 GLN GLN B . n 
D 1 321 LYS 321 1321 1321 LYS LYS B . n 
D 1 322 ILE 322 1322 1322 ILE ILE B . n 
D 1 323 LEU 323 1323 1323 LEU LEU B . n 
D 1 324 GLU 324 1324 1324 GLU GLU B . n 
D 1 325 GLU 325 1325 1325 GLU GLU B . n 
D 1 326 ASP 326 1326 1326 ASP ASP B . n 
D 1 327 GLU 327 1327 1327 GLU GLU B . n 
D 1 328 ARG 328 1328 1328 ARG ARG B . n 
D 1 329 LYS 329 1329 1329 LYS LYS B . n 
D 1 330 ILE 330 1330 1330 ILE ILE B . n 
D 1 331 ARG 331 1331 1331 ARG ARG B . n 
D 1 332 ARG 332 1332 1332 ARG ARG B . n 
D 1 333 ILE 333 1333 1333 ILE ILE B . n 
D 1 334 GLY 334 1334 1334 GLY GLY B . n 
D 1 335 VAL 335 1335 1335 VAL VAL B . n 
D 1 336 ARG 336 1336 1336 ARG ARG B . n 
D 1 337 PHE 337 1337 1337 PHE PHE B . n 
D 1 338 SER 338 1338 1338 SER SER B . n 
D 1 339 LYS 339 1339 1339 LYS LYS B . n 
D 1 340 PHE 340 1340 1340 PHE PHE B . n 
D 1 341 ILE 341 1341 1341 ILE ILE B . n 
E 2 1   DT  1   1803 1803 DT  T   H . n 
E 2 2   DT  2   1804 1804 DT  T   H . n 
E 2 3   DG  3   1805 1805 DG  G   H . n 
E 2 4   DG  4   1806 1806 DG  G   H . n 
E 2 5   DA  5   1807 1807 DA  A   H . n 
E 2 6   DT  6   1808 1808 DT  T   H . n 
E 2 7   DG  7   1809 1809 DG  G   H . n 
E 2 8   DG  8   1810 1810 DG  G   H . n 
E 2 9   DT  9   1811 1811 DT  T   H . n 
E 2 10  DA  10  1812 1812 DA  A   H . n 
E 2 11  DG  11  1813 1813 DG  G   H . n 
E 2 12  DC  12  1814 1814 DC  C   H . n 
E 2 13  DDG 13  1815 1815 DDG DDG H . n 
F 3 1   DC  1   1901 1901 DC  C   J . n 
F 3 2   DT  2   1902 1902 DT  T   J . n 
F 3 3   DA  3   1903 1903 DA  A   J . n 
F 3 4   DA  4   1904 1904 DA  A   J . n 
F 3 5   DC  5   1905 1905 DC  C   J . n 
F 3 6   DG  6   1906 1906 DG  G   J . n 
F 3 7   DC  7   1907 1907 DC  C   J . n 
F 3 8   DT  8   1908 1908 DT  T   J . n 
F 3 9   DA  9   1909 1909 DA  A   J . n 
F 3 10  DC  10  1910 1910 DC  C   J . n 
F 3 11  DC  11  1911 1911 DC  C   J . n 
F 3 12  DA  12  1912 1912 DA  A   J . n 
F 3 13  DT  13  1913 1913 DT  T   J . n 
F 3 14  DC  14  1914 1914 DC  C   J . n 
F 3 15  DC  15  1915 1915 DC  C   J . n 
F 3 16  DA  16  1916 1916 DA  A   J . n 
F 3 17  DA  17  1917 1917 DA  A   J . n 
F 3 18  DC  18  1918 1918 DC  C   J . n 
F 3 19  DC  19  1919 ?    ?   ?   J . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 TTP 1   414  414  TTP TTP A . 
H 5 CA  1   415  415  CA  CA  A . 
I 5 CA  1   416  416  CA  CA  A . 
J 5 CA  1   417  417  CA  CA  A . 
K 6 AF  1   926  926  AF  AF  E . 
L 4 TTP 1   1414 1414 TTP TTP B . 
M 5 CA  1   1415 1415 CA  CA  B . 
N 5 CA  1   1416 1416 CA  CA  B . 
O 5 CA  1   1417 1417 CA  CA  B . 
P 6 AF  1   1926 1926 AF  AF  J . 
Q 7 HOH 1   349  349  HOH HOH A . 
Q 7 HOH 2   350  350  HOH HOH A . 
Q 7 HOH 3   351  165  HOH HOH A . 
Q 7 HOH 4   352  352  HOH HOH A . 
Q 7 HOH 5   353  353  HOH HOH A . 
Q 7 HOH 6   354  354  HOH HOH A . 
Q 7 HOH 7   355  355  HOH HOH A . 
Q 7 HOH 8   357  357  HOH HOH A . 
Q 7 HOH 9   358  358  HOH HOH A . 
Q 7 HOH 10  365  365  HOH HOH A . 
Q 7 HOH 11  366  366  HOH HOH A . 
Q 7 HOH 12  367  367  HOH HOH A . 
Q 7 HOH 13  369  369  HOH HOH A . 
Q 7 HOH 14  373  373  HOH HOH A . 
Q 7 HOH 15  374  374  HOH HOH A . 
Q 7 HOH 16  378  378  HOH HOH A . 
Q 7 HOH 17  381  381  HOH HOH A . 
Q 7 HOH 18  382  382  HOH HOH A . 
Q 7 HOH 19  383  383  HOH HOH A . 
Q 7 HOH 20  386  386  HOH HOH A . 
Q 7 HOH 21  388  388  HOH HOH A . 
Q 7 HOH 22  389  389  HOH HOH A . 
Q 7 HOH 23  395  395  HOH HOH A . 
Q 7 HOH 24  396  396  HOH HOH A . 
Q 7 HOH 25  407  407  HOH HOH A . 
Q 7 HOH 26  408  408  HOH HOH A . 
Q 7 HOH 27  411  411  HOH HOH A . 
Q 7 HOH 28  420  420  HOH HOH A . 
Q 7 HOH 29  421  421  HOH HOH A . 
Q 7 HOH 30  423  423  HOH HOH A . 
Q 7 HOH 31  424  424  HOH HOH A . 
Q 7 HOH 32  426  426  HOH HOH A . 
Q 7 HOH 33  432  432  HOH HOH A . 
Q 7 HOH 34  433  433  HOH HOH A . 
Q 7 HOH 35  435  435  HOH HOH A . 
Q 7 HOH 36  436  436  HOH HOH A . 
Q 7 HOH 37  437  437  HOH HOH A . 
Q 7 HOH 38  440  440  HOH HOH A . 
Q 7 HOH 39  445  445  HOH HOH A . 
Q 7 HOH 40  446  446  HOH HOH A . 
Q 7 HOH 41  447  447  HOH HOH A . 
Q 7 HOH 42  449  449  HOH HOH A . 
