data_3KK3
# 
_entry.id   3KK3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KK3         
NDB   NA0440       
RCSB  RCSB056090   
WWPDB D_1000056090 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3kjv . unspecified 
PDB 3kk2 . unspecified 
PDB 3kk3 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KK3 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Lansdon, E.B.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            397 
_citation.page_first                967 
_citation.page_last                 978 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20156454 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.02.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lansdon, E.B.'   1  
primary 'Samuel, D.'      2  
primary 'Lagpacan, L.'    3  
primary 'Brendza, K.M.'   4  
primary 'White, K.L.'     5  
primary 'Hung, M.'        6  
primary 'Liu, X.'         7  
primary 'Boojamra, C.G.'  8  
primary 'Mackman, R.L.'   9  
primary 'Cihlar, T.'      10 
primary 'Ray, A.S.'       11 
primary 'McGrath, M.E.'   12 
primary 'Swaminathan, S.' 13 
# 
_cell.entry_id           3KK3 
_cell.length_a           166.998 
_cell.length_b           169.070 
_cell.length_c           96.398 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KK3 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Reverse transcriptase p66 subunit'                                                         64521.895 1  
2.7.7.49 'C280S, Q258C' ? ?              
2 polymer     man 'Reverse transcriptase p51 subunit'                                                         52748.418 1  
2.7.7.49 C280S          ? ?              
3 polymer     syn "5'-D(*AP*CP*AP*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*GP*CP*GP*CP*C*(URT))-3'"                6400.098  1  ? ? ? 
'primer DNA'   
4 polymer     syn "5'-D(*AP*TP*GP*GP*TP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*CP*TP*GP*TP*G)-3'" 8398.396  1  ? ? ? 
'template DNA' 
5 non-polymer syn 'MAGNESIUM ION'                                                                             24.305    1  ? ? ? ? 
6 non-polymer syn 'SULFATE ION'                                                                               96.063    2  ? ? ? ? 
7 water       nat water                                                                                       18.015    22 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'p66 RT' 
2 'p51 RT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(DG)(DC)(DG)(DC)(DC)
(URT)
;
ACAGTCCCTGTTCGGGCGCCX P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DT)(DT)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGTTGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 CYS n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 SER n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 ARG n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 VAL n 
1 560 LEU n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  SER n 
2 12  SER n 
2 13  PRO n 
2 14  ILE n 
2 15  SER n 
2 16  PRO n 
2 17  ILE n 
2 18  GLU n 
2 19  THR n 
2 20  VAL n 
2 21  PRO n 
2 22  VAL n 
2 23  LYS n 
2 24  LEU n 
2 25  LYS n 
2 26  PRO n 
2 27  GLY n 
2 28  MET n 
2 29  ASP n 
2 30  GLY n 
2 31  PRO n 
2 32  LYS n 
2 33  VAL n 
2 34  LYS n 
2 35  GLN n 
2 36  TRP n 
2 37  PRO n 
2 38  LEU n 
2 39  THR n 
2 40  GLU n 
2 41  GLU n 
2 42  LYS n 
2 43  ILE n 
2 44  LYS n 
2 45  ALA n 
2 46  LEU n 
2 47  VAL n 
2 48  GLU n 
2 49  ILE n 
2 50  CYS n 
2 51  THR n 
2 52  GLU n 
2 53  MET n 
2 54  GLU n 
2 55  LYS n 
2 56  GLU n 
2 57  GLY n 
2 58  LYS n 
2 59  ILE n 
2 60  SER n 
2 61  LYS n 
2 62  ILE n 
2 63  GLY n 
2 64  PRO n 
2 65  GLU n 
2 66  ASN n 
2 67  PRO n 
2 68  TYR n 
2 69  ASN n 
2 70  THR n 
2 71  PRO n 
2 72  VAL n 
2 73  PHE n 
2 74  ALA n 
2 75  ILE n 
2 76  LYS n 
2 77  LYS n 
2 78  LYS n 
2 79  ASP n 
2 80  SER n 
2 81  THR n 
2 82  LYS n 
2 83  TRP n 
2 84  ARG n 
2 85  LYS n 
2 86  LEU n 
2 87  VAL n 
2 88  ASP n 
2 89  PHE n 
2 90  ARG n 
2 91  GLU n 
2 92  LEU n 
2 93  ASN n 
2 94  LYS n 
2 95  ARG n 
2 96  THR n 
2 97  GLN n 
2 98  ASP n 
2 99  PHE n 
2 100 TRP n 
2 101 GLU n 
2 102 VAL n 
2 103 GLN n 
2 104 LEU n 
2 105 GLY n 
2 106 ILE n 
2 107 PRO n 
2 108 HIS n 
2 109 PRO n 
2 110 ALA n 
2 111 GLY n 
2 112 LEU n 
2 113 LYS n 
2 114 LYS n 
2 115 LYS n 
2 116 LYS n 
2 117 SER n 
2 118 VAL n 
2 119 THR n 
2 120 VAL n 
2 121 LEU n 
2 122 ASP n 
2 123 VAL n 
2 124 GLY n 
2 125 ASP n 
2 126 ALA n 
2 127 TYR n 
2 128 PHE n 
2 129 SER n 
2 130 VAL n 
2 131 PRO n 
2 132 LEU n 
2 133 ASP n 
2 134 GLU n 
2 135 ASP n 
2 136 PHE n 
2 137 ARG n 
2 138 LYS n 
2 139 TYR n 
2 140 THR n 
2 141 ALA n 
2 142 PHE n 
2 143 THR n 
2 144 ILE n 
2 145 PRO n 
2 146 SER n 
2 147 ILE n 
2 148 ASN n 
2 149 ASN n 
2 150 GLU n 
2 151 THR n 
2 152 PRO n 
2 153 GLY n 
2 154 ILE n 
2 155 ARG n 
2 156 TYR n 
2 157 GLN n 
2 158 TYR n 
2 159 ASN n 
2 160 VAL n 
2 161 LEU n 
2 162 PRO n 
2 163 GLN n 
2 164 GLY n 
2 165 TRP n 
2 166 LYS n 
2 167 GLY n 
2 168 SER n 
2 169 PRO n 
2 170 ALA n 
2 171 ILE n 
2 172 PHE n 
2 173 GLN n 
2 174 SER n 
2 175 SER n 
2 176 MET n 
2 177 THR n 
2 178 LYS n 
2 179 ILE n 
2 180 LEU n 
2 181 GLU n 
2 182 PRO n 
2 183 PHE n 
2 184 ARG n 
2 185 LYS n 
2 186 GLN n 
2 187 ASN n 
2 188 PRO n 
2 189 ASP n 
2 190 ILE n 
2 191 VAL n 
2 192 ILE n 
2 193 TYR n 
2 194 GLN n 
2 195 TYR n 
2 196 MET n 
2 197 ASP n 
2 198 ASP n 
2 199 LEU n 
2 200 TYR n 
2 201 VAL n 
2 202 GLY n 
2 203 SER n 
2 204 ASP n 
2 205 LEU n 
2 206 GLU n 
2 207 ILE n 
2 208 GLY n 
2 209 GLN n 
2 210 HIS n 
2 211 ARG n 
2 212 THR n 
2 213 LYS n 
2 214 ILE n 
2 215 GLU n 
2 216 GLU n 
2 217 LEU n 
2 218 ARG n 
2 219 GLN n 
2 220 HIS n 
2 221 LEU n 
2 222 LEU n 
2 223 ARG n 
2 224 TRP n 
2 225 GLY n 
2 226 LEU n 
2 227 THR n 
2 228 THR n 
2 229 PRO n 
2 230 ASP n 
2 231 LYS n 
2 232 LYS n 
2 233 HIS n 
2 234 GLN n 
2 235 LYS n 
2 236 GLU n 
2 237 PRO n 
2 238 PRO n 
2 239 PHE n 
2 240 LEU n 
2 241 TRP n 
2 242 MET n 
2 243 GLY n 
2 244 TYR n 
2 245 GLU n 
2 246 LEU n 
2 247 HIS n 
2 248 PRO n 
2 249 ASP n 
2 250 LYS n 
2 251 TRP n 
2 252 THR n 
2 253 VAL n 
2 254 GLN n 
2 255 PRO n 
2 256 ILE n 
2 257 VAL n 
2 258 LEU n 
2 259 PRO n 
2 260 GLU n 
2 261 LYS n 
2 262 ASP n 
2 263 SER n 
2 264 TRP n 
2 265 THR n 
2 266 VAL n 
2 267 ASN n 
2 268 ASP n 
2 269 ILE n 
2 270 GLN n 
2 271 LYS n 
2 272 LEU n 
2 273 VAL n 
2 274 GLY n 
2 275 LYS n 
2 276 LEU n 
2 277 ASN n 
2 278 TRP n 
2 279 ALA n 
2 280 SER n 
2 281 GLN n 
2 282 ILE n 
2 283 TYR n 
2 284 PRO n 
2 285 GLY n 
2 286 ILE n 
2 287 LYS n 
2 288 VAL n 
2 289 ARG n 
2 290 GLN n 
2 291 LEU n 
2 292 SER n 
2 293 LYS n 
2 294 LEU n 
2 295 LEU n 
2 296 ARG n 
2 297 GLY n 
2 298 THR n 
2 299 LYS n 
2 300 ALA n 
2 301 LEU n 
2 302 THR n 
2 303 GLU n 
2 304 VAL n 
2 305 ILE n 
2 306 PRO n 
2 307 LEU n 
2 308 THR n 
2 309 GLU n 
2 310 GLU n 
2 311 ALA n 
2 312 GLU n 
2 313 LEU n 
2 314 GLU n 
2 315 LEU n 
2 316 ALA n 
2 317 GLU n 
2 318 ASN n 
2 319 ARG n 
2 320 GLU n 
2 321 ILE n 
2 322 LEU n 
2 323 LYS n 
2 324 GLU n 
2 325 PRO n 
2 326 VAL n 
2 327 HIS n 
2 328 GLY n 
2 329 VAL n 
2 330 TYR n 
2 331 TYR n 
2 332 ASP n 
2 333 PRO n 
2 334 SER n 
2 335 LYS n 
2 336 ASP n 
2 337 LEU n 
2 338 ILE n 
2 339 ALA n 
2 340 GLU n 
2 341 ILE n 
2 342 GLN n 
2 343 LYS n 
2 344 GLN n 
2 345 GLY n 
2 346 GLN n 
2 347 GLY n 
2 348 GLN n 
2 349 TRP n 
2 350 THR n 
2 351 TYR n 
2 352 GLN n 
2 353 ILE n 
2 354 TYR n 
2 355 GLN n 
2 356 GLU n 
2 357 PRO n 
2 358 PHE n 
2 359 LYS n 
2 360 ASN n 
2 361 LEU n 
2 362 LYS n 
2 363 THR n 
2 364 GLY n 
2 365 LYS n 
2 366 TYR n 
2 367 ALA n 
2 368 ARG n 
2 369 MET n 
2 370 ARG n 
2 371 GLY n 
2 372 ALA n 
2 373 HIS n 
2 374 THR n 
2 375 ASN n 
2 376 ASP n 
2 377 VAL n 
2 378 LYS n 
2 379 GLN n 
2 380 LEU n 
2 381 THR n 
2 382 GLU n 
2 383 ALA n 
2 384 VAL n 
2 385 GLN n 
2 386 LYS n 
2 387 ILE n 
2 388 THR n 
2 389 THR n 
2 390 GLU n 
2 391 SER n 
2 392 ILE n 
2 393 VAL n 
2 394 ILE n 
2 395 TRP n 
2 396 GLY n 
2 397 LYS n 
2 398 THR n 
2 399 PRO n 
2 400 LYS n 
2 401 PHE n 
2 402 LYS n 
2 403 LEU n 
2 404 PRO n 
2 405 ILE n 
2 406 GLN n 
2 407 LYS n 
2 408 GLU n 
2 409 THR n 
2 410 TRP n 
2 411 GLU n 
2 412 THR n 
2 413 TRP n 
2 414 TRP n 
2 415 THR n 
2 416 GLU n 
2 417 TYR n 
2 418 TRP n 
2 419 GLN n 
2 420 ALA n 
2 421 THR n 
2 422 TRP n 
2 423 ILE n 
2 424 PRO n 
2 425 GLU n 
2 426 TRP n 
2 427 GLU n 
2 428 PHE n 
2 429 VAL n 
2 430 ASN n 
2 431 THR n 
2 432 PRO n 
2 433 PRO n 
2 434 LEU n 
2 435 VAL n 
2 436 LYS n 
2 437 LEU n 
2 438 TRP n 
2 439 TYR n 
2 440 GLN n 
2 441 LEU n 
2 442 GLU n 
2 443 LYS n 
2 444 GLU n 
2 445 PRO n 
2 446 ILE n 
2 447 VAL n 
2 448 GLY n 
2 449 ALA n 
2 450 GLU n 
2 451 THR n 
2 452 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  DG  n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  URT n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DT  n 
4 6   DT  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HIV-1 ? gag-pol ? HXB2D ? ? ? ? 'Human immunodeficiency virus type 1' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 
469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET14b ? ? 
2 1 sample ? ? ? HIV-1 ? gag-pol ? HXB2D ? ? ? ? 'Human immunodeficiency virus type 1' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 
469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET14b ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1H2 P04585 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 ? 
2 UNP POL_HV1H2 P04585 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 ? 
3 PDB 3KK3      3KK3   3 ACAGTCCCTGTTCGGGCGCCN 802 ? 
4 PDB 3KK3      3KK3   4 ATGGTTGGCGCCCGAACAGGGACTGTG 701 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KK3 A 1  ? 560 ? P04585 588 ? 1147 ? 1   560 
2 2 3KK3 B 13 ? 452 ? P04585 588 ? 1027 ? 1   440 
3 3 3KK3 P 1  ? 21  ? 3KK3   802 ? 822  ? 802 822 
4 4 3KK3 T 1  ? 27  ? 3KK3   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KK3 CYS A 258 ? UNP P04585 GLN 845 ENGINEERED       258 1  
1 3KK3 SER A 280 ? UNP P04585 CYS 867 ENGINEERED       280 2  
2 3KK3 MET B 1   ? UNP P04585 ?   ?   'EXPRESSION TAG' -11 3  
2 3KK3 GLY B 2   ? UNP P04585 ?   ?   'EXPRESSION TAG' -10 4  
2 3KK3 SER B 3   ? UNP P04585 ?   ?   'EXPRESSION TAG' -9  5  
2 3KK3 SER B 4   ? UNP P04585 ?   ?   'EXPRESSION TAG' -8  6  
2 3KK3 HIS B 5   ? UNP P04585 ?   ?   'EXPRESSION TAG' -7  7  
2 3KK3 HIS B 6   ? UNP P04585 ?   ?   'EXPRESSION TAG' -6  8  
2 3KK3 HIS B 7   ? UNP P04585 ?   ?   'EXPRESSION TAG' -5  9  
2 3KK3 HIS B 8   ? UNP P04585 ?   ?   'EXPRESSION TAG' -4  10 
2 3KK3 HIS B 9   ? UNP P04585 ?   ?   'EXPRESSION TAG' -3  11 
2 3KK3 HIS B 10  ? UNP P04585 ?   ?   'EXPRESSION TAG' -2  12 
2 3KK3 SER B 11  ? UNP P04585 ?   ?   'EXPRESSION TAG' -1  13 
2 3KK3 SER B 12  ? UNP P04585 ?   ?   'EXPRESSION TAG' 0   14 
2 3KK3 SER B 292 ? UNP P04585 CYS 867 ENGINEERED       280 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'       y ALANINE                                                                                          ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'       y ARGININE                                                                                         ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'       y ASPARAGINE                                                                                       ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'       y 'ASPARTIC ACID'                                                                                  ? 
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'       y CYSTEINE                                                                                         ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'             y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                             ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'             y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                              ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'             y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                             ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'             y "THYMIDINE-5'-MONOPHOSPHATE"                                                                     ? 
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking'       y GLUTAMINE                                                                                        ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'       y 'GLUTAMIC ACID'                                                                                  ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'         y GLYCINE                                                                                          ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'       y HISTIDINE                                                                                        ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer               . WATER                                                                                            ? 
'H2 O'              18.015  
ILE 'L-peptide linking'       y ISOLEUCINE                                                                                       ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'       y LEUCINE                                                                                          ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'       y LYSINE                                                                                           ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'       y METHIONINE                                                                                       ? 
'C5 H11 N O2 S'     149.211 
MG  non-polymer               . 'MAGNESIUM ION'                                                                                  ? 
'Mg 2'              24.305  
PHE 'L-peptide linking'       y PHENYLALANINE                                                                                    ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'       y PROLINE                                                                                          ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking'       y SERINE                                                                                           ? 
'C3 H7 N O3'        105.093 
SO4 non-polymer               . 'SULFATE ION'                                                                                    ? 
'O4 S -2'           96.063  
THR 'L-peptide linking'       y THREONINE                                                                                        ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'       y TRYPTOPHAN                                                                                       ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'       y TYROSINE                                                                                         ? 
'C9 H11 N O3'       181.189 
URT 'DNA OH 3 prime terminus' . '({[(2R,5R)-5-(6-amino-9H-purin-9-yl)-4-fluoro-2,5-dihydrofuran-2-yl]oxy}methyl)phosphonic acid' ? 
'C10 H11 F N5 O5 P' 331.197 
VAL 'L-peptide linking'       y VALINE                                                                                           ? 
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3KK3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'3% PEG4000, 0.05M MES pH 6.0, 5mM magnesium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-01-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal, Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3KK3 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   31465 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.2 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.5 
_reflns.B_iso_Wilson_estimate        10.6 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           0.614 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3KK3 
_refine.ls_number_reflns_obs                     27244 
_refine.ls_number_reflns_all                     29088 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               104550.12 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.99 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    89.1 
_refine.ls_R_factor_obs                          0.226 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.223 
_refine.ls_R_factor_R_free                       0.287 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1343 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               72.7 
_refine.aniso_B[1][1]                            21.00 
_refine.aniso_B[2][2]                            -26.60 
_refine.aniso_B[3][3]                            5.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.313384 
_refine.solvent_model_param_bsol                 42.1455 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3KJV 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3KK3 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.50 
_refine_analyze.Luzzati_sigma_a_free            0.68 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7875 
_refine_hist.pdbx_number_atoms_nucleic_acid   844 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             22 
_refine_hist.number_atoms_total               8752 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        29.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.94  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.45  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.60  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.87  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.11  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             3740 
_refine_ls_shell.R_factor_R_work                  0.367 
_refine_ls_shell.percent_reflns_obs               79.2 
_refine_ls_shell.R_factor_R_free                  0.402 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             208 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3KK3 
_pdbx_refine.R_factor_all_no_cutoff                      0.281 
_pdbx_refine.R_factor_obs_no_cutoff                      0.278 
_pdbx_refine.free_R_factor_no_cutoff                     0.333 
_pdbx_refine.free_R_error_no_cutoff                      0.009 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     4.9 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1439 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.p protein.top 
'X-RAY DIFFRACTION' 2 dna-rna_rep.p dna-rna.top 
'X-RAY DIFFRACTION' 3 water_rep.par water.top   
'X-RAY DIFFRACTION' 4 ion.param     ion.top     
'X-RAY DIFFRACTION' 5 urt.par       urt.top     
# 
_struct.entry_id                  3KK3 
_struct.title                     'HIV-1 reverse transcriptase-DNA complex with GS-9148 terminated primer' 
_struct.pdbx_descriptor           
'Reverse transcriptase p66 subunit (E.C.2.7.7.49), Reverse transcriptase p51 subunit (E.C.2.7.7.49)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KK3 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'HIV, reverse transcriptase, protein-DNA complex, TRANSFERASE, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 27  ? GLU A 44  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  2  PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  3  HIS A 96  ? LEU A 100 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  4  ALA A 114 ? VAL A 118 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  5  PHE A 124 ? ALA A 129 ? PHE A 124 ALA A 129 5 ? 6  
HELX_P HELX_P6  6  GLY A 155 ? ASN A 175 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  7  GLU A 194 ? ARG A 211 ? GLU A 194 ARG A 211 1 ? 18 
HELX_P HELX_P8  8  THR A 253 ? SER A 268 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P9  9  THR A 296 ? LEU A 310 ? THR A 296 LEU A 310 1 ? 15 
HELX_P HELX_P10 10 ASN A 363 ? TRP A 383 ? ASN A 363 TRP A 383 1 ? 21 
HELX_P HELX_P11 11 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P12 12 THR A 473 ? SER A 489 ? THR A 473 SER A 489 1 ? 17 
HELX_P HELX_P13 13 SER A 499 ? ALA A 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P14 14 SER A 515 ? LYS A 528 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P15 15 GLU A 546 ? SER A 553 ? GLU A 546 SER A 553 1 ? 8  
HELX_P HELX_P16 16 THR B 39  ? GLU B 56  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P17 17 PHE B 89  ? THR B 96  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P18 18 PRO B 109 ? LYS B 114 ? PRO B 97  LYS B 102 5 ? 6  
HELX_P HELX_P19 19 GLY B 124 ? TYR B 127 ? GLY B 112 TYR B 115 5 ? 4  
HELX_P HELX_P20 20 PHE B 136 ? ALA B 141 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P21 21 SER B 146 ? GLU B 150 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P22 22 PHE B 172 ? LEU B 180 ? PHE B 160 LEU B 168 1 ? 9  
HELX_P HELX_P23 23 LEU B 180 ? GLN B 186 ? LEU B 168 GLN B 174 1 ? 7  
HELX_P HELX_P24 24 GLU B 206 ? ARG B 223 ? GLU B 194 ARG B 211 1 ? 18 
HELX_P HELX_P25 25 HIS B 247 ? TRP B 251 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P26 26 VAL B 266 ? SER B 280 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P27 27 THR B 308 ? LEU B 322 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P28 28 ASN B 375 ? GLY B 396 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P29 29 GLN B 406 ? TRP B 414 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P30 30 THR B 415 ? TYR B 417 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P31 31 LEU B 434 ? TRP B 438 ? LEU B 422 TRP B 426 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C DC  20  "O3'" ? ? ? 1_555 C URT 21 P1 ? ? P DC  821 P URT 822 1_555 ? ? ? ? ? ? ?            1.627 ? 
metalc1  metalc ? ? A ASP 443 OD2   ? ? ? 1_555 E MG  .  MG ? ? A ASP 443 A MG  601 1_555 ? ? ? ? ? ? ?            2.288 ? 
metalc2  metalc ? ? A ASP 498 OD1   ? ? ? 1_555 E MG  .  MG ? ? A ASP 498 A MG  601 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc3  metalc ? ? A GLU 478 OE2   ? ? ? 1_555 E MG  .  MG ? ? A GLU 478 A MG  601 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc4  metalc ? ? A ASP 498 OD2   ? ? ? 1_555 E MG  .  MG ? ? A ASP 498 A MG  601 1_555 ? ? ? ? ? ? ?            2.379 ? 
metalc5  metalc ? ? A ASP 443 OD1   ? ? ? 1_555 E MG  .  MG ? ? A ASP 443 A MG  601 1_555 ? ? ? ? ? ? ?            2.437 ? 
hydrog1  hydrog ? ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DC  7   N4    ? ? ? 1_555 D DG  19 O6 ? ? P DC  808 T DG  719 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog10 hydrog ? ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DG  14  O6    ? ? ? 1_555 D DC  12 N4 ? ? P DG  815 T DC  712 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog29 hydrog ? ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DG  16  N1    ? ? ? 1_555 D DC  11 N3 ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG  16  N2    ? ? ? 1_555 D DC  11 O2 ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG  16  O6    ? ? ? 1_555 D DC  11 N4 ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 225 A . ? PRO 225 A PRO 226 A ? PRO 226 A 1 -5.11 
2 PRO 420 A . ? PRO 420 A PRO 421 A ? PRO 421 A 1 7.76  
3 GLY 543 A . ? GLY 543 A GLY 544 A ? GLY 544 A 1 4.97  
4 GLY 225 B . ? GLY 213 B LEU 226 B ? LEU 214 B 1 1.93  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 4 ? 
D ? 3 ? 
E ? 5 ? 
F ? 2 ? 
G ? 5 ? 
H ? 3 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
L 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 47  ? LYS A 49  ? ILE A 47  LYS A 49  
A 2 ILE A 142 ? TYR A 146 ? ILE A 142 TYR A 146 
A 3 PHE A 130 ? ILE A 132 ? PHE A 130 ILE A 132 
B 1 VAL A 60  ? LYS A 64  ? VAL A 60  LYS A 64  
B 2 TRP A 71  ? VAL A 75  ? TRP A 71  VAL A 75  
C 1 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
C 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
C 3 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
C 4 LYS A 220 ? HIS A 221 ? LYS A 220 HIS A 221 
D 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
D 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
D 3 TRP A 239 ? VAL A 241 ? TRP A 239 VAL A 241 
E 1 ASN A 348 ? TYR A 354 ? ASN A 348 TYR A 354 
E 2 TRP A 337 ? TYR A 342 ? TRP A 337 TYR A 342 
E 3 ILE A 326 ? LYS A 331 ? ILE A 326 LYS A 331 
E 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
E 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
F 1 HIS A 361 ? THR A 362 ? HIS A 361 THR A 362 
F 2 GLN A 512 ? SER A 513 ? GLN A 512 SER A 513 
G 1 GLN A 464 ? LEU A 469 ? GLN A 464 LEU A 469 
G 2 GLY A 453 ? THR A 459 ? GLY A 453 THR A 459 
G 3 GLU A 438 ? ALA A 445 ? GLU A 438 ALA A 445 
G 4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
G 5 LYS A 530 ? TRP A 535 ? LYS A 530 TRP A 535 
H 1 ILE B 59  ? ILE B 62  ? ILE B 47  ILE B 50  
H 2 ILE B 154 ? TYR B 158 ? ILE B 142 TYR B 146 
H 3 PHE B 142 ? ILE B 144 ? PHE B 130 ILE B 132 
I 1 VAL B 72  ? LYS B 76  ? VAL B 60  LYS B 64  
I 2 TRP B 83  ? VAL B 87  ? TRP B 71  VAL B 75  
J 1 THR B 119 ? ASP B 122 ? THR B 107 ASP B 110 
J 2 ASP B 198 ? GLY B 202 ? ASP B 186 GLY B 190 
J 3 VAL B 191 ? TYR B 195 ? VAL B 179 TYR B 183 
K 1 TRP B 264 ? THR B 265 ? TRP B 252 THR B 253 
K 2 VAL B 304 ? ILE B 305 ? VAL B 292 ILE B 293 
L 1 ASN B 360 ? ALA B 367 ? ASN B 348 ALA B 355 
L 2 GLN B 348 ? TYR B 354 ? GLN B 336 TYR B 342 
L 3 ILE B 338 ? GLY B 345 ? ILE B 326 GLY B 333 
L 4 LYS B 400 ? LEU B 403 ? LYS B 388 LEU B 391 
L 5 GLU B 425 ? PHE B 428 ? GLU B 413 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 48  ? N SER A 48  O GLN A 145 ? O GLN A 145 
A 2 3 O TYR A 144 ? O TYR A 144 N PHE A 130 ? N PHE A 130 
B 1 2 N ILE A 63  ? N ILE A 63  O ARG A 72  ? O ARG A 72  
C 1 2 N TYR A 183 ? N TYR A 183 O ASP A 186 ? O ASP A 186 
C 2 3 O SER A 191 ? O SER A 191 N SER A 105 ? N SER A 105 
C 3 4 N VAL A 108 ? N VAL A 108 O HIS A 221 ? O HIS A 221 
D 1 2 N TRP A 229 ? N TRP A 229 O TYR A 232 ? O TYR A 232 
D 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
E 1 2 O TYR A 354 ? O TYR A 354 N TRP A 337 ? N TRP A 337 
E 2 3 O TYR A 342 ? O TYR A 342 N ILE A 326 ? N ILE A 326 
E 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
E 4 5 N PHE A 389 ? N PHE A 389 O GLU A 415 ? O GLU A 415 
F 1 2 N THR A 362 ? N THR A 362 O GLN A 512 ? O GLN A 512 
G 1 2 O VAL A 467 ? O VAL A 467 N ALA A 455 ? N ALA A 455 
G 2 3 O LYS A 454 ? O LYS A 454 N ALA A 445 ? N ALA A 445 
G 3 4 N PHE A 440 ? N PHE A 440 O ASN A 494 ? O ASN A 494 
G 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
H 1 2 N ILE B 62  ? N ILE B 50  O ARG B 155 ? O ARG B 143 
H 2 3 O TYR B 156 ? O TYR B 144 N PHE B 142 ? N PHE B 130 
I 1 2 N ILE B 75  ? N ILE B 63  O ARG B 84  ? O ARG B 72  
J 1 2 N LEU B 121 ? N LEU B 109 O LEU B 199 ? O LEU B 187 
J 2 3 O TYR B 200 ? O TYR B 188 N TYR B 193 ? N TYR B 181 
K 1 2 N TRP B 264 ? N TRP B 252 O ILE B 305 ? O ILE B 293 
L 1 2 O TYR B 366 ? O TYR B 354 N TRP B 349 ? N TRP B 337 
L 2 3 O THR B 350 ? O THR B 338 N GLN B 342 ? N GLN B 330 
L 3 4 N ILE B 341 ? N ILE B 329 O LYS B 402 ? O LYS B 390 
L 4 5 N LEU B 403 ? N LEU B 391 O GLU B 427 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 601' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 P 3'  
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 T 2'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP A 443 ? ASP A 443 . ? 1_555 ? 
2 AC1 4 GLY A 444 ? GLY A 444 . ? 1_555 ? 
3 AC1 4 GLU A 478 ? GLU A 478 . ? 1_555 ? 
4 AC1 4 ASP A 498 ? ASP A 498 . ? 1_555 ? 
5 AC2 3 DG  C 15  ? DG  P 816 . ? 1_555 ? 
6 AC2 3 DG  C 16  ? DG  P 817 . ? 1_555 ? 
7 AC2 3 DG  D 10  ? DG  T 710 . ? 1_555 ? 
8 AC3 2 DG  D 7   ? DG  T 707 . ? 1_555 ? 
9 AC3 2 DG  D 8   ? DG  T 708 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KK3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KK3 
_atom_sites.fract_transf_matrix[1][1]   0.005988 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005915 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010374 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 1   ? 41.437 179.950 30.639 1.00 83.95  ? 1   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 1   ? 42.546 180.740 31.241 1.00 83.33  ? 1   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 1   ? 43.861 180.090 30.821 1.00 81.24  ? 1   PRO A C     1 
ATOM   4    O  O     . PRO A 1 1   ? 43.945 179.433 29.787 1.00 82.27  ? 1   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 1   ? 42.399 180.680 32.766 1.00 84.65  ? 1   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 1   ? 41.005 180.053 32.965 1.00 84.41  ? 1   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 1   ? 40.681 179.239 31.686 1.00 84.33  ? 1   PRO A CD    1 
ATOM   8    N  N     . ILE A 1 2   ? 44.888 180.269 31.631 1.00 78.04  ? 2   ILE A N     1 
ATOM   9    C  CA    . ILE A 1 2   ? 45.920 179.260 31.716 1.00 74.84  ? 2   ILE A CA    1 
ATOM   10   C  C     . ILE A 1 2   ? 45.796 178.625 33.096 1.00 73.94  ? 2   ILE A C     1 
ATOM   11   O  O     . ILE A 1 2   ? 45.881 179.306 34.119 1.00 74.28  ? 2   ILE A O     1 
ATOM   12   C  CB    . ILE A 1 2   ? 47.328 179.870 31.538 1.00 74.09  ? 2   ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 2   ? 47.435 180.530 30.166 1.00 72.72  ? 2   ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 2   ? 48.384 178.805 31.688 1.00 73.65  ? 2   ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 2   ? 46.820 179.728 29.077 1.00 72.95  ? 2   ILE A CD1   1 
ATOM   16   N  N     . SER A 1 3   ? 45.562 177.320 33.117 1.00 72.48  ? 3   SER A N     1 
ATOM   17   C  CA    . SER A 1 3   ? 45.665 176.553 34.345 1.00 69.96  ? 3   SER A CA    1 
ATOM   18   C  C     . SER A 1 3   ? 46.854 177.058 35.159 1.00 69.06  ? 3   SER A C     1 
ATOM   19   O  O     . SER A 1 3   ? 47.966 177.190 34.648 1.00 67.65  ? 3   SER A O     1 
ATOM   20   C  CB    . SER A 1 3   ? 45.854 175.076 34.019 1.00 68.89  ? 3   SER A CB    1 
ATOM   21   O  OG    . SER A 1 3   ? 46.094 174.339 35.196 1.00 68.28  ? 3   SER A OG    1 
ATOM   22   N  N     . PRO A 1 4   ? 46.621 177.357 36.442 1.00 68.47  ? 4   PRO A N     1 
ATOM   23   C  CA    . PRO A 1 4   ? 47.629 177.873 37.366 1.00 67.43  ? 4   PRO A CA    1 
ATOM   24   C  C     . PRO A 1 4   ? 48.680 176.815 37.621 1.00 67.52  ? 4   PRO A C     1 
ATOM   25   O  O     . PRO A 1 4   ? 49.586 177.021 38.430 1.00 70.09  ? 4   PRO A O     1 
ATOM   26   C  CB    . PRO A 1 4   ? 46.843 178.168 38.634 1.00 67.62  ? 4   PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 4   ? 45.411 178.176 38.215 1.00 68.03  ? 4   PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 4   ? 45.321 177.195 37.106 1.00 68.78  ? 4   PRO A CD    1 
ATOM   29   N  N     . ILE A 1 5   ? 48.550 175.679 36.938 1.00 64.99  ? 5   ILE A N     1 
ATOM   30   C  CA    . ILE A 1 5   ? 49.383 174.522 37.239 1.00 61.63  ? 5   ILE A CA    1 
ATOM   31   C  C     . ILE A 1 5   ? 50.803 174.722 36.757 1.00 61.03  ? 5   ILE A C     1 
ATOM   32   O  O     . ILE A 1 5   ? 51.067 175.559 35.897 1.00 60.39  ? 5   ILE A O     1 
ATOM   33   C  CB    . ILE A 1 5   ? 48.835 173.222 36.610 1.00 60.12  ? 5   ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 5   ? 49.522 172.030 37.264 1.00 58.13  ? 5   ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 5   ? 49.097 173.196 35.107 1.00 56.85  ? 5   ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 5   ? 48.971 170.718 36.828 1.00 59.31  ? 5   ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 6   ? 51.713 173.945 37.327 1.00 60.39  ? 6   GLU A N     1 
ATOM   38   C  CA    . GLU A 1 6   ? 53.126 174.104 37.063 1.00 59.45  ? 6   GLU A CA    1 
ATOM   39   C  C     . GLU A 1 6   ? 53.448 173.414 35.757 1.00 56.36  ? 6   GLU A C     1 
ATOM   40   O  O     . GLU A 1 6   ? 52.909 172.361 35.473 1.00 54.66  ? 6   GLU A O     1 
ATOM   41   C  CB    . GLU A 1 6   ? 53.923 173.474 38.197 1.00 64.12  ? 6   GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 6   ? 55.390 173.865 38.230 1.00 70.78  ? 6   GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 6   ? 55.976 173.738 39.627 1.00 75.02  ? 6   GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 6   ? 56.354 172.603 40.009 1.00 76.96  ? 6   GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 6   ? 56.049 174.766 40.344 1.00 74.73  ? 6   GLU A OE2   1 
ATOM   46   N  N     . THR A 1 7   ? 54.320 174.006 34.954 1.00 54.35  ? 7   THR A N     1 
ATOM   47   C  CA    . THR A 1 7   ? 54.767 173.328 33.755 1.00 53.24  ? 7   THR A CA    1 
ATOM   48   C  C     . THR A 1 7   ? 55.514 172.057 34.102 1.00 52.96  ? 7   THR A C     1 
ATOM   49   O  O     . THR A 1 7   ? 55.963 171.872 35.227 1.00 54.12  ? 7   THR A O     1 
ATOM   50   C  CB    . THR A 1 7   ? 55.695 174.194 32.919 1.00 53.26  ? 7   THR A CB    1 
ATOM   51   O  OG1   . THR A 1 7   ? 56.824 174.592 33.708 1.00 55.75  ? 7   THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 7   ? 54.964 175.400 32.417 1.00 53.16  ? 7   THR A CG2   1 
ATOM   53   N  N     . VAL A 1 8   ? 55.624 171.186 33.105 1.00 53.38  ? 8   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 8   ? 56.356 169.927 33.174 1.00 51.07  ? 8   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 8   ? 57.640 170.113 32.382 1.00 53.33  ? 8   VAL A C     1 
ATOM   56   O  O     . VAL A 1 8   ? 57.600 170.336 31.168 1.00 53.14  ? 8   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 8   ? 55.576 168.820 32.487 1.00 48.95  ? 8   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 8   ? 56.370 167.574 32.495 1.00 48.50  ? 8   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 8   ? 54.236 168.627 33.149 1.00 49.26  ? 8   VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 9   ? 58.797 170.009 33.052 1.00 54.90  ? 9   PRO A N     1 
ATOM   61   C  CA    . PRO A 1 9   ? 60.103 170.276 32.438 1.00 54.93  ? 9   PRO A CA    1 
ATOM   62   C  C     . PRO A 1 9   ? 60.301 169.421 31.202 1.00 56.26  ? 9   PRO A C     1 
ATOM   63   O  O     . PRO A 1 9   ? 60.026 168.227 31.225 1.00 56.64  ? 9   PRO A O     1 
ATOM   64   C  CB    . PRO A 1 9   ? 61.094 169.904 33.526 1.00 53.22  ? 9   PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 9   ? 60.320 169.977 34.778 1.00 55.01  ? 9   PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 9   ? 58.935 169.555 34.442 1.00 54.85  ? 9   PRO A CD    1 
ATOM   67   N  N     . VAL A 1 10  ? 60.780 170.039 30.127 1.00 56.98  ? 10  VAL A N     1 
ATOM   68   C  CA    . VAL A 1 10  ? 60.990 169.342 28.866 1.00 57.30  ? 10  VAL A CA    1 
ATOM   69   C  C     . VAL A 1 10  ? 62.351 169.710 28.278 1.00 59.53  ? 10  VAL A C     1 
ATOM   70   O  O     . VAL A 1 10  ? 62.763 170.864 28.312 1.00 60.73  ? 10  VAL A O     1 
ATOM   71   C  CB    . VAL A 1 10  ? 59.894 169.706 27.859 1.00 54.42  ? 10  VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 10  ? 60.101 168.959 26.575 1.00 54.26  ? 10  VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 10  ? 58.553 169.383 28.436 1.00 55.03  ? 10  VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 11  ? 63.056 168.727 27.745 1.00 60.53  ? 11  LYS A N     1 
ATOM   75   C  CA    . LYS A 1 11  ? 64.345 168.994 27.153 1.00 62.47  ? 11  LYS A CA    1 
ATOM   76   C  C     . LYS A 1 11  ? 64.364 168.360 25.774 1.00 64.22  ? 11  LYS A C     1 
ATOM   77   O  O     . LYS A 1 11  ? 63.571 167.467 25.490 1.00 63.55  ? 11  LYS A O     1 
ATOM   78   C  CB    . LYS A 1 11  ? 65.446 168.406 28.034 1.00 63.99  ? 11  LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 11  ? 65.296 168.779 29.501 1.00 67.92  ? 11  LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 11  ? 66.574 169.382 30.101 1.00 71.26  ? 11  LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 11  ? 66.302 170.098 31.447 1.00 73.10  ? 11  LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 11  ? 67.501 170.148 32.365 1.00 72.67  ? 11  LYS A NZ    1 
ATOM   83   N  N     . LEU A 1 12  ? 65.253 168.835 24.907 1.00 65.97  ? 12  LEU A N     1 
ATOM   84   C  CA    . LEU A 1 12  ? 65.516 168.147 23.650 1.00 66.38  ? 12  LEU A CA    1 
ATOM   85   C  C     . LEU A 1 12  ? 66.493 167.028 23.959 1.00 67.78  ? 12  LEU A C     1 
ATOM   86   O  O     . LEU A 1 12  ? 67.265 167.112 24.917 1.00 68.32  ? 12  LEU A O     1 
ATOM   87   C  CB    . LEU A 1 12  ? 66.145 169.096 22.629 1.00 65.73  ? 12  LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 12  ? 65.347 170.317 22.173 1.00 66.37  ? 12  LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 12  ? 66.259 171.235 21.399 1.00 65.68  ? 12  LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 12  ? 64.168 169.895 21.310 1.00 67.06  ? 12  LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 13  ? 66.458 165.973 23.156 1.00 69.28  ? 13  LYS A N     1 
ATOM   92   C  CA    . LYS A 1 13  ? 67.433 164.909 23.302 1.00 70.87  ? 13  LYS A CA    1 
ATOM   93   C  C     . LYS A 1 13  ? 68.802 165.572 23.224 1.00 72.72  ? 13  LYS A C     1 
ATOM   94   O  O     . LYS A 1 13  ? 68.987 166.552 22.498 1.00 73.04  ? 13  LYS A O     1 
ATOM   95   C  CB    . LYS A 1 13  ? 67.264 163.870 22.185 1.00 69.78  ? 13  LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 13  ? 65.934 163.114 22.236 1.00 68.04  ? 13  LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 13  ? 65.791 162.137 21.079 1.00 65.52  ? 13  LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 13  ? 64.555 161.266 21.224 1.00 64.26  ? 13  LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 13  ? 64.307 160.411 20.017 1.00 63.81  ? 13  LYS A NZ    1 
ATOM   100  N  N     . PRO A 1 14  ? 69.775 165.054 23.983 1.00 74.30  ? 14  PRO A N     1 
ATOM   101  C  CA    . PRO A 1 14  ? 71.102 165.669 24.112 1.00 74.94  ? 14  PRO A CA    1 
ATOM   102  C  C     . PRO A 1 14  ? 71.806 165.843 22.767 1.00 75.58  ? 14  PRO A C     1 
ATOM   103  O  O     . PRO A 1 14  ? 71.730 164.976 21.894 1.00 75.93  ? 14  PRO A O     1 
ATOM   104  C  CB    . PRO A 1 14  ? 71.858 164.705 25.026 1.00 75.40  ? 14  PRO A CB    1 
ATOM   105  C  CG    . PRO A 1 14  ? 70.793 163.948 25.748 1.00 76.16  ? 14  PRO A CG    1 
ATOM   106  C  CD    . PRO A 1 14  ? 69.662 163.818 24.775 1.00 75.58  ? 14  PRO A CD    1 
ATOM   107  N  N     . GLY A 1 15  ? 72.487 166.970 22.601 1.00 75.87  ? 15  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 15  ? 73.267 167.179 21.397 1.00 77.41  ? 15  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 15  ? 72.489 167.685 20.191 1.00 78.32  ? 15  GLY A C     1 
ATOM   110  O  O     . GLY A 1 15  ? 73.076 167.961 19.140 1.00 78.49  ? 15  GLY A O     1 
ATOM   111  N  N     . MET A 1 16  ? 71.173 167.816 20.330 1.00 78.35  ? 16  MET A N     1 
ATOM   112  C  CA    . MET A 1 16  ? 70.343 168.233 19.208 1.00 77.78  ? 16  MET A CA    1 
ATOM   113  C  C     . MET A 1 16  ? 69.734 169.596 19.434 1.00 76.01  ? 16  MET A C     1 
ATOM   114  O  O     . MET A 1 16  ? 69.323 169.920 20.540 1.00 75.84  ? 16  MET A O     1 
ATOM   115  C  CB    . MET A 1 16  ? 69.239 167.215 18.978 1.00 79.67  ? 16  MET A CB    1 
ATOM   116  C  CG    . MET A 1 16  ? 69.754 165.808 18.835 1.00 81.71  ? 16  MET A CG    1 
ATOM   117  S  SD    . MET A 1 16  ? 68.566 164.790 17.981 1.00 86.27  ? 16  MET A SD    1 
ATOM   118  C  CE    . MET A 1 16  ? 69.354 163.154 18.121 1.00 85.68  ? 16  MET A CE    1 
ATOM   119  N  N     . ASP A 1 17  ? 69.682 170.401 18.385 1.00 75.27  ? 17  ASP A N     1 
ATOM   120  C  CA    . ASP A 1 17  ? 69.062 171.704 18.505 1.00 76.23  ? 17  ASP A CA    1 
ATOM   121  C  C     . ASP A 1 17  ? 67.662 171.606 17.946 1.00 75.76  ? 17  ASP A C     1 
ATOM   122  O  O     . ASP A 1 17  ? 67.252 170.544 17.495 1.00 75.69  ? 17  ASP A O     1 
ATOM   123  C  CB    . ASP A 1 17  ? 69.850 172.781 17.745 1.00 77.87  ? 17  ASP A CB    1 
ATOM   124  C  CG    . ASP A 1 17  ? 69.342 174.196 18.043 1.00 80.09  ? 17  ASP A CG    1 
ATOM   125  O  OD1   . ASP A 1 17  ? 68.660 174.374 19.080 1.00 80.59  ? 17  ASP A OD1   1 
ATOM   126  O  OD2   . ASP A 1 17  ? 69.617 175.125 17.250 1.00 80.44  ? 17  ASP A OD2   1 
ATOM   127  N  N     . GLY A 1 18  ? 66.938 172.720 17.980 1.00 75.23  ? 18  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 18  ? 65.548 172.729 17.573 1.00 74.35  ? 18  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 18  ? 65.351 172.466 16.099 1.00 73.67  ? 18  GLY A C     1 
ATOM   130  O  O     . GLY A 1 18  ? 66.285 172.071 15.406 1.00 73.32  ? 18  GLY A O     1 
ATOM   131  N  N     . PRO A 1 19  ? 64.127 172.657 15.597 1.00 73.33  ? 19  PRO A N     1 
ATOM   132  C  CA    . PRO A 1 19  ? 63.812 172.468 14.185 1.00 73.21  ? 19  PRO A CA    1 
ATOM   133  C  C     . PRO A 1 19  ? 64.123 173.727 13.381 1.00 74.57  ? 19  PRO A C     1 
ATOM   134  O  O     . PRO A 1 19  ? 63.900 174.845 13.858 1.00 73.63  ? 19  PRO A O     1 
ATOM   135  C  CB    . PRO A 1 19  ? 62.327 172.141 14.209 1.00 72.90  ? 19  PRO A CB    1 
ATOM   136  C  CG    . PRO A 1 19  ? 61.808 172.932 15.360 1.00 73.13  ? 19  PRO A CG    1 
ATOM   137  C  CD    . PRO A 1 19  ? 62.933 173.039 16.371 1.00 73.66  ? 19  PRO A CD    1 
ATOM   138  N  N     . LYS A 1 20  ? 64.653 173.534 12.171 1.00 75.72  ? 20  LYS A N     1 
ATOM   139  C  CA    . LYS A 1 20  ? 64.853 174.616 11.205 1.00 76.60  ? 20  LYS A CA    1 
ATOM   140  C  C     . LYS A 1 20  ? 64.168 174.212 9.899  1.00 77.45  ? 20  LYS A C     1 
ATOM   141  O  O     . LYS A 1 20  ? 64.826 173.964 8.890  1.00 77.03  ? 20  LYS A O     1 
ATOM   142  C  CB    . LYS A 1 20  ? 66.349 174.834 10.935 1.00 76.77  ? 20  LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 20  ? 67.221 175.089 12.157 1.00 76.85  ? 20  LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 20  ? 67.145 176.540 12.583 1.00 80.13  ? 20  LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 20  ? 68.270 176.905 13.543 1.00 81.39  ? 20  LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 20  ? 69.608 176.807 12.890 1.00 81.99  ? 20  LYS A NZ    1 
ATOM   147  N  N     . VAL A 1 21  ? 62.846 174.125 9.921  1.00 78.59  ? 21  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 21  ? 62.128 173.597 8.775  1.00 80.35  ? 21  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 21  ? 61.364 174.689 8.040  1.00 83.39  ? 21  VAL A C     1 
ATOM   150  O  O     . VAL A 1 21  ? 60.798 175.593 8.657  1.00 83.29  ? 21  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 21  ? 61.159 172.477 9.199  1.00 78.75  ? 21  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 21  ? 60.369 171.979 8.000  1.00 77.20  ? 21  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 21  ? 61.944 171.331 9.806  1.00 77.60  ? 21  VAL A CG2   1 
ATOM   154  N  N     . LYS A 1 22  ? 61.356 174.589 6.712  1.00 86.66  ? 22  LYS A N     1 
ATOM   155  C  CA    . LYS A 1 22  ? 60.887 175.658 5.840  1.00 89.82  ? 22  LYS A CA    1 
ATOM   156  C  C     . LYS A 1 22  ? 59.382 175.628 5.674  1.00 91.31  ? 22  LYS A C     1 
ATOM   157  O  O     . LYS A 1 22  ? 58.813 174.638 5.217  1.00 90.78  ? 22  LYS A O     1 
ATOM   158  C  CB    . LYS A 1 22  ? 61.547 175.545 4.462  1.00 91.92  ? 22  LYS A CB    1 
ATOM   159  C  CG    . LYS A 1 22  ? 61.037 174.387 3.590  1.00 94.95  ? 22  LYS A CG    1 
ATOM   160  C  CD    . LYS A 1 22  ? 61.773 173.070 3.854  1.00 95.77  ? 22  LYS A CD    1 
ATOM   161  C  CE    . LYS A 1 22  ? 61.483 172.037 2.764  1.00 95.34  ? 22  LYS A CE    1 
ATOM   162  N  NZ    . LYS A 1 22  ? 62.397 170.865 2.858  1.00 94.83  ? 22  LYS A NZ    1 
ATOM   163  N  N     . GLN A 1 23  ? 58.737 176.724 6.040  1.00 93.76  ? 23  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 23  ? 57.291 176.780 5.968  1.00 96.87  ? 23  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 23  ? 56.906 176.602 4.512  1.00 98.31  ? 23  GLN A C     1 
ATOM   166  O  O     . GLN A 1 23  ? 57.153 177.486 3.707  1.00 99.68  ? 23  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 23  ? 56.798 178.132 6.482  1.00 97.22  ? 23  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 23  ? 55.295 178.212 6.649  1.00 98.61  ? 23  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 23  ? 54.753 177.111 7.539  1.00 99.08  ? 23  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 23  ? 53.792 176.430 7.182  1.00 98.71  ? 23  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 23  ? 55.368 176.932 8.707  1.00 99.11  ? 23  GLN A NE2   1 
ATOM   172  N  N     . TRP A 1 24  ? 56.319 175.463 4.161  1.00 100.32 ? 24  TRP A N     1 
ATOM   173  C  CA    . TRP A 1 24  ? 55.923 175.240 2.773  1.00 103.45 ? 24  TRP A CA    1 
ATOM   174  C  C     . TRP A 1 24  ? 54.576 175.890 2.438  1.00 105.41 ? 24  TRP A C     1 
ATOM   175  O  O     . TRP A 1 24  ? 53.770 176.157 3.333  1.00 106.10 ? 24  TRP A O     1 
ATOM   176  C  CB    . TRP A 1 24  ? 55.875 173.739 2.447  1.00 104.36 ? 24  TRP A CB    1 
ATOM   177  C  CG    . TRP A 1 24  ? 55.839 172.797 3.628  1.00 104.68 ? 24  TRP A CG    1 
ATOM   178  C  CD1   . TRP A 1 24  ? 56.911 172.188 4.222  1.00 104.89 ? 24  TRP A CD1   1 
ATOM   179  C  CD2   . TRP A 1 24  ? 54.671 172.277 4.284  1.00 104.22 ? 24  TRP A CD2   1 
ATOM   180  N  NE1   . TRP A 1 24  ? 56.483 171.318 5.196  1.00 104.60 ? 24  TRP A NE1   1 
ATOM   181  C  CE2   . TRP A 1 24  ? 55.115 171.353 5.255  1.00 104.02 ? 24  TRP A CE2   1 
ATOM   182  C  CE3   . TRP A 1 24  ? 53.298 172.499 4.143  1.00 103.72 ? 24  TRP A CE3   1 
ATOM   183  C  CZ2   . TRP A 1 24  ? 54.236 170.654 6.078  1.00 103.32 ? 24  TRP A CZ2   1 
ATOM   184  C  CZ3   . TRP A 1 24  ? 52.429 171.804 4.962  1.00 104.03 ? 24  TRP A CZ3   1 
ATOM   185  C  CH2   . TRP A 1 24  ? 52.903 170.892 5.918  1.00 103.12 ? 24  TRP A CH2   1 
ATOM   186  N  N     . PRO A 1 25  ? 54.321 176.150 1.138  1.00 106.57 ? 25  PRO A N     1 
ATOM   187  C  CA    . PRO A 1 25  ? 53.233 176.999 0.618  1.00 106.86 ? 25  PRO A CA    1 
ATOM   188  C  C     . PRO A 1 25  ? 51.817 176.494 0.896  1.00 107.20 ? 25  PRO A C     1 
ATOM   189  O  O     . PRO A 1 25  ? 51.578 175.287 0.943  1.00 106.80 ? 25  PRO A O     1 
ATOM   190  C  CB    . PRO A 1 25  ? 53.511 177.066 -0.885 1.00 106.51 ? 25  PRO A CB    1 
ATOM   191  C  CG    . PRO A 1 25  ? 54.940 176.674 -1.029 1.00 106.70 ? 25  PRO A CG    1 
ATOM   192  C  CD    . PRO A 1 25  ? 55.193 175.675 0.050  1.00 106.39 ? 25  PRO A CD    1 
ATOM   193  N  N     . LEU A 1 26  ? 50.882 177.430 1.058  1.00 108.19 ? 26  LEU A N     1 
ATOM   194  C  CA    . LEU A 1 26  ? 49.481 177.104 1.349  1.00 109.22 ? 26  LEU A CA    1 
ATOM   195  C  C     . LEU A 1 26  ? 48.532 178.096 0.667  1.00 109.25 ? 26  LEU A C     1 
ATOM   196  O  O     . LEU A 1 26  ? 48.914 179.236 0.389  1.00 108.89 ? 26  LEU A O     1 
ATOM   197  C  CB    . LEU A 1 26  ? 49.241 177.137 2.861  1.00 109.68 ? 26  LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 26  ? 50.154 176.264 3.726  1.00 109.46 ? 26  LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 26  ? 50.287 176.903 5.093  1.00 109.82 ? 26  LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 26  ? 49.604 174.842 3.826  1.00 109.16 ? 26  LEU A CD2   1 
ATOM   201  N  N     . THR A 1 27  ? 47.296 177.668 0.409  1.00 109.48 ? 27  THR A N     1 
ATOM   202  C  CA    . THR A 1 27  ? 46.329 178.535 -0.265 1.00 109.86 ? 27  THR A CA    1 
ATOM   203  C  C     . THR A 1 27  ? 46.083 179.786 0.569  1.00 111.06 ? 27  THR A C     1 
ATOM   204  O  O     . THR A 1 27  ? 46.243 179.771 1.787  1.00 111.60 ? 27  THR A O     1 
ATOM   205  C  CB    . THR A 1 27  ? 44.967 177.823 -0.508 1.00 108.38 ? 27  THR A CB    1 
ATOM   206  O  OG1   . THR A 1 27  ? 44.219 177.759 0.709  1.00 106.75 ? 27  THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 27  ? 45.193 176.417 -1.011 1.00 107.71 ? 27  THR A CG2   1 
ATOM   208  N  N     . GLU A 1 28  ? 45.705 180.872 -0.090 1.00 112.45 ? 28  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 28  ? 45.420 182.113 0.613  1.00 114.14 ? 28  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 28  ? 44.195 181.908 1.507  1.00 114.11 ? 28  GLU A C     1 
ATOM   211  O  O     . GLU A 1 28  ? 44.004 182.620 2.495  1.00 114.29 ? 28  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 28  ? 45.159 183.243 -0.394 1.00 115.66 ? 28  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 28  ? 45.021 184.636 0.223  1.00 117.13 ? 28  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 28  ? 43.932 185.467 -0.446 1.00 117.98 ? 28  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 28  ? 43.404 185.020 -1.488 1.00 118.21 ? 28  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 28  ? 43.605 186.562 0.071  1.00 118.05 ? 28  GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 29  ? 43.374 180.923 1.158  1.00 113.93 ? 29  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 29  ? 42.128 180.665 1.880  1.00 113.66 ? 29  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 29  ? 42.395 180.010 3.237  1.00 112.05 ? 29  GLU A C     1 
ATOM   220  O  O     . GLU A 1 29  ? 41.614 180.172 4.183  1.00 111.47 ? 29  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 29  ? 41.219 179.767 1.038  1.00 115.52 ? 29  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 29  ? 39.826 179.567 1.606  1.00 117.71 ? 29  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 29  ? 39.078 178.443 0.907  1.00 119.30 ? 29  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 29  ? 39.682 177.786 0.027  1.00 119.39 ? 29  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 29  ? 37.891 178.217 1.236  1.00 119.69 ? 29  GLU A OE2   1 
ATOM   226  N  N     . LYS A 1 30  ? 43.500 179.267 3.313  1.00 109.95 ? 30  LYS A N     1 
ATOM   227  C  CA    . LYS A 1 30  ? 44.037 178.782 4.585  1.00 106.75 ? 30  LYS A CA    1 
ATOM   228  C  C     . LYS A 1 30  ? 44.816 179.911 5.256  1.00 103.65 ? 30  LYS A C     1 
ATOM   229  O  O     . LYS A 1 30  ? 44.615 180.199 6.429  1.00 103.41 ? 30  LYS A O     1 
ATOM   230  C  CB    . LYS A 1 30  ? 44.987 177.605 4.355  1.00 107.37 ? 30  LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 30  ? 44.543 176.607 3.304  1.00 107.75 ? 30  LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 30  ? 45.735 175.807 2.808  1.00 108.71 ? 30  LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 30  ? 45.323 174.449 2.280  1.00 108.75 ? 30  LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 30  ? 46.048 173.335 2.968  1.00 108.46 ? 30  LYS A NZ    1 
ATOM   235  N  N     . ILE A 1 31  ? 45.703 180.544 4.494  1.00 99.96  ? 31  ILE A N     1 
ATOM   236  C  CA    . ILE A 1 31  ? 46.548 181.616 5.001  1.00 96.12  ? 31  ILE A CA    1 
ATOM   237  C  C     . ILE A 1 31  ? 45.761 182.720 5.676  1.00 94.68  ? 31  ILE A C     1 
ATOM   238  O  O     . ILE A 1 31  ? 46.252 183.355 6.599  1.00 94.22  ? 31  ILE A O     1 
ATOM   239  C  CB    . ILE A 1 31  ? 47.372 182.241 3.879  1.00 95.46  ? 31  ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 31  ? 48.370 181.213 3.345  1.00 95.79  ? 31  ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 31  ? 48.073 183.481 4.385  1.00 93.44  ? 31  ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 31  ? 49.082 181.647 2.082  1.00 97.28  ? 31  ILE A CD1   1 
ATOM   243  N  N     . LYS A 1 32  ? 44.542 182.958 5.213  1.00 93.56  ? 32  LYS A N     1 
ATOM   244  C  CA    . LYS A 1 32  ? 43.647 183.861 5.916  1.00 92.77  ? 32  LYS A CA    1 
ATOM   245  C  C     . LYS A 1 32  ? 43.044 183.107 7.086  1.00 91.28  ? 32  LYS A C     1 
ATOM   246  O  O     . LYS A 1 32  ? 42.981 183.623 8.198  1.00 91.13  ? 32  LYS A O     1 
ATOM   247  C  CB    . LYS A 1 32  ? 42.542 184.370 4.977  1.00 94.65  ? 32  LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 32  ? 41.357 185.080 5.664  1.00 96.46  ? 32  LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 32  ? 41.788 186.096 6.733  1.00 98.27  ? 32  LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 32  ? 42.241 187.425 6.130  1.00 98.82  ? 32  LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 32  ? 42.559 188.442 7.174  1.00 97.03  ? 32  LYS A NZ    1 
ATOM   252  N  N     . ALA A 1 33  ? 42.620 181.874 6.834  1.00 89.95  ? 33  ALA A N     1 
ATOM   253  C  CA    . ALA A 1 33  ? 42.008 181.050 7.873  1.00 89.69  ? 33  ALA A CA    1 
ATOM   254  C  C     . ALA A 1 33  ? 42.940 180.839 9.074  1.00 88.58  ? 33  ALA A C     1 
ATOM   255  O  O     . ALA A 1 33  ? 42.491 180.775 10.222 1.00 87.03  ? 33  ALA A O     1 
ATOM   256  C  CB    . ALA A 1 33  ? 41.595 179.705 7.286  1.00 89.79  ? 33  ALA A CB    1 
ATOM   257  N  N     . LEU A 1 34  ? 44.236 180.732 8.796  1.00 88.27  ? 34  LEU A N     1 
ATOM   258  C  CA    . LEU A 1 34  ? 45.238 180.554 9.839  1.00 87.52  ? 34  LEU A CA    1 
ATOM   259  C  C     . LEU A 1 34  ? 45.515 181.875 10.543 1.00 87.18  ? 34  LEU A C     1 
ATOM   260  O  O     . LEU A 1 34  ? 45.761 181.903 11.746 1.00 88.26  ? 34  LEU A O     1 
ATOM   261  C  CB    . LEU A 1 34  ? 46.548 179.989 9.257  1.00 86.80  ? 34  LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 34  ? 46.626 178.496 8.884  1.00 86.99  ? 34  LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 34  ? 47.989 178.178 8.275  1.00 85.54  ? 34  LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 34  ? 46.388 177.633 10.120 1.00 86.68  ? 34  LEU A CD2   1 
ATOM   265  N  N     . VAL A 1 35  ? 45.471 182.975 9.805  1.00 86.41  ? 35  VAL A N     1 
ATOM   266  C  CA    . VAL A 1 35  ? 45.656 184.267 10.444 1.00 86.32  ? 35  VAL A CA    1 
ATOM   267  C  C     . VAL A 1 35  ? 44.511 184.534 11.416 1.00 86.07  ? 35  VAL A C     1 
ATOM   268  O  O     . VAL A 1 35  ? 44.698 185.168 12.451 1.00 85.42  ? 35  VAL A O     1 
ATOM   269  C  CB    . VAL A 1 35  ? 45.728 185.408 9.412  1.00 86.06  ? 35  VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 35  ? 45.826 186.739 10.128 1.00 85.87  ? 35  VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 35  ? 46.939 185.224 8.519  1.00 85.26  ? 35  VAL A CG2   1 
ATOM   272  N  N     . GLU A 1 36  ? 43.328 184.031 11.085 1.00 86.44  ? 36  GLU A N     1 
ATOM   273  C  CA    . GLU A 1 36  ? 42.160 184.214 11.936 1.00 86.97  ? 36  GLU A CA    1 
ATOM   274  C  C     . GLU A 1 36  ? 42.332 183.438 13.233 1.00 85.52  ? 36  GLU A C     1 
ATOM   275  O  O     . GLU A 1 36  ? 42.040 183.937 14.323 1.00 84.44  ? 36  GLU A O     1 
ATOM   276  C  CB    . GLU A 1 36  ? 40.899 183.741 11.205 1.00 89.50  ? 36  GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 36  ? 40.658 184.462 9.882  1.00 94.03  ? 36  GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 36  ? 39.196 184.464 9.458  1.00 96.88  ? 36  GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 36  ? 38.719 183.416 8.960  1.00 98.60  ? 36  GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 36  ? 38.529 185.514 9.622  1.00 97.65  ? 36  GLU A OE2   1 
ATOM   281  N  N     . ILE A 1 37  ? 42.820 182.213 13.097 1.00 84.49  ? 37  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 37  ? 43.073 181.357 14.236 1.00 83.52  ? 37  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 37  ? 44.218 181.940 15.049 1.00 83.26  ? 37  ILE A C     1 
ATOM   284  O  O     . ILE A 1 37  ? 44.084 182.158 16.251 1.00 84.06  ? 37  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 37  ? 43.445 179.952 13.769 1.00 83.65  ? 37  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 37  ? 42.384 179.445 12.798 1.00 84.55  ? 37  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 37  ? 43.509 179.009 14.939 1.00 84.42  ? 37  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 37  ? 42.679 178.083 12.252 1.00 85.20  ? 37  ILE A CD1   1 
ATOM   289  N  N     . CYS A 1 38  ? 45.337 182.215 14.387 1.00 82.36  ? 38  CYS A N     1 
ATOM   290  C  CA    . CYS A 1 38  ? 46.529 182.692 15.080 1.00 81.70  ? 38  CYS A CA    1 
ATOM   291  C  C     . CYS A 1 38  ? 46.395 184.105 15.613 1.00 80.61  ? 38  CYS A C     1 
ATOM   292  O  O     . CYS A 1 38  ? 47.359 184.654 16.133 1.00 81.42  ? 38  CYS A O     1 
ATOM   293  C  CB    . CYS A 1 38  ? 47.749 182.649 14.164 1.00 82.76  ? 38  CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 38  ? 48.306 181.017 13.690 1.00 86.27  ? 38  CYS A SG    1 
ATOM   295  N  N     . THR A 1 39  ? 45.222 184.709 15.474 1.00 78.86  ? 39  THR A N     1 
ATOM   296  C  CA    . THR A 1 39  ? 45.014 186.048 16.021 1.00 77.79  ? 39  THR A CA    1 
ATOM   297  C  C     . THR A 1 39  ? 44.283 185.979 17.369 1.00 76.94  ? 39  THR A C     1 
ATOM   298  O  O     . THR A 1 39  ? 44.644 186.662 18.337 1.00 74.13  ? 39  THR A O     1 
ATOM   299  C  CB    . THR A 1 39  ? 44.210 186.930 15.032 1.00 77.86  ? 39  THR A CB    1 
ATOM   300  O  OG1   . THR A 1 39  ? 44.954 187.087 13.817 1.00 78.40  ? 39  THR A OG1   1 
ATOM   301  C  CG2   . THR A 1 39  ? 43.948 188.305 15.622 1.00 77.67  ? 39  THR A CG2   1 
ATOM   302  N  N     . GLU A 1 40  ? 43.258 185.138 17.428 1.00 76.25  ? 40  GLU A N     1 
ATOM   303  C  CA    . GLU A 1 40  ? 42.501 184.985 18.653 1.00 74.58  ? 40  GLU A CA    1 
ATOM   304  C  C     . GLU A 1 40  ? 43.396 184.277 19.642 1.00 73.51  ? 40  GLU A C     1 
ATOM   305  O  O     . GLU A 1 40  ? 43.405 184.601 20.831 1.00 74.24  ? 40  GLU A O     1 
ATOM   306  C  CB    . GLU A 1 40  ? 41.231 184.172 18.401 1.00 74.54  ? 40  GLU A CB    1 
ATOM   307  C  CG    . GLU A 1 40  ? 40.087 184.545 19.325 1.00 76.44  ? 40  GLU A CG    1 
ATOM   308  C  CD    . GLU A 1 40  ? 40.003 186.050 19.568 1.00 79.30  ? 40  GLU A CD    1 
ATOM   309  O  OE1   . GLU A 1 40  ? 40.226 186.832 18.611 1.00 79.99  ? 40  GLU A OE1   1 
ATOM   310  O  OE2   . GLU A 1 40  ? 39.721 186.455 20.720 1.00 80.11  ? 40  GLU A OE2   1 
ATOM   311  N  N     . MET A 1 41  ? 44.167 183.320 19.135 1.00 71.75  ? 41  MET A N     1 
ATOM   312  C  CA    . MET A 1 41  ? 45.100 182.570 19.962 1.00 70.40  ? 41  MET A CA    1 
ATOM   313  C  C     . MET A 1 41  ? 46.152 183.488 20.559 1.00 69.94  ? 41  MET A C     1 
ATOM   314  O  O     . MET A 1 41  ? 46.596 183.291 21.686 1.00 67.60  ? 41  MET A O     1 
ATOM   315  C  CB    . MET A 1 41  ? 45.789 181.496 19.132 1.00 70.69  ? 41  MET A CB    1 
ATOM   316  C  CG    . MET A 1 41  ? 44.881 180.393 18.654 1.00 70.08  ? 41  MET A CG    1 
ATOM   317  S  SD    . MET A 1 41  ? 45.761 178.824 18.599 1.00 72.38  ? 41  MET A SD    1 
ATOM   318  C  CE    . MET A 1 41  ? 46.078 178.655 16.857 1.00 70.93  ? 41  MET A CE    1 
ATOM   319  N  N     . GLU A 1 42  ? 46.543 184.492 19.783 1.00 70.98  ? 42  GLU A N     1 
ATOM   320  C  CA    . GLU A 1 42  ? 47.479 185.514 20.235 1.00 72.43  ? 42  GLU A CA    1 
ATOM   321  C  C     . GLU A 1 42  ? 46.787 186.428 21.224 1.00 71.51  ? 42  GLU A C     1 
ATOM   322  O  O     . GLU A 1 42  ? 47.389 186.889 22.185 1.00 69.82  ? 42  GLU A O     1 
ATOM   323  C  CB    . GLU A 1 42  ? 47.968 186.323 19.038 1.00 76.32  ? 42  GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 42  ? 47.982 187.813 19.256 1.00 81.56  ? 42  GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 42  ? 49.159 188.254 20.086 1.00 84.54  ? 42  GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 42  ? 50.175 187.524 20.102 1.00 85.14  ? 42  GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 42  ? 49.067 189.330 20.722 1.00 87.58  ? 42  GLU A OE2   1 
ATOM   328  N  N     . LYS A 1 43  ? 45.507 186.678 20.973 1.00 72.85  ? 43  LYS A N     1 
ATOM   329  C  CA    . LYS A 1 43  ? 44.678 187.479 21.866 1.00 72.79  ? 43  LYS A CA    1 
ATOM   330  C  C     . LYS A 1 43  ? 44.597 186.807 23.231 1.00 70.99  ? 43  LYS A C     1 
ATOM   331  O  O     . LYS A 1 43  ? 44.433 187.463 24.256 1.00 69.70  ? 43  LYS A O     1 
ATOM   332  C  CB    . LYS A 1 43  ? 43.268 187.635 21.269 1.00 75.04  ? 43  LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 43  ? 42.833 189.093 20.998 1.00 78.14  ? 43  LYS A CG    1 
ATOM   334  C  CD    . LYS A 1 43  ? 41.604 189.176 20.059 1.00 79.78  ? 43  LYS A CD    1 
ATOM   335  C  CE    . LYS A 1 43  ? 40.959 190.574 20.051 1.00 79.49  ? 43  LYS A CE    1 
ATOM   336  N  NZ    . LYS A 1 43  ? 39.845 190.708 19.058 1.00 78.04  ? 43  LYS A NZ    1 
ATOM   337  N  N     . GLU A 1 44  ? 44.718 185.490 23.242 1.00 69.97  ? 44  GLU A N     1 
ATOM   338  C  CA    . GLU A 1 44  ? 44.518 184.752 24.471 1.00 69.76  ? 44  GLU A CA    1 
ATOM   339  C  C     . GLU A 1 44  ? 45.754 184.025 24.956 1.00 68.74  ? 44  GLU A C     1 
ATOM   340  O  O     . GLU A 1 44  ? 45.661 182.915 25.455 1.00 69.75  ? 44  GLU A O     1 
ATOM   341  C  CB    . GLU A 1 44  ? 43.380 183.759 24.292 1.00 71.22  ? 44  GLU A CB    1 
ATOM   342  C  CG    . GLU A 1 44  ? 42.037 184.414 24.059 1.00 72.74  ? 44  GLU A CG    1 
ATOM   343  C  CD    . GLU A 1 44  ? 41.046 183.467 23.414 1.00 74.55  ? 44  GLU A CD    1 
ATOM   344  O  OE1   . GLU A 1 44  ? 41.228 182.231 23.538 1.00 74.47  ? 44  GLU A OE1   1 
ATOM   345  O  OE2   . GLU A 1 44  ? 40.088 183.958 22.777 1.00 74.95  ? 44  GLU A OE2   1 
ATOM   346  N  N     . GLY A 1 45  ? 46.914 184.647 24.804 1.00 68.31  ? 45  GLY A N     1 
ATOM   347  C  CA    . GLY A 1 45  ? 48.112 184.155 25.464 1.00 67.51  ? 45  GLY A CA    1 
ATOM   348  C  C     . GLY A 1 45  ? 48.542 182.734 25.141 1.00 67.53  ? 45  GLY A C     1 
ATOM   349  O  O     . GLY A 1 45  ? 49.524 182.241 25.691 1.00 67.48  ? 45  GLY A O     1 
ATOM   350  N  N     . LYS A 1 46  ? 47.816 182.069 24.252 1.00 66.59  ? 46  LYS A N     1 
ATOM   351  C  CA    . LYS A 1 46  ? 48.170 180.718 23.856 1.00 65.58  ? 46  LYS A CA    1 
ATOM   352  C  C     . LYS A 1 46  ? 49.402 180.732 22.953 1.00 67.07  ? 46  LYS A C     1 
ATOM   353  O  O     . LYS A 1 46  ? 50.190 179.793 22.967 1.00 67.34  ? 46  LYS A O     1 
ATOM   354  C  CB    . LYS A 1 46  ? 46.999 180.069 23.124 1.00 63.84  ? 46  LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 46  ? 45.632 180.369 23.733 1.00 61.85  ? 46  LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 46  ? 45.412 179.667 25.055 1.00 60.25  ? 46  LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 46  ? 43.963 179.791 25.474 1.00 60.33  ? 46  LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 46  ? 43.630 178.892 26.608 1.00 59.80  ? 46  LYS A NZ    1 
ATOM   359  N  N     . ILE A 1 47  ? 49.563 181.796 22.167 1.00 69.16  ? 47  ILE A N     1 
ATOM   360  C  CA    . ILE A 1 47  ? 50.751 181.970 21.325 1.00 70.53  ? 47  ILE A CA    1 
ATOM   361  C  C     . ILE A 1 47  ? 51.332 183.382 21.392 1.00 72.76  ? 47  ILE A C     1 
ATOM   362  O  O     . ILE A 1 47  ? 50.604 184.367 21.285 1.00 72.88  ? 47  ILE A O     1 
ATOM   363  C  CB    . ILE A 1 47  ? 50.437 181.664 19.861 1.00 69.14  ? 47  ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 47  ? 49.231 182.484 19.418 1.00 67.84  ? 47  ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 47  ? 50.157 180.195 19.688 1.00 69.23  ? 47  ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 47  ? 48.846 182.260 17.975 1.00 69.41  ? 47  ILE A CD1   1 
ATOM   367  N  N     . SER A 1 48  ? 52.650 183.469 21.562 1.00 75.25  ? 48  SER A N     1 
ATOM   368  C  CA    . SER A 1 48  ? 53.357 184.753 21.566 1.00 77.27  ? 48  SER A CA    1 
ATOM   369  C  C     . SER A 1 48  ? 54.081 184.987 20.247 1.00 79.47  ? 48  SER A C     1 
ATOM   370  O  O     . SER A 1 48  ? 54.838 184.131 19.791 1.00 80.66  ? 48  SER A O     1 
ATOM   371  C  CB    . SER A 1 48  ? 54.382 184.808 22.705 1.00 75.93  ? 48  SER A CB    1 
ATOM   372  O  OG    . SER A 1 48  ? 53.782 185.215 23.923 1.00 76.45  ? 48  SER A OG    1 
ATOM   373  N  N     . LYS A 1 49  ? 53.856 186.151 19.644 1.00 81.91  ? 49  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 49  ? 54.592 186.549 18.444 1.00 83.76  ? 49  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 49  ? 56.070 186.772 18.781 1.00 85.51  ? 49  LYS A C     1 
ATOM   376  O  O     . LYS A 1 49  ? 56.403 187.421 19.770 1.00 85.50  ? 49  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 49  ? 53.990 187.832 17.873 1.00 82.92  ? 49  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 49  ? 54.525 188.237 16.520 1.00 81.87  ? 49  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 49  ? 53.806 189.483 16.021 1.00 82.50  ? 49  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 49  ? 52.283 189.295 16.004 1.00 82.28  ? 49  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 49  ? 51.629 189.525 17.331 1.00 80.89  ? 49  LYS A NZ    1 
ATOM   382  N  N     . ILE A 1 50  ? 56.957 186.223 17.964 1.00 87.23  ? 50  ILE A N     1 
ATOM   383  C  CA    . ILE A 1 50  ? 58.380 186.312 18.249 1.00 88.98  ? 50  ILE A CA    1 
ATOM   384  C  C     . ILE A 1 50  ? 59.112 187.074 17.157 1.00 91.42  ? 50  ILE A C     1 
ATOM   385  O  O     . ILE A 1 50  ? 58.617 187.190 16.029 1.00 92.16  ? 50  ILE A O     1 
ATOM   386  C  CB    . ILE A 1 50  ? 59.013 184.912 18.384 1.00 88.30  ? 50  ILE A CB    1 
ATOM   387  C  CG1   . ILE A 1 50  ? 58.520 184.008 17.244 1.00 87.45  ? 50  ILE A CG1   1 
ATOM   388  C  CG2   . ILE A 1 50  ? 58.721 184.350 19.761 1.00 88.65  ? 50  ILE A CG2   1 
ATOM   389  C  CD1   . ILE A 1 50  ? 59.251 182.687 17.120 1.00 85.58  ? 50  ILE A CD1   1 
ATOM   390  N  N     . GLY A 1 51  ? 60.293 187.588 17.502 1.00 92.50  ? 51  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 51  ? 61.120 188.285 16.532 1.00 93.51  ? 51  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 51  ? 62.055 187.382 15.743 1.00 93.90  ? 51  GLY A C     1 
ATOM   393  O  O     . GLY A 1 51  ? 61.897 186.164 15.730 1.00 94.36  ? 51  GLY A O     1 
ATOM   394  N  N     . PRO A 1 52  ? 63.047 187.970 15.060 1.00 94.53  ? 52  PRO A N     1 
ATOM   395  C  CA    . PRO A 1 52  ? 64.001 187.268 14.192 1.00 93.38  ? 52  PRO A CA    1 
ATOM   396  C  C     . PRO A 1 52  ? 65.106 186.535 14.952 1.00 91.26  ? 52  PRO A C     1 
ATOM   397  O  O     . PRO A 1 52  ? 65.969 185.904 14.341 1.00 90.27  ? 52  PRO A O     1 
ATOM   398  C  CB    . PRO A 1 52  ? 64.562 188.380 13.312 1.00 94.86  ? 52  PRO A CB    1 
ATOM   399  C  CG    . PRO A 1 52  ? 64.494 189.600 14.195 1.00 95.29  ? 52  PRO A CG    1 
ATOM   400  C  CD    . PRO A 1 52  ? 63.251 189.432 15.036 1.00 95.19  ? 52  PRO A CD    1 
ATOM   401  N  N     . GLU A 1 53  ? 65.082 186.636 16.279 1.00 88.82  ? 53  GLU A N     1 
ATOM   402  C  CA    . GLU A 1 53  ? 66.083 185.988 17.119 1.00 87.76  ? 53  GLU A CA    1 
ATOM   403  C  C     . GLU A 1 53  ? 65.653 184.587 17.543 1.00 86.41  ? 53  GLU A C     1 
ATOM   404  O  O     . GLU A 1 53  ? 66.266 183.969 18.420 1.00 87.15  ? 53  GLU A O     1 
ATOM   405  C  CB    . GLU A 1 53  ? 66.364 186.829 18.362 1.00 88.76  ? 53  GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 53  ? 65.146 187.094 19.198 1.00 90.27  ? 53  GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 53  ? 64.089 187.837 18.425 1.00 91.78  ? 53  GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 53  ? 64.453 188.757 17.661 1.00 92.02  ? 53  GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 53  ? 62.897 187.501 18.577 1.00 92.69  ? 53  GLU A OE2   1 
ATOM   410  N  N     . ASN A 1 54  ? 64.586 184.094 16.926 1.00 83.38  ? 54  ASN A N     1 
ATOM   411  C  CA    . ASN A 1 54  ? 64.220 182.693 17.054 1.00 79.56  ? 54  ASN A CA    1 
ATOM   412  C  C     . ASN A 1 54  ? 64.647 182.005 15.758 1.00 77.40  ? 54  ASN A C     1 
ATOM   413  O  O     . ASN A 1 54  ? 64.019 182.197 14.710 1.00 77.57  ? 54  ASN A O     1 
ATOM   414  C  CB    . ASN A 1 54  ? 62.708 182.568 17.249 1.00 78.75  ? 54  ASN A CB    1 
ATOM   415  C  CG    . ASN A 1 54  ? 62.314 181.302 17.980 1.00 77.99  ? 54  ASN A CG    1 
ATOM   416  O  OD1   . ASN A 1 54  ? 62.634 180.193 17.556 1.00 76.68  ? 54  ASN A OD1   1 
ATOM   417  N  ND2   . ASN A 1 54  ? 61.608 181.464 19.091 1.00 79.04  ? 54  ASN A ND2   1 
ATOM   418  N  N     . PRO A 1 55  ? 65.734 181.209 15.812 1.00 74.58  ? 55  PRO A N     1 
ATOM   419  C  CA    . PRO A 1 55  ? 66.297 180.522 14.636 1.00 72.66  ? 55  PRO A CA    1 
ATOM   420  C  C     . PRO A 1 55  ? 65.361 179.483 14.030 1.00 71.19  ? 55  PRO A C     1 
ATOM   421  O  O     . PRO A 1 55  ? 65.455 179.155 12.843 1.00 70.63  ? 55  PRO A O     1 
ATOM   422  C  CB    . PRO A 1 55  ? 67.587 179.888 15.164 1.00 72.03  ? 55  PRO A CB    1 
ATOM   423  C  CG    . PRO A 1 55  ? 67.402 179.804 16.641 1.00 72.29  ? 55  PRO A CG    1 
ATOM   424  C  CD    . PRO A 1 55  ? 66.509 180.943 17.038 1.00 72.87  ? 55  PRO A CD    1 
ATOM   425  N  N     . TYR A 1 56  ? 64.447 178.994 14.865 1.00 69.78  ? 56  TYR A N     1 
ATOM   426  C  CA    . TYR A 1 56  ? 63.663 177.803 14.582 1.00 68.26  ? 56  TYR A CA    1 
ATOM   427  C  C     . TYR A 1 56  ? 62.397 178.081 13.779 1.00 68.10  ? 56  TYR A C     1 
ATOM   428  O  O     . TYR A 1 56  ? 61.888 179.204 13.736 1.00 67.26  ? 56  TYR A O     1 
ATOM   429  C  CB    . TYR A 1 56  ? 63.299 177.105 15.896 1.00 66.46  ? 56  TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 56  ? 64.487 176.909 16.798 1.00 64.65  ? 56  TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 56  ? 64.647 177.679 17.946 1.00 63.48  ? 56  TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 56  ? 65.490 176.004 16.468 1.00 64.11  ? 56  TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 56  ? 65.777 177.561 18.737 1.00 62.02  ? 56  TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 56  ? 66.627 175.879 17.253 1.00 63.00  ? 56  TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 56  ? 66.766 176.662 18.383 1.00 62.42  ? 56  TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 56  ? 67.911 176.570 19.139 1.00 61.47  ? 56  TYR A OH    1 
ATOM   437  N  N     . ASN A 1 57  ? 61.904 177.036 13.130 1.00 67.67  ? 57  ASN A N     1 
ATOM   438  C  CA    . ASN A 1 57  ? 60.594 177.073 12.527 1.00 67.54  ? 57  ASN A CA    1 
ATOM   439  C  C     . ASN A 1 57  ? 60.158 175.675 12.145 1.00 68.16  ? 57  ASN A C     1 
ATOM   440  O  O     . ASN A 1 57  ? 60.955 174.871 11.667 1.00 67.47  ? 57  ASN A O     1 
ATOM   441  C  CB    . ASN A 1 57  ? 60.592 177.963 11.291 1.00 66.59  ? 57  ASN A CB    1 
ATOM   442  C  CG    . ASN A 1 57  ? 59.245 177.988 10.610 1.00 66.43  ? 57  ASN A CG    1 
ATOM   443  O  OD1   . ASN A 1 57  ? 58.451 178.906 10.807 1.00 64.94  ? 57  ASN A OD1   1 
ATOM   444  N  ND2   . ASN A 1 57  ? 58.974 176.966 9.809  1.00 66.46  ? 57  ASN A ND2   1 
ATOM   445  N  N     . THR A 1 58  ? 58.883 175.393 12.366 1.00 69.25  ? 58  THR A N     1 
ATOM   446  C  CA    . THR A 1 58  ? 58.288 174.155 11.906 1.00 70.42  ? 58  THR A CA    1 
ATOM   447  C  C     . THR A 1 58  ? 56.983 174.475 11.198 1.00 71.38  ? 58  THR A C     1 
ATOM   448  O  O     . THR A 1 58  ? 56.264 175.397 11.587 1.00 70.75  ? 58  THR A O     1 
ATOM   449  C  CB    . THR A 1 58  ? 58.043 173.198 13.095 1.00 70.67  ? 58  THR A CB    1 
ATOM   450  O  OG1   . THR A 1 58  ? 57.210 172.103 12.688 1.00 69.78  ? 58  THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 58  ? 57.412 173.944 14.239 1.00 70.52  ? 58  THR A CG2   1 
ATOM   452  N  N     . PRO A 1 59  ? 56.676 173.718 10.134 1.00 72.75  ? 59  PRO A N     1 
ATOM   453  C  CA    . PRO A 1 59  ? 55.556 173.883 9.197  1.00 74.31  ? 59  PRO A CA    1 
ATOM   454  C  C     . PRO A 1 59  ? 54.172 173.784 9.831  1.00 76.31  ? 59  PRO A C     1 
ATOM   455  O  O     . PRO A 1 59  ? 53.882 172.857 10.581 1.00 76.78  ? 59  PRO A O     1 
ATOM   456  C  CB    . PRO A 1 59  ? 55.773 172.771 8.178  1.00 72.87  ? 59  PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 59  ? 57.204 172.432 8.287  1.00 72.58  ? 59  PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 59  ? 57.565 172.623 9.720  1.00 72.22  ? 59  PRO A CD    1 
ATOM   459  N  N     . VAL A 1 60  ? 53.315 174.742 9.508  1.00 78.89  ? 60  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 60  ? 51.948 174.736 10.000 1.00 81.96  ? 60  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 60  ? 50.955 174.823 8.849  1.00 83.87  ? 60  VAL A C     1 
ATOM   462  O  O     . VAL A 1 60  ? 50.791 175.880 8.238  1.00 83.82  ? 60  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 60  ? 51.697 175.924 10.942 1.00 82.94  ? 60  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 60  ? 52.079 177.223 10.248 1.00 82.95  ? 60  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 60  ? 50.230 175.963 11.353 1.00 83.30  ? 60  VAL A CG2   1 
ATOM   466  N  N     . PHE A 1 61  ? 50.289 173.711 8.560  1.00 85.62  ? 61  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 61  ? 49.215 173.707 7.581  1.00 87.48  ? 61  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 61  ? 47.879 173.914 8.267  1.00 90.12  ? 61  PHE A C     1 
ATOM   469  O  O     . PHE A 1 61  ? 47.825 174.227 9.454  1.00 90.48  ? 61  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 61  ? 49.200 172.388 6.814  1.00 87.40  ? 61  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 61  ? 48.991 171.175 7.677  1.00 86.79  ? 61  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 61  ? 47.775 170.505 7.671  1.00 87.43  ? 61  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 61  ? 50.020 170.677 8.459  1.00 86.62  ? 61  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 61  ? 47.594 169.352 8.416  1.00 87.63  ? 61  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 61  ? 49.848 169.526 9.207  1.00 87.45  ? 61  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 61  ? 48.632 168.864 9.188  1.00 87.80  ? 61  PHE A CZ    1 
ATOM   477  N  N     . ALA A 1 62  ? 46.800 173.741 7.512  1.00 93.74  ? 62  ALA A N     1 
ATOM   478  C  CA    . ALA A 1 62  ? 45.448 173.849 8.055  1.00 97.28  ? 62  ALA A CA    1 
ATOM   479  C  C     . ALA A 1 62  ? 44.469 173.095 7.171  1.00 99.81  ? 62  ALA A C     1 
ATOM   480  O  O     . ALA A 1 62  ? 44.651 173.023 5.958  1.00 100.27 ? 62  ALA A O     1 
ATOM   481  C  CB    . ALA A 1 62  ? 45.036 175.309 8.154  1.00 97.48  ? 62  ALA A CB    1 
ATOM   482  N  N     . ILE A 1 63  ? 43.433 172.535 7.784  1.00 103.17 ? 63  ILE A N     1 
ATOM   483  C  CA    . ILE A 1 63  ? 42.445 171.752 7.057  1.00 106.43 ? 63  ILE A CA    1 
ATOM   484  C  C     . ILE A 1 63  ? 41.067 171.943 7.663  1.00 110.03 ? 63  ILE A C     1 
ATOM   485  O  O     . ILE A 1 63  ? 40.938 172.088 8.875  1.00 110.41 ? 63  ILE A O     1 
ATOM   486  C  CB    . ILE A 1 63  ? 42.793 170.258 7.092  1.00 104.92 ? 63  ILE A CB    1 
ATOM   487  C  CG1   . ILE A 1 63  ? 42.961 169.798 8.534  1.00 104.09 ? 63  ILE A CG1   1 
ATOM   488  C  CG2   . ILE A 1 63  ? 44.074 170.004 6.332  1.00 105.31 ? 63  ILE A CG2   1 
ATOM   489  C  CD1   . ILE A 1 63  ? 43.719 168.492 8.659  1.00 104.14 ? 63  ILE A CD1   1 
ATOM   490  N  N     . LYS A 1 64  ? 40.039 171.948 6.816  1.00 114.43 ? 64  LYS A N     1 
ATOM   491  C  CA    . LYS A 1 64  ? 38.655 172.026 7.285  1.00 117.89 ? 64  LYS A CA    1 
ATOM   492  C  C     . LYS A 1 64  ? 38.282 170.710 7.963  1.00 119.98 ? 64  LYS A C     1 
ATOM   493  O  O     . LYS A 1 64  ? 38.693 169.636 7.512  1.00 119.98 ? 64  LYS A O     1 
ATOM   494  C  CB    . LYS A 1 64  ? 37.709 172.297 6.110  1.00 117.86 ? 64  LYS A CB    1 
ATOM   495  C  CG    . LYS A 1 64  ? 37.915 173.649 5.439  1.00 118.41 ? 64  LYS A CG    1 
ATOM   496  C  CD    . LYS A 1 64  ? 37.163 173.723 4.121  1.00 119.02 ? 64  LYS A CD    1 
ATOM   497  C  CE    . LYS A 1 64  ? 37.372 175.059 3.433  1.00 119.13 ? 64  LYS A CE    1 
ATOM   498  N  NZ    . LYS A 1 64  ? 36.834 175.052 2.045  1.00 119.07 ? 64  LYS A NZ    1 
ATOM   499  N  N     . LYS A 1 65  ? 37.513 170.793 9.050  1.00 122.59 ? 65  LYS A N     1 
ATOM   500  C  CA    . LYS A 1 65  ? 37.227 169.611 9.860  1.00 124.91 ? 65  LYS A CA    1 
ATOM   501  C  C     . LYS A 1 65  ? 35.746 169.311 10.078 1.00 126.35 ? 65  LYS A C     1 
ATOM   502  O  O     . LYS A 1 65  ? 34.989 170.148 10.577 1.00 127.02 ? 65  LYS A O     1 
ATOM   503  C  CB    . LYS A 1 65  ? 37.920 169.720 11.223 1.00 125.09 ? 65  LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 65  ? 37.944 168.408 11.998 1.00 124.99 ? 65  LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 65  ? 38.210 167.228 11.062 1.00 124.53 ? 65  LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 65  ? 39.533 167.383 10.314 1.00 124.06 ? 65  LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 65  ? 39.574 166.587 9.054  1.00 123.16 ? 65  LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 66  ? 35.355 168.098 9.698  1.00 127.61 ? 66  LYS A N     1 
ATOM   509  C  CA    . LYS A 1 66  ? 34.048 167.542 10.027 1.00 128.87 ? 66  LYS A CA    1 
ATOM   510  C  C     . LYS A 1 66  ? 32.872 168.441 9.657  1.00 130.69 ? 66  LYS A C     1 
ATOM   511  O  O     . LYS A 1 66  ? 32.267 169.086 10.519 1.00 130.97 ? 66  LYS A O     1 
ATOM   512  C  CB    . LYS A 1 66  ? 33.988 167.198 11.518 1.00 127.43 ? 66  LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 66  ? 35.041 166.199 11.958 1.00 124.88 ? 66  LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 66  ? 34.543 165.397 13.136 1.00 123.31 ? 66  LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 66  ? 33.144 164.877 12.866 1.00 122.25 ? 66  LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 66  ? 32.694 163.898 13.885 1.00 120.76 ? 66  LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 67  ? 32.561 168.477 8.365  1.00 132.65 ? 67  ASP A N     1 
ATOM   518  C  CA    . ASP A 1 67  ? 31.281 168.991 7.880  1.00 134.07 ? 67  ASP A CA    1 
ATOM   519  C  C     . ASP A 1 67  ? 30.966 170.437 8.238  1.00 134.01 ? 67  ASP A C     1 
ATOM   520  O  O     . ASP A 1 67  ? 29.868 170.923 7.961  1.00 133.76 ? 67  ASP A O     1 
ATOM   521  C  CB    . ASP A 1 67  ? 30.146 168.094 8.374  1.00 135.58 ? 67  ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 67  ? 30.226 166.694 7.804  1.00 137.15 ? 67  ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 67  ? 31.179 165.958 8.145  1.00 137.67 ? 67  ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 67  ? 29.335 166.331 7.008  1.00 138.27 ? 67  ASP A OD2   1 
ATOM   525  N  N     . SER A 1 68  ? 31.918 171.125 8.853  1.00 133.61 ? 68  SER A N     1 
ATOM   526  C  CA    . SER A 1 68  ? 31.698 172.508 9.227  1.00 133.32 ? 68  SER A CA    1 
ATOM   527  C  C     . SER A 1 68  ? 32.196 173.486 8.168  1.00 133.81 ? 68  SER A C     1 
ATOM   528  O  O     . SER A 1 68  ? 31.710 174.618 8.095  1.00 134.34 ? 68  SER A O     1 
ATOM   529  C  CB    . SER A 1 68  ? 32.370 172.799 10.568 1.00 132.43 ? 68  SER A CB    1 
ATOM   530  O  OG    . SER A 1 68  ? 31.690 172.153 11.628 1.00 131.41 ? 68  SER A OG    1 
ATOM   531  N  N     . THR A 1 69  ? 33.151 173.042 7.349  1.00 133.57 ? 69  THR A N     1 
ATOM   532  C  CA    . THR A 1 69  ? 33.941 173.939 6.496  1.00 133.22 ? 69  THR A CA    1 
ATOM   533  C  C     . THR A 1 69  ? 34.610 175.005 7.379  1.00 132.81 ? 69  THR A C     1 
ATOM   534  O  O     . THR A 1 69  ? 34.931 176.107 6.927  1.00 133.58 ? 69  THR A O     1 
ATOM   535  C  CB    . THR A 1 69  ? 33.051 174.611 5.404  1.00 133.33 ? 69  THR A CB    1 
ATOM   536  O  OG1   . THR A 1 69  ? 32.412 173.596 4.615  1.00 133.26 ? 69  THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 69  ? 33.888 175.472 4.472  1.00 132.87 ? 69  THR A CG2   1 