Q 7 HOH 43  456  456  HOH HOH A . 
Q 7 HOH 44  458  458  HOH HOH A . 
Q 7 HOH 45  460  460  HOH HOH A . 
Q 7 HOH 46  510  510  HOH HOH A . 
Q 7 HOH 47  511  2    HOH HOH A . 
Q 7 HOH 48  512  5    HOH HOH A . 
Q 7 HOH 49  513  513  HOH HOH A . 
Q 7 HOH 50  514  6    HOH HOH A . 
Q 7 HOH 51  515  8    HOH HOH A . 
Q 7 HOH 52  516  9    HOH HOH A . 
Q 7 HOH 53  517  10   HOH HOH A . 
Q 7 HOH 54  518  11   HOH HOH A . 
Q 7 HOH 55  519  12   HOH HOH A . 
Q 7 HOH 56  520  15   HOH HOH A . 
Q 7 HOH 57  521  22   HOH HOH A . 
Q 7 HOH 58  522  26   HOH HOH A . 
Q 7 HOH 59  523  31   HOH HOH A . 
Q 7 HOH 60  524  36   HOH HOH A . 
Q 7 HOH 61  525  37   HOH HOH A . 
Q 7 HOH 62  526  38   HOH HOH A . 
Q 7 HOH 63  527  41   HOH HOH A . 
Q 7 HOH 64  528  42   HOH HOH A . 
Q 7 HOH 65  529  44   HOH HOH A . 
Q 7 HOH 66  530  47   HOH HOH A . 
Q 7 HOH 67  531  49   HOH HOH A . 
Q 7 HOH 68  532  56   HOH HOH A . 
Q 7 HOH 69  533  58   HOH HOH A . 
Q 7 HOH 70  534  60   HOH HOH A . 
Q 7 HOH 71  535  67   HOH HOH A . 
Q 7 HOH 72  536  71   HOH HOH A . 
Q 7 HOH 73  537  73   HOH HOH A . 
Q 7 HOH 74  538  79   HOH HOH A . 
Q 7 HOH 75  539  80   HOH HOH A . 
Q 7 HOH 76  540  81   HOH HOH A . 
Q 7 HOH 77  541  83   HOH HOH A . 
Q 7 HOH 78  542  86   HOH HOH A . 
Q 7 HOH 79  543  87   HOH HOH A . 
Q 7 HOH 80  544  90   HOH HOH A . 
Q 7 HOH 81  545  92   HOH HOH A . 
Q 7 HOH 82  546  95   HOH HOH A . 
Q 7 HOH 83  547  97   HOH HOH A . 
Q 7 HOH 84  548  98   HOH HOH A . 
Q 7 HOH 85  549  99   HOH HOH A . 
Q 7 HOH 86  550  100  HOH HOH A . 
Q 7 HOH 87  551  103  HOH HOH A . 
Q 7 HOH 88  552  110  HOH HOH A . 
Q 7 HOH 89  553  112  HOH HOH A . 
Q 7 HOH 90  554  113  HOH HOH A . 
Q 7 HOH 91  555  115  HOH HOH A . 
Q 7 HOH 92  556  116  HOH HOH A . 
Q 7 HOH 93  557  119  HOH HOH A . 
Q 7 HOH 94  558  122  HOH HOH A . 
Q 7 HOH 95  559  126  HOH HOH A . 
Q 7 HOH 96  560  128  HOH HOH A . 
Q 7 HOH 97  561  130  HOH HOH A . 
Q 7 HOH 98  562  132  HOH HOH A . 
Q 7 HOH 99  563  134  HOH HOH A . 
Q 7 HOH 100 564  136  HOH HOH A . 
Q 7 HOH 101 565  142  HOH HOH A . 
Q 7 HOH 102 566  143  HOH HOH A . 
Q 7 HOH 103 567  146  HOH HOH A . 
Q 7 HOH 104 568  150  HOH HOH A . 
Q 7 HOH 105 569  152  HOH HOH A . 
Q 7 HOH 106 570  154  HOH HOH A . 
Q 7 HOH 107 571  155  HOH HOH A . 
Q 7 HOH 108 572  160  HOH HOH A . 
Q 7 HOH 109 573  164  HOH HOH A . 
Q 7 HOH 110 574  173  HOH HOH A . 
Q 7 HOH 111 575  174  HOH HOH A . 
Q 7 HOH 112 576  176  HOH HOH A . 
Q 7 HOH 113 577  177  HOH HOH A . 
Q 7 HOH 114 578  180  HOH HOH A . 
Q 7 HOH 115 579  181  HOH HOH A . 
Q 7 HOH 116 580  182  HOH HOH A . 
Q 7 HOH 117 581  186  HOH HOH A . 
Q 7 HOH 118 582  187  HOH HOH A . 
Q 7 HOH 119 583  190  HOH HOH A . 
Q 7 HOH 120 584  207  HOH HOH A . 
Q 7 HOH 121 585  214  HOH HOH A . 
Q 7 HOH 122 586  216  HOH HOH A . 
Q 7 HOH 123 587  217  HOH HOH A . 
Q 7 HOH 124 588  218  HOH HOH A . 
Q 7 HOH 125 589  220  HOH HOH A . 
Q 7 HOH 126 590  221  HOH HOH A . 
Q 7 HOH 127 591  225  HOH HOH A . 
Q 7 HOH 128 592  226  HOH HOH A . 
Q 7 HOH 129 593  227  HOH HOH A . 
Q 7 HOH 130 594  228  HOH HOH A . 
Q 7 HOH 131 595  230  HOH HOH A . 
Q 7 HOH 132 596  233  HOH HOH A . 
Q 7 HOH 133 597  238  HOH HOH A . 
Q 7 HOH 134 598  239  HOH HOH A . 
Q 7 HOH 135 599  243  HOH HOH A . 
Q 7 HOH 136 600  247  HOH HOH A . 
Q 7 HOH 137 601  248  HOH HOH A . 
Q 7 HOH 138 602  249  HOH HOH A . 
Q 7 HOH 139 603  250  HOH HOH A . 
Q 7 HOH 140 604  258  HOH HOH A . 
Q 7 HOH 141 605  260  HOH HOH A . 
Q 7 HOH 142 606  263  HOH HOH A . 
Q 7 HOH 143 607  264  HOH HOH A . 
Q 7 HOH 144 608  265  HOH HOH A . 
Q 7 HOH 145 609  267  HOH HOH A . 
Q 7 HOH 146 610  268  HOH HOH A . 
Q 7 HOH 147 611  272  HOH HOH A . 
Q 7 HOH 148 612  275  HOH HOH A . 
Q 7 HOH 149 613  277  HOH HOH A . 
Q 7 HOH 150 614  280  HOH HOH A . 
Q 7 HOH 151 615  290  HOH HOH A . 
Q 7 HOH 152 616  294  HOH HOH A . 
Q 7 HOH 153 617  295  HOH HOH A . 
Q 7 HOH 154 618  296  HOH HOH A . 
Q 7 HOH 155 619  298  HOH HOH A . 
Q 7 HOH 156 620  301  HOH HOH A . 
Q 7 HOH 157 621  302  HOH HOH A . 
Q 7 HOH 158 622  307  HOH HOH A . 
Q 7 HOH 159 623  309  HOH HOH A . 
Q 7 HOH 160 624  311  HOH HOH A . 
Q 7 HOH 161 625  315  HOH HOH A . 
Q 7 HOH 162 626  316  HOH HOH A . 
Q 7 HOH 163 627  317  HOH HOH A . 
Q 7 HOH 164 628  325  HOH HOH A . 
Q 7 HOH 165 629  327  HOH HOH A . 
Q 7 HOH 166 630  330  HOH HOH A . 
Q 7 HOH 167 631  334  HOH HOH A . 
Q 7 HOH 168 632  335  HOH HOH A . 
Q 7 HOH 169 633  337  HOH HOH A . 
Q 7 HOH 170 634  415  HOH HOH A . 
Q 7 HOH 171 635  416  HOH HOH A . 
R 7 HOH 1   82   82   HOH HOH D . 
R 7 HOH 2   88   88   HOH HOH D . 
R 7 HOH 3   120  120  HOH HOH D . 
R 7 HOH 4   158  158  HOH HOH D . 
R 7 HOH 5   193  193  HOH HOH D . 
R 7 HOH 6   194  194  HOH HOH D . 
R 7 HOH 7   198  198  HOH HOH D . 
R 7 HOH 8   213  213  HOH HOH D . 
R 7 HOH 9   235  235  HOH HOH D . 
R 7 HOH 10  237  237  HOH HOH D . 
R 7 HOH 11  306  306  HOH HOH D . 
R 7 HOH 12  392  392  HOH HOH D . 
R 7 HOH 13  514  514  HOH HOH D . 
S 7 HOH 1   17   17   HOH HOH E . 
S 7 HOH 2   33   33   HOH HOH E . 
S 7 HOH 3   45   45   HOH HOH E . 
S 7 HOH 4   46   46   HOH HOH E . 
S 7 HOH 5   69   69   HOH HOH E . 
S 7 HOH 6   108  108  HOH HOH E . 
S 7 HOH 7   121  121  HOH HOH E . 
S 7 HOH 8   127  127  HOH HOH E . 
S 7 HOH 9   156  156  HOH HOH E . 
S 7 HOH 10  159  159  HOH HOH E . 
S 7 HOH 11  163  163  HOH HOH E . 
S 7 HOH 12  179  179  HOH HOH E . 
S 7 HOH 13  223  223  HOH HOH E . 
S 7 HOH 14  231  231  HOH HOH E . 
S 7 HOH 15  242  242  HOH HOH E . 
S 7 HOH 16  253  253  HOH HOH E . 
S 7 HOH 17  308  308  HOH HOH E . 
S 7 HOH 18  312  312  HOH HOH E . 
S 7 HOH 19  313  313  HOH HOH E . 
S 7 HOH 20  380  380  HOH HOH E . 
S 7 HOH 21  406  406  HOH HOH E . 
S 7 HOH 22  412  412  HOH HOH E . 
S 7 HOH 23  444  444  HOH HOH E . 
S 7 HOH 24  463  463  HOH HOH E . 
T 7 HOH 1   3    3    HOH HOH B . 
T 7 HOH 2   13   13   HOH HOH B . 
T 7 HOH 3   14   14   HOH HOH B . 
T 7 HOH 4   16   16   HOH HOH B . 
T 7 HOH 5   18   18   HOH HOH B . 
T 7 HOH 6   19   19   HOH HOH B . 
T 7 HOH 7   21   21   HOH HOH B . 
T 7 HOH 8   25   25   HOH HOH B . 
T 7 HOH 9   27   27   HOH HOH B . 
T 7 HOH 10  28   28   HOH HOH B . 
T 7 HOH 11  29   29   HOH HOH B . 
T 7 HOH 12  32   32   HOH HOH B . 
T 7 HOH 13  35   35   HOH HOH B . 
T 7 HOH 14  39   39   HOH HOH B . 
T 7 HOH 15  43   43   HOH HOH B . 
T 7 HOH 16  48   48   HOH HOH B . 
T 7 HOH 17  51   51   HOH HOH B . 
T 7 HOH 18  52   52   HOH HOH B . 
T 7 HOH 19  54   54   HOH HOH B . 
T 7 HOH 20  55   55   HOH HOH B . 
T 7 HOH 21  57   57   HOH HOH B . 
T 7 HOH 22  59   59   HOH HOH B . 
T 7 HOH 23  61   61   HOH HOH B . 
T 7 HOH 24  63   63   HOH HOH B . 
T 7 HOH 25  64   64   HOH HOH B . 
T 7 HOH 26  65   65   HOH HOH B . 
T 7 HOH 27  68   68   HOH HOH B . 
T 7 HOH 28  70   70   HOH HOH B . 
T 7 HOH 29  75   75   HOH HOH B . 
T 7 HOH 30  76   76   HOH HOH B . 
T 7 HOH 31  77   77   HOH HOH B . 
T 7 HOH 32  78   78   HOH HOH B . 
T 7 HOH 33  85   85   HOH HOH B . 
T 7 HOH 34  89   89   HOH HOH B . 
T 7 HOH 35  91   91   HOH HOH B . 
T 7 HOH 36  94   94   HOH HOH B . 
T 7 HOH 37  96   96   HOH HOH B . 
T 7 HOH 38  102  102  HOH HOH B . 
T 7 HOH 39  104  104  HOH HOH B . 
T 7 HOH 40  106  106  HOH HOH B . 
T 7 HOH 41  109  109  HOH HOH B . 
T 7 HOH 42  111  111  HOH HOH B . 
T 7 HOH 43  118  118  HOH HOH B . 
T 7 HOH 44  123  123  HOH HOH B . 
T 7 HOH 45  125  125  HOH HOH B . 
T 7 HOH 46  129  129  HOH HOH B . 
T 7 HOH 47  135  135  HOH HOH B . 
T 7 HOH 48  137  137  HOH HOH B . 
T 7 HOH 49  138  138  HOH HOH B . 
T 7 HOH 50  139  139  HOH HOH B . 
T 7 HOH 51  140  140  HOH HOH B . 
T 7 HOH 52  147  147  HOH HOH B . 
T 7 HOH 53  151  151  HOH HOH B . 
T 7 HOH 54  153  153  HOH HOH B . 
T 7 HOH 55  162  162  HOH HOH B . 
T 7 HOH 56  167  167  HOH HOH B . 
T 7 HOH 57  169  169  HOH HOH B . 
T 7 HOH 58  172  172  HOH HOH B . 
T 7 HOH 59  175  175  HOH HOH B . 
T 7 HOH 60  183  183  HOH HOH B . 