ATOM   538  N  N     . LYS A 1 70  ? 34.793 174.668 8.656  1.00 131.21 ? 70  LYS A N     1 
ATOM   539  C  CA    . LYS A 1 70  ? 35.630 175.462 9.548  1.00 128.35 ? 70  LYS A CA    1 
ATOM   540  C  C     . LYS A 1 70  ? 37.038 174.899 9.450  1.00 126.73 ? 70  LYS A C     1 
ATOM   541  O  O     . LYS A 1 70  ? 37.247 173.686 9.520  1.00 126.47 ? 70  LYS A O     1 
ATOM   542  C  CB    . LYS A 1 70  ? 35.140 175.372 11.001 1.00 128.15 ? 70  LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 70  ? 35.629 174.148 11.759 1.00 127.83 ? 70  LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 70  ? 35.231 174.192 13.229 1.00 126.96 ? 70  LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 70  ? 33.842 173.603 13.458 1.00 126.27 ? 70  LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 70  ? 33.488 173.534 14.901 1.00 124.69 ? 70  LYS A NZ    1 
ATOM   547  N  N     . TRP A 1 71  ? 38.006 175.780 9.260  1.00 124.58 ? 71  TRP A N     1 
ATOM   548  C  CA    . TRP A 1 71  ? 39.386 175.351 9.235  1.00 122.39 ? 71  TRP A CA    1 
ATOM   549  C  C     . TRP A 1 71  ? 39.815 175.025 10.656 1.00 118.99 ? 71  TRP A C     1 
ATOM   550  O  O     . TRP A 1 71  ? 39.255 175.549 11.617 1.00 118.44 ? 71  TRP A O     1 
ATOM   551  C  CB    . TRP A 1 71  ? 40.255 176.457 8.656  1.00 125.81 ? 71  TRP A CB    1 
ATOM   552  C  CG    . TRP A 1 71  ? 39.842 176.842 7.278  1.00 129.69 ? 71  TRP A CG    1 
ATOM   553  C  CD1   . TRP A 1 71  ? 38.810 177.666 6.929  1.00 130.90 ? 71  TRP A CD1   1 
ATOM   554  C  CD2   . TRP A 1 71  ? 40.459 176.426 6.053  1.00 131.58 ? 71  TRP A CD2   1 
ATOM   555  N  NE1   . TRP A 1 71  ? 38.748 177.790 5.559  1.00 131.95 ? 71  TRP A NE1   1 
ATOM   556  C  CE2   . TRP A 1 71  ? 39.746 177.042 5.002  1.00 132.28 ? 71  TRP A CE2   1 
ATOM   557  C  CE3   . TRP A 1 71  ? 41.541 175.596 5.747  1.00 132.17 ? 71  TRP A CE3   1 
ATOM   558  C  CZ2   . TRP A 1 71  ? 40.090 176.850 3.665  1.00 132.95 ? 71  TRP A CZ2   1 
ATOM   559  C  CZ3   . TRP A 1 71  ? 41.876 175.409 4.419  1.00 132.74 ? 71  TRP A CZ3   1 
ATOM   560  C  CH2   . TRP A 1 71  ? 41.153 176.032 3.394  1.00 133.08 ? 71  TRP A CH2   1 
ATOM   561  N  N     . ARG A 1 72  ? 40.795 174.140 10.788 1.00 115.00 ? 72  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 72  ? 41.370 173.832 12.092 1.00 110.99 ? 72  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 72  ? 42.892 173.811 12.020 1.00 107.49 ? 72  ARG A C     1 
ATOM   564  O  O     . ARG A 1 72  ? 43.480 172.982 11.326 1.00 107.21 ? 72  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 72  ? 40.868 172.477 12.602 1.00 112.08 ? 72  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 72  ? 39.401 172.443 13.011 1.00 112.89 ? 72  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 72  ? 39.163 171.423 14.129 1.00 113.97 ? 72  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 72  ? 39.849 170.145 13.905 1.00 114.15 ? 72  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 72  ? 40.996 169.788 14.484 1.00 114.09 ? 72  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 72  ? 41.606 170.609 15.330 1.00 113.65 ? 72  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 72  ? 41.536 168.605 14.224 1.00 112.92 ? 72  ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 73  ? 43.522 174.725 12.751 1.00 103.45 ? 73  LYS A N     1 
ATOM   573  C  CA    . LYS A 1 73  ? 44.974 174.844 12.752 1.00 98.42  ? 73  LYS A CA    1 
ATOM   574  C  C     . LYS A 1 73  ? 45.625 173.481 12.903 1.00 94.97  ? 73  LYS A C     1 
ATOM   575  O  O     . LYS A 1 73  ? 45.012 172.543 13.405 1.00 94.71  ? 73  LYS A O     1 
ATOM   576  C  CB    . LYS A 1 73  ? 45.429 175.748 13.896 1.00 97.91  ? 73  LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 73  ? 46.931 175.867 14.006 1.00 96.35  ? 73  LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 73  ? 47.362 177.313 14.018 1.00 95.13  ? 73  LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 73  ? 48.843 177.417 14.296 1.00 94.82  ? 73  LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 73  ? 49.252 176.478 15.368 1.00 93.62  ? 73  LYS A NZ    1 
ATOM   581  N  N     . LEU A 1 74  ? 46.868 173.368 12.461 1.00 90.79  ? 74  LEU A N     1 
ATOM   582  C  CA    . LEU A 1 74  ? 47.594 172.137 12.676 1.00 86.86  ? 74  LEU A CA    1 
ATOM   583  C  C     . LEU A 1 74  ? 49.050 172.234 12.261 1.00 83.22  ? 74  LEU A C     1 
ATOM   584  O  O     . LEU A 1 74  ? 49.360 172.485 11.100 1.00 83.07  ? 74  LEU A O     1 
ATOM   585  C  CB    . LEU A 1 74  ? 46.912 170.997 11.928 1.00 87.87  ? 74  LEU A CB    1 
ATOM   586  C  CG    . LEU A 1 74  ? 47.486 169.626 12.275 1.00 89.30  ? 74  LEU A CG    1 
ATOM   587  C  CD1   . LEU A 1 74  ? 47.675 169.516 13.780 1.00 89.93  ? 74  LEU A CD1   1 
ATOM   588  C  CD2   . LEU A 1 74  ? 46.557 168.543 11.767 1.00 90.59  ? 74  LEU A CD2   1 
ATOM   589  N  N     . VAL A 1 75  ? 49.940 172.029 13.225 1.00 78.26  ? 75  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 75  ? 51.364 172.072 12.964 1.00 72.49  ? 75  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 75  ? 51.917 170.671 12.775 1.00 69.33  ? 75  VAL A C     1 
ATOM   592  O  O     . VAL A 1 75  ? 51.425 169.712 13.355 1.00 67.56  ? 75  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 75  ? 52.109 172.749 14.112 1.00 71.91  ? 75  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 75  ? 53.586 172.862 13.776 1.00 71.46  ? 75  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 75  ? 51.509 174.111 14.375 1.00 71.04  ? 75  VAL A CG2   1 
ATOM   596  N  N     . ASP A 1 76  ? 52.939 170.567 11.938 1.00 66.84  ? 76  ASP A N     1 
ATOM   597  C  CA    . ASP A 1 76  ? 53.600 169.305 11.676 1.00 64.28  ? 76  ASP A CA    1 
ATOM   598  C  C     . ASP A 1 76  ? 54.912 169.314 12.456 1.00 63.38  ? 76  ASP A C     1 
ATOM   599  O  O     . ASP A 1 76  ? 55.943 169.760 11.956 1.00 64.21  ? 76  ASP A O     1 
ATOM   600  C  CB    . ASP A 1 76  ? 53.862 169.174 10.174 1.00 62.93  ? 76  ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 76  ? 54.575 167.883 9.808  1.00 64.38  ? 76  ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 76  ? 54.955 167.130 10.730 1.00 65.48  ? 76  ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 76  ? 54.757 167.618 8.598  1.00 62.32  ? 76  ASP A OD2   1 
ATOM   604  N  N     . PHE A 1 77  ? 54.864 168.830 13.692 1.00 60.98  ? 77  PHE A N     1 
ATOM   605  C  CA    . PHE A 1 77  ? 56.034 168.842 14.562 1.00 57.78  ? 77  PHE A CA    1 
ATOM   606  C  C     . PHE A 1 77  ? 56.904 167.607 14.388 1.00 58.25  ? 77  PHE A C     1 
ATOM   607  O  O     . PHE A 1 77  ? 57.695 167.273 15.265 1.00 57.39  ? 77  PHE A O     1 
ATOM   608  C  CB    . PHE A 1 77  ? 55.599 168.926 16.013 1.00 54.16  ? 77  PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 77  ? 55.169 170.284 16.433 1.00 51.13  ? 77  PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 77  ? 56.094 171.213 16.844 1.00 51.28  ? 77  PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 77  ? 53.845 170.624 16.457 1.00 50.50  ? 77  PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 77  ? 55.701 172.456 17.269 1.00 50.87  ? 77  PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 77  ? 53.449 171.869 16.884 1.00 51.09  ? 77  PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 77  ? 54.376 172.781 17.290 1.00 50.02  ? 77  PHE A CZ    1 
ATOM   615  N  N     . ARG A 1 78  ? 56.763 166.921 13.263 1.00 58.54  ? 78  ARG A N     1 
ATOM   616  C  CA    . ARG A 1 78  ? 57.413 165.634 13.119 1.00 59.84  ? 78  ARG A CA    1 
ATOM   617  C  C     . ARG A 1 78  ? 58.899 165.726 13.450 1.00 59.94  ? 78  ARG A C     1 
ATOM   618  O  O     . ARG A 1 78  ? 59.489 164.763 13.928 1.00 60.15  ? 78  ARG A O     1 
ATOM   619  C  CB    . ARG A 1 78  ? 57.222 165.099 11.701 1.00 61.51  ? 78  ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 78  ? 56.812 163.625 11.641 1.00 63.97  ? 78  ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 78  ? 56.717 163.116 10.193 1.00 67.46  ? 78  ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 78  ? 55.795 163.914 9.381  1.00 69.92  ? 78  ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 78  ? 56.147 164.645 8.325  1.00 69.62  ? 78  ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 78  ? 57.415 164.688 7.925  1.00 68.20  ? 78  ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 78  ? 55.224 165.350 7.681  1.00 69.36  ? 78  ARG A NH2   1 
ATOM   626  N  N     . GLU A 1 79  ? 59.499 166.887 13.208 1.00 60.63  ? 79  GLU A N     1 
ATOM   627  C  CA    . GLU A 1 79  ? 60.922 167.090 13.476 1.00 60.14  ? 79  GLU A CA    1 
ATOM   628  C  C     . GLU A 1 79  ? 61.215 167.419 14.929 1.00 58.69  ? 79  GLU A C     1 
ATOM   629  O  O     . GLU A 1 79  ? 62.167 166.909 15.515 1.00 57.77  ? 79  GLU A O     1 
ATOM   630  C  CB    . GLU A 1 79  ? 61.465 168.209 12.600 1.00 62.69  ? 79  GLU A CB    1 
ATOM   631  C  CG    . GLU A 1 79  ? 62.414 167.722 11.534 1.00 66.47  ? 79  GLU A CG    1 
ATOM   632  C  CD    . GLU A 1 79  ? 63.612 167.014 12.120 1.00 68.63  ? 79  GLU A CD    1 
ATOM   633  O  OE1   . GLU A 1 79  ? 64.234 167.590 13.043 1.00 68.23  ? 79  GLU A OE1   1 
ATOM   634  O  OE2   . GLU A 1 79  ? 63.925 165.888 11.660 1.00 69.30  ? 79  GLU A OE2   1 
ATOM   635  N  N     . LEU A 1 80  ? 60.399 168.284 15.508 1.00 57.49  ? 80  LEU A N     1 
ATOM   636  C  CA    . LEU A 1 80  ? 60.554 168.608 16.909 1.00 56.95  ? 80  LEU A CA    1 
ATOM   637  C  C     . LEU A 1 80  ? 60.392 167.334 17.719 1.00 58.13  ? 80  LEU A C     1 
ATOM   638  O  O     . LEU A 1 80  ? 61.112 167.118 18.691 1.00 60.43  ? 80  LEU A O     1 
ATOM   639  C  CB    . LEU A 1 80  ? 59.502 169.626 17.336 1.00 56.14  ? 80  LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 80  ? 59.920 170.635 18.407 1.00 55.87  ? 80  LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 80  ? 58.808 171.653 18.606 1.00 55.38  ? 80  LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 80  ? 60.243 169.921 19.703 1.00 54.82  ? 80  LEU A CD2   1 
ATOM   643  N  N     . ASN A 1 81  ? 59.447 166.484 17.324 1.00 57.65  ? 81  ASN A N     1 
ATOM   644  C  CA    . ASN A 1 81  ? 59.204 165.255 18.064 1.00 55.66  ? 81  ASN A CA    1 
ATOM   645  C  C     . ASN A 1 81  ? 60.443 164.380 18.003 1.00 57.34  ? 81  ASN A C     1 
ATOM   646  O  O     . ASN A 1 81  ? 60.811 163.750 18.992 1.00 60.14  ? 81  ASN A O     1 
ATOM   647  C  CB    . ASN A 1 81  ? 58.011 164.516 17.483 1.00 51.54  ? 81  ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 81  ? 56.736 165.309 17.596 1.00 51.04  ? 81  ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 81  ? 56.594 166.144 18.488 1.00 49.83  ? 81  ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 81  ? 55.794 165.057 16.691 1.00 49.79  ? 81  ASN A ND2   1 
ATOM   651  N  N     . LYS A 1 82  ? 61.098 164.359 16.848 1.00 57.71  ? 82  LYS A N     1 
ATOM   652  C  CA    . LYS A 1 82  ? 62.332 163.606 16.686 1.00 57.59  ? 82  LYS A CA    1 
ATOM   653  C  C     . LYS A 1 82  ? 63.393 164.095 17.653 1.00 58.11  ? 82  LYS A C     1 
ATOM   654  O  O     . LYS A 1 82  ? 64.164 163.303 18.187 1.00 58.55  ? 82  LYS A O     1 
ATOM   655  C  CB    . LYS A 1 82  ? 62.857 163.741 15.259 1.00 58.51  ? 82  LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 82  ? 62.151 162.868 14.235 1.00 60.91  ? 82  LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 82  ? 63.112 161.857 13.598 1.00 61.88  ? 82  LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 82  ? 62.495 161.139 12.391 1.00 61.67  ? 82  LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 82  ? 62.353 162.041 11.197 1.00 60.34  ? 82  LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 83  ? 63.430 165.402 17.878 1.00 58.67  ? 83  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 83  ? 64.472 166.006 18.697 1.00 60.09  ? 83  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 83  ? 64.072 166.175 20.161 1.00 59.50  ? 83  ARG A C     1 
ATOM   663  O  O     . ARG A 1 83  ? 64.920 166.370 21.022 1.00 60.13  ? 83  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 83  ? 64.844 167.356 18.110 1.00 63.36  ? 83  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 83  ? 65.113 167.292 16.630 1.00 68.73  ? 83  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 83  ? 65.386 168.671 16.055 1.00 73.06  ? 83  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 83  ? 66.353 168.596 14.964 1.00 77.52  ? 83  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 83  ? 67.670 168.522 15.140 1.00 79.44  ? 83  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 83  ? 68.188 168.519 16.365 1.00 79.87  ? 83  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 83  ? 68.471 168.430 14.087 1.00 81.78  ? 83  ARG A NH2   1 
ATOM   671  N  N     . THR A 1 84  ? 62.775 166.107 20.434 1.00 58.51  ? 84  THR A N     1 
ATOM   672  C  CA    . THR A 1 84  ? 62.272 166.094 21.797 1.00 57.09  ? 84  THR A CA    1 
ATOM   673  C  C     . THR A 1 84  ? 62.747 164.861 22.568 1.00 56.05  ? 84  THR A C     1 
ATOM   674  O  O     . THR A 1 84  ? 63.044 163.822 21.984 1.00 54.31  ? 84  THR A O     1 
ATOM   675  C  CB    . THR A 1 84  ? 60.736 166.120 21.802 1.00 58.69  ? 84  THR A CB    1 
ATOM   676  O  OG1   . THR A 1 84  ? 60.291 167.397 21.337 1.00 57.90  ? 84  THR A OG1   1 
ATOM   677  C  CG2   . THR A 1 84  ? 60.181 165.858 23.214 1.00 58.72  ? 84  THR A CG2   1 
ATOM   678  N  N     . GLN A 1 85  ? 62.816 164.999 23.888 1.00 54.89  ? 85  GLN A N     1 
ATOM   679  C  CA    . GLN A 1 85  ? 63.205 163.913 24.766 1.00 52.84  ? 85  GLN A CA    1 
ATOM   680  C  C     . GLN A 1 85  ? 62.222 162.792 24.590 1.00 52.71  ? 85  GLN A C     1 
ATOM   681  O  O     . GLN A 1 85  ? 61.155 162.985 24.018 1.00 52.24  ? 85  GLN A O     1 
ATOM   682  C  CB    . GLN A 1 85  ? 63.171 164.363 26.222 1.00 52.88  ? 85  GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 85  ? 61.774 164.483 26.811 1.00 52.99  ? 85  GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 85  ? 61.788 164.899 28.274 1.00 53.90  ? 85  GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 85  ? 62.452 165.864 28.653 1.00 54.13  ? 85  GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 85  ? 61.048 164.168 29.105 1.00 53.78  ? 85  GLN A NE2   1 
ATOM   687  N  N     . ASP A 1 86  ? 62.589 161.618 25.084 1.00 52.82  ? 86  ASP A N     1 
ATOM   688  C  CA    . ASP A 1 86  ? 61.632 160.542 25.249 1.00 53.35  ? 86  ASP A CA    1 
ATOM   689  C  C     . ASP A 1 86  ? 60.710 160.872 26.412 1.00 51.46  ? 86  ASP A C     1 
ATOM   690  O  O     . ASP A 1 86  ? 61.048 161.676 27.276 1.00 50.27  ? 86  ASP A O     1 
ATOM   691  C  CB    . ASP A 1 86  ? 62.359 159.227 25.528 1.00 57.48  ? 86  ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 86  ? 63.191 158.763 24.351 1.00 61.68  ? 86  ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 86  ? 64.397 158.489 24.546 1.00 63.58  ? 86  ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 86  ? 62.637 158.673 23.233 1.00 63.14  ? 86  ASP A OD2   1 
ATOM   695  N  N     . PHE A 1 87  ? 59.537 160.255 26.421 1.00 49.08  ? 87  PHE A N     1 
ATOM   696  C  CA    . PHE A 1 87  ? 58.639 160.366 27.554 1.00 47.43  ? 87  PHE A CA    1 
ATOM   697  C  C     . PHE A 1 87  ? 58.255 158.969 27.966 1.00 46.49  ? 87  PHE A C     1 
ATOM   698  O  O     . PHE A 1 87  ? 58.417 158.028 27.198 1.00 46.14  ? 87  PHE A O     1 
ATOM   699  C  CB    . PHE A 1 87  ? 57.384 161.155 27.174 1.00 49.55  ? 87  PHE A CB    1 
ATOM   700  C  CG    . PHE A 1 87  ? 57.632 162.622 26.965 1.00 51.65  ? 87  PHE A CG    1 
ATOM   701  C  CD1   . PHE A 1 87  ? 57.663 163.160 25.690 1.00 52.64  ? 87  PHE A CD1   1 
ATOM   702  C  CD2   . PHE A 1 87  ? 57.869 163.458 28.043 1.00 53.37  ? 87  PHE A CD2   1 
ATOM   703  C  CE1   . PHE A 1 87  ? 57.937 164.510 25.492 1.00 53.78  ? 87  PHE A CE1   1 
ATOM   704  C  CE2   . PHE A 1 87  ? 58.141 164.809 27.852 1.00 54.13  ? 87  PHE A CE2   1 
ATOM   705  C  CZ    . PHE A 1 87  ? 58.175 165.332 26.574 1.00 53.78  ? 87  PHE A CZ    1 
ATOM   706  N  N     . TRP A 1 88  ? 57.758 158.817 29.186 1.00 45.40  ? 88  TRP A N     1 
ATOM   707  C  CA    . TRP A 1 88  ? 57.048 157.597 29.505 1.00 44.30  ? 88  TRP A CA    1 
ATOM   708  C  C     . TRP A 1 88  ? 55.563 157.853 29.433 1.00 43.48  ? 88  TRP A C     1 
ATOM   709  O  O     . TRP A 1 88  ? 55.018 158.578 30.246 1.00 42.86  ? 88  TRP A O     1 
ATOM   710  C  CB    . TRP A 1 88  ? 57.410 157.089 30.891 1.00 44.61  ? 88  TRP A CB    1 
ATOM   711  C  CG    . TRP A 1 88  ? 56.872 155.726 31.119 1.00 46.62  ? 88  TRP A CG    1 
ATOM   712  C  CD1   . TRP A 1 88  ? 55.815 155.385 31.905 1.00 48.87  ? 88  TRP A CD1   1 
ATOM   713  C  CD2   . TRP A 1 88  ? 57.321 154.514 30.502 1.00 47.12  ? 88  TRP A CD2   1 
ATOM   714  N  NE1   . TRP A 1 88  ? 55.571 154.037 31.814 1.00 48.50  ? 88  TRP A NE1   1 
ATOM   715  C  CE2   . TRP A 1 88  ? 56.483 153.481 30.958 1.00 48.45  ? 88  TRP A CE2   1 
ATOM   716  C  CE3   . TRP A 1 88  ? 58.345 154.204 29.606 1.00 48.30  ? 88  TRP A CE3   1 
ATOM   717  C  CZ2   . TRP A 1 88  ? 56.641 152.159 30.547 1.00 50.14  ? 88  TRP A CZ2   1 
ATOM   718  C  CZ3   . TRP A 1 88  ? 58.498 152.892 29.196 1.00 48.15  ? 88  TRP A CZ3   1 
ATOM   719  C  CH2   . TRP A 1 88  ? 57.651 151.887 29.667 1.00 50.00  ? 88  TRP A CH2   1 
ATOM   720  N  N     . GLU A 1 89  ? 54.917 157.256 28.441 1.00 43.83  ? 89  GLU A N     1 
ATOM   721  C  CA    . GLU A 1 89  ? 53.486 157.437 28.230 1.00 44.72  ? 89  GLU A CA    1 
ATOM   722  C  C     . GLU A 1 89  ? 52.699 156.912 29.423 1.00 43.97  ? 89  GLU A C     1 
ATOM   723  O  O     . GLU A 1 89  ? 52.927 155.798 29.843 1.00 45.37  ? 89  GLU A O     1 
ATOM   724  C  CB    . GLU A 1 89  ? 53.063 156.689 26.962 1.00 44.90  ? 89  GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 89  ? 53.618 157.275 25.685 1.00 44.21  ? 89  GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 89  ? 53.218 158.714 25.512 1.00 46.35  ? 89  GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 89  ? 52.184 159.106 26.103 1.00 46.93  ? 89  GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 89  ? 53.932 159.451 24.797 1.00 46.23  ? 89  GLU A OE2   1 
ATOM   729  N  N     . VAL A 1 90  ? 51.768 157.697 29.958 1.00 44.80  ? 90  VAL A N     1 
ATOM   730  C  CA    . VAL A 1 90  ? 50.985 157.256 31.121 1.00 44.32  ? 90  VAL A CA    1 
ATOM   731  C  C     . VAL A 1 90  ? 49.619 156.650 30.805 1.00 44.53  ? 90  VAL A C     1 
ATOM   732  O  O     . VAL A 1 90  ? 49.004 156.057 31.680 1.00 45.90  ? 90  VAL A O     1 
ATOM   733  C  CB    . VAL A 1 90  ? 50.716 158.398 32.144 1.00 43.98  ? 90  VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 90  ? 52.010 158.966 32.651 1.00 42.60  ? 90  VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 90  ? 49.847 159.470 31.518 1.00 42.98  ? 90  VAL A CG2   1 
ATOM   736  N  N     . GLN A 1 91  ? 49.125 156.809 29.581 1.00 43.80  ? 91  GLN A N     1 
ATOM   737  C  CA    . GLN A 1 91  ? 47.846 156.204 29.215 1.00 41.11  ? 91  GLN A CA    1 
ATOM   738  C  C     . GLN A 1 91  ? 48.090 154.751 28.859 1.00 39.95  ? 91  GLN A C     1 
ATOM   739  O  O     . GLN A 1 91  ? 48.687 154.460 27.845 1.00 40.36  ? 91  GLN A O     1 
ATOM   740  C  CB    . GLN A 1 91  ? 47.240 156.927 28.018 1.00 42.70  ? 91  GLN A CB    1 
ATOM   741  C  CG    . GLN A 1 91  ? 45.840 156.479 27.668 1.00 42.43  ? 91  GLN A CG    1 
ATOM   742  C  CD    . GLN A 1 91  ? 44.863 156.816 28.748 1.00 43.26  ? 91  GLN A CD    1 
ATOM   743  O  OE1   . GLN A 1 91  ? 44.744 157.969 29.140 1.00 47.35  ? 91  GLN A OE1   1 
ATOM   744  N  NE2   . GLN A 1 91  ? 44.154 155.815 29.244 1.00 44.93  ? 91  GLN A NE2   1 
ATOM   745  N  N     . LEU A 1 92  ? 47.629 153.837 29.700 1.00 39.52  ? 92  LEU A N     1 
ATOM   746  C  CA    . LEU A 1 92  ? 48.075 152.450 29.628 1.00 38.38  ? 92  LEU A CA    1 
ATOM   747  C  C     . LEU A 1 92  ? 47.092 151.598 28.852 1.00 38.76  ? 92  LEU A C     1 
ATOM   748  O  O     . LEU A 1 92  ? 47.424 150.500 28.417 1.00 41.57  ? 92  LEU A O     1 
ATOM   749  C  CB    . LEU A 1 92  ? 48.250 151.861 31.039 1.00 36.00  ? 92  LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 92  ? 49.428 152.181 31.984 1.00 35.25  ? 92  LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 92  ? 50.385 153.222 31.414 1.00 33.61  ? 92  LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 92  ? 48.848 152.657 33.291 1.00 35.25  ? 92  LEU A CD2   1 
ATOM   753  N  N     . GLY A 1 93  ? 45.881 152.108 28.683 1.00 37.46  ? 93  GLY A N     1 
ATOM   754  C  CA    . GLY A 1 93  ? 44.813 151.300 28.138 1.00 34.11  ? 93  GLY A CA    1 
ATOM   755  C  C     . GLY A 1 93  ? 43.564 152.127 27.999 1.00 32.04  ? 93  GLY A C     1 
ATOM   756  O  O     . GLY A 1 93  ? 43.570 153.308 28.312 1.00 30.78  ? 93  GLY A O     1 
ATOM   757  N  N     . ILE A 1 94  ? 42.489 151.507 27.532 1.00 33.35  ? 94  ILE A N     1 
ATOM   758  C  CA    . ILE A 1 94  ? 41.227 152.224 27.318 1.00 35.22  ? 94  ILE A CA    1 
ATOM   759  C  C     . ILE A 1 94  ? 40.097 151.713 28.209 1.00 33.99  ? 94  ILE A C     1 
ATOM   760  O  O     . ILE A 1 94  ? 39.821 150.516 28.262 1.00 36.40  ? 94  ILE A O     1 
ATOM   761  C  CB    . ILE A 1 94  ? 40.776 152.117 25.856 1.00 33.24  ? 94  ILE A CB    1 
ATOM   762  C  CG1   . ILE A 1 94  ? 41.851 152.678 24.953 1.00 37.39  ? 94  ILE A CG1   1 
ATOM   763  C  CG2   . ILE A 1 94  ? 39.536 152.896 25.630 1.00 34.79  ? 94  ILE A CG2   1 
ATOM   764  C  CD1   . ILE A 1 94  ? 42.939 151.699 24.678 1.00 40.57  ? 94  ILE A CD1   1 
ATOM   765  N  N     . PRO A 1 95  ? 39.422 152.620 28.913 1.00 32.53  ? 95  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 95  ? 38.326 152.202 29.785 1.00 34.96  ? 95  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 95  ? 37.293 151.416 29.009 1.00 34.34  ? 95  PRO A C     1 
ATOM   768  O  O     . PRO A 1 95  ? 36.915 151.818 27.921 1.00 32.79  ? 95  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 95  ? 37.764 153.520 30.313 1.00 36.15  ? 95  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 95  ? 38.180 154.541 29.311 1.00 34.83  ? 95  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 95  ? 39.514 154.079 28.801 1.00 35.13  ? 95  PRO A CD    1 
ATOM   772  N  N     . HIS A 1 96  ? 36.844 150.288 29.555 1.00 35.05  ? 96  HIS A N     1 
ATOM   773  C  CA    . HIS A 1 96  ? 35.776 149.543 28.902 1.00 36.60  ? 96  HIS A CA    1 
ATOM   774  C  C     . HIS A 1 96  ? 34.478 149.595 29.684 1.00 34.63  ? 96  HIS A C     1 
ATOM   775  O  O     . HIS A 1 96  ? 34.473 149.502 30.898 1.00 34.09  ? 96  HIS A O     1 
ATOM   776  C  CB    . HIS A 1 96  ? 36.181 148.092 28.679 1.00 39.29  ? 96  HIS A CB    1 
ATOM   777  C  CG    . HIS A 1 96  ? 35.420 147.426 27.575 1.00 44.91  ? 96  HIS A CG    1 
ATOM   778  N  ND1   . HIS A 1 96  ? 34.117 147.000 27.723 1.00 47.65  ? 96  HIS A ND1   1 
ATOM   779  C  CD2   . HIS A 1 96  ? 35.762 147.157 26.293 1.00 46.69  ? 96  HIS A CD2   1 
ATOM   780  C  CE1   . HIS A 1 96  ? 33.687 146.499 26.578 1.00 48.42  ? 96  HIS A CE1   1 
ATOM   781  N  NE2   . HIS A 1 96  ? 34.665 146.584 25.693 1.00 48.79  ? 96  HIS A NE2   1 
ATOM   782  N  N     . PRO A 1 97  ? 33.356 149.751 28.982 1.00 34.81  ? 97  PRO A N     1 
ATOM   783  C  CA    . PRO A 1 97  ? 32.035 149.895 29.591 1.00 36.51  ? 97  PRO A CA    1 
ATOM   784  C  C     . PRO A 1 97  ? 31.669 148.836 30.610 1.00 35.83  ? 97  PRO A C     1 
ATOM   785  O  O     . PRO A 1 97  ? 30.880 149.087 31.514 1.00 35.44  ? 97  PRO A O     1 
ATOM   786  C  CB    . PRO A 1 97  ? 31.076 149.896 28.391 1.00 37.46  ? 97  PRO A CB    1 
ATOM   787  C  CG    . PRO A 1 97  ? 31.930 149.633 27.170 1.00 38.03  ? 97  PRO A CG    1 
ATOM   788  C  CD    . PRO A 1 97  ? 33.313 150.068 27.549 1.00 37.00  ? 97  PRO A CD    1 
ATOM   789  N  N     . ALA A 1 98  ? 32.256 147.659 30.476 1.00 35.98  ? 98  ALA A N     1 
ATOM   790  C  CA    . ALA A 1 98  ? 31.856 146.540 31.297 1.00 37.52  ? 98  ALA A CA    1 
ATOM   791  C  C     . ALA A 1 98  ? 32.580 146.515 32.632 1.00 40.36  ? 98  ALA A C     1 
ATOM   792  O  O     . ALA A 1 98  ? 32.249 145.719 33.513 1.00 42.58  ? 98  ALA A O     1 
ATOM   793  C  CB    . ALA A 1 98  ? 32.092 145.255 30.554 1.00 35.85  ? 98  ALA A CB    1 
ATOM   794  N  N     . GLY A 1 99  ? 33.578 147.370 32.789 1.00 40.95  ? 99  GLY A N     1 
ATOM   795  C  CA    . GLY A 1 99  ? 34.245 147.440 34.073 1.00 45.29  ? 99  GLY A CA    1 
ATOM   796  C  C     . GLY A 1 99  ? 33.555 148.505 34.888 1.00 46.93  ? 99  GLY A C     1 
ATOM   797  O  O     . GLY A 1 99  ? 33.827 148.712 36.074 1.00 46.15  ? 99  GLY A O     1 
ATOM   798  N  N     . LEU A 1 100 ? 32.651 149.195 34.201 1.00 49.68  ? 100 LEU A N     1 
ATOM   799  C  CA    . LEU A 1 100 ? 31.773 150.181 34.812 1.00 49.49  ? 100 LEU A CA    1 
ATOM   800  C  C     . LEU A 1 100 ? 30.791 149.439 35.693 1.00 49.61  ? 100 LEU A C     1 
ATOM   801  O  O     . LEU A 1 100 ? 30.166 148.477 35.255 1.00 49.02  ? 100 LEU A O     1 
ATOM   802  C  CB    . LEU A 1 100 ? 31.021 150.946 33.725 1.00 45.99  ? 100 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 100 ? 31.504 152.359 33.394 1.00 44.84  ? 100 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 100 ? 33.010 152.495 33.574 1.00 39.87  ? 100 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 100 ? 31.068 152.675 31.977 1.00 42.13  ? 100 LEU A CD2   1 
ATOM   806  N  N     . LYS A 1 101 ? 30.680 149.875 36.941 1.00 51.14  ? 101 LYS A N     1 
ATOM   807  C  CA    . LYS A 1 101 ? 29.666 149.351 37.833 1.00 52.20  ? 101 LYS A CA    1 
ATOM   808  C  C     . LYS A 1 101 ? 28.421 150.205 37.660 1.00 52.55  ? 101 LYS A C     1 
ATOM   809  O  O     . LYS A 1 101 ? 28.515 151.391 37.364 1.00 53.78  ? 101 LYS A O     1 
ATOM   810  C  CB    . LYS A 1 101 ? 30.155 149.427 39.271 1.00 53.29  ? 101 LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 101 ? 31.642 149.147 39.426 1.00 56.15  ? 101 LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 101 ? 31.981 148.850 40.882 1.00 58.34  ? 101 LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 101 ? 33.400 149.258 41.244 1.00 59.11  ? 101 LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 101 ? 33.567 149.417 42.728 1.00 61.37  ? 101 LYS A NZ    1 
ATOM   815  N  N     . LYS A 1 102 ? 27.255 149.600 37.825 1.00 52.68  ? 102 LYS A N     1 
ATOM   816  C  CA    . LYS A 1 102 ? 26.003 150.344 37.793 1.00 52.47  ? 102 LYS A CA    1 
ATOM   817  C  C     . LYS A 1 102 ? 25.986 151.362 38.938 1.00 51.32  ? 102 LYS A C     1 
ATOM   818  O  O     . LYS A 1 102 ? 26.011 150.979 40.105 1.00 52.28  ? 102 LYS A O     1 
ATOM   819  C  CB    . LYS A 1 102 ? 24.831 149.370 37.941 1.00 52.71  ? 102 LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 102 ? 23.461 149.969 37.703 1.00 56.37  ? 102 LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 102 ? 22.494 148.871 37.302 1.00 60.54  ? 102 LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 102 ? 23.077 148.054 36.136 1.00 64.12  ? 102 LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 102 ? 22.654 146.612 36.064 1.00 64.42  ? 102 LYS A NZ    1 
ATOM   824  N  N     . LYS A 1 103 ? 25.958 152.653 38.605 1.00 49.82  ? 103 LYS A N     1 
ATOM   825  C  CA    . LYS A 1 103 ? 25.818 153.718 39.608 1.00 48.03  ? 103 LYS A CA    1 
ATOM   826  C  C     . LYS A 1 103 ? 24.394 154.246 39.521 1.00 47.68  ? 103 LYS A C     1 
ATOM   827  O  O     . LYS A 1 103 ? 23.703 153.989 38.541 1.00 48.81  ? 103 LYS A O     1 
ATOM   828  C  CB    . LYS A 1 103 ? 26.799 154.865 39.341 1.00 46.42  ? 103 LYS A CB    1 
ATOM   829  C  CG    . LYS A 1 103 ? 28.254 154.453 39.250 1.00 44.20  ? 103 LYS A CG    1 
ATOM   830  C  CD    . LYS A 1 103 ? 28.639 153.560 40.403 1.00 45.80  ? 103 LYS A CD    1 
ATOM   831  C  CE    . LYS A 1 103 ? 29.024 154.334 41.655 1.00 46.51  ? 103 LYS A CE    1 
ATOM   832  N  NZ    . LYS A 1 103 ? 29.256 153.379 42.797 1.00 48.58  ? 103 LYS A NZ    1 
ATOM   833  N  N     . LYS A 1 104 ? 23.942 154.977 40.527 1.00 46.17  ? 104 LYS A N     1 
ATOM   834  C  CA    . LYS A 1 104 ? 22.565 155.426 40.497 1.00 46.04  ? 104 LYS A CA    1 
ATOM   835  C  C     . LYS A 1 104 ? 22.428 156.649 39.618 1.00 47.63  ? 104 LYS A C     1 
ATOM   836  O  O     . LYS A 1 104 ? 21.395 156.842 38.971 1.00 48.80  ? 104 LYS A O     1 
ATOM   837  C  CB    . LYS A 1 104 ? 22.064 155.763 41.891 1.00 47.02  ? 104 LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 104 ? 20.611 156.171 41.887 1.00 46.99  ? 104 LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 104 ? 20.299 157.120 43.014 1.00 50.56  ? 104 LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 104 ? 19.750 156.392 44.231 1.00 52.56  ? 104 LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 104 ? 18.980 157.300 45.150 1.00 52.21  ? 104 LYS A NZ    1 
ATOM   842  N  N     . SER A 1 105 ? 23.477 157.474 39.609 1.00 47.08  ? 105 SER A N     1 
ATOM   843  C  CA    . SER A 1 105 ? 23.491 158.730 38.868 1.00 45.61  ? 105 SER A CA    1 
ATOM   844  C  C     . SER A 1 105 ? 24.746 158.901 38.035 1.00 44.16  ? 105 SER A C     1 
ATOM   845  O  O     . SER A 1 105 ? 25.852 158.753 38.541 1.00 45.08  ? 105 SER A O     1 
ATOM   846  C  CB    . SER A 1 105 ? 23.375 159.899 39.833 1.00 47.62  ? 105 SER A CB    1 
ATOM   847  O  OG    . SER A 1 105 ? 22.024 160.124 40.174 1.00 53.61  ? 105 SER A OG    1 
ATOM   848  N  N     . VAL A 1 106 ? 24.572 159.222 36.759 1.00 42.33  ? 106 VAL A N     1 
ATOM   849  C  CA    . VAL A 1 106 ? 25.705 159.360 35.860 1.00 41.94  ? 106 VAL A CA    1 
ATOM   850  C  C     . VAL A 1 106 ? 25.758 160.676 35.099 1.00 43.82  ? 106 VAL A C     1 
ATOM   851  O  O     . VAL A 1 106 ? 24.737 161.224 34.692 1.00 45.07  ? 106 VAL A O     1 
ATOM   852  C  CB    . VAL A 1 106 ? 25.743 158.223 34.834 1.00 40.40  ? 106 VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 106 ? 26.717 158.562 33.725 1.00 40.74  ? 106 VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 106 ? 26.178 156.943 35.502 1.00 38.13  ? 106 VAL A CG2   1 
ATOM   855  N  N     . THR A 1 107 ? 26.974 161.172 34.907 1.00 44.83  ? 107 THR A N     1 
ATOM   856  C  CA    . THR A 1 107 ? 27.221 162.361 34.103 1.00 44.20  ? 107 THR A CA    1 
ATOM   857  C  C     . THR A 1 107 ? 28.452 162.135 33.234 1.00 43.45  ? 107 THR A C     1 
ATOM   858  O  O     . THR A 1 107 ? 29.412 161.478 33.646 1.00 43.52  ? 107 THR A O     1 
ATOM   859  C  CB    . THR A 1 107 ? 27.442 163.601 34.995 1.00 44.54  ? 107 THR A CB    1 
ATOM   860  O  OG1   . THR A 1 107 ? 26.200 163.990 35.590 1.00 47.70  ? 107 THR A OG1   1 
ATOM   861  C  CG2   . THR A 1 107 ? 27.981 164.741 34.199 1.00 44.94  ? 107 THR A CG2   1 
ATOM   862  N  N     . VAL A 1 108 ? 28.397 162.659 32.017 1.00 41.12  ? 108 VAL A N     1 
ATOM   863  C  CA    . VAL A 1 108 ? 29.547 162.685 31.144 1.00 41.02  ? 108 VAL A CA    1 
ATOM   864  C  C     . VAL A 1 108 ? 29.796 164.134 30.759 1.00 43.95  ? 108 VAL A C     1 
ATOM   865  O  O     . VAL A 1 108 ? 28.874 164.836 30.360 1.00 44.31  ? 108 VAL A O     1 
ATOM   866  C  CB    . VAL A 1 108 ? 29.289 161.910 29.876 1.00 39.33  ? 108 VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1 108 ? 30.553 161.866 29.049 1.00 39.08  ? 108 VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1 108 ? 28.778 160.534 30.202 1.00 38.36  ? 108 VAL A CG2   1 
ATOM   869  N  N     . LEU A 1 109 ? 31.034 164.592 30.887 1.00 45.27  ? 109 LEU A N     1 
ATOM   870  C  CA    . LEU A 1 109 ? 31.367 165.929 30.443 1.00 47.38  ? 109 LEU A CA    1 
ATOM   871  C  C     . LEU A 1 109 ? 32.795 166.004 29.915 1.00 49.70  ? 109 LEU A C     1 
ATOM   872  O  O     . LEU A 1 109 ? 33.687 165.324 30.424 1.00 51.28  ? 109 LEU A O     1 
ATOM   873  C  CB    . LEU A 1 109 ? 31.152 166.930 31.583 1.00 46.78  ? 109 LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 109 ? 31.441 166.546 33.030 1.00 46.49  ? 109 LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 109 ? 32.917 166.429 33.270 1.00 47.86  ? 109 LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 109 ? 30.877 167.609 33.921 1.00 45.97  ? 109 LEU A CD2   1 
ATOM   877  N  N     . ASP A 1 110 ? 32.993 166.825 28.885 1.00 49.22  ? 110 ASP A N     1 
ATOM   878  C  CA    . ASP A 1 110 ? 34.281 166.966 28.222 1.00 50.09  ? 110 ASP A CA    1 
ATOM   879  C  C     . ASP A 1 110 ? 34.972 168.261 28.645 1.00 49.57  ? 110 ASP A C     1 
ATOM   880  O  O     . ASP A 1 110 ? 34.307 169.240 28.982 1.00 50.01  ? 110 ASP A O     1 
ATOM   881  C  CB    . ASP A 1 110 ? 34.079 166.974 26.709 1.00 53.67  ? 110 ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 110 ? 34.035 165.582 26.119 1.00 60.08  ? 110 ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 110 ? 32.938 165.140 25.687 1.00 63.44  ? 110 ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 110 ? 35.105 164.928 26.079 1.00 62.43  ? 110 ASP A OD2   1 
ATOM   885  N  N     . VAL A 1 111 ? 36.301 168.272 28.613 1.00 47.72  ? 111 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 111 ? 37.057 169.481 28.928 1.00 48.23  ? 111 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 111 ? 37.434 170.312 27.699 1.00 50.10  ? 111 VAL A C     1 
ATOM   888  O  O     . VAL A 1 111 ? 38.153 169.842 26.810 1.00 52.57  ? 111 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 111 ? 38.356 169.154 29.686 1.00 46.92  ? 111 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 111 ? 39.220 170.397 29.770 1.00 44.31  ? 111 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 111 ? 38.037 168.649 31.088 1.00 45.94  ? 111 VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 112 ? 36.974 171.561 27.675 1.00 49.87  ? 112 GLY A N     1 
ATOM   893  C  CA    . GLY A 1 112 ? 37.170 172.417 26.523 1.00 50.08  ? 112 GLY A CA    1 
ATOM   894  C  C     . GLY A 1 112 ? 38.535 173.073 26.381 1.00 51.72  ? 112 GLY A C     1 
ATOM   895  O  O     . GLY A 1 112 ? 39.125 173.549 27.351 1.00 52.39  ? 112 GLY A O     1 
ATOM   896  N  N     . ASP A 1 113 ? 39.018 173.113 25.142 1.00 52.91  ? 113 ASP A N     1 
ATOM   897  C  CA    . ASP A 1 113 ? 40.314 173.682 24.817 1.00 54.11  ? 113 ASP A CA    1 
ATOM   898  C  C     . ASP A 1 113 ? 41.386 173.175 25.749 1.00 52.70  ? 113 ASP A C     1 
ATOM   899  O  O     . ASP A 1 113 ? 42.277 173.923 26.152 1.00 52.31  ? 113 ASP A O     1 
ATOM   900  C  CB    . ASP A 1 113 ? 40.251 175.203 24.862 1.00 59.34  ? 113 ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 113 ? 39.708 175.793 23.574 1.00 65.91  ? 113 ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 113 ? 38.485 175.647 23.329 1.00 68.04  ? 113 ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 113 ? 40.506 176.392 22.804 1.00 68.09  ? 113 ASP A OD2   1 
ATOM   904  N  N     . ALA A 1 114 ? 41.290 171.890 26.071 1.00 50.58  ? 114 ALA A N     1 
ATOM   905  C  CA    . ALA A 1 114 ? 42.160 171.252 27.045 1.00 49.31  ? 114 ALA A CA    1 
ATOM   906  C  C     . ALA A 1 114 ? 43.677 171.488 26.853 1.00 48.37  ? 114 ALA A C     1 
ATOM   907  O  O     . ALA A 1 114 ? 44.325 172.019 27.751 1.00 47.70  ? 114 ALA A O     1 
ATOM   908  C  CB    . ALA A 1 114 ? 41.851 169.768 27.086 1.00 49.45  ? 114 ALA A CB    1 
ATOM   909  N  N     . TYR A 1 115 ? 44.253 171.112 25.711 1.00 47.00  ? 115 TYR A N     1 
ATOM   910  C  CA    . TYR A 1 115 ? 45.696 171.293 25.534 1.00 46.77  ? 115 TYR A CA    1 
ATOM   911  C  C     . TYR A 1 115 ? 46.092 172.747 25.684 1.00 48.29  ? 115 TYR A C     1 
ATOM   912  O  O     . TYR A 1 115 ? 47.164 173.052 26.204 1.00 48.33  ? 115 TYR A O     1 
ATOM   913  C  CB    . TYR A 1 115 ? 46.165 170.829 24.163 1.00 44.24  ? 115 TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 115 ? 46.364 169.334 24.006 1.00 43.91  ? 115 TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 115 ? 45.871 168.427 24.932 1.00 42.87  ? 115 TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 115 ? 46.955 168.831 22.866 1.00 42.89  ? 115 TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 115 ? 45.958 167.069 24.703 1.00 41.97  ? 115 TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 115 ? 47.037 167.490 22.634 1.00 42.55  ? 115 TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 115 ? 46.537 166.614 23.541 1.00 42.50  ? 115 TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 115 ? 46.585 165.278 23.224 1.00 47.09  ? 115 TYR A OH    1 
ATOM   921  N  N     . PHE A 1 116 ? 45.226 173.642 25.216 1.00 49.31  ? 116 PHE A N     1 
ATOM   922  C  CA    . PHE A 1 116 ? 45.519 175.071 25.222 1.00 49.99  ? 116 PHE A CA    1 
ATOM   923  C  C     . PHE A 1 116 ? 45.248 175.686 26.574 1.00 50.24  ? 116 PHE A C     1 
ATOM   924  O  O     . PHE A 1 116 ? 45.354 176.900 26.735 1.00 52.34  ? 116 PHE A O     1 
ATOM   925  C  CB    . PHE A 1 116 ? 44.673 175.817 24.196 1.00 51.20  ? 116 PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 116 ? 44.984 175.474 22.772 1.00 53.22  ? 116 PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 116 ? 45.792 174.401 22.458 1.00 53.98  ? 116 PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 116 ? 44.431 176.215 21.738 1.00 54.30  ? 116 PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 116 ? 46.039 174.070 21.144 1.00 54.30  ? 116 PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 116 ? 44.676 175.888 20.427 1.00 53.92  ? 116 PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 116 ? 45.481 174.812 20.130 1.00 54.14  ? 116 PHE A CZ    1 
ATOM   932  N  N     . SER A 1 117 ? 44.869 174.862 27.539 1.00 49.31  ? 117 SER A N     1 
ATOM   933  C  CA    . SER A 1 117 ? 44.572 175.362 28.873 1.00 49.00  ? 117 SER A CA    1 
ATOM   934  C  C     . SER A 1 117 ? 45.667 174.919 29.819 1.00 48.38  ? 117 SER A C     1 
ATOM   935  O  O     . SER A 1 117 ? 45.534 175.043 31.033 1.00 48.88  ? 117 SER A O     1 
ATOM   936  C  CB    . SER A 1 117 ? 43.218 174.835 29.353 1.00 49.68  ? 117 SER A CB    1 
ATOM   937  O  OG    . SER A 1 117 ? 42.160 175.312 28.534 1.00 52.07  ? 117 SER A OG    1 
ATOM   938  N  N     . VAL A 1 118 ? 46.745 174.392 29.245 1.00 46.80  ? 118 VAL A N     1 
ATOM   939  C  CA    . VAL A 1 118 ? 47.858 173.844 30.010 1.00 44.74  ? 118 VAL A CA    1 
ATOM   940  C  C     . VAL A 1 118 ? 49.147 174.509 29.560 1.00 45.84  ? 118 VAL A C     1 
ATOM   941  O  O     . VAL A 1 118 ? 49.425 174.607 28.369 1.00 48.26  ? 118 VAL A O     1 
ATOM   942  C  CB    . VAL A 1 118 ? 47.969 172.323 29.799 1.00 43.98  ? 118 VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 118 ? 49.182 171.777 30.505 1.00 40.08  ? 118 VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 118 ? 46.705 171.640 30.317 1.00 44.89  ? 118 VAL A CG2   1 
ATOM   945  N  N     . PRO A 1 119 ? 49.948 175.001 30.509 1.00 45.06  ? 119 PRO A N     1 
ATOM   946  C  CA    . PRO A 1 119 ? 51.147 175.732 30.123 1.00 42.86  ? 119 PRO A CA    1 
ATOM   947  C  C     . PRO A 1 119 ? 52.241 174.794 29.666 1.00 43.24  ? 119 PRO A C     1 
ATOM   948  O  O     . PRO A 1 119 ? 52.480 173.755 30.292 1.00 39.62  ? 119 PRO A O     1 
ATOM   949  C  CB    . PRO A 1 119 ? 51.532 176.471 31.395 1.00 43.55  ? 119 PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 119 ? 50.344 176.358 32.302 1.00 43.67  ? 119 PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 119 ? 49.733 175.062 31.961 1.00 45.14  ? 119 PRO A CD    1 
ATOM   952  N  N     . LEU A 1 120 ? 52.902 175.175 28.574 1.00 45.77  ? 120 LEU A N     1 
ATOM   953  C  CA    . LEU A 1 120 ? 54.134 174.531 28.120 1.00 47.83  ? 120 LEU A CA    1 
ATOM   954  C  C     . LEU A 1 120 ? 55.332 175.137 28.844 1.00 51.06  ? 120 LEU A C     1 
ATOM   955  O  O     . LEU A 1 120 ? 55.379 176.341 29.063 1.00 51.81  ? 120 LEU A O     1 
ATOM   956  C  CB    . LEU A 1 120 ? 54.291 174.714 26.612 1.00 45.22  ? 120 LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 120 ? 55.610 174.317 25.944 1.00 46.20  ? 120 LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 120 ? 55.991 172.901 26.315 1.00 46.26  ? 120 LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 120 ? 55.477 174.453 24.439 1.00 44.24  ? 120 LEU A CD2   1 
ATOM   960  N  N     . ASP A 1 121 ? 56.287 174.291 29.228 1.00 55.70  ? 121 ASP A N     1 
ATOM   961  C  CA    . ASP A 1 121 ? 57.523 174.737 29.873 1.00 59.11  ? 121 ASP A CA    1 
ATOM   962  C  C     . ASP A 1 121 ? 58.151 175.882 29.082 1.00 61.02  ? 121 ASP A C     1 
ATOM   963  O  O     . ASP A 1 121 ? 58.394 175.763 27.888 1.00 61.83  ? 121 ASP A O     1 
ATOM   964  C  CB    . ASP A 1 121 ? 58.507 173.562 29.972 1.00 60.86  ? 121 ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 121 ? 59.927 174.006 30.290 1.00 63.20  ? 121 ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 121 ? 60.870 173.265 29.941 1.00 63.73  ? 121 ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 121 ? 60.104 175.092 30.886 1.00 65.72  ? 121 ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 122 ? 58.416 176.996 29.751 1.00 63.89  ? 122 GLU A N     1 
ATOM   969  C  CA    . GLU A 1 122 ? 58.796 178.210 29.048 1.00 66.22  ? 122 GLU A CA    1 
ATOM   970  C  C     . GLU A 1 122 ? 60.126 178.065 28.316 1.00 66.90  ? 122 GLU A C     1 
ATOM   971  O  O     . GLU A 1 122 ? 60.304 178.627 27.234 1.00 67.58  ? 122 GLU A O     1 
ATOM   972  C  CB    . GLU A 1 122 ? 58.867 179.377 30.030 1.00 68.39  ? 122 GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 122 ? 57.668 179.461 30.961 1.00 73.40  ? 122 GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 122 ? 57.707 180.689 31.861 1.00 77.68  ? 122 GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 122 ? 58.747 180.925 32.519 1.00 80.26  ? 122 GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 122 ? 56.695 181.424 31.912 1.00 79.73  ? 122 GLU A OE2   1 
ATOM   977  N  N     . ASP A 1 123 ? 61.055 177.307 28.895 1.00 66.81  ? 123 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 123 ? 62.400 177.200 28.327 1.00 67.62  ? 123 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 123 ? 62.410 176.309 27.089 1.00 65.72  ? 123 ASP A C     1 
ATOM   980  O  O     . ASP A 1 123 ? 63.370 176.300 26.321 1.00 65.15  ? 123 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 123 ? 63.390 176.649 29.366 1.00 72.02  ? 123 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 123 ? 63.615 177.602 30.544 1.00 76.01  ? 123 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 123 ? 62.843 177.511 31.533 1.00 78.89  ? 123 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 123 ? 64.561 178.429 30.488 1.00 75.17  ? 123 ASP A OD2   1 
ATOM   985  N  N     . PHE A 1 124 ? 61.335 175.554 26.908 1.00 63.57  ? 124 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 124 ? 61.177 174.730 25.723 1.00 60.98  ? 124 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 124 ? 60.358 175.482 24.681 1.00 60.57  ? 124 PHE A C     1 
ATOM   988  O  O     . PHE A 1 124 ? 60.393 175.160 23.498 1.00 61.87  ? 124 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 124 ? 60.478 173.422 26.085 1.00 58.87  ? 124 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 124 ? 60.560 172.375 25.016 1.00 58.05  ? 124 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 124 ? 61.612 171.474 24.988 1.00 57.76  ? 124 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 124 ? 59.591 172.295 24.034 1.00 56.85  ? 124 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 124 ? 61.694 170.511 24.003 1.00 57.23  ? 124 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 124 ? 59.668 171.331 23.044 1.00 56.29  ? 124 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 124 ? 60.720 170.441 23.028 1.00 56.67  ? 124 PHE A CZ    1 
ATOM   996  N  N     . ARG A 1 125 ? 59.637 176.500 25.130 1.00 59.15  ? 125 ARG A N     1 
ATOM   997  C  CA    . ARG A 1 125 ? 58.649 177.174 24.302 1.00 58.30  ? 125 ARG A CA    1 
ATOM   998  C  C     . ARG A 1 125 ? 59.153 177.592 22.918 1.00 59.48  ? 125 ARG A C     1 
ATOM   999  O  O     . ARG A 1 125 ? 58.396 177.568 21.946 1.00 60.83  ? 125 ARG A O     1 
ATOM   1000 C  CB    . ARG A 1 125 ? 58.114 178.398 25.043 1.00 56.60  ? 125 ARG A CB    1 
ATOM   1001 C  CG    . ARG A 1 125 ? 56.644 178.323 25.348 1.00 54.99  ? 125 ARG A CG    1 
ATOM   1002 C  CD    . ARG A 1 125 ? 56.181 179.488 26.192 1.00 53.84  ? 125 ARG A CD    1 
ATOM   1003 N  NE    . ARG A 1 125 ? 55.831 179.026 27.528 1.00 55.25  ? 125 ARG A NE    1 
ATOM   1004 C  CZ    . ARG A 1 125 ? 55.193 179.749 28.443 1.00 56.14  ? 125 ARG A CZ    1 
ATOM   1005 N  NH1   . ARG A 1 125 ? 54.822 180.995 28.178 1.00 56.13  ? 125 ARG A NH1   1 
ATOM   1006 N  NH2   . ARG A 1 125 ? 54.918 179.214 29.627 1.00 55.15  ? 125 ARG A NH2   1 
ATOM   1007 N  N     . LYS A 1 126 ? 60.426 177.968 22.826 1.00 60.13  ? 126 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 126 ? 60.959 178.589 21.610 1.00 59.47  ? 126 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 126 ? 61.149 177.620 20.449 1.00 59.53  ? 126 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 126 ? 61.300 178.036 19.307 1.00 59.45  ? 126 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 126 ? 62.293 179.272 21.908 1.00 58.46  ? 126 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 126 ? 63.309 178.360 22.546 1.00 58.02  ? 126 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 126 ? 64.660 179.016 22.621 1.00 56.65  ? 126 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 126 ? 65.524 178.319 23.638 1.00 56.76  ? 126 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 126 ? 64.967 178.539 24.994 1.00 57.03  ? 126 LYS A NZ    1 
ATOM   1016 N  N     . TYR A 1 127 ? 61.148 176.328 20.737 1.00 59.97  ? 127 TYR A N     1 
ATOM   1017 C  CA    . TYR A 1 127 ? 61.374 175.343 19.692 1.00 61.20  ? 127 TYR A CA    1 
ATOM   1018 C  C     . TYR A 1 127 ? 60.098 175.117 18.911 1.00 61.62  ? 127 TYR A C     1 
ATOM   1019 O  O     . TYR A 1 127 ? 60.100 174.430 17.892 1.00 61.65  ? 127 TYR A O     1 
ATOM   1020 C  CB    . TYR A 1 127 ? 61.844 174.024 20.298 1.00 60.93  ? 127 TYR A CB    1 
ATOM   1021 C  CG    . TYR A 1 127 ? 63.119 174.145 21.092 1.00 61.24  ? 127 TYR A CG    1 
ATOM   1022 C  CD1   . TYR A 1 127 ? 64.283 174.584 20.492 1.00 61.72  ? 127 TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A 1 127 ? 63.165 173.802 22.432 1.00 61.22  ? 127 TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A 1 127 ? 65.457 174.677 21.199 1.00 62.53  ? 127 TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A 1 127 ? 64.340 173.893 23.148 1.00 61.84  ? 127 TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A 1 127 ? 65.483 174.331 22.523 1.00 62.36  ? 127 TYR A CZ    1 
ATOM   1027 O  OH    . TYR A 1 127 ? 66.668 174.424 23.211 1.00 64.16  ? 127 TYR A OH    1 
ATOM   1028 N  N     . THR A 1 128 ? 59.007 175.695 19.404 1.00 62.54  ? 128 THR A N     1 
ATOM   1029 C  CA    . THR A 1 128 ? 57.704 175.525 18.776 1.00 63.07  ? 128 THR A CA    1 
ATOM   1030 C  C     . THR A 1 128 ? 57.431 176.635 17.768 1.00 63.50  ? 128 THR A C     1 
ATOM   1031 O  O     . THR A 1 128 ? 56.322 176.742 17.241 1.00 62.69  ? 128 THR A O     1 
ATOM   1032 C  CB    . THR A 1 128 ? 56.554 175.511 19.822 1.00 62.18  ? 128 THR A CB    1 
ATOM   1033 O  OG1   . THR A 1 128 ? 56.537 176.751 20.546 1.00 61.66  ? 128 THR A OG1   1 
ATOM   1034 C  CG2   . THR A 1 128 ? 56.732 174.360 20.784 1.00 59.47  ? 128 THR A CG2   1 
ATOM   1035 N  N     . ALA A 1 129 ? 58.440 177.460 17.503 1.00 63.91  ? 129 ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 129 ? 58.283 178.552 16.549 1.00 64.57  ? 129 ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 129 ? 57.766 178.033 15.210 1.00 65.44  ? 129 ALA A C     1 
ATOM   1038 O  O     . ALA A 1 129 ? 58.303 177.086 14.636 1.00 64.96  ? 129 ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 129 ? 59.606 179.279 16.360 1.00 63.10  ? 129 ALA A CB    1 
ATOM   1040 N  N     . PHE A 1 130 ? 56.695 178.647 14.731 1.00 67.63  ? 130 PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 130 ? 56.186 178.363 13.401 1.00 70.89  ? 130 PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 130 ? 55.902 179.695 12.737 1.00 73.99  ? 130 PHE A C     1 
ATOM   1043 O  O     . PHE A 1 130 ? 55.712 180.702 13.416 1.00 73.47  ? 130 PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 130 ? 54.904 177.534 13.478 1.00 69.87  ? 130 PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 130 ? 53.750 178.247 14.127 1.00 68.24  ? 130 PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 130 ? 52.777 178.855 13.358 1.00 68.48  ? 130 PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 130 ? 53.639 178.310 15.502 1.00 67.73  ? 130 PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 130 ? 51.712 179.509 13.949 1.00 68.41  ? 130 PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 130 ? 52.576 178.962 16.097 1.00 67.79  ? 130 PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 130 ? 51.614 179.564 15.321 1.00 67.88  ? 130 PHE A CZ    1 
ATOM   1051 N  N     . THR A 1 131 ? 55.893 179.716 11.413 1.00 78.14  ? 131 THR A N     1 
ATOM   1052 C  CA    . THR A 1 131 ? 55.587 180.953 10.720 1.00 83.28  ? 131 THR A CA    1 
ATOM   1053 C  C     . THR A 1 131 ? 54.404 180.695 9.822  1.00 87.03  ? 131 THR A C     1 
ATOM   1054 O  O     . THR A 1 131 ? 54.374 179.688 9.120  1.00 87.54  ? 131 THR A O     1 
ATOM   1055 C  CB    . THR A 1 131 ? 56.757 181.431 9.851  1.00 83.08  ? 131 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 131 ? 57.984 181.294 10.575 1.00 84.80  ? 131 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 131 ? 56.575 182.890 9.495  1.00 82.65  ? 131 THR A CG2   1 
ATOM   1058 N  N     . ILE A 1 132 ? 53.428 181.598 9.852  1.00 91.69  ? 132 ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 132 ? 52.258 181.499 8.984  1.00 96.82  ? 132 ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 132 ? 52.565 182.196 7.654  1.00 101.23 ? 132 ILE A C     1 
ATOM   1061 O  O     . ILE A 1 132 ? 52.961 183.365 7.629  1.00 101.97 ? 132 ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 132 ? 51.023 182.145 9.660  1.00 96.24  ? 132 ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 132 ? 49.809 182.051 8.747  1.00 95.53  ? 132 ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 132 ? 51.307 183.595 10.005 1.00 96.21  ? 132 ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 132 ? 48.563 182.587 9.393  1.00 96.19  ? 132 ILE A CD1   1 
ATOM   1066 N  N     . PRO A 1 133 ? 52.407 181.476 6.527  1.00 104.76 ? 133 PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 133 ? 52.990 181.925 5.257  1.00 107.93 ? 133 PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 133 ? 52.226 183.086 4.623  1.00 111.58 ? 133 PRO A C     1 
ATOM   1069 O  O     . PRO A 1 133 ? 51.018 182.990 4.408  1.00 112.02 ? 133 PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 133 ? 52.945 180.673 4.385  1.00 106.51 ? 133 PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 133 ? 51.761 179.929 4.887  1.00 105.57 ? 133 PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 133 ? 51.688 180.198 6.375  1.00 105.27 ? 133 PRO A CD    1 
ATOM   1073 N  N     . SER A 1 134 ? 52.927 184.179 4.323  1.00 115.28 ? 134 SER A N     1 
ATOM   1074 C  CA    . SER A 1 134 ? 52.350 185.218 3.483  1.00 119.07 ? 134 SER A CA    1 
ATOM   1075 C  C     . SER A 1 134 ? 52.049 184.528 2.162  1.00 121.40 ? 134 SER A C     1 
ATOM   1076 O  O     . SER A 1 134 ? 52.678 183.518 1.826  1.00 121.68 ? 134 SER A O     1 
ATOM   1077 C  CB    . SER A 1 134 ? 53.336 186.366 3.266  1.00 119.62 ? 134 SER A CB    1 
ATOM   1078 O  OG    . SER A 1 134 ? 54.440 185.948 2.488  1.00 120.71 ? 134 SER A OG    1 
ATOM   1079 N  N     . ILE A 1 135 ? 51.088 185.069 1.419  1.00 123.97 ? 135 ILE A N     1 
ATOM   1080 C  CA    . ILE A 1 135 ? 50.424 184.327 0.343  1.00 125.95 ? 135 ILE A CA    1 
ATOM   1081 C  C     . ILE A 1 135 ? 51.416 183.756 -0.667 1.00 127.31 ? 135 ILE A C     1 
ATOM   1082 O  O     . ILE A 1 135 ? 51.037 182.989 -1.555 1.00 127.37 ? 135 ILE A O     1 
ATOM   1083 C  CB    . ILE A 1 135 ? 49.421 185.232 -0.389 1.00 125.77 ? 135 ILE A CB    1 
ATOM   1084 C  CG1   . ILE A 1 135 ? 48.590 184.430 -1.382 1.00 125.30 ? 135 ILE A CG1   1 
ATOM   1085 C  CG2   . ILE A 1 135 ? 50.161 186.356 -1.068 1.00 126.58 ? 135 ILE A CG2   1 
ATOM   1086 C  CD1   . ILE A 1 135 ? 49.066 184.556 -2.806 1.00 124.73 ? 135 ILE A CD1   1 
ATOM   1087 N  N     . ASN A 1 136 ? 52.689 184.114 -0.518 1.00 128.83 ? 136 ASN A N     1 
ATOM   1088 C  CA    . ASN A 1 136 ? 53.731 183.635 -1.422 1.00 130.24 ? 136 ASN A CA    1 
ATOM   1089 C  C     . ASN A 1 136 ? 55.120 183.965 -0.876 1.00 131.35 ? 136 ASN A C     1 
ATOM   1090 O  O     . ASN A 1 136 ? 55.347 183.958 0.337  1.00 131.74 ? 136 ASN A O     1 
ATOM   1091 C  CB    . ASN A 1 136 ? 53.537 184.291 -2.779 1.00 129.50 ? 136 ASN A CB    1 
ATOM   1092 C  CG    . ASN A 1 136 ? 52.788 185.602 -2.672 1.00 129.25 ? 136 ASN A CG    1 
ATOM   1093 O  OD1   . ASN A 1 136 ? 51.852 185.858 -3.425 1.00 129.75 ? 136 ASN A OD1   1 
ATOM   1094 N  ND2   . ASN A 1 136 ? 53.193 186.440 -1.724 1.00 128.18 ? 136 ASN A ND2   1 
ATOM   1095 N  N     . ASN A 1 137 ? 56.047 184.250 -1.784 1.00 132.14 ? 137 ASN A N     1 
ATOM   1096 C  CA    . ASN A 1 137 ? 57.400 184.649 -1.411 1.00 132.58 ? 137 ASN A CA    1 
ATOM   1097 C  C     . ASN A 1 137 ? 57.346 186.021 -0.739 1.00 131.86 ? 137 ASN A C     1 
ATOM   1098 O  O     . ASN A 1 137 ? 58.184 186.361 0.101  1.00 131.95 ? 137 ASN A O     1 
ATOM   1099 C  CB    . ASN A 1 137 ? 58.279 184.711 -2.669 1.00 134.07 ? 137 ASN A CB    1 
ATOM   1100 C  CG    . ASN A 1 137 ? 59.718 185.092 -2.367 1.00 135.05 ? 137 ASN A CG    1 
ATOM   1101 O  OD1   . ASN A 1 137 ? 60.624 184.262 -2.478 1.00 135.94 ? 137 ASN A OD1   1 
ATOM   1102 N  ND2   . ASN A 1 137 ? 59.938 186.351 -1.991 1.00 135.00 ? 137 ASN A ND2   1 
ATOM   1103 N  N     . GLU A 1 138 ? 56.325 186.786 -1.113 1.00 130.51 ? 138 GLU A N     1 
ATOM   1104 C  CA    . GLU A 1 138 ? 56.231 188.215 -0.830 1.00 128.84 ? 138 GLU A CA    1 
ATOM   1105 C  C     . GLU A 1 138 ? 56.700 188.676 0.552  1.00 127.00 ? 138 GLU A C     1 
ATOM   1106 O  O     . GLU A 1 138 ? 57.741 189.327 0.676  1.00 127.27 ? 138 GLU A O     1 
ATOM   1107 C  CB    . GLU A 1 138 ? 54.790 188.659 -1.066 1.00 129.76 ? 138 GLU A CB    1 
ATOM   1108 C  CG    . GLU A 1 138 ? 54.288 189.727 -0.137 1.00 130.43 ? 138 GLU A CG    1 
ATOM   1109 C  CD    . GLU A 1 138 ? 52.825 190.004 -0.358 1.00 130.98 ? 138 GLU A CD    1 
ATOM   1110 O  OE1   . GLU A 1 138 ? 51.988 189.216 0.139  1.00 130.94 ? 138 GLU A OE1   1 
ATOM   1111 O  OE2   . GLU A 1 138 ? 52.517 191.004 -1.038 1.00 131.00 ? 138 GLU A OE2   1 
ATOM   1112 N  N     . THR A 1 139 ? 55.928 188.346 1.584  1.00 124.04 ? 139 THR A N     1 
ATOM   1113 C  CA    . THR A 1 139 ? 56.201 188.845 2.924  1.00 120.81 ? 139 THR A CA    1 
ATOM   1114 C  C     . THR A 1 139 ? 56.870 187.779 3.781  1.00 118.61 ? 139 THR A C     1 
ATOM   1115 O  O     . THR A 1 139 ? 56.554 186.590 3.689  1.00 118.17 ? 139 THR A O     1 
ATOM   1116 C  CB    . THR A 1 139 ? 54.902 189.313 3.629  1.00 120.42 ? 139 THR A CB    1 
ATOM   1117 O  OG1   . THR A 1 139 ? 54.308 190.371 2.872  1.00 120.09 ? 139 THR A OG1   1 
ATOM   1118 C  CG2   . THR A 1 139 ? 55.201 189.816 5.031  1.00 119.75 ? 139 THR A CG2   1 
ATOM   1119 N  N     . PRO A 1 140 ? 57.828 188.194 4.620  1.00 116.11 ? 140 PRO A N     1 
ATOM   1120 C  CA    . PRO A 1 140 ? 58.210 187.319 5.727  1.00 113.44 ? 140 PRO A CA    1 
ATOM   1121 C  C     . PRO A 1 140 ? 56.962 187.135 6.579  1.00 110.94 ? 140 PRO A C     1 
ATOM   1122 O  O     . PRO A 1 140 ? 56.441 188.103 7.129  1.00 111.24 ? 140 PRO A O     1 
ATOM   1123 C  CB    . PRO A 1 140 ? 59.291 188.114 6.457  1.00 114.10 ? 140 PRO A CB    1 
ATOM   1124 C  CG    . PRO A 1 140 ? 59.812 189.075 5.433  1.00 115.08 ? 140 PRO A CG    1 
ATOM   1125 C  CD    . PRO A 1 140 ? 58.626 189.430 4.591  1.00 115.58 ? 140 PRO A CD    1 
ATOM   1126 N  N     . GLY A 1 141 ? 56.471 185.903 6.665  1.00 107.57 ? 141 GLY A N     1 
ATOM   1127 C  CA    . GLY A 1 141 ? 55.238 185.648 7.392  1.00 102.45 ? 141 GLY A CA    1 
ATOM   1128 C  C     . GLY A 1 141 ? 55.337 186.009 8.863  1.00 99.22  ? 141 GLY A C     1 
ATOM   1129 O  O     . GLY A 1 141 ? 56.400 186.410 9.341  1.00 99.54  ? 141 GLY A O     1 
ATOM   1130 N  N     . ILE A 1 142 ? 54.232 185.870 9.588  1.00 95.06  ? 142 ILE A N     1 
ATOM   1131 C  CA    . ILE A 1 142 ? 54.227 186.174 11.012 1.00 90.13  ? 142 ILE A CA    1 
ATOM   1132 C  C     . ILE A 1 142 ? 54.902 185.034 11.770 1.00 87.07  ? 142 ILE A C     1 
ATOM   1133 O  O     . ILE A 1 142 ? 54.600 183.867 11.539 1.00 86.83  ? 142 ILE A O     1 
ATOM   1134 C  CB    . ILE A 1 142 ? 52.783 186.353 11.539 1.00 89.54  ? 142 ILE A CB    1 
ATOM   1135 C  CG1   . ILE A 1 142 ? 52.058 187.432 10.730 1.00 88.26  ? 142 ILE A CG1   1 
ATOM   1136 C  CG2   . ILE A 1 142 ? 52.810 186.750 13.002 1.00 89.04  ? 142 ILE A CG2   1 
ATOM   1137 C  CD1   . ILE A 1 142 ? 50.655 187.731 11.220 1.00 86.50  ? 142 ILE A CD1   1 
ATOM   1138 N  N     . ARG A 1 143 ? 55.831 185.376 12.658 1.00 83.37  ? 143 ARG A N     1 
ATOM   1139 C  CA    . ARG A 1 143 ? 56.460 184.385 13.523 1.00 79.85  ? 143 ARG A CA    1 
ATOM   1140 C  C     . ARG A 1 143 ? 55.663 184.288 14.804 1.00 78.19  ? 143 ARG A C     1 
ATOM   1141 O  O     . ARG A 1 143 ? 55.229 185.298 15.355 1.00 78.48  ? 143 ARG A O     1 
ATOM   1142 C  CB    . ARG A 1 143 ? 57.899 184.776 13.885 1.00 79.27  ? 143 ARG A CB    1 
ATOM   1143 C  CG    . ARG A 1 143 ? 58.888 184.853 12.728 1.00 75.86  ? 143 ARG A CG    1 
ATOM   1144 C  CD    . ARG A 1 143 ? 59.031 183.539 11.993 1.00 73.35  ? 143 ARG A CD    1 
ATOM   1145 N  NE    . ARG A 1 143 ? 59.753 182.503 12.737 1.00 70.73  ? 143 ARG A NE    1 
ATOM   1146 C  CZ    . ARG A 1 143 ? 60.878 182.690 13.420 1.00 67.49  ? 143 ARG A CZ    1 
ATOM   1147 N  NH1   . ARG A 1 143 ? 61.444 183.885 13.485 1.00 65.25  ? 143 ARG A NH1   1 
ATOM   1148 N  NH2   . ARG A 1 143 ? 61.453 181.663 14.017 1.00 64.95  ? 143 ARG A NH2   1 
ATOM   1149 N  N     . TYR A 1 144 ? 55.486 183.063 15.277 1.00 75.99  ? 144 TYR A N     1 
ATOM   1150 C  CA    . TYR A 1 144 ? 54.799 182.801 16.532 1.00 72.86  ? 144 TYR A CA    1 
ATOM   1151 C  C     . TYR A 1 144 ? 55.493 181.652 17.257 1.00 70.82  ? 144 TYR A C     1 
ATOM   1152 O  O     . TYR A 1 144 ? 55.986 180.719 16.614 1.00 70.05  ? 144 TYR A O     1 
ATOM   1153 C  CB    . TYR A 1 144 ? 53.347 182.406 16.263 1.00 73.13  ? 144 TYR A CB    1 
ATOM   1154 C  CG    . TYR A 1 144 ? 52.409 183.558 16.028 1.00 73.86  ? 144 TYR A CG    1 
ATOM   1155 C  CD1   . TYR A 1 144 ? 52.278 184.570 16.968 1.00 74.25  ? 144 TYR A CD1   1 
ATOM   1156 C  CD2   . TYR A 1 144 ? 51.601 183.601 14.896 1.00 74.81  ? 144 TYR A CD2   1 
ATOM   1157 C  CE1   . TYR A 1 144 ? 51.362 185.592 16.794 1.00 75.20  ? 144 TYR A CE1   1 
ATOM   1158 C  CE2   . TYR A 1 144 ? 50.681 184.619 14.708 1.00 75.01  ? 144 TYR A CE2   1 
ATOM   1159 C  CZ    . TYR A 1 144 ? 50.565 185.610 15.663 1.00 76.22  ? 144 TYR A CZ    1 
ATOM   1160 O  OH    . TYR A 1 144 ? 49.634 186.611 15.502 1.00 77.27  ? 144 TYR A OH    1 
ATOM   1161 N  N     . GLN A 1 145 ? 55.529 181.717 18.589 1.00 68.21  ? 145 GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 145 ? 55.794 180.531 19.398 1.00 64.16  ? 145 GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 145 ? 54.630 180.184 20.319 1.00 61.88  ? 145 GLN A C     1 
ATOM   1164 O  O     . GLN A 1 145 ? 53.706 180.980 20.521 1.00 60.98  ? 145 GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 145 ? 57.077 180.696 20.214 1.00 63.39  ? 145 GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 145 ? 57.046 181.785 21.251 1.00 62.28  ? 145 GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 145 ? 58.327 181.823 22.075 1.00 62.60  ? 145 GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 145 ? 59.434 181.697 21.542 1.00 61.36  ? 145 GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 145 ? 58.179 181.992 23.383 1.00 61.89  ? 145 GLN A NE2   1 
ATOM   1170 N  N     . TYR A 1 146 ? 54.680 178.974 20.858 1.00 58.82  ? 146 TYR A N     1 
ATOM   1171 C  CA    . TYR A 1 146 ? 53.551 178.402 21.564 1.00 56.26  ? 146 TYR A CA    1 
ATOM   1172 C  C     . TYR A 1 146 ? 53.722 178.582 23.059 1.00 56.45  ? 146 TYR A C     1 
ATOM   1173 O  O     . TYR A 1 146 ? 54.808 178.395 23.588 1.00 57.21  ? 146 TYR A O     1 
ATOM   1174 C  CB    . TYR A 1 146 ? 53.445 176.918 21.227 1.00 54.26  ? 146 TYR A CB    1 
ATOM   1175 C  CG    . TYR A 1 146 ? 52.277 176.578 20.334 1.00 52.37  ? 146 TYR A CG    1 
ATOM   1176 C  CD1   . TYR A 1 146 ? 50.981 176.684 20.799 1.00 52.03  ? 146 TYR A CD1   1 
ATOM   1177 C  CD2   . TYR A 1 146 ? 52.471 176.137 19.035 1.00 51.76  ? 146 TYR A CD2   1 
ATOM   1178 C  CE1   . TYR A 1 146 ? 49.907 176.362 20.005 1.00 51.79  ? 146 TYR A CE1   1 
ATOM   1179 C  CE2   . TYR A 1 146 ? 51.405 175.811 18.227 1.00 51.62  ? 146 TYR A CE2   1 
ATOM   1180 C  CZ    . TYR A 1 146 ? 50.117 175.923 18.721 1.00 53.39  ? 146 TYR A CZ    1 
ATOM   1181 O  OH    . TYR A 1 146 ? 49.026 175.576 17.945 1.00 54.99  ? 146 TYR A OH    1 
ATOM   1182 N  N     . ASN A 1 147 ? 52.646 178.937 23.744 1.00 55.72  ? 147 ASN A N     1 
ATOM   1183 C  CA    . ASN A 1 147 ? 52.701 179.115 25.184 1.00 56.00  ? 147 ASN A CA    1 
ATOM   1184 C  C     . ASN A 1 147 ? 52.035 177.977 25.935 1.00 55.39  ? 147 ASN A C     1 
ATOM   1185 O  O     . ASN A 1 147 ? 52.300 177.769 27.117 1.00 56.53  ? 147 ASN A O     1 
ATOM   1186 C  CB    . ASN A 1 147 ? 52.027 180.419 25.572 1.00 58.89  ? 147 ASN A CB    1 
ATOM   1187 C  CG    . ASN A 1 147 ? 52.802 181.624 25.118 1.00 61.23  ? 147 ASN A CG    1 
ATOM   1188 O  OD1   . ASN A 1 147 ? 54.027 181.676 25.259 1.00 65.47  ? 147 ASN A OD1   1 
ATOM   1189 N  ND2   . ASN A 1 147 ? 52.099 182.607 24.567 1.00 61.13  ? 147 ASN A ND2   1 
ATOM   1190 N  N     . VAL A 1 148 ? 51.153 177.255 25.252 1.00 52.70  ? 148 VAL A N     1 
ATOM   1191 C  CA    . VAL A 1 148 ? 50.447 176.129 25.853 1.00 48.64  ? 148 VAL A CA    1 
ATOM   1192 C  C     . VAL A 1 148 ? 50.885 174.848 25.165 1.00 48.42  ? 148 VAL A C     1 
ATOM   1193 O  O     . VAL A 1 148 ? 51.903 174.835 24.489 1.00 47.98  ? 148 VAL A O     1 
ATOM   1194 C  CB    . VAL A 1 148 ? 48.914 176.282 25.714 1.00 46.46  ? 148 VAL A CB    1 
ATOM   1195 C  CG1   . VAL A 1 148 ? 48.434 177.446 26.546 1.00 40.69  ? 148 VAL A CG1   1 
ATOM   1196 C  CG2   . VAL A 1 148 ? 48.535 176.471 24.245 1.00 42.81  ? 148 VAL A CG2   1 
ATOM   1197 N  N     . LEU A 1 149 ? 50.118 173.775 25.339 1.00 48.37  ? 149 LEU A N     1 
ATOM   1198 C  CA    . LEU A 1 149 ? 50.454 172.485 24.744 1.00 47.57  ? 149 LEU A CA    1 
ATOM   1199 C  C     . LEU A 1 149 ? 50.007 172.473 23.305 1.00 47.72  ? 149 LEU A C     1 
ATOM   1200 O  O     . LEU A 1 149 ? 48.824 172.583 23.015 1.00 48.41  ? 149 LEU A O     1 
ATOM   1201 C  CB    . LEU A 1 149 ? 49.760 171.344 25.485 1.00 46.84  ? 149 LEU A CB    1 
ATOM   1202 C  CG    . LEU A 1 149 ? 50.220 171.012 26.901 1.00 45.67  ? 149 LEU A CG    1 
ATOM   1203 C  CD1   . LEU A 1 149 ? 49.356 169.889 27.422 1.00 45.84  ? 149 LEU A CD1   1 
ATOM   1204 C  CD2   . LEU A 1 149 ? 51.691 170.619 26.917 1.00 42.57  ? 149 LEU A CD2   1 
ATOM   1205 N  N     . PRO A 1 150 ? 50.956 172.340 22.379 1.00 47.68  ? 150 PRO A N     1 
ATOM   1206 C  CA    . PRO A 1 150 ? 50.646 172.400 20.955 1.00 47.96  ? 150 PRO A CA    1 
ATOM   1207 C  C     . PRO A 1 150 ? 49.957 171.120 20.534 1.00 48.85  ? 150 PRO A C     1 
ATOM   1208 O  O     . PRO A 1 150 ? 50.235 170.053 21.074 1.00 50.50  ? 150 PRO A O     1 
ATOM   1209 C  CB    . PRO A 1 150 ? 52.019 172.546 20.292 1.00 49.07  ? 150 PRO A CB    1 
ATOM   1210 C  CG    . PRO A 1 150 ? 52.996 172.816 21.435 1.00 48.47  ? 150 PRO A CG    1 
ATOM   1211 C  CD    . PRO A 1 150 ? 52.391 172.133 22.611 1.00 48.51  ? 150 PRO A CD    1 
ATOM   1212 N  N     . GLN A 1 151 ? 49.063 171.226 19.567 1.00 49.05  ? 151 GLN A N     1 
ATOM   1213 C  CA    . GLN A 1 151 ? 48.518 170.055 18.914 1.00 48.37  ? 151 GLN A CA    1 
ATOM   1214 C  C     . GLN A 1 151 ? 49.630 169.429 18.103 1.00 48.23  ? 151 GLN A C     1 
ATOM   1215 O  O     . GLN A 1 151 ? 50.371 170.146 17.440 1.00 48.34  ? 151 GLN A O     1 
ATOM   1216 C  CB    . GLN A 1 151 ? 47.423 170.472 17.961 1.00 51.73  ? 151 GLN A CB    1 
ATOM   1217 C  CG    . GLN A 1 151 ? 46.371 169.446 17.788 1.00 55.04  ? 151 GLN A CG    1 
ATOM   1218 C  CD    . GLN A 1 151 ? 45.316 169.612 18.820 1.00 57.71  ? 151 GLN A CD    1 
ATOM   1219 O  OE1   . GLN A 1 151 ? 44.698 170.679 18.923 1.00 57.35  ? 151 GLN A OE1   1 
ATOM   1220 N  NE2   . GLN A 1 151 ? 45.098 168.567 19.612 1.00 59.01  ? 151 GLN A NE2   1 
ATOM   1221 N  N     . GLY A 1 152 ? 49.740 168.103 18.142 1.00 47.47  ? 152 GLY A N     1 
ATOM   1222 C  CA    . GLY A 1 152 ? 50.627 167.405 17.229 1.00 44.62  ? 152 GLY A CA    1 
ATOM   1223 C  C     . GLY A 1 152 ? 52.076 167.313 17.676 1.00 45.07  ? 152 GLY A C     1 
ATOM   1224 O  O     . GLY A 1 152 ? 52.937 166.882 16.910 1.00 45.03  ? 152 GLY A O     1 
ATOM   1225 N  N     . TRP A 1 153 ? 52.363 167.709 18.910 1.00 44.57  ? 153 TRP A N     1 
ATOM   1226 C  CA    . TRP A 1 153 ? 53.696 167.496 19.463 1.00 44.97  ? 153 TRP A CA    1 
ATOM   1227 C  C     . TRP A 1 153 ? 53.770 166.244 20.347 1.00 44.85  ? 153 TRP A C     1 
ATOM   1228 O  O     . TRP A 1 153 ? 53.083 166.131 21.351 1.00 47.28  ? 153 TRP A O     1 
ATOM   1229 C  CB    . TRP A 1 153 ? 54.128 168.727 20.253 1.00 45.07  ? 153 TRP A CB    1 
ATOM   1230 C  CG    . TRP A 1 153 ? 55.433 168.572 20.979 1.00 45.96  ? 153 TRP A CG    1 
ATOM   1231 C  CD1   . TRP A 1 153 ? 56.666 168.399 20.429 1.00 45.60  ? 153 TRP A CD1   1 
ATOM   1232 C  CD2   . TRP A 1 153 ? 55.630 168.611 22.398 1.00 45.49  ? 153 TRP A CD2   1 
ATOM   1233 N  NE1   . TRP A 1 153 ? 57.623 168.330 21.419 1.00 44.53  ? 153 TRP A NE1   1 
ATOM   1234 C  CE2   . TRP A 1 153 ? 57.012 168.458 22.633 1.00 43.16  ? 153 TRP A CE2   1 
ATOM   1235 C  CE3   . TRP A 1 153 ? 54.772 168.760 23.488 1.00 43.99  ? 153 TRP A CE3   1 
ATOM   1236 C  CZ2   . TRP A 1 153 ? 57.550 168.450 23.902 1.00 43.25  ? 153 TRP A CZ2   1 
ATOM   1237 C  CZ3   . TRP A 1 153 ? 55.312 168.752 24.749 1.00 46.08  ? 153 TRP A CZ3   1 
ATOM   1238 C  CH2   . TRP A 1 153 ? 56.689 168.599 24.949 1.00 44.32  ? 153 TRP A CH2   1 
ATOM   1239 N  N     . LYS A 1 154 ? 54.604 165.300 19.949 1.00 44.25  ? 154 LYS A N     1 
ATOM   1240 C  CA    . LYS A 1 154 ? 54.942 164.122 20.753 1.00 44.17  ? 154 LYS A CA    1 
ATOM   1241 C  C     . LYS A 1 154 ? 54.596 164.169 22.263 1.00 44.18  ? 154 LYS A C     1 
ATOM   1242 O  O     . LYS A 1 154 ? 54.155 163.181 22.844 1.00 44.33  ? 154 LYS A O     1 
ATOM   1243 C  CB    . LYS A 1 154 ? 56.445 163.832 20.559 1.00 43.45  ? 154 LYS A CB    1 
ATOM   1244 C  CG    . LYS A 1 154 ? 57.030 162.648 21.313 1.00 40.59  ? 154 LYS A CG    1 
ATOM   1245 C  CD    . LYS A 1 154 ? 58.531 162.770 21.342 1.00 37.97  ? 154 LYS A CD    1 
ATOM   1246 C  CE    . LYS A 1 154 ? 59.158 161.415 21.481 1.00 42.14  ? 154 LYS A CE    1 
ATOM   1247 N  NZ    . LYS A 1 154 ? 60.500 161.361 20.841 1.00 44.79  ? 154 LYS A NZ    1 
ATOM   1248 N  N     . GLY A 1 155 ? 54.802 165.305 22.906 1.00 44.88  ? 155 GLY A N     1 
ATOM   1249 C  CA    . GLY A 1 155 ? 54.718 165.313 24.350 1.00 46.07  ? 155 GLY A CA    1 
ATOM   1250 C  C     . GLY A 1 155 ? 53.356 165.675 24.903 1.00 47.42  ? 155 GLY A C     1 
ATOM   1251 O  O     . GLY A 1 155 ? 53.035 165.338 26.047 1.00 47.67  ? 155 GLY A O     1 
ATOM   1252 N  N     . SER A 1 156 ? 52.550 166.357 24.097 1.00 46.23  ? 156 SER A N     1 
ATOM   1253 C  CA    . SER A 1 156 ? 51.364 167.017 24.607 1.00 45.58  ? 156 SER A CA    1 
ATOM   1254 C  C     . SER A 1 156 ? 50.330 166.074 25.217 1.00 45.31  ? 156 SER A C     1 
ATOM   1255 O  O     . SER A 1 156 ? 49.743 166.366 26.265 1.00 47.15  ? 156 SER A O     1 
ATOM   1256 C  CB    . SER A 1 156 ? 50.730 167.853 23.500 1.00 46.76  ? 156 SER A CB    1 
ATOM   1257 O  OG    . SER A 1 156 ? 51.596 168.916 23.124 1.00 50.55  ? 156 SER A OG    1 
ATOM   1258 N  N     . PRO A 1 157 ? 50.090 164.924 24.583 1.00 42.53  ? 157 PRO A N     1 
ATOM   1259 C  CA    . PRO A 1 157 ? 49.104 164.048 25.197 1.00 41.81  ? 157 PRO A CA    1 
ATOM   1260 C  C     . PRO A 1 157 ? 49.487 163.733 26.630 1.00 42.33  ? 157 PRO A C     1 
ATOM   1261 O  O     . PRO A 1 157 ? 48.827 164.197 27.556 1.00 46.13  ? 157 PRO A O     1 
ATOM   1262 C  CB    . PRO A 1 157 ? 49.117 162.818 24.305 1.00 41.92  ? 157 PRO A CB    1 
ATOM   1263 C  CG    . PRO A 1 157 ? 49.570 163.323 23.007 1.00 42.66  ? 157 PRO A CG    1 
ATOM   1264 C  CD    . PRO A 1 157 ? 50.599 164.367 23.328 1.00 42.69  ? 157 PRO A CD    1 
ATOM   1265 N  N     . ALA A 1 158 ? 50.561 162.972 26.812 1.00 39.89  ? 158 ALA A N     1 
ATOM   1266 C  CA    . ALA A 1 158 ? 51.060 162.613 28.146 1.00 37.94  ? 158 ALA A CA    1 
ATOM   1267 C  C     . ALA A 1 158 ? 51.024 163.737 29.179 1.00 37.45  ? 158 ALA A C     1 
ATOM   1268 O  O     . ALA A 1 158 ? 50.407 163.618 30.231 1.00 36.41  ? 158 ALA A O     1 
ATOM   1269 C  CB    . ALA A 1 158 ? 52.484 162.098 28.029 1.00 37.90  ? 158 ALA A CB    1 
ATOM   1270 N  N     . ILE A 1 159 ? 51.709 164.831 28.886 1.00 36.86  ? 159 ILE A N     1 
ATOM   1271 C  CA    . ILE A 1 159 ? 51.822 165.889 29.853 1.00 35.68  ? 159 ILE A CA    1 
ATOM   1272 C  C     . ILE A 1 159 ? 50.436 166.375 30.219 1.00 36.12  ? 159 ILE A C     1 
ATOM   1273 O  O     . ILE A 1 159 ? 50.233 166.884 31.313 1.00 38.20  ? 159 ILE A O     1 
ATOM   1274 C  CB    . ILE A 1 159 ? 52.653 167.058 29.306 1.00 36.15  ? 159 ILE A CB    1 
ATOM   1275 C  CG1   . ILE A 1 159 ? 54.096 166.603 29.064 1.00 36.40  ? 159 ILE A CG1   1 
ATOM   1276 C  CG2   . ILE A 1 159 ? 52.610 168.214 30.274 1.00 36.01  ? 159 ILE A CG2   1 
ATOM   1277 C  CD1   . ILE A 1 159 ? 55.016 167.692 28.529 1.00 33.28  ? 159 ILE A CD1   1 
ATOM   1278 N  N     . PHE A 1 160 ? 49.468 166.220 29.320 1.00 34.13  ? 160 PHE A N     1 
ATOM   1279 C  CA    . PHE A 1 160 ? 48.115 166.620 29.661 1.00 32.76  ? 160 PHE A CA    1 
ATOM   1280 C  C     . PHE A 1 160 ? 47.360 165.606 30.523 1.00 36.17  ? 160 PHE A C     1 
ATOM   1281 O  O     . PHE A 1 160 ? 46.628 165.976 31.435 1.00 37.31  ? 160 PHE A O     1 
ATOM   1282 C  CB    . PHE A 1 160 ? 47.305 166.885 28.419 1.00 29.07  ? 160 PHE A CB    1 
ATOM   1283 C  CG    . PHE A 1 160 ? 45.880 167.218 28.719 1.00 26.84  ? 160 PHE A CG    1 
ATOM   1284 C  CD1   . PHE A 1 160 ? 45.502 168.522 28.935 1.00 27.33  ? 160 PHE A CD1   1 
ATOM   1285 C  CD2   . PHE A 1 160 ? 44.927 166.220 28.836 1.00 24.73  ? 160 PHE A CD2   1 
ATOM   1286 C  CE1   . PHE A 1 160 ? 44.193 168.823 29.272 1.00 28.11  ? 160 PHE A CE1   1 
ATOM   1287 C  CE2   . PHE A 1 160 ? 43.637 166.513 29.167 1.00 24.77  ? 160 PHE A CE2   1 
ATOM   1288 C  CZ    . PHE A 1 160 ? 43.263 167.811 29.387 1.00 25.95  ? 160 PHE A CZ    1 
ATOM   1289 N  N     . GLN A 1 161 ? 47.520 164.323 30.225 1.00 38.06  ? 161 GLN A N     1 
ATOM   1290 C  CA    . GLN A 1 161 ? 46.922 163.275 31.036 1.00 39.42  ? 161 GLN A CA    1 
ATOM   1291 C  C     . GLN A 1 161 ? 47.491 163.382 32.448 1.00 40.82  ? 161 GLN A C     1 
ATOM   1292 O  O     . GLN A 1 161 ? 46.773 163.296 33.449 1.00 41.48  ? 161 GLN A O     1 
ATOM   1293 C  CB    . GLN A 1 161 ? 47.253 161.912 30.419 1.00 41.04  ? 161 GLN A CB    1 
ATOM   1294 C  CG    . GLN A 1 161 ? 46.667 161.740 29.027 1.00 46.93  ? 161 GLN A CG    1 
ATOM   1295 C  CD    . GLN A 1 161 ? 47.356 160.677 28.195 1.00 50.05  ? 161 GLN A CD    1 
ATOM   1296 O  OE1   . GLN A 1 161 ? 46.980 160.449 27.046 1.00 53.41  ? 161 GLN A OE1   1 
ATOM   1297 N  NE2   . GLN A 1 161 ? 48.368 160.027 28.760 1.00 52.13  ? 161 GLN A NE2   1 
ATOM   1298 N  N     . SER A 1 162 ? 48.799 163.594 32.518 1.00 41.50  ? 162 SER A N     1 
ATOM   1299 C  CA    . SER A 1 162 ? 49.481 163.750 33.789 1.00 40.35  ? 162 SER A CA    1 
ATOM   1300 C  C     . SER A 1 162 ? 48.902 164.924 34.579 1.00 40.80  ? 162 SER A C     1 
ATOM   1301 O  O     . SER A 1 162 ? 48.546 164.788 35.751 1.00 41.85  ? 162 SER A O     1 
ATOM   1302 C  CB    . SER A 1 162 ? 50.964 163.971 33.543 1.00 37.29  ? 162 SER A CB    1 
ATOM   1303 O  OG    . SER A 1 162 ? 51.626 164.200 34.766 1.00 38.35  ? 162 SER A OG    1 
ATOM   1304 N  N     . SER A 1 163 ? 48.803 166.072 33.926 1.00 39.56  ? 163 SER A N     1 
ATOM   1305 C  CA    . SER A 1 163 ? 48.279 167.255 34.569 1.00 40.28  ? 163 SER A CA    1 
ATOM   1306 C  C     . SER A 1 163 ? 46.837 167.036 34.961 1.00 40.81  ? 163 SER A C     1 
ATOM   1307 O  O     . SER A 1 163 ? 46.410 167.441 36.030 1.00 40.64  ? 163 SER A O     1 
ATOM   1308 C  CB    . SER A 1 163 ? 48.372 168.436 33.624 1.00 40.40  ? 163 SER A CB    1 
ATOM   1309 O  OG    . SER A 1 163 ? 49.704 168.581 33.189 1.00 43.03  ? 163 SER A OG    1 
ATOM   1310 N  N     . MET A 1 164 ? 46.084 166.387 34.089 1.00 41.26  ? 164 MET A N     1 
ATOM   1311 C  CA    . MET A 1 164 ? 44.689 166.150 34.370 1.00 41.34  ? 164 MET A CA    1 
ATOM   1312 C  C     . MET A 1 164 ? 44.571 165.389 35.696 1.00 42.48  ? 164 MET A C     1 
ATOM   1313 O  O     . MET A 1 164 ? 43.848 165.780 36.607 1.00 42.75  ? 164 MET A O     1 
ATOM   1314 C  CB    . MET A 1 164 ? 44.077 165.342 33.244 1.00 41.60  ? 164 MET A CB    1 
ATOM   1315 C  CG    . MET A 1 164 ? 42.597 165.240 33.373 1.00 42.96  ? 164 MET A CG    1 
ATOM   1316 S  SD    . MET A 1 164 ? 41.967 166.896 33.570 1.00 46.49  ? 164 MET A SD    1 
ATOM   1317 C  CE    . MET A 1 164 ? 40.189 166.588 33.649 1.00 43.46  ? 164 MET A CE    1 
ATOM   1318 N  N     . THR A 1 165 ? 45.303 164.296 35.796 1.00 42.04  ? 165 THR A N     1 
ATOM   1319 C  CA    . THR A 1 165 ? 45.339 163.513 37.016 1.00 41.17  ? 165 THR A CA    1 
ATOM   1320 C  C     . THR A 1 165 ? 45.647 164.378 38.226 1.00 40.59  ? 165 THR A C     1 
ATOM   1321 O  O     . THR A 1 165 ? 44.935 164.363 39.219 1.00 40.95  ? 165 THR A O     1 
ATOM   1322 C  CB    . THR A 1 165 ? 46.416 162.448 36.897 1.00 40.93  ? 165 THR A CB    1 
ATOM   1323 O  OG1   . THR A 1 165 ? 46.043 161.514 35.876 1.00 38.02  ? 165 THR A OG1   1 
ATOM   1324 C  CG2   . THR A 1 165 ? 46.618 161.757 38.217 1.00 39.82  ? 165 THR A CG2   1 
ATOM   1325 N  N     . LYS A 1 166 ? 46.729 165.130 38.123 1.00 41.35  ? 166 LYS A N     1 
ATOM   1326 C  CA    . LYS A 1 166 ? 47.243 165.919 39.224 1.00 41.59  ? 166 LYS A CA    1 
ATOM   1327 C  C     . LYS A 1 166 ? 46.256 167.013 39.644 1.00 40.22  ? 166 LYS A C     1 
ATOM   1328 O  O     . LYS A 1 166 ? 46.253 167.429 40.797 1.00 40.43  ? 166 LYS A O     1 
ATOM   1329 C  CB    . LYS A 1 166 ? 48.589 166.518 38.802 1.00 44.32  ? 166 LYS A CB    1 
ATOM   1330 C  CG    . LYS A 1 166 ? 49.279 167.380 39.842 1.00 50.98  ? 166 LYS A CG    1 
ATOM   1331 C  CD    . LYS A 1 166 ? 50.757 167.607 39.483 1.00 55.50  ? 166 LYS A CD    1 
ATOM   1332 C  CE    . LYS A 1 166 ? 51.495 166.278 39.215 1.00 57.11  ? 166 LYS A CE    1 
ATOM   1333 N  NZ    . LYS A 1 166 ? 52.968 166.316 39.545 1.00 58.22  ? 166 LYS A NZ    1 
ATOM   1334 N  N     . ILE A 1 167 ? 45.422 167.471 38.708 1.00 38.55  ? 167 ILE A N     1 
ATOM   1335 C  CA    . ILE A 1 167 ? 44.324 168.413 39.001 1.00 35.96  ? 167 ILE A CA    1 
ATOM   1336 C  C     . ILE A 1 167 ? 43.096 167.767 39.645 1.00 36.47  ? 167 ILE A C     1 
ATOM   1337 O  O     . ILE A 1 167 ? 42.442 168.370 40.485 1.00 36.40  ? 167 ILE A O     1 
ATOM   1338 C  CB    . ILE A 1 167 ? 43.815 169.135 37.736 1.00 32.84  ? 167 ILE A CB    1 
ATOM   1339 C  CG1   . ILE A 1 167 ? 44.758 170.267 37.348 1.00 33.84  ? 167 ILE A CG1   1 
ATOM   1340 C  CG2   . ILE A 1 167 ? 42.437 169.683 37.975 1.00 26.66  ? 167 ILE A CG2   1 
ATOM   1341 C  CD1   . ILE A 1 167 ? 44.345 170.976 36.077 1.00 34.62  ? 167 ILE A CD1   1 
ATOM   1342 N  N     . LEU A 1 168 ? 42.786 166.544 39.244 1.00 36.43  ? 168 LEU A N     1 
ATOM   1343 C  CA    . LEU A 1 168 ? 41.622 165.858 39.744 1.00 37.88  ? 168 LEU A CA    1 
ATOM   1344 C  C     . LEU A 1 168 ? 41.878 165.269 41.115 1.00 40.81  ? 168 LEU A C     1 
ATOM   1345 O  O     . LEU A 1 168 ? 40.939 164.964 41.849 1.00 43.06  ? 168 LEU A O     1 
ATOM   1346 C  CB    . LEU A 1 168 ? 41.228 164.749 38.783 1.00 37.89  ? 168 LEU A CB    1 
ATOM   1347 C  CG    . LEU A 1 168 ? 40.044 165.040 37.874 1.00 39.99  ? 168 LEU A CG    1 
ATOM   1348 C  CD1   . LEU A 1 168 ? 39.428 166.361 38.290 1.00 40.57  ? 168 LEU A CD1   1 
ATOM   1349 C  CD2   . LEU A 1 168 ? 40.493 165.066 36.423 1.00 39.80  ? 168 LEU A CD2   1 
ATOM   1350 N  N     . GLU A 1 169 ? 43.145 165.089 41.464 1.00 43.83  ? 169 GLU A N     1 
ATOM   1351 C  CA    . GLU A 1 169 ? 43.476 164.412 42.719 1.00 46.75  ? 169 GLU A CA    1 
ATOM   1352 C  C     . GLU A 1 169 ? 42.774 165.093 43.911 1.00 46.12  ? 169 GLU A C     1 
ATOM   1353 O  O     . GLU A 1 169 ? 41.986 164.460 44.612 1.00 45.07  ? 169 GLU A O     1 
ATOM   1354 C  CB    . GLU A 1 169 ? 45.000 164.386 42.922 1.00 51.61  ? 169 GLU A CB    1 
ATOM   1355 C  CG    . GLU A 1 169 ? 45.498 163.415 44.001 1.00 57.96  ? 169 GLU A CG    1 
ATOM   1356 C  CD    . GLU A 1 169 ? 47.017 163.171 43.928 1.00 62.70  ? 169 GLU A CD    1 
ATOM   1357 O  OE1   . GLU A 1 169 ? 47.698 163.798 43.073 1.00 63.55  ? 169 GLU A OE1   1 
ATOM   1358 O  OE2   . GLU A 1 169 ? 47.529 162.347 44.727 1.00 64.19  ? 169 GLU A OE2   1 
ATOM   1359 N  N     . PRO A 1 170 ? 43.013 166.402 44.123 1.00 44.67  ? 170 PRO A N     1 
ATOM   1360 C  CA    . PRO A 1 170 ? 42.293 167.093 45.189 1.00 43.86  ? 170 PRO A CA    1 
ATOM   1361 C  C     . PRO A 1 170 ? 40.818 166.708 45.291 1.00 43.93  ? 170 PRO A C     1 
ATOM   1362 O  O     . PRO A 1 170 ? 40.362 166.334 46.366 1.00 43.82  ? 170 PRO A O     1 
ATOM   1363 C  CB    . PRO A 1 170 ? 42.482 168.577 44.845 1.00 44.51  ? 170 PRO A CB    1 
ATOM   1364 C  CG    . PRO A 1 170 ? 43.772 168.625 44.134 1.00 43.82  ? 170 PRO A CG    1 
ATOM   1365 C  CD    . PRO A 1 170 ? 43.836 167.340 43.336 1.00 45.73  ? 170 PRO A CD    1 
ATOM   1366 N  N     . PHE A 1 171 ? 40.080 166.790 44.183 1.00 43.49  ? 171 PHE A N     1 
ATOM   1367 C  CA    . PHE A 1 171 ? 38.655 166.445 44.193 1.00 42.48  ? 171 PHE A CA    1 
ATOM   1368 C  C     . PHE A 1 171 ? 38.451 164.975 44.550 1.00 43.76  ? 171 PHE A C     1 
ATOM   1369 O  O     . PHE A 1 171 ? 37.541 164.613 45.294 1.00 44.50  ? 171 PHE A O     1 
ATOM   1370 C  CB    . PHE A 1 171 ? 38.035 166.714 42.825 1.00 38.63  ? 171 PHE A CB    1 
ATOM   1371 C  CG    . PHE A 1 171 ? 36.537 166.662 42.821 1.00 34.31  ? 171 PHE A CG    1 
ATOM   1372 C  CD1   . PHE A 1 171 ? 35.794 167.830 42.891 1.00 33.14  ? 171 PHE A CD1   1 
ATOM   1373 C  CD2   . PHE A 1 171 ? 35.869 165.451 42.746 1.00 31.98  ? 171 PHE A CD2   1 
ATOM   1374 C  CE1   . PHE A 1 171 ? 34.405 167.791 42.893 1.00 32.58  ? 171 PHE A CE1   1 
ATOM   1375 C  CE2   . PHE A 1 171 ? 34.481 165.401 42.748 1.00 32.65  ? 171 PHE A CE2   1 