T 7 HOH 61  184  184  HOH HOH B . 
T 7 HOH 62  191  191  HOH HOH B . 
T 7 HOH 63  192  192  HOH HOH B . 
T 7 HOH 64  195  195  HOH HOH B . 
T 7 HOH 65  199  199  HOH HOH B . 
T 7 HOH 66  200  200  HOH HOH B . 
T 7 HOH 67  201  201  HOH HOH B . 
T 7 HOH 68  203  203  HOH HOH B . 
T 7 HOH 69  204  204  HOH HOH B . 
T 7 HOH 70  205  205  HOH HOH B . 
T 7 HOH 71  208  208  HOH HOH B . 
T 7 HOH 72  209  209  HOH HOH B . 
T 7 HOH 73  210  210  HOH HOH B . 
T 7 HOH 74  219  219  HOH HOH B . 
T 7 HOH 75  222  222  HOH HOH B . 
T 7 HOH 76  224  224  HOH HOH B . 
T 7 HOH 77  229  229  HOH HOH B . 
T 7 HOH 78  232  232  HOH HOH B . 
T 7 HOH 79  234  234  HOH HOH B . 
T 7 HOH 80  236  236  HOH HOH B . 
T 7 HOH 81  241  241  HOH HOH B . 
T 7 HOH 82  244  244  HOH HOH B . 
T 7 HOH 83  245  245  HOH HOH B . 
T 7 HOH 84  246  246  HOH HOH B . 
T 7 HOH 85  252  252  HOH HOH B . 
T 7 HOH 86  259  259  HOH HOH B . 
T 7 HOH 87  266  266  HOH HOH B . 
T 7 HOH 88  270  270  HOH HOH B . 
T 7 HOH 89  271  271  HOH HOH B . 
T 7 HOH 90  273  273  HOH HOH B . 
T 7 HOH 91  274  274  HOH HOH B . 
T 7 HOH 92  276  276  HOH HOH B . 
T 7 HOH 93  279  279  HOH HOH B . 
T 7 HOH 94  281  281  HOH HOH B . 
T 7 HOH 95  282  282  HOH HOH B . 
T 7 HOH 96  285  285  HOH HOH B . 
T 7 HOH 97  286  286  HOH HOH B . 
T 7 HOH 98  289  289  HOH HOH B . 
T 7 HOH 99  291  291  HOH HOH B . 
T 7 HOH 100 297  297  HOH HOH B . 
T 7 HOH 101 300  300  HOH HOH B . 
T 7 HOH 102 304  304  HOH HOH B . 
T 7 HOH 103 310  310  HOH HOH B . 
T 7 HOH 104 318  318  HOH HOH B . 
T 7 HOH 105 322  322  HOH HOH B . 
T 7 HOH 106 324  324  HOH HOH B . 
T 7 HOH 107 326  326  HOH HOH B . 
T 7 HOH 108 328  328  HOH HOH B . 
T 7 HOH 109 332  332  HOH HOH B . 
T 7 HOH 110 336  336  HOH HOH B . 
T 7 HOH 111 340  340  HOH HOH B . 
T 7 HOH 112 342  342  HOH HOH B . 
T 7 HOH 113 344  344  HOH HOH B . 
T 7 HOH 114 345  345  HOH HOH B . 
T 7 HOH 115 348  348  HOH HOH B . 
T 7 HOH 116 359  359  HOH HOH B . 
T 7 HOH 117 360  360  HOH HOH B . 
T 7 HOH 118 361  361  HOH HOH B . 
T 7 HOH 119 362  362  HOH HOH B . 
T 7 HOH 120 368  368  HOH HOH B . 
T 7 HOH 121 370  370  HOH HOH B . 
T 7 HOH 122 379  379  HOH HOH B . 
T 7 HOH 123 384  384  HOH HOH B . 
T 7 HOH 124 385  385  HOH HOH B . 
T 7 HOH 125 391  391  HOH HOH B . 
T 7 HOH 126 394  394  HOH HOH B . 
T 7 HOH 127 398  398  HOH HOH B . 
T 7 HOH 128 400  400  HOH HOH B . 
T 7 HOH 129 401  401  HOH HOH B . 
T 7 HOH 130 402  402  HOH HOH B . 
T 7 HOH 131 403  403  HOH HOH B . 
T 7 HOH 132 405  405  HOH HOH B . 
T 7 HOH 133 413  413  HOH HOH B . 
T 7 HOH 134 414  414  HOH HOH B . 
T 7 HOH 135 418  418  HOH HOH B . 
T 7 HOH 136 425  425  HOH HOH B . 
T 7 HOH 137 430  430  HOH HOH B . 
T 7 HOH 138 431  431  HOH HOH B . 
T 7 HOH 139 453  453  HOH HOH B . 
T 7 HOH 140 455  455  HOH HOH B . 
T 7 HOH 141 457  457  HOH HOH B . 
T 7 HOH 142 459  459  HOH HOH B . 
T 7 HOH 143 462  462  HOH HOH B . 
T 7 HOH 144 1511 1511 HOH HOH B . 
T 7 HOH 145 1512 1512 HOH HOH B . 
T 7 HOH 146 1513 1513 HOH HOH B . 
T 7 HOH 147 1519 1519 HOH HOH B . 
U 7 HOH 1   7    7    HOH HOH H . 
U 7 HOH 2   23   23   HOH HOH H . 
U 7 HOH 3   34   34   HOH HOH H . 
U 7 HOH 4   53   53   HOH HOH H . 
U 7 HOH 5   62   62   HOH HOH H . 
U 7 HOH 6   66   66   HOH HOH H . 
U 7 HOH 7   107  107  HOH HOH H . 
U 7 HOH 8   114  114  HOH HOH H . 
U 7 HOH 9   133  133  HOH HOH H . 
U 7 HOH 10  141  141  HOH HOH H . 
U 7 HOH 11  144  144  HOH HOH H . 
U 7 HOH 12  145  145  HOH HOH H . 
U 7 HOH 13  148  148  HOH HOH H . 
U 7 HOH 14  149  149  HOH HOH H . 
U 7 HOH 15  166  166  HOH HOH H . 
U 7 HOH 16  168  168  HOH HOH H . 
U 7 HOH 17  178  178  HOH HOH H . 
U 7 HOH 18  189  189  HOH HOH H . 
U 7 HOH 19  206  206  HOH HOH H . 
U 7 HOH 20  269  269  HOH HOH H . 
U 7 HOH 21  305  305  HOH HOH H . 
U 7 HOH 22  331  331  HOH HOH H . 
U 7 HOH 23  419  419  HOH HOH H . 
V 7 HOH 1   20   20   HOH HOH J . 
V 7 HOH 2   24   24   HOH HOH J . 
V 7 HOH 3   30   30   HOH HOH J . 
V 7 HOH 4   40   40   HOH HOH J . 
V 7 HOH 5   50   50   HOH HOH J . 