ATOM   1376 C  CZ    . PHE A 1 171 ? 33.746 166.577 42.820 1.00 31.62  ? 171 PHE A CZ    1 
ATOM   1377 N  N     . ARG A 1 172 ? 39.308 164.127 44.005 1.00 44.74  ? 172 ARG A N     1 
ATOM   1378 C  CA    . ARG A 1 172 ? 39.187 162.706 44.232 1.00 47.00  ? 172 ARG A CA    1 
ATOM   1379 C  C     . ARG A 1 172 ? 39.392 162.373 45.727 1.00 49.16  ? 172 ARG A C     1 
ATOM   1380 O  O     . ARG A 1 172 ? 38.624 161.595 46.313 1.00 49.15  ? 172 ARG A O     1 
ATOM   1381 C  CB    . ARG A 1 172 ? 40.202 161.966 43.339 1.00 45.13  ? 172 ARG A CB    1 
ATOM   1382 C  CG    . ARG A 1 172 ? 39.589 161.197 42.118 1.00 43.89  ? 172 ARG A CG    1 
ATOM   1383 C  CD    . ARG A 1 172 ? 40.680 160.805 41.076 1.00 42.20  ? 172 ARG A CD    1 
ATOM   1384 N  NE    . ARG A 1 172 ? 40.124 160.209 39.855 1.00 42.35  ? 172 ARG A NE    1 
ATOM   1385 C  CZ    . ARG A 1 172 ? 40.605 160.429 38.623 1.00 42.70  ? 172 ARG A CZ    1 
ATOM   1386 N  NH1   . ARG A 1 172 ? 41.648 161.243 38.466 1.00 43.71  ? 172 ARG A NH1   1 
ATOM   1387 N  NH2   . ARG A 1 172 ? 40.069 159.812 37.551 1.00 44.22  ? 172 ARG A NH2   1 
ATOM   1388 N  N     . LYS A 1 173 ? 40.410 162.971 46.347 1.00 50.13  ? 173 LYS A N     1 
ATOM   1389 C  CA    . LYS A 1 173 ? 40.603 162.825 47.789 1.00 50.80  ? 173 LYS A CA    1 
ATOM   1390 C  C     . LYS A 1 173 ? 39.285 163.101 48.507 1.00 50.31  ? 173 LYS A C     1 
ATOM   1391 O  O     . LYS A 1 173 ? 38.813 162.291 49.299 1.00 50.96  ? 173 LYS A O     1 
ATOM   1392 C  CB    . LYS A 1 173 ? 41.657 163.811 48.298 1.00 51.64  ? 173 LYS A CB    1 
ATOM   1393 C  CG    . LYS A 1 173 ? 43.049 163.597 47.768 1.00 51.41  ? 173 LYS A CG    1 
ATOM   1394 C  CD    . LYS A 1 173 ? 43.514 162.211 48.059 1.00 53.82  ? 173 LYS A CD    1 
ATOM   1395 C  CE    . LYS A 1 173 ? 44.979 162.085 47.735 1.00 57.90  ? 173 LYS A CE    1 
ATOM   1396 N  NZ    . LYS A 1 173 ? 45.349 160.649 47.557 1.00 61.80  ? 173 LYS A NZ    1 
ATOM   1397 N  N     . GLN A 1 174 ? 38.695 164.248 48.206 1.00 49.90  ? 174 GLN A N     1 
ATOM   1398 C  CA    . GLN A 1 174 ? 37.547 164.739 48.943 1.00 51.17  ? 174 GLN A CA    1 
ATOM   1399 C  C     . GLN A 1 174 ? 36.241 164.059 48.632 1.00 51.46  ? 174 GLN A C     1 
ATOM   1400 O  O     . GLN A 1 174 ? 35.282 164.205 49.377 1.00 50.71  ? 174 GLN A O     1 
ATOM   1401 C  CB    . GLN A 1 174 ? 37.373 166.213 48.693 1.00 51.97  ? 174 GLN A CB    1 
ATOM   1402 C  CG    . GLN A 1 174 ? 38.317 167.029 49.475 1.00 57.61  ? 174 GLN A CG    1 
ATOM   1403 C  CD    . GLN A 1 174 ? 37.591 168.039 50.274 1.00 61.10  ? 174 GLN A CD    1 
ATOM   1404 O  OE1   . GLN A 1 174 ? 36.951 167.709 51.274 1.00 62.97  ? 174 GLN A OE1   1 
ATOM   1405 N  NE2   . GLN A 1 174 ? 37.662 169.294 49.840 1.00 63.39  ? 174 GLN A NE2   1 
ATOM   1406 N  N     . ASN A 1 175 ? 36.188 163.348 47.515 1.00 52.08  ? 175 ASN A N     1 
ATOM   1407 C  CA    . ASN A 1 175 ? 34.951 162.714 47.092 1.00 52.20  ? 175 ASN A CA    1 
ATOM   1408 C  C     . ASN A 1 175 ? 35.227 161.262 46.768 1.00 52.40  ? 175 ASN A C     1 
ATOM   1409 O  O     . ASN A 1 175 ? 34.933 160.781 45.679 1.00 53.50  ? 175 ASN A O     1 
ATOM   1410 C  CB    . ASN A 1 175 ? 34.385 163.444 45.878 1.00 53.12  ? 175 ASN A CB    1 
ATOM   1411 C  CG    . ASN A 1 175 ? 34.231 164.934 46.127 1.00 53.93  ? 175 ASN A CG    1 
ATOM   1412 O  OD1   . ASN A 1 175 ? 33.217 165.388 46.648 1.00 54.33  ? 175 ASN A OD1   1 
ATOM   1413 N  ND2   . ASN A 1 175 ? 35.249 165.697 45.769 1.00 55.25  ? 175 ASN A ND2   1 
ATOM   1414 N  N     . PRO A 1 176 ? 35.792 160.537 47.734 1.00 52.11  ? 176 PRO A N     1 
ATOM   1415 C  CA    . PRO A 1 176 ? 36.272 159.178 47.505 1.00 50.93  ? 176 PRO A CA    1 
ATOM   1416 C  C     . PRO A 1 176 ? 35.203 158.276 46.947 1.00 50.45  ? 176 PRO A C     1 
ATOM   1417 O  O     . PRO A 1 176 ? 35.488 157.202 46.449 1.00 48.93  ? 176 PRO A O     1 
ATOM   1418 C  CB    . PRO A 1 176 ? 36.743 158.729 48.880 1.00 52.24  ? 176 PRO A CB    1 
ATOM   1419 C  CG    . PRO A 1 176 ? 36.042 159.623 49.846 1.00 52.64  ? 176 PRO A CG    1 
ATOM   1420 C  CD    . PRO A 1 176 ? 35.883 160.926 49.151 1.00 52.40  ? 176 PRO A CD    1 
ATOM   1421 N  N     . ASP A 1 177 ? 33.960 158.713 47.022 1.00 52.53  ? 177 ASP A N     1 
ATOM   1422 C  CA    . ASP A 1 177 ? 32.871 157.845 46.627 1.00 54.80  ? 177 ASP A CA    1 
ATOM   1423 C  C     . ASP A 1 177 ? 32.215 158.314 45.336 1.00 54.39  ? 177 ASP A C     1 
ATOM   1424 O  O     . ASP A 1 177 ? 31.289 157.679 44.822 1.00 54.53  ? 177 ASP A O     1 
ATOM   1425 C  CB    . ASP A 1 177 ? 31.877 157.747 47.779 1.00 59.13  ? 177 ASP A CB    1 
ATOM   1426 C  CG    . ASP A 1 177 ? 32.537 157.226 49.077 1.00 65.85  ? 177 ASP A CG    1 
ATOM   1427 O  OD1   . ASP A 1 177 ? 32.471 157.943 50.113 1.00 67.62  ? 177 ASP A OD1   1 
ATOM   1428 O  OD2   . ASP A 1 177 ? 33.122 156.103 49.060 1.00 65.65  ? 177 ASP A OD2   1 
ATOM   1429 N  N     . ILE A 1 178 ? 32.719 159.435 44.820 1.00 53.14  ? 178 ILE A N     1 
ATOM   1430 C  CA    . ILE A 1 178 ? 32.538 159.834 43.421 1.00 50.18  ? 178 ILE A CA    1 
ATOM   1431 C  C     . ILE A 1 178 ? 33.594 159.098 42.571 1.00 49.11  ? 178 ILE A C     1 
ATOM   1432 O  O     . ILE A 1 178 ? 34.799 159.205 42.834 1.00 48.63  ? 178 ILE A O     1 
ATOM   1433 C  CB    . ILE A 1 178 ? 32.719 161.389 43.255 1.00 48.10  ? 178 ILE A CB    1 
ATOM   1434 C  CG1   . ILE A 1 178 ? 31.597 162.138 43.972 1.00 48.56  ? 178 ILE A CG1   1 
ATOM   1435 C  CG2   . ILE A 1 178 ? 32.714 161.779 41.791 1.00 46.19  ? 178 ILE A CG2   1 
ATOM   1436 C  CD1   . ILE A 1 178 ? 30.229 162.026 43.297 1.00 47.72  ? 178 ILE A CD1   1 
ATOM   1437 N  N     . VAL A 1 179 ? 33.142 158.343 41.571 1.00 45.88  ? 179 VAL A N     1 
ATOM   1438 C  CA    . VAL A 1 179 ? 34.062 157.694 40.654 1.00 45.27  ? 179 VAL A CA    1 
ATOM   1439 C  C     . VAL A 1 179 ? 34.213 158.519 39.385 1.00 45.67  ? 179 VAL A C     1 
ATOM   1440 O  O     . VAL A 1 179 ? 33.233 158.877 38.741 1.00 48.76  ? 179 VAL A O     1 
ATOM   1441 C  CB    . VAL A 1 179 ? 33.582 156.269 40.289 1.00 44.55  ? 179 VAL A CB    1 
ATOM   1442 C  CG1   . VAL A 1 179 ? 32.179 156.316 39.764 1.00 45.33  ? 179 VAL A CG1   1 
ATOM   1443 C  CG2   . VAL A 1 179 ? 34.499 155.656 39.247 1.00 43.82  ? 179 VAL A CG2   1 
ATOM   1444 N  N     . ILE A 1 180 ? 35.443 158.835 39.021 1.00 44.02  ? 180 ILE A N     1 
ATOM   1445 C  CA    . ILE A 1 180 ? 35.658 159.651 37.841 1.00 42.26  ? 180 ILE A CA    1 
ATOM   1446 C  C     . ILE A 1 180 ? 36.512 158.893 36.858 1.00 42.69  ? 180 ILE A C     1 
ATOM   1447 O  O     . ILE A 1 180 ? 37.665 158.600 37.148 1.00 43.52  ? 180 ILE A O     1 
ATOM   1448 C  CB    . ILE A 1 180 ? 36.371 160.953 38.203 1.00 41.06  ? 180 ILE A CB    1 
ATOM   1449 C  CG1   . ILE A 1 180 ? 35.512 161.760 39.164 1.00 37.97  ? 180 ILE A CG1   1 
ATOM   1450 C  CG2   . ILE A 1 180 ? 36.630 161.778 36.972 1.00 41.58  ? 180 ILE A CG2   1 
ATOM   1451 C  CD1   . ILE A 1 180 ? 36.028 163.133 39.358 1.00 35.71  ? 180 ILE A CD1   1 
ATOM   1452 N  N     . TYR A 1 181 ? 35.947 158.563 35.699 1.00 43.11  ? 181 TYR A N     1 
ATOM   1453 C  CA    . TYR A 1 181 ? 36.734 157.968 34.626 1.00 42.46  ? 181 TYR A CA    1 
ATOM   1454 C  C     . TYR A 1 181 ? 37.312 159.070 33.770 1.00 42.07  ? 181 TYR A C     1 
ATOM   1455 O  O     . TYR A 1 181 ? 36.612 159.980 33.354 1.00 41.19  ? 181 TYR A O     1 
ATOM   1456 C  CB    . TYR A 1 181 ? 35.886 157.030 33.774 1.00 41.31  ? 181 TYR A CB    1 
ATOM   1457 C  CG    . TYR A 1 181 ? 35.970 155.580 34.207 1.00 42.46  ? 181 TYR A CG    1 
ATOM   1458 C  CD1   . TYR A 1 181 ? 35.211 155.116 35.261 1.00 42.31  ? 181 TYR A CD1   1 
ATOM   1459 C  CD2   . TYR A 1 181 ? 36.792 154.670 33.548 1.00 42.01  ? 181 TYR A CD2   1 
ATOM   1460 C  CE1   . TYR A 1 181 ? 35.255 153.798 35.651 1.00 41.69  ? 181 TYR A CE1   1 
ATOM   1461 C  CE2   . TYR A 1 181 ? 36.839 153.340 33.937 1.00 41.79  ? 181 TYR A CE2   1 
ATOM   1462 C  CZ    . TYR A 1 181 ? 36.062 152.911 34.994 1.00 41.76  ? 181 TYR A CZ    1 
ATOM   1463 O  OH    . TYR A 1 181 ? 36.064 151.590 35.402 1.00 41.55  ? 181 TYR A OH    1 
ATOM   1464 N  N     . GLN A 1 182 ? 38.607 158.987 33.520 1.00 42.96  ? 182 GLN A N     1 
ATOM   1465 C  CA    . GLN A 1 182 ? 39.333 160.129 32.993 1.00 45.25  ? 182 GLN A CA    1 
ATOM   1466 C  C     . GLN A 1 182 ? 40.075 159.750 31.726 1.00 44.21  ? 182 GLN A C     1 
ATOM   1467 O  O     . GLN A 1 182 ? 41.182 159.221 31.786 1.00 45.22  ? 182 GLN A O     1 
ATOM   1468 C  CB    . GLN A 1 182 ? 40.317 160.623 34.049 1.00 46.03  ? 182 GLN A CB    1 
ATOM   1469 C  CG    . GLN A 1 182 ? 41.210 161.741 33.608 1.00 50.10  ? 182 GLN A CG    1 
ATOM   1470 C  CD    . GLN A 1 182 ? 42.563 161.693 34.294 1.00 52.81  ? 182 GLN A CD    1 
ATOM   1471 O  OE1   . GLN A 1 182 ? 42.676 161.296 35.463 1.00 53.93  ? 182 GLN A OE1   1 
ATOM   1472 N  NE2   . GLN A 1 182 ? 43.602 162.092 33.567 1.00 53.65  ? 182 GLN A NE2   1 
ATOM   1473 N  N     . TYR A 1 183 ? 39.467 160.008 30.576 1.00 42.56  ? 183 TYR A N     1 
ATOM   1474 C  CA    . TYR A 1 183 ? 40.143 159.709 29.331 1.00 43.59  ? 183 TYR A CA    1 
ATOM   1475 C  C     . TYR A 1 183 ? 40.445 160.961 28.534 1.00 44.45  ? 183 TYR A C     1 
ATOM   1476 O  O     . TYR A 1 183 ? 39.539 161.602 28.035 1.00 45.60  ? 183 TYR A O     1 
ATOM   1477 C  CB    . TYR A 1 183 ? 39.312 158.769 28.470 1.00 43.38  ? 183 TYR A CB    1 
ATOM   1478 C  CG    . TYR A 1 183 ? 40.154 158.111 27.408 1.00 43.90  ? 183 TYR A CG    1 
ATOM   1479 C  CD1   . TYR A 1 183 ? 41.006 157.071 27.735 1.00 43.54  ? 183 TYR A CD1   1 
ATOM   1480 C  CD2   . TYR A 1 183 ? 40.149 158.568 26.094 1.00 44.57  ? 183 TYR A CD2   1 
ATOM   1481 C  CE1   . TYR A 1 183 ? 41.832 156.504 26.799 1.00 45.71  ? 183 TYR A CE1   1 
ATOM   1482 C  CE2   . TYR A 1 183 ? 40.980 158.001 25.139 1.00 45.77  ? 183 TYR A CE2   1 
ATOM   1483 C  CZ    . TYR A 1 183 ? 41.823 156.967 25.502 1.00 46.96  ? 183 TYR A CZ    1 
ATOM   1484 O  OH    . TYR A 1 183 ? 42.670 156.386 24.582 1.00 48.32  ? 183 TYR A OH    1 
ATOM   1485 N  N     . MET A 1 184 ? 41.725 161.286 28.390 1.00 45.35  ? 184 MET A N     1 
ATOM   1486 C  CA    . MET A 1 184 ? 42.129 162.566 27.828 1.00 45.84  ? 184 MET A CA    1 
ATOM   1487 C  C     . MET A 1 184 ? 41.300 163.668 28.451 1.00 46.37  ? 184 MET A C     1 
ATOM   1488 O  O     . MET A 1 184 ? 41.286 163.818 29.667 1.00 48.28  ? 184 MET A O     1 
ATOM   1489 C  CB    . MET A 1 184 ? 41.950 162.583 26.322 1.00 48.42  ? 184 MET A CB    1 
ATOM   1490 C  CG    . MET A 1 184 ? 42.817 163.610 25.655 1.00 52.81  ? 184 MET A CG    1 
ATOM   1491 S  SD    . MET A 1 184 ? 44.559 163.334 26.055 1.00 63.39  ? 184 MET A SD    1 
ATOM   1492 C  CE    . MET A 1 184 ? 45.080 162.247 24.670 1.00 55.92  ? 184 MET A CE    1 
ATOM   1493 N  N     . ASP A 1 185 ? 40.593 164.436 27.635 1.00 45.96  ? 185 ASP A N     1 
ATOM   1494 C  CA    . ASP A 1 185 ? 39.746 165.490 28.177 1.00 46.31  ? 185 ASP A CA    1 
ATOM   1495 C  C     . ASP A 1 185 ? 38.311 165.041 28.455 1.00 44.96  ? 185 ASP A C     1 
ATOM   1496 O  O     . ASP A 1 185 ? 37.451 165.862 28.756 1.00 44.91  ? 185 ASP A O     1 
ATOM   1497 C  CB    . ASP A 1 185 ? 39.742 166.704 27.240 1.00 49.00  ? 185 ASP A CB    1 
ATOM   1498 C  CG    . ASP A 1 185 ? 39.452 166.329 25.803 1.00 50.09  ? 185 ASP A CG    1 
ATOM   1499 O  OD1   . ASP A 1 185 ? 39.134 165.153 25.569 1.00 49.52  ? 185 ASP A OD1   1 
ATOM   1500 O  OD2   . ASP A 1 185 ? 39.541 167.205 24.915 1.00 51.83  ? 185 ASP A OD2   1 
ATOM   1501 N  N     . ASP A 1 186 ? 38.064 163.741 28.365 1.00 44.53  ? 186 ASP A N     1 
ATOM   1502 C  CA    . ASP A 1 186 ? 36.741 163.170 28.636 1.00 46.17  ? 186 ASP A CA    1 
ATOM   1503 C  C     . ASP A 1 186 ? 36.564 162.804 30.116 1.00 46.02  ? 186 ASP A C     1 
ATOM   1504 O  O     . ASP A 1 186 ? 37.460 162.248 30.745 1.00 48.19  ? 186 ASP A O     1 
ATOM   1505 C  CB    . ASP A 1 186 ? 36.528 161.911 27.784 1.00 47.61  ? 186 ASP A CB    1 
ATOM   1506 C  CG    . ASP A 1 186 ? 35.088 161.729 27.355 1.00 48.51  ? 186 ASP A CG    1 
ATOM   1507 O  OD1   . ASP A 1 186 ? 34.555 160.603 27.448 1.00 47.66  ? 186 ASP A OD1   1 
ATOM   1508 O  OD2   . ASP A 1 186 ? 34.491 162.722 26.910 1.00 50.66  ? 186 ASP A OD2   1 
ATOM   1509 N  N     . LEU A 1 187 ? 35.399 163.106 30.669 1.00 44.87  ? 187 LEU A N     1 
ATOM   1510 C  CA    . LEU A 1 187 ? 35.105 162.719 32.031 1.00 43.19  ? 187 LEU A CA    1 
ATOM   1511 C  C     . LEU A 1 187 ? 33.756 162.022 32.132 1.00 43.70  ? 187 LEU A C     1 
ATOM   1512 O  O     . LEU A 1 187 ? 32.725 162.580 31.766 1.00 45.22  ? 187 LEU A O     1 
ATOM   1513 C  CB    . LEU A 1 187 ? 35.117 163.941 32.932 1.00 42.69  ? 187 LEU A CB    1 
ATOM   1514 C  CG    . LEU A 1 187 ? 36.466 164.619 33.173 1.00 43.37  ? 187 LEU A CG    1 
ATOM   1515 C  CD1   . LEU A 1 187 ? 36.264 165.832 34.061 1.00 39.00  ? 187 LEU A CD1   1 
ATOM   1516 C  CD2   . LEU A 1 187 ? 37.437 163.637 33.824 1.00 43.33  ? 187 LEU A CD2   1 
ATOM   1517 N  N     . TYR A 1 188 ? 33.785 160.788 32.612 1.00 41.93  ? 188 TYR A N     1 
ATOM   1518 C  CA    . TYR A 1 188 ? 32.603 160.104 33.092 1.00 41.75  ? 188 TYR A CA    1 
ATOM   1519 C  C     . TYR A 1 188 ? 32.659 160.194 34.616 1.00 43.16  ? 188 TYR A C     1 
ATOM   1520 O  O     . TYR A 1 188 ? 33.710 159.979 35.229 1.00 43.59  ? 188 TYR A O     1 
ATOM   1521 C  CB    . TYR A 1 188 ? 32.636 158.651 32.634 1.00 40.62  ? 188 TYR A CB    1 
ATOM   1522 C  CG    . TYR A 1 188 ? 31.700 157.711 33.350 1.00 40.07  ? 188 TYR A CG    1 
ATOM   1523 C  CD1   . TYR A 1 188 ? 32.086 157.087 34.532 1.00 40.75  ? 188 TYR A CD1   1 
ATOM   1524 C  CD2   . TYR A 1 188 ? 30.459 157.384 32.811 1.00 39.23  ? 188 TYR A CD2   1 
ATOM   1525 C  CE1   . TYR A 1 188 ? 31.265 156.157 35.157 1.00 40.41  ? 188 TYR A CE1   1 
ATOM   1526 C  CE2   . TYR A 1 188 ? 29.634 156.457 33.424 1.00 38.95  ? 188 TYR A CE2   1 
ATOM   1527 C  CZ    . TYR A 1 188 ? 30.043 155.844 34.597 1.00 40.11  ? 188 TYR A CZ    1 
ATOM   1528 O  OH    . TYR A 1 188 ? 29.241 154.900 35.201 1.00 42.38  ? 188 TYR A OH    1 
ATOM   1529 N  N     . VAL A 1 189 ? 31.529 160.543 35.218 1.00 41.39  ? 189 VAL A N     1 
ATOM   1530 C  CA    . VAL A 1 189 ? 31.464 160.734 36.645 1.00 38.61  ? 189 VAL A CA    1 
ATOM   1531 C  C     . VAL A 1 189 ? 30.240 160.015 37.153 1.00 38.88  ? 189 VAL A C     1 
ATOM   1532 O  O     . VAL A 1 189 ? 29.139 160.224 36.673 1.00 38.60  ? 189 VAL A O     1 
ATOM   1533 C  CB    . VAL A 1 189 ? 31.337 162.204 36.966 1.00 38.67  ? 189 VAL A CB    1 
ATOM   1534 C  CG1   . VAL A 1 189 ? 31.589 162.433 38.427 1.00 38.36  ? 189 VAL A CG1   1 
ATOM   1535 C  CG2   . VAL A 1 189 ? 32.298 162.985 36.128 1.00 37.55  ? 189 VAL A CG2   1 
ATOM   1536 N  N     . GLY A 1 190 ? 30.428 159.154 38.129 1.00 39.97  ? 190 GLY A N     1 
ATOM   1537 C  CA    . GLY A 1 190 ? 29.316 158.337 38.560 1.00 42.86  ? 190 GLY A CA    1 
ATOM   1538 C  C     . GLY A 1 190 ? 29.192 158.259 40.062 1.00 44.53  ? 190 GLY A C     1 
ATOM   1539 O  O     . GLY A 1 190 ? 30.195 158.239 40.778 1.00 43.39  ? 190 GLY A O     1 
ATOM   1540 N  N     . SER A 1 191 ? 27.954 158.220 40.538 1.00 46.49  ? 191 SER A N     1 
ATOM   1541 C  CA    . SER A 1 191 ? 27.713 158.155 41.959 1.00 50.22  ? 191 SER A CA    1 
ATOM   1542 C  C     . SER A 1 191 ? 26.446 157.419 42.286 1.00 52.55  ? 191 SER A C     1 
ATOM   1543 O  O     . SER A 1 191 ? 25.572 157.235 41.440 1.00 52.73  ? 191 SER A O     1 
ATOM   1544 C  CB    . SER A 1 191 ? 27.616 159.544 42.545 1.00 50.87  ? 191 SER A CB    1 
ATOM   1545 O  OG    . SER A 1 191 ? 26.555 160.222 41.924 1.00 54.95  ? 191 SER A OG    1 
ATOM   1546 N  N     . ASP A 1 192 ? 26.372 157.004 43.543 1.00 55.62  ? 192 ASP A N     1 
ATOM   1547 C  CA    . ASP A 1 192 ? 25.218 156.338 44.093 1.00 57.21  ? 192 ASP A CA    1 
ATOM   1548 C  C     . ASP A 1 192 ? 24.393 157.398 44.816 1.00 57.58  ? 192 ASP A C     1 
ATOM   1549 O  O     . ASP A 1 192 ? 24.051 157.239 45.975 1.00 59.31  ? 192 ASP A O     1 
ATOM   1550 C  CB    . ASP A 1 192 ? 25.687 155.253 45.062 1.00 59.33  ? 192 ASP A CB    1 
ATOM   1551 C  CG    . ASP A 1 192 ? 26.333 154.061 44.350 1.00 63.56  ? 192 ASP A CG    1 
ATOM   1552 O  OD1   . ASP A 1 192 ? 27.480 153.694 44.699 1.00 64.90  ? 192 ASP A OD1   1 
ATOM   1553 O  OD2   . ASP A 1 192 ? 25.687 153.482 43.446 1.00 64.38  ? 192 ASP A OD2   1 
ATOM   1554 N  N     . LEU A 1 193 ? 24.091 158.490 44.123 1.00 57.57  ? 193 LEU A N     1 
ATOM   1555 C  CA    . LEU A 1 193 ? 23.352 159.606 44.707 1.00 57.11  ? 193 LEU A CA    1 
ATOM   1556 C  C     . LEU A 1 193 ? 22.060 159.865 43.952 1.00 58.05  ? 193 LEU A C     1 
ATOM   1557 O  O     . LEU A 1 193 ? 21.886 159.406 42.829 1.00 59.32  ? 193 LEU A O     1 
ATOM   1558 C  CB    . LEU A 1 193 ? 24.192 160.884 44.676 1.00 55.96  ? 193 LEU A CB    1 
ATOM   1559 C  CG    . LEU A 1 193 ? 25.502 160.908 45.459 1.00 55.55  ? 193 LEU A CG    1 
ATOM   1560 C  CD1   . LEU A 1 193 ? 26.209 162.237 45.248 1.00 53.26  ? 193 LEU A CD1   1 
ATOM   1561 C  CD2   . LEU A 1 193 ? 25.209 160.684 46.928 1.00 54.42  ? 193 LEU A CD2   1 
ATOM   1562 N  N     . GLU A 1 194 ? 21.164 160.610 44.590 1.00 58.49  ? 194 GLU A N     1 
ATOM   1563 C  CA    . GLU A 1 194 ? 19.953 161.130 43.967 1.00 60.31  ? 194 GLU A CA    1 
ATOM   1564 C  C     . GLU A 1 194 ? 20.389 162.284 43.077 1.00 59.62  ? 194 GLU A C     1 
ATOM   1565 O  O     . GLU A 1 194 ? 21.259 163.048 43.469 1.00 62.36  ? 194 GLU A O     1 
ATOM   1566 C  CB    . GLU A 1 194 ? 19.003 161.659 45.052 1.00 65.86  ? 194 GLU A CB    1 
ATOM   1567 C  CG    . GLU A 1 194 ? 18.657 160.661 46.202 1.00 72.78  ? 194 GLU A CG    1 
ATOM   1568 C  CD    . GLU A 1 194 ? 19.799 160.431 47.222 1.00 75.14  ? 194 GLU A CD    1 
ATOM   1569 O  OE1   . GLU A 1 194 ? 19.713 159.447 48.003 1.00 73.87  ? 194 GLU A OE1   1 
ATOM   1570 O  OE2   . GLU A 1 194 ? 20.772 161.226 47.244 1.00 76.64  ? 194 GLU A OE2   1 
ATOM   1571 N  N     . ILE A 1 195 ? 19.803 162.433 41.894 1.00 57.79  ? 195 ILE A N     1 
ATOM   1572 C  CA    . ILE A 1 195 ? 20.341 163.396 40.931 1.00 56.19  ? 195 ILE A CA    1 
ATOM   1573 C  C     . ILE A 1 195 ? 20.623 164.732 41.558 1.00 55.37  ? 195 ILE A C     1 
ATOM   1574 O  O     . ILE A 1 195 ? 21.706 165.277 41.401 1.00 55.78  ? 195 ILE A O     1 
ATOM   1575 C  CB    . ILE A 1 195 ? 19.407 163.655 39.744 1.00 55.42  ? 195 ILE A CB    1 
ATOM   1576 C  CG1   . ILE A 1 195 ? 17.969 163.719 40.231 1.00 54.28  ? 195 ILE A CG1   1 
ATOM   1577 C  CG2   . ILE A 1 195 ? 19.636 162.613 38.664 1.00 55.06  ? 195 ILE A CG2   1 
ATOM   1578 C  CD1   . ILE A 1 195 ? 17.370 162.360 40.523 1.00 57.83  ? 195 ILE A CD1   1 
ATOM   1579 N  N     . GLY A 1 196 ? 19.649 165.263 42.275 1.00 54.57  ? 196 GLY A N     1 
ATOM   1580 C  CA    . GLY A 1 196 ? 19.855 166.549 42.909 1.00 54.82  ? 196 GLY A CA    1 
ATOM   1581 C  C     . GLY A 1 196 ? 21.247 166.720 43.487 1.00 54.74  ? 196 GLY A C     1 
ATOM   1582 O  O     . GLY A 1 196 ? 21.977 167.616 43.074 1.00 53.83  ? 196 GLY A O     1 
ATOM   1583 N  N     . GLN A 1 197 ? 21.616 165.859 44.437 1.00 56.61  ? 197 GLN A N     1 
ATOM   1584 C  CA    . GLN A 1 197 ? 22.901 165.963 45.131 1.00 58.15  ? 197 GLN A CA    1 
ATOM   1585 C  C     . GLN A 1 197 ? 24.046 165.497 44.241 1.00 57.24  ? 197 GLN A C     1 
ATOM   1586 O  O     . GLN A 1 197 ? 25.148 166.050 44.292 1.00 57.15  ? 197 GLN A O     1 
ATOM   1587 C  CB    . GLN A 1 197 ? 22.890 165.141 46.424 1.00 59.33  ? 197 GLN A CB    1 
ATOM   1588 C  CG    . GLN A 1 197 ? 24.051 165.463 47.365 1.00 61.67  ? 197 GLN A CG    1 
ATOM   1589 C  CD    . GLN A 1 197 ? 24.109 164.537 48.584 1.00 65.00  ? 197 GLN A CD    1 
ATOM   1590 O  OE1   . GLN A 1 197 ? 25.095 164.539 49.343 1.00 64.96  ? 197 GLN A OE1   1 
ATOM   1591 N  NE2   . GLN A 1 197 ? 23.054 163.741 48.776 1.00 63.79  ? 197 GLN A NE2   1 
ATOM   1592 N  N     . HIS A 1 198 ? 23.779 164.489 43.417 1.00 55.37  ? 198 HIS A N     1 
ATOM   1593 C  CA    . HIS A 1 198 ? 24.721 164.115 42.370 1.00 54.97  ? 198 HIS A CA    1 
ATOM   1594 C  C     . HIS A 1 198 ? 25.090 165.343 41.556 1.00 54.82  ? 198 HIS A C     1 
ATOM   1595 O  O     . HIS A 1 198 ? 26.260 165.684 41.406 1.00 55.72  ? 198 HIS A O     1 
ATOM   1596 C  CB    . HIS A 1 198 ? 24.113 163.072 41.435 1.00 52.93  ? 198 HIS A CB    1 
ATOM   1597 C  CG    . HIS A 1 198 ? 24.934 162.824 40.210 1.00 51.74  ? 198 HIS A CG    1 
ATOM   1598 N  ND1   . HIS A 1 198 ? 25.946 161.891 40.170 1.00 50.09  ? 198 HIS A ND1   1 
ATOM   1599 C  CD2   . HIS A 1 198 ? 24.909 163.405 38.989 1.00 52.40  ? 198 HIS A CD2   1 
ATOM   1600 C  CE1   . HIS A 1 198 ? 26.511 161.908 38.977 1.00 52.04  ? 198 HIS A CE1   1 
ATOM   1601 N  NE2   . HIS A 1 198 ? 25.901 162.820 38.240 1.00 52.12  ? 198 HIS A NE2   1 
ATOM   1602 N  N     . ARG A 1 199 ? 24.067 166.007 41.039 1.00 54.78  ? 199 ARG A N     1 
ATOM   1603 C  CA    . ARG A 1 199 ? 24.244 167.186 40.216 1.00 53.65  ? 199 ARG A CA    1 
ATOM   1604 C  C     . ARG A 1 199 ? 25.083 168.230 40.912 1.00 53.09  ? 199 ARG A C     1 
ATOM   1605 O  O     . ARG A 1 199 ? 25.890 168.898 40.270 1.00 54.38  ? 199 ARG A O     1 
ATOM   1606 C  CB    . ARG A 1 199 ? 22.887 167.786 39.860 1.00 54.08  ? 199 ARG A CB    1 
ATOM   1607 C  CG    . ARG A 1 199 ? 22.105 166.979 38.861 1.00 54.06  ? 199 ARG A CG    1 
ATOM   1608 C  CD    . ARG A 1 199 ? 21.570 167.896 37.803 1.00 56.92  ? 199 ARG A CD    1 
ATOM   1609 N  NE    . ARG A 1 199 ? 21.049 167.163 36.661 1.00 58.23  ? 199 ARG A NE    1 
ATOM   1610 C  CZ    . ARG A 1 199 ? 19.776 166.823 36.515 1.00 60.81  ? 199 ARG A CZ    1 
ATOM   1611 N  NH1   . ARG A 1 199 ? 18.871 167.141 37.442 1.00 61.41  ? 199 ARG A NH1   1 
ATOM   1612 N  NH2   . ARG A 1 199 ? 19.405 166.174 35.429 1.00 60.95  ? 199 ARG A NH2   1 
ATOM   1613 N  N     . THR A 1 200 ? 24.892 168.381 42.218 1.00 51.20  ? 200 THR A N     1 
ATOM   1614 C  CA    . THR A 1 200 ? 25.682 169.343 42.973 1.00 50.52  ? 200 THR A CA    1 
ATOM   1615 C  C     . THR A 1 200 ? 27.145 168.978 42.917 1.00 50.49  ? 200 THR A C     1 
ATOM   1616 O  O     . THR A 1 200 ? 27.988 169.813 42.623 1.00 52.29  ? 200 THR A O     1 
ATOM   1617 C  CB    . THR A 1 200 ? 25.297 169.376 44.436 1.00 50.37  ? 200 THR A CB    1 
ATOM   1618 O  OG1   . THR A 1 200 ? 23.967 169.875 44.564 1.00 52.69  ? 200 THR A OG1   1 
ATOM   1619 C  CG2   . THR A 1 200 ? 26.237 170.267 45.194 1.00 48.99  ? 200 THR A CG2   1 
ATOM   1620 N  N     . LYS A 1 201 ? 27.437 167.719 43.206 1.00 48.84  ? 201 LYS A N     1 
ATOM   1621 C  CA    . LYS A 1 201 ? 28.798 167.233 43.209 1.00 47.89  ? 201 LYS A CA    1 
ATOM   1622 C  C     . LYS A 1 201 ? 29.463 167.561 41.877 1.00 48.08  ? 201 LYS A C     1 
ATOM   1623 O  O     . LYS A 1 201 ? 30.657 167.851 41.817 1.00 47.57  ? 201 LYS A O     1 
ATOM   1624 C  CB    . LYS A 1 201 ? 28.785 165.722 43.434 1.00 50.05  ? 201 LYS A CB    1 
ATOM   1625 C  CG    . LYS A 1 201 ? 29.762 165.230 44.488 1.00 50.71  ? 201 LYS A CG    1 
ATOM   1626 C  CD    . LYS A 1 201 ? 29.490 165.874 45.837 1.00 48.68  ? 201 LYS A CD    1 
ATOM   1627 C  CE    . LYS A 1 201 ? 30.486 166.982 46.128 1.00 48.46  ? 201 LYS A CE    1 
ATOM   1628 N  NZ    . LYS A 1 201 ? 31.082 166.822 47.484 1.00 48.13  ? 201 LYS A NZ    1 
ATOM   1629 N  N     . ILE A 1 202 ? 28.681 167.511 40.805 1.00 48.47  ? 202 ILE A N     1 
ATOM   1630 C  CA    . ILE A 1 202 ? 29.203 167.788 39.476 1.00 49.06  ? 202 ILE A CA    1 
ATOM   1631 C  C     . ILE A 1 202 ? 29.589 169.255 39.342 1.00 50.24  ? 202 ILE A C     1 
ATOM   1632 O  O     . ILE A 1 202 ? 30.705 169.577 38.952 1.00 51.58  ? 202 ILE A O     1 
ATOM   1633 C  CB    . ILE A 1 202 ? 28.166 167.441 38.382 1.00 48.77  ? 202 ILE A CB    1 
ATOM   1634 C  CG1   . ILE A 1 202 ? 28.046 165.922 38.228 1.00 49.33  ? 202 ILE A CG1   1 
ATOM   1635 C  CG2   . ILE A 1 202 ? 28.562 168.078 37.063 1.00 47.51  ? 202 ILE A CG2   1 
ATOM   1636 C  CD1   . ILE A 1 202 ? 29.297 165.242 37.733 1.00 47.76  ? 202 ILE A CD1   1 
ATOM   1637 N  N     . GLU A 1 203 ? 28.674 170.154 39.669 1.00 50.95  ? 203 GLU A N     1 
ATOM   1638 C  CA    . GLU A 1 203 ? 28.968 171.566 39.512 1.00 52.76  ? 203 GLU A CA    1 
ATOM   1639 C  C     . GLU A 1 203 ? 30.177 171.864 40.369 1.00 52.84  ? 203 GLU A C     1 
ATOM   1640 O  O     . GLU A 1 203 ? 30.955 172.777 40.090 1.00 52.24  ? 203 GLU A O     1 
ATOM   1641 C  CB    . GLU A 1 203 ? 27.781 172.401 39.970 1.00 55.40  ? 203 GLU A CB    1 
ATOM   1642 C  CG    . GLU A 1 203 ? 26.461 171.832 39.513 1.00 58.90  ? 203 GLU A CG    1 
ATOM   1643 C  CD    . GLU A 1 203 ? 26.414 171.605 38.009 1.00 61.73  ? 203 GLU A CD    1 
ATOM   1644 O  OE1   . GLU A 1 203 ? 26.910 172.489 37.260 1.00 59.53  ? 203 GLU A OE1   1 
ATOM   1645 O  OE2   . GLU A 1 203 ? 25.880 170.541 37.587 1.00 63.51  ? 203 GLU A OE2   1 
ATOM   1646 N  N     . GLU A 1 204 ? 30.324 171.062 41.415 1.00 52.37  ? 204 GLU A N     1 
ATOM   1647 C  CA    . GLU A 1 204 ? 31.387 171.233 42.386 1.00 52.11  ? 204 GLU A CA    1 
ATOM   1648 C  C     . GLU A 1 204 ? 32.684 170.798 41.739 1.00 52.41  ? 204 GLU A C     1 
ATOM   1649 O  O     . GLU A 1 204 ? 33.753 171.306 42.074 1.00 54.26  ? 204 GLU A O     1 
ATOM   1650 C  CB    . GLU A 1 204 ? 31.099 170.372 43.598 1.00 52.72  ? 204 GLU A CB    1 
ATOM   1651 C  CG    . GLU A 1 204 ? 31.426 171.009 44.919 1.00 56.20  ? 204 GLU A CG    1 
ATOM   1652 C  CD    . GLU A 1 204 ? 30.560 170.449 46.031 1.00 57.45  ? 204 GLU A CD    1 
ATOM   1653 O  OE1   . GLU A 1 204 ? 29.355 170.771 46.037 1.00 57.73  ? 204 GLU A OE1   1 
ATOM   1654 O  OE2   . GLU A 1 204 ? 31.074 169.684 46.885 1.00 57.29  ? 204 GLU A OE2   1 
ATOM   1655 N  N     . LEU A 1 205 ? 32.572 169.856 40.806 1.00 51.17  ? 205 LEU A N     1 
ATOM   1656 C  CA    . LEU A 1 205 ? 33.701 169.389 40.007 1.00 49.71  ? 205 LEU A CA    1 
ATOM   1657 C  C     . LEU A 1 205 ? 34.067 170.434 38.963 1.00 49.87  ? 205 LEU A C     1 
ATOM   1658 O  O     . LEU A 1 205 ? 35.247 170.679 38.696 1.00 50.53  ? 205 LEU A O     1 
ATOM   1659 C  CB    . LEU A 1 205 ? 33.339 168.088 39.288 1.00 47.83  ? 205 LEU A CB    1 
ATOM   1660 C  CG    . LEU A 1 205 ? 34.421 167.019 39.131 1.00 45.15  ? 205 LEU A CG    1 
ATOM   1661 C  CD1   . LEU A 1 205 ? 33.995 166.072 38.044 1.00 44.89  ? 205 LEU A CD1   1 
ATOM   1662 C  CD2   . LEU A 1 205 ? 35.746 167.621 38.794 1.00 43.70  ? 205 LEU A CD2   1 
ATOM   1663 N  N     . ARG A 1 206 ? 33.047 171.041 38.367 1.00 48.39  ? 206 ARG A N     1 
ATOM   1664 C  CA    . ARG A 1 206 ? 33.258 172.001 37.297 1.00 48.07  ? 206 ARG A CA    1 
ATOM   1665 C  C     . ARG A 1 206 ? 33.786 173.316 37.840 1.00 48.07  ? 206 ARG A C     1 
ATOM   1666 O  O     . ARG A 1 206 ? 34.430 174.068 37.121 1.00 49.78  ? 206 ARG A O     1 
ATOM   1667 C  CB    . ARG A 1 206 ? 31.952 172.234 36.542 1.00 48.07  ? 206 ARG A CB    1 
ATOM   1668 C  CG    . ARG A 1 206 ? 31.331 170.953 36.017 1.00 47.69  ? 206 ARG A CG    1 
ATOM   1669 C  CD    . ARG A 1 206 ? 30.021 171.209 35.321 1.00 45.88  ? 206 ARG A CD    1 
ATOM   1670 N  NE    . ARG A 1 206 ? 30.192 172.085 34.177 1.00 45.66  ? 206 ARG A NE    1 
ATOM   1671 C  CZ    . ARG A 1 206 ? 29.231 172.853 33.689 1.00 46.20  ? 206 ARG A CZ    1 
ATOM   1672 N  NH1   . ARG A 1 206 ? 28.035 172.839 34.259 1.00 46.19  ? 206 ARG A NH1   1 
ATOM   1673 N  NH2   . ARG A 1 206 ? 29.471 173.630 32.642 1.00 44.91  ? 206 ARG A NH2   1 
ATOM   1674 N  N     . GLN A 1 207 ? 33.517 173.597 39.109 1.00 48.08  ? 207 GLN A N     1 
ATOM   1675 C  CA    . GLN A 1 207 ? 34.074 174.782 39.736 1.00 47.39  ? 207 GLN A CA    1 
ATOM   1676 C  C     . GLN A 1 207 ? 35.532 174.511 40.039 1.00 46.51  ? 207 GLN A C     1 
ATOM   1677 O  O     . GLN A 1 207 ? 36.384 175.351 39.818 1.00 44.87  ? 207 GLN A O     1 
ATOM   1678 C  CB    . GLN A 1 207 ? 33.317 175.110 41.017 1.00 49.78  ? 207 GLN A CB    1 
ATOM   1679 C  CG    . GLN A 1 207 ? 31.832 175.459 40.798 1.00 54.02  ? 207 GLN A CG    1 
ATOM   1680 C  CD    . GLN A 1 207 ? 30.998 175.395 42.088 1.00 57.24  ? 207 GLN A CD    1 
ATOM   1681 O  OE1   . GLN A 1 207 ? 31.536 175.428 43.213 1.00 59.14  ? 207 GLN A OE1   1 
ATOM   1682 N  NE2   . GLN A 1 207 ? 29.679 175.301 41.930 1.00 56.11  ? 207 GLN A NE2   1 
ATOM   1683 N  N     . HIS A 1 208 ? 35.820 173.313 40.529 1.00 47.12  ? 208 HIS A N     1 
ATOM   1684 C  CA    . HIS A 1 208 ? 37.199 172.912 40.769 1.00 45.53  ? 208 HIS A CA    1 
ATOM   1685 C  C     . HIS A 1 208 ? 37.965 173.000 39.472 1.00 45.85  ? 208 HIS A C     1 
ATOM   1686 O  O     . HIS A 1 208 ? 39.097 173.490 39.427 1.00 47.55  ? 208 HIS A O     1 
ATOM   1687 C  CB    . HIS A 1 208 ? 37.260 171.481 41.285 1.00 44.62  ? 208 HIS A CB    1 
ATOM   1688 C  CG    . HIS A 1 208 ? 38.650 170.992 41.541 1.00 45.80  ? 208 HIS A CG    1 
ATOM   1689 N  ND1   . HIS A 1 208 ? 39.430 171.469 42.571 1.00 47.67  ? 208 HIS A ND1   1 
ATOM   1690 C  CD2   . HIS A 1 208 ? 39.392 170.044 40.919 1.00 45.51  ? 208 HIS A CD2   1 
ATOM   1691 C  CE1   . HIS A 1 208 ? 40.590 170.835 42.574 1.00 47.43  ? 208 HIS A CE1   1 
ATOM   1692 N  NE2   . HIS A 1 208 ? 40.590 169.966 41.582 1.00 45.61  ? 208 HIS A NE2   1 
ATOM   1693 N  N     . LEU A 1 209 ? 37.341 172.513 38.409 1.00 44.09  ? 209 LEU A N     1 
ATOM   1694 C  CA    . LEU A 1 209 ? 37.970 172.526 37.108 1.00 42.43  ? 209 LEU A CA    1 
ATOM   1695 C  C     . LEU A 1 209 ? 38.177 173.957 36.664 1.00 41.08  ? 209 LEU A C     1 
ATOM   1696 O  O     . LEU A 1 209 ? 39.214 174.314 36.115 1.00 40.70  ? 209 LEU A O     1 
ATOM   1697 C  CB    . LEU A 1 209 ? 37.098 171.796 36.098 1.00 44.87  ? 209 LEU A CB    1 
ATOM   1698 C  CG    . LEU A 1 209 ? 37.431 170.324 35.850 1.00 45.94  ? 209 LEU A CG    1 
ATOM   1699 C  CD1   . LEU A 1 209 ? 38.457 169.846 36.861 1.00 46.38  ? 209 LEU A CD1   1 
ATOM   1700 C  CD2   . LEU A 1 209 ? 36.162 169.502 35.924 1.00 44.53  ? 209 LEU A CD2   1 
ATOM   1701 N  N     . LEU A 1 210 ? 37.186 174.793 36.908 1.00 40.36  ? 210 LEU A N     1 
ATOM   1702 C  CA    . LEU A 1 210 ? 37.284 176.153 36.432 1.00 40.14  ? 210 LEU A CA    1 
ATOM   1703 C  C     . LEU A 1 210 ? 38.421 176.845 37.177 1.00 40.27  ? 210 LEU A C     1 
ATOM   1704 O  O     . LEU A 1 210 ? 39.220 177.518 36.565 1.00 42.24  ? 210 LEU A O     1 
ATOM   1705 C  CB    . LEU A 1 210 ? 35.947 176.892 36.617 1.00 36.91  ? 210 LEU A CB    1 
ATOM   1706 C  CG    . LEU A 1 210 ? 35.806 178.215 35.857 1.00 36.20  ? 210 LEU A CG    1 
ATOM   1707 C  CD1   . LEU A 1 210 ? 35.516 177.959 34.396 1.00 32.74  ? 210 LEU A CD1   1 
ATOM   1708 C  CD2   . LEU A 1 210 ? 34.701 179.043 36.492 1.00 34.37  ? 210 LEU A CD2   1 
ATOM   1709 N  N     . ARG A 1 211 ? 38.520 176.644 38.487 1.00 41.76  ? 211 ARG A N     1 
ATOM   1710 C  CA    . ARG A 1 211 ? 39.617 177.215 39.268 1.00 42.13  ? 211 ARG A CA    1 
ATOM   1711 C  C     . ARG A 1 211 ? 40.993 176.762 38.815 1.00 43.68  ? 211 ARG A C     1 
ATOM   1712 O  O     . ARG A 1 211 ? 41.995 177.322 39.236 1.00 43.73  ? 211 ARG A O     1 
ATOM   1713 C  CB    . ARG A 1 211 ? 39.454 176.877 40.748 1.00 42.35  ? 211 ARG A CB    1 
ATOM   1714 C  CG    . ARG A 1 211 ? 38.498 177.800 41.482 1.00 45.22  ? 211 ARG A CG    1 
ATOM   1715 C  CD    . ARG A 1 211 ? 38.261 177.383 42.934 1.00 45.62  ? 211 ARG A CD    1 
ATOM   1716 N  NE    . ARG A 1 211 ? 36.839 177.211 43.196 1.00 44.63  ? 211 ARG A NE    1 
ATOM   1717 C  CZ    . ARG A 1 211 ? 36.300 176.088 43.644 1.00 44.69  ? 211 ARG A CZ    1 
ATOM   1718 N  NH1   . ARG A 1 211 ? 37.074 175.039 43.898 1.00 42.07  ? 211 ARG A NH1   1 
ATOM   1719 N  NH2   . ARG A 1 211 ? 34.982 176.004 43.779 1.00 45.92  ? 211 ARG A NH2   1 
ATOM   1720 N  N     . TRP A 1 212 ? 41.051 175.743 37.968 1.00 44.99  ? 212 TRP A N     1 
ATOM   1721 C  CA    . TRP A 1 212 ? 42.328 175.278 37.446 1.00 46.38  ? 212 TRP A CA    1 
ATOM   1722 C  C     . TRP A 1 212 ? 42.519 175.587 35.969 1.00 47.08  ? 212 TRP A C     1 
ATOM   1723 O  O     . TRP A 1 212 ? 43.440 175.078 35.330 1.00 47.56  ? 212 TRP A O     1 
ATOM   1724 C  CB    . TRP A 1 212 ? 42.470 173.783 37.671 1.00 47.19  ? 212 TRP A CB    1 
ATOM   1725 C  CG    . TRP A 1 212 ? 42.826 173.455 39.067 1.00 48.31  ? 212 TRP A CG    1 
ATOM   1726 C  CD1   . TRP A 1 212 ? 41.979 173.078 40.061 1.00 47.79  ? 212 TRP A CD1   1 
ATOM   1727 C  CD2   . TRP A 1 212 ? 44.132 173.512 39.647 1.00 48.65  ? 212 TRP A CD2   1 
ATOM   1728 N  NE1   . TRP A 1 212 ? 42.678 172.898 41.232 1.00 47.35  ? 212 TRP A NE1   1 
ATOM   1729 C  CE2   . TRP A 1 212 ? 43.996 173.159 41.002 1.00 47.50  ? 212 TRP A CE2   1 
ATOM   1730 C  CE3   . TRP A 1 212 ? 45.395 173.830 39.150 1.00 50.68  ? 212 TRP A CE3   1 
ATOM   1731 C  CZ2   . TRP A 1 212 ? 45.085 173.115 41.865 1.00 48.45  ? 212 TRP A CZ2   1 
ATOM   1732 C  CZ3   . TRP A 1 212 ? 46.474 173.785 40.014 1.00 51.38  ? 212 TRP A CZ3   1 
ATOM   1733 C  CH2   . TRP A 1 212 ? 46.310 173.431 41.357 1.00 49.76  ? 212 TRP A CH2   1 
ATOM   1734 N  N     . GLY A 1 213 ? 41.644 176.424 35.429 1.00 45.87  ? 213 GLY A N     1 
ATOM   1735 C  CA    . GLY A 1 213 ? 41.782 176.828 34.046 1.00 44.80  ? 213 GLY A CA    1 
ATOM   1736 C  C     . GLY A 1 213 ? 41.143 175.859 33.073 1.00 44.34  ? 213 GLY A C     1 
ATOM   1737 O  O     . GLY A 1 213 ? 41.427 175.919 31.885 1.00 44.57  ? 213 GLY A O     1 
ATOM   1738 N  N     . LEU A 1 214 ? 40.284 174.968 33.558 1.00 44.14  ? 214 LEU A N     1 
ATOM   1739 C  CA    . LEU A 1 214 ? 39.666 173.983 32.679 1.00 45.59  ? 214 LEU A CA    1 
ATOM   1740 C  C     . LEU A 1 214 ? 38.157 174.128 32.510 1.00 45.71  ? 214 LEU A C     1 
ATOM   1741 O  O     . LEU A 1 214 ? 37.364 173.783 33.386 1.00 44.88  ? 214 LEU A O     1 
ATOM   1742 C  CB    . LEU A 1 214 ? 40.003 172.565 33.146 1.00 45.89  ? 214 LEU A CB    1 
ATOM   1743 C  CG    . LEU A 1 214 ? 41.503 172.248 33.220 1.00 47.07  ? 214 LEU A CG    1 
ATOM   1744 C  CD1   . LEU A 1 214 ? 41.689 170.765 33.461 1.00 47.78  ? 214 LEU A CD1   1 
ATOM   1745 C  CD2   . LEU A 1 214 ? 42.202 172.664 31.941 1.00 43.92  ? 214 LEU A CD2   1 
ATOM   1746 N  N     . THR A 1 215 ? 37.777 174.627 31.344 1.00 47.32  ? 215 THR A N     1 
ATOM   1747 C  CA    . THR A 1 215 ? 36.390 174.927 31.048 1.00 48.47  ? 215 THR A CA    1 
ATOM   1748 C  C     . THR A 1 215 ? 35.636 173.664 30.713 1.00 49.10  ? 215 THR A C     1 
ATOM   1749 O  O     . THR A 1 215 ? 36.126 172.797 30.005 1.00 50.39  ? 215 THR A O     1 
ATOM   1750 C  CB    . THR A 1 215 ? 36.276 175.872 29.858 1.00 48.35  ? 215 THR A CB    1 
ATOM   1751 O  OG1   . THR A 1 215 ? 37.013 177.071 30.125 1.00 47.77  ? 215 THR A OG1   1 
ATOM   1752 C  CG2   . THR A 1 215 ? 34.837 176.212 29.606 1.00 48.34  ? 215 THR A CG2   1 
ATOM   1753 N  N     . THR A 1 216 ? 34.431 173.568 31.236 1.00 50.24  ? 216 THR A N     1 
ATOM   1754 C  CA    . THR A 1 216 ? 33.598 172.402 31.021 1.00 49.85  ? 216 THR A CA    1 
ATOM   1755 C  C     . THR A 1 216 ? 32.397 172.874 30.202 1.00 51.09  ? 216 THR A C     1 
ATOM   1756 O  O     . THR A 1 216 ? 31.350 173.225 30.760 1.00 51.14  ? 216 THR A O     1 
ATOM   1757 C  CB    . THR A 1 216 ? 33.152 171.830 32.388 1.00 49.09  ? 216 THR A CB    1 
ATOM   1758 O  OG1   . THR A 1 216 ? 33.510 172.753 33.435 1.00 48.71  ? 216 THR A OG1   1 
ATOM   1759 C  CG2   . THR A 1 216 ? 33.830 170.501 32.652 1.00 47.15  ? 216 THR A CG2   1 
ATOM   1760 N  N     . PRO A 1 217 ? 32.543 172.905 28.864 1.00 50.68  ? 217 PRO A N     1 
ATOM   1761 C  CA    . PRO A 1 217 ? 31.559 173.504 27.954 1.00 50.90  ? 217 PRO A CA    1 
ATOM   1762 C  C     . PRO A 1 217 ? 30.205 172.892 28.236 1.00 52.08  ? 217 PRO A C     1 
ATOM   1763 O  O     . PRO A 1 217 ? 30.041 172.235 29.241 1.00 54.73  ? 217 PRO A O     1 
ATOM   1764 C  CB    . PRO A 1 217 ? 32.066 173.123 26.571 1.00 49.75  ? 217 PRO A CB    1 
ATOM   1765 C  CG    . PRO A 1 217 ? 33.505 172.797 26.758 1.00 50.39  ? 217 PRO A CG    1 
ATOM   1766 C  CD    . PRO A 1 217 ? 33.614 172.217 28.128 1.00 50.59  ? 217 PRO A CD    1 
ATOM   1767 N  N     . ASP A 1 218 ? 29.226 173.100 27.367 1.00 54.59  ? 218 ASP A N     1 
ATOM   1768 C  CA    . ASP A 1 218 ? 27.997 172.319 27.457 1.00 56.01  ? 218 ASP A CA    1 
ATOM   1769 C  C     . ASP A 1 218 ? 27.810 171.551 26.143 1.00 57.16  ? 218 ASP A C     1 
ATOM   1770 O  O     . ASP A 1 218 ? 26.928 171.831 25.333 1.00 56.39  ? 218 ASP A O     1 
ATOM   1771 C  CB    . ASP A 1 218 ? 26.820 173.234 27.784 1.00 57.13  ? 218 ASP A CB    1 
ATOM   1772 C  CG    . ASP A 1 218 ? 27.136 174.190 28.947 1.00 61.16  ? 218 ASP A CG    1 
ATOM   1773 O  OD1   . ASP A 1 218 ? 28.307 174.611 29.075 1.00 58.99  ? 218 ASP A OD1   1 
ATOM   1774 O  OD2   . ASP A 1 218 ? 26.228 174.530 29.740 1.00 63.73  ? 218 ASP A OD2   1 
ATOM   1775 N  N     . LYS A 1 219 ? 28.768 170.655 25.919 1.00 57.55  ? 219 LYS A N     1 
ATOM   1776 C  CA    . LYS A 1 219 ? 28.552 169.255 25.599 1.00 57.17  ? 219 LYS A CA    1 
ATOM   1777 C  C     . LYS A 1 219 ? 28.694 168.444 26.914 1.00 57.04  ? 219 LYS A C     1 
ATOM   1778 O  O     . LYS A 1 219 ? 29.556 167.580 27.078 1.00 54.96  ? 219 LYS A O     1 
ATOM   1779 C  CB    . LYS A 1 219 ? 29.598 168.811 24.577 1.00 59.12  ? 219 LYS A CB    1 
ATOM   1780 C  CG    . LYS A 1 219 ? 31.027 169.173 24.968 1.00 60.01  ? 219 LYS A CG    1 
ATOM   1781 C  CD    . LYS A 1 219 ? 31.927 169.326 23.744 1.00 63.16  ? 219 LYS A CD    1 
ATOM   1782 C  CE    . LYS A 1 219 ? 33.077 170.310 24.025 1.00 65.31  ? 219 LYS A CE    1 
ATOM   1783 N  NZ    . LYS A 1 219 ? 34.166 170.275 23.002 1.00 65.00  ? 219 LYS A NZ    1 
ATOM   1784 N  N     . LYS A 1 220 ? 27.824 168.758 27.858 1.00 57.51  ? 220 LYS A N     1 
ATOM   1785 C  CA    . LYS A 1 220 ? 27.681 167.995 29.077 1.00 56.98  ? 220 LYS A CA    1 
ATOM   1786 C  C     . LYS A 1 220 ? 26.376 167.192 28.947 1.00 58.45  ? 220 LYS A C     1 
ATOM   1787 O  O     . LYS A 1 220 ? 25.285 167.776 28.917 1.00 56.59  ? 220 LYS A O     1 
ATOM   1788 C  CB    . LYS A 1 220 ? 27.614 168.979 30.248 1.00 56.16  ? 220 LYS A CB    1 
ATOM   1789 C  CG    . LYS A 1 220 ? 27.144 168.405 31.568 1.00 56.44  ? 220 LYS A CG    1 
ATOM   1790 C  CD    . LYS A 1 220 ? 26.304 169.420 32.314 1.00 56.12  ? 220 LYS A CD    1 
ATOM   1791 C  CE    . LYS A 1 220 ? 25.624 168.778 33.478 1.00 56.48  ? 220 LYS A CE    1 
ATOM   1792 N  NZ    . LYS A 1 220 ? 26.605 167.975 34.235 1.00 58.73  ? 220 LYS A NZ    1 
ATOM   1793 N  N     . HIS A 1 221 ? 26.487 165.863 28.843 1.00 60.08  ? 221 HIS A N     1 
ATOM   1794 C  CA    . HIS A 1 221 ? 25.299 165.009 28.860 1.00 61.99  ? 221 HIS A CA    1 
ATOM   1795 C  C     . HIS A 1 221 ? 24.786 164.964 30.295 1.00 62.99  ? 221 HIS A C     1 
ATOM   1796 O  O     . HIS A 1 221 ? 25.272 164.195 31.119 1.00 62.53  ? 221 HIS A O     1 
ATOM   1797 C  CB    . HIS A 1 221 ? 25.573 163.549 28.453 1.00 62.42  ? 221 HIS A CB    1 
ATOM   1798 C  CG    . HIS A 1 221 ? 26.564 163.355 27.350 1.00 60.70  ? 221 HIS A CG    1 
ATOM   1799 N  ND1   . HIS A 1 221 ? 27.711 164.105 27.223 1.00 61.98  ? 221 HIS A ND1   1 
ATOM   1800 C  CD2   . HIS A 1 221 ? 26.668 162.359 26.434 1.00 61.14  ? 221 HIS A CD2   1 
ATOM   1801 C  CE1   . HIS A 1 221 ? 28.486 163.577 26.291 1.00 61.92  ? 221 HIS A CE1   1 
ATOM   1802 N  NE2   . HIS A 1 221 ? 27.873 162.513 25.800 1.00 61.63  ? 221 HIS A NE2   1 
ATOM   1803 N  N     . GLN A 1 222 ? 23.797 165.793 30.575 1.00 66.21  ? 222 GLN A N     1 
ATOM   1804 C  CA    . GLN A 1 222 ? 23.201 165.902 31.898 1.00 70.11  ? 222 GLN A CA    1 
ATOM   1805 C  C     . GLN A 1 222 ? 22.047 164.927 31.809 1.00 70.51  ? 222 GLN A C     1 
ATOM   1806 O  O     . GLN A 1 222 ? 21.561 164.693 30.717 1.00 71.70  ? 222 GLN A O     1 
ATOM   1807 C  CB    . GLN A 1 222 ? 22.690 167.341 32.084 1.00 72.63  ? 222 GLN A CB    1 
ATOM   1808 C  CG    . GLN A 1 222 ? 22.375 167.802 33.507 1.00 78.23  ? 222 GLN A CG    1 
ATOM   1809 C  CD    . GLN A 1 222 ? 21.714 169.202 33.547 1.00 81.24  ? 222 GLN A CD    1 
ATOM   1810 O  OE1   . GLN A 1 222 ? 21.047 169.618 32.593 1.00 82.41  ? 222 GLN A OE1   1 
ATOM   1811 N  NE2   . GLN A 1 222 ? 21.903 169.923 34.654 1.00 80.76  ? 222 GLN A NE2   1 
ATOM   1812 N  N     . LYS A 1 223 ? 21.619 164.352 32.927 1.00 71.65  ? 223 LYS A N     1 
ATOM   1813 C  CA    . LYS A 1 223 ? 20.397 163.544 32.947 1.00 73.97  ? 223 LYS A CA    1 
ATOM   1814 C  C     . LYS A 1 223 ? 20.008 163.087 31.539 1.00 73.39  ? 223 LYS A C     1 
ATOM   1815 O  O     . LYS A 1 223 ? 18.958 163.471 30.989 1.00 72.43  ? 223 LYS A O     1 
ATOM   1816 C  CB    . LYS A 1 223 ? 19.244 164.347 33.554 1.00 76.93  ? 223 LYS A CB    1 
ATOM   1817 C  CG    . LYS A 1 223 ? 17.865 163.679 33.468 1.00 80.17  ? 223 LYS A CG    1 
ATOM   1818 C  CD    . LYS A 1 223 ? 16.739 164.719 33.421 1.00 81.96  ? 223 LYS A CD    1 
ATOM   1819 C  CE    . LYS A 1 223 ? 15.674 164.437 34.490 1.00 82.58  ? 223 LYS A CE    1 
ATOM   1820 N  NZ    . LYS A 1 223 ? 14.799 165.619 34.768 1.00 83.82  ? 223 LYS A NZ    1 
ATOM   1821 N  N     . GLU A 1 224 ? 20.861 162.270 30.945 1.00 71.06  ? 224 GLU A N     1 
ATOM   1822 C  CA    . GLU A 1 224 ? 20.683 161.983 29.548 1.00 70.28  ? 224 GLU A CA    1 
ATOM   1823 C  C     . GLU A 1 224 ? 21.135 160.608 29.167 1.00 68.42  ? 224 GLU A C     1 
ATOM   1824 O  O     . GLU A 1 224 ? 21.946 160.446 28.268 1.00 70.87  ? 224 GLU A O     1 
ATOM   1825 C  CB    . GLU A 1 224 ? 21.438 163.016 28.730 1.00 72.37  ? 224 GLU A CB    1 
ATOM   1826 C  CG    . GLU A 1 224 ? 21.538 162.749 27.258 1.00 74.08  ? 224 GLU A CG    1 
ATOM   1827 C  CD    . GLU A 1 224 ? 22.708 163.493 26.692 1.00 75.20  ? 224 GLU A CD    1 
ATOM   1828 O  OE1   . GLU A 1 224 ? 22.788 164.719 26.971 1.00 75.94  ? 224 GLU A OE1   1 
ATOM   1829 O  OE2   . GLU A 1 224 ? 23.541 162.857 25.998 1.00 73.54  ? 224 GLU A OE2   1 
ATOM   1830 N  N     . PRO A 1 225 ? 20.623 159.582 29.835 1.00 65.87  ? 225 PRO A N     1 
ATOM   1831 C  CA    . PRO A 1 225 ? 20.780 158.350 29.070 1.00 63.42  ? 225 PRO A CA    1 
ATOM   1832 C  C     . PRO A 1 225 ? 20.020 158.573 27.771 1.00 60.98  ? 225 PRO A C     1 
ATOM   1833 O  O     . PRO A 1 225 ? 18.957 159.195 27.778 1.00 61.78  ? 225 PRO A O     1 
ATOM   1834 C  CB    . PRO A 1 225 ? 20.133 157.300 29.962 1.00 63.79  ? 225 PRO A CB    1 
ATOM   1835 C  CG    . PRO A 1 225 ? 20.266 157.870 31.350 1.00 63.56  ? 225 PRO A CG    1 
ATOM   1836 C  CD    . PRO A 1 225 ? 20.080 159.346 31.179 1.00 64.56  ? 225 PRO A CD    1 
ATOM   1837 N  N     . PRO A 1 226 ? 20.564 158.111 26.635 1.00 57.75  ? 226 PRO A N     1 
ATOM   1838 C  CA    . PRO A 1 226 ? 21.874 157.486 26.433 1.00 55.21  ? 226 PRO A CA    1 
ATOM   1839 C  C     . PRO A 1 226 ? 22.989 158.494 26.573 1.00 52.05  ? 226 PRO A C     1 
ATOM   1840 O  O     . PRO A 1 226 ? 22.953 159.543 25.940 1.00 52.14  ? 226 PRO A O     1 
ATOM   1841 C  CB    . PRO A 1 226 ? 21.817 156.962 24.995 1.00 56.05  ? 226 PRO A CB    1 
ATOM   1842 C  CG    . PRO A 1 226 ? 20.387 156.947 24.642 1.00 57.83  ? 226 PRO A CG    1 
ATOM   1843 C  CD    . PRO A 1 226 ? 19.769 158.084 25.401 1.00 57.83  ? 226 PRO A CD    1 
ATOM   1844 N  N     . PHE A 1 227 ? 23.983 158.170 27.386 1.00 49.00  ? 227 PHE A N     1 
ATOM   1845 C  CA    . PHE A 1 227 ? 25.230 158.920 27.389 1.00 46.35  ? 227 PHE A CA    1 
ATOM   1846 C  C     . PHE A 1 227 ? 26.156 158.407 26.284 1.00 45.17  ? 227 PHE A C     1 
ATOM   1847 O  O     . PHE A 1 227 ? 26.274 157.210 26.063 1.00 45.94  ? 227 PHE A O     1 
ATOM   1848 C  CB    . PHE A 1 227 ? 25.926 158.771 28.746 1.00 44.89  ? 227 PHE A CB    1 
ATOM   1849 C  CG    . PHE A 1 227 ? 25.130 159.303 29.907 1.00 42.09  ? 227 PHE A CG    1 
ATOM   1850 C  CD1   . PHE A 1 227 ? 24.471 158.436 30.767 1.00 39.51  ? 227 PHE A CD1   1 
ATOM   1851 C  CD2   . PHE A 1 227 ? 25.062 160.671 30.155 1.00 40.10  ? 227 PHE A CD2   1 
ATOM   1852 C  CE1   . PHE A 1 227 ? 23.773 158.917 31.850 1.00 35.87  ? 227 PHE A CE1   1 
ATOM   1853 C  CE2   . PHE A 1 227 ? 24.365 161.157 31.237 1.00 36.58  ? 227 PHE A CE2   1 
ATOM   1854 C  CZ    . PHE A 1 227 ? 23.719 160.278 32.081 1.00 37.06  ? 227 PHE A CZ    1 
ATOM   1855 N  N     . LEU A 1 228 ? 26.835 159.299 25.587 1.00 44.02  ? 228 LEU A N     1 
ATOM   1856 C  CA    . LEU A 1 228 ? 27.782 158.826 24.594 1.00 42.72  ? 228 LEU A CA    1 
ATOM   1857 C  C     . LEU A 1 228 ? 29.196 158.949 25.133 1.00 41.99  ? 228 LEU A C     1 
ATOM   1858 O  O     . LEU A 1 228 ? 29.697 160.048 25.329 1.00 44.45  ? 228 LEU A O     1 
ATOM   1859 C  CB    . LEU A 1 228 ? 27.636 159.623 23.294 1.00 42.60  ? 228 LEU A CB    1 
ATOM   1860 C  CG    . LEU A 1 228 ? 26.241 159.730 22.658 1.00 41.12  ? 228 LEU A CG    1 
ATOM   1861 C  CD1   . LEU A 1 228 ? 26.375 159.644 21.165 1.00 40.42  ? 228 LEU A CD1   1 
ATOM   1862 C  CD2   . LEU A 1 228 ? 25.334 158.624 23.138 1.00 42.34  ? 228 LEU A CD2   1 
ATOM   1863 N  N     . TRP A 1 229 ? 29.835 157.811 25.364 1.00 39.74  ? 229 TRP A N     1 
ATOM   1864 C  CA    . TRP A 1 229 ? 31.130 157.758 26.033 1.00 38.11  ? 229 TRP A CA    1 
ATOM   1865 C  C     . TRP A 1 229 ? 32.059 156.761 25.338 1.00 38.28  ? 229 TRP A C     1 
ATOM   1866 O  O     . TRP A 1 229 ? 31.707 155.602 25.145 1.00 38.46  ? 229 TRP A O     1 
ATOM   1867 C  CB    . TRP A 1 229 ? 30.933 157.353 27.505 1.00 36.91  ? 229 TRP A CB    1 
ATOM   1868 C  CG    . TRP A 1 229 ? 32.190 157.257 28.305 1.00 36.52  ? 229 TRP A CG    1 
ATOM   1869 C  CD1   . TRP A 1 229 ? 33.013 158.280 28.675 1.00 37.33  ? 229 TRP A CD1   1 
ATOM   1870 C  CD2   . TRP A 1 229 ? 32.777 156.067 28.824 1.00 38.03  ? 229 TRP A CD2   1 
ATOM   1871 N  NE1   . TRP A 1 229 ? 34.085 157.800 29.393 1.00 36.82  ? 229 TRP A NE1   1 
ATOM   1872 C  CE2   . TRP A 1 229 ? 33.960 156.436 29.501 1.00 38.54  ? 229 TRP A CE2   1 
ATOM   1873 C  CE3   . TRP A 1 229 ? 32.422 154.711 28.783 1.00 38.81  ? 229 TRP A CE3   1 
ATOM   1874 C  CZ2   . TRP A 1 229 ? 34.786 155.508 30.132 1.00 39.04  ? 229 TRP A CZ2   1 
ATOM   1875 C  CZ3   . TRP A 1 229 ? 33.244 153.788 29.411 1.00 39.42  ? 229 TRP A CZ3   1 
ATOM   1876 C  CH2   . TRP A 1 229 ? 34.412 154.191 30.076 1.00 38.79  ? 229 TRP A CH2   1 
ATOM   1877 N  N     . MET A 1 230 ? 33.253 157.207 24.973 1.00 38.26  ? 230 MET A N     1 
ATOM   1878 C  CA    . MET A 1 230 ? 34.293 156.288 24.515 1.00 38.07  ? 230 MET A CA    1 
ATOM   1879 C  C     . MET A 1 230 ? 33.847 155.371 23.391 1.00 38.64  ? 230 MET A C     1 
ATOM   1880 O  O     . MET A 1 230 ? 34.444 154.316 23.161 1.00 38.06  ? 230 MET A O     1 
ATOM   1881 C  CB    . MET A 1 230 ? 34.804 155.446 25.669 1.00 36.48  ? 230 MET A CB    1 
ATOM   1882 C  CG    . MET A 1 230 ? 35.553 156.257 26.689 1.00 38.26  ? 230 MET A CG    1 
ATOM   1883 S  SD    . MET A 1 230 ? 37.050 157.033 26.065 1.00 39.93  ? 230 MET A SD    1 
ATOM   1884 C  CE    . MET A 1 230 ? 38.042 155.642 25.773 1.00 37.30  ? 230 MET A CE    1 
ATOM   1885 N  N     . GLY A 1 231 ? 32.800 155.795 22.692 1.00 38.80  ? 231 GLY A N     1 
ATOM   1886 C  CA    . GLY A 1 231 ? 32.329 155.065 21.538 1.00 38.30  ? 231 GLY A CA    1 
ATOM   1887 C  C     . GLY A 1 231 ? 31.010 154.353 21.769 1.00 39.03  ? 231 GLY A C     1 
ATOM   1888 O  O     . GLY A 1 231 ? 30.504 153.729 20.853 1.00 40.53  ? 231 GLY A O     1 
ATOM   1889 N  N     . TYR A 1 232 ? 30.459 154.430 22.978 1.00 38.38  ? 232 TYR A N     1 
ATOM   1890 C  CA    . TYR A 1 232 ? 29.302 153.624 23.336 1.00 39.88  ? 232 TYR A CA    1 
ATOM   1891 C  C     . TYR A 1 232 ? 28.114 154.479 23.739 1.00 43.07  ? 232 TYR A C     1 
ATOM   1892 O  O     . TYR A 1 232 ? 28.247 155.657 24.041 1.00 44.52  ? 232 TYR A O     1 
ATOM   1893 C  CB    . TYR A 1 232 ? 29.636 152.682 24.490 1.00 38.24  ? 232 TYR A CB    1 
ATOM   1894 C  CG    . TYR A 1 232 ? 30.941 151.942 24.337 1.00 40.19  ? 232 TYR A CG    1 
ATOM   1895 C  CD1   . TYR A 1 232 ? 30.986 150.658 23.837 1.00 41.42  ? 232 TYR A CD1   1 
ATOM   1896 C  CD2   . TYR A 1 232 ? 32.136 152.532 24.697 1.00 43.47  ? 232 TYR A CD2   1 
ATOM   1897 C  CE1   . TYR A 1 232 ? 32.191 149.983 23.701 1.00 43.23  ? 232 TYR A CE1   1 
ATOM   1898 C  CE2   . TYR A 1 232 ? 33.345 151.861 24.566 1.00 43.74  ? 232 TYR A CE2   1 
ATOM   1899 C  CZ    . TYR A 1 232 ? 33.366 150.593 24.070 1.00 42.59  ? 232 TYR A CZ    1 
ATOM   1900 O  OH    . TYR A 1 232 ? 34.563 149.932 23.956 1.00 42.38  ? 232 TYR A OH    1 
ATOM   1901 N  N     . GLU A 1 233 ? 26.938 153.878 23.735 1.00 45.73  ? 233 GLU A N     1 
ATOM   1902 C  CA    . GLU A 1 233 ? 25.788 154.499 24.347 1.00 48.47  ? 233 GLU A CA    1 
ATOM   1903 C  C     . GLU A 1 233 ? 25.638 153.837 25.690 1.00 48.65  ? 233 GLU A C     1 
ATOM   1904 O  O     . GLU A 1 233 ? 25.642 152.624 25.780 1.00 51.00  ? 233 GLU A O     1 
ATOM   1905 C  CB    . GLU A 1 233 ? 24.536 154.245 23.516 1.00 53.39  ? 233 GLU A CB    1 
ATOM   1906 C  CG    . GLU A 1 233 ? 24.461 155.051 22.230 1.00 62.06  ? 233 GLU A CG    1 
ATOM   1907 C  CD    . GLU A 1 233 ? 23.403 154.523 21.264 1.00 66.64  ? 233 GLU A CD    1 
ATOM   1908 O  OE1   . GLU A 1 233 ? 22.470 153.816 21.728 1.00 67.79  ? 233 GLU A OE1   1 
ATOM   1909 O  OE2   . GLU A 1 233 ? 23.517 154.814 20.045 1.00 67.51  ? 233 GLU A OE2   1 
ATOM   1910 N  N     . LEU A 1 234 ? 25.504 154.627 26.739 1.00 48.31  ? 234 LEU A N     1 
ATOM   1911 C  CA    . LEU A 1 234 ? 25.282 154.076 28.060 1.00 47.14  ? 234 LEU A CA    1 
ATOM   1912 C  C     . LEU A 1 234 ? 23.861 154.376 28.503 1.00 47.92  ? 234 LEU A C     1 
ATOM   1913 O  O     . LEU A 1 234 ? 23.479 155.533 28.640 1.00 47.46  ? 234 LEU A O     1 
ATOM   1914 C  CB    . LEU A 1 234 ? 26.287 154.685 29.026 1.00 44.96  ? 234 LEU A CB    1 
ATOM   1915 C  CG    . LEU A 1 234 ? 27.704 154.571 28.471 1.00 44.09  ? 234 LEU A CG    1 
ATOM   1916 C  CD1   . LEU A 1 234 ? 28.627 155.505 29.211 1.00 40.47  ? 234 LEU A CD1   1 
ATOM   1917 C  CD2   . LEU A 1 234 ? 28.175 153.125 28.577 1.00 43.77  ? 234 LEU A CD2   1 
ATOM   1918 N  N     . HIS A 1 235 ? 23.076 153.324 28.701 1.00 49.34  ? 235 HIS A N     1 
ATOM   1919 C  CA    . HIS A 1 235 ? 21.753 153.448 29.283 1.00 50.81  ? 235 HIS A CA    1 
ATOM   1920 C  C     . HIS A 1 235 ? 21.874 153.027 30.728 1.00 52.92  ? 235 HIS A C     1 
ATOM   1921 O  O     . HIS A 1 235 ? 22.871 152.448 31.120 1.00 54.17  ? 235 HIS A O     1 
ATOM   1922 C  CB    . HIS A 1 235 ? 20.781 152.551 28.536 1.00 50.77  ? 235 HIS A CB    1 
ATOM   1923 C  CG    . HIS A 1 235 ? 20.800 152.764 27.056 1.00 54.11  ? 235 HIS A CG    1 
ATOM   1924 N  ND1   . HIS A 1 235 ? 21.595 152.021 26.207 1.00 56.16  ? 235 HIS A ND1   1 
ATOM   1925 C  CD2   . HIS A 1 235 ? 20.139 153.648 26.273 1.00 55.42  ? 235 HIS A CD2   1 
ATOM   1926 C  CE1   . HIS A 1 235 ? 21.423 152.438 24.964 1.00 55.71  ? 235 HIS A CE1   1 
ATOM   1927 N  NE2   . HIS A 1 235 ? 20.545 153.425 24.975 1.00 57.16  ? 235 HIS A NE2   1 
ATOM   1928 N  N     . PRO A 1 236 ? 20.865 153.316 31.550 1.00 56.28  ? 236 PRO A N     1 
ATOM   1929 C  CA    . PRO A 1 236 ? 21.056 153.159 32.999 1.00 57.99  ? 236 PRO A CA    1 
ATOM   1930 C  C     . PRO A 1 236 ? 21.337 151.718 33.469 1.00 59.54  ? 236 PRO A C     1 
ATOM   1931 O  O     . PRO A 1 236 ? 21.998 151.507 34.491 1.00 60.20  ? 236 PRO A O     1 
ATOM   1932 C  CB    . PRO A 1 236 ? 19.755 153.715 33.590 1.00 58.13  ? 236 PRO A CB    1 
ATOM   1933 C  CG    . PRO A 1 236 ? 19.148 154.554 32.492 1.00 56.00  ? 236 PRO A CG    1 
ATOM   1934 C  CD    . PRO A 1 236 ? 19.535 153.859 31.226 1.00 57.36  ? 236 PRO A CD    1 
ATOM   1935 N  N     . ASP A 1 237 ? 20.830 150.738 32.723 1.00 60.64  ? 237 ASP A N     1 
ATOM   1936 C  CA    . ASP A 1 237 ? 20.966 149.331 33.084 1.00 61.31  ? 237 ASP A CA    1 
ATOM   1937 C  C     . ASP A 1 237 ? 21.551 148.468 31.964 1.00 60.70  ? 237 ASP A C     1 
ATOM   1938 O  O     . ASP A 1 237 ? 21.865 147.302 32.175 1.00 62.41  ? 237 ASP A O     1 
ATOM   1939 C  CB    . ASP A 1 237 ? 19.607 148.764 33.499 1.00 64.88  ? 237 ASP A CB    1 
ATOM   1940 C  CG    . ASP A 1 237 ? 19.168 149.238 34.881 1.00 69.77  ? 237 ASP A CG    1 
ATOM   1941 O  OD1   . ASP A 1 237 ? 18.550 150.327 34.969 1.00 71.12  ? 237 ASP A OD1   1 
ATOM   1942 O  OD2   . ASP A 1 237 ? 19.437 148.520 35.878 1.00 71.08  ? 237 ASP A OD2   1 
ATOM   1943 N  N     . LYS A 1 238 ? 21.687 149.032 30.771 1.00 58.68  ? 238 LYS A N     1 
ATOM   1944 C  CA    . LYS A 1 238 ? 22.390 148.354 29.690 1.00 56.92  ? 238 LYS A CA    1 
ATOM   1945 C  C     . LYS A 1 238 ? 23.305 149.325 28.933 1.00 55.84  ? 238 LYS A C     1 
ATOM   1946 O  O     . LYS A 1 238 ? 23.058 150.533 28.907 1.00 56.15  ? 238 LYS A O     1 
ATOM   1947 C  CB    . LYS A 1 238 ? 21.382 147.723 28.725 1.00 57.76  ? 238 LYS A CB    1 
ATOM   1948 C  CG    . LYS A 1 238 ? 20.367 148.699 28.119 1.00 58.36  ? 238 LYS A CG    1 
ATOM   1949 C  CD    . LYS A 1 238 ? 19.938 148.275 26.705 1.00 59.52  ? 238 LYS A CD    1 
ATOM   1950 C  CE    . LYS A 1 238 ? 18.659 148.996 26.248 1.00 60.59  ? 238 LYS A CE    1 
ATOM   1951 N  NZ    . LYS A 1 238 ? 18.480 149.065 24.760 1.00 59.26  ? 238 LYS A NZ    1 
ATOM   1952 N  N     . TRP A 1 239 ? 24.364 148.798 28.327 1.00 53.21  ? 239 TRP A N     1 
ATOM   1953 C  CA    . TRP A 1 239 ? 25.203 149.592 27.437 1.00 51.18  ? 239 TRP A CA    1 
ATOM   1954 C  C     . TRP A 1 239 ? 25.286 148.945 26.047 1.00 52.21  ? 239 TRP A C     1 
ATOM   1955 O  O     . TRP A 1 239 ? 24.878 147.804 25.867 1.00 54.42  ? 239 TRP A O     1 
ATOM   1956 C  CB    . TRP A 1 239 ? 26.599 149.783 28.056 1.00 46.56  ? 239 TRP A CB    1 
ATOM   1957 C  CG    . TRP A 1 239 ? 27.473 148.577 28.070 1.00 44.36  ? 239 TRP A CG    1 
ATOM   1958 C  CD1   . TRP A 1 239 ? 27.758 147.785 29.137 1.00 44.19  ? 239 TRP A CD1   1 
ATOM   1959 C  CD2   . TRP A 1 239 ? 28.216 148.040 26.964 1.00 44.12  ? 239 TRP A CD2   1 
ATOM   1960 N  NE1   . TRP A 1 239 ? 28.630 146.782 28.768 1.00 41.54  ? 239 TRP A NE1   1 
ATOM   1961 C  CE2   . TRP A 1 239 ? 28.924 146.923 27.440 1.00 42.05  ? 239 TRP A CE2   1 
ATOM   1962 C  CE3   . TRP A 1 239 ? 28.353 148.401 25.617 1.00 43.45  ? 239 TRP A CE3   1 
ATOM   1963 C  CZ2   . TRP A 1 239 ? 29.750 146.170 26.622 1.00 42.61  ? 239 TRP A CZ2   1 
ATOM   1964 C  CZ3   . TRP A 1 239 ? 29.175 147.651 24.811 1.00 41.55  ? 239 TRP A CZ3   1 
ATOM   1965 C  CH2   . TRP A 1 239 ? 29.861 146.552 25.310 1.00 41.14  ? 239 TRP A CH2   1 
ATOM   1966 N  N     . THR A 1 240 ? 25.796 149.682 25.067 1.00 52.10  ? 240 THR A N     1 
ATOM   1967 C  CA    . THR A 1 240 ? 25.800 149.244 23.672 1.00 53.46  ? 240 THR A CA    1 
ATOM   1968 C  C     . THR A 1 240 ? 26.872 150.011 22.875 1.00 54.04  ? 240 THR A C     1 
ATOM   1969 O  O     . THR A 1 240 ? 27.436 150.986 23.377 1.00 55.33  ? 240 THR A O     1 
ATOM   1970 C  CB    . THR A 1 240 ? 24.416 149.496 23.018 1.00 54.31  ? 240 THR A CB    1 
ATOM   1971 O  OG1   . THR A 1 240 ? 24.478 149.169 21.626 1.00 57.43  ? 240 THR A OG1   1 
ATOM   1972 C  CG2   . THR A 1 240 ? 23.999 150.962 23.160 1.00 53.97  ? 240 THR A CG2   1 
ATOM   1973 N  N     . VAL A 1 241 ? 27.160 149.588 21.645 1.00 52.25  ? 241 VAL A N     1 
ATOM   1974 C  CA    . VAL A 1 241 ? 27.997 150.401 20.767 1.00 51.52  ? 241 VAL A CA    1 
ATOM   1975 C  C     . VAL A 1 241 ? 27.155 151.300 19.881 1.00 52.22  ? 241 VAL A C     1 
ATOM   1976 O  O     . VAL A 1 241 ? 26.089 150.912 19.408 1.00 53.17  ? 241 VAL A O     1 
ATOM   1977 C  CB    . VAL A 1 241 ? 28.886 149.551 19.837 1.00 51.66  ? 241 VAL A CB    1 
ATOM   1978 C  CG1   . VAL A 1 241 ? 29.979 148.863 20.622 1.00 49.69  ? 241 VAL A CG1   1 
ATOM   1979 C  CG2   . VAL A 1 241 ? 28.034 148.539 19.116 1.00 52.08  ? 241 VAL A CG2   1 
ATOM   1980 N  N     . GLN A 1 242 ? 27.648 152.510 19.662 1.00 52.78  ? 242 GLN A N     1 
ATOM   1981 C  CA    . GLN A 1 242 ? 27.113 153.396 18.643 1.00 53.39  ? 242 GLN A CA    1 
ATOM   1982 C  C     . GLN A 1 242 ? 27.310 152.707 17.304 1.00 54.79  ? 242 GLN A C     1 
ATOM   1983 O  O     . GLN A 1 242 ? 28.326 152.039 17.085 1.00 56.40  ? 242 GLN A O     1 
ATOM   1984 C  CB    . GLN A 1 242 ? 27.873 154.721 18.659 1.00 52.43  ? 242 GLN A CB    1 
ATOM   1985 C  CG    . GLN A 1 242 ? 27.916 155.369 20.033 1.00 51.73  ? 242 GLN A CG    1 
ATOM   1986 C  CD    . GLN A 1 242 ? 28.699 156.654 20.050 1.00 48.90  ? 242 GLN A CD    1 
ATOM   1987 O  OE1   . GLN A 1 242 ? 29.028 157.174 21.109 1.00 48.24  ? 242 GLN A OE1   1 
ATOM   1988 N  NE2   . GLN A 1 242 ? 29.003 157.173 18.874 1.00 47.72  ? 242 GLN A NE2   1 
ATOM   1989 N  N     . PRO A 1 243 ? 26.355 152.888 16.382 1.00 54.83  ? 243 PRO A N     1 
ATOM   1990 C  CA    . PRO A 1 243 ? 26.147 152.056 15.193 1.00 55.77  ? 243 PRO A CA    1 
ATOM   1991 C  C     . PRO A 1 243 ? 27.368 151.865 14.313 1.00 56.73  ? 243 PRO A C     1 
ATOM   1992 O  O     . PRO A 1 243 ? 28.107 152.801 14.038 1.00 57.60  ? 243 PRO A O     1 
ATOM   1993 C  CB    . PRO A 1 243 ? 25.017 152.757 14.447 1.00 54.82  ? 243 PRO A CB    1 
ATOM   1994 C  CG    . PRO A 1 243 ? 25.049 154.151 14.939 1.00 56.29  ? 243 PRO A CG    1 
ATOM   1995 C  CD    . PRO A 1 243 ? 25.490 154.077 16.370 1.00 55.58  ? 243 PRO A CD    1 
ATOM   1996 N  N     . ILE A 1 244 ? 27.564 150.627 13.882 1.00 58.32  ? 244 ILE A N     1 
ATOM   1997 C  CA    . ILE A 1 244 ? 28.684 150.276 13.029 1.00 60.76  ? 244 ILE A CA    1 
ATOM   1998 C  C     . ILE A 1 244 ? 28.160 150.111 11.615 1.00 63.57  ? 244 ILE A C     1 
ATOM   1999 O  O     . ILE A 1 244 ? 27.048 149.619 11.399 1.00 64.42  ? 244 ILE A O     1 
ATOM   2000 C  CB    . ILE A 1 244 ? 29.345 148.947 13.481 1.00 58.91  ? 244 ILE A CB    1 
ATOM   2001 C  CG1   . ILE A 1 244 ? 29.978 149.119 14.863 1.00 58.87  ? 244 ILE A CG1   1 
ATOM   2002 C  CG2   . ILE A 1 244 ? 30.390 148.514 12.473 1.00 56.74  ? 244 ILE A CG2   1 
ATOM   2003 C  CD1   . ILE A 1 244 ? 30.517 147.843 15.459 1.00 56.83  ? 244 ILE A CD1   1 
ATOM   2004 N  N     . VAL A 1 245 ? 28.959 150.529 10.649 1.00 64.90  ? 245 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 245 ? 28.564 150.390 9.267  1.00 66.98  ? 245 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 245 ? 29.736 149.907 8.446  1.00 69.26  ? 245 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 245 ? 30.686 150.648 8.206  1.00 70.14  ? 245 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 245 ? 28.050 151.724 8.720  1.00 66.22  ? 245 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 245 ? 27.938 151.663 7.209  1.00 65.77  ? 245 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 245 ? 26.703 152.037 9.351  1.00 64.01  ? 245 VAL A CG2   1 
ATOM   2011 N  N     . LEU A 1 246 ? 29.668 148.648 8.028  1.00 71.60  ? 246 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 246 ? 30.732 148.051 7.239  1.00 73.61  ? 246 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 246 ? 30.662 148.612 5.834  1.00 75.28  ? 246 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 246 ? 29.592 148.661 5.229  1.00 75.08  ? 246 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 246 ? 30.568 146.533 7.181  1.00 73.42  ? 246 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 246 ? 30.319 145.798 8.497  1.00 73.31  ? 246 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 246 ? 30.077 144.327 8.209  1.00 73.60  ? 246 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 246 ? 31.499 145.977 9.424  1.00 72.30  ? 246 LEU A CD2   1 
ATOM   2019 N  N     . PRO A 1 247 ? 31.808 149.037 5.293  1.00 77.23  ? 247 PRO A N     1 
ATOM   2020 C  CA    . PRO A 1 247 ? 31.858 149.508 3.907  1.00 79.27  ? 247 PRO A CA    1 
ATOM   2021 C  C     . PRO A 1 247 ? 31.456 148.419 2.908  1.00 81.20  ? 247 PRO A C     1 
ATOM   2022 O  O     . PRO A 1 247 ? 32.177 147.436 2.710  1.00 79.60  ? 247 PRO A O     1 
ATOM   2023 C  CB    . PRO A 1 247 ? 33.307 149.962 3.731  1.00 78.70  ? 247 PRO A CB    1 
ATOM   2024 C  CG    . PRO A 1 247 ? 34.069 149.215 4.776  1.00 78.34  ? 247 PRO A CG    1 
ATOM   2025 C  CD    . PRO A 1 247 ? 33.133 149.042 5.934  1.00 77.48  ? 247 PRO A CD    1 
ATOM   2026 N  N     . GLU A 1 248 ? 30.289 148.609 2.292  1.00 83.73  ? 248 GLU A N     1 
ATOM   2027 C  CA    . GLU A 1 248 ? 29.797 147.719 1.247  1.00 85.50  ? 248 GLU A CA    1 
ATOM   2028 C  C     . GLU A 1 248 ? 30.468 148.154 -0.049 1.00 86.46  ? 248 GLU A C     1 
ATOM   2029 O  O     . GLU A 1 248 ? 30.038 149.119 -0.677 1.00 86.95  ? 248 GLU A O     1 
ATOM   2030 C  CB    . GLU A 1 248 ? 28.271 147.848 1.132  1.00 85.35  ? 248 GLU A CB    1 
ATOM   2031 C  CG    . GLU A 1 248 ? 27.554 147.830 2.488  1.00 85.85  ? 248 GLU A CG    1 
ATOM   2032 C  CD    . GLU A 1 248 ? 26.033 147.732 2.385  1.00 86.64  ? 248 GLU A CD    1 
ATOM   2033 O  OE1   . GLU A 1 248 ? 25.527 146.767 1.767  1.00 86.09  ? 248 GLU A OE1   1 
ATOM   2034 O  OE2   . GLU A 1 248 ? 25.341 148.620 2.932  1.00 86.37  ? 248 GLU A OE2   1 
ATOM   2035 N  N     . LYS A 1 249 ? 31.531 147.449 -0.433 1.00 87.41  ? 249 LYS A N     1 
ATOM   2036 C  CA    . LYS A 1 249 ? 32.402 147.888 -1.526 1.00 88.35  ? 249 LYS A CA    1 
ATOM   2037 C  C     . LYS A 1 249 ? 32.425 146.905 -2.706 1.00 90.11  ? 249 LYS A C     1 
ATOM   2038 O  O     . LYS A 1 249 ? 32.205 145.705 -2.532 1.00 90.84  ? 249 LYS A O     1 
ATOM   2039 C  CB    . LYS A 1 249 ? 33.823 148.096 -0.995 1.00 86.79  ? 249 LYS A CB    1 
ATOM   2040 C  CG    . LYS A 1 249 ? 34.803 148.655 -2.008 1.00 86.14  ? 249 LYS A CG    1 
ATOM   2041 C  CD    . LYS A 1 249 ? 36.127 149.044 -1.352 1.00 85.31  ? 249 LYS A CD    1 
ATOM   2042 C  CE    . LYS A 1 249 ? 35.953 150.125 -0.270 1.00 84.81  ? 249 LYS A CE    1 
ATOM   2043 N  NZ    . LYS A 1 249 ? 35.591 151.487 -0.781 1.00 82.41  ? 249 LYS A NZ    1 
ATOM   2044 N  N     . ASP A 1 250 ? 32.688 147.424 -3.905 1.00 91.35  ? 250 ASP A N     1 
ATOM   2045 C  CA    . ASP A 1 250 ? 32.663 146.620 -5.133 1.00 92.50  ? 250 ASP A CA    1 
ATOM   2046 C  C     . ASP A 1 250 ? 33.972 145.859 -5.350 1.00 92.94  ? 250 ASP A C     1 
ATOM   2047 O  O     . ASP A 1 250 ? 33.976 144.646 -5.598 1.00 92.83  ? 250 ASP A O     1 
ATOM   2048 C  CB    . ASP A 1 250 ? 32.415 147.517 -6.356 1.00 93.29  ? 250 ASP A CB    1 
ATOM   2049 C  CG    . ASP A 1 250 ? 30.997 148.046 -6.421 1.00 94.17  ? 250 ASP A CG    1 
ATOM   2050 O  OD1   . ASP A 1 250 ? 30.057 147.230 -6.318 1.00 94.50  ? 250 ASP A OD1   1 
ATOM   2051 O  OD2   . ASP A 1 250 ? 30.827 149.277 -6.579 1.00 94.04  ? 250 ASP A OD2   1 
ATOM   2052 N  N     . SER A 1 251 ? 35.078 146.594 -5.275 1.00 92.86  ? 251 SER A N     1 
ATOM   2053 C  CA    . SER A 1 251 ? 36.398 146.053 -5.562 1.00 92.01  ? 251 SER A CA    1 
ATOM   2054 C  C     . SER A 1 251 ? 37.310 146.290 -4.366 1.00 91.52  ? 251 SER A C     1 
ATOM   2055 O  O     . SER A 1 251 ? 37.857 147.379 -4.184 1.00 91.35  ? 251 SER A O     1 
ATOM   2056 C  CB    . SER A 1 251 ? 36.979 146.734 -6.804 1.00 91.85  ? 251 SER A CB    1 
ATOM   2057 O  OG    . SER A 1 251 ? 38.274 146.250 -7.104 1.00 92.12  ? 251 SER A OG    1 
ATOM   2058 N  N     . TRP A 1 252 ? 37.476 145.265 -3.544 1.00 90.56  ? 252 TRP A N     1 
ATOM   2059 C  CA    . TRP A 1 252 ? 38.262 145.430 -2.340 1.00 89.61  ? 252 TRP A CA    1 
ATOM   2060 C  C     . TRP A 1 252 ? 39.759 145.513 -2.631 1.00 87.51  ? 252 TRP A C     1 
ATOM   2061 O  O     . TRP A 1 252 ? 40.355 144.583 -3.177 1.00 86.09  ? 252 TRP A O     1 
ATOM   2062 C  CB    . TRP A 1 252 ? 37.958 144.293 -1.351 1.00 90.99  ? 252 TRP A CB    1 
ATOM   2063 C  CG    . TRP A 1 252 ? 36.916 144.669 -0.305 1.00 93.26  ? 252 TRP A CG    1 
ATOM   2064 C  CD1   . TRP A 1 252 ? 37.131 145.363 0.859  1.00 92.92  ? 252 TRP A CD1   1 
ATOM   2065 C  CD2   . TRP A 1 252 ? 35.502 144.399 -0.351 1.00 94.15  ? 252 TRP A CD2   1 
ATOM   2066 N  NE1   . TRP A 1 252 ? 35.946 145.538 1.536  1.00 92.26  ? 252 TRP A NE1   1 
ATOM   2067 C  CE2   . TRP A 1 252 ? 34.933 144.956 0.821  1.00 93.79  ? 252 TRP A CE2   1 
ATOM   2068 C  CE3   . TRP A 1 252 ? 34.667 143.734 -1.258 1.00 93.59  ? 252 TRP A CE3   1 
ATOM   2069 C  CZ2   . TRP A 1 252 ? 33.563 144.878 1.096  1.00 93.70  ? 252 TRP A CZ2   1 
ATOM   2070 C  CZ3   . TRP A 1 252 ? 33.308 143.657 -0.979 1.00 93.83  ? 252 TRP A CZ3   1 
ATOM   2071 C  CH2   . TRP A 1 252 ? 32.773 144.224 0.190  1.00 93.78  ? 252 TRP A CH2   1 
ATOM   2072 N  N     . THR A 1 253 ? 40.354 146.648 -2.275 1.00 85.86  ? 253 THR A N     1 
ATOM   2073 C  CA    . THR A 1 253 ? 41.799 146.718 -2.081 1.00 84.18  ? 253 THR A CA    1 
ATOM   2074 C  C     . THR A 1 253 ? 42.123 146.048 -0.743 1.00 82.61  ? 253 THR A C     1 
ATOM   2075 O  O     . THR A 1 253 ? 41.246 145.875 0.104  1.00 81.83  ? 253 THR A O     1 
ATOM   2076 C  CB    . THR A 1 253 ? 42.325 148.195 -2.059 1.00 84.47  ? 253 THR A CB    1 
ATOM   2077 O  OG1   . THR A 1 253 ? 41.981 148.833 -0.820 1.00 82.11  ? 253 THR A OG1   1 
ATOM   2078 C  CG2   . THR A 1 253 ? 41.719 148.990 -3.209 1.00 84.14  ? 253 THR A CG2   1 
ATOM   2079 N  N     . VAL A 1 254 ? 43.378 145.663 -0.560 1.00 81.20  ? 254 VAL A N     1 
ATOM   2080 C  CA    . VAL A 1 254 ? 43.800 145.022 0.679  1.00 80.15  ? 254 VAL A CA    1 
ATOM   2081 C  C     . VAL A 1 254 ? 43.541 145.911 1.890  1.00 78.87  ? 254 VAL A C     1 
ATOM   2082 O  O     . VAL A 1 254 ? 42.940 145.482 2.873  1.00 79.53  ? 254 VAL A O     1 
ATOM   2083 C  CB    . VAL A 1 254 ? 45.294 144.668 0.620  1.00 80.13  ? 254 VAL A CB    1 
ATOM   2084 C  CG1   . VAL A 1 254 ? 46.039 145.767 -0.071 1.00 81.60  ? 254 VAL A CG1   1 
ATOM   2085 C  CG2   . VAL A 1 254 ? 45.844 144.482 2.017  1.00 79.22  ? 254 VAL A CG2   1 
ATOM   2086 N  N     . ASN A 1 255 ? 43.987 147.155 1.809  1.00 77.01  ? 255 ASN A N     1 
ATOM   2087 C  CA    . ASN A 1 255 ? 43.770 148.111 2.882  1.00 74.79  ? 255 ASN A CA    1 
ATOM   2088 C  C     . ASN A 1 255 ? 42.282 148.368 3.141  1.00 73.29  ? 255 ASN A C     1 
ATOM   2089 O  O     . ASN A 1 255 ? 41.900 148.712 4.250  1.00 73.44  ? 255 ASN A O     1 
ATOM   2090 C  CB    . ASN A 1 255 ? 44.467 149.419 2.537  1.00 74.98  ? 255 ASN A CB    1 
ATOM   2091 C  CG    . ASN A 1 255 ? 44.859 150.201 3.755  1.00 75.66  ? 255 ASN A CG    1 
ATOM   2092 O  OD1   . ASN A 1 255 ? 44.296 151.258 4.028  1.00 77.26  ? 255 ASN A OD1   1 
ATOM   2093 N  ND2   . ASN A 1 255 ? 45.835 149.691 4.501  1.00 75.65  ? 255 ASN A ND2   1 
ATOM   2094 N  N     . ASP A 1 256 ? 41.444 148.212 2.119  1.00 72.45  ? 256 ASP A N     1 
ATOM   2095 C  CA    . ASP A 1 256 ? 39.993 148.268 2.311  1.00 70.50  ? 256 ASP A CA    1 
ATOM   2096 C  C     . ASP A 1 256 ? 39.600 147.106 3.213  1.00 69.20  ? 256 ASP A C     1 
ATOM   2097 O  O     . ASP A 1 256 ? 38.637 147.184 3.975  1.00 69.09  ? 256 ASP A O     1 
ATOM   2098 C  CB    . ASP A 1 256 ? 39.247 148.130 0.971  1.00 71.84  ? 256 ASP A CB    1 
ATOM   2099 C  CG    . ASP A 1 256 ? 39.339 149.384 0.089  1.00 73.49  ? 256 ASP A CG    1 
ATOM   2100 O  OD1   . ASP A 1 256 ? 39.333 149.228 -1.154 1.00 73.72  ? 256 ASP A OD1   1 
ATOM   2101 O  OD2   . ASP A 1 256 ? 39.406 150.516 0.621  1.00 73.55  ? 256 ASP A OD2   1 
ATOM   2102 N  N     . ILE A 1 257 ? 40.362 146.024 3.110  1.00 67.57  ? 257 ILE A N     1 
ATOM   2103 C  CA    . ILE A 1 257 ? 40.102 144.805 3.862  1.00 65.52  ? 257 ILE A CA    1 
ATOM   2104 C  C     . ILE A 1 257 ? 40.561 144.949 5.302  1.00 64.54  ? 257 ILE A C     1 
ATOM   2105 O  O     . ILE A 1 257 ? 39.943 144.420 6.227  1.00 65.14  ? 257 ILE A O     1 
ATOM   2106 C  CB    . ILE A 1 257 ? 40.824 143.605 3.212  1.00 65.30  ? 257 ILE A CB    1 
ATOM   2107 C  CG1   . ILE A 1 257 ? 40.016 143.094 2.021  1.00 65.10  ? 257 ILE A CG1   1 
ATOM   2108 C  CG2   . ILE A 1 257 ? 41.050 142.510 4.222  1.00 65.71  ? 257 ILE A CG2   1 
ATOM   2109 C  CD1   . ILE A 1 257 ? 40.435 141.716 1.571  1.00 64.14  ? 257 ILE A CD1   1 
ATOM   2110 N  N     . CYS A 1 258 ? 41.646 145.677 5.503  1.00 62.55  ? 258 CYS A N     1 
ATOM   2111 C  CA    . CYS A 1 258 ? 42.065 145.960 6.855  1.00 61.84  ? 258 CYS A CA    1 
ATOM   2112 C  C     . CYS A 1 258 ? 41.060 146.881 7.552  1.00 61.66  ? 258 CYS A C     1 
ATOM   2113 O  O     . CYS A 1 258 ? 40.840 146.768 8.754  1.00 61.94  ? 258 CYS A O     1 
ATOM   2114 C  CB    . CYS A 1 258 ? 43.480 146.550 6.850  1.00 60.98  ? 258 CYS A CB    1 
ATOM   2115 S  SG    . CYS A 1 258 ? 44.763 145.284 7.150  1.00 57.80  ? 258 CYS A SG    1 
ATOM   2116 N  N     . LYS A 1 259 ? 40.430 147.767 6.784  1.00 61.77  ? 259 LYS A N     1 
ATOM   2117 C  CA    . LYS A 1 259 ? 39.353 148.620 7.285  1.00 59.94  ? 259 LYS A CA    1 
ATOM   2118 C  C     . LYS A 1 259 ? 38.099 147.830 7.628  1.00 58.55  ? 259 LYS A C     1 
ATOM   2119 O  O     . LYS A 1 259 ? 37.322 148.234 8.493  1.00 59.03  ? 259 LYS A O     1 
ATOM   2120 C  CB    . LYS A 1 259 ? 38.992 149.694 6.254  1.00 61.56  ? 259 LYS A CB    1 
ATOM   2121 C  CG    . LYS A 1 259 ? 37.700 150.472 6.585  1.00 66.31  ? 259 LYS A CG    1 
ATOM   2122 C  CD    . LYS A 1 259 ? 37.531 151.747 5.725  1.00 67.25  ? 259 LYS A CD    1 
ATOM   2123 C  CE    . LYS A 1 259 ? 36.088 152.287 5.761  1.00 67.18  ? 259 LYS A CE    1 
ATOM   2124 N  NZ    . LYS A 1 259 ? 35.724 153.093 4.543  1.00 66.18  ? 259 LYS A NZ    1 
ATOM   2125 N  N     . LEU A 1 260 ? 37.890 146.710 6.947  1.00 56.94  ? 260 LEU A N     1 
ATOM   2126 C  CA    . LEU A 1 260 ? 36.725 145.881 7.222  1.00 54.42  ? 260 LEU A CA    1 
ATOM   2127 C  C     . LEU A 1 260 ? 36.976 144.991 8.430  1.00 52.92  ? 260 LEU A C     1 
ATOM   2128 O  O     . LEU A 1 260 ? 36.121 144.838 9.291  1.00 52.45  ? 260 LEU A O     1 
ATOM   2129 C  CB    . LEU A 1 260 ? 36.376 145.012 6.012  1.00 53.57  ? 260 LEU A CB    1 
ATOM   2130 C  CG    . LEU A 1 260 ? 35.145 144.135 6.269  1.00 54.04  ? 260 LEU A CG    1 
ATOM   2131 C  CD1   . LEU A 1 260 ? 33.875 144.961 6.131  1.00 53.06  ? 260 LEU A CD1   1 
ATOM   2132 C  CD2   . LEU A 1 260 ? 35.130 142.976 5.307  1.00 53.27  ? 260 LEU A CD2   1 
ATOM   2133 N  N     . VAL A 1 261 ? 38.157 144.402 8.497  1.00 52.56  ? 261 VAL A N     1 
ATOM   2134 C  CA    . VAL A 1 261 ? 38.525 143.630 9.672  1.00 52.48  ? 261 VAL A CA    1 
ATOM   2135 C  C     . VAL A 1 261 ? 38.461 144.484 10.927 1.00 51.53  ? 261 VAL A C     1 
ATOM   2136 O  O     . VAL A 1 261 ? 38.165 143.990 12.009 1.00 50.17  ? 261 VAL A O     1 
ATOM   2137 C  CB    . VAL A 1 261 ? 39.942 143.083 9.535  1.00 54.16  ? 261 VAL A CB    1 
ATOM   2138 C  CG1   . VAL A 1 261 ? 40.429 142.555 10.871 1.00 54.08  ? 261 VAL A CG1   1 
ATOM   2139 C  CG2   . VAL A 1 261 ? 39.963 141.986 8.493  1.00 55.28  ? 261 VAL A CG2   1 
ATOM   2140 N  N     . GLY A 1 262 ? 38.744 145.774 10.766 1.00 50.97  ? 262 GLY A N     1 
ATOM   2141 C  CA    . GLY A 1 262 ? 38.791 146.683 11.893 1.00 48.67  ? 262 GLY A CA    1 
ATOM   2142 C  C     . GLY A 1 262 ? 37.439 146.869 12.538 1.00 48.03  ? 262 GLY A C     1 
ATOM   2143 O  O     . GLY A 1 262 ? 37.300 146.707 13.751 1.00 48.39  ? 262 GLY A O     1 
ATOM   2144 N  N     . LYS A 1 263 ? 36.435 147.206 11.738 1.00 47.19  ? 263 LYS A N     1 
ATOM   2145 C  CA    . LYS A 1 263 ? 35.104 147.426 12.280 1.00 47.25  ? 263 LYS A CA    1 
ATOM   2146 C  C     . LYS A 1 263 ? 34.551 146.149 12.874 1.00 48.43  ? 263 LYS A C     1 
ATOM   2147 O  O     . LYS A 1 263 ? 33.885 146.181 13.909 1.00 48.94  ? 263 LYS A O     1 
ATOM   2148 C  CB    . LYS A 1 263 ? 34.155 147.940 11.204 1.00 46.62  ? 263 LYS A CB    1 
ATOM   2149 C  CG    . LYS A 1 263 ? 34.604 149.242 10.589 1.00 48.79  ? 263 LYS A CG    1 
ATOM   2150 C  CD    . LYS A 1 263 ? 33.436 150.106 10.165 1.00 48.29  ? 263 LYS A CD    1 
ATOM   2151 C  CE    . LYS A 1 263 ? 33.812 151.581 10.261 1.00 50.76  ? 263 LYS A CE    1 
ATOM   2152 N  NZ    . LYS A 1 263 ? 33.054 152.441 9.307  1.00 52.07  ? 263 LYS A NZ    1 
ATOM   2153 N  N     . LEU A 1 264 ? 34.837 145.020 12.228 1.00 48.02  ? 264 LEU A N     1 
ATOM   2154 C  CA    . LEU A 1 264 ? 34.369 143.734 12.727 1.00 47.75  ? 264 LEU A CA    1 
ATOM   2155 C  C     . LEU A 1 264 ? 34.963 143.416 14.099 1.00 48.19  ? 264 LEU A C     1 
ATOM   2156 O  O     . LEU A 1 264 ? 34.264 142.931 14.984 1.00 49.57  ? 264 LEU A O     1 
ATOM   2157 C  CB    . LEU A 1 264 ? 34.725 142.615 11.746 1.00 47.40  ? 264 LEU A CB    1 
ATOM   2158 C  CG    . LEU A 1 264 ? 33.730 142.161 10.666 1.00 46.51  ? 264 LEU A CG    1 
ATOM   2159 C  CD1   . LEU A 1 264 ? 32.307 142.500 11.092 1.00 42.51  ? 264 LEU A CD1   1 
ATOM   2160 C  CD2   . LEU A 1 264 ? 34.088 142.807 9.328  1.00 45.89  ? 264 LEU A CD2   1 
ATOM   2161 N  N     . ASN A 1 265 ? 36.254 143.688 14.273 1.00 48.00  ? 265 ASN A N     1 
ATOM   2162 C  CA    . ASN A 1 265 ? 36.925 143.474 15.553 1.00 46.88  ? 265 ASN A CA    1 
ATOM   2163 C  C     . ASN A 1 265 ? 36.283 144.302 16.664 1.00 47.10  ? 265 ASN A C     1 
ATOM   2164 O  O     . ASN A 1 265 ? 36.001 143.796 17.753 1.00 46.31  ? 265 ASN A O     1 
ATOM   2165 C  CB    . ASN A 1 265 ? 38.401 143.848 15.433 1.00 47.83  ? 265 ASN A CB    1 
ATOM   2166 C  CG    . ASN A 1 265 ? 39.234 142.754 14.790 1.00 47.60  ? 265 ASN A CG    1 
ATOM   2167 O  OD1   . ASN A 1 265 ? 39.024 141.573 15.050 1.00 44.74  ? 265 ASN A OD1   1 
ATOM   2168 N  ND2   . ASN A 1 265 ? 40.196 143.147 13.957 1.00 47.60  ? 265 ASN A ND2   1 
ATOM   2169 N  N     . TRP A 1 266 ? 36.056 145.581 16.372 1.00 46.68  ? 266 TRP A N     1 
ATOM   2170 C  CA    . TRP A 1 266 ? 35.405 146.499 17.301 1.00 45.84  ? 266 TRP A CA    1 
ATOM   2171 C  C     . TRP A 1 266 ? 33.977 146.055 17.624 1.00 46.63  ? 266 TRP A C     1 
ATOM   2172 O  O     . TRP A 1 266 ? 33.495 146.239 18.738 1.00 46.73  ? 266 TRP A O     1 
ATOM   2173 C  CB    . TRP A 1 266 ? 35.397 147.904 16.702 1.00 44.41  ? 266 TRP A CB    1 
ATOM   2174 C  CG    . TRP A 1 266 ? 34.496 148.883 17.394 1.00 44.25  ? 266 TRP A CG    1 
ATOM   2175 C  CD1   . TRP A 1 266 ? 33.285 149.321 16.955 1.00 45.39  ? 266 TRP A CD1   1 
ATOM   2176 C  CD2   . TRP A 1 266 ? 34.763 149.598 18.604 1.00 44.62  ? 266 TRP A CD2   1 
ATOM   2177 N  NE1   . TRP A 1 266 ? 32.783 150.264 17.809 1.00 45.24  ? 266 TRP A NE1   1 
ATOM   2178 C  CE2   . TRP A 1 266 ? 33.673 150.455 18.829 1.00 44.59  ? 266 TRP A CE2   1 
ATOM   2179 C  CE3   . TRP A 1 266 ? 35.820 149.601 19.517 1.00 45.66  ? 266 TRP A CE3   1 
ATOM   2180 C  CZ2   . TRP A 1 266 ? 33.608 151.306 19.927 1.00 45.19  ? 266 TRP A CZ2   1 
ATOM   2181 C  CZ3   . TRP A 1 266 ? 35.754 150.449 20.611 1.00 45.43  ? 266 TRP A CZ3   1 
ATOM   2182 C  CH2   . TRP A 1 266 ? 34.657 151.288 20.805 1.00 45.81  ? 266 TRP A CH2   1 
ATOM   2183 N  N     . ALA A 1 267 ? 33.307 145.473 16.636 1.00 46.35  ? 267 ALA A N     1 
ATOM   2184 C  CA    . ALA A 1 267 ? 31.951 144.988 16.804 1.00 44.35  ? 267 ALA A CA    1 
ATOM   2185 C  C     . ALA A 1 267 ? 31.989 143.739 17.658 1.00 44.22  ? 267 ALA A C     1 
ATOM   2186 O  O     . ALA A 1 267 ? 31.012 143.394 18.323 1.00 44.28  ? 267 ALA A O     1 
ATOM   2187 C  CB    . ALA A 1 267 ? 31.360 144.672 15.449 1.00 45.51  ? 267 ALA A CB    1 
ATOM   2188 N  N     . SER A 1 268 ? 33.138 143.075 17.642 1.00 44.16  ? 268 SER A N     1 
ATOM   2189 C  CA    . SER A 1 268 ? 33.258 141.737 18.193 1.00 44.24  ? 268 SER A CA    1 
ATOM   2190 C  C     . SER A 1 268 ? 33.226 141.784 19.698 1.00 43.45  ? 268 SER A C     1 
ATOM   2191 O  O     . SER A 1 268 ? 33.167 140.757 20.349 1.00 45.11  ? 268 SER A O     1 
ATOM   2192 C  CB    . SER A 1 268 ? 34.556 141.078 17.723 1.00 44.71  ? 268 SER A CB    1 
ATOM   2193 O  OG    . SER A 1 268 ? 35.558 141.140 18.723 1.00 47.20  ? 268 SER A OG    1 
ATOM   2194 N  N     . GLN A 1 269 ? 33.253 142.983 20.252 1.00 43.68  ? 269 GLN A N     1 
ATOM   2195 C  CA    . GLN A 1 269 ? 33.259 143.140 21.698 1.00 44.88  ? 269 GLN A CA    1 
ATOM   2196 C  C     . GLN A 1 269 ? 31.875 143.057 22.335 1.00 45.93  ? 269 GLN A C     1 
ATOM   2197 O  O     . GLN A 1 269 ? 31.765 142.928 23.551 1.00 46.26  ? 269 GLN A O     1 
ATOM   2198 C  CB    . GLN A 1 269 ? 33.892 144.469 22.075 1.00 42.63  ? 269 GLN A CB    1 
ATOM   2199 C  CG    . GLN A 1 269 ? 33.068 145.623 21.632 1.00 40.97  ? 269 GLN A CG    1 
ATOM   2200 C  CD    . GLN A 1 269 ? 33.710 146.935 21.932 1.00 42.73  ? 269 GLN A CD    1 
ATOM   2201 O  OE1   . GLN A 1 269 ? 33.946 147.731 21.030 1.00 45.19  ? 269 GLN A OE1   1 
ATOM   2202 N  NE2   . GLN A 1 269 ? 33.993 147.186 23.207 1.00 42.40  ? 269 GLN A NE2   1 
ATOM   2203 N  N     . ILE A 1 270 ? 30.817 143.134 21.539 1.00 46.94  ? 270 ILE A N     1 
ATOM   2204 C  CA    . ILE A 1 270 ? 29.484 142.996 22.119 1.00 51.56  ? 270 ILE A CA    1 
ATOM   2205 C  C     . ILE A 1 270 ? 28.538 142.167 21.244 1.00 54.58  ? 270 ILE A C     1 
ATOM   2206 O  O     . ILE A 1 270 ? 27.488 141.700 21.702 1.00 54.25  ? 270 ILE A O     1 
ATOM   2207 C  CB    . ILE A 1 270 ? 28.846 144.379 22.395 1.00 50.22  ? 270 ILE A CB    1 
ATOM   2208 C  CG1   . ILE A 1 270 ? 27.823 144.264 23.524 1.00 49.83  ? 270 ILE A CG1   1 
ATOM   2209 C  CG2   . ILE A 1 270 ? 28.146 144.891 21.145 1.00 49.55  ? 270 ILE A CG2   1 
ATOM   2210 C  CD1   . ILE A 1 270 ? 28.281 143.405 24.682 1.00 48.79  ? 270 ILE A CD1   1 
ATOM   2211 N  N     . TYR A 1 271 ? 28.918 141.984 19.985 1.00 56.85  ? 271 TYR A N     1 
ATOM   2212 C  CA    . TYR A 1 271 ? 28.183 141.091 19.109 1.00 59.66  ? 271 TYR A CA    1 
ATOM   2213 C  C     . TYR A 1 271 ? 28.825 139.715 19.121 1.00 60.95  ? 271 TYR A C     1 
ATOM   2214 O  O     . TYR A 1 271 ? 29.818 139.475 18.423 1.00 62.46  ? 271 TYR A O     1 
ATOM   2215 C  CB    . TYR A 1 271 ? 28.175 141.623 17.680 1.00 61.87  ? 271 TYR A CB    1 
ATOM   2216 C  CG    . TYR A 1 271 ? 27.313 142.840 17.478 1.00 65.60  ? 271 TYR A CG    1 
ATOM   2217 C  CD1   . TYR A 1 271 ? 25.930 142.739 17.480 1.00 67.05  ? 271 TYR A CD1   1 
ATOM   2218 C  CD2   . TYR A 1 271 ? 27.878 144.083 17.234 1.00 66.62  ? 271 TYR A CD2   1 
ATOM   2219 C  CE1   . TYR A 1 271 ? 25.128 143.841 17.236 1.00 68.11  ? 271 TYR A CE1   1 
ATOM   2220 C  CE2   . TYR A 1 271 ? 27.085 145.190 16.985 1.00 68.58  ? 271 TYR A CE2   1 
ATOM   2221 C  CZ    . TYR A 1 271 ? 25.708 145.062 16.982 1.00 68.80  ? 271 TYR A CZ    1 
ATOM   2222 O  OH    . TYR A 1 271 ? 24.912 146.143 16.660 1.00 69.71  ? 271 TYR A OH    1 
ATOM   2223 N  N     . PRO A 1 272 ? 28.254 138.784 19.899 1.00 60.72  ? 272 PRO A N     1 
ATOM   2224 C  CA    . PRO A 1 272 ? 28.753 137.407 19.892 1.00 59.45  ? 272 PRO A CA    1 
ATOM   2225 C  C     . PRO A 1 272 ? 28.784 136.822 18.488 1.00 58.15  ? 272 PRO A C     1 
ATOM   2226 O  O     . PRO A 1 272 ? 27.857 137.021 17.701 1.00 57.71  ? 272 PRO A O     1 
ATOM   2227 C  CB    . PRO A 1 272 ? 27.774 136.662 20.792 1.00 59.50  ? 272 PRO A CB    1 
ATOM   2228 C  CG    . PRO A 1 272 ? 26.526 137.492 20.766 1.00 60.07  ? 272 PRO A CG    1 
ATOM   2229 C  CD    . PRO A 1 272 ? 26.992 138.911 20.648 1.00 61.12  ? 272 PRO A CD    1 
ATOM   2230 N  N     . GLY A 1 273 ? 29.869 136.116 18.182 1.00 57.51  ? 273 GLY A N     1 
ATOM   2231 C  CA    . GLY A 1 273 ? 29.894 135.275 17.004 1.00 56.18  ? 273 GLY A CA    1 
ATOM   2232 C  C     . GLY A 1 273 ? 30.560 135.881 15.796 1.00 56.48  ? 273 GLY A C     1 
ATOM   2233 O  O     . GLY A 1 273 ? 30.498 135.316 14.712 1.00 57.56  ? 273 GLY A O     1 
ATOM   2234 N  N     . ILE A 1 274 ? 31.205 137.026 15.973 1.00 56.75  ? 274 ILE A N     1 
ATOM   2235 C  CA    . ILE A 1 274 ? 31.838 137.714 14.858 1.00 55.89  ? 274 ILE A CA    1 
ATOM   2236 C  C     . ILE A 1 274 ? 33.050 136.928 14.384 1.00 56.36  ? 274 ILE A C     1 
ATOM   2237 O  O     . ILE A 1 274 ? 33.937 136.631 15.169 1.00 56.15  ? 274 ILE A O     1 
ATOM   2238 C  CB    . ILE A 1 274 ? 32.259 139.141 15.276 1.00 56.21  ? 274 ILE A CB    1 
ATOM   2239 C  CG1   . ILE A 1 274 ? 31.017 139.990 15.552 1.00 56.40  ? 274 ILE A CG1   1 
ATOM   2240 C  CG2   . ILE A 1 274 ? 33.073 139.794 14.188 1.00 54.51  ? 274 ILE A CG2   1 
ATOM   2241 C  CD1   . ILE A 1 274 ? 30.309 140.442 14.284 1.00 57.64  ? 274 ILE A CD1   1 
ATOM   2242 N  N     . LYS A 1 275 ? 33.069 136.580 13.099 1.00 58.12  ? 275 LYS A N     1 
ATOM   2243 C  CA    . LYS A 1 275 ? 34.165 135.810 12.516 1.00 60.69  ? 275 LYS A CA    1 
ATOM   2244 C  C     . LYS A 1 275 ? 35.043 136.672 11.610 1.00 61.40  ? 275 LYS A C     1 
ATOM   2245 O  O     . LYS A 1 275 ? 34.541 137.430 10.786 1.00 60.74  ? 275 LYS A O     1 
ATOM   2246 C  CB    . LYS A 1 275 ? 33.611 134.638 11.704 1.00 61.70  ? 275 LYS A CB    1 
ATOM   2247 C  CG    . LYS A 1 275 ? 32.922 133.562 12.526 1.00 65.32  ? 275 LYS A CG    1 
ATOM   2248 C  CD    . LYS A 1 275 ? 32.243 132.535 11.624 1.00 68.61  ? 275 LYS A CD    1 
ATOM   2249 C  CE    . LYS A 1 275 ? 31.501 131.469 12.431 1.00 70.34  ? 275 LYS A CE    1 
ATOM   2250 N  NZ    . LYS A 1 275 ? 30.764 130.502 11.555 1.00 72.12  ? 275 LYS A NZ    1 
ATOM   2251 N  N     . VAL A 1 276 ? 36.357 136.549 11.747 1.00 63.31  ? 276 VAL A N     1 
ATOM   2252 C  CA    . VAL A 1 276 ? 37.257 137.395 10.973 1.00 65.64  ? 276 VAL A CA    1 
ATOM   2253 C  C     . VAL A 1 276 ? 38.446 136.619 10.421 1.00 69.35  ? 276 VAL A C     1 
ATOM   2254 O  O     . VAL A 1 276 ? 39.197 137.148 9.604  1.00 70.33  ? 276 VAL A O     1 
ATOM   2255 C  CB    . VAL A 1 276 ? 37.817 138.564 11.818 1.00 63.28  ? 276 VAL A CB    1 
ATOM   2256 C  CG1   . VAL A 1 276 ? 39.039 138.111 12.592 1.00 63.39  ? 276 VAL A CG1   1 
ATOM   2257 C  CG2   . VAL A 1 276 ? 38.177 139.713 10.932 1.00 62.50  ? 276 VAL A CG2   1 
ATOM   2258 N  N     . ARG A 1 277 ? 38.622 135.377 10.871 1.00 72.91  ? 277 ARG A N     1 
ATOM   2259 C  CA    . ARG A 1 277 ? 39.751 134.552 10.432 1.00 76.22  ? 277 ARG A CA    1 
ATOM   2260 C  C     . ARG A 1 277 ? 39.832 134.376 8.909  1.00 77.60  ? 277 ARG A C     1 
ATOM   2261 O  O     . ARG A 1 277 ? 40.929 134.392 8.338  1.00 78.58  ? 277 ARG A O     1 
ATOM   2262 C  CB    . ARG A 1 277 ? 39.698 133.175 11.099 1.00 77.54  ? 277 ARG A CB    1 
ATOM   2263 C  CG    . ARG A 1 277 ? 40.666 132.154 10.516 1.00 79.97  ? 277 ARG A CG    1 
ATOM   2264 C  CD    . ARG A 1 277 ? 42.108 132.385 10.972 1.00 83.72  ? 277 ARG A CD    1 
ATOM   2265 N  NE    . ARG A 1 277 ? 42.989 131.293 10.545 1.00 87.37  ? 277 ARG A NE    1 
ATOM   2266 C  CZ    . ARG A 1 277 ? 44.302 131.233 10.776 1.00 88.35  ? 277 ARG A CZ    1 
ATOM   2267 N  NH1   . ARG A 1 277 ? 44.912 132.210 11.440 1.00 88.66  ? 277 ARG A NH1   1 
ATOM   2268 N  NH2   . ARG A 1 277 ? 45.006 130.192 10.341 1.00 88.06  ? 277 ARG A NH2   1 
ATOM   2269 N  N     . GLN A 1 278 ? 38.684 134.215 8.250  1.00 78.05  ? 278 GLN A N     1 
ATOM   2270 C  CA    . GLN A 1 278 ? 38.657 134.033 6.797  1.00 77.74  ? 278 GLN A CA    1 
ATOM   2271 C  C     . GLN A 1 278 ? 39.092 135.282 6.051  1.00 77.49  ? 278 GLN A C     1 
ATOM   2272 O  O     . GLN A 1 278 ? 39.678 135.191 4.970  1.00 78.16  ? 278 GLN A O     1 
ATOM   2273 C  CB    . GLN A 1 278 ? 37.258 133.638 6.330  1.00 79.03  ? 278 GLN A CB    1 
ATOM   2274 C  CG    . GLN A 1 278 ? 36.965 132.161 6.465  1.00 81.42  ? 278 GLN A CG    1 
ATOM   2275 C  CD    . GLN A 1 278 ? 37.883 131.318 5.604  1.00 83.48  ? 278 GLN A CD    1 
ATOM   2276 O  OE1   . GLN A 1 278 ? 38.356 131.764 4.552  1.00 85.09  ? 278 GLN A OE1   1 
ATOM   2277 N  NE2   . GLN A 1 278 ? 38.146 130.094 6.045  1.00 84.28  ? 278 GLN A NE2   1 
ATOM   2278 N  N     . LEU A 1 279 ? 38.804 136.445 6.632  1.00 75.80  ? 279 LEU A N     1 
ATOM   2279 C  CA    . LEU A 1 279 ? 39.127 137.718 6.001  1.00 73.90  ? 279 LEU A CA    1 
ATOM   2280 C  C     . LEU A 1 279 ? 40.542 138.197 6.322  1.00 74.54  ? 279 LEU A C     1 
ATOM   2281 O  O     . LEU A 1 279 ? 41.204 138.795 5.472  1.00 73.09  ? 279 LEU A O     1 
ATOM   2282 C  CB    . LEU A 1 279 ? 38.087 138.758 6.408  1.00 71.16  ? 279 LEU A CB    1 
ATOM   2283 C  CG    . LEU A 1 279 ? 36.773 138.569 5.645  1.00 69.27  ? 279 LEU A CG    1 
ATOM   2284 C  CD1   . LEU A 1 279 ? 35.573 138.802 6.540  1.00 67.91  ? 279 LEU A CD1   1 
ATOM   2285 C  CD2   . LEU A 1 279 ? 36.763 139.513 4.455  1.00 68.24  ? 279 LEU A CD2   1 
ATOM   2286 N  N     . SER A 1 280 ? 41.003 137.914 7.540  1.00 76.14  ? 280 SER A N     1 
ATOM   2287 C  CA    . SER A 1 280 ? 42.420 138.055 7.898  1.00 77.76  ? 280 SER A CA    1 
ATOM   2288 C  C     . SER A 1 280 ? 43.228 136.843 7.425  1.00 78.72  ? 280 SER A C     1 
ATOM   2289 O  O     . SER A 1 280 ? 44.102 136.330 8.140  1.00 78.46  ? 280 SER A O     1 
ATOM   2290 C  CB    . SER A 1 280 ? 42.583 138.221 9.419  1.00 77.80  ? 280 SER A CB    1 
ATOM   2291 O  OG    . SER A 1 280 ? 42.744 136.979 10.091 1.00 77.74  ? 280 SER A OG    1 
ATOM   2292 N  N     . LYS A 1 281 ? 42.908 136.379 6.222  1.00 79.69  ? 281 LYS A N     1 
ATOM   2293 C  CA    . LYS A 1 281 ? 43.740 135.414 5.513  1.00 81.16  ? 281 LYS A CA    1 
ATOM   2294 C  C     . LYS A 1 281 ? 43.963 135.958 4.113  1.00 81.42  ? 281 LYS A C     1 
ATOM   2295 O  O     . LYS A 1 281 ? 45.046 135.838 3.554  1.00 81.87  ? 281 LYS A O     1 
ATOM   2296 C  CB    . LYS A 1 281 ? 43.052 134.049 5.432  1.00 80.96  ? 281 LYS A CB    1 
ATOM   2297 C  CG    . LYS A 1 281 ? 43.980 132.910 5.020  1.00 82.25  ? 281 LYS A CG    1 
ATOM   2298 C  CD    . LYS A 1 281 ? 44.684 132.275 6.224  1.00 83.36  ? 281 LYS A CD    1 
ATOM   2299 C  CE    . LYS A 1 281 ? 46.205 132.189 6.030  1.00 83.54  ? 281 LYS A CE    1 
ATOM   2300 N  NZ    . LYS A 1 281 ? 46.918 133.484 6.305  1.00 83.02  ? 281 LYS A NZ    1 
ATOM   2301 N  N     . LEU A 1 282 ? 42.933 136.579 3.558  1.00 82.19  ? 282 LEU A N     1 
ATOM   2302 C  CA    . LEU A 1 282 ? 43.074 137.267 2.290  1.00 84.08  ? 282 LEU A CA    1 
ATOM   2303 C  C     . LEU A 1 282 ? 44.251 138.226 2.386  1.00 86.23  ? 282 LEU A C     1 
ATOM   2304 O  O     . LEU A 1 282 ? 44.773 138.691 1.378  1.00 86.58  ? 282 LEU A O     1 
ATOM   2305 C  CB    . LEU A 1 282 ? 41.806 138.053 1.971  1.00 84.18  ? 282 LEU A CB    1 
ATOM   2306 C  CG    . LEU A 1 282 ? 40.480 137.308 2.117  1.00 83.69  ? 282 LEU A CG    1 
ATOM   2307 C  CD1   . LEU A 1 282 ? 39.380 138.108 1.450  1.00 82.75  ? 282 LEU A CD1   1 
ATOM   2308 C  CD2   . LEU A 1 282 ? 40.589 135.943 1.478  1.00 84.65  ? 282 LEU A CD2   1 
ATOM   2309 N  N     . LEU A 1 283 ? 44.664 138.516 3.614  1.00 88.70  ? 283 LEU A N     1 
ATOM   2310 C  CA    . LEU A 1 283 ? 45.716 139.488 3.857  1.00 90.18  ? 283 LEU A CA    1 
ATOM   2311 C  C     . LEU A 1 283 ? 47.100 138.900 3.688  1.00 92.48  ? 283 LEU A C     1 
ATOM   2312 O  O     . LEU A 1 283 ? 48.062 139.634 3.489  1.00 91.99  ? 283 LEU A O     1 
ATOM   2313 C  CB    . LEU A 1 283 ? 45.585 140.060 5.264  1.00 89.68  ? 283 LEU A CB    1 
ATOM   2314 C  CG    . LEU A 1 283 ? 44.427 141.037 5.423  1.00 89.51  ? 283 LEU A CG    1 
ATOM   2315 C  CD1   . LEU A 1 283 ? 44.414 141.640 6.822  1.00 89.69  ? 283 LEU A CD1   1 
ATOM   2316 C  CD2   . LEU A 1 283 ? 44.575 142.117 4.376  1.00 89.30  ? 283 LEU A CD2   1 
ATOM   2317 N  N     . ARG A 1 284 ? 47.205 137.578 3.771  1.00 95.80  ? 284 ARG A N     1 
ATOM   2318 C  CA    . ARG A 1 284 ? 48.513 136.924 3.756  1.00 99.63  ? 284 ARG A CA    1 
ATOM   2319 C  C     . ARG A 1 284 ? 49.255 137.133 2.429  1.00 100.82 ? 284 ARG A C     1 
ATOM   2320 O  O     . ARG A 1 284 ? 49.553 136.183 1.715  1.00 100.92 ? 284 ARG A O     1 
ATOM   2321 C  CB    . ARG A 1 284 ? 48.361 135.419 4.035  1.00 100.61 ? 284 ARG A CB    1 
ATOM   2322 C  CG    . ARG A 1 284 ? 47.647 134.638 2.929  1.00 104.00 ? 284 ARG A CG    1 
ATOM   2323 C  CD    . ARG A 1 284 ? 48.325 133.292 2.637  1.00 105.37 ? 284 ARG A CD    1 
ATOM   2324 N  NE    . ARG A 1 284 ? 48.435 133.011 1.203  1.00 106.47 ? 284 ARG A NE    1 
ATOM   2325 C  CZ    . ARG A 1 284 ? 49.583 132.988 0.526  1.00 107.64 ? 284 ARG A CZ    1 
ATOM   2326 N  NH1   . ARG A 1 284 ? 49.585 132.726 -0.775 1.00 108.06 ? 284 ARG A NH1   1 
ATOM   2327 N  NH2   . ARG A 1 284 ? 50.733 133.224 1.148  1.00 107.60 ? 284 ARG A NH2   1 
ATOM   2328 N  N     . GLY A 1 285 ? 49.564 138.379 2.097  1.00 102.31 ? 285 GLY A N     1 
ATOM   2329 C  CA    . GLY A 1 285 ? 50.210 138.634 0.826  1.00 104.03 ? 285 GLY A CA    1 
ATOM   2330 C  C     . GLY A 1 285 ? 51.095 139.859 0.852  1.00 106.07 ? 285 GLY A C     1 
ATOM   2331 O  O     . GLY A 1 285 ? 50.601 140.981 0.684  1.00 105.52 ? 285 GLY A O     1 
ATOM   2332 N  N     . THR A 1 286 ? 52.396 139.647 1.061  1.00 108.08 ? 286 THR A N     1 
ATOM   2333 C  CA    . THR A 1 286 ? 53.362 140.729 0.934  1.00 110.13 ? 286 THR A CA    1 
ATOM   2334 C  C     . THR A 1 286 ? 52.954 141.540 -0.279 1.00 111.14 ? 286 THR A C     1 
ATOM   2335 O  O     . THR A 1 286 ? 52.716 141.003 -1.366 1.00 111.42 ? 286 THR A O     1 
ATOM   2336 C  CB    . THR A 1 286 ? 54.807 140.207 0.734  1.00 110.30 ? 286 THR A CB    1 
ATOM   2337 O  OG1   . THR A 1 286 ? 55.119 139.264 1.765  1.00 111.15 ? 286 THR A OG1   1 
ATOM   2338 C  CG2   . THR A 1 286 ? 55.812 141.360 0.808  1.00 108.93 ? 286 THR A CG2   1 
ATOM   2339 N  N     . LYS A 1 287 ? 52.881 142.846 -0.070 1.00 112.03 ? 287 LYS A N     1 
ATOM   2340 C  CA    . LYS A 1 287 ? 51.699 143.595 -0.444 1.00 112.94 ? 287 LYS A CA    1 
ATOM   2341 C  C     . LYS A 1 287 ? 52.080 144.942 -1.024 1.00 112.73 ? 287 LYS A C     1 
ATOM   2342 O  O     . LYS A 1 287 ? 53.150 145.465 -0.728 1.00 112.57 ? 287 LYS A O     1 
ATOM   2343 C  CB    . LYS A 1 287 ? 50.820 143.785 0.794  1.00 113.67 ? 287 LYS A CB    1 
ATOM   2344 C  CG    . LYS A 1 287 ? 51.475 144.695 1.818  1.00 114.76 ? 287 LYS A CG    1 
ATOM   2345 C  CD    . LYS A 1 287 ? 50.732 144.746 3.129  1.00 115.41 ? 287 LYS A CD    1 
ATOM   2346 C  CE    . LYS A 1 287 ? 50.641 146.176 3.614  1.00 116.56 ? 287 LYS A CE    1 
ATOM   2347 N  NZ    . LYS A 1 287 ? 50.563 146.288 5.084  1.00 116.81 ? 287 LYS A NZ    1 
ATOM   2348 N  N     . ALA A 1 288 ? 51.220 145.458 -1.899 1.00 112.60 ? 288 ALA A N     1 
ATOM   2349 C  CA    . ALA A 1 288 ? 50.936 146.883 -1.950 1.00 112.35 ? 288 ALA A CA    1 
ATOM   2350 C  C     . ALA A 1 288 ? 49.552 147.002 -1.352 1.00 111.97 ? 288 ALA A C     1 
ATOM   2351 O  O     . ALA A 1 288 ? 48.666 146.228 -1.707 1.00 111.49 ? 288 ALA A O     1 
ATOM   2352 C  CB    . ALA A 1 288 ? 50.948 147.416 -3.403 1.00 111.86 ? 288 ALA A CB    1 
ATOM   2353 N  N     . LEU A 1 289 ? 49.382 147.944 -0.428 1.00 111.87 ? 289 LEU A N     1 
ATOM   2354 C  CA    . LEU A 1 289 ? 48.088 148.186 0.189  1.00 111.44 ? 289 LEU A CA    1 
ATOM   2355 C  C     . LEU A 1 289 ? 47.127 148.637 -0.894 1.00 111.62 ? 289 LEU A C     1 
ATOM   2356 O  O     . LEU A 1 289 ? 45.910 148.517 -0.757 1.00 111.17 ? 289 LEU A O     1 
ATOM   2357 C  CB    . LEU A 1 289 ? 48.207 149.269 1.257  1.00 111.00 ? 289 LEU A CB    1 
ATOM   2358 C  CG    . LEU A 1 289 ? 48.768 148.902 2.626  1.00 109.73 ? 289 LEU A CG    1 
ATOM   2359 C  CD1   . LEU A 1 289 ? 48.934 150.154 3.437  1.00 108.70 ? 289 LEU A CD1   1 
ATOM   2360 C  CD2   . LEU A 1 289 ? 47.833 147.936 3.327  1.00 110.03 ? 289 LEU A CD2   1 
ATOM   2361 N  N     . THR A 1 290 ? 47.691 149.160 -1.974 1.00 112.37 ? 290 THR A N     1 
ATOM   2362 C  CA    . THR A 1 290 ? 46.902 149.640 -3.096 1.00 113.08 ? 290 THR A CA    1 
ATOM   2363 C  C     . THR A 1 290 ? 46.324 148.424 -3.824 1.00 113.53 ? 290 THR A C     1 
ATOM   2364 O  O     . THR A 1 290 ? 45.143 148.396 -4.184 1.00 113.76 ? 290 THR A O     1 
ATOM   2365 C  CB    . THR A 1 290 ? 47.789 150.443 -4.064 1.00 113.21 ? 290 THR A CB    1 
ATOM   2366 O  OG1   . THR A 1 290 ? 48.821 151.109 -3.321 1.00 112.86 ? 290 THR A OG1   1 
ATOM   2367 C  CG2   . THR A 1 290 ? 46.959 151.487 -4.803 1.00 112.94 ? 290 THR A CG2   1 
ATOM   2368 N  N     . GLU A 1 291 ? 47.177 147.421 -4.019 1.00 113.59 ? 291 GLU A N     1 
ATOM   2369 C  CA    . GLU A 1 291 ? 46.803 146.140 -4.612 1.00 113.64 ? 291 GLU A CA    1 
ATOM   2370 C  C     . GLU A 1 291 ? 45.343 145.781 -4.356 1.00 113.52 ? 291 GLU A C     1 
ATOM   2371 O  O     . GLU A 1 291 ? 44.799 146.074 -3.293 1.00 113.70 ? 291 GLU A O     1 
ATOM   2372 C  CB    . GLU A 1 291 ? 47.709 145.045 -4.045 1.00 114.00 ? 291 GLU A CB    1 
ATOM   2373 C  CG    . GLU A 1 291 ? 47.571 143.682 -4.693 1.00 114.34 ? 291 GLU A CG    1 
ATOM   2374 C  CD    . GLU A 1 291 ? 48.733 142.774 -4.343 1.00 114.77 ? 291 GLU A CD    1 
ATOM   2375 O  OE1   . GLU A 1 291 ? 49.171 142.790 -3.171 1.00 114.36 ? 291 GLU A OE1   1 
ATOM   2376 O  OE2   . GLU A 1 291 ? 49.214 142.052 -5.241 1.00 115.19 ? 291 GLU A OE2   1 
ATOM   2377 N  N     . VAL A 1 292 ? 44.712 145.143 -5.335 1.00 113.21 ? 292 VAL A N     1 
ATOM   2378 C  CA    . VAL A 1 292 ? 43.313 144.761 -5.206 1.00 113.04 ? 292 VAL A CA    1 
ATOM   2379 C  C     . VAL A 1 292 ? 43.138 143.252 -5.067 1.00 112.69 ? 292 VAL A C     1 
ATOM   2380 O  O     . VAL A 1 292 ? 43.258 142.516 -6.039 1.00 112.25 ? 292 VAL A O     1 
ATOM   2381 C  CB    . VAL A 1 292 ? 42.505 145.233 -6.425 1.00 113.26 ? 292 VAL A CB    1 
ATOM   2382 C  CG1   . VAL A 1 292 ? 41.068 144.754 -6.306 1.00 113.35 ? 292 VAL A CG1   1 
ATOM   2383 C  CG2   . VAL A 1 292 ? 42.567 146.752 -6.531 1.00 112.65 ? 292 VAL A CG2   1 
ATOM   2384 N  N     . ILE A 1 293 ? 42.845 142.791 -3.858 1.00 112.88 ? 293 ILE A N     1 
ATOM   2385 C  CA    . ILE A 1 293 ? 42.660 141.363 -3.639 1.00 113.45 ? 293 ILE A CA    1 
ATOM   2386 C  C     . ILE A 1 293 ? 41.216 140.969 -3.927 1.00 113.58 ? 293 ILE A C     1 
ATOM   2387 O  O     . ILE A 1 293 ? 40.272 141.590 -3.429 1.00 113.57 ? 293 ILE A O     1 
ATOM   2388 C  CB    . ILE A 1 293 ? 43.007 140.957 -2.185 1.00 113.62 ? 293 ILE A CB    1 
ATOM   2389 C  CG1   . ILE A 1 293 ? 42.924 139.433 -2.019 1.00 114.70 ? 293 ILE A CG1   1 
ATOM   2390 C  CG2   . ILE A 1 293 ? 42.041 141.611 -1.225 1.00 113.56 ? 293 ILE A CG2   1 
ATOM   2391 C  CD1   . ILE A 1 293 ? 44.029 138.646 -2.730 1.00 115.55 ? 293 ILE A CD1   1 
ATOM   2392 N  N     . PRO A 1 294 ? 41.029 139.928 -4.753 1.00 113.47 ? 294 PRO A N     1 
ATOM   2393 C  CA    . PRO A 1 294 ? 39.697 139.399 -5.069 1.00 112.58 ? 294 PRO A CA    1 
ATOM   2394 C  C     . PRO A 1 294 ? 39.065 138.711 -3.867 1.00 111.25 ? 294 PRO A C     1 
ATOM   2395 O  O     . PRO A 1 294 ? 39.733 137.988 -3.126 1.00 110.83 ? 294 PRO A O     1 
ATOM   2396 C  CB    . PRO A 1 294 ? 39.958 138.428 -6.221 1.00 113.15 ? 294 PRO A CB    1 
ATOM   2397 C  CG    . PRO A 1 294 ? 41.383 138.018 -6.047 1.00 113.97 ? 294 PRO A CG    1 
ATOM   2398 C  CD    . PRO A 1 294 ? 42.098 139.210 -5.471 1.00 113.53 ? 294 PRO A CD    1 
ATOM   2399 N  N     . LEU A 1 295 ? 37.773 138.939 -3.677 1.00 109.71 ? 295 LEU A N     1 
ATOM   2400 C  CA    . LEU A 1 295 ? 37.077 138.376 -2.534 1.00 108.92 ? 295 LEU A CA    1 
ATOM   2401 C  C     . LEU A 1 295 ? 37.040 136.852 -2.647 1.00 108.82 ? 295 LEU A C     1 
ATOM   2402 O  O     . LEU A 1 295 ? 36.408 136.306 -3.553 1.00 109.51 ? 295 LEU A O     1 
ATOM   2403 C  CB    . LEU A 1 295 ? 35.651 138.926 -2.480 1.00 108.71 ? 295 LEU A CB    1 
ATOM   2404 C  CG    . LEU A 1 295 ? 34.945 139.034 -1.126 1.00 108.07 ? 295 LEU A CG    1 
ATOM   2405 C  CD1   . LEU A 1 295 ? 35.511 138.024 -0.144 1.00 108.20 ? 295 LEU A CD1   1 
ATOM   2406 C  CD2   . LEU A 1 295 ? 35.106 140.443 -0.594 1.00 107.27 ? 295 LEU A CD2   1 
ATOM   2407 N  N     . THR A 1 296 ? 37.720 136.169 -1.730 1.00 108.22 ? 296 THR A N     1 
ATOM   2408 C  CA    . THR A 1 296 ? 37.551 134.727 -1.575 1.00 107.83 ? 296 THR A CA    1 
ATOM   2409 C  C     . THR A 1 296 ? 36.109 134.434 -1.194 1.00 108.46 ? 296 THR A C     1 
ATOM   2410 O  O     . THR A 1 296 ? 35.535 135.097 -0.336 1.00 109.04 ? 296 THR A O     1 
ATOM   2411 C  CB    . THR A 1 296 ? 38.465 134.164 -0.467 1.00 107.31 ? 296 THR A CB    1 
ATOM   2412 O  OG1   . THR A 1 296 ? 39.826 134.213 -0.902 1.00 106.87 ? 296 THR A OG1   1 
ATOM   2413 C  CG2   . THR A 1 296 ? 38.086 132.730 -0.132 1.00 106.53 ? 296 THR A CG2   1 
ATOM   2414 N  N     . GLU A 1 297 ? 35.523 133.436 -1.833 1.00 108.86 ? 297 GLU A N     1 
ATOM   2415 C  CA    . GLU A 1 297 ? 34.127 133.130 -1.597 1.00 109.83 ? 297 GLU A CA    1 
ATOM   2416 C  C     . GLU A 1 297 ? 33.948 132.516 -0.210 1.00 110.04 ? 297 GLU A C     1 
ATOM   2417 O  O     . GLU A 1 297 ? 32.828 132.407 0.290  1.00 110.33 ? 297 GLU A O     1 
ATOM   2418 C  CB    . GLU A 1 297 ? 33.621 132.172 -2.675 1.00 111.04 ? 297 GLU A CB    1 
ATOM   2419 C  CG    . GLU A 1 297 ? 32.111 132.028 -2.718 1.00 112.66 ? 297 GLU A CG    1 
ATOM   2420 C  CD    . GLU A 1 297 ? 31.648 131.132 -3.851 1.00 113.09 ? 297 GLU A CD    1 
ATOM   2421 O  OE1   . GLU A 1 297 ? 31.342 129.950 -3.581 1.00 113.73 ? 297 GLU A OE1   1 
ATOM   2422 O  OE2   . GLU A 1 297 ? 31.591 131.608 -5.008 1.00 112.50 ? 297 GLU A OE2   1 
ATOM   2423 N  N     . GLU A 1 298 ? 35.056 132.119 0.409  1.00 109.92 ? 298 GLU A N     1 
ATOM   2424 C  CA    . GLU A 1 298 ? 35.033 131.603 1.778  1.00 109.69 ? 298 GLU A CA    1 
ATOM   2425 C  C     . GLU A 1 298 ? 34.904 132.758 2.765  1.00 108.37 ? 298 GLU A C     1 
ATOM   2426 O  O     . GLU A 1 298 ? 34.067 132.737 3.669  1.00 106.63 ? 298 GLU A O     1 
ATOM   2427 C  CB    . GLU A 1 298 ? 36.317 130.827 2.059  1.00 111.73 ? 298 GLU A CB    1 
ATOM   2428 C  CG    . GLU A 1 298 ? 36.501 129.620 1.164  1.00 113.94 ? 298 GLU A CG    1 
ATOM   2429 C  CD    . GLU A 1 298 ? 35.485 128.536 1.457  1.00 115.63 ? 298 GLU A CD    1 
ATOM   2430 O  OE1   . GLU A 1 298 ? 35.076 127.827 0.509  1.00 115.59 ? 298 GLU A OE1   1 
ATOM   2431 O  OE2   . GLU A 1 298 ? 35.097 128.399 2.641  1.00 115.92 ? 298 GLU A OE2   1 
ATOM   2432 N  N     . ALA A 1 299 ? 35.752 133.763 2.579  1.00 107.38 ? 299 ALA A N     1 
ATOM   2433 C  CA    . ALA A 1 299 ? 35.569 135.048 3.229  1.00 106.69 ? 299 ALA A CA    1 
ATOM   2434 C  C     . ALA A 1 299 ? 34.153 135.531 2.951  1.00 106.18 ? 299 ALA A C     1 
ATOM   2435 O  O     . ALA A 1 299 ? 33.434 135.931 3.864  1.00 106.62 ? 299 ALA A O     1 
ATOM   2436 C  CB    . ALA A 1 299 ? 36.572 136.047 2.687  1.00 106.49 ? 299 ALA A CB    1 
ATOM   2437 N  N     . GLU A 1 300 ? 33.761 135.484 1.682  1.00 105.45 ? 300 GLU A N     1 
ATOM   2438 C  CA    . GLU A 1 300 ? 32.413 135.861 1.272  1.00 104.54 ? 300 GLU A CA    1 
ATOM   2439 C  C     . GLU A 1 300 ? 31.363 135.251 2.184  1.00 102.14 ? 300 GLU A C     1 
ATOM   2440 O  O     . GLU A 1 300 ? 30.399 135.915 2.572  1.00 101.52 ? 300 GLU A O     1 
ATOM   2441 C  CB    . GLU A 1 300 ? 32.145 135.409 -0.167 1.00 107.28 ? 300 GLU A CB    1 
ATOM   2442 C  CG    . GLU A 1 300 ? 32.017 136.554 -1.144 1.00 110.72 ? 300 GLU A CG    1 
ATOM   2443 C  CD    . GLU A 1 300 ? 31.600 137.848 -0.459 1.00 112.82 ? 300 GLU A CD    1 
ATOM   2444 O  OE1   . GLU A 1 300 ? 30.681 137.818 0.392  1.00 112.98 ? 300 GLU A OE1   1 
ATOM   2445 O  OE2   . GLU A 1 300 ? 32.198 138.900 -0.772 1.00 114.44 ? 300 GLU A OE2   1 
ATOM   2446 N  N     . LEU A 1 301 ? 31.552 133.979 2.516  1.00 99.52  ? 301 LEU A N     1 
ATOM   2447 C  CA    . LEU A 1 301 ? 30.648 133.311 3.426  1.00 97.18  ? 301 LEU A CA    1 
ATOM   2448 C  C     . LEU A 1 301 ? 30.695 134.088 4.731  1.00 95.72  ? 301 LEU A C     1 
ATOM   2449 O  O     . LEU A 1 301 ? 29.665 134.527 5.238  1.00 96.10  ? 301 LEU A O     1 
ATOM   2450 C  CB    . LEU A 1 301 ? 31.090 131.860 3.646  1.00 97.72  ? 301 LEU A CB    1 
ATOM   2451 C  CG    . LEU A 1 301 ? 30.114 130.898 4.342  1.00 98.03  ? 301 LEU A CG    1 
ATOM   2452 C  CD1   . LEU A 1 301 ? 30.513 129.467 4.033  1.00 98.13  ? 301 LEU A CD1   1 
ATOM   2453 C  CD2   . LEU A 1 301 ? 30.111 131.123 5.846  1.00 97.82  ? 301 LEU A CD2   1 
ATOM   2454 N  N     . GLU A 1 302 ? 31.903 134.285 5.251  1.00 93.49  ? 302 GLU A N     1 
ATOM   2455 C  CA    . GLU A 1 302 ? 32.102 134.935 6.546  1.00 90.35  ? 302 GLU A CA    1 
ATOM   2456 C  C     . GLU A 1 302 ? 31.443 136.306 6.650  1.00 87.42  ? 302 GLU A C     1 
ATOM   2457 O  O     . GLU A 1 302 ? 30.576 136.535 7.490  1.00 85.81  ? 302 GLU A O     1 
ATOM   2458 C  CB    . GLU A 1 302 ? 33.591 135.091 6.819  1.00 91.40  ? 302 GLU A CB    1 
ATOM   2459 C  CG    . GLU A 1 302 ? 34.068 134.357 8.040  1.00 93.87  ? 302 GLU A CG    1 
ATOM   2460 C  CD    . GLU A 1 302 ? 35.409 134.863 8.513  1.00 96.22  ? 302 GLU A CD    1 
ATOM   2461 O  OE1   . GLU A 1 302 ? 36.236 134.027 8.933  1.00 97.27  ? 302 GLU A OE1   1 
ATOM   2462 O  OE2   . GLU A 1 302 ? 35.636 136.094 8.465  1.00 97.60  ? 302 GLU A OE2   1 
ATOM   2463 N  N     . LEU A 1 303 ? 31.878 137.221 5.800  1.00 84.54  ? 303 LEU A N     1 
ATOM   2464 C  CA    . LEU A 1 303 ? 31.336 138.565 5.798  1.00 82.83  ? 303 LEU A CA    1 
ATOM   2465 C  C     . LEU A 1 303 ? 29.811 138.524 5.813  1.00 81.71  ? 303 LEU A C     1 
ATOM   2466 O  O     . LEU A 1 303 ? 29.165 139.203 6.610  1.00 80.94  ? 303 LEU A O     1 
ATOM   2467 C  CB    . LEU A 1 303 ? 31.851 139.303 4.565  1.00 82.74  ? 303 LEU A CB    1 
ATOM   2468 C  CG    . LEU A 1 303 ? 31.144 140.559 4.070  1.00 82.58  ? 303 LEU A CG    1 
ATOM   2469 C  CD1   . LEU A 1 303 ? 30.889 141.534 5.207  1.00 82.31  ? 303 LEU A CD1   1 
ATOM   2470 C  CD2   . LEU A 1 303 ? 32.014 141.183 2.997  1.00 83.05  ? 303 LEU A CD2   1 
ATOM   2471 N  N     . ALA A 1 304 ? 29.237 137.710 4.936  1.00 80.93  ? 304 ALA A N     1 
ATOM   2472 C  CA    . ALA A 1 304 ? 27.794 137.523 4.916  1.00 79.38  ? 304 ALA A CA    1 
ATOM   2473 C  C     . ALA A 1 304 ? 27.283 137.116 6.307  1.00 78.79  ? 304 ALA A C     1 
ATOM   2474 O  O     . ALA A 1 304 ? 26.363 137.732 6.832  1.00 78.08  ? 304 ALA A O     1 
ATOM   2475 C  CB    . ALA A 1 304 ? 27.429 136.474 3.874  1.00 77.84  ? 304 ALA A CB    1 
ATOM   2476 N  N     . GLU A 1 305 ? 27.895 136.093 6.903  1.00 79.28  ? 305 GLU A N     1 
ATOM   2477 C  CA    . GLU A 1 305 ? 27.594 135.695 8.284  1.00 79.84  ? 305 GLU A CA    1 
ATOM   2478 C  C     . GLU A 1 305 ? 27.597 136.889 9.230  1.00 78.93  ? 305 GLU A C     1 
ATOM   2479 O  O     . GLU A 1 305 ? 26.703 137.034 10.059 1.00 78.15  ? 305 GLU A O     1 
ATOM   2480 C  CB    . GLU A 1 305 ? 28.620 134.671 8.801  1.00 82.22  ? 305 GLU A CB    1 
ATOM   2481 C  CG    . GLU A 1 305 ? 28.331 133.199 8.462  1.00 85.97  ? 305 GLU A CG    1 
ATOM   2482 C  CD    . GLU A 1 305 ? 29.264 132.203 9.176  1.00 87.91  ? 305 GLU A CD    1 
ATOM   2483 O  OE1   . GLU A 1 305 ? 28.748 131.214 9.752  1.00 88.42  ? 305 GLU A OE1   1 
ATOM   2484 O  OE2   . GLU A 1 305 ? 30.506 132.403 9.160  1.00 88.13  ? 305 GLU A OE2   1 
ATOM   2485 N  N     . ASN A 1 306 ? 28.614 137.737 9.114  1.00 78.48  ? 306 ASN A N     1 
ATOM   2486 C  CA    . ASN A 1 306 ? 28.749 138.881 10.009 1.00 77.60  ? 306 ASN A CA    1 
ATOM   2487 C  C     . ASN A 1 306 ? 27.682 139.914 9.712  1.00 78.01  ? 306 ASN A C     1 
ATOM   2488 O  O     . ASN A 1 306 ? 26.931 140.318 10.603 1.00 78.16  ? 306 ASN A O     1 
ATOM   2489 C  CB    . ASN A 1 306 ? 30.121 139.540 9.856  1.00 75.94  ? 306 ASN A CB    1 
ATOM   2490 C  CG    . ASN A 1 306 ? 31.231 138.722 10.461 1.00 73.73  ? 306 ASN A CG    1 
ATOM   2491 O  OD1   . ASN A 1 306 ? 32.357 138.732 9.970  1.00 72.80  ? 306 ASN A OD1   1 
ATOM   2492 N  ND2   . ASN A 1 306 ? 30.923 138.009 11.533 1.00 72.59  ? 306 ASN A ND2   1 
ATOM   2493 N  N     . ARG A 1 307 ? 27.619 140.344 8.455  1.00 78.27  ? 307 ARG A N     1 
ATOM   2494 C  CA    . ARG A 1 307 ? 26.726 141.432 8.090  1.00 78.63  ? 307 ARG A CA    1 
ATOM   2495 C  C     . ARG A 1 307 ? 25.350 141.097 8.618  1.00 78.17  ? 307 ARG A C     1 
ATOM   2496 O  O     . ARG A 1 307 ? 24.594 141.985 8.998  1.00 78.81  ? 307 ARG A O     1 
ATOM   2497 C  CB    . ARG A 1 307 ? 26.677 141.616 6.570  1.00 80.00  ? 307 ARG A CB    1 
ATOM   2498 C  CG    . ARG A 1 307 ? 26.007 142.920 6.123  1.00 81.74  ? 307 ARG A CG    1 
ATOM   2499 C  CD    . ARG A 1 307 ? 26.964 143.798 5.319  1.00 83.16  ? 307 ARG A CD    1 
ATOM   2500 N  NE    . ARG A 1 307 ? 27.555 143.071 4.194  1.00 85.01  ? 307 ARG A NE    1 
ATOM   2501 C  CZ    . ARG A 1 307 ? 28.484 143.569 3.381  1.00 85.22  ? 307 ARG A CZ    1 
ATOM   2502 N  NH1   . ARG A 1 307 ? 28.938 144.804 3.561  1.00 84.83  ? 307 ARG A NH1   1 
ATOM   2503 N  NH2   . ARG A 1 307 ? 28.961 142.831 2.386  1.00 84.25  ? 307 ARG A NH2   1 
ATOM   2504 N  N     . GLU A 1 308 ? 25.043 139.805 8.663  1.00 77.90  ? 308 GLU A N     1 
ATOM   2505 C  CA    . GLU A 1 308 ? 23.779 139.337 9.210  1.00 78.27  ? 308 GLU A CA    1 
ATOM   2506 C  C     . GLU A 1 308 ? 23.705 139.483 10.721 1.00 77.46  ? 308 GLU A C     1 
ATOM   2507 O  O     . GLU A 1 308 ? 22.688 139.927 11.252 1.00 77.87  ? 308 GLU A O     1 
ATOM   2508 C  CB    . GLU A 1 308 ? 23.539 137.878 8.821  1.00 80.61  ? 308 GLU A CB    1 
ATOM   2509 C  CG    . GLU A 1 308 ? 22.912 137.714 7.449  1.00 84.01  ? 308 GLU A CG    1 
ATOM   2510 C  CD    . GLU A 1 308 ? 21.605 138.480 7.330  1.00 87.13  ? 308 GLU A CD    1 
ATOM   2511 O  OE1   . GLU A 1 308 ? 21.528 139.423 6.506  1.00 88.18  ? 308 GLU A OE1   1 
ATOM   2512 O  OE2   . GLU A 1 308 ? 20.652 138.139 8.066  1.00 88.62  ? 308 GLU A OE2   1 
ATOM   2513 N  N     . ILE A 1 309 ? 24.775 139.117 11.420 1.00 75.97  ? 309 ILE A N     1 
ATOM   2514 C  CA    . ILE A 1 309 ? 24.780 139.235 12.872 1.00 74.37  ? 309 ILE A CA    1 
ATOM   2515 C  C     . ILE A 1 309 ? 24.574 140.689 13.270 1.00 74.59  ? 309 ILE A C     1 
ATOM   2516 O  O     . ILE A 1 309 ? 23.965 140.975 14.302 1.00 74.80  ? 309 ILE A O     1 
ATOM   2517 C  CB    . ILE A 1 309 ? 26.107 138.749 13.491 1.00 73.16  ? 309 ILE A CB    1 
ATOM   2518 C  CG1   . ILE A 1 309 ? 26.320 137.269 13.187 1.00 72.94  ? 309 ILE A CG1   1 
ATOM   2519 C  CG2   . ILE A 1 309 ? 26.088 138.964 14.992 1.00 72.88  ? 309 ILE A CG2   1 
ATOM   2520 C  CD1   . ILE A 1 309 ? 27.397 136.622 14.023 1.00 70.90  ? 309 ILE A CD1   1 
ATOM   2521 N  N     . LEU A 1 310 ? 25.078 141.603 12.440 1.00 73.81  ? 310 LEU A N     1 
ATOM   2522 C  CA    . LEU A 1 310 ? 25.107 143.025 12.781 1.00 73.62  ? 310 LEU A CA    1 
ATOM   2523 C  C     . LEU A 1 310 ? 23.719 143.652 12.824 1.00 74.25  ? 310 LEU A C     1 
ATOM   2524 O  O     . LEU A 1 310 ? 23.532 144.722 13.407 1.00 74.94  ? 310 LEU A O     1 
ATOM   2525 C  CB    . LEU A 1 310 ? 25.984 143.804 11.791 1.00 71.88  ? 310 LEU A CB    1 
ATOM   2526 C  CG    . LEU A 1 310 ? 27.486 143.911 12.088 1.00 69.71  ? 310 LEU A CG    1 
ATOM   2527 C  CD1   . LEU A 1 310 ? 28.146 144.856 11.102 1.00 66.78  ? 310 LEU A CD1   1 
ATOM   2528 C  CD2   . LEU A 1 310 ? 27.691 144.416 13.498 1.00 68.97  ? 310 LEU A CD2   1 
ATOM   2529 N  N     . LYS A 1 311 ? 22.751 142.986 12.207 1.00 74.07  ? 311 LYS A N     1 
ATOM   2530 C  CA    . LYS A 1 311 ? 21.388 143.485 12.184 1.00 72.98  ? 311 LYS A CA    1 
ATOM   2531 C  C     . LYS A 1 311 ? 20.696 143.191 13.500 1.00 72.67  ? 311 LYS A C     1 
ATOM   2532 O  O     . LYS A 1 311 ? 19.591 143.657 13.754 1.00 71.59  ? 311 LYS A O     1 
ATOM   2533 C  CB    . LYS A 1 311 ? 20.628 142.855 11.021 1.00 73.55  ? 311 LYS A CB    1 
ATOM   2534 C  CG    . LYS A 1 311 ? 20.931 143.539 9.701  1.00 74.05  ? 311 LYS A CG    1 
ATOM   2535 C  CD    . LYS A 1 311 ? 21.356 142.566 8.627  1.00 74.38  ? 311 LYS A CD    1 
ATOM   2536 C  CE    . LYS A 1 311 ? 21.929 143.317 7.431  1.00 74.92  ? 311 LYS A CE    1 
ATOM   2537 N  NZ    . LYS A 1 311 ? 22.139 142.429 6.249  1.00 76.08  ? 311 LYS A NZ    1 
ATOM   2538 N  N     . GLU A 1 312 ? 21.364 142.423 14.346 1.00 73.38  ? 312 GLU A N     1 
ATOM   2539 C  CA    . GLU A 1 312 ? 20.808 142.091 15.642 1.00 75.20  ? 312 GLU A CA    1 
ATOM   2540 C  C     . GLU A 1 312 ? 21.002 143.202 16.653 1.00 74.30  ? 312 GLU A C     1 
ATOM   2541 O  O     . GLU A 1 312 ? 22.032 143.872 16.684 1.00 73.50  ? 312 GLU A O     1 
ATOM   2542 C  CB    . GLU A 1 312 ? 21.420 140.790 16.177 1.00 78.55  ? 312 GLU A CB    1 
ATOM   2543 C  CG    . GLU A 1 312 ? 20.942 139.535 15.441 1.00 84.53  ? 312 GLU A CG    1 
ATOM   2544 C  CD    . GLU A 1 312 ? 19.436 139.556 15.126 1.00 87.70  ? 312 GLU A CD    1 
ATOM   2545 O  OE1   . GLU A 1 312 ? 19.004 140.400 14.301 1.00 88.65  ? 312 GLU A OE1   1 
ATOM   2546 O  OE2   . GLU A 1 312 ? 18.685 138.727 15.697 1.00 88.15  ? 312 GLU A OE2   1 
ATOM   2547 N  N     . PRO A 1 313 ? 19.990 143.420 17.493 1.00 73.92  ? 313 PRO A N     1 
ATOM   2548 C  CA    . PRO A 1 313 ? 20.106 144.301 18.651 1.00 72.78  ? 313 PRO A CA    1 
ATOM   2549 C  C     . PRO A 1 313 ? 20.890 143.573 19.740 1.00 71.02  ? 313 PRO A C     1 
ATOM   2550 O  O     . PRO A 1 313 ? 20.480 142.496 20.197 1.00 71.53  ? 313 PRO A O     1 
ATOM   2551 C  CB    . PRO A 1 313 ? 18.658 144.533 19.059 1.00 73.82  ? 313 PRO A CB    1 
ATOM   2552 C  CG    . PRO A 1 313 ? 17.979 143.238 18.691 1.00 73.72  ? 313 PRO A CG    1 
ATOM   2553 C  CD    . PRO A 1 313 ? 18.672 142.760 17.434 1.00 74.85  ? 313 PRO A CD    1 
ATOM   2554 N  N     . VAL A 1 314 ? 22.013 144.152 20.152 1.00 67.40  ? 314 VAL A N     1 
ATOM   2555 C  CA    . VAL A 1 314 ? 22.754 143.613 21.284 1.00 62.67  ? 314 VAL A CA    1 
ATOM   2556 C  C     . VAL A 1 314 ? 23.069 144.688 22.312 1.00 59.55  ? 314 VAL A C     1 
ATOM   2557 O  O     . VAL A 1 314 ? 22.975 145.888 22.046 1.00 58.02  ? 314 VAL A O     1 
ATOM   2558 C  CB    . VAL A 1 314 ? 24.079 142.935 20.841 1.00 61.57  ? 314 VAL A CB    1 
ATOM   2559 C  CG1   . VAL A 1 314 ? 23.794 141.909 19.773 1.00 60.17  ? 314 VAL A CG1   1 
ATOM   2560 C  CG2   . VAL A 1 314 ? 25.071 143.974 20.346 1.00 60.32  ? 314 VAL A CG2   1 
ATOM   2561 N  N     . HIS A 1 315 ? 23.439 144.238 23.496 1.00 55.80  ? 315 HIS A N     1 
ATOM   2562 C  CA    . HIS A 1 315 ? 23.813 145.141 24.542 1.00 53.11  ? 315 HIS A CA    1 
ATOM   2563 C  C     . HIS A 1 315 ? 24.639 144.380 25.550 1.00 51.76  ? 315 HIS A C     1 
ATOM   2564 O  O     . HIS A 1 315 ? 24.662 143.147 25.540 1.00 49.89  ? 315 HIS A O     1 
ATOM   2565 C  CB    . HIS A 1 315 ? 22.565 145.714 25.205 1.00 55.10  ? 315 HIS A CB    1 
ATOM   2566 C  CG    . HIS A 1 315 ? 21.667 144.680 25.812 1.00 56.81  ? 315 HIS A CG    1 
ATOM   2567 N  ND1   . HIS A 1 315 ? 21.584 144.473 27.174 1.00 58.35  ? 315 HIS A ND1   1 
ATOM   2568 C  CD2   . HIS A 1 315 ? 20.797 143.811 25.247 1.00 57.44  ? 315 HIS A CD2   1 
ATOM   2569 C  CE1   . HIS A 1 315 ? 20.701 143.522 27.422 1.00 57.90  ? 315 HIS A CE1   1 
ATOM   2570 N  NE2   . HIS A 1 315 ? 20.209 143.104 26.270 1.00 58.51  ? 315 HIS A NE2   1 
ATOM   2571 N  N     . GLY A 1 316 ? 25.330 145.127 26.407 1.00 49.86  ? 316 GLY A N     1 
ATOM   2572 C  CA    . GLY A 1 316 ? 26.018 144.528 27.526 1.00 47.49  ? 316 GLY A CA    1 
ATOM   2573 C  C     . GLY A 1 316 ? 25.417 145.087 28.787 1.00 46.39  ? 316 GLY A C     1 
ATOM   2574 O  O     . GLY A 1 316 ? 24.572 145.967 28.719 1.00 46.66  ? 316 GLY A O     1 
ATOM   2575 N  N     . VAL A 1 317 ? 25.841 144.564 29.931 1.00 45.98  ? 317 VAL A N     1 
ATOM   2576 C  CA    . VAL A 1 317 ? 25.490 145.122 31.231 1.00 46.18  ? 317 VAL A CA    1 
ATOM   2577 C  C     . VAL A 1 317 ? 26.764 145.503 31.994 1.00 48.19  ? 317 VAL A C     1 
ATOM   2578 O  O     . VAL A 1 317 ? 27.874 145.410 31.464 1.00 49.42  ? 317 VAL A O     1 
ATOM   2579 C  CB    . VAL A 1 317 ? 24.681 144.113 32.075 1.00 45.25  ? 317 VAL A CB    1 
ATOM   2580 C  CG1   . VAL A 1 317 ? 23.350 143.836 31.417 1.00 44.53  ? 317 VAL A CG1   1 
ATOM   2581 C  CG2   . VAL A 1 317 ? 25.460 142.823 32.222 1.00 44.01  ? 317 VAL A CG2   1 
ATOM   2582 N  N     . TYR A 1 318 ? 26.604 145.922 33.242 1.00 47.73  ? 318 TYR A N     1 
ATOM   2583 C  CA    . TYR A 1 318 ? 27.704 146.491 33.987 1.00 48.03  ? 318 TYR A CA    1 
ATOM   2584 C  C     . TYR A 1 318 ? 28.212 145.567 35.090 1.00 49.39  ? 318 TYR A C     1 
ATOM   2585 O  O     . TYR A 1 318 ? 27.538 144.625 35.487 1.00 50.80  ? 318 TYR A O     1 
ATOM   2586 C  CB    . TYR A 1 318 ? 27.253 147.818 34.571 1.00 49.29  ? 318 TYR A CB    1 
ATOM   2587 C  CG    . TYR A 1 318 ? 26.789 148.797 33.523 1.00 50.41  ? 318 TYR A CG    1 
ATOM   2588 C  CD1   . TYR A 1 318 ? 25.450 149.156 33.420 1.00 51.30  ? 318 TYR A CD1   1 
ATOM   2589 C  CD2   . TYR A 1 318 ? 27.694 149.382 32.645 1.00 50.19  ? 318 TYR A CD2   1 
ATOM   2590 C  CE1   . TYR A 1 318 ? 25.034 150.078 32.470 1.00 50.16  ? 318 TYR A CE1   1 
ATOM   2591 C  CE2   . TYR A 1 318 ? 27.287 150.294 31.702 1.00 48.75  ? 318 TYR A CE2   1 
ATOM   2592 C  CZ    . TYR A 1 318 ? 25.964 150.637 31.621 1.00 49.17  ? 318 TYR A CZ    1 
ATOM   2593 O  OH    . TYR A 1 318 ? 25.576 151.558 30.693 1.00 51.32  ? 318 TYR A OH    1 
ATOM   2594 N  N     . TYR A 1 319 ? 29.403 145.845 35.600 1.00 49.87  ? 319 TYR A N     1 
ATOM   2595 C  CA    . TYR A 1 319 ? 30.059 144.913 36.510 1.00 51.64  ? 319 TYR A CA    1 
ATOM   2596 C  C     . TYR A 1 319 ? 29.566 144.961 37.954 1.00 55.43  ? 319 TYR A C     1 
ATOM   2597 O  O     . TYR A 1 319 ? 29.588 146.016 38.590 1.00 58.15  ? 319 TYR A O     1 
ATOM   2598 C  CB    . TYR A 1 319 ? 31.559 145.159 36.512 1.00 47.50  ? 319 TYR A CB    1 
ATOM   2599 C  CG    . TYR A 1 319 ? 32.300 144.228 37.426 1.00 44.31  ? 319 TYR A CG    1 
ATOM   2600 C  CD1   . TYR A 1 319 ? 32.166 142.854 37.291 1.00 44.24  ? 319 TYR A CD1   1 
ATOM   2601 C  CD2   . TYR A 1 319 ? 33.169 144.712 38.390 1.00 42.05  ? 319 TYR A CD2   1 
ATOM   2602 C  CE1   . TYR A 1 319 ? 32.880 141.988 38.082 1.00 43.79  ? 319 TYR A CE1   1 
ATOM   2603 C  CE2   . TYR A 1 319 ? 33.894 143.847 39.191 1.00 42.78  ? 319 TYR A CE2   1 
ATOM   2604 C  CZ    . TYR A 1 319 ? 33.744 142.488 39.027 1.00 44.28  ? 319 TYR A CZ    1 
ATOM   2605 O  OH    . TYR A 1 319 ? 34.477 141.608 39.780 1.00 45.13  ? 319 TYR A OH    1 
ATOM   2606 N  N     . ASP A 1 320 ? 29.149 143.812 38.479 1.00 57.83  ? 320 ASP A N     1 
ATOM   2607 C  CA    . ASP A 1 320 ? 28.871 143.680 39.906 1.00 59.92  ? 320 ASP A CA    1 
ATOM   2608 C  C     . ASP A 1 320 ? 30.017 142.935 40.591 1.00 61.49  ? 320 ASP A C     1 
ATOM   2609 O  O     . ASP A 1 320 ? 30.218 141.745 40.362 1.00 61.20  ? 320 ASP A O     1 
ATOM   2610 C  CB    . ASP A 1 320 ? 27.559 142.915 40.102 1.00 61.76  ? 320 ASP A CB    1 
ATOM   2611 C  CG    . ASP A 1 320 ? 27.119 142.861 41.553 1.00 64.25  ? 320 ASP A CG    1 
ATOM   2612 O  OD1   . ASP A 1 320 ? 27.557 143.725 42.350 1.00 65.66  ? 320 ASP A OD1   1 
ATOM   2613 O  OD2   . ASP A 1 320 ? 26.335 141.951 41.897 1.00 64.67  ? 320 ASP A OD2   1 
ATOM   2614 N  N     . PRO A 1 321 ? 30.796 143.632 41.429 1.00 63.47  ? 321 PRO A N     1 
ATOM   2615 C  CA    . PRO A 1 321 ? 31.893 142.968 42.139 1.00 66.31  ? 321 PRO A CA    1 
ATOM   2616 C  C     . PRO A 1 321 ? 31.402 142.096 43.296 1.00 68.43  ? 321 PRO A C     1 
ATOM   2617 O  O     . PRO A 1 321 ? 32.175 141.337 43.889 1.00 70.08  ? 321 PRO A O     1 
ATOM   2618 C  CB    . PRO A 1 321 ? 32.784 144.126 42.603 1.00 65.90  ? 321 PRO A CB    1 
ATOM   2619 C  CG    . PRO A 1 321 ? 31.872 145.285 42.705 1.00 65.55  ? 321 PRO A CG    1 
ATOM   2620 C  CD    . PRO A 1 321 ? 30.815 145.088 41.629 1.00 65.33  ? 321 PRO A CD    1 
ATOM   2621 N  N     . SER A 1 322 ? 30.115 142.205 43.614 1.00 69.84  ? 322 SER A N     1 
ATOM   2622 C  CA    . SER A 1 322 ? 29.484 141.272 44.544 1.00 69.35  ? 322 SER A CA    1 
ATOM   2623 C  C     . SER A 1 322 ? 29.584 139.879 43.959 1.00 68.10  ? 322 SER A C     1 
ATOM   2624 O  O     . SER A 1 322 ? 29.990 138.956 44.646 1.00 70.06  ? 322 SER A O     1 
ATOM   2625 C  CB    . SER A 1 322 ? 28.007 141.604 44.743 1.00 69.94  ? 322 SER A CB    1 
ATOM   2626 O  OG    . SER A 1 322 ? 27.822 142.988 44.947 1.00 71.12  ? 322 SER A OG    1 
ATOM   2627 N  N     . LYS A 1 323 ? 29.220 139.734 42.690 1.00 65.88  ? 323 LYS A N     1 
ATOM   2628 C  CA    . LYS A 1 323 ? 29.176 138.423 42.065 1.00 66.03  ? 323 LYS A CA    1 
ATOM   2629 C  C     . LYS A 1 323 ? 30.517 138.024 41.422 1.00 66.89  ? 323 LYS A C     1 
ATOM   2630 O  O     . LYS A 1 323 ? 31.485 138.786 41.464 1.00 66.59  ? 323 LYS A O     1 
ATOM   2631 C  CB    . LYS A 1 323 ? 28.069 138.391 41.013 1.00 65.09  ? 323 LYS A CB    1 
ATOM   2632 C  CG    . LYS A 1 323 ? 26.817 139.142 41.392 1.00 64.06  ? 323 LYS A CG    1 
ATOM   2633 C  CD    . LYS A 1 323 ? 25.822 139.080 40.240 1.00 65.73  ? 323 LYS A CD    1 
ATOM   2634 C  CE    . LYS A 1 323 ? 24.912 140.305 40.183 1.00 66.43  ? 323 LYS A CE    1 
ATOM   2635 N  NZ    . LYS A 1 323 ? 25.411 141.368 39.251 1.00 63.85  ? 323 LYS A NZ    1 
ATOM   2636 N  N     . ASP A 1 324 ? 30.554 136.824 40.836 1.00 67.54  ? 324 ASP A N     1 
ATOM   2637 C  CA    . ASP A 1 324 ? 31.743 136.288 40.156 1.00 68.27  ? 324 ASP A CA    1 
ATOM   2638 C  C     . ASP A 1 324 ? 31.791 136.685 38.668 1.00 67.69  ? 324 ASP A C     1 
ATOM   2639 O  O     . ASP A 1 324 ? 30.823 137.235 38.137 1.00 69.23  ? 324 ASP A O     1 
ATOM   2640 C  CB    . ASP A 1 324 ? 31.753 134.755 40.244 1.00 70.29  ? 324 ASP A CB    1 
ATOM   2641 C  CG    . ASP A 1 324 ? 31.939 134.234 41.663 1.00 72.45  ? 324 ASP A CG    1 
ATOM   2642 O  OD1   . ASP A 1 324 ? 32.519 134.962 42.506 1.00 72.75  ? 324 ASP A OD1   1 
ATOM   2643 O  OD2   . ASP A 1 324 ? 31.508 133.084 41.920 1.00 71.58  ? 324 ASP A OD2   1 
ATOM   2644 N  N     . LEU A 1 325 ? 32.911 136.392 38.003 1.00 64.24  ? 325 LEU A N     1 
ATOM   2645 C  CA    . LEU A 1 325 ? 33.014 136.513 36.544 1.00 60.72  ? 325 LEU A CA    1 
ATOM   2646 C  C     . LEU A 1 325 ? 32.936 135.149 35.899 1.00 59.70  ? 325 LEU A C     1 
ATOM   2647 O  O     . LEU A 1 325 ? 33.528 134.208 36.396 1.00 61.16  ? 325 LEU A O     1 
ATOM   2648 C  CB    . LEU A 1 325 ? 34.346 137.131 36.151 1.00 59.30  ? 325 LEU A CB    1 
ATOM   2649 C  CG    . LEU A 1 325 ? 34.501 138.622 36.368 1.00 59.42  ? 325 LEU A CG    1 
ATOM   2650 C  CD1   . LEU A 1 325 ? 35.930 139.024 36.048 1.00 60.38  ? 325 LEU A CD1   1 
ATOM   2651 C  CD2   . LEU A 1 325 ? 33.515 139.363 35.494 1.00 57.40  ? 325 LEU A CD2   1 
ATOM   2652 N  N     . ILE A 1 326 ? 32.236 135.024 34.781 1.00 57.83  ? 326 ILE A N     1 
ATOM   2653 C  CA    . ILE A 1 326 ? 32.145 133.722 34.141 1.00 56.58  ? 326 ILE A CA    1 
ATOM   2654 C  C     . ILE A 1 326 ? 32.264 133.833 32.639 1.00 58.11  ? 326 ILE A C     1 
ATOM   2655 O  O     . ILE A 1 326 ? 31.494 134.548 32.003 1.00 59.42  ? 326 ILE A O     1 
ATOM   2656 C  CB    . ILE A 1 326 ? 30.811 133.043 34.446 1.00 55.33  ? 326 ILE A CB    1 
ATOM   2657 C  CG1   . ILE A 1 326 ? 30.602 132.942 35.952 1.00 54.66  ? 326 ILE A CG1   1 
ATOM   2658 C  CG2   . ILE A 1 326 ? 30.791 131.666 33.841 1.00 53.95  ? 326 ILE A CG2   1 
ATOM   2659 C  CD1   . ILE A 1 326 ? 29.275 132.345 36.320 1.00 54.38  ? 326 ILE A CD1   1 
ATOM   2660 N  N     . ALA A 1 327 ? 33.221 133.110 32.067 1.00 58.73  ? 327 ALA A N     1 
ATOM   2661 C  CA    . ALA A 1 327 ? 33.479 133.178 30.631 1.00 58.13  ? 327 ALA A CA    1 
ATOM   2662 C  C     . ALA A 1 327 ? 33.080 131.873 29.983 1.00 58.73  ? 327 ALA A C     1 
ATOM   2663 O  O     . ALA A 1 327 ? 33.400 130.806 30.498 1.00 59.05  ? 327 ALA A O     1 
ATOM   2664 C  CB    . ALA A 1 327 ? 34.961 133.449 30.370 1.00 57.04  ? 327 ALA A CB    1 
ATOM   2665 N  N     . GLU A 1 328 ? 32.386 131.967 28.854 1.00 58.95  ? 328 GLU A N     1 
ATOM   2666 C  CA    . GLU A 1 328 ? 32.077 130.807 28.039 1.00 60.01  ? 328 GLU A CA    1 
ATOM   2667 C  C     . GLU A 1 328 ? 32.776 130.922 26.692 1.00 58.91  ? 328 GLU A C     1 
ATOM   2668 O  O     . GLU A 1 328 ? 32.573 131.893 25.982 1.00 59.46  ? 328 GLU A O     1 
ATOM   2669 C  CB    . GLU A 1 328 ? 30.566 130.697 27.826 1.00 63.08  ? 328 GLU A CB    1 
ATOM   2670 C  CG    . GLU A 1 328 ? 29.877 129.638 28.693 1.00 68.48  ? 328 GLU A CG    1 
ATOM   2671 C  CD    . GLU A 1 328 ? 28.830 128.825 27.923 1.00 72.78  ? 328 GLU A CD    1 
ATOM   2672 O  OE1   . GLU A 1 328 ? 27.617 128.982 28.210 1.00 74.64  ? 328 GLU A OE1   1 
ATOM   2673 O  OE2   . GLU A 1 328 ? 29.217 128.028 27.033 1.00 73.35  ? 328 GLU A OE2   1 
ATOM   2674 N  N     . ILE A 1 329 ? 33.592 129.928 26.345 1.00 57.78  ? 329 ILE A N     1 
ATOM   2675 C  CA    . ILE A 1 329 ? 34.303 129.906 25.063 1.00 57.02  ? 329 ILE A CA    1 
ATOM   2676 C  C     . ILE A 1 329 ? 33.531 129.027 24.067 1.00 58.85  ? 329 ILE A C     1 
ATOM   2677 O  O     . ILE A 1 329 ? 32.774 128.145 24.467 1.00 58.84  ? 329 ILE A O     1 
ATOM   2678 C  CB    . ILE A 1 329 ? 35.738 129.314 25.218 1.00 55.37  ? 329 ILE A CB    1 
ATOM   2679 C  CG1   . ILE A 1 329 ? 36.394 129.845 26.492 1.00 53.26  ? 329 ILE A CG1   1 
ATOM   2680 C  CG2   . ILE A 1 329 ? 36.587 129.646 24.001 1.00 51.91  ? 329 ILE A CG2   1 
ATOM   2681 C  CD1   . ILE A 1 329 ? 36.275 131.309 26.656 1.00 54.98  ? 329 ILE A CD1   1 
ATOM   2682 N  N     . GLN A 1 330 ? 33.731 129.266 22.775 1.00 60.69  ? 330 GLN A N     1 
ATOM   2683 C  CA    . GLN A 1 330 ? 33.084 128.468 21.741 1.00 63.29  ? 330 GLN A CA    1 
ATOM   2684 C  C     . GLN A 1 330 ? 33.964 128.236 20.509 1.00 65.20  ? 330 GLN A C     1 
ATOM   2685 O  O     . GLN A 1 330 ? 34.336 129.180 19.799 1.00 65.75  ? 330 GLN A O     1 
ATOM   2686 C  CB    . GLN A 1 330 ? 31.780 129.134 21.307 1.00 65.67  ? 330 GLN A CB    1 
ATOM   2687 C  CG    . GLN A 1 330 ? 30.522 128.453 21.833 1.00 69.74  ? 330 GLN A CG    1 
ATOM   2688 C  CD    . GLN A 1 330 ? 29.820 129.255 22.916 1.00 71.70  ? 330 GLN A CD    1 
ATOM   2689 O  OE1   . GLN A 1 330 ? 29.471 130.422 22.713 1.00 72.63  ? 330 GLN A OE1   1 
ATOM   2690 N  NE2   . GLN A 1 330 ? 29.609 128.630 24.076 1.00 72.61  ? 330 GLN A NE2   1 
ATOM   2691 N  N     . LYS A 1 331 ? 34.292 126.971 20.258 1.00 65.99  ? 331 LYS A N     1 
ATOM   2692 C  CA    . LYS A 1 331 ? 34.958 126.562 19.021 1.00 66.93  ? 331 LYS A CA    1 
ATOM   2693 C  C     . LYS A 1 331 ? 33.967 126.739 17.873 1.00 67.11  ? 331 LYS A C     1 
ATOM   2694 O  O     . LYS A 1 331 ? 32.984 126.009 17.767 1.00 68.49  ? 331 LYS A O     1 
ATOM   2695 C  CB    . LYS A 1 331 ? 35.380 125.089 19.117 1.00 67.43  ? 331 LYS A CB    1 
ATOM   2696 C  CG    . LYS A 1 331 ? 36.477 124.644 18.130 1.00 67.21  ? 331 LYS A CG    1 
ATOM   2697 C  CD    . LYS A 1 331 ? 36.009 124.649 16.691 1.00 65.84  ? 331 LYS A CD    1 
ATOM   2698 C  CE    . LYS A 1 331 ? 37.155 124.327 15.750 1.00 65.99  ? 331 LYS A CE    1 
ATOM   2699 N  NZ    . LYS A 1 331 ? 37.665 122.962 15.976 1.00 63.42  ? 331 LYS A NZ    1 
ATOM   2700 N  N     . GLN A 1 332 ? 34.220 127.706 17.007 1.00 66.63  ? 332 GLN A N     1 
ATOM   2701 C  CA    . GLN A 1 332 ? 33.192 128.106 16.053 1.00 67.19  ? 332 GLN A CA    1 
ATOM   2702 C  C     . GLN A 1 332 ? 33.683 128.136 14.620 1.00 67.82  ? 332 GLN A C     1 
ATOM   2703 O  O     . GLN A 1 332 ? 33.265 128.981 13.822 1.00 68.70  ? 332 GLN A O     1 
ATOM   2704 C  CB    . GLN A 1 332 ? 32.640 129.452 16.428 1.00 68.21  ? 332 GLN A CB    1 
ATOM   2705 C  CG    . GLN A 1 332 ? 33.686 130.509 16.613 1.00 69.21  ? 332 GLN A CG    1 
ATOM   2706 C  CD    . GLN A 1 332 ? 33.260 131.821 16.027 1.00 70.81  ? 332 GLN A CD    1 
ATOM   2707 O  OE1   . GLN A 1 332 ? 32.195 131.917 15.405 1.00 72.60  ? 332 GLN A OE1   1 
ATOM   2708 N  NE2   . GLN A 1 332 ? 34.086 132.852 16.214 1.00 70.54  ? 332 GLN A NE2   1 
ATOM   2709 N  N     . GLY A 1 333 ? 34.575 127.214 14.305 1.00 67.72  ? 333 GLY A N     1 
ATOM   2710 C  CA    . GLY A 1 333 ? 35.191 127.235 12.991 1.00 68.71  ? 333 GLY A CA    1 
ATOM   2711 C  C     . GLY A 1 333 ? 36.669 127.019 13.049 1.00 69.53  ? 333 GLY A C     1 
ATOM   2712 O  O     . GLY A 1 333 ? 37.220 126.854 14.125 1.00 69.27  ? 333 GLY A O     1 
ATOM   2713 N  N     . GLN A 1 334 ? 37.314 126.996 11.888 1.00 70.86  ? 334 GLN A N     1 
ATOM   2714 C  CA    . GLN A 1 334 ? 38.713 126.601 11.845 1.00 71.72  ? 334 GLN A CA    1 
ATOM   2715 C  C     . GLN A 1 334 ? 39.567 127.641 12.517 1.00 70.70  ? 334 GLN A C     1 
ATOM   2716 O  O     . GLN A 1 334 ? 39.932 128.644 11.896 1.00 70.97  ? 334 GLN A O     1 
ATOM   2717 C  CB    . GLN A 1 334 ? 39.208 126.412 10.407 1.00 75.71  ? 334 GLN A CB    1 
ATOM   2718 C  CG    . GLN A 1 334 ? 40.468 125.540 10.315 1.00 81.26  ? 334 GLN A CG    1 
ATOM   2719 C  CD    . GLN A 1 334 ? 40.334 124.269 11.137 1.00 85.19  ? 334 GLN A CD    1 
ATOM   2720 O  OE1   . GLN A 1 334 ? 40.499 124.285 12.361 1.00 88.89  ? 334 GLN A OE1   1 
ATOM   2721 N  NE2   . GLN A 1 334 ? 40.017 123.163 10.473 1.00 86.92  ? 334 GLN A NE2   1 
ATOM   2722 N  N     . GLY A 1 335 ? 39.892 127.394 13.784 1.00 69.73  ? 335 GLY A N     1 
ATOM   2723 C  CA    . GLY A 1 335 ? 40.677 128.352 14.553 1.00 68.20  ? 335 GLY A CA    1 
ATOM   2724 C  C     . GLY A 1 335 ? 40.046 129.725 14.712 1.00 66.97  ? 335 GLY A C     1 
ATOM   2725 O  O     . GLY A 1 335 ? 40.710 130.754 14.798 1.00 67.42  ? 335 GLY A O     1 
ATOM   2726 N  N     . GLN A 1 336 ? 38.724 129.722 14.729 1.00 66.25  ? 336 GLN A N     1 
ATOM   2727 C  CA    . GLN A 1 336 ? 37.947 130.891 15.118 1.00 64.55  ? 336 GLN A CA    1 
ATOM   2728 C  C     . GLN A 1 336 ? 37.183 130.566 16.372 1.00 62.70  ? 336 GLN A C     1 
ATOM   2729 O  O     . GLN A 1 336 ? 36.454 129.590 16.413 1.00 63.57  ? 336 GLN A O     1 
ATOM   2730 C  CB    . GLN A 1 336 ? 36.959 131.241 14.034 1.00 66.21  ? 336 GLN A CB    1 
ATOM   2731 C  CG    . GLN A 1 336 ? 37.592 131.194 12.656 1.00 69.29  ? 336 GLN A CG    1 
ATOM   2732 C  CD    . GLN A 1 336 ? 36.810 131.984 11.602 1.00 72.59  ? 336 GLN A CD    1 
ATOM   2733 O  OE1   . GLN A 1 336 ? 36.152 131.399 10.727 1.00 73.46  ? 336 GLN A OE1   1 
ATOM   2734 N  NE2   . GLN A 1 336 ? 36.872 133.321 11.687 1.00 73.36  ? 336 GLN A NE2   1 
ATOM   2735 N  N     . TRP A 1 337 ? 37.332 131.389 17.392 1.00 60.52  ? 337 TRP A N     1 
ATOM   2736 C  CA    . TRP A 1 337 ? 36.723 131.095 18.665 1.00 58.60  ? 337 TRP A CA    1 
ATOM   2737 C  C     . TRP A 1 337 ? 35.921 132.320 19.067 1.00 58.12  ? 337 TRP A C     1 
ATOM   2738 O  O     . TRP A 1 337 ? 36.101 133.393 18.506 1.00 58.32  ? 337 TRP A O     1 
ATOM   2739 C  CB    . TRP A 1 337 ? 37.825 130.776 19.673 1.00 57.79  ? 337 TRP A CB    1 
ATOM   2740 C  CG    . TRP A 1 337 ? 38.708 129.643 19.216 1.00 56.93  ? 337 TRP A CG    1 
ATOM   2741 C  CD1   . TRP A 1 337 ? 39.605 129.669 18.189 1.00 56.74  ? 337 TRP A CD1   1 
ATOM   2742 C  CD2   . TRP A 1 337 ? 38.738 128.302 19.738 1.00 57.43  ? 337 TRP A CD2   1 
ATOM   2743 N  NE1   . TRP A 1 337 ? 40.189 128.435 18.033 1.00 56.51  ? 337 TRP A NE1   1 
ATOM   2744 C  CE2   . TRP A 1 337 ? 39.675 127.578 18.967 1.00 57.01  ? 337 TRP A CE2   1 
ATOM   2745 C  CE3   . TRP A 1 337 ? 38.061 127.645 20.776 1.00 56.52  ? 337 TRP A CE3   1 
ATOM   2746 C  CZ2   . TRP A 1 337 ? 39.953 126.228 19.207 1.00 56.93  ? 337 TRP A CZ2   1 
ATOM   2747 C  CZ3   . TRP A 1 337 ? 38.339 126.303 21.012 1.00 55.59  ? 337 TRP A CZ3   1 
ATOM   2748 C  CH2   . TRP A 1 337 ? 39.276 125.612 20.229 1.00 57.12  ? 337 TRP A CH2   1 
ATOM   2749 N  N     . THR A 1 338 ? 35.017 132.148 20.017 1.00 57.20  ? 338 THR A N     1 
ATOM   2750 C  CA    . THR A 1 338 ? 34.150 133.225 20.473 1.00 55.76  ? 338 THR A CA    1 
ATOM   2751 C  C     . THR A 1 338 ? 33.993 133.021 21.948 1.00 54.39  ? 338 THR A C     1 
ATOM   2752 O  O     . THR A 1 338 ? 34.095 131.900 22.428 1.00 58.11  ? 338 THR A O     1 
ATOM   2753 C  CB    . THR A 1 338 ? 32.761 133.119 19.855 1.00 57.61  ? 338 THR A CB    1 
ATOM   2754 O  OG1   . THR A 1 338 ? 32.843 133.402 18.452 1.00 59.16  ? 338 THR A OG1   1 
ATOM   2755 C  CG2   . THR A 1 338 ? 31.792 134.081 20.548 1.00 58.32  ? 338 THR A CG2   1 
ATOM   2756 N  N     . TYR A 1 339 ? 33.735 134.079 22.685 1.00 51.32  ? 339 TYR A N     1 
ATOM   2757 C  CA    . TYR A 1 339 ? 33.435 133.888 24.087 1.00 49.45  ? 339 TYR A CA    1 
ATOM   2758 C  C     . TYR A 1 339 ? 32.470 134.960 24.557 1.00 47.52  ? 339 TYR A C     1 
ATOM   2759 O  O     . TYR A 1 339 ? 32.272 135.960 23.876 1.00 47.42  ? 339 TYR A O     1 
ATOM   2760 C  CB    . TYR A 1 339 ? 34.733 133.908 24.913 1.00 49.15  ? 339 TYR A CB    1 
ATOM   2761 C  CG    . TYR A 1 339 ? 35.531 135.177 24.778 1.00 50.14  ? 339 TYR A CG    1 
ATOM   2762 C  CD1   . TYR A 1 339 ? 36.350 135.394 23.681 1.00 49.95  ? 339 TYR A CD1   1 
ATOM   2763 C  CD2   . TYR A 1 339 ? 35.464 136.160 25.750 1.00 51.49  ? 339 TYR A CD2   1 
ATOM   2764 C  CE1   . TYR A 1 339 ? 37.083 136.554 23.555 1.00 50.53  ? 339 TYR A CE1   1 
ATOM   2765 C  CE2   . TYR A 1 339 ? 36.192 137.328 25.632 1.00 52.79  ? 339 TYR A CE2   1 
ATOM   2766 C  CZ    . TYR A 1 339 ? 37.002 137.519 24.534 1.00 52.47  ? 339 TYR A CZ    1 
ATOM   2767 O  OH    . TYR A 1 339 ? 37.744 138.677 24.434 1.00 53.42  ? 339 TYR A OH    1 
ATOM   2768 N  N     . GLN A 1 340 ? 31.848 134.736 25.704 1.00 45.08  ? 340 GLN A N     1 
ATOM   2769 C  CA    . GLN A 1 340 ? 31.109 135.792 26.354 1.00 46.26  ? 340 GLN A CA    1 
ATOM   2770 C  C     . GLN A 1 340 ? 31.445 135.794 27.829 1.00 47.03  ? 340 GLN A C     1 
ATOM   2771 O  O     . GLN A 1 340 ? 31.681 134.757 28.420 1.00 47.60  ? 340 GLN A O     1 
ATOM   2772 C  CB    . GLN A 1 340 ? 29.597 135.624 26.129 1.00 44.92  ? 340 GLN A CB    1 
ATOM   2773 C  CG    . GLN A 1 340 ? 29.139 134.206 25.888 1.00 45.02  ? 340 GLN A CG    1 
ATOM   2774 C  CD    . GLN A 1 340 ? 29.280 133.779 24.442 1.00 46.80  ? 340 GLN A CD    1 
ATOM   2775 O  OE1   . GLN A 1 340 ? 29.165 134.597 23.526 1.00 47.33  ? 340 GLN A OE1   1 
ATOM   2776 N  NE2   . GLN A 1 340 ? 29.530 132.488 24.227 1.00 46.98  ? 340 GLN A NE2   1 
ATOM   2777 N  N     . ILE A 1 341 ? 31.503 136.969 28.426 1.00 49.26  ? 341 ILE A N     1 
ATOM   2778 C  CA    . ILE A 1 341 ? 31.769 137.038 29.845 1.00 52.34  ? 341 ILE A CA    1 
ATOM   2779 C  C     . ILE A 1 341 ? 30.507 137.544 30.520 1.00 55.06  ? 341 ILE A C     1 
ATOM   2780 O  O     . ILE A 1 341 ? 29.956 138.576 30.139 1.00 55.68  ? 341 ILE A O     1 
ATOM   2781 C  CB    . ILE A 1 341 ? 32.961 137.982 30.146 1.00 51.90  ? 341 ILE A CB    1 
ATOM   2782 C  CG1   . ILE A 1 341 ? 34.210 137.474 29.410 1.00 50.44  ? 341 ILE A CG1   1 
ATOM   2783 C  CG2   . ILE A 1 341 ? 33.191 138.082 31.658 1.00 47.43  ? 341 ILE A CG2   1 
ATOM   2784 C  CD1   . ILE A 1 341 ? 35.455 138.272 29.689 1.00 51.65  ? 341 ILE A CD1   1 
ATOM   2785 N  N     . TYR A 1 342 ? 30.032 136.800 31.507 1.00 56.95  ? 342 TYR A N     1 
ATOM   2786 C  CA    . TYR A 1 342 ? 28.812 137.183 32.182 1.00 58.28  ? 342 TYR A CA    1 
ATOM   2787 C  C     . TYR A 1 342 ? 28.891 136.987 33.674 1.00 58.80  ? 342 TYR A C     1 
ATOM   2788 O  O     . TYR A 1 342 ? 29.841 136.399 34.196 1.00 58.57  ? 342 TYR A O     1 
ATOM   2789 C  CB    . TYR A 1 342 ? 27.616 136.411 31.622 1.00 59.15  ? 342 TYR A CB    1 
ATOM   2790 C  CG    . TYR A 1 342 ? 27.770 134.903 31.581 1.00 62.21  ? 342 TYR A CG    1 
ATOM   2791 C  CD1   . TYR A 1 342 ? 27.930 134.231 30.368 1.00 62.99  ? 342 TYR A CD1   1 
ATOM   2792 C  CD2   . TYR A 1 342 ? 27.695 134.143 32.744 1.00 63.52  ? 342 TYR A CD2   1 
ATOM   2793 C  CE1   . TYR A 1 342 ? 28.003 132.853 30.318 1.00 62.62  ? 342 TYR A CE1   1 
ATOM   2794 C  CE2   . TYR A 1 342 ? 27.769 132.756 32.701 1.00 62.54  ? 342 TYR A CE2   1 
ATOM   2795 C  CZ    . TYR A 1 342 ? 27.920 132.124 31.488 1.00 62.76  ? 342 TYR A CZ    1 
ATOM   2796 O  OH    . TYR A 1 342 ? 27.973 130.750 31.441 1.00 65.57  ? 342 TYR A OH    1 
ATOM   2797 N  N     . GLN A 1 343 ? 27.890 137.513 34.360 1.00 59.40  ? 343 GLN A N     1 
ATOM   2798 C  CA    . GLN A 1 343 ? 27.741 137.249 35.770 1.00 60.23  ? 343 GLN A CA    1 
ATOM   2799 C  C     . GLN A 1 343 ? 26.372 136.632 36.048 1.00 62.74  ? 343 GLN A C     1 
ATOM   2800 O  O     . GLN A 1 343 ? 26.097 136.160 37.153 1.00 63.00  ? 343 GLN A O     1 
ATOM   2801 C  CB    . GLN A 1 343 ? 27.931 138.538 36.541 1.00 56.76  ? 343 GLN A CB    1 
ATOM   2802 C  CG    . GLN A 1 343 ? 29.302 139.107 36.390 1.00 50.93  ? 343 GLN A CG    1 
ATOM   2803 C  CD    . GLN A 1 343 ? 29.518 140.267 37.317 1.00 50.36  ? 343 GLN A CD    1 
ATOM   2804 O  OE1   . GLN A 1 343 ? 28.891 141.317 37.155 1.00 51.53  ? 343 GLN A OE1   1 
ATOM   2805 N  NE2   . GLN A 1 343 ? 30.395 140.092 38.303 1.00 44.19  ? 343 GLN A NE2   1 
ATOM   2806 N  N     . GLU A 1 344 ? 25.526 136.631 35.025 1.00 64.94  ? 344 GLU A N     1 
ATOM   2807 C  CA    . GLU A 1 344 ? 24.246 135.956 35.093 1.00 68.46  ? 344 GLU A CA    1 
ATOM   2808 C  C     . GLU A 1 344 ? 23.800 135.587 33.699 1.00 70.06  ? 344 GLU A C     1 
ATOM   2809 O  O     . GLU A 1 344 ? 23.946 136.365 32.760 1.00 71.02  ? 344 GLU A O     1 
ATOM   2810 C  CB    . GLU A 1 344 ? 23.196 136.854 35.730 1.00 71.30  ? 344 GLU A CB    1 
ATOM   2811 C  CG    . GLU A 1 344 ? 23.224 136.870 37.238 1.00 76.04  ? 344 GLU A CG    1 
ATOM   2812 C  CD    . GLU A 1 344 ? 22.160 137.780 37.811 1.00 79.20  ? 344 GLU A CD    1 
ATOM   2813 O  OE1   . GLU A 1 344 ? 21.217 138.122 37.062 1.00 81.93  ? 344 GLU A OE1   1 
ATOM   2814 O  OE2   . GLU A 1 344 ? 22.265 138.156 39.001 1.00 80.77  ? 344 GLU A OE2   1 
ATOM   2815 N  N     . PRO A 1 345 ? 23.221 134.395 33.546 1.00 71.74  ? 345 PRO A N     1 
ATOM   2816 C  CA    . PRO A 1 345 ? 23.001 133.863 32.200 1.00 71.77  ? 345 PRO A CA    1 
ATOM   2817 C  C     . PRO A 1 345 ? 22.249 134.807 31.273 1.00 70.68  ? 345 PRO A C     1 
ATOM   2818 O  O     . PRO A 1 345 ? 21.231 135.389 31.641 1.00 69.40  ? 345 PRO A O     1 
ATOM   2819 C  CB    . PRO A 1 345 ? 22.253 132.552 32.445 1.00 72.23  ? 345 PRO A CB    1 
ATOM   2820 C  CG    . PRO A 1 345 ? 21.696 132.669 33.825 1.00 72.10  ? 345 PRO A CG    1 
ATOM   2821 C  CD    . PRO A 1 345 ? 22.639 133.537 34.592 1.00 72.33  ? 345 PRO A CD    1 
ATOM   2822 N  N     . PHE A 1 346 ? 22.785 134.943 30.066 1.00 70.78  ? 346 PHE A N     1 
ATOM   2823 C  CA    . PHE A 1 346 ? 22.206 135.767 29.015 1.00 71.37  ? 346 PHE A CA    1 
ATOM   2824 C  C     . PHE A 1 346 ? 22.327 137.259 29.305 1.00 70.18  ? 346 PHE A C     1 
ATOM   2825 O  O     . PHE A 1 346 ? 21.771 138.086 28.582 1.00 70.56  ? 346 PHE A O     1 
ATOM   2826 C  CB    . PHE A 1 346 ? 20.743 135.394 28.793 1.00 74.44  ? 346 PHE A CB    1 
ATOM   2827 C  CG    . PHE A 1 346 ? 20.537 133.961 28.377 1.00 78.26  ? 346 PHE A CG    1 
ATOM   2828 C  CD1   . PHE A 1 346 ? 20.817 132.916 29.258 1.00 78.52  ? 346 PHE A CD1   1 
ATOM   2829 C  CD2   . PHE A 1 346 ? 20.020 133.657 27.119 1.00 79.72  ? 346 PHE A CD2   1 
ATOM   2830 C  CE1   . PHE A 1 346 ? 20.586 131.596 28.896 1.00 79.41  ? 346 PHE A CE1   1 
ATOM   2831 C  CE2   . PHE A 1 346 ? 19.782 132.331 26.745 1.00 80.60  ? 346 PHE A CE2   1 
ATOM   2832 C  CZ    . PHE A 1 346 ? 20.064 131.301 27.637 1.00 80.29  ? 346 PHE A CZ    1 
ATOM   2833 N  N     . LYS A 1 347 ? 23.060 137.602 30.360 1.00 67.91  ? 347 LYS A N     1 
ATOM   2834 C  CA    . LYS A 1 347 ? 23.454 138.989 30.593 1.00 65.19  ? 347 LYS A CA    1 
ATOM   2835 C  C     . LYS A 1 347 ? 24.968 139.205 30.420 1.00 61.90  ? 347 LYS A C     1 
ATOM   2836 O  O     . LYS A 1 347 ? 25.752 138.945 31.331 1.00 60.30  ? 347 LYS A O     1 
ATOM   2837 C  CB    . LYS A 1 347 ? 23.012 139.412 31.994 1.00 66.78  ? 347 LYS A CB    1 
ATOM   2838 C  CG    . LYS A 1 347 ? 21.496 139.438 32.192 1.00 67.48  ? 347 LYS A CG    1 
ATOM   2839 C  CD    . LYS A 1 347 ? 21.110 140.345 33.365 1.00 69.42  ? 347 LYS A CD    1 
ATOM   2840 C  CE    . LYS A 1 347 ? 19.796 141.078 33.107 1.00 68.94  ? 347 LYS A CE    1 
ATOM   2841 N  NZ    . LYS A 1 347 ? 18.670 140.486 33.894 1.00 70.16  ? 347 LYS A NZ    1 
ATOM   2842 N  N     . ASN A 1 348 ? 25.350 139.703 29.248 1.00 58.46  ? 348 ASN A N     1 
ATOM   2843 C  CA    . ASN A 1 348 ? 26.742 139.738 28.792 1.00 57.06  ? 348 ASN A CA    1 
ATOM   2844 C  C     . ASN A 1 348 ? 27.538 140.984 29.160 1.00 55.98  ? 348 ASN A C     1 
ATOM   2845 O  O     . ASN A 1 348 ? 27.483 141.972 28.418 1.00 57.58  ? 348 ASN A O     1 
ATOM   2846 C  CB    . ASN A 1 348 ? 26.789 139.665 27.274 1.00 58.42  ? 348 ASN A CB    1 
ATOM   2847 C  CG    . ASN A 1 348 ? 26.719 138.279 26.763 1.00 60.94  ? 348 ASN A CG    1 
ATOM   2848 O  OD1   . ASN A 1 348 ? 26.781 137.324 27.533 1.00 63.80  ? 348 ASN A OD1   1 
ATOM   2849 N  ND2   . ASN A 1 348 ? 26.600 138.141 25.445 1.00 61.14  ? 348 ASN A ND2   1 
ATOM   2850 N  N     . LEU A 1 349 ? 28.321 140.950 30.236 1.00 52.62  ? 349 LEU A N     1 
ATOM   2851 C  CA    . LEU A 1 349 ? 29.271 142.041 30.459 1.00 48.54  ? 349 LEU A CA    1 
ATOM   2852 C  C     . LEU A 1 349 ? 29.903 142.467 29.119 1.00 47.26  ? 349 LEU A C     1 
ATOM   2853 O  O     . LEU A 1 349 ? 29.837 143.633 28.746 1.00 48.05  ? 349 LEU A O     1 
ATOM   2854 C  CB    . LEU A 1 349 ? 30.352 141.617 31.447 1.00 46.06  ? 349 LEU A CB    1 
ATOM   2855 C  CG    . LEU A 1 349 ? 29.888 141.383 32.881 1.00 45.40  ? 349 LEU A CG    1 
ATOM   2856 C  CD1   . LEU A 1 349 ? 31.085 141.210 33.784 1.00 46.36  ? 349 LEU A CD1   1 
ATOM   2857 C  CD2   . LEU A 1 349 ? 29.084 142.561 33.359 1.00 46.57  ? 349 LEU A CD2   1 
ATOM   2858 N  N     . LYS A 1 350 ? 30.487 141.514 28.393 1.00 44.41  ? 350 LYS A N     1 
ATOM   2859 C  CA    . LYS A 1 350 ? 30.896 141.714 26.997 1.00 43.79  ? 350 LYS A CA    1 
ATOM   2860 C  C     . LYS A 1 350 ? 31.069 140.370 26.252 1.00 45.53  ? 350 LYS A C     1 
ATOM   2861 O  O     . LYS A 1 350 ? 30.642 139.313 26.733 1.00 45.07  ? 350 LYS A O     1 
ATOM   2862 C  CB    . LYS A 1 350 ? 32.207 142.513 26.917 1.00 40.95  ? 350 LYS A CB    1 
ATOM   2863 C  CG    . LYS A 1 350 ? 33.470 141.723 27.251 1.00 37.75  ? 350 LYS A CG    1 
ATOM   2864 C  CD    . LYS A 1 350 ? 34.655 142.634 27.544 1.00 34.52  ? 350 LYS A CD    1 
ATOM   2865 C  CE    . LYS A 1 350 ? 35.316 143.087 26.270 1.00 33.42  ? 350 LYS A CE    1 
ATOM   2866 N  NZ    . LYS A 1 350 ? 35.404 141.970 25.303 1.00 34.26  ? 350 LYS A NZ    1 
ATOM   2867 N  N     . THR A 1 351 ? 31.678 140.409 25.070 1.00 45.12  ? 351 THR A N     1 
ATOM   2868 C  CA    . THR A 1 351 ? 32.042 139.173 24.399 1.00 45.55  ? 351 THR A CA    1 
ATOM   2869 C  C     . THR A 1 351 ? 33.409 139.312 23.764 1.00 46.71  ? 351 THR A C     1 
ATOM   2870 O  O     . THR A 1 351 ? 34.189 140.172 24.167 1.00 46.16  ? 351 THR A O     1 
ATOM   2871 C  CB    . THR A 1 351 ? 31.013 138.788 23.323 1.00 44.79  ? 351 THR A CB    1 
ATOM   2872 O  OG1   . THR A 1 351 ? 31.026 139.754 22.274 1.00 42.76  ? 351 THR A OG1   1 
ATOM   2873 C  CG2   . THR A 1 351 ? 29.624 138.715 23.925 1.00 42.52  ? 351 THR A CG2   1 
ATOM   2874 N  N     . GLY A 1 352 ? 33.697 138.452 22.788 1.00 48.12  ? 352 GLY A N     1 
ATOM   2875 C  CA    . GLY A 1 352 ? 34.936 138.558 22.029 1.00 48.56  ? 352 GLY A CA    1 
ATOM   2876 C  C     . GLY A 1 352 ? 35.343 137.332 21.225 1.00 48.23  ? 352 GLY A C     1 
ATOM   2877 O  O     . GLY A 1 352 ? 34.892 136.219 21.472 1.00 49.49  ? 352 GLY A O     1 
ATOM   2878 N  N     . LYS A 1 353 ? 36.214 137.532 20.249 1.00 47.87  ? 353 LYS A N     1 
ATOM   2879 C  CA    . LYS A 1 353 ? 36.807 136.408 19.549 1.00 47.96  ? 353 LYS A CA    1 
ATOM   2880 C  C     . LYS A 1 353 ? 38.276 136.170 19.899 1.00 49.56  ? 353 LYS A C     1 
ATOM   2881 O  O     . LYS A 1 353 ? 38.987 137.068 20.342 1.00 50.44  ? 353 LYS A O     1 
ATOM   2882 C  CB    . LYS A 1 353 ? 36.673 136.610 18.049 1.00 45.03  ? 353 LYS A CB    1 
ATOM   2883 C  CG    . LYS A 1 353 ? 37.115 137.961 17.584 1.00 43.98  ? 353 LYS A CG    1 
ATOM   2884 C  CD    . LYS A 1 353 ? 36.743 138.177 16.132 1.00 43.43  ? 353 LYS A CD    1 
ATOM   2885 C  CE    . LYS A 1 353 ? 37.699 139.143 15.468 1.00 43.97  ? 353 LYS A CE    1 
ATOM   2886 N  NZ    . LYS A 1 353 ? 39.127 138.881 15.851 1.00 45.22  ? 353 LYS A NZ    1 
ATOM   2887 N  N     . TYR A 1 354 ? 38.714 134.932 19.717 1.00 52.52  ? 354 TYR A N     1 
ATOM   2888 C  CA    . TYR A 1 354 ? 40.123 134.636 19.498 1.00 54.96  ? 354 TYR A CA    1 
ATOM   2889 C  C     . TYR A 1 354 ? 40.241 134.014 18.115 1.00 55.83  ? 354 TYR A C     1 
ATOM   2890 O  O     . TYR A 1 354 ? 39.376 133.244 17.721 1.00 58.71  ? 354 TYR A O     1 
ATOM   2891 C  CB    . TYR A 1 354 ? 40.646 133.645 20.532 1.00 54.93  ? 354 TYR A CB    1 
ATOM   2892 C  CG    . TYR A 1 354 ? 42.116 133.410 20.370 1.00 58.72  ? 354 TYR A CG    1 
ATOM   2893 C  CD1   . TYR A 1 354 ? 43.034 134.140 21.095 1.00 60.50  ? 354 TYR A CD1   1 
ATOM   2894 C  CD2   . TYR A 1 354 ? 42.595 132.496 19.449 1.00 60.87  ? 354 TYR A CD2   1 
ATOM   2895 C  CE1   . TYR A 1 354 ? 44.386 133.967 20.905 1.00 61.94  ? 354 TYR A CE1   1 
ATOM   2896 C  CE2   . TYR A 1 354 ? 43.949 132.321 19.251 1.00 60.95  ? 354 TYR A CE2   1 
ATOM   2897 C  CZ    . TYR A 1 354 ? 44.837 133.059 19.982 1.00 60.85  ? 354 TYR A CZ    1 
ATOM   2898 O  OH    . TYR A 1 354 ? 46.186 132.896 19.798 1.00 61.25  ? 354 TYR A OH    1 
ATOM   2899 N  N     . ALA A 1 355 ? 41.290 134.338 17.370 1.00 55.54  ? 355 ALA A N     1 
ATOM   2900 C  CA    . ALA A 1 355 ? 41.504 133.665 16.100 1.00 55.64  ? 355 ALA A CA    1 
ATOM   2901 C  C     . ALA A 1 355 ? 42.920 133.853 15.618 1.00 57.83  ? 355 ALA A C     1 
ATOM   2902 O  O     . ALA A 1 355 ? 43.168 134.126 14.445 1.00 59.75  ? 355 ALA A O     1 
ATOM   2903 C  CB    . ALA A 1 355 ? 40.528 134.176 15.063 1.00 53.40  ? 355 ALA A CB    1 
ATOM   2904 N  N     . ARG A 1 356 ? 43.863 133.699 16.529 1.00 60.05  ? 356 ARG A N     1 
ATOM   2905 C  CA    . ARG A 1 356 ? 45.244 133.949 16.188 1.00 62.87  ? 356 ARG A CA    1 
ATOM   2906 C  C     . ARG A 1 356 ? 45.914 132.629 15.858 1.00 64.19  ? 356 ARG A C     1 
ATOM   2907 O  O     . ARG A 1 356 ? 45.658 131.614 16.517 1.00 64.46  ? 356 ARG A O     1 
ATOM   2908 C  CB    . ARG A 1 356 ? 45.941 134.629 17.366 1.00 64.46  ? 356 ARG A CB    1 
ATOM   2909 C  CG    . ARG A 1 356 ? 47.048 135.569 16.971 1.00 66.71  ? 356 ARG A CG    1 
ATOM   2910 C  CD    . ARG A 1 356 ? 48.395 134.963 17.278 1.00 69.77  ? 356 ARG A CD    1 
ATOM   2911 N  NE    . ARG A 1 356 ? 49.051 135.663 18.378 1.00 73.63  ? 356 ARG A NE    1 
ATOM   2912 C  CZ    . ARG A 1 356 ? 50.234 136.263 18.278 1.00 74.08  ? 356 ARG A CZ    1 
ATOM   2913 N  NH1   . ARG A 1 356 ? 50.893 136.242 17.123 1.00 73.91  ? 356 ARG A NH1   1 
ATOM   2914 N  NH2   . ARG A 1 356 ? 50.748 136.897 19.325 1.00 73.63  ? 356 ARG A NH2   1 
ATOM   2915 N  N     . MET A 1 357 ? 46.766 132.630 14.837 1.00 64.98  ? 357 MET A N     1 
ATOM   2916 C  CA    . MET A 1 357 ? 47.582 131.450 14.561 1.00 66.46  ? 357 MET A CA    1 
ATOM   2917 C  C     . MET A 1 357 ? 48.958 131.558 15.215 1.00 66.24  ? 357 MET A C     1 
ATOM   2918 O  O     . MET A 1 357 ? 49.879 132.128 14.644 1.00 66.64  ? 357 MET A O     1 
ATOM   2919 C  CB    . MET A 1 357 ? 47.735 131.242 13.045 1.00 66.61  ? 357 MET A CB    1 
ATOM   2920 C  CG    . MET A 1 357 ? 48.589 130.020 12.643 1.00 67.23  ? 357 MET A CG    1 
ATOM   2921 S  SD    . MET A 1 357 ? 47.771 128.398 12.715 1.00 65.00  ? 357 MET A SD    1 
ATOM   2922 C  CE    . MET A 1 357 ? 47.819 127.906 10.985 1.00 66.54  ? 357 MET A CE    1 
ATOM   2923 N  N     . ARG A 1 358 ? 49.093 131.009 16.415 1.00 66.80  ? 358 ARG A N     1 
ATOM   2924 C  CA    . ARG A 1 358 ? 50.381 131.010 17.094 1.00 68.69  ? 358 ARG A CA    1 
ATOM   2925 C  C     . ARG A 1 358 ? 51.147 129.724 16.823 1.00 68.75  ? 358 ARG A C     1 
ATOM   2926 O  O     . ARG A 1 358 ? 50.896 128.685 17.431 1.00 69.81  ? 358 ARG A O     1 
ATOM   2927 C  CB    . ARG A 1 358 ? 50.202 131.205 18.604 1.00 70.17  ? 358 ARG A CB    1 
ATOM   2928 C  CG    . ARG A 1 358 ? 49.945 132.658 19.006 1.00 74.17  ? 358 ARG A CG    1 
ATOM   2929 C  CD    . ARG A 1 358 ? 49.614 132.811 20.486 1.00 77.79  ? 358 ARG A CD    1 
ATOM   2930 N  NE    . ARG A 1 358 ? 50.730 133.336 21.273 1.00 80.49  ? 358 ARG A NE    1 
ATOM   2931 C  CZ    . ARG A 1 358 ? 51.865 132.678 21.498 1.00 82.41  ? 358 ARG A CZ    1 
ATOM   2932 N  NH1   . ARG A 1 358 ? 52.047 131.461 20.992 1.00 82.36  ? 358 ARG A NH1   1 
ATOM   2933 N  NH2   . ARG A 1 358 ? 52.816 133.232 22.243 1.00 83.08  ? 358 ARG A NH2   1 
ATOM   2934 N  N     . GLY A 1 359 ? 52.097 129.809 15.906 1.00 67.50  ? 359 GLY A N     1 
ATOM   2935 C  CA    . GLY A 1 359 ? 52.794 128.621 15.467 1.00 66.39  ? 359 GLY A CA    1 
ATOM   2936 C  C     . GLY A 1 359 ? 52.571 128.403 13.984 1.00 65.89  ? 359 GLY A C     1 
ATOM   2937 O  O     . GLY A 1 359 ? 51.642 128.970 13.395 1.00 66.48  ? 359 GLY A O     1 
ATOM   2938 N  N     . ALA A 1 360 ? 53.429 127.596 13.369 1.00 63.73  ? 360 ALA A N     1 
ATOM   2939 C  CA    . ALA A 1 360 ? 53.218 127.198 11.987 1.00 62.45  ? 360 ALA A CA    1 
ATOM   2940 C  C     . ALA A 1 360 ? 52.309 125.983 12.038 1.00 60.55  ? 360 ALA A C     1 
ATOM   2941 O  O     . ALA A 1 360 ? 51.644 125.630 11.061 1.00 61.31  ? 360 ALA A O     1 
ATOM   2942 C  CB    . ALA A 1 360 ? 54.546 126.844 11.332 1.00 64.00  ? 360 ALA A CB    1 
ATOM   2943 N  N     . HIS A 1 361 ? 52.288 125.359 13.208 1.00 56.68  ? 361 HIS A N     1 
ATOM   2944 C  CA    . HIS A 1 361 ? 51.488 124.177 13.433 1.00 54.24  ? 361 HIS A CA    1 
ATOM   2945 C  C     . HIS A 1 361 ? 50.809 124.302 14.779 1.00 53.71  ? 361 HIS A C     1 
ATOM   2946 O  O     . HIS A 1 361 ? 51.424 124.712 15.754 1.00 54.81  ? 361 HIS A O     1 
ATOM   2947 C  CB    . HIS A 1 361 ? 52.386 122.948 13.408 1.00 53.82  ? 361 HIS A CB    1 
ATOM   2948 C  CG    . HIS A 1 361 ? 53.422 122.998 12.333 1.00 52.95  ? 361 HIS A CG    1 
ATOM   2949 N  ND1   . HIS A 1 361 ? 53.101 122.988 10.994 1.00 52.96  ? 361 HIS A ND1   1 
ATOM   2950 C  CD2   . HIS A 1 361 ? 54.766 123.120 12.396 1.00 51.72  ? 361 HIS A CD2   1 
ATOM   2951 C  CE1   . HIS A 1 361 ? 54.202 123.106 10.278 1.00 50.95  ? 361 HIS A CE1   1 
ATOM   2952 N  NE2   . HIS A 1 361 ? 55.226 123.188 11.104 1.00 51.65  ? 361 HIS A NE2   1 
ATOM   2953 N  N     . THR A 1 362 ? 49.531 123.951 14.827 1.00 53.73  ? 362 THR A N     1 
ATOM   2954 C  CA    . THR A 1 362 ? 48.766 124.045 16.058 1.00 52.38  ? 362 THR A CA    1 
ATOM   2955 C  C     . THR A 1 362 ? 47.597 123.056 16.030 1.00 53.05  ? 362 THR A C     1 
ATOM   2956 O  O     . THR A 1 362 ? 47.357 122.375 15.019 1.00 54.30  ? 362 THR A O     1 
ATOM   2957 C  CB    . THR A 1 362 ? 48.241 125.480 16.251 1.00 49.97  ? 362 THR A CB    1 
ATOM   2958 O  OG1   . THR A 1 362 ? 47.844 125.656 17.609 1.00 52.23  ? 362 THR A OG1   1 
ATOM   2959 C  CG2   . THR A 1 362 ? 47.064 125.755 15.344 1.00 46.13  ? 362 THR A CG2   1 
ATOM   2960 N  N     . ASN A 1 363 ? 46.881 122.957 17.142 1.00 51.58  ? 363 ASN A N     1 
ATOM   2961 C  CA    . ASN A 1 363 ? 45.670 122.158 17.180 1.00 50.92  ? 363 ASN A CA    1 
ATOM   2962 C  C     . ASN A 1 363 ? 44.620 122.852 18.037 1.00 51.70  ? 363 ASN A C     1 
ATOM   2963 O  O     . ASN A 1 363 ? 44.864 123.929 18.571 1.00 52.31  ? 363 ASN A O     1 
ATOM   2964 C  CB    . ASN A 1 363 ? 45.986 120.758 17.720 1.00 50.57  ? 363 ASN A CB    1 
ATOM   2965 C  CG    . ASN A 1 363 ? 46.625 120.784 19.100 1.00 51.09  ? 363 ASN A CG    1 
ATOM   2966 O  OD1   . ASN A 1 363 ? 46.194 121.522 19.985 1.00 53.57  ? 363 ASN A OD1   1 
ATOM   2967 N  ND2   . ASN A 1 363 ? 47.656 119.967 19.289 1.00 50.51  ? 363 ASN A ND2   1 
ATOM   2968 N  N     . ASP A 1 364 ? 43.450 122.247 18.174 1.00 51.76  ? 364 ASP A N     1 
ATOM   2969 C  CA    . ASP A 1 364 ? 42.399 122.861 18.972 1.00 51.41  ? 364 ASP A CA    1 
ATOM   2970 C  C     . ASP A 1 364 ? 42.721 123.050 20.444 1.00 50.90  ? 364 ASP A C     1 
ATOM   2971 O  O     . ASP A 1 364 ? 42.346 124.063 21.027 1.00 50.49  ? 364 ASP A O     1 
ATOM   2972 C  CB    . ASP A 1 364 ? 41.111 122.066 18.852 1.00 50.72  ? 364 ASP A CB    1 
ATOM   2973 C  CG    . ASP A 1 364 ? 40.452 122.271 17.539 1.00 51.80  ? 364 ASP A CG    1 
ATOM   2974 O  OD1   . ASP A 1 364 ? 40.691 123.336 16.930 1.00 52.69  ? 364 ASP A OD1   1 
ATOM   2975 O  OD2   . ASP A 1 364 ? 39.704 121.370 17.115 1.00 53.84  ? 364 ASP A OD2   1 
ATOM   2976 N  N     . VAL A 1 365 ? 43.392 122.092 21.068 1.00 50.31  ? 365 VAL A N     1 
ATOM   2977 C  CA    . VAL A 1 365 ? 43.562 122.206 22.507 1.00 50.42  ? 365 VAL A CA    1 
ATOM   2978 C  C     . VAL A 1 365 ? 44.626 123.244 22.832 1.00 51.57  ? 365 VAL A C     1 
ATOM   2979 O  O     . VAL A 1 365 ? 44.611 123.837 23.910 1.00 53.43  ? 365 VAL A O     1 
ATOM   2980 C  CB    . VAL A 1 365 ? 43.935 120.869 23.154 1.00 48.92  ? 365 VAL A CB    1 
ATOM   2981 C  CG1   . VAL A 1 365 ? 43.971 121.022 24.663 1.00 48.78  ? 365 VAL A CG1   1 
ATOM   2982 C  CG2   . VAL A 1 365 ? 42.922 119.831 22.788 1.00 48.83  ? 365 VAL A CG2   1 
ATOM   2983 N  N     . LYS A 1 366 ? 45.538 123.482 21.895 1.00 50.39  ? 366 LYS A N     1 
ATOM   2984 C  CA    . LYS A 1 366 ? 46.444 124.607 22.031 1.00 49.69  ? 366 LYS A CA    1 
ATOM   2985 C  C     . LYS A 1 366 ? 45.675 125.923 21.970 1.00 48.78  ? 366 LYS A C     1 
ATOM   2986 O  O     . LYS A 1 366 ? 45.670 126.690 22.923 1.00 46.94  ? 366 LYS A O     1 
ATOM   2987 C  CB    . LYS A 1 366 ? 47.517 124.552 20.940 1.00 51.52  ? 366 LYS A CB    1 
ATOM   2988 C  CG    . LYS A 1 366 ? 48.497 123.407 21.148 1.00 54.09  ? 366 LYS A CG    1 
ATOM   2989 C  CD    . LYS A 1 366 ? 49.881 123.735 20.641 1.00 55.35  ? 366 LYS A CD    1 
ATOM   2990 C  CE    . LYS A 1 366 ? 50.184 122.987 19.352 1.00 57.95  ? 366 LYS A CE    1 
ATOM   2991 N  NZ    . LYS A 1 366 ? 51.537 123.323 18.815 1.00 58.30  ? 366 LYS A NZ    1 
ATOM   2992 N  N     . GLN A 1 367 ? 45.001 126.166 20.852 1.00 49.22  ? 367 GLN A N     1 
ATOM   2993 C  CA    . GLN A 1 367 ? 44.236 127.392 20.668 1.00 49.06  ? 367 GLN A CA    1 
ATOM   2994 C  C     . GLN A 1 367 ? 43.254 127.686 21.816 1.00 49.27  ? 367 GLN A C     1 
ATOM   2995 O  O     . GLN A 1 367 ? 43.262 128.774 22.378 1.00 49.61  ? 367 GLN A O     1 
ATOM   2996 C  CB    . GLN A 1 367 ? 43.500 127.329 19.332 1.00 48.88  ? 367 GLN A CB    1 
ATOM   2997 C  CG    . GLN A 1 367 ? 44.425 127.059 18.163 1.00 52.62  ? 367 GLN A CG    1 
ATOM   2998 C  CD    . GLN A 1 367 ? 43.714 127.077 16.821 1.00 57.19  ? 367 GLN A CD    1 
ATOM   2999 O  OE1   . GLN A 1 367 ? 42.960 126.155 16.483 1.00 59.89  ? 367 GLN A OE1   1 
ATOM   3000 N  NE2   . GLN A 1 367 ? 43.951 128.129 16.043 1.00 56.92  ? 367 GLN A NE2   1 
ATOM   3001 N  N     . LEU A 1 368 ? 42.418 126.721 22.175 1.00 49.04  ? 368 LEU A N     1 
ATOM   3002 C  CA    . LEU A 1 368 ? 41.503 126.899 23.301 1.00 48.70  ? 368 LEU A CA    1 
ATOM   3003 C  C     . LEU A 1 368 ? 42.301 127.164 24.585 1.00 49.33  ? 368 LEU A C     1 
ATOM   3004 O  O     . LEU A 1 368 ? 41.765 127.637 25.579 1.00 50.27  ? 368 LEU A O     1 
ATOM   3005 C  CB    . LEU A 1 368 ? 40.615 125.647 23.451 1.00 47.58  ? 368 LEU A CB    1 
ATOM   3006 C  CG    . LEU A 1 368 ? 39.486 125.503 24.483 1.00 44.15  ? 368 LEU A CG    1 
ATOM   3007 C  CD1   . LEU A 1 368 ? 40.027 124.886 25.754 1.00 42.50  ? 368 LEU A CD1   1 
ATOM   3008 C  CD2   . LEU A 1 368 ? 38.841 126.851 24.758 1.00 45.24  ? 368 LEU A CD2   1 
ATOM   3009 N  N     . THR A 1 369 ? 43.590 126.860 24.557 1.00 49.11  ? 369 THR A N     1 
ATOM   3010 C  CA    . THR A 1 369 ? 44.466 127.227 25.652 1.00 48.87  ? 369 THR A CA    1 
ATOM   3011 C  C     . THR A 1 369 ? 44.894 128.667 25.491 1.00 48.96  ? 369 THR A C     1 
ATOM   3012 O  O     . THR A 1 369 ? 44.985 129.414 26.464 1.00 48.04  ? 369 THR A O     1 
ATOM   3013 C  CB    . THR A 1 369 ? 45.729 126.392 25.657 1.00 49.45  ? 369 THR A CB    1 
ATOM   3014 O  OG1   . THR A 1 369 ? 45.394 125.018 25.872 1.00 51.50  ? 369 THR A OG1   1 
ATOM   3015 C  CG2   . THR A 1 369 ? 46.673 126.883 26.747 1.00 51.43  ? 369 THR A CG2   1 
ATOM   3016 N  N     . GLU A 1 370 ? 45.175 129.045 24.249 1.00 49.44  ? 370 GLU A N     1 
ATOM   3017 C  CA    . GLU A 1 370 ? 45.602 130.398 23.939 1.00 49.81  ? 370 GLU A CA    1 
ATOM   3018 C  C     . GLU A 1 370 ? 44.469 131.375 24.235 1.00 50.12  ? 370 GLU A C     1 
ATOM   3019 O  O     . GLU A 1 370 ? 44.675 132.373 24.919 1.00 51.94  ? 370 GLU A O     1 
ATOM   3020 C  CB    . GLU A 1 370 ? 46.020 130.494 22.467 1.00 50.96  ? 370 GLU A CB    1 
ATOM   3021 C  CG    . GLU A 1 370 ? 47.297 129.728 22.124 1.00 52.97  ? 370 GLU A CG    1 
ATOM   3022 C  CD    . GLU A 1 370 ? 47.438 129.433 20.633 1.00 57.07  ? 370 GLU A CD    1 
ATOM   3023 O  OE1   . GLU A 1 370 ? 48.189 128.494 20.294 1.00 60.26  ? 370 GLU A OE1   1 
ATOM   3024 O  OE2   . GLU A 1 370 ? 46.807 130.125 19.797 1.00 56.63  ? 370 GLU A OE2   1 
ATOM   3025 N  N     . ALA A 1 371 ? 43.269 131.070 23.742 1.00 49.69  ? 371 ALA A N     1 
ATOM   3026 C  CA    . ALA A 1 371 ? 42.101 131.943 23.914 1.00 47.64  ? 371 ALA A CA    1 
ATOM   3027 C  C     . ALA A 1 371 ? 41.707 132.149 25.373 1.00 45.71  ? 371 ALA A C     1 
ATOM   3028 O  O     . ALA A 1 371 ? 41.173 133.186 25.732 1.00 46.00  ? 371 ALA A O     1 
ATOM   3029 C  CB    . ALA A 1 371 ? 40.913 131.391 23.131 1.00 46.77  ? 371 ALA A CB    1 
ATOM   3030 N  N     . VAL A 1 372 ? 41.965 131.158 26.209 1.00 45.06  ? 372 VAL A N     1 
ATOM   3031 C  CA    . VAL A 1 372 ? 41.750 131.292 27.639 1.00 44.77  ? 372 VAL A CA    1 
ATOM   3032 C  C     . VAL A 1 372 ? 42.817 132.192 28.262 1.00 46.58  ? 372 VAL A C     1 
ATOM   3033 O  O     . VAL A 1 372 ? 42.550 132.915 29.225 1.00 47.48  ? 372 VAL A O     1 
ATOM   3034 C  CB    . VAL A 1 372 ? 41.758 129.897 28.324 1.00 43.39  ? 372 VAL A CB    1 
ATOM   3035 C  CG1   . VAL A 1 372 ? 41.832 130.032 29.840 1.00 41.86  ? 372 VAL A CG1   1 
ATOM   3036 C  CG2   . VAL A 1 372 ? 40.508 129.142 27.933 1.00 42.93  ? 372 VAL A CG2   1 
ATOM   3037 N  N     . GLN A 1 373 ? 44.026 132.162 27.711 1.00 46.87  ? 373 GLN A N     1 
ATOM   3038 C  CA    . GLN A 1 373 ? 45.070 133.049 28.203 1.00 46.48  ? 373 GLN A CA    1 
ATOM   3039 C  C     . GLN A 1 373 ? 44.680 134.489 27.914 1.00 44.33  ? 373 GLN A C     1 
ATOM   3040 O  O     . GLN A 1 373 ? 44.742 135.343 28.794 1.00 43.89  ? 373 GLN A O     1 
ATOM   3041 C  CB    . GLN A 1 373 ? 46.415 132.714 27.549 1.00 48.71  ? 373 GLN A CB    1 
ATOM   3042 C  CG    . GLN A 1 373 ? 47.348 131.932 28.468 1.00 51.11  ? 373 GLN A CG    1 
ATOM   3043 C  CD    . GLN A 1 373 ? 47.997 130.734 27.787 1.00 53.16  ? 373 GLN A CD    1 
ATOM   3044 O  OE1   . GLN A 1 373 ? 48.583 130.857 26.706 1.00 53.09  ? 373 GLN A OE1   1 
ATOM   3045 N  NE2   . GLN A 1 373 ? 47.892 129.565 28.419 1.00 53.28  ? 373 GLN A NE2   1 
ATOM   3046 N  N     . LYS A 1 374 ? 44.263 134.740 26.679 1.00 42.56  ? 374 LYS A N     1 
ATOM   3047 C  CA    . LYS A 1 374 ? 43.806 136.057 26.261 1.00 43.15  ? 374 LYS A CA    1 
ATOM   3048 C  C     . LYS A 1 374 ? 42.700 136.613 27.146 1.00 43.16  ? 374 LYS A C     1 
ATOM   3049 O  O     . LYS A 1 374 ? 42.725 137.771 27.527 1.00 44.70  ? 374 LYS A O     1 
ATOM   3050 C  CB    . LYS A 1 374 ? 43.293 136.016 24.817 1.00 43.92  ? 374 LYS A CB    1 
ATOM   3051 C  CG    . LYS A 1 374 ? 42.262 137.119 24.531 1.00 46.49  ? 374 LYS A CG    1 
ATOM   3052 C  CD    . LYS A 1 374 ? 42.142 137.484 23.058 1.00 45.30  ? 374 LYS A CD    1 
ATOM   3053 C  CE    . LYS A 1 374 ? 41.406 138.808 22.882 1.00 47.55  ? 374 LYS A CE    1 
ATOM   3054 N  NZ    . LYS A 1 374 ? 42.224 140.027 23.219 1.00 47.40  ? 374 LYS A NZ    1 
ATOM   3055 N  N     . ILE A 1 375 ? 41.716 135.785 27.453 1.00 43.59  ? 375 ILE A N     1 
ATOM   3056 C  CA    . ILE A 1 375 ? 40.552 136.215 28.214 1.00 43.15  ? 375 ILE A CA    1 
ATOM   3057 C  C     . ILE A 1 375 ? 40.886 136.458 29.669 1.00 43.80  ? 375 ILE A C     1 
ATOM   3058 O  O     . ILE A 1 375 ? 40.277 137.292 30.322 1.00 43.28  ? 375 ILE A O     1 
ATOM   3059 C  CB    . ILE A 1 375 ? 39.440 135.167 28.091 1.00 43.54  ? 375 ILE A CB    1 
ATOM   3060 C  CG1   . ILE A 1 375 ? 38.806 135.303 26.704 1.00 43.53  ? 375 ILE A CG1   1 
ATOM   3061 C  CG2   . ILE A 1 375 ? 38.453 135.286 29.226 1.00 39.91  ? 375 ILE A CG2   1 
ATOM   3062 C  CD1   . ILE A 1 375 ? 38.246 134.018 26.159 1.00 45.60  ? 375 ILE A CD1   1 
ATOM   3063 N  N     . THR A 1 376 ? 41.875 135.734 30.164 1.00 44.69  ? 376 THR A N     1 
ATOM   3064 C  CA    . THR A 1 376 ? 42.431 135.989 31.481 1.00 45.98  ? 376 THR A CA    1 
ATOM   3065 C  C     . THR A 1 376 ? 43.020 137.413 31.578 1.00 47.60  ? 376 THR A C     1 
ATOM   3066 O  O     . THR A 1 376 ? 42.607 138.225 32.414 1.00 48.34  ? 376 THR A O     1 
ATOM   3067 C  CB    . THR A 1 376 ? 43.532 134.965 31.783 1.00 45.64  ? 376 THR A CB    1 
ATOM   3068 O  OG1   . THR A 1 376 ? 43.067 133.660 31.429 1.00 47.55  ? 376 THR A OG1   1 
ATOM   3069 C  CG2   . THR A 1 376 ? 43.873 134.967 33.245 1.00 44.89  ? 376 THR A CG2   1 
ATOM   3070 N  N     . THR A 1 377 ? 43.986 137.716 30.718 1.00 47.38  ? 377 THR A N     1 
ATOM   3071 C  CA    . THR A 1 377 ? 44.678 138.997 30.780 1.00 46.56  ? 377 THR A CA    1 
ATOM   3072 C  C     . THR A 1 377 ? 43.725 140.152 30.516 1.00 44.28  ? 377 THR A C     1 
ATOM   3073 O  O     . THR A 1 377 ? 43.820 141.197 31.156 1.00 43.28  ? 377 THR A O     1 
ATOM   3074 C  CB    . THR A 1 377 ? 45.834 139.035 29.769 1.00 47.16  ? 377 THR A CB    1 
ATOM   3075 O  OG1   . THR A 1 377 ? 46.651 137.880 29.969 1.00 50.92  ? 377 THR A OG1   1 
ATOM   3076 C  CG2   . THR A 1 377 ? 46.695 140.273 29.964 1.00 45.70  ? 377 THR A CG2   1 
ATOM   3077 N  N     . GLU A 1 378 ? 42.800 139.960 29.583 1.00 43.34  ? 378 GLU A N     1 
ATOM   3078 C  CA    . GLU A 1 378 ? 41.757 140.945 29.355 1.00 44.17  ? 378 GLU A CA    1 
ATOM   3079 C  C     . GLU A 1 378 ? 40.903 141.172 30.603 1.00 44.52  ? 378 GLU A C     1 
ATOM   3080 O  O     . GLU A 1 378 ? 40.618 142.309 30.955 1.00 45.55  ? 378 GLU A O     1 
ATOM   3081 C  CB    . GLU A 1 378 ? 40.861 140.523 28.200 1.00 44.89  ? 378 GLU A CB    1 
ATOM   3082 C  CG    . GLU A 1 378 ? 39.670 141.453 27.968 1.00 49.51  ? 378 GLU A CG    1 
ATOM   3083 C  CD    . GLU A 1 378 ? 38.827 141.040 26.768 1.00 53.28  ? 378 GLU A CD    1 
ATOM   3084 O  OE1   . GLU A 1 378 ? 39.370 141.007 25.638 1.00 56.07  ? 378 GLU A OE1   1 
ATOM   3085 O  OE2   . GLU A 1 378 ? 37.627 140.742 26.949 1.00 53.18  ? 378 GLU A OE2   1 
ATOM   3086 N  N     . SER A 1 379 ? 40.501 140.106 31.284 1.00 43.53  ? 379 SER A N     1 
ATOM   3087 C  CA    . SER A 1 379 ? 39.648 140.261 32.454 1.00 43.37  ? 379 SER A CA    1 