V 7 HOH 6   117  117  HOH HOH J . 
V 7 HOH 7   131  131  HOH HOH J . 
V 7 HOH 8   161  161  HOH HOH J . 
V 7 HOH 9   188  188  HOH HOH J . 
V 7 HOH 10  197  197  HOH HOH J . 
V 7 HOH 11  251  251  HOH HOH J . 
V 7 HOH 12  256  256  HOH HOH J . 
V 7 HOH 13  278  278  HOH HOH J . 
V 7 HOH 14  319  319  HOH HOH J . 
V 7 HOH 15  329  329  HOH HOH J . 
V 7 HOH 16  338  338  HOH HOH J . 
V 7 HOH 17  346  346  HOH HOH J . 
V 7 HOH 18  364  364  HOH HOH J . 
V 7 HOH 19  387  387  HOH HOH J . 
V 7 HOH 20  397  397  HOH HOH J . 
V 7 HOH 21  399  399  HOH HOH J . 
V 7 HOH 22  409  409  HOH HOH J . 
V 7 HOH 23  443  443  HOH HOH J . 
V 7 HOH 24  454  454  HOH HOH J . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B DDG 13 D DDG 815  ? DG ? 
2 E DDG 13 H DDG 1815 ? DG ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I,J,K,Q,R,S 
2 1 D,E,F,L,M,N,O,P,T,U,V 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3930  ? 
1 MORE         -27.2 ? 
1 'SSA (A^2)'  21080 ? 
2 'ABSA (A^2)' 3920  ? 
2 MORE         -27.8 ? 
2 'SSA (A^2)'  21520 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O   ? A PHE 8   ? A PHE 8    ? 1_555 90.9  ? 
2  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 101.7 ? 
3  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 80.0  ? 
4  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1A ? G TTP .   ? A TTP 414  ? 1_555 103.8 ? 
5  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1A ? G TTP .   ? A TTP 414  ? 1_555 160.4 ? 
6  OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1A ? G TTP .   ? A TTP 414  ? 1_555 84.4  ? 
7  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G TTP .   ? A TTP 414  ? 1_555 171.0 ? 
8  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G TTP .   ? A TTP 414  ? 1_555 84.0  ? 
9  OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G TTP .   ? A TTP 414  ? 1_555 84.7  ? 
10 O1A ? G TTP .   ? A TTP 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G TTP .   ? A TTP 414  ? 1_555 82.9  ? 
11 OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O3G ? G TTP .   ? A TTP 414  ? 1_555 92.7  ? 
12 O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O3G ? G TTP .   ? A TTP 414  ? 1_555 106.7 ? 
13 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O3G ? G TTP .   ? A TTP 414  ? 1_555 164.1 ? 
14 O1A ? G TTP .   ? A TTP 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O3G ? G TTP .   ? A TTP 414  ? 1_555 85.7  ? 
15 O1B ? G TTP .   ? A TTP 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O3G ? G TTP .   ? A TTP 414  ? 1_555 81.8  ? 
16 OD1 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O1A ? G TTP .   ? A TTP 414  ? 1_555 91.0  ? 
17 O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? A ILE 186 ? A ILE 186  ? 1_555 90.1  ? 
18 OD2 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1415 ? 1_555 OE2 ? D GLU 106 ? B GLU 1106 ? 1_555 119.3 ? 
19 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O   ? D PHE 8   ? B PHE 1008 ? 1_555 84.9  ? 
20 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 105.0 ? 
21 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 81.8  ? 
22 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1A ? L TTP .   ? B TTP 1414 ? 1_555 111.6 ? 
23 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1A ? L TTP .   ? B TTP 1414 ? 1_555 162.6 ? 
24 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1A ? L TTP .   ? B TTP 1414 ? 1_555 88.3  ? 
25 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1B ? L TTP .   ? B TTP 1414 ? 1_555 161.4 ? 
26 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1B ? L TTP .   ? B TTP 1414 ? 1_555 84.3  ? 
27 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1B ? L TTP .   ? B TTP 1414 ? 1_555 88.4  ? 
28 O1A ? L TTP .   ? B TTP 1414 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O1B ? L TTP .   ? B TTP 1414 ? 1_555 81.1  ? 
29 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O3G ? L TTP .   ? B TTP 1414 ? 1_555 85.9  ? 
30 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O3G ? L TTP .   ? B TTP 1414 ? 1_555 102.6 ? 
31 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O3G ? L TTP .   ? B TTP 1414 ? 1_555 168.7 ? 
32 O1A ? L TTP .   ? B TTP 1414 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O3G ? L TTP .   ? B TTP 1414 ? 1_555 84.8  ? 
33 O1B ? L TTP .   ? B TTP 1414 ? 1_555 CA ? N CA . ? B CA 1416 ? 1_555 O3G ? L TTP .   ? B TTP 1414 ? 1_555 81.7  ? 
34 O   ? D ALA 181 ? B ALA 1181 ? 1_555 CA ? O CA . ? B CA 1417 ? 1_555 O   ? D ILE 186 ? B ILE 1186 ? 1_555 91.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Database references'       
5 3 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2             
2 3 'Structure model' pdbx_struct_conn_angle 
3 3 'Structure model' struct_conn            
4 3 'Structure model' struct_ref_seq         
5 3 'Structure model' struct_ref_seq_dif     
6 3 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_database_2.pdbx_DOI'                        
2  3 'Structure model' '_database_2.pdbx_database_accession'         
3  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 3 'Structure model' '_pdbx_struct_conn_angle.value'               
18 3 'Structure model' '_struct_conn.conn_type_id'                   
19 3 'Structure model' '_struct_conn.id'                             
20 3 'Structure model' '_struct_conn.pdbx_dist_value'                
21 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
22 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
23 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
24 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
27 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
28 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
29 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
30 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
31 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
34 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
35 3 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
36 3 'Structure model' '_struct_ref_seq.db_align_beg'                
37 3 'Structure model' '_struct_ref_seq.db_align_end'                
38 3 'Structure model' '_struct_ref_seq_dif.details'                 
39 3 'Structure model' '_struct_site.pdbx_auth_asym_id'              
40 3 'Structure model' '_struct_site.pdbx_auth_comp_id'              
41 3 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 4.4088   -11.4801 -8.3164  0.2496 0.1377 0.2228 -0.0095 0.0243  -0.0692 1.3519 3.1387 1.2809 
-1.4595 -0.6466 0.2135  0.1651  -0.3869 0.2219  0.3635  -0.2675 -0.1812 -0.4558 0.1940  -0.1527 
'X-RAY DIFFRACTION' 2 ? refined -21.8296 32.5105  -47.1225 0.1926 0.2713 0.2051 0.0740  0.0476  -0.0411 1.1820 2.7618 3.6132 
-0.7539 -0.5842 0.5074  -0.1162 0.1559  -0.0398 -0.2314 0.3164  0.2172  0.6428  -0.2345 -0.4583 
'X-RAY DIFFRACTION' 3 ? refined -1.0217  2.3216   1.6495   0.0667 0.0698 0.0557 -0.0529 -0.0024 -0.0188 0.4390 1.6814 0.4127 
-0.0398 -0.1963 0.0063  0.0718  -0.0578 -0.0140 0.0355  -0.0690 0.0092  0.0363  -0.0152 -0.0352 
'X-RAY DIFFRACTION' 4 ? refined -12.0735 21.5894  -56.3325 0.0160 0.0964 0.0715 0.0011  -0.0141 0.0124  1.1812 1.4045 2.0056 
-0.1835 -0.5354 -0.5806 -0.0023 0.0055  -0.0032 -0.0550 0.0867  -0.1005 0.1037  0.0546  0.0534  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 E 902  E 918  ? . . . . ? 