ATOM   3088 C  C     . SER A 1 379 ? 40.352 140.992 33.576 1.00 45.21  ? 379 SER A C     1 
ATOM   3089 O  O     . SER A 1 379 ? 39.721 141.719 34.343 1.00 47.66  ? 379 SER A O     1 
ATOM   3090 C  CB    . SER A 1 379 ? 39.192 138.907 32.968 1.00 43.21  ? 379 SER A CB    1 
ATOM   3091 O  OG    . SER A 1 379 ? 38.457 138.227 31.976 1.00 45.70  ? 379 SER A OG    1 
ATOM   3092 N  N     . ILE A 1 380 ? 41.660 140.796 33.689 1.00 44.68  ? 380 ILE A N     1 
ATOM   3093 C  CA    . ILE A 1 380 ? 42.414 141.453 34.742 1.00 42.40  ? 380 ILE A CA    1 
ATOM   3094 C  C     . ILE A 1 380 ? 42.377 142.954 34.501 1.00 41.34  ? 380 ILE A C     1 
ATOM   3095 O  O     . ILE A 1 380 ? 42.281 143.749 35.435 1.00 42.60  ? 380 ILE A O     1 
ATOM   3096 C  CB    . ILE A 1 380 ? 43.874 140.968 34.761 1.00 42.72  ? 380 ILE A CB    1 
ATOM   3097 C  CG1   . ILE A 1 380 ? 43.926 139.492 35.134 1.00 42.02  ? 380 ILE A CG1   1 
ATOM   3098 C  CG2   . ILE A 1 380 ? 44.675 141.747 35.775 1.00 43.33  ? 380 ILE A CG2   1 
ATOM   3099 C  CD1   . ILE A 1 380 ? 45.314 139.013 35.420 1.00 40.53  ? 380 ILE A CD1   1 
ATOM   3100 N  N     . VAL A 1 381 ? 42.432 143.345 33.236 1.00 39.59  ? 381 VAL A N     1 
ATOM   3101 C  CA    . VAL A 1 381 ? 42.469 144.762 32.899 1.00 38.31  ? 381 VAL A CA    1 
ATOM   3102 C  C     . VAL A 1 381 ? 41.143 145.463 33.155 1.00 38.21  ? 381 VAL A C     1 
ATOM   3103 O  O     . VAL A 1 381 ? 41.119 146.520 33.773 1.00 38.54  ? 381 VAL A O     1 
ATOM   3104 C  CB    . VAL A 1 381 ? 42.882 144.983 31.427 1.00 36.69  ? 381 VAL A CB    1 
ATOM   3105 C  CG1   . VAL A 1 381 ? 42.825 146.458 31.092 1.00 32.45  ? 381 VAL A CG1   1 
ATOM   3106 C  CG2   . VAL A 1 381 ? 44.289 144.454 31.199 1.00 33.06  ? 381 VAL A CG2   1 
ATOM   3107 N  N     . ILE A 1 382 ? 40.046 144.873 32.693 1.00 37.70  ? 382 ILE A N     1 
ATOM   3108 C  CA    . ILE A 1 382 ? 38.731 145.444 32.913 1.00 37.90  ? 382 ILE A CA    1 
ATOM   3109 C  C     . ILE A 1 382 ? 38.177 145.258 34.319 1.00 41.05  ? 382 ILE A C     1 
ATOM   3110 O  O     . ILE A 1 382 ? 37.577 146.193 34.861 1.00 43.50  ? 382 ILE A O     1 
ATOM   3111 C  CB    . ILE A 1 382 ? 37.732 144.880 31.949 1.00 36.67  ? 382 ILE A CB    1 
ATOM   3112 C  CG1   . ILE A 1 382 ? 38.256 145.076 30.530 1.00 35.05  ? 382 ILE A CG1   1 
ATOM   3113 C  CG2   . ILE A 1 382 ? 36.394 145.555 32.147 1.00 33.28  ? 382 ILE A CG2   1 
ATOM   3114 C  CD1   . ILE A 1 382 ? 37.382 144.466 29.470 1.00 35.50  ? 382 ILE A CD1   1 
ATOM   3115 N  N     . TRP A 1 383 ? 38.366 144.083 34.927 1.00 41.94  ? 383 TRP A N     1 
ATOM   3116 C  CA    . TRP A 1 383 ? 37.851 143.854 36.299 1.00 42.83  ? 383 TRP A CA    1 
ATOM   3117 C  C     . TRP A 1 383 ? 38.879 143.581 37.400 1.00 43.40  ? 383 TRP A C     1 
ATOM   3118 O  O     . TRP A 1 383 ? 38.556 143.657 38.586 1.00 44.00  ? 383 TRP A O     1 
ATOM   3119 C  CB    . TRP A 1 383 ? 36.826 142.717 36.315 1.00 41.23  ? 383 TRP A CB    1 
ATOM   3120 C  CG    . TRP A 1 383 ? 35.776 142.888 35.313 1.00 38.70  ? 383 TRP A CG    1 
ATOM   3121 C  CD1   . TRP A 1 383 ? 34.749 143.753 35.369 1.00 38.71  ? 383 TRP A CD1   1 
ATOM   3122 C  CD2   . TRP A 1 383 ? 35.678 142.219 34.058 1.00 38.01  ? 383 TRP A CD2   1 
ATOM   3123 N  NE1   . TRP A 1 383 ? 34.003 143.678 34.224 1.00 40.42  ? 383 TRP A NE1   1 
ATOM   3124 C  CE2   . TRP A 1 383 ? 34.562 142.735 33.396 1.00 38.51  ? 383 TRP A CE2   1 
ATOM   3125 C  CE3   . TRP A 1 383 ? 36.434 141.234 33.424 1.00 38.51  ? 383 TRP A CE3   1 
ATOM   3126 C  CZ2   . TRP A 1 383 ? 34.172 142.309 32.135 1.00 38.34  ? 383 TRP A CZ2   1 
ATOM   3127 C  CZ3   . TRP A 1 383 ? 36.052 140.810 32.172 1.00 40.29  ? 383 TRP A CZ3   1 
ATOM   3128 C  CH2   . TRP A 1 383 ? 34.932 141.346 31.538 1.00 38.67  ? 383 TRP A CH2   1 
ATOM   3129 N  N     . GLY A 1 384 ? 40.105 143.252 37.017 1.00 44.60  ? 384 GLY A N     1 
ATOM   3130 C  CA    . GLY A 1 384 ? 41.151 143.077 38.009 1.00 46.41  ? 384 GLY A CA    1 
ATOM   3131 C  C     . GLY A 1 384 ? 41.058 141.759 38.754 1.00 47.28  ? 384 GLY A C     1 
ATOM   3132 O  O     . GLY A 1 384 ? 41.474 141.661 39.901 1.00 45.83  ? 384 GLY A O     1 
ATOM   3133 N  N     . LYS A 1 385 ? 40.501 140.751 38.093 1.00 48.80  ? 385 LYS A N     1 
ATOM   3134 C  CA    . LYS A 1 385 ? 40.453 139.391 38.606 1.00 49.54  ? 385 LYS A CA    1 
ATOM   3135 C  C     . LYS A 1 385 ? 40.199 138.485 37.409 1.00 50.02  ? 385 LYS A C     1 
ATOM   3136 O  O     . LYS A 1 385 ? 39.920 138.969 36.315 1.00 50.36  ? 385 LYS A O     1 
ATOM   3137 C  CB    . LYS A 1 385 ? 39.324 139.246 39.626 1.00 52.51  ? 385 LYS A CB    1 
ATOM   3138 C  CG    . LYS A 1 385 ? 37.926 139.307 39.032 1.00 57.18  ? 385 LYS A CG    1 
ATOM   3139 C  CD    . LYS A 1 385 ? 36.923 139.825 40.058 1.00 62.65  ? 385 LYS A CD    1 
ATOM   3140 C  CE    . LYS A 1 385 ? 36.373 138.724 40.971 1.00 64.83  ? 385 LYS A CE    1 
ATOM   3141 N  NZ    . LYS A 1 385 ? 35.091 138.138 40.449 1.00 69.50  ? 385 LYS A NZ    1 
ATOM   3142 N  N     . THR A 1 386 ? 40.303 137.176 37.606 1.00 50.54  ? 386 THR A N     1 
ATOM   3143 C  CA    . THR A 1 386 ? 40.110 136.233 36.506 1.00 51.75  ? 386 THR A CA    1 
ATOM   3144 C  C     . THR A 1 386 ? 38.781 135.501 36.623 1.00 53.08  ? 386 THR A C     1 
ATOM   3145 O  O     . THR A 1 386 ? 38.360 135.131 37.714 1.00 53.87  ? 386 THR A O     1 
ATOM   3146 C  CB    . THR A 1 386 ? 41.243 135.199 36.458 1.00 50.27  ? 386 THR A CB    1 
ATOM   3147 O  OG1   . THR A 1 386 ? 41.425 134.646 37.759 1.00 49.94  ? 386 THR A OG1   1 
ATOM   3148 C  CG2   . THR A 1 386 ? 42.540 135.845 36.027 1.00 50.74  ? 386 THR A CG2   1 
ATOM   3149 N  N     . PRO A 1 387 ? 38.101 135.291 35.494 1.00 53.28  ? 387 PRO A N     1 
ATOM   3150 C  CA    . PRO A 1 387 ? 36.767 134.691 35.489 1.00 54.48  ? 387 PRO A CA    1 
ATOM   3151 C  C     . PRO A 1 387 ? 36.824 133.192 35.766 1.00 55.97  ? 387 PRO A C     1 
ATOM   3152 O  O     . PRO A 1 387 ? 37.873 132.571 35.618 1.00 58.44  ? 387 PRO A O     1 
ATOM   3153 C  CB    . PRO A 1 387 ? 36.258 134.977 34.083 1.00 53.98  ? 387 PRO A CB    1 
ATOM   3154 C  CG    . PRO A 1 387 ? 37.485 134.988 33.259 1.00 52.81  ? 387 PRO A CG    1 
ATOM   3155 C  CD    . PRO A 1 387 ? 38.592 135.539 34.131 1.00 52.73  ? 387 PRO A CD    1 
ATOM   3156 N  N     . LYS A 1 388 ? 35.697 132.610 36.163 1.00 56.40  ? 388 LYS A N     1 
ATOM   3157 C  CA    . LYS A 1 388 ? 35.536 131.164 36.086 1.00 55.01  ? 388 LYS A CA    1 
ATOM   3158 C  C     . LYS A 1 388 ? 35.275 130.852 34.631 1.00 53.42  ? 388 LYS A C     1 
ATOM   3159 O  O     . LYS A 1 388 ? 34.629 131.623 33.937 1.00 54.84  ? 388 LYS A O     1 
ATOM   3160 C  CB    . LYS A 1 388 ? 34.352 130.710 36.939 1.00 56.31  ? 388 LYS A CB    1 
ATOM   3161 C  CG    . LYS A 1 388 ? 34.543 130.987 38.421 1.00 58.65  ? 388 LYS A CG    1 
ATOM   3162 C  CD    . LYS A 1 388 ? 33.292 130.701 39.231 1.00 60.97  ? 388 LYS A CD    1 
ATOM   3163 C  CE    . LYS A 1 388 ? 33.645 130.554 40.706 1.00 64.03  ? 388 LYS A CE    1 
ATOM   3164 N  NZ    . LYS A 1 388 ? 34.696 131.533 41.132 1.00 66.57  ? 388 LYS A NZ    1 
ATOM   3165 N  N     . PHE A 1 389 ? 35.793 129.733 34.159 1.00 51.84  ? 389 PHE A N     1 
ATOM   3166 C  CA    . PHE A 1 389 ? 35.585 129.349 32.773 1.00 49.69  ? 389 PHE A CA    1 
ATOM   3167 C  C     . PHE A 1 389 ? 34.571 128.213 32.654 1.00 50.04  ? 389 PHE A C     1 
ATOM   3168 O  O     . PHE A 1 389 ? 34.431 127.376 33.552 1.00 48.63  ? 389 PHE A O     1 
ATOM   3169 C  CB    . PHE A 1 389 ? 36.903 128.903 32.136 1.00 47.42  ? 389 PHE A CB    1 
ATOM   3170 C  CG    . PHE A 1 389 ? 37.871 130.005 31.914 1.00 43.54  ? 389 PHE A CG    1 
ATOM   3171 C  CD1   . PHE A 1 389 ? 37.900 130.679 30.713 1.00 41.98  ? 389 PHE A CD1   1 
ATOM   3172 C  CD2   . PHE A 1 389 ? 38.745 130.378 32.910 1.00 42.58  ? 389 PHE A CD2   1 
ATOM   3173 C  CE1   . PHE A 1 389 ? 38.777 131.708 30.507 1.00 41.15  ? 389 PHE A CE1   1 
ATOM   3174 C  CE2   . PHE A 1 389 ? 39.631 131.411 32.711 1.00 42.44  ? 389 PHE A CE2   1 
ATOM   3175 C  CZ    . PHE A 1 389 ? 39.646 132.077 31.507 1.00 42.18  ? 389 PHE A CZ    1 
ATOM   3176 N  N     . LYS A 1 390 ? 33.869 128.201 31.528 1.00 49.47  ? 390 LYS A N     1 
ATOM   3177 C  CA    . LYS A 1 390 ? 33.049 127.075 31.140 1.00 49.85  ? 390 LYS A CA    1 
ATOM   3178 C  C     . LYS A 1 390 ? 33.509 126.718 29.721 1.00 50.67  ? 390 LYS A C     1 
ATOM   3179 O  O     . LYS A 1 390 ? 33.249 127.466 28.778 1.00 49.79  ? 390 LYS A O     1 
ATOM   3180 C  CB    . LYS A 1 390 ? 31.555 127.473 31.139 1.00 51.83  ? 390 LYS A CB    1 
ATOM   3181 C  CG    . LYS A 1 390 ? 31.014 128.149 32.415 1.00 51.85  ? 390 LYS A CG    1 
ATOM   3182 C  CD    . LYS A 1 390 ? 31.106 127.248 33.654 1.00 55.25  ? 390 LYS A CD    1 
ATOM   3183 C  CE    . LYS A 1 390 ? 30.772 128.015 34.954 1.00 56.92  ? 390 LYS A CE    1 
ATOM   3184 N  NZ    . LYS A 1 390 ? 31.192 127.323 36.231 1.00 54.85  ? 390 LYS A NZ    1 
ATOM   3185 N  N     . LEU A 1 391 ? 34.198 125.587 29.567 1.00 51.71  ? 391 LEU A N     1 
ATOM   3186 C  CA    . LEU A 1 391 ? 34.783 125.220 28.271 1.00 53.13  ? 391 LEU A CA    1 
ATOM   3187 C  C     . LEU A 1 391 ? 34.139 123.967 27.650 1.00 52.89  ? 391 LEU A C     1 
ATOM   3188 O  O     . LEU A 1 391 ? 33.771 123.031 28.359 1.00 53.97  ? 391 LEU A O     1 
ATOM   3189 C  CB    . LEU A 1 391 ? 36.289 124.983 28.421 1.00 54.84  ? 391 LEU A CB    1 
ATOM   3190 C  CG    . LEU A 1 391 ? 37.280 126.105 28.749 1.00 56.31  ? 391 LEU A CG    1 
ATOM   3191 C  CD1   . LEU A 1 391 ? 36.572 127.343 29.226 1.00 55.75  ? 391 LEU A CD1   1 
ATOM   3192 C  CD2   . LEU A 1 391 ? 38.251 125.599 29.810 1.00 55.57  ? 391 LEU A CD2   1 
ATOM   3193 N  N     . PRO A 1 392 ? 33.998 123.947 26.312 1.00 51.64  ? 392 PRO A N     1 
ATOM   3194 C  CA    . PRO A 1 392 ? 33.495 122.843 25.490 1.00 51.79  ? 392 PRO A CA    1 
ATOM   3195 C  C     . PRO A 1 392 ? 34.526 121.760 25.297 1.00 53.33  ? 392 PRO A C     1 
ATOM   3196 O  O     . PRO A 1 392 ? 34.746 121.294 24.181 1.00 53.35  ? 392 PRO A O     1 
ATOM   3197 C  CB    . PRO A 1 392 ? 33.168 123.504 24.165 1.00 52.65  ? 392 PRO A CB    1 
ATOM   3198 C  CG    . PRO A 1 392 ? 34.138 124.617 24.076 1.00 52.10  ? 392 PRO A CG    1 
ATOM   3199 C  CD    . PRO A 1 392 ? 34.285 125.132 25.489 1.00 52.97  ? 392 PRO A CD    1 
ATOM   3200 N  N     . ILE A 1 393 ? 35.180 121.368 26.377 1.00 54.73  ? 393 ILE A N     1 
ATOM   3201 C  CA    . ILE A 1 393 ? 36.181 120.326 26.281 1.00 56.99  ? 393 ILE A CA    1 
ATOM   3202 C  C     . ILE A 1 393 ? 35.979 119.469 27.516 1.00 58.43  ? 393 ILE A C     1 
ATOM   3203 O  O     . ILE A 1 393 ? 35.686 120.000 28.572 1.00 57.74  ? 393 ILE A O     1 
ATOM   3204 C  CB    . ILE A 1 393 ? 37.604 120.928 26.274 1.00 56.08  ? 393 ILE A CB    1 
ATOM   3205 C  CG1   . ILE A 1 393 ? 38.567 119.992 25.541 1.00 57.64  ? 393 ILE A CG1   1 
ATOM   3206 C  CG2   . ILE A 1 393 ? 38.089 121.119 27.686 1.00 55.30  ? 393 ILE A CG2   1 
ATOM   3207 C  CD1   . ILE A 1 393 ? 40.031 120.279 25.803 1.00 57.77  ? 393 ILE A CD1   1 
ATOM   3208 N  N     . GLN A 1 394 ? 36.103 118.149 27.384 1.00 60.16  ? 394 GLN A N     1 
ATOM   3209 C  CA    . GLN A 1 394 ? 35.893 117.260 28.519 1.00 61.50  ? 394 GLN A CA    1 
ATOM   3210 C  C     . GLN A 1 394 ? 37.196 116.924 29.214 1.00 63.62  ? 394 GLN A C     1 
ATOM   3211 O  O     . GLN A 1 394 ? 38.210 116.652 28.561 1.00 62.50  ? 394 GLN A O     1 
ATOM   3212 C  CB    . GLN A 1 394 ? 35.219 115.983 28.060 1.00 62.14  ? 394 GLN A CB    1 
ATOM   3213 C  CG    . GLN A 1 394 ? 35.260 115.806 26.557 1.00 65.41  ? 394 GLN A CG    1 
ATOM   3214 C  CD    . GLN A 1 394 ? 34.171 114.866 26.059 1.00 67.35  ? 394 GLN A CD    1 
ATOM   3215 O  OE1   . GLN A 1 394 ? 33.382 114.335 26.847 1.00 67.93  ? 394 GLN A OE1   1 
ATOM   3216 N  NE2   . GLN A 1 394 ? 34.126 114.654 24.748 1.00 67.15  ? 394 GLN A NE2   1 
ATOM   3217 N  N     . LYS A 1 395 ? 37.157 116.942 30.546 1.00 65.79  ? 395 LYS A N     1 
ATOM   3218 C  CA    . LYS A 1 395 ? 38.354 116.750 31.355 1.00 68.43  ? 395 LYS A CA    1 
ATOM   3219 C  C     . LYS A 1 395 ? 39.235 115.674 30.740 1.00 70.34  ? 395 LYS A C     1 
ATOM   3220 O  O     . LYS A 1 395 ? 40.459 115.810 30.701 1.00 70.45  ? 395 LYS A O     1 
ATOM   3221 C  CB    . LYS A 1 395 ? 37.968 116.357 32.779 1.00 68.47  ? 395 LYS A CB    1 
ATOM   3222 C  CG    . LYS A 1 395 ? 37.032 117.355 33.457 1.00 70.40  ? 395 LYS A CG    1 
ATOM   3223 C  CD    . LYS A 1 395 ? 37.700 118.715 33.658 1.00 69.96  ? 395 LYS A CD    1 
ATOM   3224 C  CE    . LYS A 1 395 ? 36.775 119.715 34.338 1.00 68.49  ? 395 LYS A CE    1 
ATOM   3225 N  NZ    . LYS A 1 395 ? 37.070 119.862 35.789 1.00 67.55  ? 395 LYS A NZ    1 
ATOM   3226 N  N     . GLU A 1 396 ? 38.595 114.615 30.247 1.00 72.62  ? 396 GLU A N     1 
ATOM   3227 C  CA    . GLU A 1 396 ? 39.286 113.544 29.525 1.00 74.28  ? 396 GLU A CA    1 
ATOM   3228 C  C     . GLU A 1 396 ? 40.302 114.139 28.570 1.00 72.81  ? 396 GLU A C     1 
ATOM   3229 O  O     . GLU A 1 396 ? 41.507 113.950 28.729 1.00 73.90  ? 396 GLU A O     1 
ATOM   3230 C  CB    . GLU A 1 396 ? 38.298 112.685 28.710 1.00 76.34  ? 396 GLU A CB    1 
ATOM   3231 C  CG    . GLU A 1 396 ? 37.356 111.810 29.531 1.00 80.59  ? 396 GLU A CG    1 
ATOM   3232 C  CD    . GLU A 1 396 ? 36.204 112.591 30.158 1.00 83.51  ? 396 GLU A CD    1 
ATOM   3233 O  OE1   . GLU A 1 396 ? 35.589 113.433 29.455 1.00 84.07  ? 396 GLU A OE1   1 
ATOM   3234 O  OE2   . GLU A 1 396 ? 35.916 112.358 31.356 1.00 84.30  ? 396 GLU A OE2   1 
ATOM   3235 N  N     . THR A 1 397 ? 39.811 114.871 27.578 1.00 70.25  ? 397 THR A N     1 
ATOM   3236 C  CA    . THR A 1 397 ? 40.669 115.282 26.486 1.00 67.48  ? 397 THR A CA    1 
ATOM   3237 C  C     . THR A 1 397 ? 41.820 116.104 27.033 1.00 67.09  ? 397 THR A C     1 
ATOM   3238 O  O     . THR A 1 397 ? 42.966 115.904 26.656 1.00 65.34  ? 397 THR A O     1 
ATOM   3239 C  CB    . THR A 1 397 ? 39.901 116.106 25.460 1.00 65.02  ? 397 THR A CB    1 
ATOM   3240 O  OG1   . THR A 1 397 ? 38.691 115.424 25.118 1.00 63.47  ? 397 THR A OG1   1 
ATOM   3241 C  CG2   . THR A 1 397 ? 40.737 116.283 24.212 1.00 63.42  ? 397 THR A CG2   1 
ATOM   3242 N  N     . TRP A 1 398 ? 41.519 117.018 27.942 1.00 67.65  ? 398 TRP A N     1 
ATOM   3243 C  CA    . TRP A 1 398 ? 42.562 117.859 28.488 1.00 69.28  ? 398 TRP A CA    1 
ATOM   3244 C  C     . TRP A 1 398 ? 43.696 116.987 29.009 1.00 70.09  ? 398 TRP A C     1 
ATOM   3245 O  O     . TRP A 1 398 ? 44.851 117.170 28.630 1.00 70.23  ? 398 TRP A O     1 
ATOM   3246 C  CB    . TRP A 1 398 ? 42.011 118.739 29.613 1.00 70.16  ? 398 TRP A CB    1 
ATOM   3247 C  CG    . TRP A 1 398 ? 43.079 119.480 30.357 1.00 71.09  ? 398 TRP A CG    1 
ATOM   3248 C  CD1   . TRP A 1 398 ? 43.433 119.314 31.665 1.00 72.25  ? 398 TRP A CD1   1 
ATOM   3249 C  CD2   . TRP A 1 398 ? 43.943 120.497 29.837 1.00 71.26  ? 398 TRP A CD2   1 
ATOM   3250 N  NE1   . TRP A 1 398 ? 44.464 120.165 31.993 1.00 72.00  ? 398 TRP A NE1   1 
ATOM   3251 C  CE2   . TRP A 1 398 ? 44.795 120.902 30.885 1.00 72.46  ? 398 TRP A CE2   1 
ATOM   3252 C  CE3   . TRP A 1 398 ? 44.081 121.106 28.588 1.00 70.43  ? 398 TRP A CE3   1 
ATOM   3253 C  CZ2   . TRP A 1 398 ? 45.768 121.883 30.718 1.00 72.55  ? 398 TRP A CZ2   1 
ATOM   3254 C  CZ3   . TRP A 1 398 ? 45.048 122.078 28.425 1.00 70.30  ? 398 TRP A CZ3   1 
ATOM   3255 C  CH2   . TRP A 1 398 ? 45.876 122.458 29.482 1.00 71.16  ? 398 TRP A CH2   1 
ATOM   3256 N  N     . GLU A 1 399 ? 43.373 116.023 29.861 1.00 70.79  ? 399 GLU A N     1 
ATOM   3257 C  CA    . GLU A 1 399 ? 44.417 115.238 30.504 1.00 72.26  ? 399 GLU A CA    1 
ATOM   3258 C  C     . GLU A 1 399 ? 45.178 114.342 29.528 1.00 71.61  ? 399 GLU A C     1 
ATOM   3259 O  O     . GLU A 1 399 ? 46.372 114.108 29.692 1.00 71.02  ? 399 GLU A O     1 
ATOM   3260 C  CB    . GLU A 1 399 ? 43.822 114.401 31.633 1.00 74.76  ? 399 GLU A CB    1 
ATOM   3261 C  CG    . GLU A 1 399 ? 43.349 115.229 32.812 1.00 80.73  ? 399 GLU A CG    1 
ATOM   3262 C  CD    . GLU A 1 399 ? 41.937 114.870 33.262 1.00 85.07  ? 399 GLU A CD    1 
ATOM   3263 O  OE1   . GLU A 1 399 ? 41.044 115.758 33.206 1.00 86.87  ? 399 GLU A OE1   1 
ATOM   3264 O  OE2   . GLU A 1 399 ? 41.723 113.704 33.677 1.00 85.96  ? 399 GLU A OE2   1 
ATOM   3265 N  N     . THR A 1 400 ? 44.493 113.844 28.506 1.00 71.34  ? 400 THR A N     1 
ATOM   3266 C  CA    . THR A 1 400 ? 45.162 113.059 27.476 1.00 70.93  ? 400 THR A CA    1 
ATOM   3267 C  C     . THR A 1 400 ? 46.320 113.920 26.965 1.00 70.25  ? 400 THR A C     1 
ATOM   3268 O  O     . THR A 1 400 ? 47.416 113.428 26.710 1.00 69.41  ? 400 THR A O     1 
ATOM   3269 C  CB    . THR A 1 400 ? 44.213 112.746 26.268 1.00 72.49  ? 400 THR A CB    1 
ATOM   3270 O  OG1   . THR A 1 400 ? 42.906 112.384 26.740 1.00 73.92  ? 400 THR A OG1   1 
ATOM   3271 C  CG2   . THR A 1 400 ? 44.769 111.591 25.430 1.00 71.16  ? 400 THR A CG2   1 
ATOM   3272 N  N     . TRP A 1 401 ? 46.058 115.218 26.837 1.00 69.64  ? 401 TRP A N     1 
ATOM   3273 C  CA    . TRP A 1 401 ? 46.964 116.130 26.159 1.00 69.78  ? 401 TRP A CA    1 
ATOM   3274 C  C     . TRP A 1 401 ? 47.975 116.777 27.103 1.00 71.55  ? 401 TRP A C     1 
ATOM   3275 O  O     . TRP A 1 401 ? 49.141 116.935 26.745 1.00 71.41  ? 401 TRP A O     1 
ATOM   3276 C  CB    . TRP A 1 401 ? 46.158 117.203 25.426 1.00 68.15  ? 401 TRP A CB    1 
ATOM   3277 C  CG    . TRP A 1 401 ? 46.942 118.436 25.069 1.00 68.48  ? 401 TRP A CG    1 
ATOM   3278 C  CD1   . TRP A 1 401 ? 46.849 119.666 25.659 1.00 68.28  ? 401 TRP A CD1   1 
ATOM   3279 C  CD2   . TRP A 1 401 ? 47.939 118.561 24.041 1.00 68.23  ? 401 TRP A CD2   1 
ATOM   3280 N  NE1   . TRP A 1 401 ? 47.722 120.546 25.063 1.00 67.26  ? 401 TRP A NE1   1 
ATOM   3281 C  CE2   . TRP A 1 401 ? 48.399 119.895 24.073 1.00 67.24  ? 401 TRP A CE2   1 
ATOM   3282 C  CE3   . TRP A 1 401 ? 48.480 117.679 23.106 1.00 68.19  ? 401 TRP A CE3   1 
ATOM   3283 C  CZ2   . TRP A 1 401 ? 49.376 120.359 23.200 1.00 67.32  ? 401 TRP A CZ2   1 
ATOM   3284 C  CZ3   . TRP A 1 401 ? 49.451 118.147 22.241 1.00 68.34  ? 401 TRP A CZ3   1 
ATOM   3285 C  CH2   . TRP A 1 401 ? 49.888 119.475 22.294 1.00 67.95  ? 401 TRP A CH2   1 
ATOM   3286 N  N     . TRP A 1 402 ? 47.548 117.145 28.307 1.00 73.04  ? 402 TRP A N     1 
ATOM   3287 C  CA    . TRP A 1 402 ? 48.492 117.697 29.267 1.00 75.68  ? 402 TRP A CA    1 
ATOM   3288 C  C     . TRP A 1 402 ? 49.537 116.620 29.524 1.00 76.43  ? 402 TRP A C     1 
ATOM   3289 O  O     . TRP A 1 402 ? 50.591 116.878 30.103 1.00 77.01  ? 402 TRP A O     1 
ATOM   3290 C  CB    . TRP A 1 402 ? 47.783 118.081 30.571 1.00 78.82  ? 402 TRP A CB    1 
ATOM   3291 C  CG    . TRP A 1 402 ? 48.056 117.144 31.702 1.00 82.71  ? 402 TRP A CG    1 
ATOM   3292 C  CD1   . TRP A 1 402 ? 47.322 116.042 32.055 1.00 84.80  ? 402 TRP A CD1   1 
ATOM   3293 C  CD2   . TRP A 1 402 ? 49.175 117.177 32.593 1.00 84.16  ? 402 TRP A CD2   1 
ATOM   3294 N  NE1   . TRP A 1 402 ? 47.922 115.381 33.105 1.00 85.46  ? 402 TRP A NE1   1 
ATOM   3295 C  CE2   . TRP A 1 402 ? 49.068 116.059 33.456 1.00 85.93  ? 402 TRP A CE2   1 
ATOM   3296 C  CE3   . TRP A 1 402 ? 50.268 118.038 32.746 1.00 83.73  ? 402 TRP A CE3   1 
ATOM   3297 C  CZ2   . TRP A 1 402 ? 50.003 115.778 34.452 1.00 85.74  ? 402 TRP A CZ2   1 
ATOM   3298 C  CZ3   . TRP A 1 402 ? 51.198 117.761 33.733 1.00 86.44  ? 402 TRP A CZ3   1 
ATOM   3299 C  CH2   . TRP A 1 402 ? 51.061 116.639 34.575 1.00 86.89  ? 402 TRP A CH2   1 
ATOM   3300 N  N     . THR A 1 403 ? 49.228 115.411 29.061 1.00 77.50  ? 403 THR A N     1 
ATOM   3301 C  CA    . THR A 1 403 ? 50.054 114.223 29.273 1.00 77.38  ? 403 THR A CA    1 
ATOM   3302 C  C     . THR A 1 403 ? 51.090 114.019 28.179 1.00 78.57  ? 403 THR A C     1 
ATOM   3303 O  O     . THR A 1 403 ? 52.269 113.835 28.461 1.00 79.23  ? 403 THR A O     1 
ATOM   3304 C  CB    . THR A 1 403 ? 49.180 112.963 29.334 1.00 76.19  ? 403 THR A CB    1 
ATOM   3305 O  OG1   . THR A 1 403 ? 49.213 112.433 30.660 1.00 75.71  ? 403 THR A OG1   1 
ATOM   3306 C  CG2   . THR A 1 403 ? 49.672 111.911 28.350 1.00 74.63  ? 403 THR A CG2   1 
ATOM   3307 N  N     . GLU A 1 404 ? 50.641 114.048 26.930 1.00 79.78  ? 404 GLU A N     1 
ATOM   3308 C  CA    . GLU A 1 404 ? 51.515 113.808 25.792 1.00 80.86  ? 404 GLU A CA    1 
ATOM   3309 C  C     . GLU A 1 404 ? 52.341 115.042 25.488 1.00 80.43  ? 404 GLU A C     1 
ATOM   3310 O  O     . GLU A 1 404 ? 53.399 114.951 24.868 1.00 81.88  ? 404 GLU A O     1 
ATOM   3311 C  CB    . GLU A 1 404 ? 50.686 113.445 24.566 1.00 82.41  ? 404 GLU A CB    1 
ATOM   3312 C  CG    . GLU A 1 404 ? 49.705 112.326 24.827 1.00 85.90  ? 404 GLU A CG    1 
ATOM   3313 C  CD    . GLU A 1 404 ? 48.794 112.069 23.647 1.00 87.55  ? 404 GLU A CD    1 
ATOM   3314 O  OE1   . GLU A 1 404 ? 48.391 110.898 23.461 1.00 88.38  ? 404 GLU A OE1   1 
ATOM   3315 O  OE2   . GLU A 1 404 ? 48.486 113.037 22.912 1.00 87.02  ? 404 GLU A OE2   1 
ATOM   3316 N  N     . TYR A 1 405 ? 51.850 116.197 25.920 1.00 78.59  ? 405 TYR A N     1 
ATOM   3317 C  CA    . TYR A 1 405 ? 52.560 117.436 25.683 1.00 76.43  ? 405 TYR A CA    1 
ATOM   3318 C  C     . TYR A 1 405 ? 53.641 117.635 26.737 1.00 76.25  ? 405 TYR A C     1 
ATOM   3319 O  O     . TYR A 1 405 ? 53.417 117.394 27.927 1.00 75.01  ? 405 TYR A O     1 
ATOM   3320 C  CB    . TYR A 1 405 ? 51.591 118.617 25.688 1.00 75.30  ? 405 TYR A CB    1 
ATOM   3321 C  CG    . TYR A 1 405 ? 52.135 119.829 24.965 1.00 73.57  ? 405 TYR A CG    1 
ATOM   3322 C  CD1   . TYR A 1 405 ? 52.765 119.694 23.738 1.00 72.39  ? 405 TYR A CD1   1 
ATOM   3323 C  CD2   . TYR A 1 405 ? 52.043 121.096 25.516 1.00 72.10  ? 405 TYR A CD2   1 
ATOM   3324 C  CE1   . TYR A 1 405 ? 53.287 120.772 23.083 1.00 70.88  ? 405 TYR A CE1   1 
ATOM   3325 C  CE2   . TYR A 1 405 ? 52.567 122.183 24.863 1.00 71.54  ? 405 TYR A CE2   1 
ATOM   3326 C  CZ    . TYR A 1 405 ? 53.189 122.012 23.644 1.00 71.37  ? 405 TYR A CZ    1 
ATOM   3327 O  OH    . TYR A 1 405 ? 53.726 123.086 22.974 1.00 72.70  ? 405 TYR A OH    1 
ATOM   3328 N  N     . TRP A 1 406 ? 54.807 118.087 26.272 1.00 76.62  ? 406 TRP A N     1 
ATOM   3329 C  CA    . TRP A 1 406 ? 56.059 118.065 27.028 1.00 76.80  ? 406 TRP A CA    1 
ATOM   3330 C  C     . TRP A 1 406 ? 56.525 119.450 27.474 1.00 75.98  ? 406 TRP A C     1 
ATOM   3331 O  O     . TRP A 1 406 ? 57.577 119.593 28.108 1.00 75.93  ? 406 TRP A O     1 
ATOM   3332 C  CB    . TRP A 1 406 ? 57.156 117.414 26.182 1.00 78.87  ? 406 TRP A CB    1 
ATOM   3333 C  CG    . TRP A 1 406 ? 57.381 118.077 24.837 1.00 80.89  ? 406 TRP A CG    1 
ATOM   3334 C  CD1   . TRP A 1 406 ? 58.226 119.120 24.563 1.00 81.26  ? 406 TRP A CD1   1 
ATOM   3335 C  CD2   . TRP A 1 406 ? 56.784 117.710 23.584 1.00 81.28  ? 406 TRP A CD2   1 
ATOM   3336 N  NE1   . TRP A 1 406 ? 58.193 119.420 23.222 1.00 81.91  ? 406 TRP A NE1   1 
ATOM   3337 C  CE2   . TRP A 1 406 ? 57.316 118.569 22.598 1.00 81.24  ? 406 TRP A CE2   1 
ATOM   3338 C  CE3   . TRP A 1 406 ? 55.852 116.738 23.200 1.00 81.06  ? 406 TRP A CE3   1 
ATOM   3339 C  CZ2   . TRP A 1 406 ? 56.951 118.485 21.256 1.00 80.54  ? 406 TRP A CZ2   1 
ATOM   3340 C  CZ3   . TRP A 1 406 ? 55.492 116.656 21.867 1.00 81.38  ? 406 TRP A CZ3   1 
ATOM   3341 C  CH2   . TRP A 1 406 ? 56.040 117.525 20.912 1.00 80.85  ? 406 TRP A CH2   1 
ATOM   3342 N  N     . GLN A 1 407 ? 55.751 120.466 27.108 1.00 75.04  ? 407 GLN A N     1 
ATOM   3343 C  CA    . GLN A 1 407 ? 55.937 121.817 27.618 1.00 73.02  ? 407 GLN A CA    1 
ATOM   3344 C  C     . GLN A 1 407 ? 54.784 122.044 28.583 1.00 71.02  ? 407 GLN A C     1 
ATOM   3345 O  O     . GLN A 1 407 ? 53.634 121.792 28.249 1.00 70.76  ? 407 GLN A O     1 
ATOM   3346 C  CB    . GLN A 1 407 ? 55.862 122.837 26.471 1.00 73.93  ? 407 GLN A CB    1 
ATOM   3347 C  CG    . GLN A 1 407 ? 56.561 122.418 25.175 1.00 75.35  ? 407 GLN A CG    1 
ATOM   3348 C  CD    . GLN A 1 407 ? 58.062 122.693 25.176 1.00 77.02  ? 407 GLN A CD    1 
ATOM   3349 O  OE1   . GLN A 1 407 ? 58.824 122.022 24.479 1.00 76.00  ? 407 GLN A OE1   1 
ATOM   3350 N  NE2   . GLN A 1 407 ? 58.490 123.684 25.955 1.00 76.51  ? 407 GLN A NE2   1 
ATOM   3351 N  N     . ALA A 1 408 ? 55.081 122.510 29.782 1.00 69.87  ? 408 ALA A N     1 
ATOM   3352 C  CA    . ALA A 1 408 ? 54.023 122.753 30.753 1.00 68.93  ? 408 ALA A CA    1 
ATOM   3353 C  C     . ALA A 1 408 ? 52.858 123.493 30.093 1.00 66.75  ? 408 ALA A C     1 
ATOM   3354 O  O     . ALA A 1 408 ? 53.077 124.422 29.332 1.00 66.46  ? 408 ALA A O     1 
ATOM   3355 C  CB    . ALA A 1 408 ? 54.575 123.569 31.924 1.00 69.95  ? 408 ALA A CB    1 
ATOM   3356 N  N     . THR A 1 409 ? 51.627 123.078 30.380 1.00 65.94  ? 409 THR A N     1 
ATOM   3357 C  CA    . THR A 1 409 ? 50.441 123.757 29.846 1.00 64.69  ? 409 THR A CA    1 
ATOM   3358 C  C     . THR A 1 409 ? 49.340 123.733 30.900 1.00 65.15  ? 409 THR A C     1 
ATOM   3359 O  O     . THR A 1 409 ? 49.234 122.772 31.655 1.00 65.94  ? 409 THR A O     1 
ATOM   3360 C  CB    . THR A 1 409 ? 49.929 123.054 28.576 1.00 63.26  ? 409 THR A CB    1 
ATOM   3361 O  OG1   . THR A 1 409 ? 49.195 123.982 27.777 1.00 61.84  ? 409 THR A OG1   1 
ATOM   3362 C  CG2   . THR A 1 409 ? 49.019 121.896 28.938 1.00 62.89  ? 409 THR A CG2   1 
ATOM   3363 N  N     . TRP A 1 410 ? 48.526 124.781 30.973 1.00 65.94  ? 410 TRP A N     1 
ATOM   3364 C  CA    . TRP A 1 410 ? 47.529 124.849 32.041 1.00 67.51  ? 410 TRP A CA    1 
ATOM   3365 C  C     . TRP A 1 410 ? 46.250 125.652 31.769 1.00 68.89  ? 410 TRP A C     1 
ATOM   3366 O  O     . TRP A 1 410 ? 46.219 126.548 30.921 1.00 70.69  ? 410 TRP A O     1 
ATOM   3367 C  CB    . TRP A 1 410 ? 48.179 125.370 33.326 1.00 67.37  ? 410 TRP A CB    1 
ATOM   3368 C  CG    . TRP A 1 410 ? 47.304 125.161 34.515 1.00 68.89  ? 410 TRP A CG    1 
ATOM   3369 C  CD1   . TRP A 1 410 ? 46.881 123.966 35.012 1.00 69.31  ? 410 TRP A CD1   1 
ATOM   3370 C  CD2   . TRP A 1 410 ? 46.664 126.171 35.302 1.00 69.04  ? 410 TRP A CD2   1 
ATOM   3371 N  NE1   . TRP A 1 410 ? 46.009 124.167 36.055 1.00 69.14  ? 410 TRP A NE1   1 
ATOM   3372 C  CE2   . TRP A 1 410 ? 45.860 125.514 36.253 1.00 68.94  ? 410 TRP A CE2   1 
ATOM   3373 C  CE3   . TRP A 1 410 ? 46.690 127.566 35.294 1.00 68.27  ? 410 TRP A CE3   1 
ATOM   3374 C  CZ2   . TRP A 1 410 ? 45.094 126.202 37.183 1.00 68.29  ? 410 TRP A CZ2   1 
ATOM   3375 C  CZ3   . TRP A 1 410 ? 45.930 128.244 36.218 1.00 67.58  ? 410 TRP A CZ3   1 
ATOM   3376 C  CH2   . TRP A 1 410 ? 45.144 127.564 37.148 1.00 67.85  ? 410 TRP A CH2   1 
ATOM   3377 N  N     . ILE A 1 411 ? 45.195 125.314 32.509 1.00 69.16  ? 411 ILE A N     1 
ATOM   3378 C  CA    . ILE A 1 411 ? 43.918 126.026 32.476 1.00 69.52  ? 411 ILE A CA    1 
ATOM   3379 C  C     . ILE A 1 411 ? 43.312 125.979 33.876 1.00 71.50  ? 411 ILE A C     1 
ATOM   3380 O  O     . ILE A 1 411 ? 43.379 124.948 34.541 1.00 73.37  ? 411 ILE A O     1 
ATOM   3381 C  CB    . ILE A 1 411 ? 42.928 125.346 31.534 1.00 68.10  ? 411 ILE A CB    1 
ATOM   3382 C  CG1   . ILE A 1 411 ? 43.488 125.307 30.123 1.00 66.72  ? 411 ILE A CG1   1 
ATOM   3383 C  CG2   . ILE A 1 411 ? 41.611 126.093 31.546 1.00 70.36  ? 411 ILE A CG2   1 
ATOM   3384 C  CD1   . ILE A 1 411 ? 42.486 124.836 29.137 1.00 65.41  ? 411 ILE A CD1   1 
ATOM   3385 N  N     . PRO A 1 412 ? 42.704 127.086 34.345 1.00 72.05  ? 412 PRO A N     1 
ATOM   3386 C  CA    . PRO A 1 412 ? 42.188 127.069 35.720 1.00 72.79  ? 412 PRO A CA    1 
ATOM   3387 C  C     . PRO A 1 412 ? 40.885 126.285 35.943 1.00 74.63  ? 412 PRO A C     1 
ATOM   3388 O  O     . PRO A 1 412 ? 40.469 125.470 35.113 1.00 73.03  ? 412 PRO A O     1 
ATOM   3389 C  CB    . PRO A 1 412 ? 42.035 128.551 36.066 1.00 70.16  ? 412 PRO A CB    1 
ATOM   3390 C  CG    . PRO A 1 412 ? 41.848 129.216 34.766 1.00 69.66  ? 412 PRO A CG    1 
ATOM   3391 C  CD    . PRO A 1 412 ? 42.627 128.429 33.747 1.00 71.25  ? 412 PRO A CD    1 
ATOM   3392 N  N     . GLU A 1 413 ? 40.275 126.530 37.101 1.00 77.03  ? 413 GLU A N     1 
ATOM   3393 C  CA    . GLU A 1 413 ? 38.873 126.205 37.351 1.00 77.22  ? 413 GLU A CA    1 
ATOM   3394 C  C     . GLU A 1 413 ? 38.084 126.239 36.055 1.00 76.27  ? 413 GLU A C     1 
ATOM   3395 O  O     . GLU A 1 413 ? 37.901 127.308 35.475 1.00 76.31  ? 413 GLU A O     1 
ATOM   3396 C  CB    . GLU A 1 413 ? 38.253 127.249 38.286 1.00 79.19  ? 413 GLU A CB    1 
ATOM   3397 C  CG    . GLU A 1 413 ? 38.729 127.244 39.725 1.00 81.17  ? 413 GLU A CG    1 
ATOM   3398 C  CD    . GLU A 1 413 ? 37.681 127.832 40.660 1.00 82.05  ? 413 GLU A CD    1 
ATOM   3399 O  OE1   . GLU A 1 413 ? 36.903 127.053 41.253 1.00 83.00  ? 413 GLU A OE1   1 
ATOM   3400 O  OE2   . GLU A 1 413 ? 37.628 129.074 40.793 1.00 82.32  ? 413 GLU A OE2   1 
ATOM   3401 N  N     . TRP A 1 414 ? 37.585 125.099 35.603 1.00 75.38  ? 414 TRP A N     1 
ATOM   3402 C  CA    . TRP A 1 414 ? 36.679 125.147 34.469 1.00 75.16  ? 414 TRP A CA    1 
ATOM   3403 C  C     . TRP A 1 414 ? 35.697 124.000 34.403 1.00 75.39  ? 414 TRP A C     1 
ATOM   3404 O  O     . TRP A 1 414 ? 36.074 122.837 34.435 1.00 75.74  ? 414 TRP A O     1 
ATOM   3405 C  CB    . TRP A 1 414 ? 37.471 125.209 33.171 1.00 74.57  ? 414 TRP A CB    1 
ATOM   3406 C  CG    . TRP A 1 414 ? 38.146 123.942 32.837 1.00 73.27  ? 414 TRP A CG    1 
ATOM   3407 C  CD1   . TRP A 1 414 ? 39.395 123.553 33.213 1.00 74.11  ? 414 TRP A CD1   1 
ATOM   3408 C  CD2   . TRP A 1 414 ? 37.624 122.897 32.029 1.00 72.11  ? 414 TRP A CD2   1 
ATOM   3409 N  NE1   . TRP A 1 414 ? 39.685 122.319 32.687 1.00 73.32  ? 414 TRP A NE1   1 
ATOM   3410 C  CE2   . TRP A 1 414 ? 38.607 121.892 31.958 1.00 71.76  ? 414 TRP A CE2   1 
ATOM   3411 C  CE3   . TRP A 1 414 ? 36.413 122.701 31.370 1.00 70.41  ? 414 TRP A CE3   1 
ATOM   3412 C  CZ2   . TRP A 1 414 ? 38.428 120.730 31.244 1.00 71.02  ? 414 TRP A CZ2   1 
ATOM   3413 C  CZ3   . TRP A 1 414 ? 36.236 121.551 30.669 1.00 70.52  ? 414 TRP A CZ3   1 
ATOM   3414 C  CH2   . TRP A 1 414 ? 37.233 120.572 30.614 1.00 70.71  ? 414 TRP A CH2   1 
ATOM   3415 N  N     . GLU A 1 415 ? 34.426 124.349 34.293 1.00 76.10  ? 415 GLU A N     1 
ATOM   3416 C  CA    . GLU A 1 415 ? 33.367 123.370 34.180 1.00 77.30  ? 415 GLU A CA    1 
ATOM   3417 C  C     . GLU A 1 415 ? 33.183 122.954 32.735 1.00 77.14  ? 415 GLU A C     1 
ATOM   3418 O  O     . GLU A 1 415 ? 33.238 123.781 31.830 1.00 76.86  ? 415 GLU A O     1 
ATOM   3419 C  CB    . GLU A 1 415 ? 32.066 123.961 34.715 1.00 79.92  ? 415 GLU A CB    1 
ATOM   3420 C  CG    . GLU A 1 415 ? 30.836 123.581 33.906 1.00 83.49  ? 415 GLU A CG    1 
ATOM   3421 C  CD    . GLU A 1 415 ? 29.543 124.104 34.519 1.00 85.04  ? 415 GLU A CD    1 
ATOM   3422 O  OE1   . GLU A 1 415 ? 29.619 124.893 35.489 1.00 85.98  ? 415 GLU A OE1   1 
ATOM   3423 O  OE2   . GLU A 1 415 ? 28.454 123.722 34.029 1.00 84.90  ? 415 GLU A OE2   1 
ATOM   3424 N  N     . PHE A 1 416 ? 32.962 121.665 32.515 1.00 78.61  ? 416 PHE A N     1 
ATOM   3425 C  CA    . PHE A 1 416 ? 32.680 121.188 31.170 1.00 79.16  ? 416 PHE A CA    1 
ATOM   3426 C  C     . PHE A 1 416 ? 31.400 121.848 30.708 1.00 79.18  ? 416 PHE A C     1 
ATOM   3427 O  O     . PHE A 1 416 ? 30.484 122.072 31.495 1.00 79.54  ? 416 PHE A O     1 
ATOM   3428 C  CB    . PHE A 1 416 ? 32.508 119.667 31.146 1.00 79.01  ? 416 PHE A CB    1 
ATOM   3429 C  CG    . PHE A 1 416 ? 32.090 119.127 29.805 1.00 79.31  ? 416 PHE A CG    1 
ATOM   3430 C  CD1   . PHE A 1 416 ? 32.695 119.571 28.641 1.00 79.54  ? 416 PHE A CD1   1 
ATOM   3431 C  CD2   . PHE A 1 416 ? 31.091 118.176 29.705 1.00 78.86  ? 416 PHE A CD2   1 
ATOM   3432 C  CE1   . PHE A 1 416 ? 32.304 119.071 27.399 1.00 79.37  ? 416 PHE A CE1   1 
ATOM   3433 C  CE2   . PHE A 1 416 ? 30.701 117.677 28.465 1.00 78.23  ? 416 PHE A CE2   1 
ATOM   3434 C  CZ    . PHE A 1 416 ? 31.307 118.125 27.316 1.00 77.36  ? 416 PHE A CZ    1 
ATOM   3435 N  N     . VAL A 1 417 ? 31.343 122.174 29.431 1.00 78.52  ? 417 VAL A N     1 
ATOM   3436 C  CA    . VAL A 1 417 ? 30.112 122.654 28.851 1.00 79.25  ? 417 VAL A CA    1 
ATOM   3437 C  C     . VAL A 1 417 ? 29.848 121.912 27.557 1.00 80.16  ? 417 VAL A C     1 
ATOM   3438 O  O     . VAL A 1 417 ? 30.689 121.889 26.660 1.00 80.95  ? 417 VAL A O     1 
ATOM   3439 C  CB    . VAL A 1 417 ? 30.180 124.167 28.586 1.00 79.39  ? 417 VAL A CB    1 
ATOM   3440 C  CG1   . VAL A 1 417 ? 29.085 124.578 27.621 1.00 79.53  ? 417 VAL A CG1   1 
ATOM   3441 C  CG2   . VAL A 1 417 ? 30.020 124.919 29.893 1.00 78.30  ? 417 VAL A CG2   1 
ATOM   3442 N  N     . ASN A 1 418 ? 28.680 121.288 27.462 1.00 80.88  ? 418 ASN A N     1 
ATOM   3443 C  CA    . ASN A 1 418 ? 28.351 120.530 26.268 1.00 80.79  ? 418 ASN A CA    1 
ATOM   3444 C  C     . ASN A 1 418 ? 27.727 121.436 25.221 1.00 80.60  ? 418 ASN A C     1 
ATOM   3445 O  O     . ASN A 1 418 ? 26.632 121.192 24.732 1.00 79.97  ? 418 ASN A O     1 
ATOM   3446 C  CB    . ASN A 1 418 ? 27.406 119.384 26.607 1.00 80.06  ? 418 ASN A CB    1 
ATOM   3447 C  CG    . ASN A 1 418 ? 27.123 118.507 25.417 1.00 79.26  ? 418 ASN A CG    1 
ATOM   3448 O  OD1   . ASN A 1 418 ? 27.791 118.604 24.383 1.00 78.05  ? 418 ASN A OD1   1 
ATOM   3449 N  ND2   . ASN A 1 418 ? 26.125 117.644 25.548 1.00 79.35  ? 418 ASN A ND2   1 
ATOM   3450 N  N     . THR A 1 419 ? 28.446 122.494 24.889 1.00 81.72  ? 419 THR A N     1 
ATOM   3451 C  CA    . THR A 1 419 ? 28.038 123.391 23.827 1.00 83.50  ? 419 THR A CA    1 
ATOM   3452 C  C     . THR A 1 419 ? 28.749 123.014 22.522 1.00 82.93  ? 419 THR A C     1 
ATOM   3453 O  O     . THR A 1 419 ? 29.655 123.712 22.063 1.00 83.61  ? 419 THR A O     1 
ATOM   3454 C  CB    . THR A 1 419 ? 28.354 124.869 24.217 1.00 85.17  ? 419 THR A CB    1 
ATOM   3455 O  OG1   . THR A 1 419 ? 28.033 125.731 23.119 1.00 88.07  ? 419 THR A OG1   1 
ATOM   3456 C  CG2   . THR A 1 419 ? 29.829 125.045 24.594 1.00 84.74  ? 419 THR A CG2   1 
ATOM   3457 N  N     . PRO A 1 420 ? 28.339 121.898 21.904 1.00 82.01  ? 420 PRO A N     1 
ATOM   3458 C  CA    . PRO A 1 420 ? 29.075 121.370 20.750 1.00 80.93  ? 420 PRO A CA    1 
ATOM   3459 C  C     . PRO A 1 420 ? 29.126 122.360 19.595 1.00 79.53  ? 420 PRO A C     1 
ATOM   3460 O  O     . PRO A 1 420 ? 28.222 123.174 19.430 1.00 78.56  ? 420 PRO A O     1 
ATOM   3461 C  CB    . PRO A 1 420 ? 28.313 120.097 20.387 1.00 81.81  ? 420 PRO A CB    1 
ATOM   3462 C  CG    . PRO A 1 420 ? 26.931 120.321 20.915 1.00 82.27  ? 420 PRO A CG    1 
ATOM   3463 C  CD    . PRO A 1 420 ? 27.090 121.159 22.154 1.00 81.96  ? 420 PRO A CD    1 
ATOM   3464 N  N     . PRO A 1 421 ? 30.184 122.294 18.770 1.00 79.13  ? 421 PRO A N     1 
ATOM   3465 C  CA    . PRO A 1 421 ? 31.227 121.258 18.771 1.00 78.84  ? 421 PRO A CA    1 
ATOM   3466 C  C     . PRO A 1 421 ? 32.100 121.254 20.019 1.00 78.45  ? 421 PRO A C     1 
ATOM   3467 O  O     . PRO A 1 421 ? 32.385 122.305 20.585 1.00 79.49  ? 421 PRO A O     1 
ATOM   3468 C  CB    . PRO A 1 421 ? 32.042 121.569 17.520 1.00 78.32  ? 421 PRO A CB    1 
ATOM   3469 C  CG    . PRO A 1 421 ? 31.847 123.021 17.297 1.00 78.18  ? 421 PRO A CG    1 
ATOM   3470 C  CD    . PRO A 1 421 ? 30.448 123.328 17.755 1.00 78.87  ? 421 PRO A CD    1 
ATOM   3471 N  N     . LEU A 1 422 ? 32.519 120.068 20.445 1.00 77.82  ? 422 LEU A N     1 
ATOM   3472 C  CA    . LEU A 1 422 ? 33.486 119.953 21.528 1.00 77.50  ? 422 LEU A CA    1 
ATOM   3473 C  C     . LEU A 1 422 ? 34.903 119.875 20.963 1.00 78.42  ? 422 LEU A C     1 
ATOM   3474 O  O     . LEU A 1 422 ? 35.116 119.424 19.826 1.00 79.33  ? 422 LEU A O     1 
ATOM   3475 C  CB    . LEU A 1 422 ? 33.203 118.712 22.379 1.00 75.35  ? 422 LEU A CB    1 
ATOM   3476 C  CG    . LEU A 1 422 ? 31.824 118.601 23.028 1.00 74.83  ? 422 LEU A CG    1 
ATOM   3477 C  CD1   . LEU A 1 422 ? 31.926 117.678 24.230 1.00 73.10  ? 422 LEU A CD1   1 
ATOM   3478 C  CD2   . LEU A 1 422 ? 31.323 119.974 23.459 1.00 74.65  ? 422 LEU A CD2   1 
ATOM   3479 N  N     . VAL A 1 423 ? 35.873 120.326 21.755 1.00 77.71  ? 423 VAL A N     1 
ATOM   3480 C  CA    . VAL A 1 423 ? 37.261 120.304 21.322 1.00 76.77  ? 423 VAL A CA    1 
ATOM   3481 C  C     . VAL A 1 423 ? 37.799 118.892 21.493 1.00 75.98  ? 423 VAL A C     1 
ATOM   3482 O  O     . VAL A 1 423 ? 37.812 118.355 22.598 1.00 76.16  ? 423 VAL A O     1 
ATOM   3483 C  CB    . VAL A 1 423 ? 38.128 121.280 22.151 1.00 77.58  ? 423 VAL A CB    1 
ATOM   3484 C  CG1   . VAL A 1 423 ? 39.558 121.276 21.629 1.00 77.06  ? 423 VAL A CG1   1 
ATOM   3485 C  CG2   . VAL A 1 423 ? 37.546 122.687 22.082 1.00 78.56  ? 423 VAL A CG2   1 
ATOM   3486 N  N     . LYS A 1 424 ? 38.235 118.295 20.389 1.00 75.08  ? 424 LYS A N     1 
ATOM   3487 C  CA    . LYS A 1 424 ? 38.737 116.929 20.400 1.00 73.55  ? 424 LYS A CA    1 
ATOM   3488 C  C     . LYS A 1 424 ? 40.128 116.874 19.781 1.00 71.97  ? 424 LYS A C     1 
ATOM   3489 O  O     . LYS A 1 424 ? 40.477 117.696 18.931 1.00 71.74  ? 424 LYS A O     1 
ATOM   3490 C  CB    . LYS A 1 424 ? 37.801 116.023 19.600 1.00 74.50  ? 424 LYS A CB    1 
ATOM   3491 C  CG    . LYS A 1 424 ? 37.870 116.265 18.091 1.00 76.05  ? 424 LYS A CG    1 
ATOM   3492 C  CD    . LYS A 1 424 ? 36.817 115.468 17.340 1.00 77.54  ? 424 LYS A CD    1 
ATOM   3493 C  CE    . LYS A 1 424 ? 35.459 115.503 18.062 1.00 79.32  ? 424 LYS A CE    1 
ATOM   3494 N  NZ    . LYS A 1 424 ? 34.721 116.801 17.932 1.00 77.57  ? 424 LYS A NZ    1 
ATOM   3495 N  N     . LEU A 1 425 ? 40.915 115.894 20.208 1.00 69.76  ? 425 LEU A N     1 
ATOM   3496 C  CA    . LEU A 1 425 ? 42.164 115.571 19.535 1.00 67.16  ? 425 LEU A CA    1 
ATOM   3497 C  C     . LEU A 1 425 ? 41.873 114.648 18.365 1.00 65.96  ? 425 LEU A C     1 
ATOM   3498 O  O     . LEU A 1 425 ? 41.337 113.561 18.543 1.00 66.53  ? 425 LEU A O     1 
ATOM   3499 C  CB    . LEU A 1 425 ? 43.111 114.891 20.515 1.00 66.08  ? 425 LEU A CB    1 
ATOM   3500 C  CG    . LEU A 1 425 ? 43.750 115.857 21.503 1.00 64.70  ? 425 LEU A CG    1 
ATOM   3501 C  CD1   . LEU A 1 425 ? 44.247 115.106 22.720 1.00 64.32  ? 425 LEU A CD1   1 
ATOM   3502 C  CD2   . LEU A 1 425 ? 44.876 116.599 20.801 1.00 63.34  ? 425 LEU A CD2   1 
ATOM   3503 N  N     . TRP A 1 426 ? 42.232 115.078 17.166 1.00 65.31  ? 426 TRP A N     1 
ATOM   3504 C  CA    . TRP A 1 426 ? 41.771 114.408 15.962 1.00 66.30  ? 426 TRP A CA    1 
ATOM   3505 C  C     . TRP A 1 426 ? 42.388 113.033 15.755 1.00 65.59  ? 426 TRP A C     1 
ATOM   3506 O  O     . TRP A 1 426 ? 41.779 112.157 15.153 1.00 66.08  ? 426 TRP A O     1 
ATOM   3507 C  CB    . TRP A 1 426 ? 42.036 115.291 14.746 1.00 69.81  ? 426 TRP A CB    1 
ATOM   3508 C  CG    . TRP A 1 426 ? 41.027 116.366 14.602 1.00 74.38  ? 426 TRP A CG    1 
ATOM   3509 C  CD1   . TRP A 1 426 ? 41.099 117.637 15.100 1.00 76.16  ? 426 TRP A CD1   1 
ATOM   3510 C  CD2   . TRP A 1 426 ? 39.763 116.266 13.937 1.00 78.24  ? 426 TRP A CD2   1 
ATOM   3511 N  NE1   . TRP A 1 426 ? 39.954 118.333 14.787 1.00 78.32  ? 426 TRP A NE1   1 
ATOM   3512 C  CE2   . TRP A 1 426 ? 39.119 117.512 14.071 1.00 79.83  ? 426 TRP A CE2   1 
ATOM   3513 C  CE3   . TRP A 1 426 ? 39.112 115.239 13.239 1.00 79.55  ? 426 TRP A CE3   1 
ATOM   3514 C  CZ2   . TRP A 1 426 ? 37.851 117.760 13.530 1.00 81.11  ? 426 TRP A CZ2   1 
ATOM   3515 C  CZ3   . TRP A 1 426 ? 37.853 115.489 12.703 1.00 80.43  ? 426 TRP A CZ3   1 
ATOM   3516 C  CH2   . TRP A 1 426 ? 37.238 116.738 12.851 1.00 80.18  ? 426 TRP A CH2   1 
ATOM   3517 N  N     . TYR A 1 427 ? 43.604 112.845 16.247 1.00 64.68  ? 427 TYR A N     1 
ATOM   3518 C  CA    . TYR A 1 427 ? 44.221 111.529 16.246 1.00 62.89  ? 427 TYR A CA    1 
ATOM   3519 C  C     . TYR A 1 427 ? 45.122 111.413 17.450 1.00 62.33  ? 427 TYR A C     1 
ATOM   3520 O  O     . TYR A 1 427 ? 45.410 112.401 18.115 1.00 61.14  ? 427 TYR A O     1 
ATOM   3521 C  CB    . TYR A 1 427 ? 45.031 111.319 14.976 1.00 62.97  ? 427 TYR A CB    1 
ATOM   3522 C  CG    . TYR A 1 427 ? 46.079 112.364 14.781 1.00 63.00  ? 427 TYR A CG    1 
ATOM   3523 C  CD1   . TYR A 1 427 ? 45.791 113.537 14.101 1.00 63.42  ? 427 TYR A CD1   1 
ATOM   3524 C  CD2   . TYR A 1 427 ? 47.345 112.210 15.323 1.00 63.56  ? 427 TYR A CD2   1 
ATOM   3525 C  CE1   . TYR A 1 427 ? 46.731 114.528 13.976 1.00 63.28  ? 427 TYR A CE1   1 
ATOM   3526 C  CE2   . TYR A 1 427 ? 48.296 113.198 15.201 1.00 63.12  ? 427 TYR A CE2   1 
ATOM   3527 C  CZ    . TYR A 1 427 ? 47.981 114.355 14.531 1.00 62.30  ? 427 TYR A CZ    1 
ATOM   3528 O  OH    . TYR A 1 427 ? 48.910 115.355 14.445 1.00 62.76  ? 427 TYR A OH    1 
ATOM   3529 N  N     . GLN A 1 428 ? 45.558 110.202 17.745 1.00 63.00  ? 428 GLN A N     1 
ATOM   3530 C  CA    . GLN A 1 428 ? 46.488 110.028 18.836 1.00 64.59  ? 428 GLN A CA    1 
ATOM   3531 C  C     . GLN A 1 428 ? 47.599 109.086 18.433 1.00 63.94  ? 428 GLN A C     1 
ATOM   3532 O  O     . GLN A 1 428 ? 47.367 108.071 17.767 1.00 63.96  ? 428 GLN A O     1 
ATOM   3533 C  CB    . GLN A 1 428 ? 45.763 109.495 20.069 1.00 66.97  ? 428 GLN A CB    1 
ATOM   3534 C  CG    . GLN A 1 428 ? 46.582 109.562 21.342 1.00 71.31  ? 428 GLN A CG    1 
ATOM   3535 C  CD    . GLN A 1 428 ? 45.728 109.865 22.562 1.00 73.87  ? 428 GLN A CD    1 
ATOM   3536 O  OE1   . GLN A 1 428 ? 44.714 110.557 22.465 1.00 74.07  ? 428 GLN A OE1   1 
ATOM   3537 N  NE2   . GLN A 1 428 ? 46.135 109.347 23.721 1.00 75.00  ? 428 GLN A NE2   1 
ATOM   3538 N  N     . LEU A 1 429 ? 48.814 109.441 18.830 1.00 63.01  ? 429 LEU A N     1 
ATOM   3539 C  CA    . LEU A 1 429 ? 49.964 108.581 18.616 1.00 62.34  ? 429 LEU A CA    1 
ATOM   3540 C  C     . LEU A 1 429 ? 50.012 107.518 19.700 1.00 61.70  ? 429 LEU A C     1 
ATOM   3541 O  O     . LEU A 1 429 ? 49.672 107.778 20.853 1.00 61.19  ? 429 LEU A O     1 
ATOM   3542 C  CB    . LEU A 1 429 ? 51.244 109.403 18.661 1.00 61.70  ? 429 LEU A CB    1 
ATOM   3543 C  CG    . LEU A 1 429 ? 51.235 110.646 17.784 1.00 61.48  ? 429 LEU A CG    1 
ATOM   3544 C  CD1   . LEU A 1 429 ? 52.390 111.517 18.201 1.00 62.56  ? 429 LEU A CD1   1 
ATOM   3545 C  CD2   . LEU A 1 429 ? 51.327 110.265 16.316 1.00 58.80  ? 429 LEU A CD2   1 
ATOM   3546 N  N     . GLU A 1 430 ? 50.427 106.316 19.326 1.00 61.76  ? 430 GLU A N     1 
ATOM   3547 C  CA    . GLU A 1 430 ? 50.611 105.271 20.315 1.00 62.25  ? 430 GLU A CA    1 
ATOM   3548 C  C     . GLU A 1 430 ? 51.783 105.666 21.197 1.00 62.48  ? 430 GLU A C     1 
ATOM   3549 O  O     . GLU A 1 430 ? 52.619 106.484 20.814 1.00 62.40  ? 430 GLU A O     1 
ATOM   3550 C  CB    . GLU A 1 430 ? 50.884 103.927 19.635 1.00 61.56  ? 430 GLU A CB    1 
ATOM   3551 C  CG    . GLU A 1 430 ? 49.767 103.467 18.721 1.00 60.20  ? 430 GLU A CG    1 
ATOM   3552 C  CD    . GLU A 1 430 ? 48.410 103.507 19.395 1.00 59.76  ? 430 GLU A CD    1 
ATOM   3553 O  OE1   . GLU A 1 430 ? 47.690 104.511 19.223 1.00 61.66  ? 430 GLU A OE1   1 
ATOM   3554 O  OE2   . GLU A 1 430 ? 48.056 102.539 20.095 1.00 57.37  ? 430 GLU A OE2   1 
ATOM   3555 N  N     . LYS A 1 431 ? 51.835 105.088 22.386 1.00 63.36  ? 431 LYS A N     1 
ATOM   3556 C  CA    . LYS A 1 431 ? 52.909 105.378 23.312 1.00 63.83  ? 431 LYS A CA    1 
ATOM   3557 C  C     . LYS A 1 431 ? 53.938 104.251 23.254 1.00 63.22  ? 431 LYS A C     1 
ATOM   3558 O  O     . LYS A 1 431 ? 55.125 104.455 23.519 1.00 62.61  ? 431 LYS A O     1 
ATOM   3559 C  CB    . LYS A 1 431 ? 52.318 105.546 24.709 1.00 65.88  ? 431 LYS A CB    1 
ATOM   3560 C  CG    . LYS A 1 431 ? 51.252 106.648 24.753 1.00 69.59  ? 431 LYS A CG    1 
ATOM   3561 C  CD    . LYS A 1 431 ? 50.536 106.724 26.099 1.00 74.42  ? 431 LYS A CD    1 
ATOM   3562 C  CE    . LYS A 1 431 ? 49.220 107.517 26.001 1.00 78.17  ? 431 LYS A CE    1 
ATOM   3563 N  NZ    . LYS A 1 431 ? 48.136 107.014 26.930 1.00 78.42  ? 431 LYS A NZ    1 
ATOM   3564 N  N     . GLU A 1 432 ? 53.467 103.066 22.873 1.00 62.68  ? 432 GLU A N     1 
ATOM   3565 C  CA    . GLU A 1 432 ? 54.332 101.917 22.602 1.00 61.66  ? 432 GLU A CA    1 
ATOM   3566 C  C     . GLU A 1 432 ? 54.071 101.322 21.202 1.00 58.53  ? 432 GLU A C     1 
ATOM   3567 O  O     . GLU A 1 432 ? 52.958 101.407 20.670 1.00 58.11  ? 432 GLU A O     1 
ATOM   3568 C  CB    . GLU A 1 432 ? 54.118 100.850 23.684 1.00 65.08  ? 432 GLU A CB    1 
ATOM   3569 C  CG    . GLU A 1 432 ? 54.743 101.199 25.035 1.00 71.86  ? 432 GLU A CG    1 
ATOM   3570 C  CD    . GLU A 1 432 ? 56.280 101.136 25.022 1.00 77.69  ? 432 GLU A CD    1 
ATOM   3571 O  OE1   . GLU A 1 432 ? 56.834 100.059 25.364 1.00 78.36  ? 432 GLU A OE1   1 
ATOM   3572 O  OE2   . GLU A 1 432 ? 56.935 102.158 24.674 1.00 79.37  ? 432 GLU A OE2   1 
ATOM   3573 N  N     . PRO A 1 433 ? 55.097 100.703 20.593 1.00 54.83  ? 433 PRO A N     1 
ATOM   3574 C  CA    . PRO A 1 433 ? 55.017 100.231 19.205 1.00 51.44  ? 433 PRO A CA    1 
ATOM   3575 C  C     . PRO A 1 433 ? 53.880 99.244  18.947 1.00 47.81  ? 433 PRO A C     1 
ATOM   3576 O  O     . PRO A 1 433 ? 53.446 98.538  19.848 1.00 46.86  ? 433 PRO A O     1 
ATOM   3577 C  CB    . PRO A 1 433 ? 56.393 99.615  18.957 1.00 51.56  ? 433 PRO A CB    1 
ATOM   3578 C  CG    . PRO A 1 433 ? 56.896 99.266  20.286 1.00 51.64  ? 433 PRO A CG    1 
ATOM   3579 C  CD    . PRO A 1 433 ? 56.364 100.307 21.224 1.00 53.39  ? 433 PRO A CD    1 
ATOM   3580 N  N     . ILE A 1 434 ? 53.400 99.201  17.712 1.00 44.13  ? 434 ILE A N     1 
ATOM   3581 C  CA    . ILE A 1 434 ? 52.195 98.441  17.404 1.00 43.13  ? 434 ILE A CA    1 
ATOM   3582 C  C     . ILE A 1 434 ? 52.517 96.999  17.037 1.00 45.47  ? 434 ILE A C     1 
ATOM   3583 O  O     . ILE A 1 434 ? 53.000 96.746  15.942 1.00 47.82  ? 434 ILE A O     1 
ATOM   3584 C  CB    . ILE A 1 434 ? 51.439 99.053  16.214 1.00 38.98  ? 434 ILE A CB    1 
ATOM   3585 C  CG1   . ILE A 1 434 ? 51.265 100.550 16.421 1.00 35.75  ? 434 ILE A CG1   1 
ATOM   3586 C  CG2   . ILE A 1 434 ? 50.089 98.387  16.068 1.00 35.03  ? 434 ILE A CG2   1 
ATOM   3587 C  CD1   . ILE A 1 434 ? 50.860 101.271 15.190 1.00 35.33  ? 434 ILE A CD1   1 
ATOM   3588 N  N     . VAL A 1 435 ? 52.231 96.047  17.919 1.00 45.61  ? 435 VAL A N     1 
ATOM   3589 C  CA    . VAL A 1 435 ? 52.581 94.657  17.637 1.00 46.05  ? 435 VAL A CA    1 
ATOM   3590 C  C     . VAL A 1 435 ? 52.197 94.191  16.230 1.00 46.26  ? 435 VAL A C     1 
ATOM   3591 O  O     . VAL A 1 435 ? 51.056 94.338  15.817 1.00 47.04  ? 435 VAL A O     1 
ATOM   3592 C  CB    . VAL A 1 435 ? 51.926 93.710  18.646 1.00 46.43  ? 435 VAL A CB    1 
ATOM   3593 C  CG1   . VAL A 1 435 ? 51.948 92.295  18.105 1.00 47.68  ? 435 VAL A CG1   1 
ATOM   3594 C  CG2   . VAL A 1 435 ? 52.668 93.761  19.961 1.00 45.30  ? 435 VAL A CG2   1 
ATOM   3595 N  N     . GLY A 1 436 ? 53.155 93.628  15.495 1.00 48.11  ? 436 GLY A N     1 
ATOM   3596 C  CA    . GLY A 1 436 ? 52.838 92.951  14.241 1.00 48.84  ? 436 GLY A CA    1 
ATOM   3597 C  C     . GLY A 1 436 ? 52.436 93.805  13.039 1.00 48.42  ? 436 GLY A C     1 
ATOM   3598 O  O     . GLY A 1 436 ? 52.142 93.279  11.956 1.00 49.97  ? 436 GLY A O     1 
ATOM   3599 N  N     . ALA A 1 437 ? 52.419 95.120  13.216 1.00 46.96  ? 437 ALA A N     1 
ATOM   3600 C  CA    . ALA A 1 437 ? 52.116 96.030  12.124 1.00 45.18  ? 437 ALA A CA    1 
ATOM   3601 C  C     . ALA A 1 437 ? 53.370 96.321  11.332 1.00 44.81  ? 437 ALA A C     1 
ATOM   3602 O  O     . ALA A 1 437 ? 54.483 96.158  11.828 1.00 43.91  ? 437 ALA A O     1 
ATOM   3603 C  CB    . ALA A 1 437 ? 51.553 97.310  12.666 1.00 45.68  ? 437 ALA A CB    1 
ATOM   3604 N  N     . GLU A 1 438 ? 53.193 96.764  10.097 1.00 44.30  ? 438 GLU A N     1 
ATOM   3605 C  CA    . GLU A 1 438 ? 54.341 97.013  9.256  1.00 46.08  ? 438 GLU A CA    1 
ATOM   3606 C  C     . GLU A 1 438 ? 55.161 98.168  9.800  1.00 48.02  ? 438 GLU A C     1 
ATOM   3607 O  O     . GLU A 1 438 ? 54.600 99.172  10.234 1.00 48.84  ? 438 GLU A O     1 
ATOM   3608 C  CB    . GLU A 1 438 ? 53.902 97.320  7.832  1.00 46.88  ? 438 GLU A CB    1 
ATOM   3609 C  CG    . GLU A 1 438 ? 55.068 97.471  6.880  1.00 46.95  ? 438 GLU A CG    1 
ATOM   3610 C  CD    . GLU A 1 438 ? 54.677 97.284  5.434  1.00 47.46  ? 438 GLU A CD    1 
ATOM   3611 O  OE1   . GLU A 1 438 ? 55.559 96.895  4.642  1.00 43.61  ? 438 GLU A OE1   1 
ATOM   3612 O  OE2   . GLU A 1 438 ? 53.499 97.529  5.095  1.00 48.18  ? 438 GLU A OE2   1 
ATOM   3613 N  N     . THR A 1 439 ? 56.488 98.013  9.772  1.00 48.68  ? 439 THR A N     1 
ATOM   3614 C  CA    . THR A 1 439 ? 57.431 98.997  10.322 1.00 48.24  ? 439 THR A CA    1 
ATOM   3615 C  C     . THR A 1 439 ? 58.222 99.683  9.191  1.00 49.28  ? 439 THR A C     1 
ATOM   3616 O  O     . THR A 1 439 ? 59.048 99.048  8.526  1.00 51.09  ? 439 THR A O     1 
ATOM   3617 C  CB    . THR A 1 439 ? 58.441 98.313  11.306 1.00 47.41  ? 439 THR A CB    1 
ATOM   3618 O  OG1   . THR A 1 439 ? 57.738 97.743  12.416 1.00 46.60  ? 439 THR A OG1   1 
ATOM   3619 C  CG2   . THR A 1 439 ? 59.455 99.313  11.822 1.00 45.86  ? 439 THR A CG2   1 
ATOM   3620 N  N     . PHE A 1 440 ? 57.962 100.972 8.977  1.00 47.53  ? 440 PHE A N     1 
ATOM   3621 C  CA    . PHE A 1 440 ? 58.666 101.750 7.961  1.00 46.52  ? 440 PHE A CA    1 
ATOM   3622 C  C     . PHE A 1 440 ? 59.845 102.472 8.573  1.00 47.61  ? 440 PHE A C     1 
ATOM   3623 O  O     . PHE A 1 440 ? 59.677 103.340 9.424  1.00 47.95  ? 440 PHE A O     1 
ATOM   3624 C  CB    . PHE A 1 440 ? 57.743 102.793 7.330  1.00 44.67  ? 440 PHE A CB    1 
ATOM   3625 C  CG    . PHE A 1 440 ? 56.715 102.219 6.417  1.00 43.18  ? 440 PHE A CG    1 
ATOM   3626 C  CD1   . PHE A 1 440 ? 55.708 101.415 6.914  1.00 43.70  ? 440 PHE A CD1   1 
ATOM   3627 C  CD2   . PHE A 1 440 ? 56.767 102.461 5.057  1.00 43.17  ? 440 PHE A CD2   1 
ATOM   3628 C  CE1   . PHE A 1 440 ? 54.767 100.863 6.080  1.00 43.63  ? 440 PHE A CE1   1 
ATOM   3629 C  CE2   . PHE A 1 440 ? 55.823 101.910 4.204  1.00 42.96  ? 440 PHE A CE2   1 
ATOM   3630 C  CZ    . PHE A 1 440 ? 54.826 101.108 4.715  1.00 44.23  ? 440 PHE A CZ    1 
ATOM   3631 N  N     . TYR A 1 441 ? 61.042 102.110 8.139  1.00 49.17  ? 441 TYR A N     1 
ATOM   3632 C  CA    . TYR A 1 441 ? 62.216 102.929 8.384  1.00 48.50  ? 441 TYR A CA    1 
ATOM   3633 C  C     . TYR A 1 441 ? 62.285 103.948 7.254  1.00 49.10  ? 441 TYR A C     1 
ATOM   3634 O  O     . TYR A 1 441 ? 62.578 103.606 6.117  1.00 49.97  ? 441 TYR A O     1 
ATOM   3635 C  CB    . TYR A 1 441 ? 63.468 102.052 8.400  1.00 47.38  ? 441 TYR A CB    1 
ATOM   3636 C  CG    . TYR A 1 441 ? 63.528 101.148 9.602  1.00 48.45  ? 441 TYR A CG    1 
ATOM   3637 C  CD1   . TYR A 1 441 ? 62.824 99.943  9.629  1.00 50.33  ? 441 TYR A CD1   1 
ATOM   3638 C  CD2   . TYR A 1 441 ? 64.229 101.524 10.739 1.00 48.94  ? 441 TYR A CD2   1 
ATOM   3639 C  CE1   . TYR A 1 441 ? 62.807 99.145  10.762 1.00 49.75  ? 441 TYR A CE1   1 
ATOM   3640 C  CE2   . TYR A 1 441 ? 64.222 100.737 11.875 1.00 50.01  ? 441 TYR A CE2   1 
ATOM   3641 C  CZ    . TYR A 1 441 ? 63.505 99.551  11.882 1.00 50.30  ? 441 TYR A CZ    1 
ATOM   3642 O  OH    . TYR A 1 441 ? 63.454 98.796  13.022 1.00 49.99  ? 441 TYR A OH    1 
ATOM   3643 N  N     . VAL A 1 442 ? 61.991 105.202 7.571  1.00 50.21  ? 442 VAL A N     1 
ATOM   3644 C  CA    . VAL A 1 442 ? 61.982 106.263 6.571  1.00 49.05  ? 442 VAL A CA    1 
ATOM   3645 C  C     . VAL A 1 442 ? 63.211 107.139 6.742  1.00 50.22  ? 442 VAL A C     1 
ATOM   3646 O  O     . VAL A 1 442 ? 63.750 107.274 7.842  1.00 51.89  ? 442 VAL A O     1 
ATOM   3647 C  CB    . VAL A 1 442 ? 60.748 107.154 6.722  1.00 46.27  ? 442 VAL A CB    1 
ATOM   3648 C  CG1   . VAL A 1 442 ? 59.498 106.311 6.736  1.00 44.60  ? 442 VAL A CG1   1 
ATOM   3649 C  CG2   . VAL A 1 442 ? 60.849 107.938 7.981  1.00 42.55  ? 442 VAL A CG2   1 
ATOM   3650 N  N     . ASP A 1 443 ? 63.664 107.723 5.648  1.00 50.15  ? 443 ASP A N     1 
ATOM   3651 C  CA    . ASP A 1 443 ? 64.527 108.876 5.748  1.00 52.26  ? 443 ASP A CA    1 
ATOM   3652 C  C     . ASP A 1 443 ? 64.477 109.683 4.472  1.00 51.53  ? 443 ASP A C     1 
ATOM   3653 O  O     . ASP A 1 443 ? 63.968 109.225 3.453  1.00 52.04  ? 443 ASP A O     1 
ATOM   3654 C  CB    . ASP A 1 443 ? 65.972 108.464 6.048  1.00 54.49  ? 443 ASP A CB    1 
ATOM   3655 C  CG    . ASP A 1 443 ? 66.718 109.529 6.844  1.00 56.61  ? 443 ASP A CG    1 
ATOM   3656 O  OD1   . ASP A 1 443 ? 67.940 109.713 6.628  1.00 52.88  ? 443 ASP A OD1   1 
ATOM   3657 O  OD2   . ASP A 1 443 ? 66.058 110.183 7.693  1.00 56.12  ? 443 ASP A OD2   1 
ATOM   3658 N  N     . GLY A 1 444 ? 65.003 110.894 4.544  1.00 51.30  ? 444 GLY A N     1 
ATOM   3659 C  CA    . GLY A 1 444 ? 65.136 111.713 3.359  1.00 53.40  ? 444 GLY A CA    1 
ATOM   3660 C  C     . GLY A 1 444 ? 66.474 112.409 3.370  1.00 54.42  ? 444 GLY A C     1 
ATOM   3661 O  O     . GLY A 1 444 ? 67.190 112.376 4.370  1.00 54.63  ? 444 GLY A O     1 
ATOM   3662 N  N     . ALA A 1 445 ? 66.818 113.046 2.262  1.00 56.51  ? 445 ALA A N     1 
ATOM   3663 C  CA    . ALA A 1 445 ? 68.137 113.638 2.136  1.00 59.88  ? 445 ALA A CA    1 
ATOM   3664 C  C     . ALA A 1 445 ? 68.214 114.670 1.015  1.00 62.11  ? 445 ALA A C     1 
ATOM   3665 O  O     . ALA A 1 445 ? 67.916 114.364 -0.144 1.00 62.07  ? 445 ALA A O     1 
ATOM   3666 C  CB    . ALA A 1 445 ? 69.159 112.542 1.908  1.00 60.00  ? 445 ALA A CB    1 
ATOM   3667 N  N     . ALA A 1 446 ? 68.635 115.884 1.369  1.00 64.18  ? 446 ALA A N     1 
ATOM   3668 C  CA    . ALA A 1 446 ? 68.744 116.980 0.412  1.00 66.47  ? 446 ALA A CA    1 
ATOM   3669 C  C     . ALA A 1 446 ? 70.199 117.320 0.069  1.00 68.27  ? 446 ALA A C     1 
ATOM   3670 O  O     . ALA A 1 446 ? 71.132 116.736 0.610  1.00 67.93  ? 446 ALA A O     1 
ATOM   3671 C  CB    . ALA A 1 446 ? 68.032 118.214 0.956  1.00 64.56  ? 446 ALA A CB    1 
ATOM   3672 N  N     . ASN A 1 447 ? 70.369 118.279 -0.836 1.00 71.30  ? 447 ASN A N     1 
ATOM   3673 C  CA    . ASN A 1 447 ? 71.668 118.631 -1.401 1.00 73.87  ? 447 ASN A CA    1 
ATOM   3674 C  C     . ASN A 1 447 ? 71.790 120.151 -1.425 1.00 76.01  ? 447 ASN A C     1 
ATOM   3675 O  O     . ASN A 1 447 ? 71.415 120.784 -2.411 1.00 75.97  ? 447 ASN A O     1 
ATOM   3676 C  CB    . ASN A 1 447 ? 71.749 118.092 -2.830 1.00 75.59  ? 447 ASN A CB    1 
ATOM   3677 C  CG    . ASN A 1 447 ? 73.110 118.283 -3.458 1.00 77.38  ? 447 ASN A CG    1 
ATOM   3678 O  OD1   . ASN A 1 447 ? 73.750 119.322 -3.281 1.00 78.02  ? 447 ASN A OD1   1 
ATOM   3679 N  ND2   . ASN A 1 447 ? 73.562 117.276 -4.205 1.00 76.97  ? 447 ASN A ND2   1 
ATOM   3680 N  N     . ARG A 1 448 ? 72.316 120.731 -0.347 1.00 78.44  ? 448 ARG A N     1 
ATOM   3681 C  CA    . ARG A 1 448 ? 72.272 122.186 -0.144 1.00 80.65  ? 448 ARG A CA    1 
ATOM   3682 C  C     . ARG A 1 448 ? 72.577 122.970 -1.415 1.00 81.17  ? 448 ARG A C     1 
ATOM   3683 O  O     . ARG A 1 448 ? 72.158 124.110 -1.567 1.00 80.49  ? 448 ARG A O     1 
ATOM   3684 C  CB    . ARG A 1 448 ? 73.260 122.605 0.949  1.00 81.53  ? 448 ARG A CB    1 
ATOM   3685 C  CG    . ARG A 1 448 ? 73.026 121.941 2.299  1.00 84.76  ? 448 ARG A CG    1 
ATOM   3686 C  CD    . ARG A 1 448 ? 72.598 122.959 3.356  1.00 87.21  ? 448 ARG A CD    1 
ATOM   3687 N  NE    . ARG A 1 448 ? 73.720 123.746 3.873  1.00 89.41  ? 448 ARG A NE    1 
ATOM   3688 C  CZ    . ARG A 1 448 ? 74.252 123.598 5.085  1.00 90.09  ? 448 ARG A CZ    1 
ATOM   3689 N  NH1   . ARG A 1 448 ? 73.770 122.685 5.926  1.00 90.56  ? 448 ARG A NH1   1 
ATOM   3690 N  NH2   . ARG A 1 448 ? 75.267 124.367 5.456  1.00 89.70  ? 448 ARG A NH2   1 
ATOM   3691 N  N     . GLU A 1 449 ? 73.317 122.344 -2.319 1.00 82.89  ? 449 GLU A N     1 
ATOM   3692 C  CA    . GLU A 1 449 ? 73.722 122.971 -3.567 1.00 84.94  ? 449 GLU A CA    1 
ATOM   3693 C  C     . GLU A 1 449 ? 72.570 123.032 -4.562 1.00 84.16  ? 449 GLU A C     1 
ATOM   3694 O  O     . GLU A 1 449 ? 72.049 124.104 -4.863 1.00 84.43  ? 449 GLU A O     1 
ATOM   3695 C  CB    . GLU A 1 449 ? 74.879 122.180 -4.178 1.00 88.44  ? 449 GLU A CB    1 
ATOM   3696 C  CG    . GLU A 1 449 ? 75.123 122.459 -5.654 1.00 92.09  ? 449 GLU A CG    1 
ATOM   3697 C  CD    . GLU A 1 449 ? 76.044 123.641 -5.874 1.00 94.42  ? 449 GLU A CD    1 
ATOM   3698 O  OE1   . GLU A 1 449 ? 76.369 124.336 -4.882 1.00 95.87  ? 449 GLU A OE1   1 
ATOM   3699 O  OE2   . GLU A 1 449 ? 76.441 123.872 -7.038 1.00 95.05  ? 449 GLU A OE2   1 
ATOM   3700 N  N     . THR A 1 450 ? 72.179 121.865 -5.061 1.00 83.10  ? 450 THR A N     1 
ATOM   3701 C  CA    . THR A 1 450 ? 71.199 121.757 -6.133 1.00 81.72  ? 450 THR A CA    1 
ATOM   3702 C  C     . THR A 1 450 ? 69.759 121.799 -5.618 1.00 80.07  ? 450 THR A C     1 
ATOM   3703 O  O     . THR A 1 450 ? 68.805 121.861 -6.399 1.00 79.11  ? 450 THR A O     1 
ATOM   3704 C  CB    . THR A 1 450 ? 71.418 120.450 -6.927 1.00 82.96  ? 450 THR A CB    1 
ATOM   3705 O  OG1   . THR A 1 450 ? 71.343 119.325 -6.038 1.00 84.08  ? 450 THR A OG1   1 
ATOM   3706 C  CG2   . THR A 1 450 ? 72.788 120.463 -7.601 1.00 82.82  ? 450 THR A CG2   1 
ATOM   3707 N  N     . LYS A 1 451 ? 69.608 121.763 -4.298 1.00 78.61  ? 451 LYS A N     1 
ATOM   3708 C  CA    . LYS A 1 451 ? 68.292 121.833 -3.686 1.00 76.62  ? 451 LYS A CA    1 
ATOM   3709 C  C     . LYS A 1 451 ? 67.507 120.573 -4.016 1.00 75.00  ? 451 LYS A C     1 
ATOM   3710 O  O     . LYS A 1 451 ? 66.324 120.471 -3.708 1.00 74.70  ? 451 LYS A O     1 
ATOM   3711 C  CB    . LYS A 1 451 ? 67.549 123.068 -4.200 1.00 77.70  ? 451 LYS A CB    1 
ATOM   3712 C  CG    . LYS A 1 451 ? 68.297 124.373 -3.947 1.00 77.69  ? 451 LYS A CG    1 
ATOM   3713 C  CD    . LYS A 1 451 ? 68.528 124.575 -2.463 1.00 78.20  ? 451 LYS A CD    1 
ATOM   3714 C  CE    . LYS A 1 451 ? 69.707 125.497 -2.181 1.00 78.81  ? 451 LYS A CE    1 
ATOM   3715 N  NZ    . LYS A 1 451 ? 70.108 125.459 -0.734 1.00 78.83  ? 451 LYS A NZ    1 
ATOM   3716 N  N     . LEU A 1 452 ? 68.183 119.619 -4.653 1.00 73.26  ? 452 LEU A N     1 
ATOM   3717 C  CA    . LEU A 1 452 ? 67.607 118.313 -4.967 1.00 71.27  ? 452 LEU A CA    1 
ATOM   3718 C  C     . LEU A 1 452 ? 67.731 117.360 -3.784 1.00 70.35  ? 452 LEU A C     1 
ATOM   3719 O  O     . LEU A 1 452 ? 68.778 117.292 -3.142 1.00 70.96  ? 452 LEU A O     1 
ATOM   3720 C  CB    . LEU A 1 452 ? 68.321 117.706 -6.172 1.00 71.60  ? 452 LEU A CB    1 
ATOM   3721 C  CG    . LEU A 1 452 ? 67.780 118.078 -7.553 1.00 72.47  ? 452 LEU A CG    1 
ATOM   3722 C  CD1   . LEU A 1 452 ? 67.590 119.583 -7.646 1.00 74.20  ? 452 LEU A CD1   1 
ATOM   3723 C  CD2   . LEU A 1 452 ? 68.732 117.578 -8.622 1.00 71.07  ? 452 LEU A CD2   1 
ATOM   3724 N  N     . GLY A 1 453 ? 66.664 116.622 -3.496 1.00 68.18  ? 453 GLY A N     1 
ATOM   3725 C  CA    . GLY A 1 453 ? 66.695 115.708 -2.371 1.00 64.52  ? 453 GLY A CA    1 
ATOM   3726 C  C     . GLY A 1 453 ? 66.078 114.372 -2.712 1.00 61.96  ? 453 GLY A C     1 
ATOM   3727 O  O     . GLY A 1 453 ? 65.514 114.222 -3.791 1.00 63.06  ? 453 GLY A O     1 
ATOM   3728 N  N     . LYS A 1 454 ? 66.195 113.404 -1.804 1.00 58.91  ? 454 LYS A N     1 
ATOM   3729 C  CA    . LYS A 1 454 ? 65.441 112.154 -1.898 1.00 56.25  ? 454 LYS A CA    1 
ATOM   3730 C  C     . LYS A 1 454 ? 64.730 111.800 -0.586 1.00 54.61  ? 454 LYS A C     1 
ATOM   3731 O  O     . LYS A 1 454 ? 65.244 112.053 0.501  1.00 55.54  ? 454 LYS A O     1 
ATOM   3732 C  CB    . LYS A 1 454 ? 66.365 111.002 -2.309 1.00 55.99  ? 454 LYS A CB    1 
ATOM   3733 C  CG    . LYS A 1 454 ? 66.738 110.989 -3.782 1.00 54.95  ? 454 LYS A CG    1 
ATOM   3734 C  CD    . LYS A 1 454 ? 67.750 109.902 -4.067 1.00 56.26  ? 454 LYS A CD    1 
ATOM   3735 C  CE    . LYS A 1 454 ? 67.833 109.566 -5.558 1.00 56.82  ? 454 LYS A CE    1 
ATOM   3736 N  NZ    . LYS A 1 454 ? 68.327 108.160 -5.796 1.00 56.70  ? 454 LYS A NZ    1 
ATOM   3737 N  N     . ALA A 1 455 ? 63.537 111.231 -0.693 1.00 52.08  ? 455 ALA A N     1 
ATOM   3738 C  CA    . ALA A 1 455 ? 62.816 110.738 0.474  1.00 50.21  ? 455 ALA A CA    1 
ATOM   3739 C  C     . ALA A 1 455 ? 62.291 109.375 0.102  1.00 49.94  ? 455 ALA A C     1 
ATOM   3740 O  O     . ALA A 1 455 ? 61.972 109.133 -1.061 1.00 50.92  ? 455 ALA A O     1 
ATOM   3741 C  CB    . ALA A 1 455 ? 61.659 111.655 0.819  1.00 48.86  ? 455 ALA A CB    1 
ATOM   3742 N  N     . GLY A 1 456 ? 62.203 108.483 1.081  1.00 48.08  ? 456 GLY A N     1 
ATOM   3743 C  CA    . GLY A 1 456 ? 61.821 107.117 0.779  1.00 46.60  ? 456 GLY A CA    1 
ATOM   3744 C  C     . GLY A 1 456 ? 61.850 106.288 2.039  1.00 45.36  ? 456 GLY A C     1 
ATOM   3745 O  O     . GLY A 1 456 ? 62.105 106.840 3.101  1.00 46.60  ? 456 GLY A O     1 
ATOM   3746 N  N     . TYR A 1 457 ? 61.585 104.985 1.927  1.00 44.06  ? 457 TYR A N     1 
ATOM   3747 C  CA    . TYR A 1 457 ? 61.567 104.094 3.086  1.00 43.90  ? 457 TYR A CA    1 
ATOM   3748 C  C     . TYR A 1 457 ? 62.059 102.692 2.770  1.00 44.29  ? 457 TYR A C     1 
ATOM   3749 O  O     . TYR A 1 457 ? 62.277 102.339 1.615  1.00 45.48  ? 457 TYR A O     1 
ATOM   3750 C  CB    . TYR A 1 457 ? 60.161 103.994 3.685  1.00 43.34  ? 457 TYR A CB    1 
ATOM   3751 C  CG    . TYR A 1 457 ? 59.129 103.430 2.744  1.00 43.85  ? 457 TYR A CG    1 
ATOM   3752 C  CD1   . TYR A 1 457 ? 59.181 102.105 2.324  1.00 41.39  ? 457 TYR A CD1   1 
ATOM   3753 C  CD2   . TYR A 1 457 ? 58.117 104.246 2.237  1.00 45.56  ? 457 TYR A CD2   1 
ATOM   3754 C  CE1   . TYR A 1 457 ? 58.256 101.611 1.421  1.00 43.87  ? 457 TYR A CE1   1 
ATOM   3755 C  CE2   . TYR A 1 457 ? 57.186 103.764 1.328  1.00 44.17  ? 457 TYR A CE2   1 
ATOM   3756 C  CZ    . TYR A 1 457 ? 57.254 102.454 0.922  1.00 43.88  ? 457 TYR A CZ    1 
ATOM   3757 O  OH    . TYR A 1 457 ? 56.315 102.002 0.018  1.00 43.42  ? 457 TYR A OH    1 
ATOM   3758 N  N     . VAL A 1 458 ? 62.227 101.904 3.825  1.00 43.97  ? 458 VAL A N     1 
ATOM   3759 C  CA    . VAL A 1 458 ? 62.603 100.498 3.730  1.00 45.28  ? 458 VAL A CA    1 
ATOM   3760 C  C     . VAL A 1 458 ? 61.859 99.806  4.894  1.00 44.88  ? 458 VAL A C     1 
ATOM   3761 O  O     . VAL A 1 458 ? 61.799 100.359 5.988  1.00 45.46  ? 458 VAL A O     1 
ATOM   3762 C  CB    . VAL A 1 458 ? 64.138 100.363 3.888  1.00 44.69  ? 458 VAL A CB    1 
ATOM   3763 C  CG1   . VAL A 1 458 ? 64.501 100.138 5.330  1.00 45.43  ? 458 VAL A CG1   1 
ATOM   3764 C  CG2   . VAL A 1 458 ? 64.654 99.266  3.022  1.00 47.09  ? 458 VAL A CG2   1 
ATOM   3765 N  N     . THR A 1 459 ? 61.252 98.642  4.670  1.00 43.42  ? 459 THR A N     1 
ATOM   3766 C  CA    . THR A 1 459 ? 60.374 98.083  5.707  1.00 45.58  ? 459 THR A CA    1 
ATOM   3767 C  C     . THR A 1 459 ? 60.655 96.616  6.048  1.00 45.47  ? 459 THR A C     1 
ATOM   3768 O  O     . THR A 1 459 ? 61.263 95.887  5.266  1.00 46.20  ? 459 THR A O     1 
ATOM   3769 C  CB    . THR A 1 459 ? 58.862 98.185  5.333  1.00 46.46  ? 459 THR A CB    1 
ATOM   3770 O  OG1   . THR A 1 459 ? 58.496 97.077  4.499  1.00 49.53  ? 459 THR A OG1   1 
ATOM   3771 C  CG2   . THR A 1 459 ? 58.567 99.468  4.595  1.00 45.91  ? 459 THR A CG2   1 
ATOM   3772 N  N     . ASN A 1 460 ? 60.192 96.193  7.221  1.00 43.95  ? 460 ASN A N     1 
ATOM   3773 C  CA    . ASN A 1 460 ? 60.432 94.841  7.702  1.00 42.45  ? 460 ASN A CA    1 
ATOM   3774 C  C     . ASN A 1 460 ? 59.753 93.817  6.807  1.00 42.61  ? 460 ASN A C     1 
ATOM   3775 O  O     . ASN A 1 460 ? 60.260 92.706  6.659  1.00 44.25  ? 460 ASN A O     1 
ATOM   3776 C  CB    . ASN A 1 460 ? 59.910 94.667  9.127  1.00 41.44  ? 460 ASN A CB    1 
ATOM   3777 C  CG    . ASN A 1 460 ? 58.394 94.699  9.192  1.00 42.14  ? 460 ASN A CG    1 
ATOM   3778 O  OD1   . ASN A 1 460 ? 57.769 95.691  8.840  1.00 44.92  ? 460 ASN A OD1   1 
ATOM   3779 N  ND2   . ASN A 1 460 ? 57.801 93.614  9.636  1.00 40.99  ? 460 ASN A ND2   1 
ATOM   3780 N  N     . ARG A 1 461 ? 58.611 94.162  6.219  1.00 40.87  ? 461 ARG A N     1 
ATOM   3781 C  CA    . ARG A 1 461 ? 57.925 93.193  5.374  1.00 40.90  ? 461 ARG A CA    1 
ATOM   3782 C  C     . ARG A 1 461 ? 58.574 93.069  4.007  1.00 42.36  ? 461 ARG A C     1 
ATOM   3783 O  O     . ARG A 1 461 ? 58.215 92.196  3.219  1.00 43.56  ? 461 ARG A O     1 
ATOM   3784 C  CB    . ARG A 1 461 ? 56.457 93.556  5.190  1.00 40.03  ? 461 ARG A CB    1 
ATOM   3785 C  CG    . ARG A 1 461 ? 55.636 93.521  6.459  1.00 39.79  ? 461 ARG A CG    1 
ATOM   3786 C  CD    . ARG A 1 461 ? 54.187 93.899  6.173  1.00 40.80  ? 461 ARG A CD    1 
ATOM   3787 N  NE    . ARG A 1 461 ? 53.426 93.748  7.408  1.00 45.11  ? 461 ARG A NE    1 
ATOM   3788 C  CZ    . ARG A 1 461 ? 52.160 94.115  7.599  1.00 46.32  ? 461 ARG A CZ    1 
ATOM   3789 N  NH1   . ARG A 1 461 ? 51.490 94.674  6.589  1.00 45.69  ? 461 ARG A NH1   1 
ATOM   3790 N  NH2   . ARG A 1 461 ? 51.589 93.910  8.822  1.00 48.82  ? 461 ARG A NH2   1 
ATOM   3791 N  N     . GLY A 1 462 ? 59.515 93.959  3.717  1.00 43.34  ? 462 GLY A N     1 
ATOM   3792 C  CA    . GLY A 1 462 ? 60.363 93.768  2.559  1.00 42.45  ? 462 GLY A CA    1 
ATOM   3793 C  C     . GLY A 1 462 ? 60.297 94.816  1.460  1.00 43.96  ? 462 GLY A C     1 
ATOM   3794 O  O     . GLY A 1 462 ? 61.056 94.748  0.492  1.00 46.04  ? 462 GLY A O     1 
ATOM   3795 N  N     . ARG A 1 463 ? 59.406 95.789  1.577  1.00 42.66  ? 463 ARG A N     1 
ATOM   3796 C  CA    . ARG A 1 463 ? 59.219 96.706  0.474  1.00 42.68  ? 463 ARG A CA    1 
ATOM   3797 C  C     . ARG A 1 463 ? 59.965 98.005  0.690  1.00 45.11  ? 463 ARG A C     1 
ATOM   3798 O  O     . ARG A 1 463 ? 60.239 98.381  1.830  1.00 46.00  ? 463 ARG A O     1 
ATOM   3799 C  CB    . ARG A 1 463 ? 57.729 96.972  0.255  1.00 40.69  ? 463 ARG A CB    1 
ATOM   3800 C  CG    . ARG A 1 463 ? 56.919 97.111  1.504  1.00 39.85  ? 463 ARG A CG    1 
ATOM   3801 C  CD    . ARG A 1 463 ? 55.505 96.611  1.286  1.00 41.51  ? 463 ARG A CD    1 
ATOM   3802 N  NE    . ARG A 1 463 ? 54.637 97.641  0.723  1.00 45.33  ? 463 ARG A NE    1 
ATOM   3803 C  CZ    . ARG A 1 463 ? 53.795 98.387  1.438  1.00 46.19  ? 463 ARG A CZ    1 
ATOM   3804 N  NH1   . ARG A 1 463 ? 53.705 98.218  2.752  1.00 43.39  ? 463 ARG A NH1   1 
ATOM   3805 N  NH2   . ARG A 1 463 ? 53.035 99.298  0.835  1.00 46.09  ? 463 ARG A NH2   1 
ATOM   3806 N  N     . GLN A 1 464 ? 60.308 98.688  -0.401 1.00 46.52  ? 464 GLN A N     1 
ATOM   3807 C  CA    . GLN A 1 464 ? 60.934 100.000 -0.286 1.00 49.17  ? 464 GLN A CA    1 
ATOM   3808 C  C     . GLN A 1 464 ? 60.623 100.940 -1.426 1.00 49.16  ? 464 GLN A C     1 
ATOM   3809 O  O     . GLN A 1 464 ? 60.517 100.519 -2.565 1.00 50.06  ? 464 GLN A O     1 
ATOM   3810 C  CB    . GLN A 1 464 ? 62.444 99.863  -0.186 1.00 50.62  ? 464 GLN A CB    1 
ATOM   3811 C  CG    . GLN A 1 464 ? 63.105 99.486  -1.478 1.00 52.80  ? 464 GLN A CG    1 
ATOM   3812 C  CD    . GLN A 1 464 ? 64.256 98.548  -1.237 1.00 56.38  ? 464 GLN A CD    1 
ATOM   3813 O  OE1   . GLN A 1 464 ? 64.123 97.563  -0.500 1.00 56.76  ? 464 GLN A OE1   1 
ATOM   3814 N  NE2   . GLN A 1 464 ? 65.401 98.845  -1.844 1.00 56.41  ? 464 GLN A NE2   1 
ATOM   3815 N  N     . LYS A 1 465 ? 60.503 102.224 -1.108 1.00 49.65  ? 465 LYS A N     1 
ATOM   3816 C  CA    . LYS A 1 465 ? 60.350 103.254 -2.122 1.00 49.94  ? 465 LYS A CA    1 
ATOM   3817 C  C     . LYS A 1 465 ? 61.477 104.279 -1.973 1.00 51.83  ? 465 LYS A C     1 
ATOM   3818 O  O     . LYS A 1 465 ? 61.936 104.543 -0.855 1.00 51.29  ? 465 LYS A O     1 
ATOM   3819 C  CB    . LYS A 1 465 ? 58.994 103.953 -1.959 1.00 49.88  ? 465 LYS A CB    1 
ATOM   3820 C  CG    . LYS A 1 465 ? 58.142 104.027 -3.217 1.00 49.24  ? 465 LYS A CG    1 
ATOM   3821 C  CD    . LYS A 1 465 ? 56.838 104.764 -2.926 1.00 50.75  ? 465 LYS A CD    1 
ATOM   3822 C  CE    . LYS A 1 465 ? 55.750 104.479 -3.966 1.00 52.72  ? 465 LYS A CE    1 
ATOM   3823 N  NZ    . LYS A 1 465 ? 55.117 103.127 -3.784 1.00 56.21  ? 465 LYS A NZ    1 
ATOM   3824 N  N     . VAL A 1 466 ? 61.923 104.837 -3.102 1.00 51.73  ? 466 VAL A N     1 
ATOM   3825 C  CA    . VAL A 1 466 ? 62.704 106.072 -3.104 1.00 51.14  ? 466 VAL A CA    1 
ATOM   3826 C  C     . VAL A 1 466 ? 62.141 107.061 -4.120 1.00 52.81  ? 466 VAL A C     1 
ATOM   3827 O  O     . VAL A 1 466 ? 61.853 106.712 -5.254 1.00 51.97  ? 466 VAL A O     1 
ATOM   3828 C  CB    . VAL A 1 466 ? 64.184 105.811 -3.431 1.00 49.33  ? 466 VAL A CB    1 
ATOM   3829 C  CG1   . VAL A 1 466 ? 65.007 107.060 -3.162 1.00 48.69  ? 466 VAL A CG1   1 
ATOM   3830 C  CG2   . VAL A 1 466 ? 64.687 104.674 -2.596 1.00 48.49  ? 466 VAL A CG2   1 
ATOM   3831 N  N     . VAL A 1 467 ? 61.973 108.305 -3.694 1.00 55.19  ? 467 VAL A N     1 
ATOM   3832 C  CA    . VAL A 1 467 ? 61.350 109.316 -4.529 1.00 56.50  ? 467 VAL A CA    1 
ATOM   3833 C  C     . VAL A 1 467 ? 62.210 110.554 -4.511 1.00 57.56  ? 467 VAL A C     1 
ATOM   3834 O  O     . VAL A 1 467 ? 62.770 110.900 -3.479 1.00 59.57  ? 467 VAL A O     1 
ATOM   3835 C  CB    . VAL A 1 467 ? 59.956 109.683 -4.009 1.00 56.13  ? 467 VAL A CB    1 
ATOM   3836 C  CG1   . VAL A 1 467 ? 59.403 110.834 -4.801 1.00 58.38  ? 467 VAL A CG1   1 
ATOM   3837 C  CG2   . VAL A 1 467 ? 59.034 108.501 -4.145 1.00 53.05  ? 467 VAL A CG2   1 
ATOM   3838 N  N     . THR A 1 468 ? 62.303 111.227 -5.648 1.00 58.41  ? 468 THR A N     1 
ATOM   3839 C  CA    . THR A 1 468 ? 63.212 112.352 -5.772 1.00 59.80  ? 468 THR A CA    1 
ATOM   3840 C  C     . THR A 1 468 ? 62.436 113.653 -5.795 1.00 61.94  ? 468 THR A C     1 
ATOM   3841 O  O     . THR A 1 468 ? 61.450 113.776 -6.514 1.00 64.55  ? 468 THR A O     1 
ATOM   3842 C  CB    . THR A 1 468 ? 64.007 112.227 -7.068 1.00 59.21  ? 468 THR A CB    1 
ATOM   3843 O  OG1   . THR A 1 468 ? 63.082 112.145 -8.164 1.00 59.91  ? 468 THR A OG1   1 
ATOM   3844 C  CG2   . THR A 1 468 ? 64.798 110.897 -7.101 1.00 60.10  ? 468 THR A CG2   1 
ATOM   3845 N  N     . LEU A 1 469 ? 62.880 114.625 -5.011 1.00 63.23  ? 469 LEU A N     1 
ATOM   3846 C  CA    . LEU A 1 469 ? 62.172 115.896 -4.924 1.00 65.03  ? 469 LEU A CA    1 
ATOM   3847 C  C     . LEU A 1 469 ? 63.019 117.038 -5.481 1.00 66.55  ? 469 LEU A C     1 
ATOM   3848 O  O     . LEU A 1 469 ? 64.137 117.283 -5.017 1.00 68.89  ? 469 LEU A O     1 
ATOM   3849 C  CB    . LEU A 1 469 ? 61.820 116.239 -3.473 1.00 62.29  ? 469 LEU A CB    1 
ATOM   3850 C  CG    . LEU A 1 469 ? 61.421 115.202 -2.428 1.00 59.76  ? 469 LEU A CG    1 
ATOM   3851 C  CD1   . LEU A 1 469 ? 60.236 114.403 -2.908 1.00 59.60  ? 469 LEU A CD1   1 
ATOM   3852 C  CD2   . LEU A 1 469 ? 62.599 114.315 -2.136 1.00 59.31  ? 469 LEU A CD2   1 
ATOM   3853 N  N     . THR A 1 470 ? 62.474 117.758 -6.452 1.00 66.56  ? 470 THR A N     1 
ATOM   3854 C  CA    . THR A 1 470 ? 63.093 118.994 -6.908 1.00 65.15  ? 470 THR A CA    1 
ATOM   3855 C  C     . THR A 1 470 ? 62.908 120.133 -5.880 1.00 66.27  ? 470 THR A C     1 
ATOM   3856 O  O     . THR A 1 470 ? 61.950 120.124 -5.103 1.00 66.03  ? 470 THR A O     1 
ATOM   3857 C  CB    . THR A 1 470 ? 62.496 119.411 -8.256 1.00 62.43  ? 470 THR A CB    1 
ATOM   3858 O  OG1   . THR A 1 470 ? 62.879 118.460 -9.254 1.00 60.33  ? 470 THR A OG1   1 
ATOM   3859 C  CG2   . THR A 1 470 ? 62.984 120.795 -8.653 1.00 62.54  ? 470 THR A CG2   1 
ATOM   3860 N  N     . ASP A 1 471 ? 63.839 121.089 -5.869 1.00 66.67  ? 471 ASP A N     1 
ATOM   3861 C  CA    . ASP A 1 471 ? 63.719 122.309 -5.073 1.00 67.03  ? 471 ASP A CA    1 
ATOM   3862 C  C     . ASP A 1 471 ? 63.180 122.118 -3.672 1.00 67.23  ? 471 ASP A C     1 
ATOM   3863 O  O     . ASP A 1 471 ? 62.245 122.811 -3.270 1.00 66.21  ? 471 ASP A O     1 
ATOM   3864 C  CB    . ASP A 1 471 ? 62.832 123.331 -5.791 1.00 69.00  ? 471 ASP A CB    1 
ATOM   3865 C  CG    . ASP A 1 471 ? 63.468 123.854 -7.144 1.00 72.24  ? 471 ASP A CG    1 
ATOM   3866 O  OD1   . ASP A 1 471 ? 64.652 123.421 -7.464 1.00 74.97  ? 471 ASP A OD1   1 
ATOM   3867 O  OD2   . ASP A 1 471 ? 62.790 124.695 -7.872 1.00 73.64  ? 471 ASP A OD2   1 
ATOM   3868 N  N     . THR A 1 472 ? 63.778 121.187 -2.936 1.00 65.87  ? 472 THR A N     1 
ATOM   3869 C  CA    . THR A 1 472 ? 63.348 120.870 -1.583 1.00 63.19  ? 472 THR A CA    1 
ATOM   3870 C  C     . THR A 1 472 ? 64.483 121.115 -0.582 1.00 61.87  ? 472 THR A C     1 
ATOM   3871 O  O     . THR A 1 472 ? 65.454 121.790 -0.900 1.00 60.67  ? 472 THR A O     1 
ATOM   3872 C  CB    . THR A 1 472 ? 62.875 119.396 -1.507 1.00 62.96  ? 472 THR A CB    1 
ATOM   3873 O  OG1   . THR A 1 472 ? 62.464 119.081 -0.168 1.00 62.75  ? 472 THR A OG1   1 
ATOM   3874 C  CG2   . THR A 1 472 ? 63.994 118.461 -1.963 1.00 60.88  ? 472 THR A CG2   1 
ATOM   3875 N  N     . THR A 1 473 ? 64.352 120.568 0.625  1.00 62.19  ? 473 THR A N     1 
ATOM   3876 C  CA    . THR A 1 473 ? 65.362 120.721 1.674  1.00 61.82  ? 473 THR A CA    1 
ATOM   3877 C  C     . THR A 1 473 ? 65.360 119.479 2.554  1.00 62.77  ? 473 THR A C     1 
ATOM   3878 O  O     . THR A 1 473 ? 64.514 118.607 2.374  1.00 64.97  ? 473 THR A O     1 
ATOM   3879 C  CB    . THR A 1 473 ? 65.059 121.919 2.556  1.00 60.94  ? 473 THR A CB    1 
ATOM   3880 O  OG1   . THR A 1 473 ? 63.747 121.769 3.107  1.00 61.58  ? 473 THR A OG1   1 
ATOM   3881 C  CG2   . THR A 1 473 ? 65.132 123.202 1.757  1.00 59.83  ? 473 THR A CG2   1 
ATOM   3882 N  N     . ASN A 1 474 ? 66.294 119.398 3.503  1.00 62.53  ? 474 ASN A N     1 
ATOM   3883 C  CA    . ASN A 1 474 ? 66.390 118.236 4.393  1.00 61.28  ? 474 ASN A CA    1 
ATOM   3884 C  C     . ASN A 1 474 ? 65.152 118.042 5.231  1.00 60.35  ? 474 ASN A C     1 
ATOM   3885 O  O     . ASN A 1 474 ? 64.690 116.927 5.388  1.00 61.13  ? 474 ASN A O     1 
ATOM   3886 C  CB    . ASN A 1 474 ? 67.575 118.356 5.342  1.00 62.99  ? 474 ASN A CB    1 
ATOM   3887 C  CG    . ASN A 1 474 ? 68.848 117.813 4.750  1.00 66.03  ? 474 ASN A CG    1 
ATOM   3888 O  OD1   . ASN A 1 474 ? 68.861 116.738 4.143  1.00 67.19  ? 474 ASN A OD1   1 
ATOM   3889 N  ND2   . ASN A 1 474 ? 69.938 118.554 4.922  1.00 68.21  ? 474 ASN A ND2   1 
ATOM   3890 N  N     . GLN A 1 475 ? 64.620 119.129 5.778  1.00 59.54  ? 475 GLN A N     1 
ATOM   3891 C  CA    . GLN A 1 475 ? 63.472 119.035 6.668  1.00 58.18  ? 475 GLN A CA    1 
ATOM   3892 C  C     . GLN A 1 475 ? 62.192 118.750 5.897  1.00 56.67  ? 475 GLN A C     1 
ATOM   3893 O  O     . GLN A 1 475 ? 61.215 118.257 6.451  1.00 56.07  ? 475 GLN A O     1 
ATOM   3894 C  CB    . GLN A 1 475 ? 63.320 120.320 7.485  1.00 59.17  ? 475 GLN A CB    1 
ATOM   3895 C  CG    . GLN A 1 475 ? 64.455 120.571 8.477  1.00 59.71  ? 475 GLN A CG    1 
ATOM   3896 C  CD    . GLN A 1 475 ? 65.488 121.561 7.946  1.00 61.73  ? 475 GLN A CD    1 
ATOM   3897 O  OE1   . GLN A 1 475 ? 65.966 121.429 6.816  1.00 60.71  ? 475 GLN A OE1   1 
ATOM   3898 N  NE2   . GLN A 1 475 ? 65.830 122.563 8.758  1.00 60.30  ? 475 GLN A NE2   1 
ATOM   3899 N  N     . LYS A 1 476 ? 62.194 119.050 4.611  1.00 55.34  ? 476 LYS A N     1 
ATOM   3900 C  CA    . LYS A 1 476 ? 61.050 118.699 3.798  1.00 55.28  ? 476 LYS A CA    1 
ATOM   3901 C  C     . LYS A 1 476 ? 61.154 117.275 3.291  1.00 55.20  ? 476 LYS A C     1 
ATOM   3902 O  O     . LYS A 1 476 ? 60.134 116.620 3.076  1.00 57.61  ? 476 LYS A O     1 
ATOM   3903 C  CB    . LYS A 1 476 ? 60.912 119.658 2.626  1.00 55.63  ? 476 LYS A CB    1 
ATOM   3904 C  CG    . LYS A 1 476 ? 60.435 121.026 3.040  1.00 57.02  ? 476 LYS A CG    1 
ATOM   3905 C  CD    . LYS A 1 476 ? 60.312 121.943 1.844  1.00 58.54  ? 476 LYS A CD    1 
ATOM   3906 C  CE    . LYS A 1 476 ? 59.884 123.333 2.274  1.00 60.05  ? 476 LYS A CE    1 
ATOM   3907 N  NZ    . LYS A 1 476 ? 59.289 124.098 1.143  1.00 61.53  ? 476 LYS A NZ    1 
ATOM   3908 N  N     . THR A 1 477 ? 62.376 116.787 3.103  1.00 52.83  ? 477 THR A N     1 
ATOM   3909 C  CA    . THR A 1 477 ? 62.571 115.408 2.662  1.00 50.69  ? 477 THR A CA    1 
ATOM   3910 C  C     . THR A 1 477 ? 62.331 114.450 3.822  1.00 49.59  ? 477 THR A C     1 
ATOM   3911 O  O     . THR A 1 477 ? 61.732 113.390 3.654  1.00 49.89  ? 477 THR A O     1 
ATOM   3912 C  CB    . THR A 1 477 ? 63.989 115.190 2.121  1.00 50.53  ? 477 THR A CB    1 
ATOM   3913 O  OG1   . THR A 1 477 ? 64.942 115.512 3.140  1.00 52.40  ? 477 THR A OG1   1 
ATOM   3914 C  CG2   . THR A 1 477 ? 64.233 116.066 0.923  1.00 46.73  ? 477 THR A CG2   1 
ATOM   3915 N  N     . GLU A 1 478 ? 62.800 114.832 5.003  1.00 47.95  ? 478 GLU A N     1 
ATOM   3916 C  CA    . GLU A 1 478 ? 62.392 114.169 6.226  1.00 47.02  ? 478 GLU A CA    1 
ATOM   3917 C  C     . GLU A 1 478 ? 60.868 114.070 6.297  1.00 46.07  ? 478 GLU A C     1 
ATOM   3918 O  O     . GLU A 1 478 ? 60.321 112.999 6.512  1.00 46.54  ? 478 GLU A O     1 
ATOM   3919 C  CB    . GLU A 1 478 ? 62.924 114.931 7.445  1.00 48.38  ? 478 GLU A CB    1 
ATOM   3920 C  CG    . GLU A 1 478 ? 64.428 114.848 7.640  1.00 50.40  ? 478 GLU A CG    1 
ATOM   3921 C  CD    . GLU A 1 478 ? 64.946 113.408 7.697  1.00 54.63  ? 478 GLU A CD    1 
ATOM   3922 O  OE1   . GLU A 1 478 ? 64.455 112.562 6.920  1.00 57.51  ? 478 GLU A OE1   1 
ATOM   3923 O  OE2   . GLU A 1 478 ? 65.850 113.111 8.515  1.00 55.12  ? 478 GLU A OE2   1 
ATOM   3924 N  N     . LEU A 1 479 ? 60.180 115.187 6.104  1.00 45.29  ? 479 LEU A N     1 
ATOM   3925 C  CA    . LEU A 1 479 ? 58.722 115.201 6.166  1.00 45.41  ? 479 LEU A CA    1 
ATOM   3926 C  C     . LEU A 1 479 ? 58.049 114.474 5.003  1.00 47.10  ? 479 LEU A C     1 
ATOM   3927 O  O     . LEU A 1 479 ? 56.901 114.051 5.103  1.00 46.82  ? 479 LEU A O     1 
ATOM   3928 C  CB    . LEU A 1 479 ? 58.228 116.639 6.212  1.00 42.86  ? 479 LEU A CB    1 
ATOM   3929 C  CG    . LEU A 1 479 ? 58.268 117.276 7.594  1.00 41.06  ? 479 LEU A CG    1 
ATOM   3930 C  CD1   . LEU A 1 479 ? 57.951 118.743 7.481  1.00 36.40  ? 479 LEU A CD1   1 
ATOM   3931 C  CD2   . LEU A 1 479 ? 57.272 116.574 8.498  1.00 38.28  ? 479 LEU A CD2   1 
ATOM   3932 N  N     . GLN A 1 480 ? 58.761 114.354 3.891  1.00 48.47  ? 480 GLN A N     1 
ATOM   3933 C  CA    . GLN A 1 480 ? 58.254 113.613 2.755  1.00 50.28  ? 480 GLN A CA    1 
ATOM   3934 C  C     . GLN A 1 480 ? 58.275 112.137 3.072  1.00 50.32  ? 480 GLN A C     1 
ATOM   3935 O  O     . GLN A 1 480 ? 57.315 111.430 2.800  1.00 52.44  ? 480 GLN A O     1 
ATOM   3936 C  CB    . GLN A 1 480 ? 59.114 113.864 1.523  1.00 52.85  ? 480 GLN A CB    1 
ATOM   3937 C  CG    . GLN A 1 480 ? 58.547 114.901 0.581  1.00 57.85  ? 480 GLN A CG    1 
ATOM   3938 C  CD    . GLN A 1 480 ? 57.233 114.469 -0.043 1.00 58.81  ? 480 GLN A CD    1 
ATOM   3939 O  OE1   . GLN A 1 480 ? 56.395 115.301 -0.387 1.00 59.06  ? 480 GLN A OE1   1 
ATOM   3940 N  NE2   . GLN A 1 480 ? 57.050 113.164 -0.191 1.00 60.20  ? 480 GLN A NE2   1 
ATOM   3941 N  N     . ALA A 1 481 ? 59.379 111.668 3.638  1.00 48.61  ? 481 ALA A N     1 
ATOM   3942 C  CA    . ALA A 1 481 ? 59.516 110.252 3.899  1.00 46.46  ? 481 ALA A CA    1 
ATOM   3943 C  C     . ALA A 1 481 ? 58.424 109.821 4.864  1.00 45.59  ? 481 ALA A C     1 
ATOM   3944 O  O     . ALA A 1 481 ? 57.898 108.727 4.755  1.00 44.18  ? 481 ALA A O     1 
ATOM   3945 C  CB    . ALA A 1 481 ? 60.888 109.947 4.476  1.00 45.57  ? 481 ALA A CB    1 
ATOM   3946 N  N     . ILE A 1 482 ? 58.062 110.678 5.803  1.00 44.29  ? 482 ILE A N     1 
ATOM   3947 C  CA    . ILE A 1 482 ? 57.066 110.279 6.768  1.00 46.79  ? 482 ILE A CA    1 
ATOM   3948 C  C     . ILE A 1 482 ? 55.652 110.274 6.183  1.00 50.41  ? 482 ILE A C     1 
ATOM   3949 O  O     . ILE A 1 482 ? 54.754 109.598 6.694  1.00 52.08  ? 482 ILE A O     1 
ATOM   3950 C  CB    . ILE A 1 482 ? 57.128 111.175 7.994  1.00 47.07  ? 482 ILE A CB    1 
ATOM   3951 C  CG1   . ILE A 1 482 ? 58.413 110.873 8.759  1.00 46.57  ? 482 ILE A CG1   1 
ATOM   3952 C  CG2   . ILE A 1 482 ? 55.899 110.969 8.872  1.00 46.65  ? 482 ILE A CG2   1 
ATOM   3953 C  CD1   . ILE A 1 482 ? 58.933 112.043 9.551  1.00 45.40  ? 482 ILE A CD1   1 
ATOM   3954 N  N     . TYR A 1 483 ? 55.454 111.008 5.096  1.00 52.13  ? 483 TYR A N     1 
ATOM   3955 C  CA    . TYR A 1 483 ? 54.160 111.036 4.435  1.00 53.78  ? 483 TYR A CA    1 
ATOM   3956 C  C     . TYR A 1 483 ? 54.051 109.911 3.410  1.00 55.95  ? 483 TYR A C     1 
ATOM   3957 O  O     . TYR A 1 483 ? 53.031 109.226 3.328  1.00 58.71  ? 483 TYR A O     1 
ATOM   3958 C  CB    . TYR A 1 483 ? 53.971 112.384 3.764  1.00 55.25  ? 483 TYR A CB    1 
ATOM   3959 C  CG    . TYR A 1 483 ? 52.805 112.470 2.816  1.00 57.33  ? 483 TYR A CG    1 
ATOM   3960 C  CD1   . TYR A 1 483 ? 51.498 112.397 3.272  1.00 58.05  ? 483 TYR A CD1   1 
ATOM   3961 C  CD2   . TYR A 1 483 ? 53.017 112.707 1.471  1.00 58.66  ? 483 TYR A CD2   1 
ATOM   3962 C  CE1   . TYR A 1 483 ? 50.441 112.568 2.410  1.00 60.47  ? 483 TYR A CE1   1 
ATOM   3963 C  CE2   . TYR A 1 483 ? 51.975 112.880 0.605  1.00 61.18  ? 483 TYR A CE2   1 
ATOM   3964 C  CZ    . TYR A 1 483 ? 50.689 112.816 1.072  1.00 61.91  ? 483 TYR A CZ    1 
ATOM   3965 O  OH    . TYR A 1 483 ? 49.666 113.044 0.184  1.00 63.40  ? 483 TYR A OH    1 
ATOM   3966 N  N     . LEU A 1 484 ? 55.108 109.724 2.631  1.00 55.42  ? 484 LEU A N     1 
ATOM   3967 C  CA    . LEU A 1 484 ? 55.295 108.510 1.845  1.00 54.50  ? 484 LEU A CA    1 
ATOM   3968 C  C     . LEU A 1 484 ? 54.967 107.239 2.651  1.00 54.21  ? 484 LEU A C     1 
ATOM   3969 O  O     . LEU A 1 484 ? 54.087 106.475 2.285  1.00 53.99  ? 484 LEU A O     1 
ATOM   3970 C  CB    . LEU A 1 484 ? 56.742 108.448 1.372  1.00 55.75  ? 484 LEU A CB    1 
ATOM   3971 C  CG    . LEU A 1 484 ? 56.946 108.042 -0.073 1.00 56.10  ? 484 LEU A CG    1 
ATOM   3972 C  CD1   . LEU A 1 484 ? 56.150 108.987 -0.932 1.00 55.72  ? 484 LEU A CD1   1 
ATOM   3973 C  CD2   . LEU A 1 484 ? 58.424 108.083 -0.422 1.00 56.01  ? 484 LEU A CD2   1 
ATOM   3974 N  N     . ALA A 1 485 ? 55.676 107.009 3.749  1.00 53.94  ? 485 ALA A N     1 
ATOM   3975 C  CA    . ALA A 1 485 ? 55.388 105.850 4.588  1.00 54.36  ? 485 ALA A CA    1 
ATOM   3976 C  C     . ALA A 1 485 ? 53.925 105.815 5.018  1.00 54.94  ? 485 ALA A C     1 
ATOM   3977 O  O     . ALA A 1 485 ? 53.318 104.751 5.064  1.00 55.31  ? 485 ALA A O     1 
ATOM   3978 C  CB    . ALA A 1 485 ? 56.288 105.844 5.820  1.00 53.55  ? 485 ALA A CB    1 
ATOM   3979 N  N     . LEU A 1 486 ? 53.354 106.969 5.343  1.00 55.35  ? 486 LEU A N     1 
ATOM   3980 C  CA    . LEU A 1 486 ? 51.953 107.008 5.739  1.00 55.96  ? 486 LEU A CA    1 
ATOM   3981 C  C     . LEU A 1 486 ? 51.026 106.598 4.597  1.00 56.98  ? 486 LEU A C     1 
ATOM   3982 O  O     . LEU A 1 486 ? 50.122 105.780 4.781  1.00 56.64  ? 486 LEU A O     1 
ATOM   3983 C  CB    . LEU A 1 486 ? 51.585 108.401 6.229  1.00 56.76  ? 486 LEU A CB    1 
ATOM   3984 C  CG    . LEU A 1 486 ? 51.954 108.655 7.689  1.00 57.87  ? 486 LEU A CG    1 
ATOM   3985 C  CD1   . LEU A 1 486 ? 51.527 110.053 8.101  1.00 55.06  ? 486 LEU A CD1   1 
ATOM   3986 C  CD2   . LEU A 1 486 ? 51.275 107.605 8.558  1.00 58.96  ? 486 LEU A CD2   1 
ATOM   3987 N  N     . GLN A 1 487 ? 51.260 107.162 3.416  1.00 56.53  ? 487 GLN A N     1 
ATOM   3988 C  CA    . GLN A 1 487 ? 50.498 106.803 2.225  1.00 55.78  ? 487 GLN A CA    1 
ATOM   3989 C  C     . GLN A 1 487 ? 50.460 105.302 1.964  1.00 54.30  ? 487 GLN A C     1 
ATOM   3990 O  O     . GLN A 1 487 ? 49.435 104.772 1.544  1.00 55.97  ? 487 GLN A O     1 
ATOM   3991 C  CB    . GLN A 1 487 ? 51.081 107.492 0.990  1.00 58.24  ? 487 GLN A CB    1 
ATOM   3992 C  CG    . GLN A 1 487 ? 50.552 108.897 0.709  1.00 61.23  ? 487 GLN A CG    1 
ATOM   3993 C  CD    . GLN A 1 487 ? 50.872 109.343 -0.709 1.00 63.03  ? 487 GLN A CD    1 
ATOM   3994 O  OE1   . GLN A 1 487 ? 50.573 110.468 -1.108 1.00 65.15  ? 487 GLN A OE1   1 
ATOM   3995 N  NE2   . GLN A 1 487 ? 51.489 108.453 -1.479 1.00 64.48  ? 487 GLN A NE2   1 
ATOM   3996 N  N     . ASP A 1 488 ? 51.580 104.622 2.203  1.00 52.68  ? 488 ASP A N     1 
ATOM   3997 C  CA    . ASP A 1 488 ? 51.757 103.232 1.769  1.00 49.10  ? 488 ASP A CA    1 
ATOM   3998 C  C     . ASP A 1 488 ? 51.538 102.197 2.845  1.00 46.78  ? 488 ASP A C     1 
ATOM   3999 O  O     . ASP A 1 488 ? 51.648 101.013 2.587  1.00 46.85  ? 488 ASP A O     1 
ATOM   4000 C  CB    . ASP A 1 488 ? 53.152 103.021 1.207  1.00 47.90  ? 488 ASP A CB    1 
ATOM   4001 C  CG    . ASP A 1 488 ? 53.386 103.797 -0.044 1.00 48.98  ? 488 ASP A CG    1 
ATOM   4002 O  OD1   . ASP A 1 488 ? 52.885 104.937 -0.149 1.00 48.69  ? 488 ASP A OD1   1 
ATOM   4003 O  OD2   . ASP A 1 488 ? 54.074 103.260 -0.928 1.00 52.45  ? 488 ASP A OD2   1 
ATOM   4004 N  N     . SER A 1 489 ? 51.256 102.636 4.056  1.00 46.23  ? 489 SER A N     1 
ATOM   4005 C  CA    . SER A 1 489 ? 51.027 101.702 5.134  1.00 47.35  ? 489 SER A CA    1 
ATOM   4006 C  C     . SER A 1 489 ? 49.534 101.407 5.281  1.00 48.18  ? 489 SER A C     1 
ATOM   4007 O  O     . SER A 1 489 ? 48.693 102.246 4.964  1.00 48.89  ? 489 SER A O     1 
ATOM   4008 C  CB    . SER A 1 489 ? 51.593 102.273 6.430  1.00 47.30  ? 489 SER A CB    1 
ATOM   4009 O  OG    . SER A 1 489 ? 51.302 103.652 6.530  1.00 50.87  ? 489 SER A OG    1 
ATOM   4010 N  N     . GLY A 1 490 ? 49.211 100.206 5.752  1.00 48.08  ? 490 GLY A N     1 
ATOM   4011 C  CA    . GLY A 1 490 ? 47.834 99.889  6.081  1.00 47.42  ? 490 GLY A CA    1 
ATOM   4012 C  C     . GLY A 1 490 ? 47.304 100.786 7.178  1.00 48.04  ? 490 GLY A C     1 
ATOM   4013 O  O     . GLY A 1 490 ? 47.815 101.884 7.384  1.00 50.07  ? 490 GLY A O     1 
ATOM   4014 N  N     . LEU A 1 491 ? 46.283 100.321 7.889  1.00 47.47  ? 491 LEU A N     1 
ATOM   4015 C  CA    . LEU A 1 491 ? 45.603 101.125 8.903  1.00 46.33  ? 491 LEU A CA    1 
ATOM   4016 C  C     . LEU A 1 491 ? 46.353 101.166 10.227 1.00 46.29  ? 491 LEU A C     1 
ATOM   4017 O  O     . LEU A 1 491 ? 45.909 101.810 11.176 1.00 47.92  ? 491 LEU A O     1 
ATOM   4018 C  CB    . LEU A 1 491 ? 44.196 100.578 9.141  1.00 46.07  ? 491 LEU A CB    1 
ATOM   4019 C  CG    . LEU A 1 491 ? 42.996 101.429 8.718  1.00 47.97  ? 491 LEU A CG    1 
ATOM   4020 C  CD1   . LEU A 1 491 ? 43.450 102.704 8.048  1.00 47.38  ? 491 LEU A CD1   1 
ATOM   4021 C  CD2   . LEU A 1 491 ? 42.125 100.624 7.791  1.00 47.33  ? 491 LEU A CD2   1 
ATOM   4022 N  N     . GLU A 1 492 ? 47.472 100.457 10.295 1.00 45.32  ? 492 GLU A N     1 
ATOM   4023 C  CA    . GLU A 1 492 ? 48.318 100.478 11.474 1.00 46.04  ? 492 GLU A CA    1 
ATOM   4024 C  C     . GLU A 1 492 ? 49.751 100.429 11.008 1.00 45.47  ? 492 GLU A C     1 
ATOM   4025 O  O     . GLU A 1 492 ? 50.141 99.548  10.236 1.00 45.96  ? 492 GLU A O     1 
ATOM   4026 C  CB    . GLU A 1 492 ? 48.047 99.275  12.371 1.00 47.42  ? 492 GLU A CB    1 
ATOM   4027 C  CG    . GLU A 1 492 ? 46.599 99.071  12.737 1.00 52.28  ? 492 GLU A CG    1 
ATOM   4028 C  CD    . GLU A 1 492 ? 46.412 98.658  14.194 1.00 57.66  ? 492 GLU A CD    1 
ATOM   4029 O  OE1   . GLU A 1 492 ? 46.320 99.571  15.042 1.00 62.02  ? 492 GLU A OE1   1 
ATOM   4030 O  OE2   . GLU A 1 492 ? 46.351 97.441  14.503 1.00 56.29  ? 492 GLU A OE2   1 
ATOM   4031 N  N     . VAL A 1 493 ? 50.544 101.374 11.479 1.00 44.62  ? 493 VAL A N     1 
ATOM   4032 C  CA    . VAL A 1 493 ? 51.916 101.459 11.030 1.00 44.07  ? 493 VAL A CA    1 
ATOM   4033 C  C     . VAL A 1 493 ? 52.871 101.839 12.144 1.00 43.17  ? 493 VAL A C     1 
ATOM   4034 O  O     . VAL A 1 493 ? 52.497 102.432 13.141 1.00 43.33  ? 493 VAL A O     1 
ATOM   4035 C  CB    . VAL A 1 493 ? 52.054 102.461 9.851  1.00 44.54  ? 493 VAL A CB    1 
ATOM   4036 C  CG1   . VAL A 1 493 ? 51.722 103.877 10.297 1.00 42.24  ? 493 VAL A CG1   1 
ATOM   4037 C  CG2   . VAL A 1 493 ? 53.447 102.380 9.277  1.00 45.34  ? 493 VAL A CG2   1 
ATOM   4038 N  N     . ASN A 1 494 ? 54.119 101.455 11.977 1.00 44.98  ? 494 ASN A N     1 
ATOM   4039 C  CA    . ASN A 1 494 ? 55.169 101.969 12.824 1.00 47.59  ? 494 ASN A CA    1 
ATOM   4040 C  C     . ASN A 1 494 ? 56.169 102.713 11.928 1.00 48.18  ? 494 ASN A C     1 
ATOM   4041 O  O     . ASN A 1 494 ? 56.541 102.229 10.858 1.00 49.50  ? 494 ASN A O     1 
ATOM   4042 C  CB    . ASN A 1 494 ? 55.827 100.807 13.580 1.00 47.96  ? 494 ASN A CB    1 
ATOM   4043 C  CG    . ASN A 1 494 ? 54.910 100.218 14.640 1.00 49.35  ? 494 ASN A CG    1 
ATOM   4044 O  OD1   . ASN A 1 494 ? 53.935 100.847 15.034 1.00 51.10  ? 494 ASN A OD1   1 
ATOM   4045 N  ND2   . ASN A 1 494 ? 55.215 99.014  15.100 1.00 48.05  ? 494 ASN A ND2   1 
ATOM   4046 N  N     . ILE A 1 495 ? 56.580 103.901 12.347 1.00 46.56  ? 495 ILE A N     1 
ATOM   4047 C  CA    . ILE A 1 495 ? 57.520 104.675 11.554 1.00 46.04  ? 495 ILE A CA    1 
ATOM   4048 C  C     . ILE A 1 495 ? 58.758 105.027 12.371 1.00 45.00  ? 495 ILE A C     1 
ATOM   4049 O  O     . ILE A 1 495 ? 58.643 105.601 13.447 1.00 44.99  ? 495 ILE A O     1 
ATOM   4050 C  CB    . ILE A 1 495 ? 56.858 105.972 11.045 1.00 46.06  ? 495 ILE A CB    1 
ATOM   4051 C  CG1   . ILE A 1 495 ? 55.656 105.630 10.153 1.00 46.32  ? 495 ILE A CG1   1 
ATOM   4052 C  CG2   . ILE A 1 495 ? 57.863 106.795 10.293 1.00 46.65  ? 495 ILE A CG2   1 
ATOM   4053 C  CD1   . ILE A 1 495 ? 55.054 106.817 9.404  1.00 42.55  ? 495 ILE A CD1   1 
ATOM   4054 N  N     . VAL A 1 496 ? 59.934 104.672 11.861 1.00 43.55  ? 496 VAL A N     1 
ATOM   4055 C  CA    . VAL A 1 496 ? 61.194 105.042 12.504 1.00 43.21  ? 496 VAL A CA    1 
ATOM   4056 C  C     . VAL A 1 496 ? 61.939 106.101 11.690 1.00 44.94  ? 496 VAL A C     1 
ATOM   4057 O  O     . VAL A 1 496 ? 62.327 105.866 10.536 1.00 45.50  ? 496 VAL A O     1 
ATOM   4058 C  CB    . VAL A 1 496 ? 62.130 103.831 12.674 1.00 42.04  ? 496 VAL A CB    1 
ATOM   4059 C  CG1   . VAL A 1 496 ? 63.366 104.247 13.422 1.00 40.24  ? 496 VAL A CG1   1 
ATOM   4060 C  CG2   . VAL A 1 496 ? 61.422 102.714 13.408 1.00 42.31  ? 496 VAL A CG2   1 
ATOM   4061 N  N     . THR A 1 497 ? 62.140 107.269 12.300 1.00 45.47  ? 497 THR A N     1 
ATOM   4062 C  CA    . THR A 1 497 ? 62.817 108.374 11.632 1.00 45.53  ? 497 THR A CA    1 
ATOM   4063 C  C     . THR A 1 497 ? 64.005 108.892 12.421 1.00 45.94  ? 497 THR A C     1 
ATOM   4064 O  O     . THR A 1 497 ? 64.076 108.742 13.640 1.00 45.56  ? 497 THR A O     1 
ATOM   4065 C  CB    . THR A 1 497 ? 61.855 109.540 11.379 1.00 46.04  ? 497 THR A CB    1 
ATOM   4066 O  OG1   . THR A 1 497 ? 62.595 110.651 10.858 1.00 46.96  ? 497 THR A OG1   1 
ATOM   4067 C  CG2   . THR A 1 497 ? 61.135 109.932 12.666 1.00 45.18  ? 497 THR A CG2   1 
ATOM   4068 N  N     . ASP A 1 498 ? 64.946 109.502 11.719 1.00 46.52  ? 498 ASP A N     1 
ATOM   4069 C  CA    . ASP A 1 498 ? 66.140 110.008 12.378 1.00 47.93  ? 498 ASP A CA    1 
ATOM   4070 C  C     . ASP A 1 498 ? 66.040 111.522 12.561 1.00 49.50  ? 498 ASP A C     1 
ATOM   4071 O  O     . ASP A 1 498 ? 67.003 112.175 12.983 1.00 51.33  ? 498 ASP A O     1 
ATOM   4072 C  CB    . ASP A 1 498 ? 67.384 109.655 11.557 1.00 45.12  ? 498 ASP A CB    1 
ATOM   4073 C  CG    . ASP A 1 498 ? 67.396 110.319 10.190 1.00 45.03  ? 498 ASP A CG    1 
ATOM   4074 O  OD1   . ASP A 1 498 ? 68.370 110.101 9.444  1.00 45.35  ? 498 ASP A OD1   1 
ATOM   4075 O  OD2   . ASP A 1 498 ? 66.448 111.057 9.850  1.00 42.72  ? 498 ASP A OD2   1 
ATOM   4076 N  N     . SER A 1 499 ? 64.869 112.070 12.240 1.00 49.54  ? 499 SER A N     1 
ATOM   4077 C  CA    . SER A 1 499 ? 64.677 113.522 12.194 1.00 50.39  ? 499 SER A CA    1 
ATOM   4078 C  C     . SER A 1 499 ? 64.113 114.097 13.491 1.00 52.10  ? 499 SER A C     1 
ATOM   4079 O  O     . SER A 1 499 ? 62.958 113.861 13.837 1.00 53.65  ? 499 SER A O     1 
ATOM   4080 C  CB    . SER A 1 499 ? 63.747 113.902 11.035 1.00 47.87  ? 499 SER A CB    1 
ATOM   4081 O  OG    . SER A 1 499 ? 63.494 115.298 11.018 1.00 44.69  ? 499 SER A OG    1 
ATOM   4082 N  N     . GLN A 1 500 ? 64.921 114.868 14.206 1.00 53.33  ? 500 GLN A N     1 
ATOM   4083 C  CA    . GLN A 1 500 ? 64.472 115.391 15.476 1.00 53.45  ? 500 GLN A CA    1 
ATOM   4084 C  C     . GLN A 1 500 ? 63.389 116.417 15.199 1.00 52.00  ? 500 GLN A C     1 
ATOM   4085 O  O     . GLN A 1 500 ? 62.527 116.662 16.038 1.00 50.19  ? 500 GLN A O     1 
ATOM   4086 C  CB    . GLN A 1 500 ? 65.642 116.023 16.226 1.00 56.42  ? 500 GLN A CB    1 
ATOM   4087 C  CG    . GLN A 1 500 ? 65.592 115.789 17.725 1.00 61.03  ? 500 GLN A CG    1 
ATOM   4088 C  CD    . GLN A 1 500 ? 66.853 116.247 18.434 1.00 64.60  ? 500 GLN A CD    1 
ATOM   4089 O  OE1   . GLN A 1 500 ? 67.968 115.993 17.967 1.00 65.13  ? 500 GLN A OE1   1 
ATOM   4090 N  NE2   . GLN A 1 500 ? 66.685 116.928 19.569 1.00 64.88  ? 500 GLN A NE2   1 
ATOM   4091 N  N     . TYR A 1 501 ? 63.436 116.995 14.002 1.00 51.96  ? 501 TYR A N     1 
ATOM   4092 C  CA    . TYR A 1 501 ? 62.505 118.043 13.594 1.00 52.35  ? 501 TYR A CA    1 
ATOM   4093 C  C     . TYR A 1 501 ? 61.139 117.475 13.255 1.00 53.17  ? 501 TYR A C     1 
ATOM   4094 O  O     . TYR A 1 501 ? 60.121 117.933 13.775 1.00 52.75  ? 501 TYR A O     1 
ATOM   4095 C  CB    . TYR A 1 501 ? 63.073 118.781 12.390 1.00 52.90  ? 501 TYR A CB    1 
ATOM   4096 C  CG    . TYR A 1 501 ? 62.061 119.488 11.499 1.00 56.23  ? 501 TYR A CG    1 
ATOM   4097 C  CD1   . TYR A 1 501 ? 61.860 120.857 11.593 1.00 55.66  ? 501 TYR A CD1   1 
ATOM   4098 C  CD2   . TYR A 1 501 ? 61.387 118.804 10.494 1.00 57.52  ? 501 TYR A CD2   1 
ATOM   4099 C  CE1   . TYR A 1 501 ? 61.037 121.516 10.713 1.00 55.69  ? 501 TYR A CE1   1 
ATOM   4100 C  CE2   . TYR A 1 501 ? 60.558 119.464 9.606  1.00 55.21  ? 501 TYR A CE2   1 
ATOM   4101 C  CZ    . TYR A 1 501 ? 60.394 120.815 9.720  1.00 55.71  ? 501 TYR A CZ    1 
ATOM   4102 O  OH    . TYR A 1 501 ? 59.613 121.483 8.810  1.00 57.05  ? 501 TYR A OH    1 
ATOM   4103 N  N     . ALA A 1 502 ? 61.124 116.477 12.378 1.00 53.28  ? 502 ALA A N     1 
ATOM   4104 C  CA    . ALA A 1 502 ? 59.898 115.759 12.061 1.00 53.98  ? 502 ALA A CA    1 
ATOM   4105 C  C     . ALA A 1 502 ? 59.274 115.164 13.316 1.00 54.77  ? 502 ALA A C     1 
ATOM   4106 O  O     . ALA A 1 502 ? 58.070 115.297 13.536 1.00 57.31  ? 502 ALA A O     1 
ATOM   4107 C  CB    . ALA A 1 502 ? 60.183 114.663 11.069 1.00 54.34  ? 502 ALA A CB    1 
ATOM   4108 N  N     . LEU A 1 503 ? 60.087 114.515 14.142 1.00 52.81  ? 503 LEU A N     1 
ATOM   4109 C  CA    . LEU A 1 503 ? 59.589 113.979 15.397 1.00 52.26  ? 503 LEU A CA    1 
ATOM   4110 C  C     . LEU A 1 503 ? 58.936 115.070 16.220 1.00 52.28  ? 503 LEU A C     1 
ATOM   4111 O  O     . LEU A 1 503 ? 57.940 114.836 16.897 1.00 53.16  ? 503 LEU A O     1 
ATOM   4112 C  CB    . LEU A 1 503 ? 60.723 113.353 16.206 1.00 53.44  ? 503 LEU A CB    1 
ATOM   4113 C  CG    . LEU A 1 503 ? 60.405 112.994 17.665 1.00 55.58  ? 503 LEU A CG    1 
ATOM   4114 C  CD1   . LEU A 1 503 ? 59.204 112.063 17.740 1.00 54.62  ? 503 LEU A CD1   1 
ATOM   4115 C  CD2   . LEU A 1 503 ? 61.623 112.335 18.298 1.00 56.58  ? 503 LEU A CD2   1 
ATOM   4116 N  N     . GLY A 1 504 ? 59.494 116.269 16.159 1.00 51.56  ? 504 GLY A N     1 
ATOM   4117 C  CA    . GLY A 1 504 ? 59.054 117.309 17.063 1.00 51.12  ? 504 GLY A CA    1 
ATOM   4118 C  C     . GLY A 1 504 ? 57.667 117.804 16.726 1.00 50.94  ? 504 GLY A C     1 
ATOM   4119 O  O     . GLY A 1 504 ? 56.800 117.908 17.595 1.00 51.15  ? 504 GLY A O     1 
ATOM   4120 N  N     . ILE A 1 505 ? 57.470 118.108 15.449 1.00 50.64  ? 505 ILE A N     1 
ATOM   4121 C  CA    . ILE A 1 505 ? 56.206 118.595 14.923 1.00 50.20  ? 505 ILE A CA    1 
ATOM   4122 C  C     . ILE A 1 505 ? 55.069 117.611 15.192 1.00 51.54  ? 505 ILE A C     1 
ATOM   4123 O  O     . ILE A 1 505 ? 54.036 117.987 15.737 1.00 52.70  ? 505 ILE A O     1 
ATOM   4124 C  CB    . ILE A 1 505 ? 56.320 118.809 13.408 1.00 51.28  ? 505 ILE A CB    1 
ATOM   4125 C  CG1   . ILE A 1 505 ? 57.334 119.909 13.119 1.00 53.69  ? 505 ILE A CG1   1 
ATOM   4126 C  CG2   . ILE A 1 505 ? 54.974 119.148 12.818 1.00 51.75  ? 505 ILE A CG2   1 
ATOM   4127 C  CD1   . ILE A 1 505 ? 57.628 120.104 11.639 1.00 55.34  ? 505 ILE A CD1   1 
ATOM   4128 N  N     . ILE A 1 506 ? 55.264 116.349 14.811 1.00 51.89  ? 506 ILE A N     1 
ATOM   4129 C  CA    . ILE A 1 506 ? 54.178 115.369 14.804 1.00 51.77  ? 506 ILE A CA    1 
ATOM   4130 C  C     . ILE A 1 506 ? 53.857 114.873 16.217 1.00 53.72  ? 506 ILE A C     1 
ATOM   4131 O  O     . ILE A 1 506 ? 52.706 114.566 16.520 1.00 55.14  ? 506 ILE A O     1 
ATOM   4132 C  CB    . ILE A 1 506 ? 54.522 114.154 13.879 1.00 48.55  ? 506 ILE A CB    1 
ATOM   4133 C  CG1   . ILE A 1 506 ? 54.805 114.652 12.468 1.00 47.23  ? 506 ILE A CG1   1 
ATOM   4134 C  CG2   . ILE A 1 506 ? 53.365 113.177 13.813 1.00 43.08  ? 506 ILE A CG2   1 
ATOM   4135 C  CD1   . ILE A 1 506 ? 55.199 113.575 11.514 1.00 48.99  ? 506 ILE A CD1   1 
ATOM   4136 N  N     . GLN A 1 507 ? 54.863 114.809 17.083 1.00 53.74  ? 507 GLN A N     1 
ATOM   4137 C  CA    . GLN A 1 507 ? 54.640 114.387 18.458 1.00 55.14  ? 507 GLN A CA    1 
ATOM   4138 C  C     . GLN A 1 507 ? 53.759 115.391 19.189 1.00 55.14  ? 507 GLN A C     1 
ATOM   4139 O  O     . GLN A 1 507 ? 53.160 115.071 20.212 1.00 54.48  ? 507 GLN A O     1 
ATOM   4140 C  CB    . GLN A 1 507 ? 55.974 114.247 19.185 1.00 59.00  ? 507 GLN A CB    1 
ATOM   4141 C  CG    . GLN A 1 507 ? 56.168 112.905 19.879 1.00 65.27  ? 507 GLN A CG    1 
ATOM   4142 C  CD    . GLN A 1 507 ? 55.895 112.969 21.376 1.00 70.42  ? 507 GLN A CD    1 
ATOM   4143 O  OE1   . GLN A 1 507 ? 56.746 112.588 22.190 1.00 72.82  ? 507 GLN A OE1   1 
ATOM   4144 N  NE2   . GLN A 1 507 ? 54.706 113.452 21.748 1.00 71.33  ? 507 GLN A NE2   1 
ATOM   4145 N  N     . ALA A 1 508 ? 53.690 116.611 18.652 1.00 55.97  ? 508 ALA A N     1 
ATOM   4146 C  CA    . ALA A 1 508 ? 52.892 117.693 19.237 1.00 55.34  ? 508 ALA A CA    1 
ATOM   4147 C  C     . ALA A 1 508 ? 51.455 117.620 18.733 1.00 56.58  ? 508 ALA A C     1 
ATOM   4148 O  O     . ALA A 1 508 ? 50.601 118.429 19.105 1.00 58.71  ? 508 ALA A O     1 
ATOM   4149 C  CB    . ALA A 1 508 ? 53.495 119.028 18.879 1.00 49.96  ? 508 ALA A CB    1 
ATOM   4150 N  N     . GLN A 1 509 ? 51.202 116.650 17.865 1.00 55.82  ? 509 GLN A N     1 
ATOM   4151 C  CA    . GLN A 1 509 ? 49.850 116.350 17.420 1.00 55.07  ? 509 GLN A CA    1 
ATOM   4152 C  C     . GLN A 1 509 ? 49.148 117.537 16.784 1.00 52.65  ? 509 GLN A C     1 
ATOM   4153 O  O     . GLN A 1 509 ? 48.099 117.970 17.246 1.00 52.61  ? 509 GLN A O     1 
ATOM   4154 C  CB    . GLN A 1 509 ? 49.025 115.814 18.595 1.00 56.76  ? 509 GLN A CB    1 
ATOM   4155 C  CG    . GLN A 1 509 ? 49.435 114.407 18.993 1.00 58.21  ? 509 GLN A CG    1 
ATOM   4156 C  CD    . GLN A 1 509 ? 48.607 113.844 20.124 1.00 60.26  ? 509 GLN A CD    1 
ATOM   4157 O  OE1   . GLN A 1 509 ? 48.343 112.645 20.163 1.00 63.64  ? 509 GLN A OE1   1 
ATOM   4158 N  NE2   . GLN A 1 509 ? 48.198 114.700 21.058 1.00 58.44  ? 509 GLN A NE2   1 
ATOM   4159 N  N     . PRO A 1 510 ? 49.714 118.062 15.701 1.00 51.18  ? 510 PRO A N     1 
ATOM   4160 C  CA    . PRO A 1 510 ? 49.089 119.145 14.940 1.00 52.18  ? 510 PRO A CA    1 
ATOM   4161 C  C     . PRO A 1 510 ? 47.736 118.690 14.414 1.00 54.06  ? 510 PRO A C     1 
ATOM   4162 O  O     . PRO A 1 510 ? 47.590 117.513 14.131 1.00 55.25  ? 510 PRO A O     1 
ATOM   4163 C  CB    . PRO A 1 510 ? 50.070 119.400 13.802 1.00 48.69  ? 510 PRO A CB    1 
ATOM   4164 C  CG    . PRO A 1 510 ? 51.366 118.741 14.240 1.00 48.80  ? 510 PRO A CG    1 
ATOM   4165 C  CD    . PRO A 1 510 ? 50.957 117.581 15.075 1.00 49.89  ? 510 PRO A CD    1 
ATOM   4166 N  N     . ASP A 1 511 ? 46.749 119.577 14.287 1.00 54.88  ? 511 ASP A N     1 
ATOM   4167 C  CA    . ASP A 1 511 ? 45.680 119.314 13.335 1.00 56.37  ? 511 ASP A CA    1 
ATOM   4168 C  C     . ASP A 1 511 ? 45.573 120.446 12.350 1.00 56.84  ? 511 ASP A C     1 
ATOM   4169 O  O     . ASP A 1 511 ? 44.600 120.527 11.604 1.00 58.71  ? 511 ASP A O     1 
ATOM   4170 C  CB    . ASP A 1 511 ? 44.325 119.086 14.024 1.00 57.76  ? 511 ASP A CB    1 
ATOM   4171 C  CG    . ASP A 1 511 ? 43.955 120.187 14.997 1.00 59.57  ? 511 ASP A CG    1 
ATOM   4172 O  OD1   . ASP A 1 511 ? 43.220 119.890 15.972 1.00 58.42  ? 511 ASP A OD1   1 
ATOM   4173 O  OD2   . ASP A 1 511 ? 44.395 121.339 14.789 1.00 60.23  ? 511 ASP A OD2   1 
ATOM   4174 N  N     . GLN A 1 512 ? 46.579 121.307 12.319 1.00 56.77  ? 512 GLN A N     1 
ATOM   4175 C  CA    . GLN A 1 512 ? 46.504 122.415 11.406 1.00 57.46  ? 512 GLN A CA    1 
ATOM   4176 C  C     . GLN A 1 512 ? 47.846 123.120 11.228 1.00 56.31  ? 512 GLN A C     1 
ATOM   4177 O  O     . GLN A 1 512 ? 48.440 123.584 12.193 1.00 56.52  ? 512 GLN A O     1 
ATOM   4178 C  CB    . GLN A 1 512 ? 45.458 123.364 11.960 1.00 59.78  ? 512 GLN A CB    1 
ATOM   4179 C  CG    . GLN A 1 512 ? 44.835 124.294 10.959 1.00 65.51  ? 512 GLN A CG    1 
ATOM   4180 C  CD    . GLN A 1 512 ? 44.132 125.428 11.715 1.00 67.04  ? 512 GLN A CD    1 
ATOM   4181 O  OE1   . GLN A 1 512 ? 44.246 126.648 11.331 1.00 69.09  ? 512 GLN A OE1   1 
ATOM   4182 N  NE2   . GLN A 1 512 ? 43.401 125.045 12.822 1.00 65.39  ? 512 GLN A NE2   1 
ATOM   4183 N  N     . SER A 1 513 ? 48.330 123.198 9.999  1.00 53.83  ? 513 SER A N     1 
ATOM   4184 C  CA    . SER A 1 513 ? 49.636 123.782 9.758  1.00 54.64  ? 513 SER A CA    1 
ATOM   4185 C  C     . SER A 1 513 ? 49.579 124.651 8.502  1.00 56.37  ? 513 SER A C     1 
ATOM   4186 O  O     . SER A 1 513 ? 48.898 124.317 7.537  1.00 57.96  ? 513 SER A O     1 
ATOM   4187 C  CB    . SER A 1 513 ? 50.687 122.690 9.575  1.00 53.96  ? 513 SER A CB    1 
ATOM   4188 O  OG    . SER A 1 513 ? 51.702 123.100 8.686  1.00 51.75  ? 513 SER A OG    1 
ATOM   4189 N  N     . GLU A 1 514 ? 50.316 125.749 8.500  1.00 57.31  ? 514 GLU A N     1 
ATOM   4190 C  CA    . GLU A 1 514 ? 50.493 126.533 7.281  1.00 58.37  ? 514 GLU A CA    1 
ATOM   4191 C  C     . GLU A 1 514 ? 51.220 125.777 6.167  1.00 58.40  ? 514 GLU A C     1 
ATOM   4192 O  O     . GLU A 1 514 ? 51.358 126.283 5.041  1.00 57.43  ? 514 GLU A O     1 
ATOM   4193 C  CB    . GLU A 1 514 ? 51.254 127.808 7.587  1.00 59.68  ? 514 GLU A CB    1 
ATOM   4194 C  CG    . GLU A 1 514 ? 52.578 127.598 8.353  1.00 64.66  ? 514 GLU A CG    1 
ATOM   4195 C  CD    . GLU A 1 514 ? 53.325 128.929 8.639  1.00 69.01  ? 514 GLU A CD    1 
ATOM   4196 O  OE1   . GLU A 1 514 ? 53.048 129.574 9.689  1.00 70.72  ? 514 GLU A OE1   1 
ATOM   4197 O  OE2   . GLU A 1 514 ? 54.174 129.347 7.804  1.00 69.46  ? 514 GLU A OE2   1 
ATOM   4198 N  N     . SER A 1 515 ? 51.690 124.578 6.492  1.00 57.28  ? 515 SER A N     1 
ATOM   4199 C  CA    . SER A 1 515 ? 52.407 123.743 5.555  1.00 55.66  ? 515 SER A CA    1 
ATOM   4200 C  C     . SER A 1 515 ? 51.494 122.684 4.941  1.00 56.25  ? 515 SER A C     1 
ATOM   4201 O  O     . SER A 1 515 ? 50.914 121.857 5.648  1.00 56.09  ? 515 SER A O     1 
ATOM   4202 C  CB    . SER A 1 515 ? 53.571 123.082 6.275  1.00 55.04  ? 515 SER A CB    1 
ATOM   4203 O  OG    . SER A 1 515 ? 54.464 122.529 5.336  1.00 55.22  ? 515 SER A OG    1 
ATOM   4204 N  N     . GLU A 1 516 ? 51.377 122.714 3.616  1.00 57.20  ? 516 GLU A N     1 
ATOM   4205 C  CA    . GLU A 1 516 ? 50.532 121.776 2.880  1.00 58.94  ? 516 GLU A CA    1 
ATOM   4206 C  C     . GLU A 1 516 ? 50.963 120.334 3.125  1.00 58.88  ? 516 GLU A C     1 
ATOM   4207 O  O     . GLU A 1 516 ? 50.123 119.435 3.255  1.00 58.95  ? 516 GLU A O     1 
ATOM   4208 C  CB    . GLU A 1 516 ? 50.591 122.089 1.379  1.00 62.75  ? 516 GLU A CB    1 
ATOM   4209 C  CG    . GLU A 1 516 ? 50.135 120.955 0.446  1.00 72.24  ? 516 GLU A CG    1 
ATOM   4210 C  CD    . GLU A 1 516 ? 48.703 120.477 0.718  1.00 78.20  ? 516 GLU A CD    1 
ATOM   4211 O  OE1   . GLU A 1 516 ? 48.296 119.421 0.161  1.00 78.82  ? 516 GLU A OE1   1 
ATOM   4212 O  OE2   . GLU A 1 516 ? 47.984 121.160 1.491  1.00 82.04  ? 516 GLU A OE2   1 
ATOM   4213 N  N     . LEU A 1 517 ? 52.278 120.128 3.195  1.00 57.61  ? 517 LEU A N     1 
ATOM   4214 C  CA    . LEU A 1 517 ? 52.869 118.824 3.475  1.00 53.37  ? 517 LEU A CA    1 
ATOM   4215 C  C     . LEU A 1 517 ? 52.446 118.303 4.842  1.00 51.41  ? 517 LEU A C     1 
ATOM   4216 O  O     . LEU A 1 517 ? 52.036 117.153 4.959  1.00 50.64  ? 517 LEU A O     1 
ATOM   4217 C  CB    . LEU A 1 517 ? 54.392 118.929 3.412  1.00 52.61  ? 517 LEU A CB    1 
ATOM   4218 C  CG    . LEU A 1 517 ? 55.256 117.665 3.441  1.00 50.86  ? 517 LEU A CG    1 
ATOM   4219 C  CD1   . LEU A 1 517 ? 54.738 116.649 2.449  1.00 49.31  ? 517 LEU A CD1   1 
ATOM   4220 C  CD2   . LEU A 1 517 ? 56.691 118.050 3.118  1.00 49.97  ? 517 LEU A CD2   1 
ATOM   4221 N  N     . VAL A 1 518 ? 52.539 119.142 5.872  1.00 48.94  ? 518 VAL A N     1 
ATOM   4222 C  CA    . VAL A 1 518 ? 52.169 118.706 7.219  1.00 48.35  ? 518 VAL A CA    1 
ATOM   4223 C  C     . VAL A 1 518 ? 50.672 118.510 7.290  1.00 48.92  ? 518 VAL A C     1 
ATOM   4224 O  O     . VAL A 1 518 ? 50.162 117.814 8.168  1.00 48.03  ? 518 VAL A O     1 
ATOM   4225 C  CB    . VAL A 1 518 ? 52.543 119.727 8.298  1.00 46.06  ? 518 VAL A CB    1 
ATOM   4226 C  CG1   . VAL A 1 518 ? 52.313 119.127 9.649  1.00 43.29  ? 518 VAL A CG1   1 
ATOM   4227 C  CG2   . VAL A 1 518 ? 53.971 120.143 8.155  1.00 45.69  ? 518 VAL A CG2   1 
ATOM   4228 N  N     . ASN A 1 519 ? 49.972 119.145 6.359  1.00 49.66  ? 519 ASN A N     1 
ATOM   4229 C  CA    . ASN A 1 519 ? 48.538 118.961 6.230  1.00 51.60  ? 519 ASN A CA    1 
ATOM   4230 C  C     . ASN A 1 519 ? 48.244 117.655 5.493  1.00 51.40  ? 519 ASN A C     1 
ATOM   4231 O  O     . ASN A 1 519 ? 47.305 116.936 5.843  1.00 51.94  ? 519 ASN A O     1 
ATOM   4232 C  CB    . ASN A 1 519 ? 47.903 120.162 5.495  1.00 53.58  ? 519 ASN A CB    1 
ATOM   4233 C  CG    . ASN A 1 519 ? 47.515 121.316 6.448  1.00 54.71  ? 519 ASN A CG    1 
ATOM   4234 O  OD1   . ASN A 1 519 ? 46.913 121.102 7.501  1.00 54.35  ? 519 ASN A OD1   1 
ATOM   4235 N  ND2   . ASN A 1 519 ? 47.862 122.536 6.067  1.00 53.74  ? 519 ASN A ND2   1 
ATOM   4236 N  N     . GLN A 1 520 ? 49.054 117.339 4.485  1.00 51.56  ? 520 GLN A N     1 
ATOM   4237 C  CA    . GLN A 1 520 ? 48.958 116.043 3.815  1.00 51.98  ? 520 GLN A CA    1 
ATOM   4238 C  C     . GLN A 1 520 ? 49.277 114.915 4.796  1.00 50.33  ? 520 GLN A C     1 
ATOM   4239 O  O     . GLN A 1 520 ? 48.677 113.858 4.746  1.00 51.82  ? 520 GLN A O     1 
ATOM   4240 C  CB    . GLN A 1 520 ? 49.923 115.974 2.623  1.00 55.51  ? 520 GLN A CB    1 
ATOM   4241 C  CG    . GLN A 1 520 ? 49.522 116.795 1.391  1.00 59.94  ? 520 GLN A CG    1 
ATOM   4242 C  CD    . GLN A 1 520 ? 50.723 117.112 0.492  1.00 65.10  ? 520 GLN A CD    1 
ATOM   4243 O  OE1   . GLN A 1 520 ? 51.649 117.823 0.906  1.00 66.42  ? 520 GLN A OE1   1 
ATOM   4244 N  NE2   . GLN A 1 520 ? 50.716 116.581 -0.738 1.00 65.35  ? 520 GLN A NE2   1 
ATOM   4245 N  N     . ILE A 1 521 ? 50.228 115.151 5.692  1.00 49.37  ? 521 ILE A N     1 
ATOM   4246 C  CA    . ILE A 1 521 ? 50.602 114.188 6.735  1.00 45.82  ? 521 ILE A CA    1 
ATOM   4247 C  C     . ILE A 1 521 ? 49.519 114.012 7.794  1.00 45.97  ? 521 ILE A C     1 
ATOM   4248 O  O     . ILE A 1 521 ? 49.280 112.912 8.276  1.00 44.59  ? 521 ILE A O     1 
ATOM   4249 C  CB    . ILE A 1 521 ? 51.916 114.634 7.417  1.00 43.59  ? 521 ILE A CB    1 
ATOM   4250 C  CG1   . ILE A 1 521 ? 53.079 114.454 6.438  1.00 41.27  ? 521 ILE A CG1   1 
ATOM   4251 C  CG2   . ILE A 1 521 ? 52.112 113.888 8.721  1.00 40.46  ? 521 ILE A CG2   1 
ATOM   4252 C  CD1   . ILE A 1 521 ? 54.406 114.937 6.938  1.00 40.53  ? 521 ILE A CD1   1 
ATOM   4253 N  N     . ILE A 1 522 ? 48.873 115.118 8.145  1.00 48.92  ? 522 ILE A N     1 
ATOM   4254 C  CA    . ILE A 1 522 ? 47.729 115.141 9.055  1.00 50.89  ? 522 ILE A CA    1 
ATOM   4255 C  C     . ILE A 1 522 ? 46.466 114.416 8.536  1.00 54.46  ? 522 ILE A C     1 
ATOM   4256 O  O     . ILE A 1 522 ? 45.796 113.686 9.287  1.00 52.12  ? 522 ILE A O     1 
ATOM   4257 C  CB    . ILE A 1 522 ? 47.356 116.599 9.389  1.00 48.72  ? 522 ILE A CB    1 
ATOM   4258 C  CG1   . ILE A 1 522 ? 48.472 117.239 10.217 1.00 47.23  ? 522 ILE A CG1   1 
ATOM   4259 C  CG2   . ILE A 1 522 ? 46.014 116.646 10.108 1.00 47.85  ? 522 ILE A CG2   1 
ATOM   4260 C  CD1   . ILE A 1 522 ? 48.116 118.574 10.794 1.00 43.85  ? 522 ILE A CD1   1 
ATOM   4261 N  N     . GLU A 1 523 ? 46.139 114.620 7.258  1.00 57.74  ? 523 GLU A N     1 
ATOM   4262 C  CA    . GLU A 1 523 ? 44.992 113.941 6.659  1.00 60.78  ? 523 GLU A CA    1 
ATOM   4263 C  C     . GLU A 1 523 ? 45.174 112.421 6.710  1.00 60.55  ? 523 GLU A C     1 
ATOM   4264 O  O     . GLU A 1 523 ? 44.227 111.681 6.987  1.00 61.33  ? 523 GLU A O     1 
ATOM   4265 C  CB    . GLU A 1 523 ? 44.779 114.406 5.205  1.00 63.94  ? 523 GLU A CB    1 
ATOM   4266 C  CG    . GLU A 1 523 ? 46.044 114.454 4.340  1.00 69.47  ? 523 GLU A CG    1 
ATOM   4267 C  CD    . GLU A 1 523 ? 46.057 113.433 3.185  1.00 73.11  ? 523 GLU A CD    1 
ATOM   4268 O  OE1   . GLU A 1 523 ? 45.568 112.294 3.378  1.00 73.98  ? 523 GLU A OE1   1 
ATOM   4269 O  OE2   . GLU A 1 523 ? 46.568 113.771 2.082  1.00 74.39  ? 523 GLU A OE2   1 
ATOM   4270 N  N     . GLN A 1 524 ? 46.394 111.960 6.450  1.00 59.55  ? 524 GLN A N     1 
ATOM   4271 C  CA    . GLN A 1 524 ? 46.713 110.549 6.594  1.00 58.04  ? 524 GLN A CA    1 
ATOM   4272 C  C     . GLN A 1 524 ? 46.520 110.146 8.048  1.00 57.73  ? 524 GLN A C     1 
ATOM   4273 O  O     . GLN A 1 524 ? 45.709 109.281 8.348  1.00 57.83  ? 524 GLN A O     1 
ATOM   4274 C  CB    . GLN A 1 524 ? 48.151 110.283 6.160  1.00 57.42  ? 524 GLN A CB    1 
ATOM   4275 C  CG    . GLN A 1 524 ? 48.378 110.486 4.678  1.00 59.37  ? 524 GLN A CG    1 
ATOM   4276 C  CD    . GLN A 1 524 ? 47.546 109.536 3.841  1.00 61.39  ? 524 GLN A CD    1 
ATOM   4277 O  OE1   . GLN A 1 524 ? 46.778 108.742 4.375  1.00 63.30  ? 524 GLN A OE1   1 
ATOM   4278 N  NE2   . GLN A 1 524 ? 47.700 109.606 2.525  1.00 62.85  ? 524 GLN A NE2   1 
ATOM   4279 N  N     . LEU A 1 525 ? 47.248 110.797 8.952  1.00 56.97  ? 525 LEU A N     1 
ATOM   4280 C  CA    . LEU A 1 525 ? 47.182 110.483 10.378 1.00 55.51  ? 525 LEU A CA    1 
ATOM   4281 C  C     . LEU A 1 525 ? 45.763 110.294 10.892 1.00 56.18  ? 525 LEU A C     1 
ATOM   4282 O  O     . LEU A 1 525 ? 45.503 109.429 11.729 1.00 55.43  ? 525 LEU A O     1 
ATOM   4283 C  CB    . LEU A 1 525 ? 47.865 111.588 11.180 1.00 53.53  ? 525 LEU A CB    1 
ATOM   4284 C  CG    . LEU A 1 525 ? 49.375 111.479 11.129 1.00 50.36  ? 525 LEU A CG    1 
ATOM   4285 C  CD1   . LEU A 1 525 ? 50.032 112.508 12.003 1.00 49.44  ? 525 LEU A CD1   1 
ATOM   4286 C  CD2   . LEU A 1 525 ? 49.727 110.104 11.604 1.00 50.48  ? 525 LEU A CD2   1 
ATOM   4287 N  N     . ILE A 1 526 ? 44.849 111.118 10.393 1.00 57.56  ? 526 ILE A N     1 
ATOM   4288 C  CA    . ILE A 1 526 ? 43.459 111.067 10.828 1.00 58.17  ? 526 ILE A CA    1 
ATOM   4289 C  C     . ILE A 1 526 ? 42.805 109.799 10.299 1.00 57.58  ? 526 ILE A C     1 
ATOM   4290 O  O     . ILE A 1 526 ? 41.788 109.361 10.827 1.00 59.14  ? 526 ILE A O     1 
ATOM   4291 C  CB    . ILE A 1 526 ? 42.658 112.298 10.319 1.00 58.62  ? 526 ILE A CB    1 
ATOM   4292 C  CG1   . ILE A 1 526 ? 43.322 113.592 10.795 1.00 59.51  ? 526 ILE A CG1   1 
ATOM   4293 C  CG2   . ILE A 1 526 ? 41.243 112.253 10.849 1.00 56.71  ? 526 ILE A CG2   1 
ATOM   4294 C  CD1   . ILE A 1 526 ? 42.794 114.829 10.106 1.00 57.91  ? 526 ILE A CD1   1 
ATOM   4295 N  N     . LYS A 1 527 ? 43.400 109.217 9.259  1.00 55.88  ? 527 LYS A N     1 
ATOM   4296 C  CA    . LYS A 1 527 ? 42.868 108.013 8.620  1.00 54.37  ? 527 LYS A CA    1 
ATOM   4297 C  C     . LYS A 1 527 ? 43.356 106.682 9.217  1.00 52.67  ? 527 LYS A C     1 
ATOM   4298 O  O     . LYS A 1 527 ? 42.686 105.673 9.087  1.00 53.28  ? 527 LYS A O     1 
ATOM   4299 C  CB    . LYS A 1 527 ? 43.185 108.031 7.119  1.00 55.02  ? 527 LYS A CB    1 
ATOM   4300 C  CG    . LYS A 1 527 ? 42.238 108.853 6.264  1.00 56.64  ? 527 LYS A CG    1 
ATOM   4301 C  CD    . LYS A 1 527 ? 42.591 108.710 4.781  1.00 57.55  ? 527 LYS A CD    1 
ATOM   4302 C  CE    . LYS A 1 527 ? 41.366 108.867 3.869  1.00 57.84  ? 527 LYS A CE    1 
ATOM   4303 N  NZ    . LYS A 1 527 ? 41.506 108.157 2.543  1.00 58.68  ? 527 LYS A NZ    1 
ATOM   4304 N  N     . LYS A 1 528 ? 44.520 106.662 9.852  1.00 52.14  ? 528 LYS A N     1 
ATOM   4305 C  CA    . LYS A 1 528 ? 45.014 105.428 10.452 1.00 52.40  ? 528 LYS A CA    1 
ATOM   4306 C  C     . LYS A 1 528 ? 44.196 105.124 11.701 1.00 53.88  ? 528 LYS A C     1 
ATOM   4307 O  O     . LYS A 1 528 ? 43.472 105.983 12.208 1.00 53.41  ? 528 LYS A O     1 
ATOM   4308 C  CB    . LYS A 1 528 ? 46.493 105.542 10.852 1.00 49.67  ? 528 LYS A CB    1 
ATOM   4309 C  CG    . LYS A 1 528 ? 47.422 106.030 9.770  1.00 48.45  ? 528 LYS A CG    1 
ATOM   4310 C  CD    . LYS A 1 528 ? 47.269 105.233 8.490  1.00 47.67  ? 528 LYS A CD    1 
ATOM   4311 C  CE    . LYS A 1 528 ? 48.291 105.674 7.446  1.00 47.22  ? 528 LYS A CE    1 
ATOM   4312 N  NZ    . LYS A 1 528 ? 48.806 104.521 6.651  1.00 44.63  ? 528 LYS A NZ    1 
ATOM   4313 N  N     . GLU A 1 529 ? 44.320 103.900 12.194 1.00 54.47  ? 529 GLU A N     1 
ATOM   4314 C  CA    . GLU A 1 529 ? 43.714 103.541 13.456 1.00 56.62  ? 529 GLU A CA    1 
ATOM   4315 C  C     . GLU A 1 529 ? 44.759 103.560 14.564 1.00 57.07  ? 529 GLU A C     1 
ATOM   4316 O  O     . GLU A 1 529 ? 44.424 103.670 15.740 1.00 58.34  ? 529 GLU A O     1 
ATOM   4317 C  CB    . GLU A 1 529 ? 43.095 102.164 13.330 1.00 59.88  ? 529 GLU A CB    1 
ATOM   4318 C  CG    . GLU A 1 529 ? 42.396 101.984 11.999 1.00 66.15  ? 529 GLU A CG    1 
ATOM   4319 C  CD    . GLU A 1 529 ? 41.135 101.132 12.099 1.00 70.99  ? 529 GLU A CD    1 
ATOM   4320 O  OE1   . GLU A 1 529 ? 41.269 99.907  12.374 1.00 69.36  ? 529 GLU A OE1   1 
ATOM   4321 O  OE2   . GLU A 1 529 ? 40.020 101.697 11.900 1.00 72.24  ? 529 GLU A OE2   1 
ATOM   4322 N  N     . LYS A 1 530 ? 46.028 103.444 14.182 1.00 55.98  ? 530 LYS A N     1 
ATOM   4323 C  CA    . LYS A 1 530 ? 47.143 103.558 15.117 1.00 53.74  ? 530 LYS A CA    1 
ATOM   4324 C  C     . LYS A 1 530 ? 48.392 103.922 14.335 1.00 52.56  ? 530 LYS A C     1 
ATOM   4325 O  O     . LYS A 1 530 ? 48.589 103.449 13.227 1.00 52.90  ? 530 LYS A O     1 
ATOM   4326 C  CB    . LYS A 1 530 ? 47.387 102.238 15.842 1.00 53.68  ? 530 LYS A CB    1 
ATOM   4327 C  CG    . LYS A 1 530 ? 46.386 101.892 16.920 1.00 55.07  ? 530 LYS A CG    1 
ATOM   4328 C  CD    . LYS A 1 530 ? 46.773 100.572 17.571 1.00 56.60  ? 530 LYS A CD    1 
ATOM   4329 C  CE    . LYS A 1 530 ? 45.779 100.121 18.627 1.00 56.20  ? 530 LYS A CE    1 
ATOM   4330 N  NZ    . LYS A 1 530 ? 46.179 98.780  19.135 1.00 56.88  ? 530 LYS A NZ    1 
ATOM   4331 N  N     . VAL A 1 531 ? 49.221 104.775 14.918 1.00 52.12  ? 531 VAL A N     1 
ATOM   4332 C  CA    . VAL A 1 531 ? 50.521 105.135 14.364 1.00 50.88  ? 531 VAL A CA    1 
ATOM   4333 C  C     . VAL A 1 531 ? 51.511 105.218 15.523 1.00 51.59  ? 531 VAL A C     1 
ATOM   4334 O  O     . VAL A 1 531 ? 51.246 105.859 16.544 1.00 51.26  ? 531 VAL A O     1 
ATOM   4335 C  CB    . VAL A 1 531 ? 50.478 106.510 13.651 1.00 49.74  ? 531 VAL A CB    1 
ATOM   4336 C  CG1   . VAL A 1 531 ? 51.874 106.952 13.289 1.00 50.61  ? 531 VAL A CG1   1 
ATOM   4337 C  CG2   . VAL A 1 531 ? 49.648 106.424 12.398 1.00 50.68  ? 531 VAL A CG2   1 
ATOM   4338 N  N     . TYR A 1 532 ? 52.644 104.550 15.385 1.00 51.41  ? 532 TYR A N     1 
ATOM   4339 C  CA    . TYR A 1 532 ? 53.708 104.744 16.347 1.00 51.83  ? 532 TYR A CA    1 
ATOM   4340 C  C     . TYR A 1 532 ? 54.892 105.388 15.667 1.00 52.04  ? 532 TYR A C     1 
ATOM   4341 O  O     . TYR A 1 532 ? 55.331 104.950 14.598 1.00 51.28  ? 532 TYR A O     1 
ATOM   4342 C  CB    . TYR A 1 532 ? 54.139 103.430 16.957 1.00 52.19  ? 532 TYR A CB    1 
ATOM   4343 C  CG    . TYR A 1 532 ? 55.245 103.589 17.960 1.00 53.13  ? 532 TYR A CG    1 
ATOM   4344 C  CD1   . TYR A 1 532 ? 55.017 104.218 19.174 1.00 54.20  ? 532 TYR A CD1   1 
ATOM   4345 C  CD2   . TYR A 1 532 ? 56.507 103.066 17.719 1.00 54.55  ? 532 TYR A CD2   1 
ATOM   4346 C  CE1   . TYR A 1 532 ? 56.020 104.320 20.132 1.00 55.08  ? 532 TYR A CE1   1 
ATOM   4347 C  CE2   . TYR A 1 532 ? 57.513 103.162 18.666 1.00 55.80  ? 532 TYR A CE2   1 
ATOM   4348 C  CZ    . TYR A 1 532 ? 57.267 103.790 19.871 1.00 55.50  ? 532 TYR A CZ    1 
ATOM   4349 O  OH    . TYR A 1 532 ? 58.274 103.895 20.805 1.00 55.65  ? 532 TYR A OH    1 
ATOM   4350 N  N     . LEU A 1 533 ? 55.399 106.439 16.299 1.00 51.22  ? 533 LEU A N     1 
ATOM   4351 C  CA    . LEU A 1 533 ? 56.504 107.198 15.755 1.00 49.51  ? 533 LEU A CA    1 
ATOM   4352 C  C     . LEU A 1 533 ? 57.698 107.072 16.682 1.00 48.87  ? 533 LEU A C     1 
ATOM   4353 O  O     . LEU A 1 533 ? 57.639 107.493 17.832 1.00 48.38  ? 533 LEU A O     1 
ATOM   4354 C  CB    . LEU A 1 533 ? 56.106 108.661 15.610 1.00 48.64  ? 533 LEU A CB    1 
ATOM   4355 C  CG    . LEU A 1 533 ? 57.052 109.420 14.689 1.00 49.48  ? 533 LEU A CG    1 
ATOM   4356 C  CD1   . LEU A 1 533 ? 56.880 108.909 13.267 1.00 48.77  ? 533 LEU A CD1   1 
ATOM   4357 C  CD2   . LEU A 1 533 ? 56.787 110.902 14.771 1.00 48.08  ? 533 LEU A CD2   1 
ATOM   4358 N  N     . ALA A 1 534 ? 58.774 106.481 16.167 1.00 49.48  ? 534 ALA A N     1 
ATOM   4359 C  CA    . ALA A 1 534 ? 60.014 106.272 16.911 1.00 48.93  ? 534 ALA A CA    1 
ATOM   4360 C  C     . ALA A 1 534 ? 61.152 107.113 16.340 1.00 49.07  ? 534 ALA A C     1 
ATOM   4361 O  O     . ALA A 1 534 ? 61.220 107.371 15.142 1.00 48.27  ? 534 ALA A O     1 
ATOM   4362 C  CB    . ALA A 1 534 ? 60.390 104.807 16.867 1.00 49.56  ? 534 ALA A CB    1 
ATOM   4363 N  N     . TRP A 1 535 ? 62.058 107.547 17.197 1.00 50.75  ? 535 TRP A N     1 
ATOM   4364 C  CA    . TRP A 1 535 ? 63.194 108.301 16.703 1.00 52.95  ? 535 TRP A CA    1 
ATOM   4365 C  C     . TRP A 1 535 ? 64.443 107.462 16.832 1.00 53.51  ? 535 TRP A C     1 
ATOM   4366 O  O     . TRP A 1 535 ? 64.485 106.522 17.622 1.00 52.87  ? 535 TRP A O     1 
ATOM   4367 C  CB    . TRP A 1 535 ? 63.354 109.605 17.478 1.00 54.29  ? 535 TRP A CB    1 
ATOM   4368 C  CG    . TRP A 1 535 ? 64.478 110.413 16.988 1.00 58.77  ? 535 TRP A CG    1 
ATOM   4369 C  CD1   . TRP A 1 535 ? 64.497 111.179 15.867 1.00 61.39  ? 535 TRP A CD1   1 
ATOM   4370 C  CD2   . TRP A 1 535 ? 65.789 110.505 17.566 1.00 61.59  ? 535 TRP A CD2   1 
ATOM   4371 N  NE1   . TRP A 1 535 ? 65.740 111.744 15.702 1.00 62.75  ? 535 TRP A NE1   1 
ATOM   4372 C  CE2   . TRP A 1 535 ? 66.545 111.349 16.730 1.00 62.88  ? 535 TRP A CE2   1 
ATOM   4373 C  CE3   . TRP A 1 535 ? 66.388 109.960 18.705 1.00 62.79  ? 535 TRP A CE3   1 
ATOM   4374 C  CZ2   . TRP A 1 535 ? 67.884 111.652 17.003 1.00 63.98  ? 535 TRP A CZ2   1 
ATOM   4375 C  CZ3   . TRP A 1 535 ? 67.717 110.265 18.971 1.00 63.16  ? 535 TRP A CZ3   1 
ATOM   4376 C  CH2   . TRP A 1 535 ? 68.448 111.104 18.126 1.00 64.16  ? 535 TRP A CH2   1 
ATOM   4377 N  N     . VAL A 1 536 ? 65.451 107.782 16.032 1.00 55.34  ? 536 VAL A N     1 
ATOM   4378 C  CA    . VAL A 1 536 ? 66.755 107.146 16.168 1.00 57.84  ? 536 VAL A CA    1 
ATOM   4379 C  C     . VAL A 1 536 ? 67.849 108.087 15.703 1.00 58.96  ? 536 VAL A C     1 
ATOM   4380 O  O     . VAL A 1 536 ? 67.650 108.880 14.783 1.00 59.96  ? 536 VAL A O     1 
ATOM   4381 C  CB    . VAL A 1 536 ? 66.880 105.842 15.329 1.00 57.66  ? 536 VAL A CB    1 
ATOM   4382 C  CG1   . VAL A 1 536 ? 65.927 104.782 15.841 1.00 55.81  ? 536 VAL A CG1   1 
ATOM   4383 C  CG2   . VAL A 1 536 ? 66.625 106.147 13.866 1.00 57.28  ? 536 VAL A CG2   1 
ATOM   4384 N  N     . PRO A 1 537 ? 69.027 107.995 16.334 1.00 59.48  ? 537 PRO A N     1 
ATOM   4385 C  CA    . PRO A 1 537 ? 70.250 108.663 15.896 1.00 59.77  ? 537 PRO A CA    1 
ATOM   4386 C  C     . PRO A 1 537 ? 70.585 108.408 14.428 1.00 60.69  ? 537 PRO A C     1 
ATOM   4387 O  O     . PRO A 1 537 ? 70.813 107.280 14.008 1.00 59.94  ? 537 PRO A O     1 
ATOM   4388 C  CB    . PRO A 1 537 ? 71.307 108.111 16.846 1.00 59.71  ? 537 PRO A CB    1 
ATOM   4389 C  CG    . PRO A 1 537 ? 70.542 107.833 18.088 1.00 60.44  ? 537 PRO A CG    1 
ATOM   4390 C  CD    . PRO A 1 537 ? 69.224 107.293 17.612 1.00 60.02  ? 537 PRO A CD    1 
ATOM   4391 N  N     . ALA A 1 538 ? 70.606 109.488 13.656 1.00 63.57  ? 538 ALA A N     1 
ATOM   4392 C  CA    . ALA A 1 538 ? 70.879 109.428 12.233 1.00 65.20  ? 538 ALA A CA    1 
ATOM   4393 C  C     . ALA A 1 538 ? 72.325 109.021 12.036 1.00 67.30  ? 538 ALA A C     1 
ATOM   4394 O  O     . ALA A 1 538 ? 73.179 109.303 12.882 1.00 67.02  ? 538 ALA A O     1 
ATOM   4395 C  CB    . ALA A 1 538 ? 70.623 110.790 11.607 1.00 64.23  ? 538 ALA A CB    1 
ATOM   4396 N  N     . HIS A 1 539 ? 72.597 108.343 10.928 1.00 70.67  ? 539 HIS A N     1 
ATOM   4397 C  CA    . HIS A 1 539 ? 73.974 108.049 10.550 1.00 73.91  ? 539 HIS A CA    1 
ATOM   4398 C  C     . HIS A 1 539 ? 74.696 107.112 11.523 1.00 74.55  ? 539 HIS A C     1 
ATOM   4399 O  O     . HIS A 1 539 ? 75.899 106.908 11.404 1.00 74.90  ? 539 HIS A O     1 
ATOM   4400 C  CB    . HIS A 1 539 ? 74.769 109.351 10.430 1.00 76.45  ? 539 HIS A CB    1 
ATOM   4401 C  CG    . HIS A 1 539 ? 74.248 110.292 9.385  1.00 79.58  ? 539 HIS A CG    1 
ATOM   4402 N  ND1   . HIS A 1 539 ? 74.131 109.939 8.055  1.00 81.24  ? 539 HIS A ND1   1 
ATOM   4403 C  CD2   . HIS A 1 539 ? 73.852 111.584 9.467  1.00 79.95  ? 539 HIS A CD2   1 
ATOM   4404 C  CE1   . HIS A 1 539 ? 73.690 110.975 7.365  1.00 81.71  ? 539 HIS A CE1   1 
ATOM   4405 N  NE2   . HIS A 1 539 ? 73.512 111.987 8.196  1.00 81.72  ? 539 HIS A NE2   1 
ATOM   4406 N  N     . LYS A 1 540 ? 73.973 106.542 12.483 1.00 75.67  ? 540 LYS A N     1 
ATOM   4407 C  CA    . LYS A 1 540 ? 74.596 105.659 13.466 1.00 75.35  ? 540 LYS A CA    1 
ATOM   4408 C  C     . LYS A 1 540 ? 74.452 104.176 13.102 1.00 75.82  ? 540 LYS A C     1 
ATOM   4409 O  O     . LYS A 1 540 ? 74.834 103.296 13.880 1.00 76.09  ? 540 LYS A O     1 
ATOM   4410 C  CB    . LYS A 1 540 ? 74.006 105.923 14.851 1.00 74.40  ? 540 LYS A CB    1 
ATOM   4411 C  CG    . LYS A 1 540 ? 75.042 105.940 15.937 1.00 74.69  ? 540 LYS A CG    1 
ATOM   4412 C  CD    . LYS A 1 540 ? 76.248 106.750 15.496 1.00 77.37  ? 540 LYS A CD    1 
ATOM   4413 C  CE    . LYS A 1 540 ? 75.873 108.210 15.241 1.00 79.32  ? 540 LYS A CE    1 
ATOM   4414 N  NZ    . LYS A 1 540 ? 77.062 109.106 15.080 1.00 79.01  ? 540 LYS A NZ    1 
ATOM   4415 N  N     . GLY A 1 541 ? 73.894 103.906 11.922 1.00 75.72  ? 541 GLY A N     1 
ATOM   4416 C  CA    . GLY A 1 541 ? 73.864 102.550 11.398 1.00 75.56  ? 541 GLY A CA    1 
ATOM   4417 C  C     . GLY A 1 541 ? 72.897 101.621 12.113 1.00 76.52  ? 541 GLY A C     1 
ATOM   4418 O  O     . GLY A 1 541 ? 73.143 100.420 12.235 1.00 76.16  ? 541 GLY A O     1 
ATOM   4419 N  N     . ILE A 1 542 ? 71.796 102.176 12.603 1.00 76.48  ? 542 ILE A N     1 
ATOM   4420 C  CA    . ILE A 1 542 ? 70.758 101.364 13.206 1.00 75.92  ? 542 ILE A CA    1 
ATOM   4421 C  C     . ILE A 1 542 ? 70.059 100.587 12.108 1.00 77.14  ? 542 ILE A C     1 
ATOM   4422 O  O     . ILE A 1 542 ? 69.851 101.098 11.010 1.00 76.27  ? 542 ILE A O     1 
ATOM   4423 C  CB    . ILE A 1 542 ? 69.721 102.234 13.952 1.00 74.93  ? 542 ILE A CB    1 
ATOM   4424 C  CG1   . ILE A 1 542 ? 70.273 102.672 15.308 1.00 73.42  ? 542 ILE A CG1   1 
ATOM   4425 C  CG2   . ILE A 1 542 ? 68.432 101.475 14.121 1.00 75.03  ? 542 ILE A CG2   1 
ATOM   4426 C  CD1   . ILE A 1 542 ? 71.434 103.615 15.220 1.00 71.97  ? 542 ILE A CD1   1 
ATOM   4427 N  N     . GLY A 1 543 ? 69.718 99.338  12.404 1.00 79.33  ? 543 GLY A N     1 
ATOM   4428 C  CA    . GLY A 1 543 ? 68.923 98.559  11.477 1.00 82.24  ? 543 GLY A CA    1 
ATOM   4429 C  C     . GLY A 1 543 ? 67.449 98.913  11.575 1.00 83.94  ? 543 GLY A C     1 
ATOM   4430 O  O     . GLY A 1 543 ? 66.800 98.676  12.602 1.00 84.40  ? 543 GLY A O     1 
ATOM   4431 N  N     . GLY A 1 544 ? 66.915 99.462  10.489 1.00 83.86  ? 544 GLY A N     1 
ATOM   4432 C  CA    . GLY A 1 544 ? 67.702 99.587  9.281  1.00 83.75  ? 544 GLY A CA    1 
ATOM   4433 C  C     . GLY A 1 544 ? 67.673 101.000 8.756  1.00 84.94  ? 544 GLY A C     1 
ATOM   4434 O  O     . GLY A 1 544 ? 67.566 101.212 7.549  1.00 85.95  ? 544 GLY A O     1 
ATOM   4435 N  N     . ASN A 1 545 ? 67.761 101.972 9.659  1.00 84.44  ? 545 ASN A N     1 
ATOM   4436 C  CA    . ASN A 1 545 ? 67.799 103.369 9.252  1.00 83.85  ? 545 ASN A CA    1 
ATOM   4437 C  C     . ASN A 1 545 ? 69.054 103.659 8.435  1.00 84.72  ? 545 ASN A C     1 
ATOM   4438 O  O     . ASN A 1 545 ? 69.256 104.784 7.986  1.00 84.94  ? 545 ASN A O     1 
ATOM   4439 C  CB    . ASN A 1 545 ? 67.764 104.288 10.475 1.00 82.07  ? 545 ASN A CB    1 
ATOM   4440 C  CG    . ASN A 1 545 ? 67.557 105.753 10.104 1.00 80.99  ? 545 ASN A CG    1 
ATOM   4441 O  OD1   . ASN A 1 545 ? 68.501 106.555 10.116 1.00 77.84  ? 545 ASN A OD1   1 
ATOM   4442 N  ND2   . ASN A 1 545 ? 66.312 106.108 9.774  1.00 80.08  ? 545 ASN A ND2   1 
ATOM   4443 N  N     . GLU A 1 546 ? 69.903 102.656 8.241  1.00 85.57  ? 546 GLU A N     1 
ATOM   4444 C  CA    . GLU A 1 546 ? 71.099 102.868 7.441  1.00 86.88  ? 546 GLU A CA    1 
ATOM   4445 C  C     . GLU A 1 546 ? 70.866 102.518 5.980  1.00 87.62  ? 546 GLU A C     1 
ATOM   4446 O  O     . GLU A 1 546 ? 71.548 103.039 5.093  1.00 88.09  ? 546 GLU A O     1 
ATOM   4447 C  CB    . GLU A 1 546 ? 72.276 102.048 7.971  1.00 87.76  ? 546 GLU A CB    1 
ATOM   4448 C  CG    . GLU A 1 546 ? 73.584 102.366 7.234  1.00 89.44  ? 546 GLU A CG    1 
ATOM   4449 C  CD    . GLU A 1 546 ? 74.719 101.400 7.554  1.00 89.99  ? 546 GLU A CD    1 
ATOM   4450 O  OE1   . GLU A 1 546 ? 75.860 101.877 7.757  1.00 89.12  ? 546 GLU A OE1   1 
ATOM   4451 O  OE2   . GLU A 1 546 ? 74.472 100.171 7.596  1.00 89.66  ? 546 GLU A OE2   1 
ATOM   4452 N  N     . GLN A 1 547 ? 69.909 101.630 5.731  1.00 88.12  ? 547 GLN A N     1 
ATOM   4453 C  CA    . GLN A 1 547 ? 69.599 101.209 4.367  1.00 88.47  ? 547 GLN A CA    1 
ATOM   4454 C  C     . GLN A 1 547 ? 68.724 102.251 3.704  1.00 87.27  ? 547 GLN A C     1 
ATOM   4455 O  O     . GLN A 1 547 ? 68.913 102.584 2.540  1.00 86.85  ? 547 GLN A O     1 
ATOM   4456 C  CB    . GLN A 1 547 ? 68.869 99.863  4.367  1.00 90.27  ? 547 GLN A CB    1 
ATOM   4457 C  CG    . GLN A 1 547 ? 69.765 98.653  4.565  1.00 92.09  ? 547 GLN A CG    1 
ATOM   4458 C  CD    . GLN A 1 547 ? 69.116 97.599  5.437  1.00 93.86  ? 547 GLN A CD    1 
ATOM   4459 O  OE1   . GLN A 1 547 ? 69.118 97.714  6.663  1.00 95.41  ? 547 GLN A OE1   1 
ATOM   4460 N  NE2   . GLN A 1 547 ? 68.553 96.566  4.810  1.00 94.38  ? 547 GLN A NE2   1 
ATOM   4461 N  N     . VAL A 1 548 ? 67.762 102.762 4.460  1.00 86.62  ? 548 VAL A N     1 
ATOM   4462 C  CA    . VAL A 1 548 ? 66.919 103.835 3.977  1.00 85.64  ? 548 VAL A CA    1 
ATOM   4463 C  C     . VAL A 1 548 ? 67.846 104.975 3.630  1.00 86.25  ? 548 VAL A C     1 
ATOM   4464 O  O     . VAL A 1 548 ? 67.621 105.691 2.664  1.00 86.91  ? 548 VAL A O     1 
ATOM   4465 C  CB    . VAL A 1 548 ? 65.976 104.334 5.061  1.00 84.74  ? 548 VAL A CB    1 
ATOM   4466 C  CG1   . VAL A 1 548 ? 64.759 104.958 4.427  1.00 84.14  ? 548 VAL A CG1   1 
ATOM   4467 C  CG2   . VAL A 1 548 ? 65.619 103.206 5.995  1.00 84.67  ? 548 VAL A CG2   1 
ATOM   4468 N  N     . ASP A 1 549 ? 68.892 105.131 4.437  1.00 86.89  ? 549 ASP A N     1 
ATOM   4469 C  CA    . ASP A 1 549 ? 69.806 106.261 4.327  1.00 87.29  ? 549 ASP A CA    1 
ATOM   4470 C  C     . ASP A 1 549 ? 70.741 106.059 3.151  1.00 87.11  ? 549 ASP A C     1 
ATOM   4471 O  O     . ASP A 1 549 ? 71.158 107.017 2.504  1.00 87.04  ? 549 ASP A O     1 
ATOM   4472 C  CB    . ASP A 1 549 ? 70.624 106.409 5.612  1.00 89.05  ? 549 ASP A CB    1 
ATOM   4473 C  CG    . ASP A 1 549 ? 71.143 107.826 5.814  1.00 91.92  ? 549 ASP A CG    1 
ATOM   4474 O  OD1   . ASP A 1 549 ? 71.041 108.358 6.949  1.00 93.44  ? 549 ASP A OD1   1 
ATOM   4475 O  OD2   . ASP A 1 549 ? 71.649 108.409 4.832  1.00 92.50  ? 549 ASP A OD2   1 
ATOM   4476 N  N     . LYS A 1 550 ? 71.058 104.799 2.879  1.00 87.27  ? 550 LYS A N     1 
ATOM   4477 C  CA    . LYS A 1 550 ? 71.971 104.437 1.805  1.00 86.49  ? 550 LYS A CA    1 
ATOM   4478 C  C     . LYS A 1 550 ? 71.278 104.554 0.441  1.00 85.82  ? 550 LYS A C     1 
ATOM   4479 O  O     . LYS A 1 550 ? 71.885 105.013 -0.529 1.00 86.73  ? 550 LYS A O     1 
ATOM   4480 C  CB    . LYS A 1 550 ? 72.482 103.007 2.034  1.00 87.96  ? 550 LYS A CB    1 
ATOM   4481 C  CG    . LYS A 1 550 ? 73.652 102.590 1.141  1.00 89.60  ? 550 LYS A CG    1 
ATOM   4482 C  CD    . LYS A 1 550 ? 74.259 101.257 1.581  1.00 90.33  ? 550 LYS A CD    1 
ATOM   4483 C  CE    . LYS A 1 550 ? 73.241 100.117 1.541  1.00 90.90  ? 550 LYS A CE    1 
ATOM   4484 N  NZ    . LYS A 1 550 ? 73.829 98.820  1.999  1.00 90.37  ? 550 LYS A NZ    1 
ATOM   4485 N  N     . LEU A 1 551 ? 70.008 104.148 0.378  1.00 84.39  ? 551 LEU A N     1 
ATOM   4486 C  CA    . LEU A 1 551 ? 69.190 104.245 -0.842 1.00 81.90  ? 551 LEU A CA    1 
ATOM   4487 C  C     . LEU A 1 551 ? 68.813 105.688 -1.153 1.00 80.66  ? 551 LEU A C     1 
ATOM   4488 O  O     . LEU A 1 551 ? 68.742 106.085 -2.321 1.00 79.42  ? 551 LEU A O     1 
ATOM   4489 C  CB    . LEU A 1 551 ? 67.894 103.445 -0.682 1.00 81.12  ? 551 LEU A CB    1 
ATOM   4490 C  CG    . LEU A 1 551 ? 67.881 101.931 -0.874 1.00 81.55  ? 551 LEU A CG    1 
ATOM   4491 C  CD1   . LEU A 1 551 ? 69.038 101.262 -0.128 1.00 82.71  ? 551 LEU A CD1   1 
ATOM   4492 C  CD2   . LEU A 1 551 ? 66.545 101.414 -0.376 1.00 81.46  ? 551 LEU A CD2   1 
ATOM   4493 N  N     . VAL A 1 552 ? 68.562 106.449 -0.086 1.00 80.17  ? 552 VAL A N     1 
ATOM   4494 C  CA    . VAL A 1 552 ? 68.015 107.805 -0.144 1.00 79.55  ? 552 VAL A CA    1 
ATOM   4495 C  C     . VAL A 1 552 ? 69.103 108.849 -0.399 1.00 80.83  ? 552 VAL A C     1 
ATOM   4496 O  O     . VAL A 1 552 ? 68.833 109.913 -0.965 1.00 80.75  ? 552 VAL A O     1 
ATOM   4497 C  CB    . VAL A 1 552 ? 67.261 108.145 1.172  1.00 77.03  ? 552 VAL A CB    1 
ATOM   4498 C  CG1   . VAL A 1 552 ? 67.063 109.617 1.293  1.00 77.84  ? 552 VAL A CG1   1 
ATOM   4499 C  CG2   . VAL A 1 552 ? 65.910 107.473 1.184  1.00 76.02  ? 552 VAL A CG2   1 
ATOM   4500 N  N     . SER A 1 553 ? 70.334 108.536 0.003  1.00 81.82  ? 553 SER A N     1 
ATOM   4501 C  CA    . SER A 1 553 ? 71.479 109.389 -0.304 1.00 82.36  ? 553 SER A CA    1 
ATOM   4502 C  C     . SER A 1 553 ? 72.115 109.083 -1.664 1.00 83.45  ? 553 SER A C     1 
ATOM   4503 O  O     . SER A 1 553 ? 73.258 108.633 -1.738 1.00 83.60  ? 553 SER A O     1 
ATOM   4504 C  CB    . SER A 1 553 ? 72.533 109.266 0.795  1.00 81.39  ? 553 SER A CB    1 
ATOM   4505 O  OG    . SER A 1 553 ? 72.043 109.779 2.019  1.00 80.47  ? 553 SER A OG    1 
ATOM   4506 N  N     . ALA A 1 554 ? 71.355 109.316 -2.734 1.00 84.52  ? 554 ALA A N     1 
ATOM   4507 C  CA    . ALA A 1 554 ? 71.921 109.575 -4.054 1.00 85.46  ? 554 ALA A CA    1 
ATOM   4508 C  C     . ALA A 1 554 ? 71.937 111.095 -4.253 1.00 87.29  ? 554 ALA A C     1 
ATOM   4509 O  O     . ALA A 1 554 ? 72.507 111.598 -5.224 1.00 87.49  ? 554 ALA A O     1 
ATOM   4510 C  CB    . ALA A 1 554 ? 71.084 108.908 -5.133 1.00 82.98  ? 554 ALA A CB    1 
ATOM   4511 N  N     . GLY A 1 555 ? 71.291 111.808 -3.324 1.00 88.34  ? 555 GLY A N     1 
ATOM   4512 C  CA    . GLY A 1 555 ? 71.517 113.235 -3.148 1.00 88.47  ? 555 GLY A CA    1 
ATOM   4513 C  C     . GLY A 1 555 ? 72.865 113.500 -2.484 1.00 89.53  ? 555 GLY A C     1 
ATOM   4514 O  O     . GLY A 1 555 ? 73.496 114.545 -2.767 1.00 89.33  ? 555 GLY A O     1 
ATOM   4515 N  N     . PRO B 2 16  ? 71.418 157.910 57.227 1.00 124.29 ? 4   PRO B N     1 
ATOM   4516 C  CA    . PRO B 2 16  ? 70.505 158.991 56.772 1.00 124.46 ? 4   PRO B CA    1 
ATOM   4517 C  C     . PRO B 2 16  ? 71.196 160.360 56.732 1.00 124.00 ? 4   PRO B C     1 
ATOM   4518 O  O     . PRO B 2 16  ? 71.228 161.079 57.735 1.00 123.95 ? 4   PRO B O     1 
ATOM   4519 C  CB    . PRO B 2 16  ? 69.311 159.025 57.721 1.00 124.65 ? 4   PRO B CB    1 
ATOM   4520 C  CG    . PRO B 2 16  ? 69.382 157.649 58.392 1.00 125.32 ? 4   PRO B CG    1 
ATOM   4521 C  CD    . PRO B 2 16  ? 70.860 157.216 58.402 1.00 124.56 ? 4   PRO B CD    1 
ATOM   4522 N  N     . ILE B 2 17  ? 71.737 160.721 55.569 1.00 123.01 ? 5   ILE B N     1 
ATOM   4523 C  CA    . ILE B 2 17  ? 72.456 161.987 55.427 1.00 121.90 ? 5   ILE B CA    1 
ATOM   4524 C  C     . ILE B 2 17  ? 72.811 162.306 53.965 1.00 121.32 ? 5   ILE B C     1 
ATOM   4525 O  O     . ILE B 2 17  ? 72.011 162.911 53.249 1.00 121.46 ? 5   ILE B O     1 
ATOM   4526 C  CB    . ILE B 2 17  ? 73.745 161.970 56.305 1.00 121.50 ? 5   ILE B CB    1 
ATOM   4527 C  CG1   . ILE B 2 17  ? 74.529 163.275 56.135 1.00 120.21 ? 5   ILE B CG1   1 
ATOM   4528 C  CG2   . ILE B 2 17  ? 74.575 160.728 55.982 1.00 121.33 ? 5   ILE B CG2   1 
ATOM   4529 C  CD1   . ILE B 2 17  ? 75.767 163.373 57.020 1.00 117.86 ? 5   ILE B CD1   1 
ATOM   4530 N  N     . GLU B 2 18  ? 74.003 161.903 53.527 1.00 120.22 ? 6   GLU B N     1 
ATOM   4531 C  CA    . GLU B 2 18  ? 74.433 162.112 52.144 1.00 118.56 ? 6   GLU B CA    1 
ATOM   4532 C  C     . GLU B 2 18  ? 74.903 160.800 51.496 1.00 116.46 ? 6   GLU B C     1 
ATOM   4533 O  O     . GLU B 2 18  ? 75.121 159.799 52.190 1.00 116.39 ? 6   GLU B O     1 
ATOM   4534 C  CB    . GLU B 2 18  ? 75.539 163.179 52.086 1.00 120.06 ? 6   GLU B CB    1 
ATOM   4535 C  CG    . GLU B 2 18  ? 76.537 163.149 53.242 1.00 121.92 ? 6   GLU B CG    1 
ATOM   4536 C  CD    . GLU B 2 18  ? 77.775 162.305 52.948 1.00 123.22 ? 6   GLU B CD    1 
ATOM   4537 O  OE1   . GLU B 2 18  ? 78.737 162.854 52.367 1.00 123.48 ? 6   GLU B OE1   1 
ATOM   4538 O  OE2   . GLU B 2 18  ? 77.793 161.102 53.303 1.00 123.47 ? 6   GLU B OE2   1 
ATOM   4539 N  N     . THR B 2 19  ? 75.053 160.805 50.170 1.00 113.58 ? 7   THR B N     1 
ATOM   4540 C  CA    . THR B 2 19  ? 75.000 159.565 49.396 1.00 110.18 ? 7   THR B CA    1 
ATOM   4541 C  C     . THR B 2 19  ? 76.161 159.280 48.435 1.00 108.06 ? 7   THR B C     1 
ATOM   4542 O  O     . THR B 2 19  ? 77.044 160.116 48.223 1.00 107.13 ? 7   THR B O     1 
ATOM   4543 C  CB    . THR B 2 19  ? 73.700 159.493 48.585 1.00 109.90 ? 7   THR B CB    1 
ATOM   4544 O  OG1   . THR B 2 19  ? 73.574 158.188 48.008 1.00 110.33 ? 7   THR B OG1   1 
ATOM   4545 C  CG2   . THR B 2 19  ? 73.713 160.540 47.477 1.00 108.39 ? 7   THR B CG2   1 
ATOM   4546 N  N     . VAL B 2 20  ? 76.127 158.079 47.854 1.00 105.63 ? 8   VAL B N     1 
ATOM   4547 C  CA    . VAL B 2 20  ? 77.222 157.528 47.059 1.00 102.84 ? 8   VAL B CA    1 
ATOM   4548 C  C     . VAL B 2 20  ? 76.884 157.454 45.576 1.00 101.87 ? 8   VAL B C     1 
ATOM   4549 O  O     . VAL B 2 20  ? 75.812 156.983 45.199 1.00 101.15 ? 8   VAL B O     1 
ATOM   4550 C  CB    . VAL B 2 20  ? 77.556 156.112 47.515 1.00 101.85 ? 8   VAL B CB    1 
ATOM   4551 C  CG1   . VAL B 2 20  ? 76.304 155.268 47.467 1.00 101.38 ? 8   VAL B CG1   1 
ATOM   4552 C  CG2   . VAL B 2 20  ? 78.624 155.513 46.620 1.00 100.59 ? 8   VAL B CG2   1 
ATOM   4553 N  N     . PRO B 2 21  ? 77.816 157.905 44.719 1.00 101.20 ? 9   PRO B N     1 
ATOM   4554 C  CA    . PRO B 2 21  ? 77.704 158.019 43.257 1.00 100.69 ? 9   PRO B CA    1 
ATOM   4555 C  C     . PRO B 2 21  ? 77.579 156.680 42.548 1.00 99.67  ? 9   PRO B C     1 
ATOM   4556 O  O     . PRO B 2 21  ? 78.306 155.740 42.861 1.00 99.78  ? 9   PRO B O     1 
ATOM   4557 C  CB    . PRO B 2 21  ? 78.990 158.740 42.848 1.00 100.91 ? 9   PRO B CB    1 
ATOM   4558 C  CG    . PRO B 2 21  ? 79.456 159.411 44.082 1.00 100.97 ? 9   PRO B CG    1 
ATOM   4559 C  CD    . PRO B 2 21  ? 79.068 158.500 45.205 1.00 101.32 ? 9   PRO B CD    1 
ATOM   4560 N  N     . VAL B 2 22  ? 76.663 156.605 41.586 1.00 98.31  ? 10  VAL B N     1 
ATOM   4561 C  CA    . VAL B 2 22  ? 76.472 155.394 40.803 1.00 96.55  ? 10  VAL B CA    1 
ATOM   4562 C  C     . VAL B 2 22  ? 76.320 155.754 39.334 1.00 95.67  ? 10  VAL B C     1 
ATOM   4563 O  O     . VAL B 2 22  ? 76.224 156.924 38.983 1.00 95.80  ? 10  VAL B O     1 
ATOM   4564 C  CB    . VAL B 2 22  ? 75.219 154.633 41.249 1.00 96.61  ? 10  VAL B CB    1 
ATOM   4565 C  CG1   . VAL B 2 22  ? 75.266 153.211 40.718 1.00 97.00  ? 10  VAL B CG1   1 
ATOM   4566 C  CG2   . VAL B 2 22  ? 75.117 154.641 42.757 1.00 96.83  ? 10  VAL B CG2   1 
ATOM   4567 N  N     . LYS B 2 23  ? 76.288 154.742 38.480 1.00 94.93  ? 11  LYS B N     1 
ATOM   4568 C  CA    . LYS B 2 23  ? 76.378 154.953 37.046 1.00 94.45  ? 11  LYS B CA    1 
ATOM   4569 C  C     . LYS B 2 23  ? 75.875 153.705 36.333 1.00 93.59  ? 11  LYS B C     1 
ATOM   4570 O  O     . LYS B 2 23  ? 76.006 152.597 36.847 1.00 92.60  ? 11  LYS B O     1 
ATOM   4571 C  CB    . LYS B 2 23  ? 77.838 155.222 36.668 1.00 96.22  ? 11  LYS B CB    1 
ATOM   4572 C  CG    . LYS B 2 23  ? 78.103 155.441 35.188 1.00 98.56  ? 11  LYS B CG    1 
ATOM   4573 C  CD    . LYS B 2 23  ? 79.590 155.315 34.868 1.00 99.72  ? 11  LYS B CD    1 
ATOM   4574 C  CE    . LYS B 2 23  ? 79.946 156.082 33.598 1.00 101.26 ? 11  LYS B CE    1 
ATOM   4575 N  NZ    . LYS B 2 23  ? 78.997 155.801 32.477 1.00 102.91 ? 11  LYS B NZ    1 
ATOM   4576 N  N     . LEU B 2 24  ? 75.295 153.881 35.153 1.00 93.26  ? 12  LEU B N     1 
ATOM   4577 C  CA    . LEU B 2 24  ? 74.904 152.738 34.337 1.00 93.34  ? 12  LEU B CA    1 
ATOM   4578 C  C     . LEU B 2 24  ? 76.103 152.175 33.592 1.00 93.61  ? 12  LEU B C     1 
ATOM   4579 O  O     . LEU B 2 24  ? 76.980 152.922 33.157 1.00 93.89  ? 12  LEU B O     1 
ATOM   4580 C  CB    . LEU B 2 24  ? 73.827 153.141 33.332 1.00 92.52  ? 12  LEU B CB    1 
ATOM   4581 C  CG    . LEU B 2 24  ? 72.484 153.487 33.964 1.00 91.99  ? 12  LEU B CG    1 
ATOM   4582 C  CD1   . LEU B 2 24  ? 71.429 153.647 32.877 1.00 91.60  ? 12  LEU B CD1   1 
ATOM   4583 C  CD2   . LEU B 2 24  ? 72.100 152.386 34.947 1.00 91.26  ? 12  LEU B CD2   1 
ATOM   4584 N  N     . LYS B 2 25  ? 76.139 150.855 33.443 1.00 94.04  ? 13  LYS B N     1 
ATOM   4585 C  CA    . LYS B 2 25  ? 77.252 150.216 32.763 1.00 94.52  ? 13  LYS B CA    1 
ATOM   4586 C  C     . LYS B 2 25  ? 77.656 151.063 31.580 1.00 95.35  ? 13  LYS B C     1 
ATOM   4587 O  O     . LYS B 2 25  ? 76.814 151.538 30.821 1.00 95.70  ? 13  LYS B O     1 
ATOM   4588 C  CB    . LYS B 2 25  ? 76.871 148.813 32.294 1.00 94.20  ? 13  LYS B CB    1 
ATOM   4589 C  CG    . LYS B 2 25  ? 77.087 147.746 33.354 1.00 94.35  ? 13  LYS B CG    1 
ATOM   4590 C  CD    . LYS B 2 25  ? 77.062 146.351 32.755 1.00 94.07  ? 13  LYS B CD    1 
ATOM   4591 C  CE    . LYS B 2 25  ? 77.356 145.308 33.812 1.00 94.69  ? 13  LYS B CE    1 
ATOM   4592 N  NZ    . LYS B 2 25  ? 76.805 143.975 33.445 1.00 94.68  ? 13  LYS B NZ    1 
ATOM   4593 N  N     . PRO B 2 26  ? 78.963 151.267 31.411 1.00 96.01  ? 14  PRO B N     1 
ATOM   4594 C  CA    . PRO B 2 26  ? 79.467 152.250 30.447 1.00 95.61  ? 14  PRO B CA    1 
ATOM   4595 C  C     . PRO B 2 26  ? 78.916 152.045 29.031 1.00 94.62  ? 14  PRO B C     1 
ATOM   4596 O  O     . PRO B 2 26  ? 79.498 151.318 28.222 1.00 94.44  ? 14  PRO B O     1 
ATOM   4597 C  CB    . PRO B 2 26  ? 80.988 152.081 30.518 1.00 96.76  ? 14  PRO B CB    1 
ATOM   4598 C  CG    . PRO B 2 26  ? 81.205 150.697 31.098 1.00 96.89  ? 14  PRO B CG    1 
ATOM   4599 C  CD    . PRO B 2 26  ? 80.036 150.448 32.006 1.00 96.44  ? 14  PRO B CD    1 
ATOM   4600 N  N     . GLY B 2 27  ? 77.789 152.695 28.747 1.00 92.90  ? 15  GLY B N     1 
ATOM   4601 C  CA    . GLY B 2 27  ? 77.223 152.657 27.409 1.00 90.34  ? 15  GLY B CA    1 
ATOM   4602 C  C     . GLY B 2 27  ? 75.727 152.387 27.361 1.00 88.20  ? 15  GLY B C     1 
ATOM   4603 O  O     . GLY B 2 27  ? 75.066 152.699 26.364 1.00 87.93  ? 15  GLY B O     1 
ATOM   4604 N  N     . MET B 2 28  ? 75.189 151.813 28.434 1.00 85.36  ? 16  MET B N     1 
ATOM   4605 C  CA    . MET B 2 28  ? 73.785 151.409 28.478 1.00 81.82  ? 16  MET B CA    1 
ATOM   4606 C  C     . MET B 2 28  ? 72.907 152.575 28.922 1.00 79.32  ? 16  MET B C     1 
ATOM   4607 O  O     . MET B 2 28  ? 73.383 153.473 29.611 1.00 79.45  ? 16  MET B O     1 
ATOM   4608 C  CB    . MET B 2 28  ? 73.618 150.251 29.453 1.00 81.25  ? 16  MET B CB    1 
ATOM   4609 C  CG    . MET B 2 28  ? 74.822 149.340 29.511 1.00 81.55  ? 16  MET B CG    1 
ATOM   4610 S  SD    . MET B 2 28  ? 74.496 147.762 28.741 1.00 82.48  ? 16  MET B SD    1 
ATOM   4611 C  CE    . MET B 2 28  ? 73.310 147.052 29.914 1.00 82.63  ? 16  MET B CE    1 
ATOM   4612 N  N     . ASP B 2 29  ? 71.635 152.559 28.525 1.00 76.17  ? 17  ASP B N     1 
ATOM   4613 C  CA    . ASP B 2 29  ? 70.668 153.548 28.998 1.00 72.36  ? 17  ASP B CA    1 
ATOM   4614 C  C     . ASP B 2 29  ? 69.669 152.947 29.986 1.00 69.85  ? 17  ASP B C     1 
ATOM   4615 O  O     . ASP B 2 29  ? 69.523 151.728 30.081 1.00 70.29  ? 17  ASP B O     1 
ATOM   4616 C  CB    . ASP B 2 29  ? 69.906 154.162 27.825 1.00 72.76  ? 17  ASP B CB    1 
ATOM   4617 C  CG    . ASP B 2 29  ? 69.046 155.349 28.246 1.00 75.14  ? 17  ASP B CG    1 
ATOM   4618 O  OD1   . ASP B 2 29  ? 69.573 156.271 28.911 1.00 75.44  ? 17  ASP B OD1   1 
ATOM   4619 O  OD2   . ASP B 2 29  ? 67.840 155.364 27.914 1.00 76.36  ? 17  ASP B OD2   1 
ATOM   4620 N  N     . GLY B 2 30  ? 68.977 153.810 30.721 1.00 65.73  ? 18  GLY B N     1 
ATOM   4621 C  CA    . GLY B 2 30  ? 68.041 153.336 31.720 1.00 59.79  ? 18  GLY B CA    1 
ATOM   4622 C  C     . GLY B 2 30  ? 66.979 152.419 31.159 1.00 55.73  ? 18  GLY B C     1 
ATOM   4623 O  O     . GLY B 2 30  ? 66.819 152.311 29.949 1.00 57.12  ? 18  GLY B O     1 
ATOM   4624 N  N     . PRO B 2 31  ? 66.234 151.743 32.037 1.00 52.74  ? 19  PRO B N     1 
ATOM   4625 C  CA    . PRO B 2 31  ? 65.143 150.792 31.793 1.00 51.67  ? 19  PRO B CA    1 
ATOM   4626 C  C     . PRO B 2 31  ? 63.932 151.445 31.155 1.00 50.80  ? 19  PRO B C     1 
ATOM   4627 O  O     . PRO B 2 31  ? 63.470 152.477 31.625 1.00 50.54  ? 19  PRO B O     1 
ATOM   4628 C  CB    . PRO B 2 31  ? 64.787 150.281 33.183 1.00 52.09  ? 19  PRO B CB    1 
ATOM   4629 C  CG    . PRO B 2 31  ? 65.938 150.635 34.034 1.00 52.26  ? 19  PRO B CG    1 
ATOM   4630 C  CD    . PRO B 2 31  ? 66.513 151.883 33.470 1.00 51.66  ? 19  PRO B CD    1 
ATOM   4631 N  N     . LYS B 2 32  ? 63.401 150.831 30.104 1.00 49.94  ? 20  LYS B N     1 
ATOM   4632 C  CA    . LYS B 2 32  ? 62.135 151.276 29.537 1.00 48.10  ? 20  LYS B CA    1 
ATOM   4633 C  C     . LYS B 2 32  ? 61.155 150.124 29.321 1.00 47.04  ? 20  LYS B C     1 
ATOM   4634 O  O     . LYS B 2 32  ? 60.806 149.812 28.194 1.00 48.68  ? 20  LYS B O     1 
ATOM   4635 C  CB    . LYS B 2 32  ? 62.389 152.006 28.225 1.00 46.84  ? 20  LYS B CB    1 
ATOM   4636 C  CG    . LYS B 2 32  ? 63.251 153.244 28.401 1.00 48.07  ? 20  LYS B CG    1 
ATOM   4637 C  CD    . LYS B 2 32  ? 63.398 154.053 27.119 1.00 46.93  ? 20  LYS B CD    1 
ATOM   4638 C  CE    . LYS B 2 32  ? 64.355 155.210 27.314 1.00 48.31  ? 20  LYS B CE    1 
ATOM   4639 N  NZ    . LYS B 2 32  ? 64.167 156.266 26.287 1.00 49.43  ? 20  LYS B NZ    1 
ATOM   4640 N  N     . VAL B 2 33  ? 60.706 149.512 30.413 1.00 45.33  ? 21  VAL B N     1 
ATOM   4641 C  CA    . VAL B 2 33  ? 59.820 148.351 30.369 1.00 43.24  ? 21  VAL B CA    1 
ATOM   4642 C  C     . VAL B 2 33  ? 58.386 148.708 30.753 1.00 43.00  ? 21  VAL B C     1 
ATOM   4643 O  O     . VAL B 2 33  ? 58.154 149.456 31.694 1.00 44.58  ? 21  VAL B O     1 
ATOM   4644 C  CB    . VAL B 2 33  ? 60.294 147.274 31.353 1.00 43.46  ? 21  VAL B CB    1 
ATOM   4645 C  CG1   . VAL B 2 33  ? 59.388 146.087 31.275 1.00 43.13  ? 21  VAL B CG1   1 
ATOM   4646 C  CG2   . VAL B 2 33  ? 61.734 146.888 31.076 1.00 41.50  ? 21  VAL B CG2   1 
ATOM   4647 N  N     . LYS B 2 34  ? 57.419 148.150 30.045 1.00 43.22  ? 22  LYS B N     1 
ATOM   4648 C  CA    . LYS B 2 34  ? 56.010 148.441 30.310 1.00 43.35  ? 22  LYS B CA    1 
ATOM   4649 C  C     . LYS B 2 34  ? 55.473 147.791 31.583 1.00 41.92  ? 22  LYS B C     1 
ATOM   4650 O  O     . LYS B 2 34  ? 55.888 146.718 31.965 1.00 41.19  ? 22  LYS B O     1 
ATOM   4651 C  CB    . LYS B 2 34  ? 55.149 147.980 29.132 1.00 45.78  ? 22  LYS B CB    1 
ATOM   4652 C  CG    . LYS B 2 34  ? 55.442 148.683 27.818 1.00 49.30  ? 22  LYS B CG    1 
ATOM   4653 C  CD    . LYS B 2 34  ? 54.487 149.834 27.577 1.00 52.07  ? 22  LYS B CD    1 
ATOM   4654 C  CE    . LYS B 2 34  ? 53.224 149.366 26.871 1.00 52.54  ? 22  LYS B CE    1 
ATOM   4655 N  NZ    . LYS B 2 34  ? 53.491 149.077 25.431 1.00 54.61  ? 22  LYS B NZ    1 
ATOM   4656 N  N     . GLN B 2 35  ? 54.517 148.444 32.225 1.00 43.11  ? 23  GLN B N     1 
ATOM   4657 C  CA    . GLN B 2 35  ? 53.833 147.853 33.365 1.00 43.07  ? 23  GLN B CA    1 
ATOM   4658 C  C     . GLN B 2 35  ? 52.775 146.886 32.869 1.00 43.14  ? 23  GLN B C     1 
ATOM   4659 O  O     . GLN B 2 35  ? 51.997 147.212 31.966 1.00 42.60  ? 23  GLN B O     1 
ATOM   4660 C  CB    . GLN B 2 35  ? 53.175 148.949 34.208 1.00 43.84  ? 23  GLN B CB    1 
ATOM   4661 C  CG    . GLN B 2 35  ? 52.285 148.450 35.342 1.00 44.94  ? 23  GLN B CG    1 
ATOM   4662 C  CD    . GLN B 2 35  ? 52.928 147.377 36.187 1.00 46.25  ? 23  GLN B CD    1 
ATOM   4663 O  OE1   . GLN B 2 35  ? 54.130 147.411 36.450 1.00 45.66  ? 23  GLN B OE1   1 
ATOM   4664 N  NE2   . GLN B 2 35  ? 52.124 146.410 36.625 1.00 48.40  ? 23  GLN B NE2   1 
ATOM   4665 N  N     . TRP B 2 36  ? 52.738 145.696 33.456 1.00 42.44  ? 24  TRP B N     1 
ATOM   4666 C  CA    . TRP B 2 36  ? 51.738 144.731 33.055 1.00 41.63  ? 24  TRP B CA    1 
ATOM   4667 C  C     . TRP B 2 36  ? 50.503 144.824 33.921 1.00 41.85  ? 24  TRP B C     1 
ATOM   4668 O  O     . TRP B 2 36  ? 50.541 145.394 35.009 1.00 41.22  ? 24  TRP B O     1 
ATOM   4669 C  CB    . TRP B 2 36  ? 52.311 143.320 33.075 1.00 39.64  ? 24  TRP B CB    1 
ATOM   4670 C  CG    . TRP B 2 36  ? 52.892 142.870 34.342 1.00 40.75  ? 24  TRP B CG    1 
ATOM   4671 C  CD1   . TRP B 2 36  ? 52.215 142.428 35.435 1.00 44.25  ? 24  TRP B CD1   1 
ATOM   4672 C  CD2   . TRP B 2 36  ? 54.277 142.632 34.605 1.00 43.02  ? 24  TRP B CD2   1 
ATOM   4673 N  NE1   . TRP B 2 36  ? 53.086 141.910 36.363 1.00 43.14  ? 24  TRP B NE1   1 
ATOM   4674 C  CE2   . TRP B 2 36  ? 54.358 142.024 35.880 1.00 43.89  ? 24  TRP B CE2   1 
ATOM   4675 C  CE3   . TRP B 2 36  ? 55.454 142.866 33.890 1.00 41.72  ? 24  TRP B CE3   1 
ATOM   4676 C  CZ2   . TRP B 2 36  ? 55.576 141.642 36.444 1.00 41.33  ? 24  TRP B CZ2   1 
ATOM   4677 C  CZ3   . TRP B 2 36  ? 56.652 142.486 34.453 1.00 40.72  ? 24  TRP B CZ3   1 
ATOM   4678 C  CH2   . TRP B 2 36  ? 56.705 141.882 35.717 1.00 40.58  ? 24  TRP B CH2   1 
ATOM   4679 N  N     . PRO B 2 37  ? 49.374 144.293 33.429 1.00 41.83  ? 25  PRO B N     1 
ATOM   4680 C  CA    . PRO B 2 37  ? 48.128 144.463 34.169 1.00 41.81  ? 25  PRO B CA    1 
ATOM   4681 C  C     . PRO B 2 37  ? 48.213 143.718 35.487 1.00 42.09  ? 25  PRO B C     1 
ATOM   4682 O  O     . PRO B 2 37  ? 48.873 142.694 35.580 1.00 40.86  ? 25  PRO B O     1 
ATOM   4683 C  CB    . PRO B 2 37  ? 47.069 143.901 33.224 1.00 42.15  ? 25  PRO B CB    1 
ATOM   4684 C  CG    . PRO B 2 37  ? 47.811 142.956 32.336 1.00 40.30  ? 25  PRO B CG    1 
ATOM   4685 C  CD    . PRO B 2 37  ? 49.185 143.521 32.190 1.00 41.15  ? 25  PRO B CD    1 
ATOM   4686 N  N     . LEU B 2 38  ? 47.564 144.263 36.505 1.00 43.30  ? 26  LEU B N     1 
ATOM   4687 C  CA    . LEU B 2 38  ? 47.629 143.724 37.848 1.00 43.16  ? 26  LEU B CA    1 
ATOM   4688 C  C     . LEU B 2 38  ? 46.212 143.493 38.345 1.00 45.26  ? 26  LEU B C     1 
ATOM   4689 O  O     . LEU B 2 38  ? 45.269 144.147 37.900 1.00 45.49  ? 26  LEU B O     1 
ATOM   4690 C  CB    . LEU B 2 38  ? 48.328 144.717 38.772 1.00 41.67  ? 26  LEU B CB    1 
ATOM   4691 C  CG    . LEU B 2 38  ? 49.768 145.147 38.492 1.00 41.42  ? 26  LEU B CG    1 
ATOM   4692 C  CD1   . LEU B 2 38  ? 50.073 146.367 39.313 1.00 39.17  ? 26  LEU B CD1   1 
ATOM   4693 C  CD2   . LEU B 2 38  ? 50.745 144.041 38.841 1.00 39.41  ? 26  LEU B CD2   1 
ATOM   4694 N  N     . THR B 2 39  ? 46.064 142.571 39.285 1.00 48.13  ? 27  THR B N     1 
ATOM   4695 C  CA    . THR B 2 39  ? 44.764 142.315 39.896 1.00 50.40  ? 27  THR B CA    1 
ATOM   4696 C  C     . THR B 2 39  ? 44.458 143.380 40.943 1.00 53.61  ? 27  THR B C     1 
ATOM   4697 O  O     . THR B 2 39  ? 45.369 143.920 41.585 1.00 55.05  ? 27  THR B O     1 
ATOM   4698 C  CB    . THR B 2 39  ? 44.726 140.942 40.598 1.00 49.50  ? 27  THR B CB    1 
ATOM   4699 O  OG1   . THR B 2 39  ? 45.712 140.914 41.638 1.00 48.42  ? 27  THR B OG1   1 
ATOM   4700 C  CG2   . THR B 2 39  ? 44.979 139.814 39.593 1.00 45.73  ? 27  THR B CG2   1 
ATOM   4701 N  N     . GLU B 2 40  ? 43.171 143.669 41.111 1.00 54.53  ? 28  GLU B N     1 
ATOM   4702 C  CA    . GLU B 2 40  ? 42.705 144.607 42.125 1.00 55.58  ? 28  GLU B CA    1 
ATOM   4703 C  C     . GLU B 2 40  ? 43.506 144.504 43.418 1.00 55.91  ? 28  GLU B C     1 
ATOM   4704 O  O     . GLU B 2 40  ? 43.967 145.510 43.955 1.00 55.00  ? 28  GLU B O     1 
ATOM   4705 C  CB    . GLU B 2 40  ? 41.232 144.338 42.429 1.00 58.53  ? 28  GLU B CB    1 
ATOM   4706 C  CG    . GLU B 2 40  ? 40.608 145.305 43.413 1.00 61.98  ? 28  GLU B CG    1 
ATOM   4707 C  CD    . GLU B 2 40  ? 39.147 145.555 43.102 1.00 65.24  ? 28  GLU B CD    1 
ATOM   4708 O  OE1   . GLU B 2 40  ? 38.623 146.625 43.495 1.00 65.40  ? 28  GLU B OE1   1 
ATOM   4709 O  OE2   . GLU B 2 40  ? 38.529 144.672 42.456 1.00 66.84  ? 28  GLU B OE2   1 
ATOM   4710 N  N     . GLU B 2 41  ? 43.662 143.283 43.917 1.00 55.85  ? 29  GLU B N     1 
ATOM   4711 C  CA    . GLU B 2 41  ? 44.343 143.061 45.177 1.00 55.65  ? 29  GLU B CA    1 
ATOM   4712 C  C     . GLU B 2 41  ? 45.794 143.536 45.134 1.00 54.61  ? 29  GLU B C     1 
ATOM   4713 O  O     . GLU B 2 41  ? 46.275 144.161 46.074 1.00 54.10  ? 29  GLU B O     1 
ATOM   4714 C  CB    . GLU B 2 41  ? 44.287 141.584 45.523 1.00 59.30  ? 29  GLU B CB    1 
ATOM   4715 C  CG    . GLU B 2 41  ? 44.533 140.685 44.323 1.00 67.12  ? 29  GLU B CG    1 
ATOM   4716 C  CD    . GLU B 2 41  ? 44.674 139.209 44.701 1.00 71.24  ? 29  GLU B CD    1 
ATOM   4717 O  OE1   . GLU B 2 41  ? 44.755 138.912 45.923 1.00 71.44  ? 29  GLU B OE1   1 
ATOM   4718 O  OE2   . GLU B 2 41  ? 44.702 138.356 43.771 1.00 72.13  ? 29  GLU B OE2   1 
ATOM   4719 N  N     . LYS B 2 42  ? 46.497 143.253 44.046 1.00 54.17  ? 30  LYS B N     1 
ATOM   4720 C  CA    . LYS B 2 42  ? 47.894 143.653 43.955 1.00 54.34  ? 30  LYS B CA    1 
ATOM   4721 C  C     . LYS B 2 42  ? 48.003 145.173 43.816 1.00 56.16  ? 30  LYS B C     1 
ATOM   4722 O  O     . LYS B 2 42  ? 49.020 145.773 44.154 1.00 57.15  ? 30  LYS B O     1 
ATOM   4723 C  CB    . LYS B 2 42  ? 48.561 142.973 42.759 1.00 54.33  ? 30  LYS B CB    1 
ATOM   4724 C  CG    . LYS B 2 42  ? 48.486 141.451 42.756 1.00 54.05  ? 30  LYS B CG    1 
ATOM   4725 C  CD    . LYS B 2 42  ? 49.792 140.842 42.250 1.00 53.69  ? 30  LYS B CD    1 
ATOM   4726 C  CE    . LYS B 2 42  ? 49.760 139.320 42.228 1.00 54.09  ? 30  LYS B CE    1 
ATOM   4727 N  NZ    . LYS B 2 42  ? 48.784 138.765 41.237 1.00 53.70  ? 30  LYS B NZ    1 
ATOM   4728 N  N     . ILE B 2 43  ? 46.948 145.801 43.313 1.00 56.73  ? 31  ILE B N     1 
ATOM   4729 C  CA    . ILE B 2 43  ? 46.935 147.251 43.171 1.00 56.17  ? 31  ILE B CA    1 
ATOM   4730 C  C     . ILE B 2 43  ? 46.554 147.939 44.483 1.00 57.55  ? 31  ILE B C     1 
ATOM   4731 O  O     . ILE B 2 43  ? 47.257 148.847 44.934 1.00 59.14  ? 31  ILE B O     1 
ATOM   4732 C  CB    . ILE B 2 43  ? 45.949 147.686 42.076 1.00 54.93  ? 31  ILE B CB    1 
ATOM   4733 C  CG1   . ILE B 2 43  ? 46.292 146.990 40.767 1.00 55.72  ? 31  ILE B CG1   1 
ATOM   4734 C  CG2   . ILE B 2 43  ? 46.022 149.179 41.871 1.00 53.68  ? 31  ILE B CG2   1 
ATOM   4735 C  CD1   . ILE B 2 43  ? 45.339 147.305 39.654 1.00 55.13  ? 31  ILE B CD1   1 
ATOM   4736 N  N     . LYS B 2 44  ? 45.447 147.519 45.098 1.00 57.14  ? 32  LYS B N     1 
ATOM   4737 C  CA    . LYS B 2 44  ? 45.077 148.054 46.402 1.00 56.87  ? 32  LYS B CA    1 
ATOM   4738 C  C     . LYS B 2 44  ? 46.280 148.003 47.328 1.00 57.06  ? 32  LYS B C     1 
ATOM   4739 O  O     . LYS B 2 44  ? 46.646 149.001 47.936 1.00 57.67  ? 32  LYS B O     1 
ATOM   4740 C  CB    . LYS B 2 44  ? 43.933 147.252 47.013 1.00 56.81  ? 32  LYS B CB    1 
ATOM   4741 C  CG    . LYS B 2 44  ? 42.575 147.905 46.874 1.00 57.77  ? 32  LYS B CG    1 
ATOM   4742 C  CD    . LYS B 2 44  ? 41.861 147.412 45.636 1.00 61.27  ? 32  LYS B CD    1 
ATOM   4743 C  CE    . LYS B 2 44  ? 40.360 147.670 45.716 1.00 63.15  ? 32  LYS B CE    1 
ATOM   4744 N  NZ    . LYS B 2 44  ? 40.008 149.113 45.529 1.00 65.14  ? 32  LYS B NZ    1 
ATOM   4745 N  N     . ALA B 2 45  ? 46.906 146.837 47.415 1.00 57.85  ? 33  ALA B N     1 
ATOM   4746 C  CA    . ALA B 2 45  ? 48.127 146.674 48.189 1.00 58.67  ? 33  ALA B CA    1 
ATOM   4747 C  C     . ALA B 2 45  ? 49.152 147.752 47.855 1.00 60.27  ? 33  ALA B C     1 
ATOM   4748 O  O     . ALA B 2 45  ? 49.763 148.330 48.750 1.00 61.86  ? 33  ALA B O     1 
ATOM   4749 C  CB    . ALA B 2 45  ? 48.716 145.316 47.920 1.00 58.26  ? 33  ALA B CB    1 
ATOM   4750 N  N     . LEU B 2 46  ? 49.321 148.024 46.562 1.00 61.11  ? 34  LEU B N     1 
ATOM   4751 C  CA    . LEU B 2 46  ? 50.431 148.837 46.062 1.00 60.90  ? 34  LEU B CA    1 
ATOM   4752 C  C     . LEU B 2 46  ? 50.307 150.330 46.334 1.00 61.13  ? 34  LEU B C     1 
ATOM   4753 O  O     . LEU B 2 46  ? 51.299 150.997 46.656 1.00 60.21  ? 34  LEU B O     1 
ATOM   4754 C  CB    . LEU B 2 46  ? 50.604 148.620 44.555 1.00 60.24  ? 34  LEU B CB    1 
ATOM   4755 C  CG    . LEU B 2 46  ? 51.443 147.416 44.152 1.00 59.09  ? 34  LEU B CG    1 
ATOM   4756 C  CD1   . LEU B 2 46  ? 51.577 147.372 42.649 1.00 58.42  ? 34  LEU B CD1   1 
ATOM   4757 C  CD2   . LEU B 2 46  ? 52.806 147.511 44.816 1.00 58.66  ? 34  LEU B CD2   1 
ATOM   4758 N  N     . VAL B 2 47  ? 49.099 150.863 46.185 1.00 61.60  ? 35  VAL B N     1 
ATOM   4759 C  CA    . VAL B 2 47  ? 48.888 152.280 46.453 1.00 61.89  ? 35  VAL B CA    1 
ATOM   4760 C  C     . VAL B 2 47  ? 48.911 152.475 47.973 1.00 62.82  ? 35  VAL B C     1 
ATOM   4761 O  O     . VAL B 2 47  ? 49.275 153.550 48.467 1.00 61.67  ? 35  VAL B O     1 
ATOM   4762 C  CB    . VAL B 2 47  ? 47.532 152.786 45.867 1.00 60.02  ? 35  VAL B CB    1 
ATOM   4763 C  CG1   . VAL B 2 47  ? 47.065 151.850 44.782 1.00 59.55  ? 35  VAL B CG1   1 
ATOM   4764 C  CG2   . VAL B 2 47  ? 46.490 152.924 46.955 1.00 58.02  ? 35  VAL B CG2   1 
ATOM   4765 N  N     . GLU B 2 48  ? 48.546 151.429 48.717 1.00 61.72  ? 36  GLU B N     1 
ATOM   4766 C  CA    . GLU B 2 48  ? 48.615 151.527 50.159 1.00 62.02  ? 36  GLU B CA    1 
ATOM   4767 C  C     . GLU B 2 48  ? 50.076 151.627 50.558 1.00 61.18  ? 36  GLU B C     1 
ATOM   4768 O  O     . GLU B 2 48  ? 50.453 152.490 51.353 1.00 61.29  ? 36  GLU B O     1 
ATOM   4769 C  CB    . GLU B 2 48  ? 47.978 150.317 50.835 1.00 63.37  ? 36  GLU B CB    1 
ATOM   4770 C  CG    . GLU B 2 48  ? 47.499 150.631 52.258 1.00 67.46  ? 36  GLU B CG    1 
ATOM   4771 C  CD    . GLU B 2 48  ? 47.514 149.427 53.185 1.00 70.00  ? 36  GLU B CD    1 
ATOM   4772 O  OE1   . GLU B 2 48  ? 47.765 149.618 54.399 1.00 71.21  ? 36  GLU B OE1   1 
ATOM   4773 O  OE2   . GLU B 2 48  ? 47.273 148.296 52.705 1.00 71.71  ? 36  GLU B OE2   1 
ATOM   4774 N  N     . ILE B 2 49  ? 50.897 150.753 49.987 1.00 59.17  ? 37  ILE B N     1 
ATOM   4775 C  CA    . ILE B 2 49  ? 52.315 150.726 50.300 1.00 58.80  ? 37  ILE B CA    1 
ATOM   4776 C  C     . ILE B 2 49  ? 53.007 152.013 49.868 1.00 61.06  ? 37  ILE B C     1 
ATOM   4777 O  O     . ILE B 2 49  ? 53.846 152.557 50.587 1.00 61.08  ? 37  ILE B O     1 
ATOM   4778 C  CB    . ILE B 2 49  ? 53.003 149.555 49.604 1.00 57.21  ? 37  ILE B CB    1 
ATOM   4779 C  CG1   . ILE B 2 49  ? 52.385 148.240 50.068 1.00 55.31  ? 37  ILE B CG1   1 
ATOM   4780 C  CG2   . ILE B 2 49  ? 54.494 149.590 49.890 1.00 58.18  ? 37  ILE B CG2   1 
ATOM   4781 C  CD1   . ILE B 2 49  ? 53.114 147.026 49.583 1.00 54.55  ? 37  ILE B CD1   1 
ATOM   4782 N  N     . CYS B 2 50  ? 52.644 152.504 48.688 1.00 63.13  ? 38  CYS B N     1 
ATOM   4783 C  CA    . CYS B 2 50  ? 53.307 153.667 48.116 1.00 63.63  ? 38  CYS B CA    1 
ATOM   4784 C  C     . CYS B 2 50  ? 52.789 154.983 48.687 1.00 64.91  ? 38  CYS B C     1 
ATOM   4785 O  O     . CYS B 2 50  ? 53.503 155.978 48.673 1.00 65.93  ? 38  CYS B O     1 
ATOM   4786 C  CB    . CYS B 2 50  ? 53.156 153.662 46.589 1.00 63.81  ? 38  CYS B CB    1 
ATOM   4787 S  SG    . CYS B 2 50  ? 53.880 152.219 45.743 1.00 63.42  ? 38  CYS B SG    1 
ATOM   4788 N  N     . THR B 2 51  ? 51.553 155.006 49.185 1.00 67.18  ? 39  THR B N     1 
ATOM   4789 C  CA    . THR B 2 51  ? 51.090 156.177 49.931 1.00 69.03  ? 39  THR B CA    1 
ATOM   4790 C  C     . THR B 2 51  ? 52.048 156.401 51.092 1.00 69.00  ? 39  THR B C     1 
ATOM   4791 O  O     . THR B 2 51  ? 52.530 157.508 51.307 1.00 66.64  ? 39  THR B O     1 
ATOM   4792 C  CB    . THR B 2 51  ? 49.655 155.997 50.513 1.00 70.19  ? 39  THR B CB    1 
ATOM   4793 O  OG1   . THR B 2 51  ? 49.592 154.801 51.305 1.00 71.84  ? 39  THR B OG1   1 
ATOM   4794 C  CG2   . THR B 2 51  ? 48.623 155.929 49.399 1.00 71.06  ? 39  THR B CG2   1 
ATOM   4795 N  N     . GLU B 2 52  ? 52.340 155.328 51.821 1.00 70.74  ? 40  GLU B N     1 
ATOM   4796 C  CA    . GLU B 2 52  ? 53.154 155.427 53.023 1.00 73.03  ? 40  GLU B CA    1 
ATOM   4797 C  C     . GLU B 2 52  ? 54.597 155.818 52.722 1.00 73.93  ? 40  GLU B C     1 
ATOM   4798 O  O     . GLU B 2 52  ? 55.166 156.672 53.406 1.00 74.52  ? 40  GLU B O     1 
ATOM   4799 C  CB    . GLU B 2 52  ? 53.127 154.107 53.798 1.00 73.13  ? 40  GLU B CB    1 
ATOM   4800 C  CG    . GLU B 2 52  ? 53.615 154.239 55.245 1.00 74.46  ? 40  GLU B CG    1 