'X-RAY DIFFRACTION' 2 1 D 803  D 814  ? . . . . ? 
'X-RAY DIFFRACTION' 3 1 A 414  A 414  ? . . . . ? 
'X-RAY DIFFRACTION' 4 2 J 1901 J 1918 ? . . . . ? 
'X-RAY DIFFRACTION' 5 2 H 1803 H 1814 ? . . . . ? 
'X-RAY DIFFRACTION' 6 2 B 1414 B 1414 ? . . . . ? 
'X-RAY DIFFRACTION' 7 3 A 1    A 341  ? . . . . ? 
'X-RAY DIFFRACTION' 8 4 B 1001 B 1341 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
AMoRE    phasing           .        ? 2 
REFMAC   refinement        5.5.0102 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id                 3KHR 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;For chains E and J, the 19-mer sequence of the DNA oligo
is 5'-C T A A C [AF]G C T A C C A T C C A A C C-3', where
[AF]G denotes a covalent modification by AF on the G base
906 in chain E and the G base 1906 in chain J.
;
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            J 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DA 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1903 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            J 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DA 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1903 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.372 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.047 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" D DT 803  ? ? "C1'" D DT 803  ? ? N1    D DT 803  ? ? 110.72 108.30 2.42   0.30 N 
2  1 "O4'" D DT 808  ? ? "C1'" D DT 808  ? ? N1    D DT 808  ? ? 102.64 108.00 -5.36  0.70 N 
3  1 "O4'" D DG 809  ? ? "C1'" D DG 809  ? ? N9    D DG 809  ? ? 111.78 108.30 3.48   0.30 N 
4  1 C4    D DT 811  ? ? C5    D DT 811  ? ? C7    D DT 811  ? ? 122.93 119.00 3.93   0.60 N 
5  1 "O4'" D DG 813  ? ? "C1'" D DG 813  ? ? N9    D DG 813  ? ? 110.14 108.30 1.84   0.30 N 
6  1 "O4'" D DC 814  ? ? "C1'" D DC 814  ? ? N1    D DC 814  ? ? 112.56 108.30 4.26   0.30 N 
7  1 "O3'" E DT 902  ? ? P     E DA 903  ? ? "O5'" E DA 903  ? ? 81.91  104.00 -22.09 1.90 Y 
8  1 "O3'" E DT 902  ? ? P     E DA 903  ? ? OP2   E DA 903  ? ? 90.18  105.20 -15.02 2.20 Y 
9  1 "O3'" E DT 902  ? ? P     E DA 903  ? ? OP1   E DA 903  ? ? 90.06  105.20 -15.14 2.20 Y 
10 1 "O5'" E DA 903  ? ? P     E DA 903  ? ? OP1   E DA 903  ? ? 119.85 110.70 9.15   1.20 N 
11 1 "O5'" E DA 903  ? ? P     E DA 903  ? ? OP2   E DA 903  ? ? 118.09 110.70 7.39   1.20 N 
12 1 "C3'" E DC 905  ? ? "C2'" E DC 905  ? ? "C1'" E DC 905  ? ? 97.15  102.40 -5.25  0.80 N 
13 1 "O4'" E DC 905  ? ? "C1'" E DC 905  ? ? N1    E DC 905  ? ? 115.16 108.30 6.86   0.30 N 
14 1 "O4'" E DC 907  ? ? "C4'" E DC 907  ? ? "C3'" E DC 907  ? ? 102.06 104.50 -2.44  0.40 N 
15 1 "O4'" E DC 907  ? ? "C1'" E DC 907  ? ? N1    E DC 907  ? ? 110.50 108.30 2.20   0.30 N 
16 1 "O4'" E DC 911  ? ? "C1'" E DC 911  ? ? N1    E DC 911  ? ? 111.98 108.30 3.68   0.30 N 
17 1 "O4'" E DT 913  ? ? "C1'" E DT 913  ? ? N1    E DT 913  ? ? 110.59 108.30 2.29   0.30 N 
18 1 "O4'" E DC 914  ? ? "C1'" E DC 914  ? ? N1    E DC 914  ? ? 113.14 108.30 4.84   0.30 N 
19 1 "O4'" E DA 917  ? ? "C1'" E DA 917  ? ? N9    E DA 917  ? ? 110.61 108.30 2.31   0.30 N 
20 1 "O4'" H DT 1804 ? ? "C1'" H DT 1804 ? ? N1    H DT 1804 ? ? 110.74 108.30 2.44   0.30 N 
21 1 "C3'" H DG 1805 ? ? "O3'" H DG 1805 ? ? P     H DG 1806 ? ? 127.29 119.70 7.59   1.20 Y 
22 1 "O4'" H DA 1812 ? ? "C1'" H DA 1812 ? ? N9    H DA 1812 ? ? 103.45 108.00 -4.55  0.70 N 
23 1 "O4'" H DC 1814 ? ? "C1'" H DC 1814 ? ? N1    H DC 1814 ? ? 113.37 108.30 5.07   0.30 N 
24 1 "O4'" J DC 1901 ? ? "C1'" J DC 1901 ? ? N1    J DC 1901 ? ? 114.44 108.30 6.14   0.30 N 
25 1 "O4'" J DT 1902 ? ? "C1'" J DT 1902 ? ? N1    J DT 1902 ? ? 110.17 108.30 1.87   0.30 N 
26 1 "C1'" J DC 1905 ? ? "O4'" J DC 1905 ? ? "C4'" J DC 1905 ? ? 103.38 110.10 -6.72  1.00 N 
27 1 "C1'" J DC 1907 ? ? "O4'" J DC 1907 ? ? "C4'" J DC 1907 ? ? 103.96 110.10 -6.14  1.00 N 
28 1 "O4'" J DC 1907 ? ? "C1'" J DC 1907 ? ? N1    J DC 1907 ? ? 110.54 108.30 2.24   0.30 N 
29 1 "O4'" J DC 1914 ? ? "C1'" J DC 1914 ? ? N1    J DC 1914 ? ? 110.57 108.30 2.27   0.30 N 
30 1 "O4'" J DC 1915 ? ? "C1'" J DC 1915 ? ? N1    J DC 1915 ? ? 111.81 108.30 3.51   0.30 N 
31 1 "O4'" J DC 1918 ? ? "C1'" J DC 1918 ? ? N1    J DC 1918 ? ? 111.03 108.30 2.73   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 10   ? ? 29.83   54.92  
2 1 ARG A 77   ? ? -107.35 73.46  
3 1 ASN A 234  ? ? -153.00 44.14  
4 1 ASP A 277  ? ? 36.72   86.64  
5 1 LYS A 278  ? ? 80.60   -24.84 
6 1 TYR B 1010 ? ? 30.83   53.73  
7 1 ASN B 1234 ? ? -145.60 35.07  
8 1 LYS B 1278 ? ? 82.57   -24.23 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 E DT 902 ? P   ? C DT 2 P   
2 1 Y 1 E DT 902 ? OP1 ? C DT 2 OP1 
3 1 Y 1 E DT 902 ? OP2 ? C DT 2 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 E DC 901  ? C DC 1  
2 1 Y 1 E DC 919  ? C DC 19 
3 1 Y 1 J DC 1919 ? F DC 19 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3KHR 'double helix'        
3KHR 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT  2  1_555 C DA 16 1_555 1.035  -0.313 -0.437 5.618   -0.897  0.613  1  D_DT804:DA916_E    D 804  ? E 916  ? 20 1 
1 B DG  3  1_555 C DC 15 1_555 0.493  -0.255 -0.161 8.531   -7.418  2.589  2  D_DG805:DC915_E    D 805  ? E 915  ? 19 1 
1 B DG  4  1_555 C DC 14 1_555 0.234  -0.120 -0.042 7.144   -6.606  -5.884 3  D_DG806:DC914_E    D 806  ? E 914  ? 19 1 
1 B DA  5  1_555 C DT 13 1_555 0.209  -0.145 0.065  1.832   -13.514 -2.792 4  D_DA807:DT913_E    D 807  ? E 913  ? 20 1 
1 B DT  6  1_555 C DA 12 1_555 0.119  -0.277 -0.172 2.360   -12.746 5.915  5  D_DT808:DA912_E    D 808  ? E 912  ? 20 1 
1 B DG  7  1_555 C DC 11 1_555 0.000  -0.183 0.026  7.850   -8.280  -0.878 6  D_DG809:DC911_E    D 809  ? E 911  ? 19 1 
1 B DG  8  1_555 C DC 10 1_555 -0.197 -0.143 -0.108 -10.327 -12.651 0.937  7  D_DG810:DC910_E    D 810  ? E 910  ? 19 1 
1 B DT  9  1_555 C DA 9  1_555 -0.168 -0.230 0.057  -7.523  -7.646  -1.865 8  D_DT811:DA909_E    D 811  ? E 909  ? 20 1 
1 B DA  10 1_555 C DT 8  1_555 0.068  -0.240 0.010  -2.552  -2.457  -3.725 9  D_DA812:DT908_E    D 812  ? E 908  ? 20 1 
1 B DG  11 1_555 C DC 7  1_555 -0.207 -0.144 -0.250 0.919   -11.568 2.286  10 D_DG813:DC907_E    D 813  ? E 907  ? 19 1 
1 B DC  12 1_555 C DG 6  1_555 0.453  -0.235 -0.398 8.175   -13.053 4.766  11 D_DC814:DG906_E    D 814  ? E 906  ? 19 1 
1 B DDG 13 1_555 C DC 5  1_555 -0.295 -0.186 -0.039 -12.401 -5.477  0.988  12 D_DDG815:DC905_E   D 815  ? E 905  ? 19 1 
1 E DG  3  1_555 F DC 15 1_555 -0.024 -0.128 -0.154 12.870  0.147   -0.965 13 H_DG1805:DC1915_J  H 1805 ? J 1915 ? 19 1 
1 E DG  4  1_555 F DC 14 1_555 -1.040 -0.442 0.293  11.110  -10.192 0.213  14 H_DG1806:DC1914_J  H 1806 ? J 1914 ? 19 1 
1 E DA  5  1_555 F DT 13 1_555 0.074  -0.262 -0.178 3.731   -20.383 -4.800 15 H_DA1807:DT1913_J  H 1807 ? J 1913 ? 20 1 
1 E DT  6  1_555 F DA 12 1_555 -0.106 -0.286 -0.151 -2.207  -14.659 2.014  16 H_DT1808:DA1912_J  H 1808 ? J 1912 ? 20 1 
1 E DG  7  1_555 F DC 11 1_555 -0.281 -0.224 -0.101 5.721   -5.213  -3.028 17 H_DG1809:DC1911_J  H 1809 ? J 1911 ? 19 1 
1 E DG  8  1_555 F DC 10 1_555 -0.213 -0.163 -0.053 -6.866  -12.937 0.762  18 H_DG1810:DC1910_J  H 1810 ? J 1910 ? 19 1 
1 E DT  9  1_555 F DA 9  1_555 -0.099 -0.199 0.093  -9.610  -8.586  -1.324 19 H_DT1811:DA1909_J  H 1811 ? J 1909 ? 20 1 
1 E DA  10 1_555 F DT 8  1_555 0.048  -0.217 -0.126 -4.572  -7.155  0.695  20 H_DA1812:DT1908_J  H 1812 ? J 1908 ? 20 1 
1 E DG  11 1_555 F DC 7  1_555 -0.258 -0.115 -0.247 -2.378  -7.092  0.018  21 H_DG1813:DC1907_J  H 1813 ? J 1907 ? 19 1 
1 E DC  12 1_555 F DG 6  1_555 0.318  -0.125 -0.604 11.635  -14.024 3.611  22 H_DC1814:DG1906_J  H 1814 ? J 1906 ? 19 1 
1 E DDG 13 1_555 F DC 5  1_555 -0.089 -0.138 -0.265 -9.941  -6.847  1.813  23 H_DDG1815:DC1905_J H 1815 ? J 1905 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 2  1_555 C DA 16 1_555 B DG  3  1_555 C DC 15 1_555 0.162  1.653  3.303 -1.552  3.560  33.635 2.246  -0.538 3.444 6.126  
2.670  33.852 1  DD_DT804DG805:DC915DA916_EE      D 804  ? E 916  ? D 805  ? E 915  ? 
1 B DG 3  1_555 C DC 15 1_555 B DG  4  1_555 C DC 14 1_555 -0.738 1.579  3.310 -3.038  4.416  41.358 1.733  0.702  3.497 6.221  
4.280  41.689 2  DD_DG805DG806:DC914DC915_EE      D 805  ? E 915  ? D 806  ? E 914  ? 
1 B DG 4  1_555 C DC 14 1_555 B DA  5  1_555 C DT 13 1_555 -0.302 -0.294 3.386 -1.563  4.195  33.147 -1.226 0.258  3.335 7.311  
2.724  33.440 3  DD_DG806DA807:DT913DC914_EE      D 806  ? E 914  ? D 807  ? E 913  ? 