ATOM   4801 C  CD    . GLU B 2 52  ? 52.848 155.299 56.048 1.00 74.72  ? 40  GLU B CD    1 
ATOM   4802 O  OE1   . GLU B 2 52  ? 51.598 155.301 56.008 1.00 74.48  ? 40  GLU B OE1   1 
ATOM   4803 O  OE2   . GLU B 2 52  ? 53.496 156.132 56.721 1.00 74.26  ? 40  GLU B OE2   1 
ATOM   4804 N  N     . MET B 2 53  ? 55.188 155.205 51.700 1.00 74.14  ? 41  MET B N     1 
ATOM   4805 C  CA    . MET B 2 53  ? 56.557 155.535 51.319 1.00 74.41  ? 41  MET B CA    1 
ATOM   4806 C  C     . MET B 2 53  ? 56.647 156.940 50.742 1.00 74.37  ? 41  MET B C     1 
ATOM   4807 O  O     . MET B 2 53  ? 57.739 157.495 50.615 1.00 74.53  ? 41  MET B O     1 
ATOM   4808 C  CB    . MET B 2 53  ? 57.089 154.539 50.296 1.00 75.77  ? 41  MET B CB    1 
ATOM   4809 C  CG    . MET B 2 53  ? 57.029 153.100 50.744 1.00 78.33  ? 41  MET B CG    1 
ATOM   4810 S  SD    . MET B 2 53  ? 57.782 152.016 49.527 1.00 82.34  ? 41  MET B SD    1 
ATOM   4811 C  CE    . MET B 2 53  ? 59.529 152.500 49.687 1.00 80.60  ? 41  MET B CE    1 
ATOM   4812 N  N     . GLU B 2 54  ? 55.500 157.512 50.389 1.00 74.20  ? 42  GLU B N     1 
ATOM   4813 C  CA    . GLU B 2 54  ? 55.450 158.919 50.011 1.00 74.14  ? 42  GLU B CA    1 
ATOM   4814 C  C     . GLU B 2 54  ? 55.493 159.806 51.254 1.00 73.28  ? 42  GLU B C     1 
ATOM   4815 O  O     . GLU B 2 54  ? 56.312 160.714 51.334 1.00 72.82  ? 42  GLU B O     1 
ATOM   4816 C  CB    . GLU B 2 54  ? 54.183 159.214 49.206 1.00 75.32  ? 42  GLU B CB    1 
ATOM   4817 C  CG    . GLU B 2 54  ? 54.059 160.670 48.774 1.00 76.93  ? 42  GLU B CG    1 
ATOM   4818 C  CD    . GLU B 2 54  ? 53.300 160.841 47.463 1.00 78.61  ? 42  GLU B CD    1 
ATOM   4819 O  OE1   . GLU B 2 54  ? 52.594 159.890 47.050 1.00 79.30  ? 42  GLU B OE1   1 
ATOM   4820 O  OE2   . GLU B 2 54  ? 53.409 161.926 46.847 1.00 78.31  ? 42  GLU B OE2   1 
ATOM   4821 N  N     . LYS B 2 55  ? 54.619 159.530 52.222 1.00 72.94  ? 43  LYS B N     1 
ATOM   4822 C  CA    . LYS B 2 55  ? 54.625 160.244 53.498 1.00 71.75  ? 43  LYS B CA    1 
ATOM   4823 C  C     . LYS B 2 55  ? 56.005 160.187 54.128 1.00 72.33  ? 43  LYS B C     1 
ATOM   4824 O  O     . LYS B 2 55  ? 56.434 161.130 54.791 1.00 73.23  ? 43  LYS B O     1 
ATOM   4825 C  CB    . LYS B 2 55  ? 53.612 159.638 54.476 1.00 70.79  ? 43  LYS B CB    1 
ATOM   4826 C  CG    . LYS B 2 55  ? 52.163 160.018 54.211 1.00 71.62  ? 43  LYS B CG    1 
ATOM   4827 C  CD    . LYS B 2 55  ? 51.194 159.383 55.217 1.00 69.45  ? 43  LYS B CD    1 
ATOM   4828 C  CE    . LYS B 2 55  ? 49.752 159.465 54.705 1.00 67.68  ? 43  LYS B CE    1 
ATOM   4829 N  NZ    . LYS B 2 55  ? 49.386 160.839 54.229 1.00 63.72  ? 43  LYS B NZ    1 
ATOM   4830 N  N     . GLU B 2 56  ? 56.703 159.078 53.930 1.00 71.51  ? 44  GLU B N     1 
ATOM   4831 C  CA    . GLU B 2 56  ? 58.005 158.926 54.540 1.00 72.34  ? 44  GLU B CA    1 
ATOM   4832 C  C     . GLU B 2 56  ? 59.101 159.583 53.703 1.00 72.19  ? 44  GLU B C     1 
ATOM   4833 O  O     . GLU B 2 56  ? 60.104 160.048 54.237 1.00 71.84  ? 44  GLU B O     1 
ATOM   4834 C  CB    . GLU B 2 56  ? 58.304 157.442 54.763 1.00 74.69  ? 44  GLU B CB    1 
ATOM   4835 C  CG    . GLU B 2 56  ? 58.314 157.030 56.243 1.00 79.72  ? 44  GLU B CG    1 
ATOM   4836 C  CD    . GLU B 2 56  ? 57.171 156.081 56.634 1.00 82.71  ? 44  GLU B CD    1 
ATOM   4837 O  OE1   . GLU B 2 56  ? 56.076 156.576 56.998 1.00 84.14  ? 44  GLU B OE1   1 
ATOM   4838 O  OE2   . GLU B 2 56  ? 57.373 154.842 56.586 1.00 83.16  ? 44  GLU B OE2   1 
ATOM   4839 N  N     . GLY B 2 57  ? 58.910 159.635 52.391 1.00 71.81  ? 45  GLY B N     1 
ATOM   4840 C  CA    . GLY B 2 57  ? 59.910 160.261 51.547 1.00 70.78  ? 45  GLY B CA    1 
ATOM   4841 C  C     . GLY B 2 57  ? 60.924 159.282 50.988 1.00 70.26  ? 45  GLY B C     1 
ATOM   4842 O  O     . GLY B 2 57  ? 62.085 159.624 50.776 1.00 68.32  ? 45  GLY B O     1 
ATOM   4843 N  N     . LYS B 2 58  ? 60.479 158.054 50.747 1.00 70.81  ? 46  LYS B N     1 
ATOM   4844 C  CA    . LYS B 2 58  ? 61.323 157.043 50.121 1.00 71.63  ? 46  LYS B CA    1 
ATOM   4845 C  C     . LYS B 2 58  ? 61.058 156.986 48.615 1.00 70.61  ? 46  LYS B C     1 
ATOM   4846 O  O     . LYS B 2 58  ? 61.955 156.681 47.827 1.00 70.52  ? 46  LYS B O     1 
ATOM   4847 C  CB    . LYS B 2 58  ? 61.056 155.677 50.765 1.00 73.46  ? 46  LYS B CB    1 
ATOM   4848 C  CG    . LYS B 2 58  ? 61.327 155.644 52.271 1.00 75.54  ? 46  LYS B CG    1 
ATOM   4849 C  CD    . LYS B 2 58  ? 60.251 154.872 53.035 1.00 77.00  ? 46  LYS B CD    1 
ATOM   4850 C  CE    . LYS B 2 58  ? 60.557 154.815 54.541 1.00 78.21  ? 46  LYS B CE    1 
ATOM   4851 N  NZ    . LYS B 2 58  ? 59.677 153.854 55.296 1.00 77.79  ? 46  LYS B NZ    1 
ATOM   4852 N  N     . ILE B 2 59  ? 59.822 157.286 48.226 1.00 69.19  ? 47  ILE B N     1 
ATOM   4853 C  CA    . ILE B 2 59  ? 59.466 157.424 46.818 1.00 67.93  ? 47  ILE B CA    1 
ATOM   4854 C  C     . ILE B 2 59  ? 58.812 158.779 46.592 1.00 67.79  ? 47  ILE B C     1 
ATOM   4855 O  O     . ILE B 2 59  ? 57.948 159.192 47.369 1.00 68.33  ? 47  ILE B O     1 
ATOM   4856 C  CB    . ILE B 2 59  ? 58.470 156.343 46.387 1.00 66.58  ? 47  ILE B CB    1 
ATOM   4857 C  CG1   . ILE B 2 59  ? 57.116 156.590 47.046 1.00 65.94  ? 47  ILE B CG1   1 
ATOM   4858 C  CG2   . ILE B 2 59  ? 58.961 154.987 46.826 1.00 67.31  ? 47  ILE B CG2   1 
ATOM   4859 C  CD1   . ILE B 2 59  ? 56.140 155.462 46.851 1.00 65.29  ? 47  ILE B CD1   1 
ATOM   4860 N  N     . SER B 2 60  ? 59.218 159.469 45.529 1.00 66.58  ? 48  SER B N     1 
ATOM   4861 C  CA    . SER B 2 60  ? 58.574 160.729 45.147 1.00 64.64  ? 48  SER B CA    1 
ATOM   4862 C  C     . SER B 2 60  ? 57.706 160.514 43.915 1.00 62.60  ? 48  SER B C     1 
ATOM   4863 O  O     . SER B 2 60  ? 57.959 159.607 43.134 1.00 63.08  ? 48  SER B O     1 
ATOM   4864 C  CB    . SER B 2 60  ? 59.626 161.794 44.845 1.00 64.42  ? 48  SER B CB    1 
ATOM   4865 O  OG    . SER B 2 60  ? 60.564 161.891 45.901 1.00 64.25  ? 48  SER B OG    1 
ATOM   4866 N  N     . LYS B 2 61  ? 56.686 161.346 43.741 1.00 60.36  ? 49  LYS B N     1 
ATOM   4867 C  CA    . LYS B 2 61  ? 55.799 161.212 42.594 1.00 58.26  ? 49  LYS B CA    1 
ATOM   4868 C  C     . LYS B 2 61  ? 56.372 161.963 41.396 1.00 56.03  ? 49  LYS B C     1 
ATOM   4869 O  O     . LYS B 2 61  ? 56.874 163.071 41.531 1.00 56.31  ? 49  LYS B O     1 
ATOM   4870 C  CB    . LYS B 2 61  ? 54.410 161.749 42.942 1.00 58.79  ? 49  LYS B CB    1 
ATOM   4871 C  CG    . LYS B 2 61  ? 53.331 161.380 41.946 1.00 60.84  ? 49  LYS B CG    1 
ATOM   4872 C  CD    . LYS B 2 61  ? 51.954 161.555 42.565 1.00 62.42  ? 49  LYS B CD    1 
ATOM   4873 C  CE    . LYS B 2 61  ? 51.758 160.608 43.746 1.00 63.67  ? 49  LYS B CE    1 
ATOM   4874 N  NZ    . LYS B 2 61  ? 50.318 160.435 44.113 1.00 62.90  ? 49  LYS B NZ    1 
ATOM   4875 N  N     . ILE B 2 62  ? 56.307 161.351 40.222 1.00 53.87  ? 50  ILE B N     1 
ATOM   4876 C  CA    . ILE B 2 62  ? 56.849 161.963 39.020 1.00 51.86  ? 50  ILE B CA    1 
ATOM   4877 C  C     . ILE B 2 62  ? 55.833 161.861 37.900 1.00 51.99  ? 50  ILE B C     1 
ATOM   4878 O  O     . ILE B 2 62  ? 54.709 161.391 38.112 1.00 52.66  ? 50  ILE B O     1 
ATOM   4879 C  CB    . ILE B 2 62  ? 58.145 161.268 38.569 1.00 51.44  ? 50  ILE B CB    1 
ATOM   4880 C  CG1   . ILE B 2 62  ? 57.877 159.788 38.279 1.00 50.86  ? 50  ILE B CG1   1 
ATOM   4881 C  CG2   . ILE B 2 62  ? 59.197 161.401 39.641 1.00 50.75  ? 50  ILE B CG2   1 
ATOM   4882 C  CD1   . ILE B 2 62  ? 59.109 159.014 37.870 1.00 50.29  ? 50  ILE B CD1   1 
ATOM   4883 N  N     . GLY B 2 63  ? 56.235 162.301 36.712 1.00 50.87  ? 51  GLY B N     1 
ATOM   4884 C  CA    . GLY B 2 63  ? 55.337 162.278 35.573 1.00 50.99  ? 51  GLY B CA    1 
ATOM   4885 C  C     . GLY B 2 63  ? 56.029 161.763 34.333 1.00 51.20  ? 51  GLY B C     1 
ATOM   4886 O  O     . GLY B 2 63  ? 57.071 161.122 34.439 1.00 50.49  ? 51  GLY B O     1 
ATOM   4887 N  N     . PRO B 2 64  ? 55.482 162.039 33.139 1.00 51.26  ? 52  PRO B N     1 
ATOM   4888 C  CA    . PRO B 2 64  ? 56.047 161.541 31.883 1.00 51.46  ? 52  PRO B CA    1 
ATOM   4889 C  C     . PRO B 2 64  ? 57.454 162.040 31.558 1.00 51.21  ? 52  PRO B C     1 
ATOM   4890 O  O     . PRO B 2 64  ? 58.185 161.365 30.833 1.00 51.26  ? 52  PRO B O     1 
ATOM   4891 C  CB    . PRO B 2 64  ? 55.028 161.969 30.828 1.00 50.07  ? 52  PRO B CB    1 
ATOM   4892 C  CG    . PRO B 2 64  ? 54.348 163.126 31.425 1.00 50.51  ? 52  PRO B CG    1 
ATOM   4893 C  CD    . PRO B 2 64  ? 54.292 162.869 32.906 1.00 50.37  ? 52  PRO B CD    1 
ATOM   4894 N  N     . GLU B 2 65  ? 57.843 163.198 32.088 1.00 51.00  ? 53  GLU B N     1 
ATOM   4895 C  CA    . GLU B 2 65  ? 59.151 163.759 31.743 1.00 52.47  ? 53  GLU B CA    1 
ATOM   4896 C  C     . GLU B 2 65  ? 60.269 162.782 32.067 1.00 52.13  ? 53  GLU B C     1 
ATOM   4897 O  O     . GLU B 2 65  ? 61.394 162.935 31.613 1.00 53.13  ? 53  GLU B O     1 
ATOM   4898 C  CB    . GLU B 2 65  ? 59.412 165.074 32.476 1.00 53.48  ? 53  GLU B CB    1 
ATOM   4899 C  CG    . GLU B 2 65  ? 58.367 165.472 33.504 1.00 56.28  ? 53  GLU B CG    1 
ATOM   4900 C  CD    . GLU B 2 65  ? 58.440 164.661 34.780 1.00 57.54  ? 53  GLU B CD    1 
ATOM   4901 O  OE1   . GLU B 2 65  ? 58.062 163.472 34.734 1.00 59.68  ? 53  GLU B OE1   1 
ATOM   4902 O  OE2   . GLU B 2 65  ? 58.866 165.210 35.824 1.00 55.95  ? 53  GLU B OE2   1 
ATOM   4903 N  N     . ASN B 2 66  ? 59.952 161.768 32.856 1.00 51.66  ? 54  ASN B N     1 
ATOM   4904 C  CA    . ASN B 2 66  ? 60.903 160.706 33.137 1.00 50.75  ? 54  ASN B CA    1 
ATOM   4905 C  C     . ASN B 2 66  ? 60.634 159.532 32.206 1.00 50.13  ? 54  ASN B C     1 
ATOM   4906 O  O     . ASN B 2 66  ? 59.663 158.800 32.372 1.00 50.17  ? 54  ASN B O     1 
ATOM   4907 C  CB    . ASN B 2 66  ? 60.759 160.263 34.588 1.00 50.25  ? 54  ASN B CB    1 
ATOM   4908 C  CG    . ASN B 2 66  ? 61.727 159.182 34.960 1.00 50.10  ? 54  ASN B CG    1 
ATOM   4909 O  OD1   . ASN B 2 66  ? 62.230 158.456 34.105 1.00 50.42  ? 54  ASN B OD1   1 
ATOM   4910 N  ND2   . ASN B 2 66  ? 61.997 159.061 36.249 1.00 51.80  ? 54  ASN B ND2   1 
ATOM   4911 N  N     . PRO B 2 67  ? 61.508 159.340 31.216 1.00 49.30  ? 55  PRO B N     1 
ATOM   4912 C  CA    . PRO B 2 67  ? 61.369 158.372 30.120 1.00 49.00  ? 55  PRO B CA    1 
ATOM   4913 C  C     . PRO B 2 67  ? 61.469 156.904 30.518 1.00 48.37  ? 55  PRO B C     1 
ATOM   4914 O  O     . PRO B 2 67  ? 61.222 156.021 29.702 1.00 48.02  ? 55  PRO B O     1 
ATOM   4915 C  CB    . PRO B 2 67  ? 62.474 158.770 29.148 1.00 50.17  ? 55  PRO B CB    1 
ATOM   4916 C  CG    . PRO B 2 67  ? 63.481 159.457 29.998 1.00 51.21  ? 55  PRO B CG    1 
ATOM   4917 C  CD    . PRO B 2 67  ? 62.724 160.156 31.086 1.00 49.00  ? 55  PRO B CD    1 
ATOM   4918 N  N     . TYR B 2 68  ? 61.826 156.652 31.773 1.00 47.74  ? 56  TYR B N     1 
ATOM   4919 C  CA    . TYR B 2 68  ? 62.182 155.312 32.222 1.00 45.96  ? 56  TYR B CA    1 
ATOM   4920 C  C     . TYR B 2 68  ? 61.058 154.622 32.980 1.00 44.87  ? 56  TYR B C     1 
ATOM   4921 O  O     . TYR B 2 68  ? 60.293 155.273 33.658 1.00 43.90  ? 56  TYR B O     1 
ATOM   4922 C  CB    . TYR B 2 68  ? 63.428 155.390 33.097 1.00 45.60  ? 56  TYR B CB    1 
ATOM   4923 C  CG    . TYR B 2 68  ? 64.589 156.024 32.380 1.00 47.95  ? 56  TYR B CG    1 
ATOM   4924 C  CD1   . TYR B 2 68  ? 65.108 155.453 31.229 1.00 50.89  ? 56  TYR B CD1   1 
ATOM   4925 C  CD2   . TYR B 2 68  ? 65.161 157.191 32.841 1.00 48.45  ? 56  TYR B CD2   1 
ATOM   4926 C  CE1   . TYR B 2 68  ? 66.168 156.025 30.554 1.00 50.69  ? 56  TYR B CE1   1 
ATOM   4927 C  CE2   . TYR B 2 68  ? 66.217 157.771 32.178 1.00 50.24  ? 56  TYR B CE2   1 
ATOM   4928 C  CZ    . TYR B 2 68  ? 66.722 157.185 31.034 1.00 50.51  ? 56  TYR B CZ    1 
ATOM   4929 O  OH    . TYR B 2 68  ? 67.798 157.751 30.382 1.00 49.83  ? 56  TYR B OH    1 
ATOM   4930 N  N     . ASN B 2 69  ? 60.958 153.301 32.856 1.00 44.13  ? 57  ASN B N     1 
ATOM   4931 C  CA    . ASN B 2 69  ? 60.015 152.544 33.656 1.00 43.86  ? 57  ASN B CA    1 
ATOM   4932 C  C     . ASN B 2 69  ? 60.484 151.128 33.929 1.00 45.32  ? 57  ASN B C     1 
ATOM   4933 O  O     . ASN B 2 69  ? 61.119 150.511 33.078 1.00 44.61  ? 57  ASN B O     1 
ATOM   4934 C  CB    . ASN B 2 69  ? 58.665 152.484 32.972 1.00 43.36  ? 57  ASN B CB    1 
ATOM   4935 C  CG    . ASN B 2 69  ? 57.534 152.296 33.949 1.00 43.74  ? 57  ASN B CG    1 
ATOM   4936 O  OD1   . ASN B 2 69  ? 57.097 153.254 34.601 1.00 42.67  ? 57  ASN B OD1   1 
ATOM   4937 N  ND2   . ASN B 2 69  ? 57.053 151.063 34.067 1.00 38.46  ? 57  ASN B ND2   1 
ATOM   4938 N  N     . THR B 2 70  ? 60.163 150.636 35.128 1.00 46.19  ? 58  THR B N     1 
ATOM   4939 C  CA    . THR B 2 70  ? 60.327 149.233 35.510 1.00 47.55  ? 58  THR B CA    1 
ATOM   4940 C  C     . THR B 2 70  ? 59.015 148.673 36.106 1.00 49.34  ? 58  THR B C     1 
ATOM   4941 O  O     . THR B 2 70  ? 58.272 149.380 36.801 1.00 50.58  ? 58  THR B O     1 
ATOM   4942 C  CB    . THR B 2 70  ? 61.441 149.085 36.554 1.00 48.58  ? 58  THR B CB    1 
ATOM   4943 O  OG1   . THR B 2 70  ? 62.686 149.527 35.999 1.00 49.06  ? 58  THR B OG1   1 
ATOM   4944 C  CG2   . THR B 2 70  ? 61.566 147.644 36.991 1.00 50.12  ? 58  THR B CG2   1 
ATOM   4945 N  N     . PRO B 2 71  ? 58.706 147.399 35.828 1.00 49.11  ? 59  PRO B N     1 
ATOM   4946 C  CA    . PRO B 2 71  ? 57.444 146.816 36.291 1.00 50.56  ? 59  PRO B CA    1 
ATOM   4947 C  C     . PRO B 2 71  ? 57.383 146.708 37.800 1.00 52.67  ? 59  PRO B C     1 
ATOM   4948 O  O     . PRO B 2 71  ? 58.413 146.575 38.440 1.00 53.84  ? 59  PRO B O     1 
ATOM   4949 C  CB    . PRO B 2 71  ? 57.422 145.444 35.634 1.00 48.94  ? 59  PRO B CB    1 
ATOM   4950 C  CG    . PRO B 2 71  ? 58.291 145.595 34.448 1.00 48.08  ? 59  PRO B CG    1 
ATOM   4951 C  CD    . PRO B 2 71  ? 59.385 146.514 34.872 1.00 48.95  ? 59  PRO B CD    1 
ATOM   4952 N  N     . VAL B 2 72  ? 56.177 146.778 38.364 1.00 54.65  ? 60  VAL B N     1 
ATOM   4953 C  CA    . VAL B 2 72  ? 55.948 146.339 39.736 1.00 57.09  ? 60  VAL B CA    1 
ATOM   4954 C  C     . VAL B 2 72  ? 54.708 145.463 39.855 1.00 60.11  ? 60  VAL B C     1 
ATOM   4955 O  O     . VAL B 2 72  ? 53.681 145.727 39.225 1.00 60.73  ? 60  VAL B O     1 
ATOM   4956 C  CB    . VAL B 2 72  ? 55.763 147.515 40.716 1.00 55.87  ? 60  VAL B CB    1 
ATOM   4957 C  CG1   . VAL B 2 72  ? 56.950 148.431 40.666 1.00 56.55  ? 60  VAL B CG1   1 
ATOM   4958 C  CG2   . VAL B 2 72  ? 54.501 148.257 40.393 1.00 55.95  ? 60  VAL B CG2   1 
ATOM   4959 N  N     . PHE B 2 73  ? 54.818 144.411 40.663 1.00 62.51  ? 61  PHE B N     1 
ATOM   4960 C  CA    . PHE B 2 73  ? 53.651 143.783 41.272 1.00 64.96  ? 61  PHE B CA    1 
ATOM   4961 C  C     . PHE B 2 73  ? 53.875 143.643 42.772 1.00 66.45  ? 61  PHE B C     1 
ATOM   4962 O  O     . PHE B 2 73  ? 54.759 144.286 43.341 1.00 65.08  ? 61  PHE B O     1 
ATOM   4963 C  CB    . PHE B 2 73  ? 53.359 142.409 40.641 1.00 65.31  ? 61  PHE B CB    1 
ATOM   4964 C  CG    . PHE B 2 73  ? 54.479 141.393 40.793 1.00 66.13  ? 61  PHE B CG    1 
ATOM   4965 C  CD1   . PHE B 2 73  ? 55.807 141.750 40.596 1.00 65.25  ? 61  PHE B CD1   1 
ATOM   4966 C  CD2   . PHE B 2 73  ? 54.190 140.067 41.092 1.00 64.08  ? 61  PHE B CD2   1 
ATOM   4967 C  CE1   . PHE B 2 73  ? 56.818 140.804 40.702 1.00 65.09  ? 61  PHE B CE1   1 
ATOM   4968 C  CE2   . PHE B 2 73  ? 55.197 139.128 41.196 1.00 63.08  ? 61  PHE B CE2   1 
ATOM   4969 C  CZ    . PHE B 2 73  ? 56.511 139.494 40.999 1.00 62.93  ? 61  PHE B CZ    1 
ATOM   4970 N  N     . ALA B 2 74  ? 53.064 142.815 43.414 1.00 69.09  ? 62  ALA B N     1 
ATOM   4971 C  CA    . ALA B 2 74  ? 53.219 142.579 44.838 1.00 72.68  ? 62  ALA B CA    1 
ATOM   4972 C  C     . ALA B 2 74  ? 52.841 141.154 45.174 1.00 74.70  ? 62  ALA B C     1 
ATOM   4973 O  O     . ALA B 2 74  ? 51.949 140.574 44.556 1.00 75.16  ? 62  ALA B O     1 
ATOM   4974 C  CB    . ALA B 2 74  ? 52.358 143.540 45.625 1.00 73.87  ? 62  ALA B CB    1 
ATOM   4975 N  N     . ILE B 2 75  ? 53.532 140.596 46.159 1.00 77.46  ? 63  ILE B N     1 
ATOM   4976 C  CA    . ILE B 2 75  ? 53.298 139.226 46.574 1.00 80.42  ? 63  ILE B CA    1 
ATOM   4977 C  C     . ILE B 2 75  ? 53.188 139.169 48.082 1.00 82.98  ? 63  ILE B C     1 
ATOM   4978 O  O     . ILE B 2 75  ? 53.976 139.799 48.786 1.00 84.22  ? 63  ILE B O     1 
ATOM   4979 C  CB    . ILE B 2 75  ? 54.457 138.307 46.144 1.00 80.03  ? 63  ILE B CB    1 
ATOM   4980 C  CG1   . ILE B 2 75  ? 55.779 138.836 46.702 1.00 79.87  ? 63  ILE B CG1   1 
ATOM   4981 C  CG2   . ILE B 2 75  ? 54.523 138.223 44.638 1.00 79.34  ? 63  ILE B CG2   1 
ATOM   4982 C  CD1   . ILE B 2 75  ? 56.952 137.933 46.425 1.00 79.75  ? 63  ILE B CD1   1 
ATOM   4983 N  N     . LYS B 2 76  ? 52.207 138.423 48.577 1.00 85.98  ? 64  LYS B N     1 
ATOM   4984 C  CA    . LYS B 2 76  ? 52.242 137.955 49.959 1.00 89.18  ? 64  LYS B CA    1 
ATOM   4985 C  C     . LYS B 2 76  ? 53.372 136.926 50.017 1.00 90.98  ? 64  LYS B C     1 
ATOM   4986 O  O     . LYS B 2 76  ? 53.310 135.903 49.333 1.00 90.16  ? 64  LYS B O     1 
ATOM   4987 C  CB    . LYS B 2 76  ? 50.916 137.280 50.332 1.00 89.09  ? 64  LYS B CB    1 
ATOM   4988 C  CG    . LYS B 2 76  ? 49.709 138.200 50.400 1.00 88.54  ? 64  LYS B CG    1 
ATOM   4989 C  CD    . LYS B 2 76  ? 48.425 137.384 50.336 1.00 88.13  ? 64  LYS B CD    1 
ATOM   4990 C  CE    . LYS B 2 76  ? 47.259 138.107 50.997 1.00 88.29  ? 64  LYS B CE    1 
ATOM   4991 N  NZ    . LYS B 2 76  ? 46.009 137.285 50.967 1.00 87.74  ? 64  LYS B NZ    1 
ATOM   4992 N  N     . LYS B 2 77  ? 54.407 137.193 50.814 1.00 93.45  ? 65  LYS B N     1 
ATOM   4993 C  CA    . LYS B 2 77  ? 55.594 136.342 50.773 1.00 95.86  ? 65  LYS B CA    1 
ATOM   4994 C  C     . LYS B 2 77  ? 55.253 134.907 51.177 1.00 98.21  ? 65  LYS B C     1 
ATOM   4995 O  O     . LYS B 2 77  ? 55.977 133.971 50.830 1.00 98.86  ? 65  LYS B O     1 
ATOM   4996 C  CB    . LYS B 2 77  ? 56.715 136.901 51.668 1.00 94.58  ? 65  LYS B CB    1 
ATOM   4997 C  CG    . LYS B 2 77  ? 58.002 136.075 51.601 1.00 92.77  ? 65  LYS B CG    1 
ATOM   4998 C  CD    . LYS B 2 77  ? 59.283 136.909 51.676 1.00 91.73  ? 65  LYS B CD    1 
ATOM   4999 C  CE    . LYS B 2 77  ? 60.491 136.059 51.252 1.00 91.15  ? 65  LYS B CE    1 
ATOM   5000 N  NZ    . LYS B 2 77  ? 61.819 136.723 51.388 1.00 89.00  ? 65  LYS B NZ    1 
ATOM   5001 N  N     . LYS B 2 78  ? 54.149 134.741 51.905 1.00 100.17 ? 66  LYS B N     1 
ATOM   5002 C  CA    . LYS B 2 78  ? 53.553 133.424 52.132 1.00 101.98 ? 66  LYS B CA    1 
ATOM   5003 C  C     . LYS B 2 78  ? 52.086 133.553 52.527 1.00 103.38 ? 66  LYS B C     1 
ATOM   5004 O  O     . LYS B 2 78  ? 51.375 134.427 52.025 1.00 103.59 ? 66  LYS B O     1 
ATOM   5005 C  CB    . LYS B 2 78  ? 54.311 132.664 53.223 1.00 101.58 ? 66  LYS B CB    1 
ATOM   5006 C  CG    . LYS B 2 78  ? 55.059 131.457 52.698 1.00 101.76 ? 66  LYS B CG    1 
ATOM   5007 C  CD    . LYS B 2 78  ? 56.505 131.798 52.408 1.00 101.59 ? 66  LYS B CD    1 
ATOM   5008 C  CE    . LYS B 2 78  ? 57.094 130.875 51.357 1.00 101.19 ? 66  LYS B CE    1 
ATOM   5009 N  NZ    . LYS B 2 78  ? 58.496 131.265 51.052 1.00 100.82 ? 66  LYS B NZ    1 
ATOM   5010 N  N     . ASP B 2 79  ? 51.633 132.680 53.425 1.00 104.49 ? 67  ASP B N     1 
ATOM   5011 C  CA    . ASP B 2 79  ? 50.267 132.764 53.938 1.00 105.14 ? 67  ASP B CA    1 
ATOM   5012 C  C     . ASP B 2 79  ? 50.116 133.897 54.948 1.00 105.24 ? 67  ASP B C     1 
ATOM   5013 O  O     . ASP B 2 79  ? 50.172 133.685 56.164 1.00 105.46 ? 67  ASP B O     1 
ATOM   5014 C  CB    . ASP B 2 79  ? 49.853 131.436 54.568 1.00 105.03 ? 67  ASP B CB    1 
ATOM   5015 C  CG    . ASP B 2 79  ? 49.339 130.447 53.541 1.00 106.21 ? 67  ASP B CG    1 
ATOM   5016 O  OD1   . ASP B 2 79  ? 50.030 129.434 53.290 1.00 106.14 ? 67  ASP B OD1   1 
ATOM   5017 O  OD2   . ASP B 2 79  ? 48.243 130.687 52.981 1.00 106.00 ? 67  ASP B OD2   1 
ATOM   5018 N  N     . SER B 2 80  ? 49.910 135.101 54.421 1.00 104.59 ? 68  SER B N     1 
ATOM   5019 C  CA    . SER B 2 80  ? 50.014 136.317 55.208 1.00 103.30 ? 68  SER B CA    1 
ATOM   5020 C  C     . SER B 2 80  ? 49.017 137.347 54.705 1.00 102.19 ? 68  SER B C     1 
ATOM   5021 O  O     . SER B 2 80  ? 48.435 137.186 53.634 1.00 101.84 ? 68  SER B O     1 
ATOM   5022 C  CB    . SER B 2 80  ? 51.434 136.873 55.102 1.00 103.19 ? 68  SER B CB    1 
ATOM   5023 O  OG    . SER B 2 80  ? 51.576 138.056 55.862 1.00 103.81 ? 68  SER B OG    1 
ATOM   5024 N  N     . THR B 2 81  ? 48.817 138.402 55.490 1.00 101.37 ? 69  THR B N     1 
ATOM   5025 C  CA    . THR B 2 81  ? 48.043 139.560 55.041 1.00 100.10 ? 69  THR B CA    1 
ATOM   5026 C  C     . THR B 2 81  ? 49.005 140.653 54.570 1.00 98.15  ? 69  THR B C     1 
ATOM   5027 O  O     . THR B 2 81  ? 48.622 141.552 53.820 1.00 98.41  ? 69  THR B O     1 
ATOM   5028 C  CB    . THR B 2 81  ? 47.145 140.153 56.175 1.00 100.72 ? 69  THR B CB    1 
ATOM   5029 O  OG1   . THR B 2 81  ? 47.968 140.727 57.199 1.00 100.84 ? 69  THR B OG1   1 
ATOM   5030 C  CG2   . THR B 2 81  ? 46.258 139.071 56.786 1.00 100.42 ? 69  THR B CG2   1 
ATOM   5031 N  N     . LYS B 2 82  ? 50.257 140.571 55.018 1.00 95.12  ? 70  LYS B N     1 
ATOM   5032 C  CA    . LYS B 2 82  ? 51.286 141.500 54.566 1.00 90.41  ? 70  LYS B CA    1 
ATOM   5033 C  C     . LYS B 2 82  ? 51.653 141.249 53.107 1.00 87.71  ? 70  LYS B C     1 
ATOM   5034 O  O     . LYS B 2 82  ? 52.128 140.164 52.740 1.00 87.85  ? 70  LYS B O     1 
ATOM   5035 C  CB    . LYS B 2 82  ? 52.535 141.383 55.443 1.00 89.00  ? 70  LYS B CB    1 
ATOM   5036 C  CG    . LYS B 2 82  ? 52.751 142.587 56.340 1.00 88.27  ? 70  LYS B CG    1 
ATOM   5037 C  CD    . LYS B 2 82  ? 52.851 143.867 55.518 1.00 88.17  ? 70  LYS B CD    1 
ATOM   5038 C  CE    . LYS B 2 82  ? 53.050 145.094 56.391 1.00 86.65  ? 70  LYS B CE    1 
ATOM   5039 N  NZ    . LYS B 2 82  ? 51.755 145.680 56.806 1.00 86.73  ? 70  LYS B NZ    1 
ATOM   5040 N  N     . TRP B 2 83  ? 51.411 142.261 52.279 1.00 82.88  ? 71  TRP B N     1 
ATOM   5041 C  CA    . TRP B 2 83  ? 51.813 142.226 50.883 1.00 77.79  ? 71  TRP B CA    1 
ATOM   5042 C  C     . TRP B 2 83  ? 53.219 142.770 50.744 1.00 75.67  ? 71  TRP B C     1 
ATOM   5043 O  O     . TRP B 2 83  ? 53.586 143.739 51.405 1.00 75.27  ? 71  TRP B O     1 
ATOM   5044 C  CB    . TRP B 2 83  ? 50.865 143.067 50.042 1.00 74.38  ? 71  TRP B CB    1 
ATOM   5045 C  CG    . TRP B 2 83  ? 49.578 142.409 49.817 1.00 69.96  ? 71  TRP B CG    1 
ATOM   5046 C  CD1   . TRP B 2 83  ? 48.476 142.475 50.609 1.00 69.69  ? 71  TRP B CD1   1 
ATOM   5047 C  CD2   . TRP B 2 83  ? 49.240 141.568 48.724 1.00 68.04  ? 71  TRP B CD2   1 
ATOM   5048 N  NE1   . TRP B 2 83  ? 47.462 141.720 50.073 1.00 68.78  ? 71  TRP B NE1   1 
ATOM   5049 C  CE2   . TRP B 2 83  ? 47.910 141.151 48.909 1.00 67.61  ? 71  TRP B CE2   1 
ATOM   5050 C  CE3   . TRP B 2 83  ? 49.933 141.124 47.599 1.00 67.18  ? 71  TRP B CE3   1 
ATOM   5051 C  CZ2   . TRP B 2 83  ? 47.258 140.316 48.018 1.00 68.05  ? 71  TRP B CZ2   1 
ATOM   5052 C  CZ3   . TRP B 2 83  ? 49.288 140.295 46.712 1.00 68.23  ? 71  TRP B CZ3   1 
ATOM   5053 C  CH2   . TRP B 2 83  ? 47.962 139.897 46.924 1.00 68.11  ? 71  TRP B CH2   1 
ATOM   5054 N  N     . ARG B 2 84  ? 54.006 142.144 49.884 1.00 73.06  ? 72  ARG B N     1 
ATOM   5055 C  CA    . ARG B 2 84  ? 55.349 142.620 49.655 1.00 72.11  ? 72  ARG B CA    1 
ATOM   5056 C  C     . ARG B 2 84  ? 55.487 143.202 48.263 1.00 71.46  ? 72  ARG B C     1 
ATOM   5057 O  O     . ARG B 2 84  ? 55.323 142.503 47.260 1.00 71.42  ? 72  ARG B O     1 
ATOM   5058 C  CB    . ARG B 2 84  ? 56.355 141.487 49.846 1.00 72.46  ? 72  ARG B CB    1 
ATOM   5059 C  CG    . ARG B 2 84  ? 57.550 141.896 50.682 1.00 72.41  ? 72  ARG B CG    1 
ATOM   5060 C  CD    . ARG B 2 84  ? 58.789 141.136 50.288 1.00 73.79  ? 72  ARG B CD    1 
ATOM   5061 N  NE    . ARG B 2 84  ? 59.505 141.795 49.208 1.00 74.46  ? 72  ARG B NE    1 
ATOM   5062 C  CZ    . ARG B 2 84  ? 60.577 142.548 49.393 1.00 75.87  ? 72  ARG B CZ    1 
ATOM   5063 N  NH1   . ARG B 2 84  ? 61.040 142.727 50.623 1.00 76.97  ? 72  ARG B NH1   1 
ATOM   5064 N  NH2   . ARG B 2 84  ? 61.182 143.115 48.355 1.00 76.16  ? 72  ARG B NH2   1 
ATOM   5065 N  N     . LYS B 2 85  ? 55.792 144.491 48.209 1.00 69.40  ? 73  LYS B N     1 
ATOM   5066 C  CA    . LYS B 2 85  ? 56.119 145.135 46.952 1.00 67.95  ? 73  LYS B CA    1 
ATOM   5067 C  C     . LYS B 2 85  ? 57.378 144.537 46.340 1.00 67.29  ? 73  LYS B C     1 
ATOM   5068 O  O     . LYS B 2 85  ? 58.411 144.415 47.000 1.00 68.07  ? 73  LYS B O     1 
ATOM   5069 C  CB    . LYS B 2 85  ? 56.320 146.628 47.169 1.00 67.41  ? 73  LYS B CB    1 
ATOM   5070 C  CG    . LYS B 2 85  ? 57.046 147.325 46.048 1.00 66.41  ? 73  LYS B CG    1 
ATOM   5071 C  CD    . LYS B 2 85  ? 56.898 148.822 46.174 1.00 66.88  ? 73  LYS B CD    1 
ATOM   5072 C  CE    . LYS B 2 85  ? 57.928 149.544 45.337 1.00 68.92  ? 73  LYS B CE    1 
ATOM   5073 N  NZ    . LYS B 2 85  ? 58.148 150.943 45.812 1.00 71.94  ? 73  LYS B NZ    1 
ATOM   5074 N  N     . LEU B 2 86  ? 57.275 144.164 45.068 1.00 65.56  ? 74  LEU B N     1 
ATOM   5075 C  CA    . LEU B 2 86  ? 58.414 143.679 44.309 1.00 63.06  ? 74  LEU B CA    1 
ATOM   5076 C  C     . LEU B 2 86  ? 58.541 144.485 43.020 1.00 60.64  ? 74  LEU B C     1 
ATOM   5077 O  O     . LEU B 2 86  ? 57.689 144.410 42.147 1.00 61.17  ? 74  LEU B O     1 
ATOM   5078 C  CB    . LEU B 2 86  ? 58.224 142.195 43.985 1.00 64.10  ? 74  LEU B CB    1 
ATOM   5079 C  CG    . LEU B 2 86  ? 59.471 141.312 43.864 1.00 64.60  ? 74  LEU B CG    1 
ATOM   5080 C  CD1   . LEU B 2 86  ? 60.344 141.507 45.101 1.00 65.69  ? 74  LEU B CD1   1 
ATOM   5081 C  CD2   . LEU B 2 86  ? 59.059 139.842 43.718 1.00 63.82  ? 74  LEU B CD2   1 
ATOM   5082 N  N     . VAL B 2 87  ? 59.604 145.264 42.913 1.00 57.63  ? 75  VAL B N     1 
ATOM   5083 C  CA    . VAL B 2 87  ? 59.915 145.950 41.679 1.00 55.54  ? 75  VAL B CA    1 
ATOM   5084 C  C     . VAL B 2 87  ? 60.894 145.107 40.877 1.00 56.29  ? 75  VAL B C     1 
ATOM   5085 O  O     . VAL B 2 87  ? 62.043 144.917 41.274 1.00 57.76  ? 75  VAL B O     1 
ATOM   5086 C  CB    . VAL B 2 87  ? 60.557 147.304 41.950 1.00 54.25  ? 75  VAL B CB    1 
ATOM   5087 C  CG1   . VAL B 2 87  ? 60.832 148.016 40.649 1.00 54.55  ? 75  VAL B CG1   1 
ATOM   5088 C  CG2   . VAL B 2 87  ? 59.652 148.126 42.813 1.00 54.42  ? 75  VAL B CG2   1 
ATOM   5089 N  N     . ASP B 2 88  ? 60.423 144.614 39.739 1.00 56.36  ? 76  ASP B N     1 
ATOM   5090 C  CA    . ASP B 2 88  ? 61.195 143.756 38.845 1.00 55.20  ? 76  ASP B CA    1 
ATOM   5091 C  C     . ASP B 2 88  ? 62.371 144.498 38.213 1.00 53.03  ? 76  ASP B C     1 
ATOM   5092 O  O     . ASP B 2 88  ? 62.352 144.777 37.020 1.00 51.62  ? 76  ASP B O     1 
ATOM   5093 C  CB    . ASP B 2 88  ? 60.259 143.220 37.753 1.00 56.05  ? 76  ASP B CB    1 
ATOM   5094 C  CG    . ASP B 2 88  ? 60.968 142.345 36.750 1.00 56.74  ? 76  ASP B CG    1 
ATOM   5095 O  OD1   . ASP B 2 88  ? 62.154 142.034 36.963 1.00 55.92  ? 76  ASP B OD1   1 
ATOM   5096 O  OD2   . ASP B 2 88  ? 60.336 141.969 35.746 1.00 56.68  ? 76  ASP B OD2   1 
ATOM   5097 N  N     . PHE B 2 89  ? 63.395 144.799 39.013 1.00 52.78  ? 77  PHE B N     1 
ATOM   5098 C  CA    . PHE B 2 89  ? 64.529 145.608 38.551 1.00 51.57  ? 77  PHE B CA    1 
ATOM   5099 C  C     . PHE B 2 89  ? 65.469 144.839 37.624 1.00 50.53  ? 77  PHE B C     1 
ATOM   5100 O  O     . PHE B 2 89  ? 66.536 145.329 37.256 1.00 50.42  ? 77  PHE B O     1 
ATOM   5101 C  CB    . PHE B 2 89  ? 65.326 146.166 39.742 1.00 49.55  ? 77  PHE B CB    1 
ATOM   5102 C  CG    . PHE B 2 89  ? 64.745 147.430 40.343 1.00 49.28  ? 77  PHE B CG    1 
ATOM   5103 C  CD1   . PHE B 2 89  ? 64.375 148.500 39.541 1.00 48.98  ? 77  PHE B CD1   1 
ATOM   5104 C  CD2   . PHE B 2 89  ? 64.586 147.552 41.720 1.00 49.57  ? 77  PHE B CD2   1 
ATOM   5105 C  CE1   . PHE B 2 89  ? 63.862 149.667 40.101 1.00 47.47  ? 77  PHE B CE1   1 
ATOM   5106 C  CE2   . PHE B 2 89  ? 64.075 148.715 42.283 1.00 47.58  ? 77  PHE B CE2   1 
ATOM   5107 C  CZ    . PHE B 2 89  ? 63.714 149.769 41.473 1.00 46.56  ? 77  PHE B CZ    1 
ATOM   5108 N  N     . ARG B 2 90  ? 65.058 143.637 37.247 1.00 49.93  ? 78  ARG B N     1 
ATOM   5109 C  CA    . ARG B 2 90  ? 65.830 142.789 36.348 1.00 50.89  ? 78  ARG B CA    1 
ATOM   5110 C  C     . ARG B 2 90  ? 66.598 143.577 35.310 1.00 52.80  ? 78  ARG B C     1 
ATOM   5111 O  O     . ARG B 2 90  ? 67.768 143.316 35.058 1.00 53.98  ? 78  ARG B O     1 
ATOM   5112 C  CB    . ARG B 2 90  ? 64.910 141.827 35.613 1.00 49.73  ? 78  ARG B CB    1 
ATOM   5113 C  CG    . ARG B 2 90  ? 65.501 140.472 35.358 1.00 47.73  ? 78  ARG B CG    1 
ATOM   5114 C  CD    . ARG B 2 90  ? 64.712 139.450 36.129 1.00 47.96  ? 78  ARG B CD    1 
ATOM   5115 N  NE    . ARG B 2 90  ? 63.289 139.731 36.019 1.00 48.44  ? 78  ARG B NE    1 
ATOM   5116 C  CZ    . ARG B 2 90  ? 62.421 138.950 35.391 1.00 47.71  ? 78  ARG B CZ    1 
ATOM   5117 N  NH1   . ARG B 2 90  ? 62.833 137.830 34.814 1.00 46.43  ? 78  ARG B NH1   1 
ATOM   5118 N  NH2   . ARG B 2 90  ? 61.141 139.289 35.353 1.00 45.94  ? 78  ARG B NH2   1 
ATOM   5119 N  N     . GLU B 2 91  ? 65.937 144.534 34.683 1.00 54.67  ? 79  GLU B N     1 
ATOM   5120 C  CA    . GLU B 2 91  ? 66.576 145.235 33.592 1.00 55.46  ? 79  GLU B CA    1 
ATOM   5121 C  C     . GLU B 2 91  ? 67.593 146.224 34.117 1.00 55.52  ? 79  GLU B C     1 
ATOM   5122 O  O     . GLU B 2 91  ? 68.723 146.279 33.648 1.00 56.27  ? 79  GLU B O     1 
ATOM   5123 C  CB    . GLU B 2 91  ? 65.542 145.961 32.762 1.00 55.73  ? 79  GLU B CB    1 
ATOM   5124 C  CG    . GLU B 2 91  ? 65.995 146.162 31.354 1.00 60.68  ? 79  GLU B CG    1 
ATOM   5125 C  CD    . GLU B 2 91  ? 66.073 144.860 30.569 1.00 64.73  ? 79  GLU B CD    1 
ATOM   5126 O  OE1   . GLU B 2 91  ? 66.305 144.928 29.340 1.00 67.78  ? 79  GLU B OE1   1 
ATOM   5127 O  OE2   . GLU B 2 91  ? 65.901 143.772 31.171 1.00 65.09  ? 79  GLU B OE2   1 
ATOM   5128 N  N     . LEU B 2 92  ? 67.189 147.006 35.102 1.00 55.87  ? 80  LEU B N     1 
ATOM   5129 C  CA    . LEU B 2 92  ? 68.062 148.030 35.632 1.00 56.12  ? 80  LEU B CA    1 
ATOM   5130 C  C     . LEU B 2 92  ? 69.290 147.372 36.205 1.00 57.16  ? 80  LEU B C     1 
ATOM   5131 O  O     . LEU B 2 92  ? 70.400 147.853 36.020 1.00 58.29  ? 80  LEU B O     1 
ATOM   5132 C  CB    . LEU B 2 92  ? 67.340 148.827 36.714 1.00 55.23  ? 80  LEU B CB    1 
ATOM   5133 C  CG    . LEU B 2 92  ? 68.156 149.862 37.483 1.00 54.68  ? 80  LEU B CG    1 
ATOM   5134 C  CD1   . LEU B 2 92  ? 69.119 150.581 36.550 1.00 53.05  ? 80  LEU B CD1   1 
ATOM   5135 C  CD2   . LEU B 2 92  ? 67.202 150.830 38.164 1.00 53.05  ? 80  LEU B CD2   1 
ATOM   5136 N  N     . ASN B 2 93  ? 69.095 146.262 36.900 1.00 58.10  ? 81  ASN B N     1 
ATOM   5137 C  CA    . ASN B 2 93  ? 70.223 145.579 37.510 1.00 59.63  ? 81  ASN B CA    1 
ATOM   5138 C  C     . ASN B 2 93  ? 71.196 145.188 36.412 1.00 61.12  ? 81  ASN B C     1 
ATOM   5139 O  O     . ASN B 2 93  ? 72.395 145.411 36.513 1.00 62.79  ? 81  ASN B O     1 
ATOM   5140 C  CB    . ASN B 2 93  ? 69.739 144.348 38.278 1.00 57.19  ? 81  ASN B CB    1 
ATOM   5141 C  CG    . ASN B 2 93  ? 69.008 144.718 39.566 1.00 57.47  ? 81  ASN B CG    1 
ATOM   5142 O  OD1   . ASN B 2 93  ? 69.264 145.769 40.147 1.00 58.31  ? 81  ASN B OD1   1 
ATOM   5143 N  ND2   . ASN B 2 93  ? 68.103 143.857 40.015 1.00 56.04  ? 81  ASN B ND2   1 
ATOM   5144 N  N     . LYS B 2 94  ? 70.657 144.634 35.341 1.00 63.87  ? 82  LYS B N     1 
ATOM   5145 C  CA    . LYS B 2 94  ? 71.444 144.237 34.186 1.00 65.79  ? 82  LYS B CA    1 
ATOM   5146 C  C     . LYS B 2 94  ? 72.192 145.435 33.597 1.00 67.27  ? 82  LYS B C     1 
ATOM   5147 O  O     . LYS B 2 94  ? 73.242 145.281 32.973 1.00 66.61  ? 82  LYS B O     1 
ATOM   5148 C  CB    . LYS B 2 94  ? 70.503 143.619 33.149 1.00 66.02  ? 82  LYS B CB    1 
ATOM   5149 C  CG    . LYS B 2 94  ? 71.161 143.083 31.903 1.00 68.61  ? 82  LYS B CG    1 
ATOM   5150 C  CD    . LYS B 2 94  ? 70.640 141.680 31.565 1.00 70.25  ? 82  LYS B CD    1 
ATOM   5151 C  CE    . LYS B 2 94  ? 69.128 141.558 31.764 1.00 70.50  ? 82  LYS B CE    1 
ATOM   5152 N  NZ    . LYS B 2 94  ? 68.319 142.025 30.597 1.00 70.58  ? 82  LYS B NZ    1 
ATOM   5153 N  N     . ARG B 2 95  ? 71.649 146.629 33.806 1.00 69.55  ? 83  ARG B N     1 
ATOM   5154 C  CA    . ARG B 2 95  ? 72.196 147.842 33.203 1.00 72.82  ? 83  ARG B CA    1 
ATOM   5155 C  C     . ARG B 2 95  ? 73.055 148.651 34.167 1.00 76.13  ? 83  ARG B C     1 
ATOM   5156 O  O     . ARG B 2 95  ? 73.840 149.494 33.745 1.00 76.63  ? 83  ARG B O     1 
ATOM   5157 C  CB    . ARG B 2 95  ? 71.068 148.732 32.695 1.00 71.92  ? 83  ARG B CB    1 
ATOM   5158 C  CG    . ARG B 2 95  ? 70.414 148.253 31.429 1.00 71.71  ? 83  ARG B CG    1 
ATOM   5159 C  CD    . ARG B 2 95  ? 69.007 148.793 31.336 1.00 71.32  ? 83  ARG B CD    1 
ATOM   5160 N  NE    . ARG B 2 95  ? 68.656 149.142 29.967 1.00 71.48  ? 83  ARG B NE    1 
ATOM   5161 C  CZ    . ARG B 2 95  ? 68.086 148.308 29.106 1.00 71.90  ? 83  ARG B CZ    1 
ATOM   5162 N  NH1   . ARG B 2 95  ? 67.801 147.069 29.473 1.00 69.98  ? 83  ARG B NH1   1 
ATOM   5163 N  NH2   . ARG B 2 95  ? 67.800 148.715 27.877 1.00 73.11  ? 83  ARG B NH2   1 
ATOM   5164 N  N     . THR B 2 96  ? 72.891 148.403 35.461 1.00 80.03  ? 84  THR B N     1 
ATOM   5165 C  CA    . THR B 2 96  ? 73.691 149.069 36.477 1.00 83.66  ? 84  THR B CA    1 
ATOM   5166 C  C     . THR B 2 96  ? 75.158 148.625 36.460 1.00 87.83  ? 84  THR B C     1 
ATOM   5167 O  O     . THR B 2 96  ? 75.468 147.444 36.274 1.00 88.43  ? 84  THR B O     1 
ATOM   5168 C  CB    . THR B 2 96  ? 73.097 148.817 37.857 1.00 82.21  ? 84  THR B CB    1 
ATOM   5169 O  OG1   . THR B 2 96  ? 71.804 149.418 37.917 1.00 82.67  ? 84  THR B OG1   1 
ATOM   5170 C  CG2   . THR B 2 96  ? 73.967 149.408 38.932 1.00 82.24  ? 84  THR B CG2   1 
ATOM   5171 N  N     . GLN B 2 97  ? 76.052 149.588 36.665 1.00 92.17  ? 85  GLN B N     1 
ATOM   5172 C  CA    . GLN B 2 97  ? 77.478 149.410 36.420 1.00 96.57  ? 85  GLN B CA    1 
ATOM   5173 C  C     . GLN B 2 97  ? 78.033 148.154 37.058 1.00 99.52  ? 85  GLN B C     1 
ATOM   5174 O  O     . GLN B 2 97  ? 77.524 147.681 38.073 1.00 99.28  ? 85  GLN B O     1 
ATOM   5175 C  CB    . GLN B 2 97  ? 78.253 150.609 36.953 1.00 96.76  ? 85  GLN B CB    1 
ATOM   5176 C  CG    . GLN B 2 97  ? 78.242 150.701 38.462 1.00 98.02  ? 85  GLN B CG    1 
ATOM   5177 C  CD    . GLN B 2 97  ? 78.530 152.098 38.956 1.00 99.05  ? 85  GLN B CD    1 
ATOM   5178 O  OE1   . GLN B 2 97  ? 79.028 152.942 38.209 1.00 100.04 ? 85  GLN B OE1   1 
ATOM   5179 N  NE2   . GLN B 2 97  ? 78.215 152.356 40.220 1.00 99.56  ? 85  GLN B NE2   1 
ATOM   5180 N  N     . ASP B 2 98  ? 79.091 147.624 36.456 1.00 103.71 ? 86  ASP B N     1 
ATOM   5181 C  CA    . ASP B 2 98  ? 79.794 146.492 37.028 1.00 107.79 ? 86  ASP B CA    1 
ATOM   5182 C  C     . ASP B 2 98  ? 80.327 146.895 38.397 1.00 110.81 ? 86  ASP B C     1 
ATOM   5183 O  O     . ASP B 2 98  ? 81.288 147.656 38.501 1.00 110.81 ? 86  ASP B O     1 
ATOM   5184 C  CB    . ASP B 2 98  ? 80.939 146.063 36.110 1.00 106.74 ? 86  ASP B CB    1 
ATOM   5185 N  N     . PHE B 2 99  ? 79.680 146.399 39.446 1.00 115.01 ? 87  PHE B N     1 
ATOM   5186 C  CA    . PHE B 2 99  ? 80.192 146.550 40.801 1.00 119.51 ? 87  PHE B CA    1 
ATOM   5187 C  C     . PHE B 2 99  ? 79.481 145.627 41.780 1.00 123.05 ? 87  PHE B C     1 
ATOM   5188 O  O     . PHE B 2 99  ? 79.619 145.781 42.993 1.00 123.89 ? 87  PHE B O     1 
ATOM   5189 C  CB    . PHE B 2 99  ? 80.058 147.998 41.274 1.00 119.48 ? 87  PHE B CB    1 
ATOM   5190 C  CG    . PHE B 2 99  ? 78.690 148.351 41.792 1.00 119.42 ? 87  PHE B CG    1 
ATOM   5191 C  CD1   . PHE B 2 99  ? 77.660 148.651 40.920 1.00 119.62 ? 87  PHE B CD1   1 
ATOM   5192 C  CD2   . PHE B 2 99  ? 78.447 148.425 43.152 1.00 118.60 ? 87  PHE B CD2   1 
ATOM   5193 C  CE1   . PHE B 2 99  ? 76.423 149.021 41.394 1.00 119.30 ? 87  PHE B CE1   1 
ATOM   5194 C  CE2   . PHE B 2 99  ? 77.213 148.794 43.623 1.00 118.32 ? 87  PHE B CE2   1 
ATOM   5195 C  CZ    . PHE B 2 99  ? 76.203 149.092 42.745 1.00 118.70 ? 87  PHE B CZ    1 
ATOM   5196 N  N     . TRP B 2 100 ? 78.713 144.675 41.252 1.00 127.10 ? 88  TRP B N     1 
ATOM   5197 C  CA    . TRP B 2 100 ? 78.195 143.577 42.068 1.00 130.55 ? 88  TRP B CA    1 
ATOM   5198 C  C     . TRP B 2 100 ? 79.222 142.445 42.063 1.00 132.07 ? 88  TRP B C     1 
ATOM   5199 O  O     . TRP B 2 100 ? 79.094 141.455 42.791 1.00 132.08 ? 88  TRP B O     1 
ATOM   5200 C  CB    . TRP B 2 100 ? 76.826 143.094 41.539 1.00 131.81 ? 88  TRP B CB    1 
ATOM   5201 C  CG    . TRP B 2 100 ? 76.833 142.321 40.231 1.00 133.43 ? 88  TRP B CG    1 
ATOM   5202 C  CD1   . TRP B 2 100 ? 76.542 140.993 40.065 1.00 133.74 ? 88  TRP B CD1   1 
ATOM   5203 C  CD2   . TRP B 2 100 ? 77.105 142.835 38.917 1.00 134.00 ? 88  TRP B CD2   1 
ATOM   5204 N  NE1   . TRP B 2 100 ? 76.613 140.653 38.735 1.00 134.06 ? 88  TRP B NE1   1 
ATOM   5205 C  CE2   . TRP B 2 100 ? 76.956 141.768 38.007 1.00 134.30 ? 88  TRP B CE2   1 
ATOM   5206 C  CE3   . TRP B 2 100 ? 77.455 144.098 38.417 1.00 133.72 ? 88  TRP B CE3   1 
ATOM   5207 C  CZ2   . TRP B 2 100 ? 77.150 141.917 36.635 1.00 134.30 ? 88  TRP B CZ2   1 
ATOM   5208 C  CZ3   . TRP B 2 100 ? 77.646 144.244 37.053 1.00 133.40 ? 88  TRP B CZ3   1 
ATOM   5209 C  CH2   . TRP B 2 100 ? 77.492 143.162 36.180 1.00 133.80 ? 88  TRP B CH2   1 
ATOM   5210 N  N     . GLU B 2 101 ? 80.247 142.620 41.233 1.00 133.64 ? 89  GLU B N     1 
ATOM   5211 C  CA    . GLU B 2 101 ? 81.415 141.750 41.222 1.00 135.15 ? 89  GLU B CA    1 
ATOM   5212 C  C     . GLU B 2 101 ? 82.676 142.567 41.536 1.00 136.14 ? 89  GLU B C     1 
ATOM   5213 O  O     . GLU B 2 101 ? 83.570 142.097 42.243 1.00 136.03 ? 89  GLU B O     1 
ATOM   5214 C  CB    . GLU B 2 101 ? 81.554 141.073 39.847 1.00 135.07 ? 89  GLU B CB    1 
ATOM   5215 C  CG    . GLU B 2 101 ? 80.325 140.270 39.411 1.00 134.44 ? 89  GLU B CG    1 
ATOM   5216 C  CD    . GLU B 2 101 ? 80.474 139.648 38.031 1.00 133.94 ? 89  GLU B CD    1 
ATOM   5217 O  OE1   . GLU B 2 101 ? 79.563 138.904 37.610 1.00 133.61 ? 89  GLU B OE1   1 
ATOM   5218 O  OE2   . GLU B 2 101 ? 81.499 139.901 37.367 1.00 133.89 ? 89  GLU B OE2   1 
ATOM   5219 N  N     . VAL B 2 102 ? 82.728 143.798 41.024 1.00 137.28 ? 90  VAL B N     1 
ATOM   5220 C  CA    . VAL B 2 102 ? 83.947 144.613 41.056 1.00 138.23 ? 90  VAL B CA    1 
ATOM   5221 C  C     . VAL B 2 102 ? 84.165 145.401 42.353 1.00 139.03 ? 90  VAL B C     1 
ATOM   5222 O  O     . VAL B 2 102 ? 85.286 145.477 42.854 1.00 139.77 ? 90  VAL B O     1 
ATOM   5223 C  CB    . VAL B 2 102 ? 83.985 145.613 39.867 1.00 137.93 ? 90  VAL B CB    1 
ATOM   5224 C  CG1   . VAL B 2 102 ? 85.213 146.508 39.972 1.00 137.39 ? 90  VAL B CG1   1 
ATOM   5225 C  CG2   . VAL B 2 102 ? 84.007 144.854 38.549 1.00 137.46 ? 90  VAL B CG2   1 
ATOM   5226 N  N     . GLN B 2 103 ? 83.107 145.995 42.893 1.00 139.61 ? 91  GLN B N     1 
ATOM   5227 C  CA    . GLN B 2 103 ? 83.221 146.715 44.159 1.00 140.12 ? 91  GLN B CA    1 
ATOM   5228 C  C     . GLN B 2 103 ? 82.718 145.869 45.325 1.00 140.42 ? 91  GLN B C     1 
ATOM   5229 O  O     . GLN B 2 103 ? 83.061 146.118 46.484 1.00 139.95 ? 91  GLN B O     1 
ATOM   5230 C  CB    . GLN B 2 103 ? 82.443 148.032 44.090 1.00 140.03 ? 91  GLN B CB    1 
ATOM   5231 C  CG    . GLN B 2 103 ? 83.207 149.167 43.420 1.00 139.76 ? 91  GLN B CG    1 
ATOM   5232 C  CD    . GLN B 2 103 ? 84.110 148.692 42.297 1.00 139.70 ? 91  GLN B CD    1 
ATOM   5233 O  OE1   . GLN B 2 103 ? 83.758 148.784 41.120 1.00 139.29 ? 91  GLN B OE1   1 
ATOM   5234 N  NE2   . GLN B 2 103 ? 85.286 148.184 42.656 1.00 139.21 ? 91  GLN B NE2   1 
ATOM   5235 N  N     . LEU B 2 104 ? 81.906 144.866 45.002 1.00 140.80 ? 92  LEU B N     1 
ATOM   5236 C  CA    . LEU B 2 104 ? 81.451 143.889 45.983 1.00 140.92 ? 92  LEU B CA    1 
ATOM   5237 C  C     . LEU B 2 104 ? 82.667 143.148 46.532 1.00 140.64 ? 92  LEU B C     1 
ATOM   5238 O  O     . LEU B 2 104 ? 83.572 142.782 45.779 1.00 140.62 ? 92  LEU B O     1 
ATOM   5239 C  CB    . LEU B 2 104 ? 80.495 142.886 45.327 1.00 141.41 ? 92  LEU B CB    1 
ATOM   5240 C  CG    . LEU B 2 104 ? 79.196 142.562 46.073 1.00 141.87 ? 92  LEU B CG    1 
ATOM   5241 C  CD1   . LEU B 2 104 ? 78.667 141.207 45.610 1.00 141.65 ? 92  LEU B CD1   1 
ATOM   5242 C  CD2   . LEU B 2 104 ? 79.450 142.545 47.570 1.00 141.98 ? 92  LEU B CD2   1 
ATOM   5243 N  N     . GLY B 2 105 ? 82.685 142.931 47.843 1.00 140.16 ? 93  GLY B N     1 
ATOM   5244 C  CA    . GLY B 2 105 ? 83.804 142.240 48.455 1.00 139.23 ? 93  GLY B CA    1 
ATOM   5245 C  C     . GLY B 2 105 ? 83.542 140.761 48.658 1.00 138.60 ? 93  GLY B C     1 
ATOM   5246 O  O     . GLY B 2 105 ? 84.477 139.962 48.700 1.00 138.48 ? 93  GLY B O     1 
ATOM   5247 N  N     . ILE B 2 106 ? 82.267 140.396 48.766 1.00 137.78 ? 94  ILE B N     1 
ATOM   5248 C  CA    . ILE B 2 106 ? 81.869 139.052 49.188 1.00 136.78 ? 94  ILE B CA    1 
ATOM   5249 C  C     . ILE B 2 106 ? 82.536 137.953 48.362 1.00 136.24 ? 94  ILE B C     1 
ATOM   5250 O  O     . ILE B 2 106 ? 82.292 137.831 47.159 1.00 136.45 ? 94  ILE B O     1 
ATOM   5251 C  CB    . ILE B 2 106 ? 80.333 138.854 49.072 1.00 136.28 ? 94  ILE B CB    1 
ATOM   5252 C  CG1   . ILE B 2 106 ? 79.598 140.047 49.685 1.00 135.58 ? 94  ILE B CG1   1 
ATOM   5253 C  CG2   . ILE B 2 106 ? 79.916 137.572 49.793 1.00 135.35 ? 94  ILE B CG2   1 
ATOM   5254 C  CD1   . ILE B 2 106 ? 78.111 140.048 49.418 1.00 134.43 ? 94  ILE B CD1   1 
ATOM   5255 N  N     . PRO B 2 107 ? 83.400 137.143 48.998 1.00 135.48 ? 95  PRO B N     1 
ATOM   5256 C  CA    . PRO B 2 107 ? 83.612 135.771 48.523 1.00 134.29 ? 95  PRO B CA    1 
ATOM   5257 C  C     . PRO B 2 107 ? 82.438 134.899 48.973 1.00 132.81 ? 95  PRO B C     1 
ATOM   5258 O  O     . PRO B 2 107 ? 81.791 135.192 49.985 1.00 133.46 ? 95  PRO B O     1 
ATOM   5259 C  CB    . PRO B 2 107 ? 84.929 135.357 49.182 1.00 134.33 ? 95  PRO B CB    1 
ATOM   5260 C  CG    . PRO B 2 107 ? 85.005 136.188 50.415 1.00 135.01 ? 95  PRO B CG    1 
ATOM   5261 C  CD    . PRO B 2 107 ? 84.331 137.500 50.085 1.00 135.45 ? 95  PRO B CD    1 
ATOM   5262 N  N     . HIS B 2 108 ? 82.147 133.842 48.225 1.00 129.95 ? 96  HIS B N     1 
ATOM   5263 C  CA    . HIS B 2 108 ? 81.058 132.958 48.611 1.00 127.30 ? 96  HIS B CA    1 
ATOM   5264 C  C     . HIS B 2 108 ? 81.566 131.906 49.583 1.00 126.34 ? 96  HIS B C     1 
ATOM   5265 O  O     . HIS B 2 108 ? 82.319 131.010 49.206 1.00 126.37 ? 96  HIS B O     1 
ATOM   5266 C  CB    . HIS B 2 108 ? 80.454 132.279 47.381 1.00 125.59 ? 96  HIS B CB    1 
ATOM   5267 C  CG    . HIS B 2 108 ? 79.166 131.564 47.657 1.00 122.89 ? 96  HIS B CG    1 
ATOM   5268 N  ND1   . HIS B 2 108 ? 78.171 132.105 48.444 1.00 121.79 ? 96  HIS B ND1   1 
ATOM   5269 C  CD2   . HIS B 2 108 ? 78.709 130.362 47.243 1.00 121.92 ? 96  HIS B CD2   1 
ATOM   5270 C  CE1   . HIS B 2 108 ? 77.156 131.263 48.501 1.00 121.42 ? 96  HIS B CE1   1 
ATOM   5271 N  NE2   . HIS B 2 108 ? 77.455 130.197 47.782 1.00 121.31 ? 96  HIS B NE2   1 
ATOM   5272 N  N     . PRO B 2 109 ? 81.156 132.000 50.855 1.00 125.50 ? 97  PRO B N     1 
ATOM   5273 C  CA    . PRO B 2 109 ? 81.605 131.019 51.847 1.00 125.05 ? 97  PRO B CA    1 
ATOM   5274 C  C     . PRO B 2 109 ? 81.182 129.609 51.449 1.00 124.14 ? 97  PRO B C     1 
ATOM   5275 O  O     . PRO B 2 109 ? 80.038 129.207 51.674 1.00 124.47 ? 97  PRO B O     1 
ATOM   5276 C  CB    . PRO B 2 109 ? 80.940 131.482 53.142 1.00 125.40 ? 97  PRO B CB    1 
ATOM   5277 C  CG    . PRO B 2 109 ? 79.753 132.266 52.691 1.00 125.52 ? 97  PRO B CG    1 
ATOM   5278 C  CD    . PRO B 2 109 ? 80.154 132.928 51.404 1.00 125.07 ? 97  PRO B CD    1 
ATOM   5279 N  N     . ALA B 2 110 ? 82.119 128.867 50.861 1.00 122.39 ? 98  ALA B N     1 
ATOM   5280 C  CA    . ALA B 2 110 ? 81.823 127.592 50.218 1.00 120.56 ? 98  ALA B CA    1 
ATOM   5281 C  C     . ALA B 2 110 ? 81.001 126.652 51.102 1.00 119.33 ? 98  ALA B C     1 
ATOM   5282 O  O     . ALA B 2 110 ? 80.373 125.712 50.608 1.00 119.54 ? 98  ALA B O     1 
ATOM   5283 C  CB    . ALA B 2 110 ? 83.124 126.913 49.806 1.00 120.40 ? 98  ALA B CB    1 
ATOM   5284 N  N     . GLY B 2 111 ? 80.997 126.917 52.405 1.00 117.17 ? 99  GLY B N     1 
ATOM   5285 C  CA    . GLY B 2 111 ? 80.475 125.948 53.351 1.00 114.46 ? 99  GLY B CA    1 
ATOM   5286 C  C     . GLY B 2 111 ? 79.036 126.156 53.763 1.00 112.52 ? 99  GLY B C     1 
ATOM   5287 O  O     . GLY B 2 111 ? 78.477 125.346 54.505 1.00 112.59 ? 99  GLY B O     1 
ATOM   5288 N  N     . LEU B 2 112 ? 78.428 127.238 53.292 1.00 110.67 ? 100 LEU B N     1 
ATOM   5289 C  CA    . LEU B 2 112 ? 77.044 127.516 53.642 1.00 108.82 ? 100 LEU B CA    1 
ATOM   5290 C  C     . LEU B 2 112 ? 76.153 126.402 53.106 1.00 108.47 ? 100 LEU B C     1 
ATOM   5291 O  O     . LEU B 2 112 ? 75.116 126.083 53.695 1.00 108.27 ? 100 LEU B O     1 
ATOM   5292 C  CB    . LEU B 2 112 ? 76.615 128.868 53.070 1.00 107.10 ? 100 LEU B CB    1 
ATOM   5293 C  CG    . LEU B 2 112 ? 75.146 129.243 53.261 1.00 105.80 ? 100 LEU B CG    1 
ATOM   5294 C  CD1   . LEU B 2 112 ? 74.644 128.773 54.611 1.00 105.01 ? 100 LEU B CD1   1 
ATOM   5295 C  CD2   . LEU B 2 112 ? 75.000 130.742 53.124 1.00 105.43 ? 100 LEU B CD2   1 
ATOM   5296 N  N     . LYS B 2 113 ? 76.576 125.800 51.997 1.00 107.71 ? 101 LYS B N     1 
ATOM   5297 C  CA    . LYS B 2 113 ? 75.849 124.683 51.399 1.00 106.95 ? 101 LYS B CA    1 
ATOM   5298 C  C     . LYS B 2 113 ? 76.050 123.396 52.197 1.00 107.04 ? 101 LYS B C     1 
ATOM   5299 O  O     . LYS B 2 113 ? 75.282 122.438 52.055 1.00 106.82 ? 101 LYS B O     1 
ATOM   5300 C  CB    . LYS B 2 113 ? 76.305 124.466 49.950 1.00 105.93 ? 101 LYS B CB    1 
ATOM   5301 C  CG    . LYS B 2 113 ? 77.810 124.318 49.773 1.00 104.34 ? 101 LYS B CG    1 
ATOM   5302 C  CD    . LYS B 2 113 ? 78.145 123.551 48.502 1.00 102.78 ? 101 LYS B CD    1 
ATOM   5303 C  CE    . LYS B 2 113 ? 79.632 123.600 48.205 1.00 101.33 ? 101 LYS B CE    1 
ATOM   5304 N  NZ    . LYS B 2 113 ? 80.093 125.001 48.027 1.00 99.92  ? 101 LYS B NZ    1 
ATOM   5305 N  N     . LYS B 2 114 ? 77.087 123.386 53.035 1.00 106.77 ? 102 LYS B N     1 
ATOM   5306 C  CA    . LYS B 2 114 ? 77.480 122.191 53.782 1.00 105.88 ? 102 LYS B CA    1 
ATOM   5307 C  C     . LYS B 2 114 ? 76.700 122.064 55.089 1.00 105.68 ? 102 LYS B C     1 
ATOM   5308 O  O     . LYS B 2 114 ? 76.574 120.969 55.648 1.00 105.88 ? 102 LYS B O     1 
ATOM   5309 C  CB    . LYS B 2 114 ? 78.990 122.223 54.067 1.00 104.71 ? 102 LYS B CB    1 
ATOM   5310 C  CG    . LYS B 2 114 ? 79.866 122.043 52.826 1.00 103.55 ? 102 LYS B CG    1 
ATOM   5311 C  CD    . LYS B 2 114 ? 81.352 122.141 53.150 1.00 102.69 ? 102 LYS B CD    1 
ATOM   5312 C  CE    . LYS B 2 114 ? 82.171 121.083 52.402 1.00 102.58 ? 102 LYS B CE    1 
ATOM   5313 N  NZ    . LYS B 2 114 ? 82.258 121.317 50.928 1.00 101.31 ? 102 LYS B NZ    1 
ATOM   5314 N  N     . LYS B 2 115 ? 76.168 123.188 55.562 1.00 104.95 ? 103 LYS B N     1 
ATOM   5315 C  CA    . LYS B 2 115 ? 75.408 123.222 56.804 1.00 104.29 ? 103 LYS B CA    1 
ATOM   5316 C  C     . LYS B 2 115 ? 74.215 122.267 56.812 1.00 104.18 ? 103 LYS B C     1 
ATOM   5317 O  O     . LYS B 2 115 ? 73.761 121.805 55.765 1.00 103.97 ? 103 LYS B O     1 
ATOM   5318 C  CB    . LYS B 2 115 ? 74.925 124.645 57.068 1.00 103.77 ? 103 LYS B CB    1 
ATOM   5319 C  CG    . LYS B 2 115 ? 76.044 125.630 57.334 1.00 103.09 ? 103 LYS B CG    1 
ATOM   5320 C  CD    . LYS B 2 115 ? 76.344 125.728 58.820 1.00 102.59 ? 103 LYS B CD    1 
ATOM   5321 C  CE    . LYS B 2 115 ? 77.454 126.725 59.080 1.00 102.18 ? 103 LYS B CE    1 
ATOM   5322 N  NZ    . LYS B 2 115 ? 78.602 126.465 58.172 1.00 100.69 ? 103 LYS B NZ    1 
ATOM   5323 N  N     . LYS B 2 116 ? 73.720 121.973 58.011 1.00 104.22 ? 104 LYS B N     1 
ATOM   5324 C  CA    . LYS B 2 116 ? 72.544 121.126 58.190 1.00 103.71 ? 104 LYS B CA    1 
ATOM   5325 C  C     . LYS B 2 116 ? 71.289 121.933 57.872 1.00 102.92 ? 104 LYS B C     1 
ATOM   5326 O  O     . LYS B 2 116 ? 70.513 121.586 56.980 1.00 102.41 ? 104 LYS B O     1 
ATOM   5327 C  CB    . LYS B 2 116 ? 72.494 120.601 59.638 1.00 104.03 ? 104 LYS B CB    1 
ATOM   5328 C  CG    . LYS B 2 116 ? 71.098 120.227 60.163 1.00 104.48 ? 104 LYS B CG    1 
ATOM   5329 C  CD    . LYS B 2 116 ? 70.745 118.763 59.905 1.00 103.73 ? 104 LYS B CD    1 
ATOM   5330 C  CE    . LYS B 2 116 ? 69.417 118.378 60.559 1.00 103.33 ? 104 LYS B CE    1 
ATOM   5331 N  NZ    . LYS B 2 116 ? 69.605 117.726 61.888 1.00 103.43 ? 104 LYS B NZ    1 
ATOM   5332 N  N     . SER B 2 117 ? 71.099 123.021 58.602 1.00 102.11 ? 105 SER B N     1 
ATOM   5333 C  CA    . SER B 2 117 ? 69.934 123.853 58.390 1.00 102.34 ? 105 SER B CA    1 
ATOM   5334 C  C     . SER B 2 117 ? 70.379 125.205 57.851 1.00 102.77 ? 105 SER B C     1 
ATOM   5335 O  O     . SER B 2 117 ? 71.434 125.712 58.241 1.00 103.14 ? 105 SER B O     1 
ATOM   5336 C  CB    . SER B 2 117 ? 69.177 124.036 59.706 1.00 101.78 ? 105 SER B CB    1 
ATOM   5337 O  OG    . SER B 2 117 ? 69.012 122.796 60.366 1.00 101.05 ? 105 SER B OG    1 
ATOM   5338 N  N     . VAL B 2 118 ? 69.581 125.771 56.943 1.00 102.53 ? 106 VAL B N     1 
ATOM   5339 C  CA    . VAL B 2 118 ? 69.705 127.177 56.550 1.00 100.49 ? 106 VAL B CA    1 
ATOM   5340 C  C     . VAL B 2 118 ? 68.329 127.843 56.517 1.00 98.93  ? 106 VAL B C     1 
ATOM   5341 O  O     . VAL B 2 118 ? 67.352 127.257 56.044 1.00 97.68  ? 106 VAL B O     1 
ATOM   5342 C  CB    . VAL B 2 118 ? 70.340 127.334 55.154 1.00 100.57 ? 106 VAL B CB    1 
ATOM   5343 C  CG1   . VAL B 2 118 ? 70.621 128.797 54.890 1.00 100.77 ? 106 VAL B CG1   1 
ATOM   5344 C  CG2   . VAL B 2 118 ? 71.620 126.520 55.056 1.00 101.03 ? 106 VAL B CG2   1 
ATOM   5345 N  N     . THR B 2 119 ? 68.256 129.069 57.025 1.00 98.32  ? 107 THR B N     1 
ATOM   5346 C  CA    . THR B 2 119 ? 66.998 129.800 57.032 1.00 97.45  ? 107 THR B CA    1 
ATOM   5347 C  C     . THR B 2 119 ? 67.080 131.009 56.105 1.00 97.06  ? 107 THR B C     1 
ATOM   5348 O  O     . THR B 2 119 ? 68.125 131.664 56.007 1.00 96.23  ? 107 THR B O     1 
ATOM   5349 C  CB    . THR B 2 119 ? 66.642 130.296 58.436 1.00 97.43  ? 107 THR B CB    1 
ATOM   5350 O  OG1   . THR B 2 119 ? 66.949 129.283 59.400 1.00 97.68  ? 107 THR B OG1   1 
ATOM   5351 C  CG2   . THR B 2 119 ? 65.156 130.600 58.510 1.00 97.16  ? 107 THR B CG2   1 
ATOM   5352 N  N     . VAL B 2 120 ? 65.969 131.294 55.428 1.00 96.57  ? 108 VAL B N     1 
ATOM   5353 C  CA    . VAL B 2 120 ? 65.919 132.367 54.437 1.00 95.66  ? 108 VAL B CA    1 
ATOM   5354 C  C     . VAL B 2 120 ? 65.323 133.613 55.085 1.00 94.20  ? 108 VAL B C     1 
ATOM   5355 O  O     . VAL B 2 120 ? 64.228 133.569 55.652 1.00 93.33  ? 108 VAL B O     1 
ATOM   5356 C  CB    . VAL B 2 120 ? 65.046 131.960 53.209 1.00 96.64  ? 108 VAL B CB    1 
ATOM   5357 C  CG1   . VAL B 2 120 ? 65.249 132.949 52.061 1.00 95.99  ? 108 VAL B CG1   1 
ATOM   5358 C  CG2   . VAL B 2 120 ? 65.393 130.548 52.762 1.00 96.34  ? 108 VAL B CG2   1 
ATOM   5359 N  N     . LEU B 2 121 ? 66.044 134.724 54.983 1.00 93.18  ? 109 LEU B N     1 
ATOM   5360 C  CA    . LEU B 2 121 ? 65.742 135.913 55.770 1.00 93.19  ? 109 LEU B CA    1 
ATOM   5361 C  C     . LEU B 2 121 ? 65.464 137.135 54.894 1.00 92.88  ? 109 LEU B C     1 
ATOM   5362 O  O     . LEU B 2 121 ? 66.348 137.591 54.170 1.00 94.13  ? 109 LEU B O     1 
ATOM   5363 C  CB    . LEU B 2 121 ? 66.924 136.206 56.690 1.00 93.29  ? 109 LEU B CB    1 
ATOM   5364 C  CG    . LEU B 2 121 ? 66.679 137.131 57.872 1.00 93.85  ? 109 LEU B CG    1 
ATOM   5365 C  CD1   . LEU B 2 121 ? 65.516 136.588 58.699 1.00 93.35  ? 109 LEU B CD1   1 
ATOM   5366 C  CD2   . LEU B 2 121 ? 67.954 137.237 58.699 1.00 92.68  ? 109 LEU B CD2   1 
ATOM   5367 N  N     . ASP B 2 122 ? 64.247 137.669 54.964 1.00 92.00  ? 110 ASP B N     1 
ATOM   5368 C  CA    . ASP B 2 122 ? 63.895 138.860 54.187 1.00 91.17  ? 110 ASP B CA    1 
ATOM   5369 C  C     . ASP B 2 122 ? 64.290 140.097 54.971 1.00 90.21  ? 110 ASP B C     1 
ATOM   5370 O  O     . ASP B 2 122 ? 63.918 140.244 56.129 1.00 90.64  ? 110 ASP B O     1 
ATOM   5371 C  CB    . ASP B 2 122 ? 62.388 138.888 53.901 1.00 91.52  ? 110 ASP B CB    1 
ATOM   5372 C  CG    . ASP B 2 122 ? 61.950 140.138 53.136 1.00 92.27  ? 110 ASP B CG    1 
ATOM   5373 O  OD1   . ASP B 2 122 ? 62.766 141.075 52.968 1.00 91.53  ? 110 ASP B OD1   1 
ATOM   5374 O  OD2   . ASP B 2 122 ? 60.776 140.178 52.705 1.00 91.94  ? 110 ASP B OD2   1 
ATOM   5375 N  N     . VAL B 2 123 ? 65.050 140.987 54.346 1.00 89.42  ? 111 VAL B N     1 
ATOM   5376 C  CA    . VAL B 2 123 ? 65.578 142.139 55.062 1.00 88.81  ? 111 VAL B CA    1 
ATOM   5377 C  C     . VAL B 2 123 ? 65.710 143.369 54.177 1.00 89.78  ? 111 VAL B C     1 
ATOM   5378 O  O     . VAL B 2 123 ? 66.485 144.275 54.479 1.00 90.16  ? 111 VAL B O     1 
ATOM   5379 C  CB    . VAL B 2 123 ? 66.964 141.836 55.666 1.00 87.06  ? 111 VAL B CB    1 
ATOM   5380 C  CG1   . VAL B 2 123 ? 66.906 140.556 56.461 1.00 86.78  ? 111 VAL B CG1   1 
ATOM   5381 C  CG2   . VAL B 2 123 ? 68.012 141.745 54.575 1.00 86.07  ? 111 VAL B CG2   1 
ATOM   5382 N  N     . GLY B 2 124 ? 64.960 143.403 53.082 1.00 90.56  ? 112 GLY B N     1 
ATOM   5383 C  CA    . GLY B 2 124 ? 65.092 144.511 52.155 1.00 91.07  ? 112 GLY B CA    1 
ATOM   5384 C  C     . GLY B 2 124 ? 64.629 145.818 52.767 1.00 90.93  ? 112 GLY B C     1 
ATOM   5385 O  O     . GLY B 2 124 ? 65.179 146.883 52.481 1.00 90.22  ? 112 GLY B O     1 
ATOM   5386 N  N     . ASP B 2 125 ? 63.617 145.724 53.625 1.00 91.41  ? 113 ASP B N     1 
ATOM   5387 C  CA    . ASP B 2 125 ? 63.007 146.895 54.247 1.00 90.93  ? 113 ASP B CA    1 
ATOM   5388 C  C     . ASP B 2 125 ? 64.041 147.598 55.116 1.00 89.39  ? 113 ASP B C     1 
ATOM   5389 O  O     . ASP B 2 125 ? 63.728 148.552 55.819 1.00 88.67  ? 113 ASP B O     1 
ATOM   5390 C  CB    . ASP B 2 125 ? 61.785 146.476 55.087 1.00 91.96  ? 113 ASP B CB    1 
ATOM   5391 C  CG    . ASP B 2 125 ? 60.757 145.660 54.278 1.00 94.39  ? 113 ASP B CG    1 
ATOM   5392 O  OD1   . ASP B 2 125 ? 59.767 146.248 53.774 1.00 93.52  ? 113 ASP B OD1   1 
ATOM   5393 O  OD2   . ASP B 2 125 ? 60.940 144.425 54.146 1.00 95.06  ? 113 ASP B OD2   1 
ATOM   5394 N  N     . ALA B 2 126 ? 65.278 147.118 55.052 1.00 88.31  ? 114 ALA B N     1 
ATOM   5395 C  CA    . ALA B 2 126 ? 66.379 147.720 55.787 1.00 88.08  ? 114 ALA B CA    1 
ATOM   5396 C  C     . ALA B 2 126 ? 67.284 148.502 54.849 1.00 88.29  ? 114 ALA B C     1 
ATOM   5397 O  O     . ALA B 2 126 ? 68.296 149.060 55.270 1.00 88.78  ? 114 ALA B O     1 
ATOM   5398 C  CB    . ALA B 2 126 ? 67.175 146.647 56.497 1.00 87.21  ? 114 ALA B CB    1 
ATOM   5399 N  N     . TYR B 2 127 ? 66.917 148.536 53.573 1.00 88.53  ? 115 TYR B N     1 
ATOM   5400 C  CA    . TYR B 2 127 ? 67.700 149.247 52.566 1.00 88.43  ? 115 TYR B CA    1 
ATOM   5401 C  C     . TYR B 2 127 ? 67.347 150.728 52.506 1.00 88.92  ? 115 TYR B C     1 
ATOM   5402 O  O     . TYR B 2 127 ? 68.116 151.542 51.986 1.00 89.29  ? 115 TYR B O     1 
ATOM   5403 C  CB    . TYR B 2 127 ? 67.470 148.624 51.188 1.00 87.12  ? 115 TYR B CB    1 
ATOM   5404 C  CG    . TYR B 2 127 ? 68.330 147.423 50.909 1.00 85.40  ? 115 TYR B CG    1 
ATOM   5405 C  CD1   . TYR B 2 127 ? 67.801 146.145 50.942 1.00 84.07  ? 115 TYR B CD1   1 
ATOM   5406 C  CD2   . TYR B 2 127 ? 69.675 147.570 50.606 1.00 85.07  ? 115 TYR B CD2   1 
ATOM   5407 C  CE1   . TYR B 2 127 ? 68.589 145.047 50.680 1.00 84.51  ? 115 TYR B CE1   1 
ATOM   5408 C  CE2   . TYR B 2 127 ? 70.471 146.479 50.344 1.00 84.53  ? 115 TYR B CE2   1 
ATOM   5409 C  CZ    . TYR B 2 127 ? 69.927 145.219 50.379 1.00 84.40  ? 115 TYR B CZ    1 
ATOM   5410 O  OH    . TYR B 2 127 ? 70.723 144.133 50.099 1.00 82.86  ? 115 TYR B OH    1 
ATOM   5411 N  N     . PHE B 2 128 ? 66.175 151.067 53.036 1.00 88.81  ? 116 PHE B N     1 
ATOM   5412 C  CA    . PHE B 2 128 ? 65.597 152.389 52.844 1.00 88.51  ? 116 PHE B CA    1 
ATOM   5413 C  C     . PHE B 2 128 ? 66.363 153.446 53.622 1.00 88.31  ? 116 PHE B C     1 
ATOM   5414 O  O     . PHE B 2 128 ? 66.389 154.618 53.252 1.00 87.77  ? 116 PHE B O     1 
ATOM   5415 C  CB    . PHE B 2 128 ? 64.128 152.366 53.266 1.00 88.26  ? 116 PHE B CB    1 
ATOM   5416 C  CG    . PHE B 2 128 ? 63.288 151.446 52.431 1.00 88.91  ? 116 PHE B CG    1 
ATOM   5417 C  CD1   . PHE B 2 128 ? 63.682 151.113 51.142 1.00 89.23  ? 116 PHE B CD1   1 
ATOM   5418 C  CD2   . PHE B 2 128 ? 62.106 150.920 52.921 1.00 89.03  ? 116 PHE B CD2   1 
ATOM   5419 C  CE1   . PHE B 2 128 ? 62.924 150.259 50.363 1.00 89.29  ? 116 PHE B CE1   1 
ATOM   5420 C  CE2   . PHE B 2 128 ? 61.343 150.066 52.146 1.00 89.61  ? 116 PHE B CE2   1 
ATOM   5421 C  CZ    . PHE B 2 128 ? 61.749 149.741 50.863 1.00 89.70  ? 116 PHE B CZ    1 
ATOM   5422 N  N     . SER B 2 129 ? 67.001 153.009 54.696 1.00 88.29  ? 117 SER B N     1 
ATOM   5423 C  CA    . SER B 2 129 ? 67.855 153.864 55.502 1.00 88.30  ? 117 SER B CA    1 
ATOM   5424 C  C     . SER B 2 129 ? 68.850 154.715 54.704 1.00 87.66  ? 117 SER B C     1 
ATOM   5425 O  O     . SER B 2 129 ? 69.327 155.731 55.209 1.00 88.40  ? 117 SER B O     1 
ATOM   5426 C  CB    . SER B 2 129 ? 68.625 152.998 56.491 1.00 88.96  ? 117 SER B CB    1 
ATOM   5427 O  OG    . SER B 2 129 ? 69.234 151.912 55.811 1.00 89.61  ? 117 SER B OG    1 
ATOM   5428 N  N     . VAL B 2 130 ? 69.166 154.306 53.473 1.00 86.36  ? 118 VAL B N     1 
ATOM   5429 C  CA    . VAL B 2 130 ? 70.291 154.892 52.730 1.00 84.44  ? 118 VAL B CA    1 
ATOM   5430 C  C     . VAL B 2 130 ? 69.934 155.669 51.462 1.00 84.07  ? 118 VAL B C     1 
ATOM   5431 O  O     . VAL B 2 130 ? 69.367 155.124 50.512 1.00 83.23  ? 118 VAL B O     1 
ATOM   5432 C  CB    . VAL B 2 130 ? 71.302 153.814 52.331 1.00 83.93  ? 118 VAL B CB    1 
ATOM   5433 C  CG1   . VAL B 2 130 ? 72.495 154.452 51.618 1.00 81.38  ? 118 VAL B CG1   1 
ATOM   5434 C  CG2   . VAL B 2 130 ? 71.728 153.038 53.564 1.00 83.54  ? 118 VAL B CG2   1 
ATOM   5435 N  N     . PRO B 2 131 ? 70.294 156.960 51.427 1.00 83.62  ? 119 PRO B N     1 
ATOM   5436 C  CA    . PRO B 2 131 ? 70.033 157.843 50.285 1.00 82.84  ? 119 PRO B CA    1 
ATOM   5437 C  C     . PRO B 2 131 ? 70.622 157.334 48.975 1.00 82.08  ? 119 PRO B C     1 
ATOM   5438 O  O     . PRO B 2 131 ? 71.711 156.757 48.951 1.00 82.55  ? 119 PRO B O     1 
ATOM   5439 C  CB    . PRO B 2 131 ? 70.650 159.173 50.714 1.00 82.05  ? 119 PRO B CB    1 
ATOM   5440 C  CG    . PRO B 2 131 ? 70.581 159.135 52.197 1.00 82.87  ? 119 PRO B CG    1 
ATOM   5441 C  CD    . PRO B 2 131 ? 70.857 157.703 52.567 1.00 82.60  ? 119 PRO B CD    1 
ATOM   5442 N  N     . LEU B 2 132 ? 69.883 157.553 47.891 1.00 80.84  ? 120 LEU B N     1 
ATOM   5443 C  CA    . LEU B 2 132 ? 70.326 157.185 46.556 1.00 78.27  ? 120 LEU B CA    1 
ATOM   5444 C  C     . LEU B 2 132 ? 70.859 158.413 45.849 1.00 77.94  ? 120 LEU B C     1 
ATOM   5445 O  O     . LEU B 2 132 ? 70.293 159.499 45.961 1.00 76.61  ? 120 LEU B O     1 
ATOM   5446 C  CB    . LEU B 2 132 ? 69.165 156.606 45.747 1.00 76.96  ? 120 LEU B CB    1 
ATOM   5447 C  CG    . LEU B 2 132 ? 69.541 156.067 44.365 1.00 75.09  ? 120 LEU B CG    1 
ATOM   5448 C  CD1   . LEU B 2 132 ? 70.502 154.890 44.503 1.00 73.51  ? 120 LEU B CD1   1 
ATOM   5449 C  CD2   . LEU B 2 132 ? 68.288 155.657 43.635 1.00 75.25  ? 120 LEU B CD2   1 
ATOM   5450 N  N     . ASP B 2 133 ? 71.953 158.228 45.120 1.00 78.27  ? 121 ASP B N     1 
ATOM   5451 C  CA    . ASP B 2 133 ? 72.526 159.290 44.311 1.00 79.25  ? 121 ASP B CA    1 
ATOM   5452 C  C     . ASP B 2 133 ? 71.411 160.140 43.695 1.00 79.65  ? 121 ASP B C     1 
ATOM   5453 O  O     . ASP B 2 133 ? 70.384 159.626 43.256 1.00 79.73  ? 121 ASP B O     1 
ATOM   5454 C  CB    . ASP B 2 133 ? 73.411 158.681 43.216 1.00 79.45  ? 121 ASP B CB    1 
ATOM   5455 C  CG    . ASP B 2 133 ? 74.201 159.726 42.452 1.00 80.86  ? 121 ASP B CG    1 
ATOM   5456 O  OD1   . ASP B 2 133 ? 75.049 160.409 43.065 1.00 81.01  ? 121 ASP B OD1   1 
ATOM   5457 O  OD2   . ASP B 2 133 ? 73.975 159.865 41.233 1.00 82.76  ? 121 ASP B OD2   1 
ATOM   5458 N  N     . GLU B 2 134 ? 71.614 161.449 43.673 1.00 80.15  ? 122 GLU B N     1 
ATOM   5459 C  CA    . GLU B 2 134 ? 70.600 162.356 43.168 1.00 80.24  ? 122 GLU B CA    1 
ATOM   5460 C  C     . GLU B 2 134 ? 70.359 162.152 41.681 1.00 79.40  ? 122 GLU B C     1 
ATOM   5461 O  O     . GLU B 2 134 ? 69.272 162.422 41.187 1.00 80.16  ? 122 GLU B O     1 
ATOM   5462 C  CB    . GLU B 2 134 ? 71.029 163.798 43.407 1.00 81.50  ? 122 GLU B CB    1 
ATOM   5463 C  CG    . GLU B 2 134 ? 69.879 164.745 43.645 1.00 82.98  ? 122 GLU B CG    1 
ATOM   5464 C  CD    . GLU B 2 134 ? 69.746 165.125 45.107 1.00 83.90  ? 122 GLU B CD    1 
ATOM   5465 O  OE1   . GLU B 2 134 ? 68.880 165.966 45.422 1.00 84.53  ? 122 GLU B OE1   1 
ATOM   5466 O  OE2   . GLU B 2 134 ? 70.508 164.588 45.942 1.00 84.52  ? 122 GLU B OE2   1 
ATOM   5467 N  N     . ASP B 2 135 ? 71.375 161.691 40.965 1.00 77.83  ? 123 ASP B N     1 
ATOM   5468 C  CA    . ASP B 2 135 ? 71.282 161.630 39.516 1.00 76.65  ? 123 ASP B CA    1 
ATOM   5469 C  C     . ASP B 2 135 ? 70.837 160.269 39.032 1.00 74.05  ? 123 ASP B C     1 
ATOM   5470 O  O     . ASP B 2 135 ? 70.649 160.059 37.837 1.00 75.14  ? 123 ASP B O     1 
ATOM   5471 C  CB    . ASP B 2 135 ? 72.626 161.984 38.876 1.00 79.88  ? 123 ASP B CB    1 
ATOM   5472 C  CG    . ASP B 2 135 ? 72.756 163.475 38.572 1.00 84.11  ? 123 ASP B CG    1 
ATOM   5473 O  OD1   . ASP B 2 135 ? 72.206 163.923 37.536 1.00 86.48  ? 123 ASP B OD1   1 
ATOM   5474 O  OD2   . ASP B 2 135 ? 73.407 164.197 39.364 1.00 84.47  ? 123 ASP B OD2   1 
ATOM   5475 N  N     . PHE B 2 136 ? 70.663 159.342 39.960 1.00 69.44  ? 124 PHE B N     1 
ATOM   5476 C  CA    . PHE B 2 136 ? 70.414 157.962 39.586 1.00 65.02  ? 124 PHE B CA    1 
ATOM   5477 C  C     . PHE B 2 136 ? 68.944 157.639 39.813 1.00 63.54  ? 124 PHE B C     1 
ATOM   5478 O  O     . PHE B 2 136 ? 68.413 156.645 39.328 1.00 62.08  ? 124 PHE B O     1 
ATOM   5479 C  CB    . PHE B 2 136 ? 71.309 157.050 40.421 1.00 62.38  ? 124 PHE B CB    1 
ATOM   5480 C  CG    . PHE B 2 136 ? 71.428 155.664 39.883 1.00 59.49  ? 124 PHE B CG    1 
ATOM   5481 C  CD1   . PHE B 2 136 ? 72.284 155.392 38.836 1.00 57.78  ? 124 PHE B CD1   1 
ATOM   5482 C  CD2   . PHE B 2 136 ? 70.678 154.631 40.422 1.00 58.91  ? 124 PHE B CD2   1 
ATOM   5483 C  CE1   . PHE B 2 136 ? 72.390 154.116 38.336 1.00 58.40  ? 124 PHE B CE1   1 
ATOM   5484 C  CE2   . PHE B 2 136 ? 70.776 153.357 39.929 1.00 57.26  ? 124 PHE B CE2   1 
ATOM   5485 C  CZ    . PHE B 2 136 ? 71.632 153.094 38.884 1.00 58.87  ? 124 PHE B CZ    1 
ATOM   5486 N  N     . ARG B 2 137 ? 68.287 158.511 40.556 1.00 63.44  ? 125 ARG B N     1 
ATOM   5487 C  CA    . ARG B 2 137 ? 66.915 158.279 40.963 1.00 63.36  ? 125 ARG B CA    1 
ATOM   5488 C  C     . ARG B 2 137 ? 66.032 157.940 39.781 1.00 62.43  ? 125 ARG B C     1 
ATOM   5489 O  O     . ARG B 2 137 ? 65.226 157.024 39.857 1.00 63.27  ? 125 ARG B O     1 
ATOM   5490 C  CB    . ARG B 2 137 ? 66.364 159.517 41.675 1.00 64.67  ? 125 ARG B CB    1 
ATOM   5491 C  CG    . ARG B 2 137 ? 67.002 159.813 43.042 1.00 66.00  ? 125 ARG B CG    1 
ATOM   5492 C  CD    . ARG B 2 137 ? 66.850 161.288 43.418 1.00 67.21  ? 125 ARG B CD    1 
ATOM   5493 N  NE    . ARG B 2 137 ? 66.622 161.454 44.846 1.00 69.31  ? 125 ARG B NE    1 
ATOM   5494 C  CZ    . ARG B 2 137 ? 67.589 161.477 45.755 1.00 70.12  ? 125 ARG B CZ    1 
ATOM   5495 N  NH1   . ARG B 2 137 ? 68.853 161.348 45.376 1.00 70.86  ? 125 ARG B NH1   1 
ATOM   5496 N  NH2   . ARG B 2 137 ? 67.289 161.612 47.039 1.00 68.58  ? 125 ARG B NH2   1 
ATOM   5497 N  N     . LYS B 2 138 ? 66.195 158.668 38.683 1.00 61.29  ? 126 LYS B N     1 
ATOM   5498 C  CA    . LYS B 2 138 ? 65.244 158.593 37.583 1.00 59.12  ? 126 LYS B CA    1 
ATOM   5499 C  C     . LYS B 2 138 ? 65.086 157.202 36.996 1.00 58.16  ? 126 LYS B C     1 
ATOM   5500 O  O     . LYS B 2 138 ? 63.994 156.832 36.580 1.00 58.66  ? 126 LYS B O     1 
ATOM   5501 C  CB    . LYS B 2 138 ? 65.629 159.571 36.475 1.00 60.59  ? 126 LYS B CB    1 
ATOM   5502 C  CG    . LYS B 2 138 ? 66.967 159.295 35.798 1.00 62.89  ? 126 LYS B CG    1 
ATOM   5503 C  CD    . LYS B 2 138 ? 67.298 160.401 34.788 1.00 62.55  ? 126 LYS B CD    1 
ATOM   5504 C  CE    . LYS B 2 138 ? 68.734 160.309 34.295 1.00 62.93  ? 126 LYS B CE    1 
ATOM   5505 N  NZ    . LYS B 2 138 ? 69.593 161.350 34.915 1.00 64.09  ? 126 LYS B NZ    1 
ATOM   5506 N  N     . TYR B 2 139 ? 66.163 156.425 36.966 1.00 56.92  ? 127 TYR B N     1 
ATOM   5507 C  CA    . TYR B 2 139 ? 66.104 155.068 36.419 1.00 55.16  ? 127 TYR B CA    1 
ATOM   5508 C  C     . TYR B 2 139 ? 65.244 154.131 37.257 1.00 53.15  ? 127 TYR B C     1 
ATOM   5509 O  O     . TYR B 2 139 ? 64.771 153.103 36.770 1.00 52.47  ? 127 TYR B O     1 
ATOM   5510 C  CB    . TYR B 2 139 ? 67.505 154.492 36.313 1.00 56.93  ? 127 TYR B CB    1 
ATOM   5511 C  CG    . TYR B 2 139 ? 68.472 155.439 35.666 1.00 60.39  ? 127 TYR B CG    1 
ATOM   5512 C  CD1   . TYR B 2 139 ? 68.163 156.051 34.460 1.00 61.06  ? 127 TYR B CD1   1 
ATOM   5513 C  CD2   . TYR B 2 139 ? 69.699 155.719 36.254 1.00 60.85  ? 127 TYR B CD2   1 
ATOM   5514 C  CE1   . TYR B 2 139 ? 69.050 156.912 33.857 1.00 63.26  ? 127 TYR B CE1   1 
ATOM   5515 C  CE2   . TYR B 2 139 ? 70.593 156.583 35.656 1.00 62.31  ? 127 TYR B CE2   1 
ATOM   5516 C  CZ    . TYR B 2 139 ? 70.262 157.177 34.458 1.00 63.26  ? 127 TYR B CZ    1 
ATOM   5517 O  OH    . TYR B 2 139 ? 71.136 158.053 33.863 1.00 64.60  ? 127 TYR B OH    1 
ATOM   5518 N  N     . THR B 2 140 ? 65.042 154.493 38.519 1.00 50.93  ? 128 THR B N     1 
ATOM   5519 C  CA    . THR B 2 140 ? 64.303 153.649 39.451 1.00 48.78  ? 128 THR B CA    1 
ATOM   5520 C  C     . THR B 2 140 ? 62.783 153.763 39.267 1.00 47.40  ? 128 THR B C     1 
ATOM   5521 O  O     . THR B 2 140 ? 62.015 153.165 40.012 1.00 46.05  ? 128 THR B O     1 
ATOM   5522 C  CB    . THR B 2 140 ? 64.685 153.992 40.927 1.00 48.83  ? 128 THR B CB    1 
ATOM   5523 O  OG1   . THR B 2 140 ? 64.404 155.366 41.193 1.00 47.94  ? 128 THR B OG1   1 
ATOM   5524 C  CG2   . THR B 2 140 ? 66.172 153.752 41.176 1.00 48.31  ? 128 THR B CG2   1 
ATOM   5525 N  N     . ALA B 2 141 ? 62.362 154.521 38.257 1.00 46.73  ? 129 ALA B N     1 
ATOM   5526 C  CA    . ALA B 2 141 ? 60.959 154.891 38.072 1.00 44.57  ? 129 ALA B CA    1 
ATOM   5527 C  C     . ALA B 2 141 ? 60.054 153.709 37.749 1.00 45.06  ? 129 ALA B C     1 
ATOM   5528 O  O     . ALA B 2 141 ? 60.435 152.799 37.015 1.00 46.26  ? 129 ALA B O     1 
ATOM   5529 C  CB    . ALA B 2 141 ? 60.854 155.932 36.985 1.00 40.94  ? 129 ALA B CB    1 
ATOM   5530 N  N     . PHE B 2 142 ? 58.850 153.721 38.305 1.00 44.71  ? 130 PHE B N     1 
ATOM   5531 C  CA    . PHE B 2 142 ? 57.892 152.653 38.057 1.00 45.33  ? 130 PHE B CA    1 
ATOM   5532 C  C     . PHE B 2 142 ? 56.489 153.228 38.108 1.00 45.95  ? 130 PHE B C     1 
ATOM   5533 O  O     . PHE B 2 142 ? 56.273 154.293 38.669 1.00 46.87  ? 130 PHE B O     1 
ATOM   5534 C  CB    . PHE B 2 142 ? 58.027 151.555 39.107 1.00 47.27  ? 130 PHE B CB    1 
ATOM   5535 C  CG    . PHE B 2 142 ? 57.717 152.015 40.505 1.00 49.08  ? 130 PHE B CG    1 
ATOM   5536 C  CD1   . PHE B 2 142 ? 58.693 152.622 41.288 1.00 49.19  ? 130 PHE B CD1   1 
ATOM   5537 C  CD2   . PHE B 2 142 ? 56.445 151.878 41.026 1.00 48.64  ? 130 PHE B CD2   1 
ATOM   5538 C  CE1   . PHE B 2 142 ? 58.397 153.088 42.558 1.00 47.47  ? 130 PHE B CE1   1 
ATOM   5539 C  CE2   . PHE B 2 142 ? 56.152 152.345 42.294 1.00 49.78  ? 130 PHE B CE2   1 
ATOM   5540 C  CZ    . PHE B 2 142 ? 57.131 152.949 43.059 1.00 47.58  ? 130 PHE B CZ    1 
ATOM   5541 N  N     . THR B 2 143 ? 55.538 152.512 37.525 1.00 46.19  ? 131 THR B N     1 
ATOM   5542 C  CA    . THR B 2 143 ? 54.218 153.050 37.229 1.00 43.35  ? 131 THR B CA    1 
ATOM   5543 C  C     . THR B 2 143 ? 53.168 152.120 37.813 1.00 44.76  ? 131 THR B C     1 
ATOM   5544 O  O     . THR B 2 143 ? 53.125 150.939 37.460 1.00 46.11  ? 131 THR B O     1 
ATOM   5545 C  CB    . THR B 2 143 ? 54.011 153.115 35.715 1.00 42.12  ? 131 THR B CB    1 
ATOM   5546 O  OG1   . THR B 2 143 ? 54.817 154.157 35.167 1.00 41.25  ? 131 THR B OG1   1 
ATOM   5547 C  CG2   . THR B 2 143 ? 52.567 153.353 35.382 1.00 42.68  ? 131 THR B CG2   1 
ATOM   5548 N  N     . ILE B 2 144 ? 52.319 152.636 38.697 1.00 43.70  ? 132 ILE B N     1 
ATOM   5549 C  CA    . ILE B 2 144 ? 51.194 151.848 39.192 1.00 43.49  ? 132 ILE B CA    1 
ATOM   5550 C  C     . ILE B 2 144 ? 49.968 152.036 38.320 1.00 43.62  ? 132 ILE B C     1 
ATOM   5551 O  O     . ILE B 2 144 ? 49.508 153.157 38.096 1.00 43.07  ? 132 ILE B O     1 
ATOM   5552 C  CB    . ILE B 2 144 ? 50.772 152.252 40.595 1.00 44.86  ? 132 ILE B CB    1 
ATOM   5553 C  CG1   . ILE B 2 144 ? 51.947 152.163 41.555 1.00 45.87  ? 132 ILE B CG1   1 
ATOM   5554 C  CG2   . ILE B 2 144 ? 49.666 151.332 41.079 1.00 43.89  ? 132 ILE B CG2   1 
ATOM   5555 C  CD1   . ILE B 2 144 ? 51.526 152.392 42.973 1.00 47.95  ? 132 ILE B CD1   1 
ATOM   5556 N  N     . PRO B 2 145 ? 49.404 150.929 37.841 1.00 43.48  ? 133 PRO B N     1 
ATOM   5557 C  CA    . PRO B 2 145 ? 48.222 150.865 36.979 1.00 44.30  ? 133 PRO B CA    1 
ATOM   5558 C  C     . PRO B 2 145 ? 46.916 151.206 37.689 1.00 44.92  ? 133 PRO B C     1 
ATOM   5559 O  O     . PRO B 2 145 ? 46.860 151.293 38.917 1.00 46.06  ? 133 PRO B O     1 
ATOM   5560 C  CB    . PRO B 2 145 ? 48.229 149.435 36.482 1.00 42.95  ? 133 PRO B CB    1 
ATOM   5561 C  CG    . PRO B 2 145 ? 48.905 148.691 37.554 1.00 44.40  ? 133 PRO B CG    1 
ATOM   5562 C  CD    . PRO B 2 145 ? 49.943 149.596 38.126 1.00 43.36  ? 133 PRO B CD    1 
ATOM   5563 N  N     . SER B 2 146 ? 45.866 151.415 36.907 1.00 44.22  ? 134 SER B N     1 
ATOM   5564 C  CA    . SER B 2 146 ? 44.541 151.604 37.478 1.00 42.82  ? 134 SER B CA    1 
ATOM   5565 C  C     . SER B 2 146 ? 43.719 150.561 36.794 1.00 40.78  ? 134 SER B C     1 
ATOM   5566 O  O     . SER B 2 146 ? 44.028 150.196 35.667 1.00 40.57  ? 134 SER B O     1 
ATOM   5567 C  CB    . SER B 2 146 ? 43.996 153.009 37.171 1.00 43.83  ? 134 SER B CB    1 
ATOM   5568 O  OG    . SER B 2 146 ? 43.558 153.127 35.834 1.00 42.02  ? 134 SER B OG    1 
ATOM   5569 N  N     . ILE B 2 147 ? 42.692 150.050 37.453 1.00 39.16  ? 135 ILE B N     1 
ATOM   5570 C  CA    . ILE B 2 147 ? 42.000 148.949 36.830 1.00 40.10  ? 135 ILE B CA    1 
ATOM   5571 C  C     . ILE B 2 147 ? 40.870 149.443 35.944 1.00 40.29  ? 135 ILE B C     1 
ATOM   5572 O  O     . ILE B 2 147 ? 40.124 150.350 36.297 1.00 39.46  ? 135 ILE B O     1 
ATOM   5573 C  CB    . ILE B 2 147 ? 41.509 147.912 37.872 1.00 40.74  ? 135 ILE B CB    1 
ATOM   5574 C  CG1   . ILE B 2 147 ? 40.042 148.086 38.189 1.00 41.42  ? 135 ILE B CG1   1 
ATOM   5575 C  CG2   . ILE B 2 147 ? 42.258 148.078 39.163 1.00 39.10  ? 135 ILE B CG2   1 
ATOM   5576 C  CD1   . ILE B 2 147 ? 39.610 147.074 39.224 1.00 42.60  ? 135 ILE B CD1   1 
ATOM   5577 N  N     . ASN B 2 148 ? 40.797 148.859 34.755 1.00 41.78  ? 136 ASN B N     1 
ATOM   5578 C  CA    . ASN B 2 148 ? 39.895 149.314 33.709 1.00 41.50  ? 136 ASN B CA    1 
ATOM   5579 C  C     . ASN B 2 148 ? 40.250 150.707 33.243 1.00 42.14  ? 136 ASN B C     1 
ATOM   5580 O  O     . ASN B 2 148 ? 39.475 151.357 32.545 1.00 42.01  ? 136 ASN B O     1 
ATOM   5581 C  CB    . ASN B 2 148 ? 38.462 149.311 34.197 1.00 41.36  ? 136 ASN B CB    1 
ATOM   5582 C  CG    . ASN B 2 148 ? 37.500 149.538 33.091 1.00 41.18  ? 136 ASN B CG    1 
ATOM   5583 O  OD1   . ASN B 2 148 ? 37.812 149.293 31.930 1.00 41.47  ? 136 ASN B OD1   1 
ATOM   5584 N  ND2   . ASN B 2 148 ? 36.320 150.017 33.429 1.00 42.02  ? 136 ASN B ND2   1 
ATOM   5585 N  N     . ASN B 2 149 ? 41.425 151.165 33.652 1.00 42.88  ? 137 ASN B N     1 
ATOM   5586 C  CA    . ASN B 2 149 ? 42.021 152.357 33.075 1.00 43.92  ? 137 ASN B CA    1 
ATOM   5587 C  C     . ASN B 2 149 ? 41.197 153.588 33.368 1.00 44.34  ? 137 ASN B C     1 
ATOM   5588 O  O     . ASN B 2 149 ? 41.053 154.475 32.523 1.00 44.07  ? 137 ASN B O     1 
ATOM   5589 C  CB    . ASN B 2 149 ? 42.173 152.190 31.568 1.00 44.88  ? 137 ASN B CB    1 
ATOM   5590 C  CG    . ASN B 2 149 ? 43.369 151.344 31.193 1.00 42.56  ? 137 ASN B CG    1 
ATOM   5591 O  OD1   . ASN B 2 149 ? 44.504 151.825 31.183 1.00 42.57  ? 137 ASN B OD1   1 
ATOM   5592 N  ND2   . ASN B 2 149 ? 43.120 150.085 30.875 1.00 39.88  ? 137 ASN B ND2   1 
ATOM   5593 N  N     . GLU B 2 150 ? 40.665 153.622 34.582 1.00 45.86  ? 138 GLU B N     1 
ATOM   5594 C  CA    . GLU B 2 150 ? 39.866 154.731 35.057 1.00 46.53  ? 138 GLU B CA    1 
ATOM   5595 C  C     . GLU B 2 150 ? 40.728 155.972 35.152 1.00 46.92  ? 138 GLU B C     1 
ATOM   5596 O  O     . GLU B 2 150 ? 40.240 157.080 34.927 1.00 49.96  ? 138 GLU B O     1 
ATOM   5597 C  CB    . GLU B 2 150 ? 39.272 154.395 36.420 1.00 47.61  ? 138 GLU B CB    1 
ATOM   5598 C  CG    . GLU B 2 150 ? 38.903 155.596 37.251 1.00 50.56  ? 138 GLU B CG    1 
ATOM   5599 C  CD    . GLU B 2 150 ? 38.627 155.218 38.687 1.00 54.71  ? 138 GLU B CD    1 
ATOM   5600 O  OE1   . GLU B 2 150 ? 38.431 156.133 39.518 1.00 56.85  ? 138 GLU B OE1   1 
ATOM   5601 O  OE2   . GLU B 2 150 ? 38.607 154.002 38.985 1.00 55.19  ? 138 GLU B OE2   1 
ATOM   5602 N  N     . THR B 2 151 ? 42.004 155.799 35.482 1.00 45.17  ? 139 THR B N     1 
ATOM   5603 C  CA    . THR B 2 151 ? 42.952 156.909 35.390 1.00 43.44  ? 139 THR B CA    1 
ATOM   5604 C  C     . THR B 2 151 ? 44.148 156.513 34.569 1.00 41.55  ? 139 THR B C     1 
ATOM   5605 O  O     . THR B 2 151 ? 44.355 155.336 34.245 1.00 40.21  ? 139 THR B O     1 
ATOM   5606 C  CB    . THR B 2 151 ? 43.509 157.359 36.759 1.00 44.56  ? 139 THR B CB    1 
ATOM   5607 O  OG1   . THR B 2 151 ? 44.477 156.405 37.208 1.00 48.31  ? 139 THR B OG1   1 
ATOM   5608 C  CG2   . THR B 2 151 ? 42.395 157.481 37.797 1.00 44.87  ? 139 THR B CG2   1 
ATOM   5609 N  N     . PRO B 2 152 ? 44.960 157.499 34.214 1.00 40.14  ? 140 PRO B N     1 
ATOM   5610 C  CA    . PRO B 2 152 ? 46.291 157.249 33.666 1.00 42.26  ? 140 PRO B CA    1 
ATOM   5611 C  C     . PRO B 2 152 ? 47.166 156.646 34.738 1.00 43.99  ? 140 PRO B C     1 
ATOM   5612 O  O     . PRO B 2 152 ? 46.795 156.635 35.909 1.00 45.20  ? 140 PRO B O     1 
ATOM   5613 C  CB    . PRO B 2 152 ? 46.776 158.629 33.245 1.00 41.74  ? 140 PRO B CB    1 
ATOM   5614 C  CG    . PRO B 2 152 ? 45.526 159.431 33.079 1.00 40.40  ? 140 PRO B CG    1 
ATOM   5615 C  CD    . PRO B 2 152 ? 44.567 158.905 34.094 1.00 40.51  ? 140 PRO B CD    1 
ATOM   5616 N  N     . GLY B 2 153 ? 48.326 156.146 34.337 1.00 45.86  ? 141 GLY B N     1 
ATOM   5617 C  CA    . GLY B 2 153 ? 49.259 155.589 35.297 1.00 48.63  ? 141 GLY B CA    1 
ATOM   5618 C  C     . GLY B 2 153 ? 49.801 156.632 36.250 1.00 50.95  ? 141 GLY B C     1 
ATOM   5619 O  O     . GLY B 2 153 ? 50.017 157.779 35.856 1.00 53.81  ? 141 GLY B O     1 
ATOM   5620 N  N     . ILE B 2 154 ? 50.010 156.231 37.504 1.00 53.06  ? 142 ILE B N     1 
ATOM   5621 C  CA    . ILE B 2 154 ? 50.549 157.101 38.562 1.00 55.27  ? 142 ILE B CA    1 
ATOM   5622 C  C     . ILE B 2 154 ? 52.037 156.800 38.815 1.00 55.37  ? 142 ILE B C     1 
ATOM   5623 O  O     . ILE B 2 154 ? 52.374 155.729 39.300 1.00 56.40  ? 142 ILE B O     1 
ATOM   5624 C  CB    . ILE B 2 154 ? 49.775 156.879 39.893 1.00 55.74  ? 142 ILE B CB    1 
ATOM   5625 C  CG1   . ILE B 2 154 ? 48.317 157.316 39.746 1.00 56.03  ? 142 ILE B CG1   1 
ATOM   5626 C  CG2   . ILE B 2 154 ? 50.430 157.660 41.009 1.00 56.04  ? 142 ILE B CG2   1 
ATOM   5627 C  CD1   . ILE B 2 154 ? 48.142 158.823 39.580 1.00 53.44  ? 142 ILE B CD1   1 
ATOM   5628 N  N     . ARG B 2 155 ? 52.926 157.735 38.504 1.00 56.15  ? 143 ARG B N     1 
ATOM   5629 C  CA    . ARG B 2 155 ? 54.350 157.402 38.422 1.00 57.71  ? 143 ARG B CA    1 
ATOM   5630 C  C     . ARG B 2 155 ? 55.186 157.776 39.645 1.00 58.58  ? 143 ARG B C     1 
ATOM   5631 O  O     . ARG B 2 155 ? 54.977 158.824 40.255 1.00 59.81  ? 143 ARG B O     1 
ATOM   5632 C  CB    . ARG B 2 155 ? 54.967 158.042 37.175 1.00 56.59  ? 143 ARG B CB    1 
ATOM   5633 C  CG    . ARG B 2 155 ? 54.308 157.600 35.879 1.00 55.43  ? 143 ARG B CG    1 
ATOM   5634 C  CD    . ARG B 2 155 ? 55.218 157.823 34.685 1.00 53.59  ? 143 ARG B CD    1 
ATOM   5635 N  NE    . ARG B 2 155 ? 56.274 156.826 34.631 1.00 51.16  ? 143 ARG B NE    1 
ATOM   5636 C  CZ    . ARG B 2 155 ? 57.566 157.092 34.482 1.00 50.42  ? 143 ARG B CZ    1 
ATOM   5637 N  NH1   . ARG B 2 155 ? 58.005 158.335 34.365 1.00 48.38  ? 143 ARG B NH1   1 
ATOM   5638 N  NH2   . ARG B 2 155 ? 58.423 156.094 34.451 1.00 53.01  ? 143 ARG B NH2   1 
ATOM   5639 N  N     . TYR B 2 156 ? 56.145 156.911 39.976 1.00 59.14  ? 144 TYR B N     1 
ATOM   5640 C  CA    . TYR B 2 156 ? 56.998 157.074 41.150 1.00 59.45  ? 144 TYR B CA    1 
ATOM   5641 C  C     . TYR B 2 156 ? 58.479 156.850 40.884 1.00 60.49  ? 144 TYR B C     1 
ATOM   5642 O  O     . TYR B 2 156 ? 58.870 156.226 39.902 1.00 60.53  ? 144 TYR B O     1 
ATOM   5643 C  CB    . TYR B 2 156 ? 56.567 156.122 42.257 1.00 58.78  ? 144 TYR B CB    1 
ATOM   5644 C  CG    . TYR B 2 156 ? 55.264 156.497 42.897 1.00 60.08  ? 144 TYR B CG    1 
ATOM   5645 C  CD1   . TYR B 2 156 ? 55.188 157.575 43.780 1.00 61.38  ? 144 TYR B CD1   1 
ATOM   5646 C  CD2   . TYR B 2 156 ? 54.110 155.780 42.631 1.00 59.64  ? 144 TYR B CD2   1 
ATOM   5647 C  CE1   . TYR B 2 156 ? 54.000 157.923 44.374 1.00 60.37  ? 144 TYR B CE1   1 
ATOM   5648 C  CE2   . TYR B 2 156 ? 52.917 156.117 43.223 1.00 60.28  ? 144 TYR B CE2   1 
ATOM   5649 C  CZ    . TYR B 2 156 ? 52.868 157.188 44.090 1.00 61.52  ? 144 TYR B CZ    1 
ATOM   5650 O  OH    . TYR B 2 156 ? 51.676 157.532 44.673 1.00 64.65  ? 144 TYR B OH    1 
ATOM   5651 N  N     . GLN B 2 157 ? 59.290 157.352 41.806 1.00 62.79  ? 145 GLN B N     1 
ATOM   5652 C  CA    . GLN B 2 157 ? 60.744 157.344 41.704 1.00 63.09  ? 145 GLN B CA    1 
ATOM   5653 C  C     . GLN B 2 157 ? 61.318 157.097 43.098 1.00 65.13  ? 145 GLN B C     1 
ATOM   5654 O  O     . GLN B 2 157 ? 60.626 157.295 44.106 1.00 65.88  ? 145 GLN B O     1 
ATOM   5655 C  CB    . GLN B 2 157 ? 61.210 158.691 41.186 1.00 61.61  ? 145 GLN B CB    1 
ATOM   5656 C  CG    . GLN B 2 157 ? 62.685 158.826 41.022 1.00 62.00  ? 145 GLN B CG    1 
ATOM   5657 C  CD    . GLN B 2 157 ? 63.030 160.023 40.168 1.00 63.10  ? 145 GLN B CD    1 