1 B DA 5  1_555 C DT 13 1_555 B DT  6  1_555 C DA 12 1_555 0.157  -0.750 3.299 2.414   2.945  27.736 -2.248 0.246  3.206 6.107  
-5.006 27.991 4  DD_DA807DT808:DA912DT913_EE      D 807  ? E 913  ? D 808  ? E 912  ? 
1 B DT 6  1_555 C DA 12 1_555 B DG  7  1_555 C DC 11 1_555 0.255  0.572  3.240 -0.596  9.380  32.508 -0.556 -0.536 3.269 16.334 
1.038  33.804 5  DD_DT808DG809:DC911DA912_EE      D 808  ? E 912  ? D 809  ? E 911  ? 
1 B DG 7  1_555 C DC 11 1_555 B DG  8  1_555 C DC 10 1_555 0.246  -0.722 3.775 0.121   4.053  34.701 -1.903 -0.389 3.671 6.767  
-0.202 34.930 6  DD_DG809DG810:DC910DC911_EE      D 809  ? E 911  ? D 810  ? E 910  ? 
1 B DG 8  1_555 C DC 10 1_555 B DT  9  1_555 C DA 9  1_555 -0.666 -0.954 3.274 -0.443  1.302  32.821 -1.909 1.102  3.243 2.302  
0.783  32.849 7  DD_DG810DT811:DA909DC910_EE      D 810  ? E 910  ? D 811  ? E 909  ? 
1 B DT 9  1_555 C DA 9  1_555 B DA  10 1_555 C DT 8  1_555 -0.191 -0.543 3.212 -1.209  3.766  32.876 -1.571 0.137  3.137 6.625  
2.127  33.107 8  DD_DT811DA812:DT908DA909_EE      D 811  ? E 909  ? D 812  ? E 908  ? 
1 B DA 10 1_555 C DT 8  1_555 B DG  11 1_555 C DC 7  1_555 0.686  -0.698 3.428 0.764   5.195  30.012 -2.400 -1.149 3.280 9.936  
-1.461 30.458 9  DD_DA812DG813:DC907DT908_EE      D 812  ? E 908  ? D 813  ? E 907  ? 
1 B DG 11 1_555 C DC 7  1_555 B DC  12 1_555 C DG 6  1_555 0.310  -0.627 3.170 0.335   5.696  27.613 -2.553 -0.561 2.986 11.774 
-0.693 28.185 10 DD_DG813DC814:DG906DC907_EE      D 813  ? E 907  ? D 814  ? E 906  ? 
1 B DC 12 1_555 C DG 6  1_555 B DDG 13 1_555 C DC 5  1_555 -0.617 -0.129 3.788 -8.416  8.421  37.577 -1.367 -0.259 3.724 12.688 
12.681 39.353 11 DD_DC814DDG815:DC905DG906_EE     D 814  ? E 906  ? D 815  ? E 905  ? 
1 E DG 3  1_555 F DC 15 1_555 E DG  4  1_555 F DC 14 1_555 0.028  0.167  3.322 -5.398  7.148  29.966 -1.076 -1.099 3.221 13.450 
10.157 31.246 12 HH_DG1805DG1806:DC1914DC1915_JJ  H 1805 ? J 1915 ? H 1806 ? J 1914 ? 
1 E DG 4  1_555 F DC 14 1_555 E DA  5  1_555 F DT 13 1_555 -0.518 0.213  3.435 2.655   8.342  39.610 -0.674 1.060  3.370 12.131 
-3.861 40.528 13 HH_DG1806DA1807:DT1913DC1914_JJ  H 1806 ? J 1914 ? H 1807 ? J 1913 ? 
1 E DA 5  1_555 F DT 13 1_555 E DT  6  1_555 F DA 12 1_555 0.417  -0.063 3.320 2.212   1.183  34.218 -0.295 -0.354 3.336 2.007  
-3.753 34.307 14 HH_DA1807DT1808:DA1912DT1913_JJ  H 1807 ? J 1913 ? H 1808 ? J 1912 ? 
1 E DT 6  1_555 F DA 12 1_555 E DG  7  1_555 F DC 11 1_555 0.246  0.715  3.276 0.020   8.119  31.631 -0.179 -0.434 3.352 14.597 
-0.035 32.630 15 HH_DT1808DG1809:DC1911DA1912_JJ  H 1808 ? J 1912 ? H 1809 ? J 1911 ? 
1 E DG 7  1_555 F DC 11 1_555 E DG  8  1_555 F DC 10 1_555 0.118  -0.494 3.683 -2.293  4.852  36.299 -1.525 -0.537 3.576 7.737  
3.655  36.681 16 HH_DG1809DG1810:DC1910DC1911_JJ  H 1809 ? J 1911 ? H 1810 ? J 1910 ? 
1 E DG 8  1_555 F DC 10 1_555 E DT  9  1_555 F DA 9  1_555 -0.608 -1.026 3.388 -0.433  -0.400 33.686 -1.703 0.975  3.407 -0.690 
0.746  33.691 17 HH_DG1810DT1811:DA1909DC1910_JJ  H 1810 ? J 1910 ? H 1811 ? J 1909 ? 
1 E DT 9  1_555 F DA 9  1_555 E DA  10 1_555 F DT 8  1_555 0.057  -0.217 3.197 -0.312  4.755  32.399 -1.184 -0.153 3.133 8.466  
0.555  32.738 18 HH_DT1811DA1812:DT1908DA1909_JJ  H 1811 ? J 1909 ? H 1812 ? J 1908 ? 
1 E DA 10 1_555 F DT 8  1_555 E DG  11 1_555 F DC 7  1_555 0.784  -0.407 3.387 1.864   1.643  32.162 -1.036 -1.067 3.402 2.961  
-3.358 32.255 19 HH_DA1812DG1813:DC1907DT1908_JJ  H 1812 ? J 1908 ? H 1813 ? J 1907 ? 
1 E DG 11 1_555 F DC 7  1_555 E DC  12 1_555 F DG 6  1_555 0.454  -0.620 3.031 1.925   9.950  24.080 -3.807 -0.533 2.601 22.610 
-4.375 26.097 20 HH_DG1813DC1814:DG1906DC1907_JJ  H 1813 ? J 1907 ? H 1814 ? J 1906 ? 
1 E DC 12 1_555 F DG 6  1_555 E DDG 13 1_555 F DC 5  1_555 -1.362 -0.362 3.834 -10.531 14.518 33.331 -2.848 0.446  3.635 23.330 
16.924 37.729 21 HH_DC1814DDG1815:DC1905DG1906_JJ H 1814 ? J 1906 ? H 1815 ? J 1905 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "THYMIDINE-5'-TRIPHOSPHATE" TTP 
5 'CALCIUM ION'               CA  
6 2-AMINOFLUORENE             AF  
7 water                       HOH 
#