ATOM   5658 O  OE1   . GLN B 2 157 ? 63.217 159.904 38.957 1.00 63.87  ? 145 GLN B OE1   1 
ATOM   5659 N  NE2   . GLN B 2 157 ? 63.105 161.190 40.791 1.00 62.67  ? 145 GLN B NE2   1 
ATOM   5660 N  N     . TYR B 2 158 ? 62.572 156.663 43.160 1.00 66.46  ? 146 TYR B N     1 
ATOM   5661 C  CA    . TYR B 2 158 ? 63.199 156.322 44.439 1.00 68.38  ? 146 TYR B CA    1 
ATOM   5662 C  C     . TYR B 2 158 ? 64.168 157.391 44.938 1.00 69.46  ? 146 TYR B C     1 
ATOM   5663 O  O     . TYR B 2 158 ? 64.954 157.933 44.164 1.00 69.84  ? 146 TYR B O     1 
ATOM   5664 C  CB    . TYR B 2 158 ? 63.939 154.988 44.320 1.00 68.13  ? 146 TYR B CB    1 
ATOM   5665 C  CG    . TYR B 2 158 ? 63.091 153.798 44.683 1.00 68.91  ? 146 TYR B CG    1 
ATOM   5666 C  CD1   . TYR B 2 158 ? 62.434 153.060 43.711 1.00 68.92  ? 146 TYR B CD1   1 
ATOM   5667 C  CD2   . TYR B 2 158 ? 62.930 153.428 46.001 1.00 68.89  ? 146 TYR B CD2   1 
ATOM   5668 C  CE1   . TYR B 2 158 ? 61.640 151.991 44.046 1.00 68.96  ? 146 TYR B CE1   1 
ATOM   5669 C  CE2   . TYR B 2 158 ? 62.141 152.365 46.349 1.00 69.94  ? 146 TYR B CE2   1 
ATOM   5670 C  CZ    . TYR B 2 158 ? 61.496 151.648 45.373 1.00 71.22  ? 146 TYR B CZ    1 
ATOM   5671 O  OH    . TYR B 2 158 ? 60.698 150.585 45.743 1.00 73.85  ? 146 TYR B OH    1 
ATOM   5672 N  N     . ASN B 2 159 ? 64.117 157.688 46.235 1.00 70.32  ? 147 ASN B N     1 
ATOM   5673 C  CA    . ASN B 2 159 ? 65.123 158.553 46.861 1.00 71.17  ? 147 ASN B CA    1 
ATOM   5674 C  C     . ASN B 2 159 ? 66.010 157.789 47.849 1.00 72.27  ? 147 ASN B C     1 
ATOM   5675 O  O     . ASN B 2 159 ? 66.848 158.382 48.525 1.00 74.08  ? 147 ASN B O     1 
ATOM   5676 C  CB    . ASN B 2 159 ? 64.450 159.706 47.590 1.00 68.70  ? 147 ASN B CB    1 
ATOM   5677 C  CG    . ASN B 2 159 ? 63.422 160.392 46.744 1.00 68.09  ? 147 ASN B CG    1 
ATOM   5678 O  OD1   . ASN B 2 159 ? 63.752 161.033 45.753 1.00 67.65  ? 147 ASN B OD1   1 
ATOM   5679 N  ND2   . ASN B 2 159 ? 62.158 160.260 47.126 1.00 67.21  ? 147 ASN B ND2   1 
ATOM   5680 N  N     . VAL B 2 160 ? 65.814 156.477 47.932 1.00 71.98  ? 148 VAL B N     1 
ATOM   5681 C  CA    . VAL B 2 160 ? 66.537 155.646 48.882 1.00 70.96  ? 148 VAL B CA    1 
ATOM   5682 C  C     . VAL B 2 160 ? 66.887 154.325 48.207 1.00 71.32  ? 148 VAL B C     1 
ATOM   5683 O  O     . VAL B 2 160 ? 66.232 153.930 47.252 1.00 71.59  ? 148 VAL B O     1 
ATOM   5684 C  CB    . VAL B 2 160 ? 65.667 155.353 50.102 1.00 70.72  ? 148 VAL B CB    1 
ATOM   5685 C  CG1   . VAL B 2 160 ? 64.923 156.610 50.508 1.00 69.56  ? 148 VAL B CG1   1 
ATOM   5686 C  CG2   . VAL B 2 160 ? 64.708 154.218 49.797 1.00 67.90  ? 148 VAL B CG2   1 
ATOM   5687 N  N     . LEU B 2 161 ? 67.918 153.644 48.694 1.00 71.81  ? 149 LEU B N     1 
ATOM   5688 C  CA    . LEU B 2 161 ? 68.268 152.344 48.141 1.00 72.91  ? 149 LEU B CA    1 
ATOM   5689 C  C     . LEU B 2 161 ? 66.999 151.525 48.010 1.00 73.55  ? 149 LEU B C     1 
ATOM   5690 O  O     . LEU B 2 161 ? 66.282 151.319 48.990 1.00 74.11  ? 149 LEU B O     1 
ATOM   5691 C  CB    . LEU B 2 161 ? 69.241 151.609 49.055 1.00 73.20  ? 149 LEU B CB    1 
ATOM   5692 C  CG    . LEU B 2 161 ? 70.619 152.245 49.193 1.00 74.41  ? 149 LEU B CG    1 
ATOM   5693 C  CD1   . LEU B 2 161 ? 71.506 151.314 50.005 1.00 75.12  ? 149 LEU B CD1   1 
ATOM   5694 C  CD2   . LEU B 2 161 ? 71.215 152.514 47.815 1.00 73.04  ? 149 LEU B CD2   1 
ATOM   5695 N  N     . PRO B 2 162 ? 66.689 151.075 46.786 1.00 73.19  ? 150 PRO B N     1 
ATOM   5696 C  CA    . PRO B 2 162 ? 65.486 150.285 46.501 1.00 73.01  ? 150 PRO B CA    1 
ATOM   5697 C  C     . PRO B 2 162 ? 65.658 148.788 46.762 1.00 73.02  ? 150 PRO B C     1 
ATOM   5698 O  O     . PRO B 2 162 ? 66.727 148.221 46.525 1.00 72.75  ? 150 PRO B O     1 
ATOM   5699 C  CB    . PRO B 2 162 ? 65.202 150.589 45.035 1.00 72.08  ? 150 PRO B CB    1 
ATOM   5700 C  CG    . PRO B 2 162 ? 66.543 150.891 44.466 1.00 72.46  ? 150 PRO B CG    1 
ATOM   5701 C  CD    . PRO B 2 162 ? 67.341 151.549 45.554 1.00 72.76  ? 150 PRO B CD    1 
ATOM   5702 N  N     . GLN B 2 163 ? 64.606 148.144 47.253 1.00 72.55  ? 151 GLN B N     1 
ATOM   5703 C  CA    . GLN B 2 163 ? 64.674 146.709 47.431 1.00 72.48  ? 151 GLN B CA    1 
ATOM   5704 C  C     . GLN B 2 163 ? 64.538 146.062 46.068 1.00 72.22  ? 151 GLN B C     1 
ATOM   5705 O  O     . GLN B 2 163 ? 63.648 146.408 45.292 1.00 73.69  ? 151 GLN B O     1 
ATOM   5706 C  CB    . GLN B 2 163 ? 63.566 146.232 48.368 1.00 74.76  ? 151 GLN B CB    1 
ATOM   5707 C  CG    . GLN B 2 163 ? 62.332 147.136 48.431 1.00 78.59  ? 151 GLN B CG    1 
ATOM   5708 C  CD    . GLN B 2 163 ? 61.231 146.553 49.327 1.00 80.96  ? 151 GLN B CD    1 
ATOM   5709 O  OE1   . GLN B 2 163 ? 61.510 145.985 50.391 1.00 81.01  ? 151 GLN B OE1   1 
ATOM   5710 N  NE2   . GLN B 2 163 ? 59.978 146.686 48.894 1.00 81.05  ? 151 GLN B NE2   1 
ATOM   5711 N  N     . GLY B 2 164 ? 65.431 145.133 45.764 1.00 70.89  ? 152 GLY B N     1 
ATOM   5712 C  CA    . GLY B 2 164 ? 65.386 144.482 44.469 1.00 69.36  ? 152 GLY B CA    1 
ATOM   5713 C  C     . GLY B 2 164 ? 66.489 144.949 43.544 1.00 68.58  ? 152 GLY B C     1 
ATOM   5714 O  O     . GLY B 2 164 ? 66.847 144.241 42.599 1.00 68.67  ? 152 GLY B O     1 
ATOM   5715 N  N     . TRP B 2 165 ? 67.031 146.136 43.816 1.00 67.16  ? 153 TRP B N     1 
ATOM   5716 C  CA    . TRP B 2 165 ? 68.146 146.668 43.034 1.00 66.14  ? 153 TRP B CA    1 
ATOM   5717 C  C     . TRP B 2 165 ? 69.470 146.127 43.542 1.00 67.11  ? 153 TRP B C     1 
ATOM   5718 O  O     . TRP B 2 165 ? 69.675 146.021 44.749 1.00 67.63  ? 153 TRP B O     1 
ATOM   5719 C  CB    . TRP B 2 165 ? 68.177 148.187 43.108 1.00 63.27  ? 153 TRP B CB    1 
ATOM   5720 C  CG    . TRP B 2 165 ? 69.284 148.780 42.306 1.00 61.40  ? 153 TRP B CG    1 
ATOM   5721 C  CD1   . TRP B 2 165 ? 69.657 148.425 41.043 1.00 60.59  ? 153 TRP B CD1   1 
ATOM   5722 C  CD2   . TRP B 2 165 ? 70.162 149.843 42.701 1.00 60.63  ? 153 TRP B CD2   1 
ATOM   5723 N  NE1   . TRP B 2 165 ? 70.712 149.199 40.625 1.00 60.46  ? 153 TRP B NE1   1 
ATOM   5724 C  CE2   . TRP B 2 165 ? 71.043 150.076 41.623 1.00 60.53  ? 153 TRP B CE2   1 
ATOM   5725 C  CE3   . TRP B 2 165 ? 70.290 150.618 43.858 1.00 60.07  ? 153 TRP B CE3   1 
ATOM   5726 C  CZ2   . TRP B 2 165 ? 72.038 151.054 41.670 1.00 60.80  ? 153 TRP B CZ2   1 
ATOM   5727 C  CZ3   . TRP B 2 165 ? 71.279 151.592 43.901 1.00 60.55  ? 153 TRP B CZ3   1 
ATOM   5728 C  CH2   . TRP B 2 165 ? 72.140 151.801 42.813 1.00 60.58  ? 153 TRP B CH2   1 
ATOM   5729 N  N     . LYS B 2 166 ? 70.371 145.796 42.622 1.00 67.96  ? 154 LYS B N     1 
ATOM   5730 C  CA    . LYS B 2 166 ? 71.594 145.086 42.988 1.00 69.02  ? 154 LYS B CA    1 
ATOM   5731 C  C     . LYS B 2 166 ? 72.662 146.032 43.512 1.00 69.79  ? 154 LYS B C     1 
ATOM   5732 O  O     . LYS B 2 166 ? 73.601 145.619 44.190 1.00 69.62  ? 154 LYS B O     1 
ATOM   5733 C  CB    . LYS B 2 166 ? 72.144 144.297 41.793 1.00 68.97  ? 154 LYS B CB    1 
ATOM   5734 C  CG    . LYS B 2 166 ? 72.858 145.127 40.732 1.00 67.97  ? 154 LYS B CG    1 
ATOM   5735 C  CD    . LYS B 2 166 ? 73.840 144.252 39.961 1.00 66.50  ? 154 LYS B CD    1 
ATOM   5736 C  CE    . LYS B 2 166 ? 74.317 144.930 38.695 1.00 66.09  ? 154 LYS B CE    1 
ATOM   5737 N  NZ    . LYS B 2 166 ? 74.939 146.249 38.955 1.00 65.32  ? 154 LYS B NZ    1 
ATOM   5738 N  N     . GLY B 2 167 ? 72.516 147.308 43.191 1.00 71.08  ? 155 GLY B N     1 
ATOM   5739 C  CA    . GLY B 2 167 ? 73.378 148.300 43.791 1.00 72.65  ? 155 GLY B CA    1 
ATOM   5740 C  C     . GLY B 2 167 ? 73.077 148.491 45.266 1.00 74.07  ? 155 GLY B C     1 
ATOM   5741 O  O     . GLY B 2 167 ? 73.841 149.124 45.985 1.00 74.72  ? 155 GLY B O     1 
ATOM   5742 N  N     . SER B 2 168 ? 71.966 147.944 45.736 1.00 74.57  ? 156 SER B N     1 
ATOM   5743 C  CA    . SER B 2 168 ? 71.534 148.258 47.085 1.00 76.22  ? 156 SER B CA    1 
ATOM   5744 C  C     . SER B 2 168 ? 72.372 147.587 48.177 1.00 77.61  ? 156 SER B C     1 
ATOM   5745 O  O     . SER B 2 168 ? 72.787 148.243 49.128 1.00 78.03  ? 156 SER B O     1 
ATOM   5746 C  CB    . SER B 2 168 ? 70.051 147.915 47.256 1.00 76.90  ? 156 SER B CB    1 
ATOM   5747 O  OG    . SER B 2 168 ? 69.233 148.864 46.586 1.00 75.85  ? 156 SER B OG    1 
ATOM   5748 N  N     . PRO B 2 169 ? 72.627 146.273 48.065 1.00 78.77  ? 157 PRO B N     1 
ATOM   5749 C  CA    . PRO B 2 169 ? 73.478 145.592 49.051 1.00 79.06  ? 157 PRO B CA    1 
ATOM   5750 C  C     . PRO B 2 169 ? 74.961 145.892 48.837 1.00 79.77  ? 157 PRO B C     1 
ATOM   5751 O  O     . PRO B 2 169 ? 75.779 145.738 49.738 1.00 79.65  ? 157 PRO B O     1 
ATOM   5752 C  CB    . PRO B 2 169 ? 73.166 144.119 48.832 1.00 78.48  ? 157 PRO B CB    1 
ATOM   5753 C  CG    . PRO B 2 169 ? 72.810 144.040 47.396 1.00 78.78  ? 157 PRO B CG    1 
ATOM   5754 C  CD    . PRO B 2 169 ? 72.095 145.330 47.067 1.00 79.14  ? 157 PRO B CD    1 
ATOM   5755 N  N     . ALA B 2 170 ? 75.300 146.309 47.627 1.00 80.40  ? 158 ALA B N     1 
ATOM   5756 C  CA    . ALA B 2 170 ? 76.671 146.630 47.300 1.00 82.27  ? 158 ALA B CA    1 
ATOM   5757 C  C     . ALA B 2 170 ? 77.051 147.984 47.895 1.00 84.78  ? 158 ALA B C     1 
ATOM   5758 O  O     . ALA B 2 170 ? 78.172 148.469 47.712 1.00 86.34  ? 158 ALA B O     1 
ATOM   5759 C  CB    . ALA B 2 170 ? 76.840 146.647 45.799 1.00 81.27  ? 158 ALA B CB    1 
ATOM   5760 N  N     . ILE B 2 171 ? 76.112 148.597 48.607 1.00 86.30  ? 159 ILE B N     1 
ATOM   5761 C  CA    . ILE B 2 171 ? 76.334 149.903 49.226 1.00 87.70  ? 159 ILE B CA    1 
ATOM   5762 C  C     . ILE B 2 171 ? 76.094 149.815 50.723 1.00 89.77  ? 159 ILE B C     1 
ATOM   5763 O  O     . ILE B 2 171 ? 76.891 150.294 51.532 1.00 90.17  ? 159 ILE B O     1 
ATOM   5764 C  CB    . ILE B 2 171 ? 75.378 150.965 48.643 1.00 86.76  ? 159 ILE B CB    1 
ATOM   5765 C  CG1   . ILE B 2 171 ? 75.893 151.434 47.282 1.00 86.34  ? 159 ILE B CG1   1 
ATOM   5766 C  CG2   . ILE B 2 171 ? 75.210 152.117 49.623 1.00 86.32  ? 159 ILE B CG2   1 
ATOM   5767 C  CD1   . ILE B 2 171 ? 74.984 152.420 46.591 1.00 85.81  ? 159 ILE B CD1   1 
ATOM   5768 N  N     . PHE B 2 172 ? 74.978 149.194 51.077 1.00 91.50  ? 160 PHE B N     1 
ATOM   5769 C  CA    . PHE B 2 172 ? 74.595 149.000 52.463 1.00 93.09  ? 160 PHE B CA    1 
ATOM   5770 C  C     . PHE B 2 172 ? 75.447 147.874 53.043 1.00 94.26  ? 160 PHE B C     1 
ATOM   5771 O  O     . PHE B 2 172 ? 75.059 147.217 54.008 1.00 94.43  ? 160 PHE B O     1 
ATOM   5772 C  CB    . PHE B 2 172 ? 73.112 148.638 52.520 1.00 93.48  ? 160 PHE B CB    1 
ATOM   5773 C  CG    . PHE B 2 172 ? 72.554 148.580 53.902 1.00 93.92  ? 160 PHE B CG    1 
ATOM   5774 C  CD1   . PHE B 2 172 ? 72.478 149.722 54.677 1.00 94.42  ? 160 PHE B CD1   1 
ATOM   5775 C  CD2   . PHE B 2 172 ? 72.097 147.382 54.427 1.00 94.16  ? 160 PHE B CD2   1 
ATOM   5776 C  CE1   . PHE B 2 172 ? 71.952 149.674 55.953 1.00 95.54  ? 160 PHE B CE1   1 
ATOM   5777 C  CE2   . PHE B 2 172 ? 71.569 147.325 55.704 1.00 95.01  ? 160 PHE B CE2   1 
ATOM   5778 C  CZ    . PHE B 2 172 ? 71.497 148.472 56.470 1.00 95.58  ? 160 PHE B CZ    1 
ATOM   5779 N  N     . GLN B 2 173 ? 76.612 147.658 52.437 1.00 95.10  ? 161 GLN B N     1 
ATOM   5780 C  CA    . GLN B 2 173 ? 77.473 146.534 52.790 1.00 95.53  ? 161 GLN B CA    1 
ATOM   5781 C  C     . GLN B 2 173 ? 78.375 146.875 53.961 1.00 95.25  ? 161 GLN B C     1 
ATOM   5782 O  O     . GLN B 2 173 ? 78.427 146.143 54.941 1.00 94.99  ? 161 GLN B O     1 
ATOM   5783 C  CB    . GLN B 2 173 ? 78.334 146.133 51.591 1.00 96.40  ? 161 GLN B CB    1 
ATOM   5784 C  CG    . GLN B 2 173 ? 79.214 144.917 51.836 1.00 96.90  ? 161 GLN B CG    1 
ATOM   5785 C  CD    . GLN B 2 173 ? 80.249 144.726 50.744 1.00 97.12  ? 161 GLN B CD    1 
ATOM   5786 O  OE1   . GLN B 2 173 ? 80.671 145.685 50.099 1.00 97.22  ? 161 GLN B OE1   1 
ATOM   5787 N  NE2   . GLN B 2 173 ? 80.661 143.483 50.531 1.00 97.30  ? 161 GLN B NE2   1 
ATOM   5788 N  N     . SER B 2 174 ? 79.093 147.986 53.850 1.00 95.66  ? 162 SER B N     1 
ATOM   5789 C  CA    . SER B 2 174 ? 79.946 148.441 54.936 1.00 95.84  ? 162 SER B CA    1 
ATOM   5790 C  C     . SER B 2 174 ? 79.122 148.395 56.209 1.00 96.28  ? 162 SER B C     1 
ATOM   5791 O  O     . SER B 2 174 ? 79.533 147.810 57.207 1.00 96.78  ? 162 SER B O     1 
ATOM   5792 C  CB    . SER B 2 174 ? 80.404 149.875 54.692 1.00 95.29  ? 162 SER B CB    1 
ATOM   5793 O  OG    . SER B 2 174 ? 79.399 150.794 55.086 1.00 94.55  ? 162 SER B OG    1 
ATOM   5794 N  N     . SER B 2 175 ? 77.947 149.012 56.157 1.00 97.05  ? 163 SER B N     1 
ATOM   5795 C  CA    . SER B 2 175 ? 77.025 148.993 57.281 1.00 97.93  ? 163 SER B CA    1 
ATOM   5796 C  C     . SER B 2 175 ? 76.662 147.555 57.609 1.00 98.65  ? 163 SER B C     1 
ATOM   5797 O  O     . SER B 2 175 ? 76.741 147.135 58.757 1.00 98.94  ? 163 SER B O     1 
ATOM   5798 C  CB    . SER B 2 175 ? 75.759 149.783 56.943 1.00 97.69  ? 163 SER B CB    1 
ATOM   5799 O  OG    . SER B 2 175 ? 76.068 151.137 56.658 1.00 97.01  ? 163 SER B OG    1 
ATOM   5800 N  N     . MET B 2 176 ? 76.280 146.795 56.591 1.00 99.98  ? 164 MET B N     1 
ATOM   5801 C  CA    . MET B 2 176 ? 75.886 145.410 56.796 1.00 100.78 ? 164 MET B CA    1 
ATOM   5802 C  C     . MET B 2 176 ? 76.999 144.625 57.485 1.00 101.32 ? 164 MET B C     1 
ATOM   5803 O  O     . MET B 2 176 ? 76.770 143.995 58.518 1.00 101.50 ? 164 MET B O     1 
ATOM   5804 C  CB    . MET B 2 176 ? 75.542 144.754 55.459 1.00 101.01 ? 164 MET B CB    1 
ATOM   5805 C  CG    . MET B 2 176 ? 74.729 143.487 55.610 1.00 100.90 ? 164 MET B CG    1 
ATOM   5806 S  SD    . MET B 2 176 ? 73.369 143.726 56.772 1.00 100.13 ? 164 MET B SD    1 
ATOM   5807 C  CE    . MET B 2 176 ? 72.635 142.089 56.766 1.00 99.31  ? 164 MET B CE    1 
ATOM   5808 N  N     . THR B 2 177 ? 78.204 144.671 56.919 1.00 102.12 ? 165 THR B N     1 
ATOM   5809 C  CA    . THR B 2 177 ? 79.355 144.004 57.522 1.00 102.21 ? 165 THR B CA    1 
ATOM   5810 C  C     . THR B 2 177 ? 79.490 144.401 58.994 1.00 102.65 ? 165 THR B C     1 
ATOM   5811 O  O     . THR B 2 177 ? 79.908 143.594 59.827 1.00 102.65 ? 165 THR B O     1 
ATOM   5812 C  CB    . THR B 2 177 ? 80.682 144.331 56.760 1.00 102.08 ? 165 THR B CB    1 
ATOM   5813 O  OG1   . THR B 2 177 ? 80.870 145.750 56.679 1.00 101.14 ? 165 THR B OG1   1 
ATOM   5814 C  CG2   . THR B 2 177 ? 80.649 143.749 55.354 1.00 101.90 ? 165 THR B CG2   1 
ATOM   5815 N  N     . LYS B 2 178 ? 79.114 145.635 59.316 1.00 102.51 ? 166 LYS B N     1 
ATOM   5816 C  CA    . LYS B 2 178 ? 79.105 146.081 60.700 1.00 102.83 ? 166 LYS B CA    1 
ATOM   5817 C  C     . LYS B 2 178 ? 77.984 145.421 61.496 1.00 103.93 ? 166 LYS B C     1 
ATOM   5818 O  O     . LYS B 2 178 ? 78.235 144.785 62.514 1.00 104.66 ? 166 LYS B O     1 
ATOM   5819 C  CB    . LYS B 2 178 ? 78.941 147.595 60.774 1.00 102.19 ? 166 LYS B CB    1 
ATOM   5820 C  CG    . LYS B 2 178 ? 80.142 148.389 60.315 1.00 102.10 ? 166 LYS B CG    1 
ATOM   5821 C  CD    . LYS B 2 178 ? 79.941 149.865 60.625 1.00 102.58 ? 166 LYS B CD    1 
ATOM   5822 C  CE    . LYS B 2 178 ? 81.094 150.708 60.114 1.00 103.14 ? 166 LYS B CE    1 
ATOM   5823 N  NZ    . LYS B 2 178 ? 80.925 152.139 60.484 1.00 103.32 ? 166 LYS B NZ    1 
ATOM   5824 N  N     . ILE B 2 179 ? 76.751 145.565 61.021 1.00 105.03 ? 167 ILE B N     1 
ATOM   5825 C  CA    . ILE B 2 179 ? 75.563 145.235 61.809 1.00 106.07 ? 167 ILE B CA    1 
ATOM   5826 C  C     . ILE B 2 179 ? 75.659 143.863 62.473 1.00 106.80 ? 167 ILE B C     1 
ATOM   5827 O  O     . ILE B 2 179 ? 74.912 143.557 63.405 1.00 106.87 ? 167 ILE B O     1 
ATOM   5828 C  CB    . ILE B 2 179 ? 74.283 145.255 60.933 1.00 106.54 ? 167 ILE B CB    1 
ATOM   5829 C  CG1   . ILE B 2 179 ? 74.233 146.541 60.102 1.00 106.70 ? 167 ILE B CG1   1 
ATOM   5830 C  CG2   . ILE B 2 179 ? 73.043 145.182 61.823 1.00 106.21 ? 167 ILE B CG2   1 
ATOM   5831 C  CD1   . ILE B 2 179 ? 73.230 146.512 58.964 1.00 106.16 ? 167 ILE B CD1   1 
ATOM   5832 N  N     . LEU B 2 180 ? 76.580 143.037 61.993 1.00 107.32 ? 168 LEU B N     1 
ATOM   5833 C  CA    . LEU B 2 180 ? 76.686 141.669 62.470 1.00 108.24 ? 168 LEU B CA    1 
ATOM   5834 C  C     . LEU B 2 180 ? 77.989 141.399 63.222 1.00 109.08 ? 168 LEU B C     1 
ATOM   5835 O  O     . LEU B 2 180 ? 78.245 140.269 63.649 1.00 109.51 ? 168 LEU B O     1 
ATOM   5836 C  CB    . LEU B 2 180 ? 76.555 140.711 61.288 1.00 108.13 ? 168 LEU B CB    1 
ATOM   5837 C  CG    . LEU B 2 180 ? 75.219 140.787 60.547 1.00 107.45 ? 168 LEU B CG    1 
ATOM   5838 C  CD1   . LEU B 2 180 ? 75.307 140.025 59.235 1.00 107.18 ? 168 LEU B CD1   1 
ATOM   5839 C  CD2   . LEU B 2 180 ? 74.120 140.224 61.435 1.00 106.97 ? 168 LEU B CD2   1 
ATOM   5840 N  N     . GLU B 2 181 ? 78.805 142.437 63.389 1.00 109.67 ? 169 GLU B N     1 
ATOM   5841 C  CA    . GLU B 2 181 ? 80.134 142.286 63.984 1.00 110.08 ? 169 GLU B CA    1 
ATOM   5842 C  C     . GLU B 2 181 ? 80.077 141.483 65.281 1.00 108.91 ? 169 GLU B C     1 
ATOM   5843 O  O     . GLU B 2 181 ? 80.757 140.467 65.423 1.00 107.75 ? 169 GLU B O     1 
ATOM   5844 C  CB    . GLU B 2 181 ? 80.757 143.662 64.251 1.00 111.32 ? 169 GLU B CB    1 
ATOM   5845 C  CG    . GLU B 2 181 ? 82.261 143.638 64.475 1.00 113.04 ? 169 GLU B CG    1 
ATOM   5846 C  CD    . GLU B 2 181 ? 83.046 143.913 63.200 1.00 113.80 ? 169 GLU B CD    1 
ATOM   5847 O  OE1   . GLU B 2 181 ? 82.677 144.856 62.466 1.00 113.21 ? 169 GLU B OE1   1 
ATOM   5848 O  OE2   . GLU B 2 181 ? 84.031 143.187 62.932 1.00 114.64 ? 169 GLU B OE2   1 
ATOM   5849 N  N     . PRO B 2 182 ? 79.255 141.929 66.242 1.00 108.51 ? 170 PRO B N     1 
ATOM   5850 C  CA    . PRO B 2 182 ? 79.006 141.103 67.424 1.00 108.36 ? 170 PRO B CA    1 
ATOM   5851 C  C     . PRO B 2 182 ? 78.475 139.712 67.087 1.00 108.05 ? 170 PRO B C     1 
ATOM   5852 O  O     . PRO B 2 182 ? 79.225 138.741 67.141 1.00 108.57 ? 170 PRO B O     1 
ATOM   5853 C  CB    . PRO B 2 182 ? 78.009 141.929 68.230 1.00 108.20 ? 170 PRO B CB    1 
ATOM   5854 C  CG    . PRO B 2 182 ? 78.304 143.337 67.827 1.00 108.44 ? 170 PRO B CG    1 
ATOM   5855 C  CD    . PRO B 2 182 ? 78.631 143.258 66.368 1.00 108.43 ? 170 PRO B CD    1 
ATOM   5856 N  N     . PHE B 2 183 ? 77.196 139.617 66.731 1.00 107.95 ? 171 PHE B N     1 
ATOM   5857 C  CA    . PHE B 2 183 ? 76.544 138.319 66.535 1.00 108.18 ? 171 PHE B CA    1 
ATOM   5858 C  C     . PHE B 2 183 ? 77.451 137.329 65.810 1.00 108.60 ? 171 PHE B C     1 
ATOM   5859 O  O     . PHE B 2 183 ? 77.445 136.133 66.109 1.00 108.10 ? 171 PHE B O     1 
ATOM   5860 C  CB    . PHE B 2 183 ? 75.241 138.478 65.743 1.00 107.91 ? 171 PHE B CB    1 
ATOM   5861 C  CG    . PHE B 2 183 ? 74.322 137.281 65.826 1.00 108.06 ? 171 PHE B CG    1 
ATOM   5862 C  CD1   . PHE B 2 183 ? 74.653 136.083 65.208 1.00 107.52 ? 171 PHE B CD1   1 
ATOM   5863 C  CD2   . PHE B 2 183 ? 73.126 137.353 66.530 1.00 108.05 ? 171 PHE B CD2   1 
ATOM   5864 C  CE1   . PHE B 2 183 ? 73.807 134.984 65.286 1.00 107.02 ? 171 PHE B CE1   1 
ATOM   5865 C  CE2   . PHE B 2 183 ? 72.278 136.255 66.610 1.00 107.23 ? 171 PHE B CE2   1 
ATOM   5866 C  CZ    . PHE B 2 183 ? 72.622 135.070 65.988 1.00 106.72 ? 171 PHE B CZ    1 
ATOM   5867 N  N     . ARG B 2 184 ? 78.232 137.832 64.860 1.00 109.10 ? 172 ARG B N     1 
ATOM   5868 C  CA    . ARG B 2 184 ? 79.171 136.991 64.132 1.00 109.39 ? 172 ARG B CA    1 
ATOM   5869 C  C     . ARG B 2 184 ? 80.310 136.519 65.034 1.00 109.25 ? 172 ARG B C     1 
ATOM   5870 O  O     . ARG B 2 184 ? 80.533 135.315 65.190 1.00 109.36 ? 172 ARG B O     1 
ATOM   5871 C  CB    . ARG B 2 184 ? 79.740 137.752 62.933 1.00 109.95 ? 172 ARG B CB    1 
ATOM   5872 C  CG    . ARG B 2 184 ? 78.718 138.035 61.844 1.00 110.98 ? 172 ARG B CG    1 
ATOM   5873 C  CD    . ARG B 2 184 ? 79.253 137.653 60.470 1.00 112.16 ? 172 ARG B CD    1 
ATOM   5874 N  NE    . ARG B 2 184 ? 78.286 137.912 59.404 1.00 112.36 ? 172 ARG B NE    1 
ATOM   5875 C  CZ    . ARG B 2 184 ? 78.404 137.454 58.162 1.00 112.81 ? 172 ARG B CZ    1 
ATOM   5876 N  NH1   . ARG B 2 184 ? 79.448 136.710 57.818 1.00 112.97 ? 172 ARG B NH1   1 
ATOM   5877 N  NH2   . ARG B 2 184 ? 77.478 137.740 57.260 1.00 112.99 ? 172 ARG B NH2   1 
ATOM   5878 N  N     . LYS B 2 185 ? 81.026 137.467 65.633 1.00 108.93 ? 173 LYS B N     1 
ATOM   5879 C  CA    . LYS B 2 185 ? 82.114 137.124 66.538 1.00 108.00 ? 173 LYS B CA    1 
ATOM   5880 C  C     . LYS B 2 185 ? 81.604 136.154 67.590 1.00 107.71 ? 173 LYS B C     1 
ATOM   5881 O  O     . LYS B 2 185 ? 82.244 135.146 67.881 1.00 107.33 ? 173 LYS B O     1 
ATOM   5882 C  CB    . LYS B 2 185 ? 82.655 138.375 67.226 1.00 107.59 ? 173 LYS B CB    1 
ATOM   5883 C  CG    . LYS B 2 185 ? 83.913 138.118 68.029 1.00 108.14 ? 173 LYS B CG    1 
ATOM   5884 C  CD    . LYS B 2 185 ? 84.172 139.221 69.038 1.00 108.66 ? 173 LYS B CD    1 
ATOM   5885 C  CE    . LYS B 2 185 ? 83.318 139.047 70.282 1.00 108.67 ? 173 LYS B CE    1 
ATOM   5886 N  NZ    . LYS B 2 185 ? 83.613 140.093 71.300 1.00 109.29 ? 173 LYS B NZ    1 
ATOM   5887 N  N     . GLN B 2 186 ? 80.434 136.462 68.143 1.00 107.76 ? 174 GLN B N     1 
ATOM   5888 C  CA    . GLN B 2 186 ? 79.852 135.669 69.218 1.00 108.15 ? 174 GLN B CA    1 
ATOM   5889 C  C     . GLN B 2 186 ? 79.315 134.339 68.700 1.00 108.53 ? 174 GLN B C     1 
ATOM   5890 O  O     . GLN B 2 186 ? 78.665 133.601 69.439 1.00 108.39 ? 174 GLN B O     1 
ATOM   5891 C  CB    . GLN B 2 186 ? 78.712 136.439 69.896 1.00 108.24 ? 174 GLN B CB    1 
ATOM   5892 C  CG    . GLN B 2 186 ? 78.973 137.928 70.128 1.00 109.36 ? 174 GLN B CG    1 
ATOM   5893 C  CD    . GLN B 2 186 ? 80.072 138.206 71.145 1.00 110.21 ? 174 GLN B CD    1 
ATOM   5894 O  OE1   . GLN B 2 186 ? 80.713 137.286 71.661 1.00 110.81 ? 174 GLN B OE1   1 
ATOM   5895 N  NE2   . GLN B 2 186 ? 80.296 139.487 71.435 1.00 109.52 ? 174 GLN B NE2   1 
ATOM   5896 N  N     . ASN B 2 187 ? 79.579 134.042 67.430 1.00 109.36 ? 175 ASN B N     1 
ATOM   5897 C  CA    . ASN B 2 187 ? 79.124 132.789 66.826 1.00 110.02 ? 175 ASN B CA    1 
ATOM   5898 C  C     . ASN B 2 187 ? 80.002 132.334 65.665 1.00 110.29 ? 175 ASN B C     1 
ATOM   5899 O  O     . ASN B 2 187 ? 79.539 132.243 64.531 1.00 110.67 ? 175 ASN B O     1 
ATOM   5900 C  CB    . ASN B 2 187 ? 77.683 132.932 66.329 1.00 109.63 ? 175 ASN B CB    1 
ATOM   5901 C  CG    . ASN B 2 187 ? 76.699 133.151 67.453 1.00 109.71 ? 175 ASN B CG    1 
ATOM   5902 O  OD1   . ASN B 2 187 ? 76.320 132.211 68.154 1.00 109.69 ? 175 ASN B OD1   1 
ATOM   5903 N  ND2   . ASN B 2 187 ? 76.276 134.396 67.634 1.00 109.43 ? 175 ASN B ND2   1 
ATOM   5904 N  N     . PRO B 2 188 ? 81.279 132.026 65.936 1.00 110.73 ? 176 PRO B N     1 
ATOM   5905 C  CA    . PRO B 2 188 ? 82.220 131.570 64.905 1.00 110.40 ? 176 PRO B CA    1 
ATOM   5906 C  C     . PRO B 2 188 ? 81.790 130.332 64.106 1.00 109.66 ? 176 PRO B C     1 
ATOM   5907 O  O     . PRO B 2 188 ? 82.461 129.952 63.146 1.00 109.73 ? 176 PRO B O     1 
ATOM   5908 C  CB    . PRO B 2 188 ? 83.515 131.330 65.685 1.00 110.65 ? 176 PRO B CB    1 
ATOM   5909 C  CG    . PRO B 2 188 ? 83.411 132.254 66.852 1.00 111.11 ? 176 PRO B CG    1 
ATOM   5910 C  CD    . PRO B 2 188 ? 81.952 132.234 67.229 1.00 111.28 ? 176 PRO B CD    1 
ATOM   5911 N  N     . ASP B 2 189 ? 80.685 129.700 64.491 1.00 108.43 ? 177 ASP B N     1 
ATOM   5912 C  CA    . ASP B 2 189 ? 80.144 128.617 63.677 1.00 107.53 ? 177 ASP B CA    1 
ATOM   5913 C  C     . ASP B 2 189 ? 78.658 128.778 63.387 1.00 106.85 ? 177 ASP B C     1 
ATOM   5914 O  O     . ASP B 2 189 ? 77.860 127.857 63.579 1.00 106.61 ? 177 ASP B O     1 
ATOM   5915 C  CB    . ASP B 2 189 ? 80.419 127.257 64.331 1.00 107.65 ? 177 ASP B CB    1 
ATOM   5916 C  CG    . ASP B 2 189 ? 81.859 126.792 64.130 1.00 106.95 ? 177 ASP B CG    1 
ATOM   5917 O  OD1   . ASP B 2 189 ? 82.128 126.034 63.172 1.00 105.99 ? 177 ASP B OD1   1 
ATOM   5918 O  OD2   . ASP B 2 189 ? 82.726 127.186 64.935 1.00 107.12 ? 177 ASP B OD2   1 
ATOM   5919 N  N     . ILE B 2 190 ? 78.304 129.974 62.930 1.00 106.30 ? 178 ILE B N     1 
ATOM   5920 C  CA    . ILE B 2 190 ? 77.054 130.206 62.217 1.00 105.71 ? 178 ILE B CA    1 
ATOM   5921 C  C     . ILE B 2 190 ? 77.342 131.190 61.082 1.00 105.28 ? 178 ILE B C     1 
ATOM   5922 O  O     . ILE B 2 190 ? 77.789 132.313 61.323 1.00 104.47 ? 178 ILE B O     1 
ATOM   5923 C  CB    . ILE B 2 190 ? 75.981 130.807 63.134 1.00 105.66 ? 178 ILE B CB    1 
ATOM   5924 C  CG1   . ILE B 2 190 ? 75.813 129.934 64.380 1.00 106.75 ? 178 ILE B CG1   1 
ATOM   5925 C  CG2   . ILE B 2 190 ? 74.664 130.899 62.385 1.00 104.46 ? 178 ILE B CG2   1 
ATOM   5926 C  CD1   . ILE B 2 190 ? 75.050 130.604 65.514 1.00 107.76 ? 178 ILE B CD1   1 
ATOM   5927 N  N     . VAL B 2 191 ? 77.086 130.755 59.849 1.00 104.92 ? 179 VAL B N     1 
ATOM   5928 C  CA    . VAL B 2 191 ? 77.514 131.480 58.651 1.00 103.00 ? 179 VAL B CA    1 
ATOM   5929 C  C     . VAL B 2 191 ? 76.374 132.295 58.034 1.00 102.27 ? 179 VAL B C     1 
ATOM   5930 O  O     . VAL B 2 191 ? 75.248 131.809 57.892 1.00 102.26 ? 179 VAL B O     1 
ATOM   5931 C  CB    . VAL B 2 191 ? 78.068 130.503 57.582 1.00 102.29 ? 179 VAL B CB    1 
ATOM   5932 C  CG1   . VAL B 2 191 ? 76.964 129.573 57.110 1.00 101.49 ? 179 VAL B CG1   1 
ATOM   5933 C  CG2   . VAL B 2 191 ? 78.667 131.278 56.419 1.00 101.49 ? 179 VAL B CG2   1 
ATOM   5934 N  N     . ILE B 2 192 ? 76.681 133.537 57.671 1.00 100.82 ? 180 ILE B N     1 
ATOM   5935 C  CA    . ILE B 2 192 ? 75.685 134.458 57.137 1.00 99.03  ? 180 ILE B CA    1 
ATOM   5936 C  C     . ILE B 2 192 ? 76.114 134.981 55.768 1.00 97.95  ? 180 ILE B C     1 
ATOM   5937 O  O     . ILE B 2 192 ? 77.288 135.293 55.550 1.00 96.87  ? 180 ILE B O     1 
ATOM   5938 C  CB    . ILE B 2 192 ? 75.484 135.660 58.082 1.00 98.87  ? 180 ILE B CB    1 
ATOM   5939 C  CG1   . ILE B 2 192 ? 75.117 135.169 59.480 1.00 99.23  ? 180 ILE B CG1   1 
ATOM   5940 C  CG2   . ILE B 2 192 ? 74.383 136.556 57.558 1.00 98.56  ? 180 ILE B CG2   1 
ATOM   5941 C  CD1   . ILE B 2 192 ? 74.903 136.287 60.472 1.00 99.89  ? 180 ILE B CD1   1 
ATOM   5942 N  N     . TYR B 2 193 ? 75.153 135.076 54.853 1.00 96.95  ? 181 TYR B N     1 
ATOM   5943 C  CA    . TYR B 2 193 ? 75.421 135.525 53.491 1.00 95.48  ? 181 TYR B CA    1 
ATOM   5944 C  C     . TYR B 2 193 ? 74.332 136.486 53.011 1.00 95.03  ? 181 TYR B C     1 
ATOM   5945 O  O     . TYR B 2 193 ? 73.137 136.263 53.243 1.00 94.76  ? 181 TYR B O     1 
ATOM   5946 C  CB    . TYR B 2 193 ? 75.515 134.308 52.567 1.00 95.24  ? 181 TYR B CB    1 
ATOM   5947 C  CG    . TYR B 2 193 ? 75.751 134.620 51.109 1.00 95.04  ? 181 TYR B CG    1 
ATOM   5948 C  CD1   . TYR B 2 193 ? 76.777 135.468 50.706 1.00 95.17  ? 181 TYR B CD1   1 
ATOM   5949 C  CD2   . TYR B 2 193 ? 74.946 134.055 50.129 1.00 95.26  ? 181 TYR B CD2   1 
ATOM   5950 C  CE1   . TYR B 2 193 ? 76.990 135.743 49.363 1.00 95.26  ? 181 TYR B CE1   1 
ATOM   5951 C  CE2   . TYR B 2 193 ? 75.150 134.322 48.789 1.00 95.10  ? 181 TYR B CE2   1 
ATOM   5952 C  CZ    . TYR B 2 193 ? 76.168 135.164 48.409 1.00 95.39  ? 181 TYR B CZ    1 
ATOM   5953 O  OH    . TYR B 2 193 ? 76.343 135.428 47.070 1.00 94.74  ? 181 TYR B OH    1 
ATOM   5954 N  N     . GLN B 2 194 ? 74.757 137.563 52.356 1.00 94.14  ? 182 GLN B N     1 
ATOM   5955 C  CA    . GLN B 2 194 ? 73.845 138.607 51.889 1.00 93.87  ? 182 GLN B CA    1 
ATOM   5956 C  C     . GLN B 2 194 ? 73.790 138.631 50.363 1.00 93.56  ? 182 GLN B C     1 
ATOM   5957 O  O     . GLN B 2 194 ? 74.639 139.250 49.721 1.00 94.30  ? 182 GLN B O     1 
ATOM   5958 C  CB    . GLN B 2 194 ? 74.307 139.979 52.408 1.00 93.31  ? 182 GLN B CB    1 
ATOM   5959 C  CG    . GLN B 2 194 ? 73.666 141.189 51.720 1.00 92.78  ? 182 GLN B CG    1 
ATOM   5960 C  CD    . GLN B 2 194 ? 74.311 142.523 52.114 1.00 93.14  ? 182 GLN B CD    1 
ATOM   5961 O  OE1   . GLN B 2 194 ? 73.765 143.596 51.850 1.00 92.30  ? 182 GLN B OE1   1 
ATOM   5962 N  NE2   . GLN B 2 194 ? 75.476 142.456 52.744 1.00 93.79  ? 182 GLN B NE2   1 
ATOM   5963 N  N     . TYR B 2 195 ? 72.798 137.955 49.785 1.00 92.11  ? 183 TYR B N     1 
ATOM   5964 C  CA    . TYR B 2 195 ? 72.496 138.098 48.360 1.00 89.90  ? 183 TYR B CA    1 
ATOM   5965 C  C     . TYR B 2 195 ? 71.246 138.959 48.197 1.00 89.94  ? 183 TYR B C     1 
ATOM   5966 O  O     . TYR B 2 195 ? 70.124 138.498 48.432 1.00 89.99  ? 183 TYR B O     1 
ATOM   5967 C  CB    . TYR B 2 195 ? 72.267 136.724 47.714 1.00 87.97  ? 183 TYR B CB    1 
ATOM   5968 C  CG    . TYR B 2 195 ? 71.919 136.771 46.239 1.00 85.12  ? 183 TYR B CG    1 
ATOM   5969 C  CD1   . TYR B 2 195 ? 72.900 136.993 45.281 1.00 84.44  ? 183 TYR B CD1   1 
ATOM   5970 C  CD2   . TYR B 2 195 ? 70.611 136.606 45.807 1.00 83.53  ? 183 TYR B CD2   1 
ATOM   5971 C  CE1   . TYR B 2 195 ? 72.587 137.053 43.934 1.00 83.69  ? 183 TYR B CE1   1 
ATOM   5972 C  CE2   . TYR B 2 195 ? 70.287 136.665 44.463 1.00 82.93  ? 183 TYR B CE2   1 
ATOM   5973 C  CZ    . TYR B 2 195 ? 71.279 136.892 43.531 1.00 83.20  ? 183 TYR B CZ    1 
ATOM   5974 O  OH    . TYR B 2 195 ? 70.966 136.975 42.192 1.00 80.81  ? 183 TYR B OH    1 
ATOM   5975 N  N     . MET B 2 196 ? 71.448 140.216 47.813 1.00 89.09  ? 184 MET B N     1 
ATOM   5976 C  CA    . MET B 2 196 ? 70.341 141.123 47.547 1.00 88.33  ? 184 MET B CA    1 
ATOM   5977 C  C     . MET B 2 196 ? 69.381 141.194 48.725 1.00 88.41  ? 184 MET B C     1 
ATOM   5978 O  O     . MET B 2 196 ? 69.788 141.072 49.876 1.00 88.02  ? 184 MET B O     1 
ATOM   5979 C  CB    . MET B 2 196 ? 69.587 140.670 46.297 1.00 87.55  ? 184 MET B CB    1 
ATOM   5980 C  CG    . MET B 2 196 ? 70.463 140.558 45.067 1.00 86.44  ? 184 MET B CG    1 
ATOM   5981 S  SD    . MET B 2 196 ? 69.759 141.424 43.673 1.00 87.02  ? 184 MET B SD    1 
ATOM   5982 C  CE    . MET B 2 196 ? 68.182 140.536 43.463 1.00 85.40  ? 184 MET B CE    1 
ATOM   5983 N  N     . ASP B 2 197 ? 68.101 141.384 48.424 1.00 88.84  ? 185 ASP B N     1 
ATOM   5984 C  CA    . ASP B 2 197 ? 67.095 141.583 49.456 1.00 88.88  ? 185 ASP B CA    1 
ATOM   5985 C  C     . ASP B 2 197 ? 67.161 140.537 50.549 1.00 88.95  ? 185 ASP B C     1 
ATOM   5986 O  O     . ASP B 2 197 ? 66.811 140.815 51.687 1.00 88.94  ? 185 ASP B O     1 
ATOM   5987 C  CB    . ASP B 2 197 ? 65.693 141.570 48.849 1.00 89.35  ? 185 ASP B CB    1 
ATOM   5988 C  CG    . ASP B 2 197 ? 65.369 142.844 48.104 1.00 89.39  ? 185 ASP B CG    1 
ATOM   5989 O  OD1   . ASP B 2 197 ? 64.175 143.075 47.825 1.00 90.50  ? 185 ASP B OD1   1 
ATOM   5990 O  OD2   . ASP B 2 197 ? 66.304 143.612 47.797 1.00 87.24  ? 185 ASP B OD2   1 
ATOM   5991 N  N     . ASP B 2 198 ? 67.594 139.328 50.211 1.00 90.17  ? 186 ASP B N     1 
ATOM   5992 C  CA    . ASP B 2 198 ? 67.543 138.237 51.177 1.00 90.95  ? 186 ASP B CA    1 
ATOM   5993 C  C     . ASP B 2 198 ? 68.855 138.028 51.924 1.00 91.47  ? 186 ASP B C     1 
ATOM   5994 O  O     . ASP B 2 198 ? 69.944 138.327 51.426 1.00 90.51  ? 186 ASP B O     1 
ATOM   5995 C  CB    . ASP B 2 198 ? 67.113 136.926 50.496 1.00 91.17  ? 186 ASP B CB    1 
ATOM   5996 C  CG    . ASP B 2 198 ? 65.589 136.760 50.427 1.00 91.78  ? 186 ASP B CG    1 
ATOM   5997 O  OD1   . ASP B 2 198 ? 65.092 136.139 49.461 1.00 91.61  ? 186 ASP B OD1   1 
ATOM   5998 O  OD2   . ASP B 2 198 ? 64.884 137.241 51.339 1.00 91.39  ? 186 ASP B OD2   1 
ATOM   5999 N  N     . LEU B 2 199 ? 68.722 137.519 53.142 1.00 92.78  ? 187 LEU B N     1 
ATOM   6000 C  CA    . LEU B 2 199 ? 69.857 137.217 53.999 1.00 94.49  ? 187 LEU B CA    1 
ATOM   6001 C  C     . LEU B 2 199 ? 69.835 135.726 54.303 1.00 95.53  ? 187 LEU B C     1 
ATOM   6002 O  O     . LEU B 2 199 ? 68.859 135.214 54.848 1.00 94.98  ? 187 LEU B O     1 
ATOM   6003 C  CB    . LEU B 2 199 ? 69.741 138.001 55.302 1.00 93.60  ? 187 LEU B CB    1 
ATOM   6004 C  CG    . LEU B 2 199 ? 71.054 138.239 56.032 1.00 92.96  ? 187 LEU B CG    1 
ATOM   6005 C  CD1   . LEU B 2 199 ? 72.013 138.966 55.096 1.00 92.35  ? 187 LEU B CD1   1 
ATOM   6006 C  CD2   . LEU B 2 199 ? 70.794 139.044 57.291 1.00 91.20  ? 187 LEU B CD2   1 
ATOM   6007 N  N     . TYR B 2 200 ? 70.904 135.025 53.948 1.00 97.37  ? 188 TYR B N     1 
ATOM   6008 C  CA    . TYR B 2 200 ? 70.924 133.580 54.132 1.00 99.59  ? 188 TYR B CA    1 
ATOM   6009 C  C     . TYR B 2 200 ? 71.810 133.182 55.299 1.00 100.81 ? 188 TYR B C     1 
ATOM   6010 O  O     . TYR B 2 200 ? 73.036 133.322 55.246 1.00 100.19 ? 188 TYR B O     1 
ATOM   6011 C  CB    . TYR B 2 200 ? 71.398 132.884 52.852 1.00 99.57  ? 188 TYR B CB    1 
ATOM   6012 C  CG    . TYR B 2 200 ? 70.339 132.799 51.773 1.00 99.24  ? 188 TYR B CG    1 
ATOM   6013 C  CD1   . TYR B 2 200 ? 70.500 133.452 50.557 1.00 98.62  ? 188 TYR B CD1   1 
ATOM   6014 C  CD2   . TYR B 2 200 ? 69.182 132.060 51.969 1.00 99.27  ? 188 TYR B CD2   1 
ATOM   6015 C  CE1   . TYR B 2 200 ? 69.541 133.369 49.569 1.00 98.08  ? 188 TYR B CE1   1 
ATOM   6016 C  CE2   . TYR B 2 200 ? 68.218 131.973 50.986 1.00 99.46  ? 188 TYR B CE2   1 
ATOM   6017 C  CZ    . TYR B 2 200 ? 68.404 132.629 49.789 1.00 98.76  ? 188 TYR B CZ    1 
ATOM   6018 O  OH    . TYR B 2 200 ? 67.443 132.541 48.811 1.00 99.21  ? 188 TYR B OH    1 
ATOM   6019 N  N     . VAL B 2 201 ? 71.175 132.688 56.357 1.00 102.16 ? 189 VAL B N     1 
ATOM   6020 C  CA    . VAL B 2 201 ? 71.892 132.298 57.558 1.00 103.80 ? 189 VAL B CA    1 
ATOM   6021 C  C     . VAL B 2 201 ? 71.482 130.890 57.957 1.00 105.57 ? 189 VAL B C     1 
ATOM   6022 O  O     . VAL B 2 201 ? 70.293 130.574 58.018 1.00 105.55 ? 189 VAL B O     1 
ATOM   6023 C  CB    . VAL B 2 201 ? 71.589 133.251 58.732 1.00 102.95 ? 189 VAL B CB    1 
ATOM   6024 C  CG1   . VAL B 2 201 ? 72.522 132.955 59.885 1.00 102.96 ? 189 VAL B CG1   1 
ATOM   6025 C  CG2   . VAL B 2 201 ? 71.737 134.690 58.290 1.00 102.27 ? 189 VAL B CG2   1 
ATOM   6026 N  N     . GLY B 2 202 ? 72.475 130.050 58.224 1.00 107.73 ? 190 GLY B N     1 
ATOM   6027 C  CA    . GLY B 2 202 ? 72.198 128.689 58.638 1.00 111.11 ? 190 GLY B CA    1 
ATOM   6028 C  C     . GLY B 2 202 ? 73.318 128.091 59.469 1.00 113.47 ? 190 GLY B C     1 
ATOM   6029 O  O     . GLY B 2 202 ? 74.480 128.487 59.344 1.00 113.55 ? 190 GLY B O     1 
ATOM   6030 N  N     . SER B 2 203 ? 72.966 127.134 60.322 1.00 115.55 ? 191 SER B N     1 
ATOM   6031 C  CA    . SER B 2 203 ? 73.949 126.438 61.144 1.00 117.86 ? 191 SER B CA    1 
ATOM   6032 C  C     . SER B 2 203 ? 73.620 124.950 61.252 1.00 118.89 ? 191 SER B C     1 
ATOM   6033 O  O     . SER B 2 203 ? 72.526 124.513 60.881 1.00 118.75 ? 191 SER B O     1 
ATOM   6034 C  CB    . SER B 2 203 ? 74.007 127.059 62.545 1.00 118.47 ? 191 SER B CB    1 
ATOM   6035 O  OG    . SER B 2 203 ? 72.787 126.877 63.244 1.00 119.37 ? 191 SER B OG    1 
ATOM   6036 N  N     . ASP B 2 204 ? 74.576 124.179 61.763 1.00 119.87 ? 192 ASP B N     1 
ATOM   6037 C  CA    . ASP B 2 204 ? 74.423 122.732 61.878 1.00 120.42 ? 192 ASP B CA    1 
ATOM   6038 C  C     . ASP B 2 204 ? 73.672 122.356 63.151 1.00 120.28 ? 192 ASP B C     1 
ATOM   6039 O  O     . ASP B 2 204 ? 73.258 121.210 63.324 1.00 120.05 ? 192 ASP B O     1 
ATOM   6040 C  CB    . ASP B 2 204 ? 75.797 122.056 61.870 1.00 121.06 ? 192 ASP B CB    1 
ATOM   6041 C  CG    . ASP B 2 204 ? 76.569 122.309 60.584 1.00 121.64 ? 192 ASP B CG    1 
ATOM   6042 O  OD1   . ASP B 2 204 ? 76.373 121.552 59.606 1.00 121.80 ? 192 ASP B OD1   1 
ATOM   6043 O  OD2   . ASP B 2 204 ? 77.373 123.266 60.553 1.00 121.62 ? 192 ASP B OD2   1 
ATOM   6044 N  N     . LEU B 2 205 ? 73.500 123.335 64.033 1.00 120.28 ? 193 LEU B N     1 
ATOM   6045 C  CA    . LEU B 2 205 ? 72.773 123.144 65.281 1.00 120.46 ? 193 LEU B CA    1 
ATOM   6046 C  C     . LEU B 2 205 ? 71.548 122.252 65.103 1.00 121.00 ? 193 LEU B C     1 
ATOM   6047 O  O     . LEU B 2 205 ? 71.090 122.003 63.987 1.00 120.51 ? 193 LEU B O     1 
ATOM   6048 C  CB    . LEU B 2 205 ? 72.338 124.503 65.855 1.00 120.07 ? 193 LEU B CB    1 
ATOM   6049 C  CG    . LEU B 2 205 ? 73.380 125.433 66.493 1.00 119.15 ? 193 LEU B CG    1 
ATOM   6050 C  CD1   . LEU B 2 205 ? 74.545 125.663 65.545 1.00 119.26 ? 193 LEU B CD1   1 
ATOM   6051 C  CD2   . LEU B 2 205 ? 72.718 126.754 66.853 1.00 118.35 ? 193 LEU B CD2   1 
ATOM   6052 N  N     . GLU B 2 206 ? 71.021 121.772 66.221 1.00 122.25 ? 194 GLU B N     1 
ATOM   6053 C  CA    . GLU B 2 206 ? 69.855 120.903 66.211 1.00 123.55 ? 194 GLU B CA    1 
ATOM   6054 C  C     . GLU B 2 206 ? 68.667 121.599 65.556 1.00 123.52 ? 194 GLU B C     1 
ATOM   6055 O  O     . GLU B 2 206 ? 68.643 122.824 65.440 1.00 123.49 ? 194 GLU B O     1 
ATOM   6056 C  CB    . GLU B 2 206 ? 69.499 120.501 67.643 1.00 124.55 ? 194 GLU B CB    1 
ATOM   6057 C  CG    . GLU B 2 206 ? 68.295 119.587 67.750 1.00 126.50 ? 194 GLU B CG    1 
ATOM   6058 C  CD    . GLU B 2 206 ? 67.230 120.143 68.672 1.00 127.99 ? 194 GLU B CD    1 
ATOM   6059 O  OE1   . GLU B 2 206 ? 67.583 120.916 69.592 1.00 128.72 ? 194 GLU B OE1   1 
ATOM   6060 O  OE2   . GLU B 2 206 ? 66.041 119.808 68.474 1.00 128.57 ? 194 GLU B OE2   1 
ATOM   6061 N  N     . ILE B 2 207 ? 67.682 120.813 65.132 1.00 123.62 ? 195 ILE B N     1 
ATOM   6062 C  CA    . ILE B 2 207 ? 66.492 121.359 64.495 1.00 123.84 ? 195 ILE B CA    1 
ATOM   6063 C  C     . ILE B 2 207 ? 65.865 122.504 65.287 1.00 124.07 ? 195 ILE B C     1 
ATOM   6064 O  O     . ILE B 2 207 ? 65.477 123.521 64.717 1.00 124.07 ? 195 ILE B O     1 
ATOM   6065 C  CB    . ILE B 2 207 ? 65.418 120.266 64.280 1.00 123.69 ? 195 ILE B CB    1 
ATOM   6066 C  CG1   . ILE B 2 207 ? 65.830 119.336 63.135 1.00 123.52 ? 195 ILE B CG1   1 
ATOM   6067 C  CG2   . ILE B 2 207 ? 64.078 120.909 63.983 1.00 124.11 ? 195 ILE B CG2   1 
ATOM   6068 C  CD1   . ILE B 2 207 ? 64.684 118.502 62.579 1.00 122.62 ? 195 ILE B CD1   1 
ATOM   6069 N  N     . GLY B 2 208 ? 65.777 122.344 66.602 1.00 124.68 ? 196 GLY B N     1 
ATOM   6070 C  CA    . GLY B 2 208 ? 64.989 123.267 67.400 1.00 125.59 ? 196 GLY B CA    1 
ATOM   6071 C  C     . GLY B 2 208 ? 65.733 124.466 67.957 1.00 126.19 ? 196 GLY B C     1 
ATOM   6072 O  O     . GLY B 2 208 ? 65.177 125.560 68.021 1.00 125.84 ? 196 GLY B O     1 
ATOM   6073 N  N     . GLN B 2 209 ? 66.981 124.269 68.371 1.00 127.33 ? 197 GLN B N     1 
ATOM   6074 C  CA    . GLN B 2 209 ? 67.767 125.357 68.949 1.00 128.81 ? 197 GLN B CA    1 
ATOM   6075 C  C     . GLN B 2 209 ? 68.397 126.202 67.846 1.00 129.50 ? 197 GLN B C     1 
ATOM   6076 O  O     . GLN B 2 209 ? 68.973 127.261 68.109 1.00 129.58 ? 197 GLN B O     1 
ATOM   6077 C  CB    . GLN B 2 209 ? 68.864 124.803 69.863 1.00 129.03 ? 197 GLN B CB    1 
ATOM   6078 C  CG    . GLN B 2 209 ? 69.936 124.013 69.136 1.00 129.33 ? 197 GLN B CG    1 
ATOM   6079 C  CD    . GLN B 2 209 ? 71.183 123.826 69.972 1.00 129.11 ? 197 GLN B CD    1 
ATOM   6080 O  OE1   . GLN B 2 209 ? 71.692 124.779 70.564 1.00 128.53 ? 197 GLN B OE1   1 
ATOM   6081 N  NE2   . GLN B 2 209 ? 71.682 122.594 70.026 1.00 129.05 ? 197 GLN B NE2   1 
ATOM   6082 N  N     . HIS B 2 210 ? 68.287 125.718 66.611 1.00 130.18 ? 198 HIS B N     1 
ATOM   6083 C  CA    . HIS B 2 210 ? 68.596 126.526 65.434 1.00 130.28 ? 198 HIS B CA    1 
ATOM   6084 C  C     . HIS B 2 210 ? 67.519 127.597 65.277 1.00 130.08 ? 198 HIS B C     1 
ATOM   6085 O  O     . HIS B 2 210 ? 67.807 128.796 65.302 1.00 129.74 ? 198 HIS B O     1 
ATOM   6086 C  CB    . HIS B 2 210 ? 68.634 125.641 64.183 1.00 130.37 ? 198 HIS B CB    1 
ATOM   6087 C  CG    . HIS B 2 210 ? 68.879 126.396 62.912 1.00 130.60 ? 198 HIS B CG    1 
ATOM   6088 N  ND1   . HIS B 2 210 ? 70.120 126.461 62.312 1.00 130.53 ? 198 HIS B ND1   1 
ATOM   6089 C  CD2   . HIS B 2 210 ? 68.044 127.115 62.129 1.00 130.75 ? 198 HIS B CD2   1 
ATOM   6090 C  CE1   . HIS B 2 210 ? 70.035 127.189 61.214 1.00 130.41 ? 198 HIS B CE1   1 
ATOM   6091 N  NE2   . HIS B 2 210 ? 68.788 127.599 61.078 1.00 130.77 ? 198 HIS B NE2   1 
ATOM   6092 N  N     . ARG B 2 211 ? 66.274 127.150 65.131 1.00 129.77 ? 199 ARG B N     1 
ATOM   6093 C  CA    . ARG B 2 211 ? 65.144 128.058 65.017 1.00 129.81 ? 199 ARG B CA    1 
ATOM   6094 C  C     . ARG B 2 211 ? 65.277 129.207 66.005 1.00 130.04 ? 199 ARG B C     1 
ATOM   6095 O  O     . ARG B 2 211 ? 65.151 130.374 65.640 1.00 130.13 ? 199 ARG B O     1 
ATOM   6096 C  CB    . ARG B 2 211 ? 63.832 127.312 65.277 1.00 129.62 ? 199 ARG B CB    1 
ATOM   6097 C  CG    . ARG B 2 211 ? 63.432 126.329 64.186 1.00 129.97 ? 199 ARG B CG    1 
ATOM   6098 C  CD    . ARG B 2 211 ? 61.922 126.118 64.166 1.00 129.69 ? 199 ARG B CD    1 
ATOM   6099 N  NE    . ARG B 2 211 ? 61.501 125.163 63.142 1.00 129.73 ? 199 ARG B NE    1 
ATOM   6100 C  CZ    . ARG B 2 211 ? 61.352 123.857 63.350 1.00 129.81 ? 199 ARG B CZ    1 
ATOM   6101 N  NH1   . ARG B 2 211 ? 61.592 123.340 64.548 1.00 129.89 ? 199 ARG B NH1   1 
ATOM   6102 N  NH2   . ARG B 2 211 ? 60.958 123.065 62.362 1.00 129.68 ? 199 ARG B NH2   1 
ATOM   6103 N  N     . THR B 2 212 ? 65.541 128.872 67.260 1.00 130.80 ? 200 THR B N     1 
ATOM   6104 C  CA    . THR B 2 212 ? 65.555 129.870 68.316 1.00 131.62 ? 200 THR B CA    1 
ATOM   6105 C  C     . THR B 2 212 ? 66.914 130.553 68.420 1.00 131.98 ? 200 THR B C     1 
ATOM   6106 O  O     . THR B 2 212 ? 67.160 131.319 69.351 1.00 131.74 ? 200 THR B O     1 
ATOM   6107 C  CB    . THR B 2 212 ? 65.201 129.243 69.677 1.00 131.70 ? 200 THR B CB    1 
ATOM   6108 O  OG1   . THR B 2 212 ? 65.088 130.276 70.662 1.00 132.04 ? 200 THR B OG1   1 
ATOM   6109 C  CG2   . THR B 2 212 ? 66.276 128.254 70.102 1.00 131.92 ? 200 THR B CG2   1 
ATOM   6110 N  N     . LYS B 2 213 ? 67.795 130.269 67.466 1.00 132.18 ? 201 LYS B N     1 
ATOM   6111 C  CA    . LYS B 2 213 ? 69.044 131.012 67.348 1.00 132.86 ? 201 LYS B CA    1 
ATOM   6112 C  C     . LYS B 2 213 ? 68.932 132.020 66.204 1.00 133.82 ? 201 LYS B C     1 
ATOM   6113 O  O     . LYS B 2 213 ? 69.559 133.082 66.236 1.00 133.93 ? 201 LYS B O     1 
ATOM   6114 C  CB    . LYS B 2 213 ? 70.218 130.059 67.102 1.00 131.82 ? 201 LYS B CB    1 
ATOM   6115 C  CG    . LYS B 2 213 ? 71.592 130.715 67.220 1.00 130.77 ? 201 LYS B CG    1 
ATOM   6116 C  CD    . LYS B 2 213 ? 71.836 131.263 68.620 1.00 129.66 ? 201 LYS B CD    1 
ATOM   6117 C  CE    . LYS B 2 213 ? 73.230 131.861 68.740 1.00 129.14 ? 201 LYS B CE    1 
ATOM   6118 N  NZ    . LYS B 2 213 ? 73.529 132.338 70.119 1.00 128.03 ? 201 LYS B NZ    1 
ATOM   6119 N  N     . ILE B 2 214 ? 68.127 131.681 65.198 1.00 134.40 ? 202 ILE B N     1 
ATOM   6120 C  CA    . ILE B 2 214 ? 67.771 132.627 64.138 1.00 135.04 ? 202 ILE B CA    1 
ATOM   6121 C  C     . ILE B 2 214 ? 66.917 133.731 64.739 1.00 135.50 ? 202 ILE B C     1 
ATOM   6122 O  O     . ILE B 2 214 ? 67.156 134.918 64.518 1.00 135.41 ? 202 ILE B O     1 
ATOM   6123 C  CB    . ILE B 2 214 ? 66.939 131.953 63.016 1.00 135.06 ? 202 ILE B CB    1 
ATOM   6124 C  CG1   . ILE B 2 214 ? 67.810 130.997 62.196 1.00 135.15 ? 202 ILE B CG1   1 
ATOM   6125 C  CG2   . ILE B 2 214 ? 66.322 133.016 62.124 1.00 134.38 ? 202 ILE B CG2   1 
ATOM   6126 C  CD1   . ILE B 2 214 ? 68.624 131.675 61.112 1.00 135.18 ? 202 ILE B CD1   1 
ATOM   6127 N  N     . GLU B 2 215 ? 65.914 133.319 65.504 1.00 135.98 ? 203 GLU B N     1 
ATOM   6128 C  CA    . GLU B 2 215 ? 65.028 134.251 66.172 1.00 136.64 ? 203 GLU B CA    1 
ATOM   6129 C  C     . GLU B 2 215 ? 65.845 135.250 66.977 1.00 136.93 ? 203 GLU B C     1 
ATOM   6130 O  O     . GLU B 2 215 ? 65.453 136.404 67.135 1.00 136.42 ? 203 GLU B O     1 
ATOM   6131 C  CB    . GLU B 2 215 ? 64.079 133.489 67.095 1.00 137.12 ? 203 GLU B CB    1 
ATOM   6132 C  CG    . GLU B 2 215 ? 63.082 134.375 67.806 1.00 138.34 ? 203 GLU B CG    1 
ATOM   6133 C  CD    . GLU B 2 215 ? 62.370 135.316 66.857 1.00 138.91 ? 203 GLU B CD    1 
ATOM   6134 O  OE1   . GLU B 2 215 ? 62.913 136.408 66.579 1.00 139.13 ? 203 GLU B OE1   1 
ATOM   6135 O  OE2   . GLU B 2 215 ? 61.269 134.960 66.390 1.00 139.12 ? 203 GLU B OE2   1 
ATOM   6136 N  N     . GLU B 2 216 ? 66.989 134.795 67.477 1.00 137.98 ? 204 GLU B N     1 
ATOM   6137 C  CA    . GLU B 2 216 ? 67.850 135.625 68.313 1.00 138.97 ? 204 GLU B CA    1 
ATOM   6138 C  C     . GLU B 2 216 ? 68.733 136.539 67.470 1.00 139.25 ? 204 GLU B C     1 
ATOM   6139 O  O     . GLU B 2 216 ? 69.409 137.425 67.992 1.00 138.88 ? 204 GLU B O     1 
ATOM   6140 C  CB    . GLU B 2 216 ? 68.717 134.742 69.223 1.00 139.50 ? 204 GLU B CB    1 
ATOM   6141 C  CG    . GLU B 2 216 ? 67.914 133.928 70.248 1.00 139.60 ? 204 GLU B CG    1 
ATOM   6142 C  CD    . GLU B 2 216 ? 68.743 133.460 71.437 1.00 139.13 ? 204 GLU B CD    1 
ATOM   6143 O  OE1   . GLU B 2 216 ? 69.370 132.382 71.343 1.00 138.71 ? 204 GLU B OE1   1 
ATOM   6144 O  OE2   . GLU B 2 216 ? 68.764 134.171 72.466 1.00 138.43 ? 204 GLU B OE2   1 
ATOM   6145 N  N     . LEU B 2 217 ? 68.724 136.319 66.161 1.00 140.10 ? 205 LEU B N     1 
ATOM   6146 C  CA    . LEU B 2 217 ? 69.383 137.238 65.246 1.00 140.87 ? 205 LEU B CA    1 
ATOM   6147 C  C     . LEU B 2 217 ? 68.418 138.356 64.866 1.00 141.41 ? 205 LEU B C     1 
ATOM   6148 O  O     . LEU B 2 217 ? 68.836 139.484 64.604 1.00 141.54 ? 205 LEU B O     1 
ATOM   6149 C  CB    . LEU B 2 217 ? 69.862 136.495 63.993 1.00 140.42 ? 205 LEU B CB    1 
ATOM   6150 C  CG    . LEU B 2 217 ? 70.614 137.321 62.943 1.00 139.77 ? 205 LEU B CG    1 
ATOM   6151 C  CD1   . LEU B 2 217 ? 71.604 138.248 63.622 1.00 139.92 ? 205 LEU B CD1   1 
ATOM   6152 C  CD2   . LEU B 2 217 ? 71.329 136.391 61.974 1.00 139.80 ? 205 LEU B CD2   1 
ATOM   6153 N  N     . ARG B 2 218 ? 67.124 138.046 64.851 1.00 142.15 ? 206 ARG B N     1 
ATOM   6154 C  CA    . ARG B 2 218 ? 66.110 139.072 64.635 1.00 142.99 ? 206 ARG B CA    1 
ATOM   6155 C  C     . ARG B 2 218 ? 66.272 140.173 65.671 1.00 143.22 ? 206 ARG B C     1 
ATOM   6156 O  O     . ARG B 2 218 ? 65.957 141.330 65.412 1.00 143.20 ? 206 ARG B O     1 
ATOM   6157 C  CB    . ARG B 2 218 ? 64.699 138.483 64.745 1.00 143.52 ? 206 ARG B CB    1 
ATOM   6158 C  CG    . ARG B 2 218 ? 64.334 137.515 63.638 1.00 144.20 ? 206 ARG B CG    1 
ATOM   6159 C  CD    . ARG B 2 218 ? 62.887 137.057 63.757 1.00 145.48 ? 206 ARG B CD    1 
ATOM   6160 N  NE    . ARG B 2 218 ? 61.961 137.899 63.001 1.00 146.99 ? 206 ARG B NE    1 
ATOM   6161 C  CZ    . ARG B 2 218 ? 60.960 138.592 63.538 1.00 147.56 ? 206 ARG B CZ    1 
ATOM   6162 N  NH1   . ARG B 2 218 ? 60.745 138.556 64.848 1.00 147.51 ? 206 ARG B NH1   1 
ATOM   6163 N  NH2   . ARG B 2 218 ? 60.162 139.314 62.762 1.00 147.88 ? 206 ARG B NH2   1 
ATOM   6164 N  N     . GLN B 2 219 ? 66.765 139.807 66.849 1.00 143.55 ? 207 GLN B N     1 
ATOM   6165 C  CA    . GLN B 2 219 ? 66.922 140.767 67.928 1.00 143.80 ? 207 GLN B CA    1 
ATOM   6166 C  C     . GLN B 2 219 ? 68.233 141.524 67.826 1.00 143.67 ? 207 GLN B C     1 
ATOM   6167 O  O     . GLN B 2 219 ? 68.270 142.733 68.050 1.00 143.60 ? 207 GLN B O     1 
ATOM   6168 C  CB    . GLN B 2 219 ? 66.823 140.067 69.282 1.00 144.50 ? 207 GLN B CB    1 
ATOM   6169 C  CG    . GLN B 2 219 ? 65.404 139.668 69.642 1.00 145.36 ? 207 GLN B CG    1 
ATOM   6170 C  CD    . GLN B 2 219 ? 64.391 140.734 69.255 1.00 145.58 ? 207 GLN B CD    1 
ATOM   6171 O  OE1   . GLN B 2 219 ? 63.489 140.486 68.452 1.00 145.87 ? 207 GLN B OE1   1 
ATOM   6172 N  NE2   . GLN B 2 219 ? 64.538 141.927 69.824 1.00 145.43 ? 207 GLN B NE2   1 
ATOM   6173 N  N     . HIS B 2 220 ? 69.308 140.825 67.480 1.00 143.42 ? 208 HIS B N     1 
ATOM   6174 C  CA    . HIS B 2 220 ? 70.552 141.512 67.166 1.00 143.31 ? 208 HIS B CA    1 
ATOM   6175 C  C     . HIS B 2 220 ? 70.297 142.341 65.917 1.00 142.89 ? 208 HIS B C     1 
ATOM   6176 O  O     . HIS B 2 220 ? 71.134 143.134 65.497 1.00 142.63 ? 208 HIS B O     1 
ATOM   6177 C  CB    . HIS B 2 220 ? 71.684 140.515 66.909 1.00 143.83 ? 208 HIS B CB    1 
ATOM   6178 C  CG    . HIS B 2 220 ? 73.046 141.141 66.905 1.00 144.59 ? 208 HIS B CG    1 
ATOM   6179 N  ND1   . HIS B 2 220 ? 73.475 141.985 65.903 1.00 144.84 ? 208 HIS B ND1   1 
ATOM   6180 C  CD2   . HIS B 2 220 ? 74.068 141.057 67.789 1.00 144.71 ? 208 HIS B CD2   1 
ATOM   6181 C  CE1   . HIS B 2 220 ? 74.702 142.395 66.171 1.00 145.07 ? 208 HIS B CE1   1 
ATOM   6182 N  NE2   . HIS B 2 220 ? 75.085 141.846 67.311 1.00 145.01 ? 208 HIS B NE2   1 
ATOM   6183 N  N     . LEU B 2 221 ? 69.123 142.138 65.328 1.00 142.71 ? 209 LEU B N     1 
ATOM   6184 C  CA    . LEU B 2 221 ? 68.658 142.960 64.221 1.00 142.60 ? 209 LEU B CA    1 
ATOM   6185 C  C     . LEU B 2 221 ? 67.738 144.063 64.723 1.00 142.75 ? 209 LEU B C     1 
ATOM   6186 O  O     . LEU B 2 221 ? 68.121 145.230 64.754 1.00 142.75 ? 209 LEU B O     1 
ATOM   6187 C  CB    . LEU B 2 221 ? 67.899 142.107 63.206 1.00 142.25 ? 209 LEU B CB    1 
ATOM   6188 C  CG    . LEU B 2 221 ? 67.005 142.910 62.259 1.00 141.93 ? 209 LEU B CG    1 
ATOM   6189 C  CD1   . LEU B 2 221 ? 67.873 143.796 61.385 1.00 141.83 ? 209 LEU B CD1   1 
ATOM   6190 C  CD2   . LEU B 2 221 ? 66.159 141.975 61.412 1.00 141.62 ? 209 LEU B CD2   1 
ATOM   6191 N  N     . LEU B 2 222 ? 66.528 143.674 65.122 1.00 142.77 ? 210 LEU B N     1 
ATOM   6192 C  CA    . LEU B 2 222 ? 65.452 144.611 65.441 1.00 142.58 ? 210 LEU B CA    1 
ATOM   6193 C  C     . LEU B 2 222 ? 65.910 145.806 66.269 1.00 142.74 ? 210 LEU B C     1 
ATOM   6194 O  O     . LEU B 2 222 ? 65.342 146.895 66.165 1.00 143.07 ? 210 LEU B O     1 
ATOM   6195 C  CB    . LEU B 2 222 ? 64.318 143.884 66.173 1.00 142.13 ? 210 LEU B CB    1 
ATOM   6196 C  CG    . LEU B 2 222 ? 63.178 143.319 65.319 1.00 141.91 ? 210 LEU B CG    1 
ATOM   6197 C  CD1   . LEU B 2 222 ? 63.744 142.546 64.146 1.00 142.40 ? 210 LEU B CD1   1 
ATOM   6198 C  CD2   . LEU B 2 222 ? 62.288 142.428 66.171 1.00 142.08 ? 210 LEU B CD2   1 
ATOM   6199 N  N     . ARG B 2 223 ? 66.934 145.606 67.091 1.00 142.59 ? 211 ARG B N     1 
ATOM   6200 C  CA    . ARG B 2 223 ? 67.492 146.702 67.872 1.00 142.29 ? 211 ARG B CA    1 
ATOM   6201 C  C     . ARG B 2 223 ? 68.065 147.766 66.939 1.00 141.28 ? 211 ARG B C     1 
ATOM   6202 O  O     . ARG B 2 223 ? 68.060 148.955 67.255 1.00 141.54 ? 211 ARG B O     1 
ATOM   6203 C  CB    . ARG B 2 223 ? 68.577 146.177 68.815 1.00 143.37 ? 211 ARG B CB    1 
ATOM   6204 C  CG    . ARG B 2 223 ? 68.040 145.379 70.002 1.00 144.13 ? 211 ARG B CG    1 
ATOM   6205 C  CD    . ARG B 2 223 ? 69.173 144.670 70.722 1.00 144.91 ? 211 ARG B CD    1 
ATOM   6206 N  NE    . ARG B 2 223 ? 70.429 145.403 70.576 1.00 145.56 ? 211 ARG B NE    1 
ATOM   6207 C  CZ    . ARG B 2 223 ? 71.621 144.920 70.909 1.00 145.52 ? 211 ARG B CZ    1 
ATOM   6208 N  NH1   . ARG B 2 223 ? 71.721 143.696 71.411 1.00 145.67 ? 211 ARG B NH1   1 
ATOM   6209 N  NH2   . ARG B 2 223 ? 72.710 145.659 70.735 1.00 145.14 ? 211 ARG B NH2   1 
ATOM   6210 N  N     . TRP B 2 224 ? 68.557 147.330 65.787 1.00 139.67 ? 212 TRP B N     1 
ATOM   6211 C  CA    . TRP B 2 224 ? 68.781 148.234 64.670 1.00 138.53 ? 212 TRP B CA    1 
ATOM   6212 C  C     . TRP B 2 224 ? 67.466 148.394 63.899 1.00 137.83 ? 212 TRP B C     1 
ATOM   6213 O  O     . TRP B 2 224 ? 66.789 149.421 64.002 1.00 137.51 ? 212 TRP B O     1 
ATOM   6214 C  CB    . TRP B 2 224 ? 69.853 147.667 63.737 1.00 138.64 ? 212 TRP B CB    1 
ATOM   6215 C  CG    . TRP B 2 224 ? 71.272 147.934 64.152 1.00 138.24 ? 212 TRP B CG    1 
ATOM   6216 C  CD1   . TRP B 2 224 ? 72.049 148.990 63.772 1.00 137.97 ? 212 TRP B CD1   1 
ATOM   6217 C  CD2   . TRP B 2 224 ? 72.101 147.104 64.975 1.00 138.61 ? 212 TRP B CD2   1 
ATOM   6218 N  NE1   . TRP B 2 224 ? 73.310 148.868 64.304 1.00 138.03 ? 212 TRP B NE1   1 
ATOM   6219 C  CE2   . TRP B 2 224 ? 73.368 147.718 65.047 1.00 138.56 ? 212 TRP B CE2   1 
ATOM   6220 C  CE3   . TRP B 2 224 ? 71.896 145.900 65.658 1.00 138.91 ? 212 TRP B CE3   1 
ATOM   6221 C  CZ2   . TRP B 2 224 ? 74.427 147.170 65.775 1.00 138.77 ? 212 TRP B CZ2   1 
ATOM   6222 C  CZ3   . TRP B 2 224 ? 72.949 145.356 66.381 1.00 139.03 ? 212 TRP B CZ3   1 
ATOM   6223 C  CH2   . TRP B 2 224 ? 74.197 145.991 66.432 1.00 138.74 ? 212 TRP B CH2   1 
ATOM   6224 N  N     . GLY B 2 225 ? 67.110 147.361 63.138 1.00 137.13 ? 213 GLY B N     1 
ATOM   6225 C  CA    . GLY B 2 225 ? 65.907 147.392 62.319 1.00 135.80 ? 213 GLY B CA    1 
ATOM   6226 C  C     . GLY B 2 225 ? 66.093 146.720 60.964 1.00 134.77 ? 213 GLY B C     1 
ATOM   6227 O  O     . GLY B 2 225 ? 67.210 146.647 60.447 1.00 134.19 ? 213 GLY B O     1 
ATOM   6228 N  N     . LEU B 2 226 ? 65.003 146.232 60.375 1.00 133.72 ? 214 LEU B N     1 
ATOM   6229 C  CA    . LEU B 2 226 ? 63.666 146.353 60.949 1.00 132.52 ? 214 LEU B CA    1 
ATOM   6230 C  C     . LEU B 2 226 ? 62.824 145.174 60.468 1.00 132.16 ? 214 LEU B C     1 
ATOM   6231 O  O     . LEU B 2 226 ? 62.464 144.312 61.296 1.00 131.95 ? 214 LEU B O     1 
ATOM   6232 C  CB    . LEU B 2 226 ? 63.026 147.679 60.507 1.00 131.77 ? 214 LEU B CB    1 
ATOM   6233 C  CG    . LEU B 2 226 ? 61.621 148.079 60.973 1.00 130.94 ? 214 LEU B CG    1 
ATOM   6234 C  CD1   . LEU B 2 226 ? 61.432 149.573 60.784 1.00 129.80 ? 214 LEU B CD1   1 
ATOM   6235 C  CD2   . LEU B 2 226 ? 60.572 147.309 60.191 1.00 130.90 ? 214 LEU B CD2   1 
ATOM   6236 N  N     . TYR B 2 244 ? 61.337 130.709 55.645 1.00 139.41 ? 232 TYR B N     1 
ATOM   6237 C  CA    . TYR B 2 244 ? 60.818 129.316 55.782 1.00 139.85 ? 232 TYR B CA    1 
ATOM   6238 C  C     . TYR B 2 244 ? 61.957 128.303 55.877 1.00 139.31 ? 232 TYR B C     1 
ATOM   6239 O  O     . TYR B 2 244 ? 63.131 128.667 55.775 1.00 139.23 ? 232 TYR B O     1 
ATOM   6240 C  CB    . TYR B 2 244 ? 59.911 128.970 54.596 1.00 140.73 ? 232 TYR B CB    1 
ATOM   6241 C  CG    . TYR B 2 244 ? 58.455 128.783 54.973 1.00 141.76 ? 232 TYR B CG    1 
ATOM   6242 C  CD1   . TYR B 2 244 ? 57.445 128.958 54.037 1.00 142.15 ? 232 TYR B CD1   1 
ATOM   6243 C  CD2   . TYR B 2 244 ? 58.093 128.430 56.268 1.00 142.31 ? 232 TYR B CD2   1 
ATOM   6244 C  CE1   . TYR B 2 244 ? 56.112 128.786 54.382 1.00 142.93 ? 232 TYR B CE1   1 
ATOM   6245 C  CE2   . TYR B 2 244 ? 56.763 128.257 56.622 1.00 142.52 ? 232 TYR B CE2   1 
ATOM   6246 C  CZ    . TYR B 2 244 ? 55.777 128.436 55.676 1.00 142.68 ? 232 TYR B CZ    1 
ATOM   6247 O  OH    . TYR B 2 244 ? 54.456 128.270 56.031 1.00 142.55 ? 232 TYR B OH    1 
ATOM   6248 N  N     . GLU B 2 245 ? 61.604 127.035 56.079 1.00 138.39 ? 233 GLU B N     1 
ATOM   6249 C  CA    . GLU B 2 245 ? 62.593 125.980 56.285 1.00 137.80 ? 233 GLU B CA    1 
ATOM   6250 C  C     . GLU B 2 245 ? 63.360 125.726 54.995 1.00 137.03 ? 233 GLU B C     1 
ATOM   6251 O  O     . GLU B 2 245 ? 62.874 126.053 53.913 1.00 137.69 ? 233 GLU B O     1 
ATOM   6252 C  CB    . GLU B 2 245 ? 61.909 124.682 56.717 1.00 138.45 ? 233 GLU B CB    1 
ATOM   6253 C  CG    . GLU B 2 245 ? 61.190 123.961 55.585 1.00 140.04 ? 233 GLU B CG    1 
ATOM   6254 C  CD    . GLU B 2 245 ? 60.884 122.507 55.909 1.00 141.33 ? 233 GLU B CD    1 
ATOM   6255 O  OE1   . GLU B 2 245 ? 61.829 121.749 56.227 1.00 141.82 ? 233 GLU B OE1   1 
ATOM   6256 O  OE2   . GLU B 2 245 ? 59.695 122.122 55.843 1.00 141.67 ? 233 GLU B OE2   1 
ATOM   6257 N  N     . LEU B 2 246 ? 64.553 125.143 55.111 1.00 135.42 ? 234 LEU B N     1 
ATOM   6258 C  CA    . LEU B 2 246 ? 65.329 124.722 53.941 1.00 133.22 ? 234 LEU B CA    1 
ATOM   6259 C  C     . LEU B 2 246 ? 66.645 124.060 54.342 1.00 132.13 ? 234 LEU B C     1 
ATOM   6260 O  O     . LEU B 2 246 ? 67.554 124.729 54.831 1.00 132.06 ? 234 LEU B O     1 
ATOM   6261 C  CB    . LEU B 2 246 ? 65.631 125.923 53.044 1.00 132.24 ? 234 LEU B CB    1 
ATOM   6262 C  CG    . LEU B 2 246 ? 66.308 125.588 51.719 1.00 131.03 ? 234 LEU B CG    1 
ATOM   6263 C  CD1   . LEU B 2 246 ? 65.390 124.704 50.891 1.00 131.08 ? 234 LEU B CD1   1 
ATOM   6264 C  CD2   . LEU B 2 246 ? 66.636 126.866 50.980 1.00 130.16 ? 234 LEU B CD2   1 
ATOM   6265 N  N     . HIS B 2 247 ? 66.750 122.751 54.124 1.00 130.83 ? 235 HIS B N     1 
ATOM   6266 C  CA    . HIS B 2 247 ? 67.952 122.019 54.511 1.00 129.53 ? 235 HIS B CA    1 
ATOM   6267 C  C     . HIS B 2 247 ? 68.793 121.622 53.308 1.00 129.06 ? 235 HIS B C     1 
ATOM   6268 O  O     . HIS B 2 247 ? 68.389 120.800 52.484 1.00 128.13 ? 235 HIS B O     1 
ATOM   6269 C  CB    . HIS B 2 247 ? 67.579 120.787 55.338 1.00 128.36 ? 235 HIS B CB    1 
ATOM   6270 C  CG    . HIS B 2 247 ? 66.994 121.123 56.673 1.00 127.05 ? 235 HIS B CG    1 
ATOM   6271 N  ND1   . HIS B 2 247 ? 65.639 121.086 56.924 1.00 126.83 ? 235 HIS B ND1   1 
ATOM   6272 C  CD2   . HIS B 2 247 ? 67.576 121.551 57.818 1.00 126.55 ? 235 HIS B CD2   1 
ATOM   6273 C  CE1   . HIS B 2 247 ? 65.411 121.480 58.163 1.00 126.59 ? 235 HIS B CE1   1 
ATOM   6274 N  NE2   . HIS B 2 247 ? 66.570 121.768 58.727 1.00 126.61 ? 235 HIS B NE2   1 
ATOM   6275 N  N     . PRO B 2 248 ? 69.991 122.213 53.207 1.00 129.06 ? 236 PRO B N     1 
ATOM   6276 C  CA    . PRO B 2 248 ? 70.859 122.240 52.025 1.00 129.13 ? 236 PRO B CA    1 
ATOM   6277 C  C     . PRO B 2 248 ? 71.473 120.905 51.617 1.00 128.94 ? 236 PRO B C     1 
ATOM   6278 O  O     . PRO B 2 248 ? 71.289 120.454 50.487 1.00 129.36 ? 236 PRO B O     1 
ATOM   6279 C  CB    . PRO B 2 248 ? 71.929 123.272 52.387 1.00 129.17 ? 236 PRO B CB    1 
ATOM   6280 C  CG    . PRO B 2 248 ? 71.967 123.268 53.871 1.00 129.43 ? 236 PRO B CG    1 
ATOM   6281 C  CD    . PRO B 2 248 ? 70.560 122.989 54.324 1.00 129.12 ? 236 PRO B CD    1 
ATOM   6282 N  N     . ASP B 2 249 ? 72.209 120.276 52.528 1.00 128.29 ? 237 ASP B N     1 
ATOM   6283 C  CA    . ASP B 2 249 ? 72.998 119.105 52.170 1.00 127.31 ? 237 ASP B CA    1 
ATOM   6284 C  C     . ASP B 2 249 ? 72.111 117.890 51.901 1.00 126.31 ? 237 ASP B C     1 
ATOM   6285 O  O     . ASP B 2 249 ? 72.512 116.753 52.142 1.00 126.07 ? 237 ASP B O     1 
ATOM   6286 C  CB    . ASP B 2 249 ? 74.002 118.787 53.282 1.00 127.82 ? 237 ASP B CB    1 
ATOM   6287 C  CG    . ASP B 2 249 ? 75.379 118.430 52.741 1.00 128.16 ? 237 ASP B CG    1 
ATOM   6288 O  OD1   . ASP B 2 249 ? 76.270 118.091 53.550 1.00 127.82 ? 237 ASP B OD1   1 
ATOM   6289 O  OD2   . ASP B 2 249 ? 75.569 118.493 51.505 1.00 128.05 ? 237 ASP B OD2   1 
ATOM   6290 N  N     . LYS B 2 250 ? 70.906 118.142 51.395 1.00 125.14 ? 238 LYS B N     1 
ATOM   6291 C  CA    . LYS B 2 250 ? 69.962 117.078 51.068 1.00 123.32 ? 238 LYS B CA    1 
ATOM   6292 C  C     . LYS B 2 250 ? 69.090 117.428 49.854 1.00 122.70 ? 238 LYS B C     1 
ATOM   6293 O  O     . LYS B 2 250 ? 67.893 117.147 49.845 1.00 122.13 ? 238 LYS B O     1 
ATOM   6294 C  CB    . LYS B 2 250 ? 69.083 116.781 52.289 1.00 122.31 ? 238 LYS B CB    1 
ATOM   6295 C  CG    . LYS B 2 250 ? 69.883 116.409 53.538 1.00 120.88 ? 238 LYS B CG    1 
ATOM   6296 C  CD    . LYS B 2 250 ? 69.035 116.416 54.804 1.00 120.25 ? 238 LYS B CD    1 
ATOM   6297 C  CE    . LYS B 2 250 ? 68.262 115.114 54.982 1.00 119.41 ? 238 LYS B CE    1 
ATOM   6298 N  NZ    . LYS B 2 250 ? 67.631 115.012 56.329 1.00 118.07 ? 238 LYS B NZ    1 
ATOM   6299 N  N     . TRP B 2 251 ? 69.700 118.047 48.839 1.00 122.47 ? 239 TRP B N     1 
ATOM   6300 C  CA    . TRP B 2 251 ? 69.050 118.309 47.544 1.00 121.88 ? 239 TRP B CA    1 
ATOM   6301 C  C     . TRP B 2 251 ? 69.425 117.228 46.535 1.00 121.11 ? 239 TRP B C     1 
ATOM   6302 O  O     . TRP B 2 251 ? 69.517 117.504 45.334 1.00 120.94 ? 239 TRP B O     1 
ATOM   6303 C  CB    . TRP B 2 251 ? 69.499 119.652 46.953 1.00 122.55 ? 239 TRP B CB    1 
ATOM   6304 C  CG    . TRP B 2 251 ? 69.137 120.867 47.747 1.00 123.51 ? 239 TRP B CG    1 
ATOM   6305 C  CD1   . TRP B 2 251 ? 67.921 121.163 48.296 1.00 123.97 ? 239 TRP B CD1   1 
ATOM   6306 C  CD2   . TRP B 2 251 ? 69.995 121.972 48.053 1.00 123.45 ? 239 TRP B CD2   1 
ATOM   6307 N  NE1   . TRP B 2 251 ? 67.971 122.386 48.925 1.00 123.88 ? 239 TRP B NE1   1 
ATOM   6308 C  CE2   . TRP B 2 251 ? 69.236 122.902 48.790 1.00 123.55 ? 239 TRP B CE2   1 
ATOM   6309 C  CE3   . TRP B 2 251 ? 71.335 122.267 47.776 1.00 123.25 ? 239 TRP B CE3   1 
ATOM   6310 C  CZ2   . TRP B 2 251 ? 69.769 124.104 49.252 1.00 123.47 ? 239 TRP B CZ2   1 
ATOM   6311 C  CZ3   . TRP B 2 251 ? 71.863 123.459 48.235 1.00 123.04 ? 239 TRP B CZ3   1 
ATOM   6312 C  CH2   . TRP B 2 251 ? 71.082 124.363 48.965 1.00 123.36 ? 239 TRP B CH2   1 
ATOM   6313 N  N     . THR B 2 252 ? 69.635 116.011 47.035 1.00 119.91 ? 240 THR B N     1 
ATOM   6314 C  CA    . THR B 2 252 ? 70.378 114.958 46.338 1.00 118.10 ? 240 THR B CA    1 
ATOM   6315 C  C     . THR B 2 252 ? 70.442 115.069 44.809 1.00 117.05 ? 240 THR B C     1 
ATOM   6316 O  O     . THR B 2 252 ? 69.441 115.343 44.138 1.00 117.35 ? 240 THR B O     1 
ATOM   6317 C  CB    . THR B 2 252 ? 69.828 113.556 46.724 1.00 117.78 ? 240 THR B CB    1 
ATOM   6318 O  OG1   . THR B 2 252 ? 70.617 112.536 46.099 1.00 117.27 ? 240 THR B OG1   1 
ATOM   6319 C  CG2   . THR B 2 252 ? 68.376 113.410 46.291 1.00 117.65 ? 240 THR B CG2   1 
ATOM   6320 N  N     . VAL B 2 253 ? 71.637 114.858 44.267 1.00 114.88 ? 241 VAL B N     1 
ATOM   6321 C  CA    . VAL B 2 253 ? 71.825 114.805 42.826 1.00 112.58 ? 241 VAL B CA    1 
ATOM   6322 C  C     . VAL B 2 253 ? 70.940 113.682 42.281 1.00 111.61 ? 241 VAL B C     1 
ATOM   6323 O  O     . VAL B 2 253 ? 70.734 112.671 42.950 1.00 111.12 ? 241 VAL B O     1 
ATOM   6324 C  CB    . VAL B 2 253 ? 73.302 114.503 42.477 1.00 112.05 ? 241 VAL B CB    1 
ATOM   6325 C  CG1   . VAL B 2 253 ? 73.541 114.716 40.999 1.00 110.85 ? 241 VAL B CG1   1 
ATOM   6326 C  CG2   . VAL B 2 253 ? 74.226 115.379 43.305 1.00 111.45 ? 241 VAL B CG2   1 
ATOM   6327 N  N     . GLN B 2 254 ? 70.408 113.862 41.076 1.00 110.48 ? 242 GLN B N     1 
ATOM   6328 C  CA    . GLN B 2 254 ? 69.616 112.817 40.425 1.00 109.14 ? 242 GLN B CA    1 
ATOM   6329 C  C     . GLN B 2 254 ? 70.396 112.193 39.273 1.00 107.69 ? 242 GLN B C     1 
ATOM   6330 O  O     . GLN B 2 254 ? 70.840 112.899 38.367 1.00 107.30 ? 242 GLN B O     1 
ATOM   6331 C  CB    . GLN B 2 254 ? 68.301 113.401 39.897 1.00 110.02 ? 242 GLN B CB    1 
ATOM   6332 C  CG    . GLN B 2 254 ? 67.673 112.616 38.742 1.00 110.50 ? 242 GLN B CG    1 
ATOM   6333 C  CD    . GLN B 2 254 ? 66.904 111.387 39.199 1.00 111.05 ? 242 GLN B CD    1 
ATOM   6334 O  OE1   . GLN B 2 254 ? 66.255 110.712 38.394 1.00 110.24 ? 242 GLN B OE1   1 
ATOM   6335 N  NE2   . GLN B 2 254 ? 66.971 111.091 40.495 1.00 111.15 ? 242 GLN B NE2   1 
ATOM   6336 N  N     . PRO B 2 255 ? 70.574 110.858 39.300 1.00 106.35 ? 243 PRO B N     1 
ATOM   6337 C  CA    . PRO B 2 255 ? 71.374 110.112 38.316 1.00 105.17 ? 243 PRO B CA    1 
ATOM   6338 C  C     . PRO B 2 255 ? 70.697 109.950 36.955 1.00 103.97 ? 243 PRO B C     1 
ATOM   6339 O  O     . PRO B 2 255 ? 69.483 110.109 36.834 1.00 103.49 ? 243 PRO B O     1 
ATOM   6340 C  CB    . PRO B 2 255 ? 71.614 108.757 38.993 1.00 105.32 ? 243 PRO B CB    1 
ATOM   6341 C  CG    . PRO B 2 255 ? 71.260 108.969 40.440 1.00 105.91 ? 243 PRO B CG    1 
ATOM   6342 C  CD    . PRO B 2 255 ? 70.170 109.995 40.420 1.00 106.03 ? 243 PRO B CD    1 
ATOM   6343 N  N     . ILE B 2 256 ? 71.492 109.629 35.938 1.00 102.83 ? 244 ILE B N     1 
ATOM   6344 C  CA    . ILE B 2 256 ? 70.962 109.274 34.625 1.00 101.49 ? 244 ILE B CA    1 
ATOM   6345 C  C     . ILE B 2 256 ? 70.866 107.756 34.517 1.00 101.08 ? 244 ILE B C     1 
ATOM   6346 O  O     . ILE B 2 256 ? 71.852 107.050 34.723 1.00 100.40 ? 244 ILE B O     1 
ATOM   6347 C  CB    . ILE B 2 256 ? 71.871 109.781 33.502 1.00 101.16 ? 244 ILE B CB    1 
ATOM   6348 C  CG1   . ILE B 2 256 ? 72.121 111.285 33.668 1.00 101.61 ? 244 ILE B CG1   1 
ATOM   6349 C  CG2   . ILE B 2 256 ? 71.232 109.488 32.158 1.00 100.70 ? 244 ILE B CG2   1 
ATOM   6350 C  CD1   . ILE B 2 256 ? 73.122 111.644 34.764 1.00 100.54 ? 244 ILE B CD1   1 
ATOM   6351 N  N     . VAL B 2 257 ? 69.678 107.258 34.184 1.00 100.98 ? 245 VAL B N     1 
ATOM   6352 C  CA    . VAL B 2 257 ? 69.329 105.861 34.449 1.00 100.81 ? 245 VAL B CA    1 
ATOM   6353 C  C     . VAL B 2 257 ? 68.973 105.035 33.201 1.00 100.16 ? 245 VAL B C     1 
ATOM   6354 O  O     . VAL B 2 257 ? 68.481 105.574 32.210 1.00 100.46 ? 245 VAL B O     1 
ATOM   6355 C  CB    . VAL B 2 257 ? 68.154 105.795 35.459 1.00 101.40 ? 245 VAL B CB    1 
ATOM   6356 C  CG1   . VAL B 2 257 ? 66.936 106.512 34.891 1.00 101.33 ? 245 VAL B CG1   1 
ATOM   6357 C  CG2   . VAL B 2 257 ? 67.831 104.350 35.797 1.00 102.09 ? 245 VAL B CG2   1 
ATOM   6358 N  N     . LEU B 2 258 ? 69.235 103.726 33.257 1.00 99.31  ? 246 LEU B N     1 
ATOM   6359 C  CA    . LEU B 2 258 ? 68.901 102.800 32.168 1.00 98.16  ? 246 LEU B CA    1 
ATOM   6360 C  C     . LEU B 2 258 ? 67.880 101.761 32.621 1.00 98.06  ? 246 LEU B C     1 
ATOM   6361 O  O     . LEU B 2 258 ? 68.010 101.176 33.697 1.00 99.25  ? 246 LEU B O     1 
ATOM   6362 C  CB    . LEU B 2 258 ? 70.151 102.064 31.679 1.00 96.74  ? 246 LEU B CB    1 
ATOM   6363 C  CG    . LEU B 2 258 ? 71.275 102.887 31.060 1.00 95.11  ? 246 LEU B CG    1 
ATOM   6364 C  CD1   . LEU B 2 258 ? 72.388 101.966 30.614 1.00 93.94  ? 246 LEU B CD1   1 
ATOM   6365 C  CD2   . LEU B 2 258 ? 70.737 103.678 29.891 1.00 94.55  ? 246 LEU B CD2   1 
ATOM   6366 N  N     . PRO B 2 259 ? 66.852 101.507 31.799 1.00 97.64  ? 247 PRO B N     1 
ATOM   6367 C  CA    . PRO B 2 259 ? 65.844 100.504 32.162 1.00 97.04  ? 247 PRO B CA    1 
ATOM   6368 C  C     . PRO B 2 259 ? 66.427 99.105  32.060 1.00 96.48  ? 247 PRO B C     1 
ATOM   6369 O  O     . PRO B 2 259 ? 66.878 98.705  30.992 1.00 96.90  ? 247 PRO B O     1 
ATOM   6370 C  CB    . PRO B 2 259 ? 64.740 100.720 31.134 1.00 96.69  ? 247 PRO B CB    1 
ATOM   6371 C  CG    . PRO B 2 259 ? 65.464 101.244 29.931 1.00 96.51  ? 247 PRO B CG    1 
ATOM   6372 C  CD    . PRO B 2 259 ? 66.599 102.086 30.466 1.00 97.31  ? 247 PRO B CD    1 
ATOM   6373 N  N     . GLU B 2 260 ? 66.425 98.357  33.155 1.00 95.55  ? 248 GLU B N     1 
ATOM   6374 C  CA    . GLU B 2 260 ? 66.750 96.942  33.051 1.00 95.36  ? 248 GLU B CA    1 
ATOM   6375 C  C     . GLU B 2 260 ? 65.480 96.151  32.755 1.00 94.20  ? 248 GLU B C     1 
ATOM   6376 O  O     . GLU B 2 260 ? 64.408 96.458  33.284 1.00 94.23  ? 248 GLU B O     1 
ATOM   6377 C  CB    . GLU B 2 260 ? 67.388 96.431  34.341 1.00 97.12  ? 248 GLU B CB    1 
ATOM   6378 C  CG    . GLU B 2 260 ? 66.481 96.502  35.551 1.00 98.93  ? 248 GLU B CG    1 
ATOM   6379 C  CD    . GLU B 2 260 ? 66.975 97.494  36.585 1.00 100.15 ? 248 GLU B CD    1 
ATOM   6380 O  OE1   . GLU B 2 260 ? 67.248 97.062  37.727 1.00 100.43 ? 248 GLU B OE1   1 
ATOM   6381 O  OE2   . GLU B 2 260 ? 67.092 98.699  36.255 1.00 100.74 ? 248 GLU B OE2   1 
ATOM   6382 N  N     . LYS B 2 261 ? 65.606 95.147  31.891 1.00 92.18  ? 249 LYS B N     1 
ATOM   6383 C  CA    . LYS B 2 261 ? 64.484 94.281  31.528 1.00 89.41  ? 249 LYS B CA    1 
ATOM   6384 C  C     . LYS B 2 261 ? 64.987 92.848  31.410 1.00 88.27  ? 249 LYS B C     1 
ATOM   6385 O  O     . LYS B 2 261 ? 66.150 92.619  31.062 1.00 87.90  ? 249 LYS B O     1 
ATOM   6386 C  CB    . LYS B 2 261 ? 63.881 94.704  30.184 1.00 88.22  ? 249 LYS B CB    1 
ATOM   6387 C  CG    . LYS B 2 261 ? 63.464 96.155  30.081 1.00 86.39  ? 249 LYS B CG    1 
ATOM   6388 C  CD    . LYS B 2 261 ? 63.068 96.489  28.652 1.00 85.78  ? 249 LYS B CD    1 
ATOM   6389 C  CE    . LYS B 2 261 ? 62.697 97.961  28.489 1.00 85.69  ? 249 LYS B CE    1 
ATOM   6390 N  NZ    . LYS B 2 261 ? 61.414 98.343  29.151 1.00 83.46  ? 249 LYS B NZ    1 
ATOM   6391 N  N     . ASP B 2 262 ? 64.114 91.884  31.691 1.00 86.69  ? 250 ASP B N     1 
ATOM   6392 C  CA    . ASP B 2 262 ? 64.474 90.482  31.512 1.00 84.89  ? 250 ASP B CA    1 
ATOM   6393 C  C     . ASP B 2 262 ? 64.389 90.123  30.029 1.00 82.45  ? 250 ASP B C     1 
ATOM   6394 O  O     . ASP B 2 262 ? 65.129 89.267  29.547 1.00 82.12  ? 250 ASP B O     1 
ATOM   6395 C  CB    . ASP B 2 262 ? 63.548 89.570  32.334 1.00 86.22  ? 250 ASP B CB    1 
ATOM   6396 C  CG    . ASP B 2 262 ? 64.167 88.196  32.605 1.00 87.38  ? 250 ASP B CG    1 
ATOM   6397 O  OD1   . ASP B 2 262 ? 65.340 88.161  33.034 1.00 88.18  ? 250 ASP B OD1   1 
ATOM   6398 O  OD2   . ASP B 2 262 ? 63.493 87.158  32.391 1.00 86.86  ? 250 ASP B OD2   1 
ATOM   6399 N  N     . SER B 2 263 ? 63.493 90.791  29.308 1.00 79.39  ? 251 SER B N     1 
ATOM   6400 C  CA    . SER B 2 263 ? 63.380 90.592  27.869 1.00 76.86  ? 251 SER B CA    1 
ATOM   6401 C  C     . SER B 2 263 ? 63.403 91.925  27.107 1.00 75.84  ? 251 SER B C     1 
ATOM   6402 O  O     . SER B 2 263 ? 62.683 92.870  27.451 1.00 76.30  ? 251 SER B O     1 
ATOM   6403 C  CB    . SER B 2 263 ? 62.091 89.827  27.553 1.00 76.07  ? 251 SER B CB    1 
ATOM   6404 O  OG    . SER B 2 263 ? 62.052 89.413  26.198 1.00 74.62  ? 251 SER B OG    1 
ATOM   6405 N  N     . TRP B 2 264 ? 64.228 91.998  26.067 1.00 73.17  ? 252 TRP B N     1 
ATOM   6406 C  CA    . TRP B 2 264 ? 64.332 93.218  25.270 1.00 69.57  ? 252 TRP B CA    1 
ATOM   6407 C  C     . TRP B 2 264 ? 63.670 93.080  23.902 1.00 66.84  ? 252 TRP B C     1 
ATOM   6408 O  O     . TRP B 2 264 ? 63.517 91.975  23.383 1.00 66.60  ? 252 TRP B O     1 
ATOM   6409 C  CB    . TRP B 2 264 ? 65.802 93.601  25.094 1.00 69.53  ? 252 TRP B CB    1 
ATOM   6410 C  CG    . TRP B 2 264 ? 66.445 93.999  26.376 1.00 69.70  ? 252 TRP B CG    1 
ATOM   6411 C  CD1   . TRP B 2 264 ? 66.832 93.173  27.385 1.00 69.65  ? 252 TRP B CD1   1 
ATOM   6412 C  CD2   . TRP B 2 264 ? 66.759 95.332  26.804 1.00 70.30  ? 252 TRP B CD2   1 
ATOM   6413 N  NE1   . TRP B 2 264 ? 67.366 93.903  28.418 1.00 70.44  ? 252 TRP B NE1   1 
ATOM   6414 C  CE2   . TRP B 2 264 ? 67.334 95.232  28.085 1.00 70.65  ? 252 TRP B CE2   1 
ATOM   6415 C  CE3   . TRP B 2 264 ? 66.606 96.598  26.231 1.00 69.11  ? 252 TRP B CE3   1 
ATOM   6416 C  CZ2   . TRP B 2 264 ? 67.757 96.348  28.801 1.00 69.89  ? 252 TRP B CZ2   1 
ATOM   6417 C  CZ3   . TRP B 2 264 ? 67.022 97.701  26.943 1.00 69.40  ? 252 TRP B CZ3   1 
ATOM   6418 C  CH2   . TRP B 2 264 ? 67.592 97.571  28.214 1.00 69.93  ? 252 TRP B CH2   1 
ATOM   6419 N  N     . THR B 2 265 ? 63.269 94.208  23.325 1.00 63.22  ? 253 THR B N     1 
ATOM   6420 C  CA    . THR B 2 265 ? 62.732 94.216  21.970 1.00 59.15  ? 253 THR B CA    1 
ATOM   6421 C  C     . THR B 2 265 ? 63.539 95.133  21.053 1.00 57.21  ? 253 THR B C     1 
ATOM   6422 O  O     . THR B 2 265 ? 64.416 95.864  21.497 1.00 56.24  ? 253 THR B O     1 
ATOM   6423 C  CB    . THR B 2 265 ? 61.244 94.648  21.954 1.00 56.44  ? 253 THR B CB    1 
ATOM   6424 O  OG1   . THR B 2 265 ? 61.095 95.886  22.641 1.00 55.11  ? 253 THR B OG1   1 
ATOM   6425 C  CG2   . THR B 2 265 ? 60.388 93.623  22.634 1.00 55.48  ? 253 THR B CG2   1 
ATOM   6426 N  N     . VAL B 2 266 ? 63.252 95.078  19.764 1.00 56.14  ? 254 VAL B N     1 
ATOM   6427 C  CA    . VAL B 2 266 ? 63.859 96.009  18.840 1.00 56.12  ? 254 VAL B CA    1 
ATOM   6428 C  C     . VAL B 2 266 ? 63.599 97.450  19.287 1.00 57.45  ? 254 VAL B C     1 
ATOM   6429 O  O     . VAL B 2 266 ? 64.511 98.276  19.312 1.00 58.96  ? 254 VAL B O     1 
ATOM   6430 C  CB    . VAL B 2 266 ? 63.310 95.791  17.432 1.00 54.64  ? 254 VAL B CB    1 
ATOM   6431 C  CG1   . VAL B 2 266 ? 63.747 96.917  16.518 1.00 53.96  ? 254 VAL B CG1   1 
ATOM   6432 C  CG2   . VAL B 2 266 ? 63.806 94.459  16.905 1.00 53.87  ? 254 VAL B CG2   1 
ATOM   6433 N  N     . ASN B 2 267 ? 62.360 97.747  19.664 1.00 56.98  ? 255 ASN B N     1 
ATOM   6434 C  CA    . ASN B 2 267 ? 62.011 99.090  20.104 1.00 55.74  ? 255 ASN B CA    1 
ATOM   6435 C  C     . ASN B 2 267 ? 62.714 99.463  21.415 1.00 56.67  ? 255 ASN B C     1 
ATOM   6436 O  O     . ASN B 2 267 ? 63.102 100.613 21.612 1.00 57.14  ? 255 ASN B O     1 
ATOM   6437 C  CB    . ASN B 2 267 ? 60.498 99.198  20.276 1.00 54.41  ? 255 ASN B CB    1 
ATOM   6438 C  CG    . ASN B 2 267 ? 60.038 100.621 20.468 1.00 52.60  ? 255 ASN B CG    1 
ATOM   6439 O  OD1   . ASN B 2 267 ? 59.440 100.964 21.482 1.00 51.62  ? 255 ASN B OD1   1 
ATOM   6440 N  ND2   . ASN B 2 267 ? 60.322 101.462 19.490 1.00 53.36  ? 255 ASN B ND2   1 
ATOM   6441 N  N     . ASP B 2 268 ? 62.877 98.490  22.309 1.00 57.12  ? 256 ASP B N     1 
ATOM   6442 C  CA    . ASP B 2 268 ? 63.554 98.724  23.584 1.00 55.89  ? 256 ASP B CA    1 
ATOM   6443 C  C     . ASP B 2 268 ? 65.027 98.995  23.373 1.00 54.71  ? 256 ASP B C     1 
ATOM   6444 O  O     . ASP B 2 268 ? 65.591 99.876  23.998 1.00 54.41  ? 256 ASP B O     1 
ATOM   6445 C  CB    . ASP B 2 268 ? 63.398 97.520  24.508 1.00 57.13  ? 256 ASP B CB    1 
ATOM   6446 C  CG    . ASP B 2 268 ? 62.014 97.428  25.121 1.00 59.89  ? 256 ASP B CG    1 
ATOM   6447 O  OD1   . ASP B 2 268 ? 61.616 96.312  25.523 1.00 61.47  ? 256 ASP B OD1   1 
ATOM   6448 O  OD2   . ASP B 2 268 ? 61.326 98.470  25.202 1.00 61.64  ? 256 ASP B OD2   1 
ATOM   6449 N  N     . ILE B 2 269 ? 65.648 98.233  22.485 1.00 54.88  ? 257 ILE B N     1 
ATOM   6450 C  CA    . ILE B 2 269 ? 67.058 98.425  22.184 1.00 56.01  ? 257 ILE B CA    1 
ATOM   6451 C  C     . ILE B 2 269 ? 67.307 99.726  21.429 1.00 56.81  ? 257 ILE B C     1 
ATOM   6452 O  O     . ILE B 2 269 ? 68.334 100.369 21.620 1.00 57.39  ? 257 ILE B O     1 
ATOM   6453 C  CB    . ILE B 2 269 ? 67.619 97.247  21.352 1.00 56.13  ? 257 ILE B CB    1 
ATOM   6454 C  CG1   . ILE B 2 269 ? 67.648 95.976  22.209 1.00 55.40  ? 257 ILE B CG1   1 
ATOM   6455 C  CG2   . ILE B 2 269 ? 69.009 97.595  20.828 1.00 55.67  ? 257 ILE B CG2   1 
ATOM   6456 C  CD1   . ILE B 2 269 ? 67.531 94.693  21.418 1.00 54.43  ? 257 ILE B CD1   1 
ATOM   6457 N  N     . GLN B 2 270 ? 66.367 100.117 20.575 1.00 57.23  ? 258 GLN B N     1 
ATOM   6458 C  CA    . GLN B 2 270 ? 66.527 101.332 19.795 1.00 56.71  ? 258 GLN B CA    1 
ATOM   6459 C  C     . GLN B 2 270 ? 66.384 102.555 20.667 1.00 58.10  ? 258 GLN B C     1 
ATOM   6460 O  O     . GLN B 2 270 ? 66.974 103.589 20.376 1.00 58.67  ? 258 GLN B O     1 
ATOM   6461 C  CB    . GLN B 2 270 ? 65.500 101.394 18.675 1.00 55.22  ? 258 GLN B CB    1 
ATOM   6462 C  CG    . GLN B 2 270 ? 65.849 100.529 17.496 1.00 55.79  ? 258 GLN B CG    1 
ATOM   6463 C  CD    . GLN B 2 270 ? 64.915 100.743 16.330 1.00 56.40  ? 258 GLN B CD    1 
ATOM   6464 O  OE1   . GLN B 2 270 ? 63.932 101.476 16.440 1.00 58.19  ? 258 GLN B OE1   1 
ATOM   6465 N  NE2   . GLN B 2 270 ? 65.212 100.101 15.203 1.00 55.76  ? 258 GLN B NE2   1 
ATOM   6466 N  N     . LYS B 2 271 ? 65.592 102.443 21.732 1.00 59.13  ? 259 LYS B N     1 
ATOM   6467 C  CA    . LYS B 2 271 ? 65.492 103.520 22.711 1.00 59.91  ? 259 LYS B CA    1 
ATOM   6468 C  C     . LYS B 2 271 ? 66.735 103.523 23.600 1.00 60.14  ? 259 LYS B C     1 
ATOM   6469 O  O     . LYS B 2 271 ? 67.270 104.573 23.944 1.00 60.89  ? 259 LYS B O     1 
ATOM   6470 C  CB    . LYS B 2 271 ? 64.228 103.365 23.561 1.00 59.94  ? 259 LYS B CB    1 
ATOM   6471 C  CG    . LYS B 2 271 ? 62.947 103.769 22.851 1.00 61.68  ? 259 LYS B CG    1 
ATOM   6472 C  CD    . LYS B 2 271 ? 61.800 104.007 23.843 1.00 64.96  ? 259 LYS B CD    1 
ATOM   6473 C  CE    . LYS B 2 271 ? 61.288 102.697 24.471 1.00 68.16  ? 259 LYS B CE    1 
ATOM   6474 N  NZ    . LYS B 2 271 ? 59.922 102.795 25.108 1.00 67.84  ? 259 LYS B NZ    1 
ATOM   6475 N  N     . LEU B 2 272 ? 67.220 102.344 23.948 1.00 59.91  ? 260 LEU B N     1 
ATOM   6476 C  CA    . LEU B 2 272 ? 68.478 102.260 24.664 1.00 60.58  ? 260 LEU B CA    1 
ATOM   6477 C  C     . LEU B 2 272 ? 69.654 102.851 23.874 1.00 60.32  ? 260 LEU B C     1 
ATOM   6478 O  O     . LEU B 2 272 ? 70.455 103.607 24.412 1.00 60.43  ? 260 LEU B O     1 
ATOM   6479 C  CB    . LEU B 2 272 ? 68.788 100.813 25.006 1.00 60.85  ? 260 LEU B CB    1 
ATOM   6480 C  CG    . LEU B 2 272 ? 69.821 100.776 26.116 1.00 62.35  ? 260 LEU B CG    1 
ATOM   6481 C  CD1   . LEU B 2 272 ? 69.235 101.499 27.326 1.00 62.04  ? 260 LEU B CD1   1 
ATOM   6482 C  CD2   . LEU B 2 272 ? 70.201 99.344  26.445 1.00 61.70  ? 260 LEU B CD2   1 
ATOM   6483 N  N     . VAL B 2 273 ? 69.766 102.500 22.602 1.00 59.39  ? 261 VAL B N     1 
ATOM   6484 C  CA    . VAL B 2 273 ? 70.844 103.023 21.779 1.00 59.13  ? 261 VAL B CA    1 
ATOM   6485 C  C     . VAL B 2 273 ? 70.683 104.529 21.605 1.00 60.51  ? 261 VAL B C     1 
ATOM   6486 O  O     . VAL B 2 273 ? 71.642 105.239 21.282 1.00 61.14  ? 261 VAL B O     1 
ATOM   6487 C  CB    . VAL B 2 273 ? 70.859 102.364 20.386 1.00 58.27  ? 261 VAL B CB    1 
ATOM   6488 C  CG1   . VAL B 2 273 ? 71.993 102.922 19.559 1.00 57.75  ? 261 VAL B CG1   1 
ATOM   6489 C  CG2   . VAL B 2 273 ? 71.014 100.865 20.524 1.00 58.68  ? 261 VAL B CG2   1 
ATOM   6490 N  N     . GLY B 2 274 ? 69.463 105.015 21.818 1.00 60.63  ? 262 GLY B N     1 
ATOM   6491 C  CA    . GLY B 2 274 ? 69.184 106.425 21.610 1.00 59.20  ? 262 GLY B CA    1 
ATOM   6492 C  C     . GLY B 2 274 ? 69.661 107.239 22.790 1.00 58.94  ? 262 GLY B C     1 
ATOM   6493 O  O     . GLY B 2 274 ? 70.301 108.275 22.623 1.00 57.23  ? 262 GLY B O     1 
ATOM   6494 N  N     . LYS B 2 275 ? 69.363 106.757 23.992 1.00 59.84  ? 263 LYS B N     1 
ATOM   6495 C  CA    . LYS B 2 275 ? 69.761 107.452 25.205 1.00 60.90  ? 263 LYS B CA    1 
ATOM   6496 C  C     . LYS B 2 275 ? 71.270 107.460 25.371 1.00 61.92  ? 263 LYS B C     1 
ATOM   6497 O  O     . LYS B 2 275 ? 71.872 108.522 25.445 1.00 63.00  ? 263 LYS B O     1 
ATOM   6498 C  CB    . LYS B 2 275 ? 69.119 106.803 26.421 1.00 60.84  ? 263 LYS B CB    1 
ATOM   6499 C  CG    . LYS B 2 275 ? 69.487 107.489 27.706 1.00 64.76  ? 263 LYS B CG    1 
ATOM   6500 C  CD    . LYS B 2 275 ? 68.624 107.007 28.849 1.00 68.28  ? 263 LYS B CD    1 
ATOM   6501 C  CE    . LYS B 2 275 ? 67.145 107.190 28.530 1.00 71.78  ? 263 LYS B CE    1 
ATOM   6502 N  NZ    . LYS B 2 275 ? 66.246 106.535 29.543 1.00 73.75  ? 263 LYS B NZ    1 
ATOM   6503 N  N     . LEU B 2 276 ? 71.877 106.276 25.417 1.00 62.93  ? 264 LEU B N     1 
ATOM   6504 C  CA    . LEU B 2 276 ? 73.328 106.142 25.551 1.00 63.27  ? 264 LEU B CA    1 
ATOM   6505 C  C     . LEU B 2 276 ? 74.105 106.924 24.492 1.00 64.72  ? 264 LEU B C     1 
ATOM   6506 O  O     . LEU B 2 276 ? 75.156 107.495 24.787 1.00 65.15  ? 264 LEU B O     1 
ATOM   6507 C  CB    . LEU B 2 276 ? 73.737 104.669 25.472 1.00 61.95  ? 264 LEU B CB    1 
ATOM   6508 C  CG    . LEU B 2 276 ? 73.305 103.724 26.595 1.00 60.61  ? 264 LEU B CG    1 
ATOM   6509 C  CD1   . LEU B 2 276 ? 73.762 102.317 26.259 1.00 58.74  ? 264 LEU B CD1   1 
ATOM   6510 C  CD2   . LEU B 2 276 ? 73.882 104.182 27.919 1.00 57.83  ? 264 LEU B CD2   1 
ATOM   6511 N  N     . ASN B 2 277 ? 73.598 106.934 23.260 1.00 65.89  ? 265 ASN B N     1 
ATOM   6512 C  CA    . ASN B 2 277 ? 74.189 107.753 22.200 1.00 67.11  ? 265 ASN B CA    1 
ATOM   6513 C  C     . ASN B 2 277 ? 74.364 109.160 22.746 1.00 69.05  ? 265 ASN B C     1 
ATOM   6514 O  O     . ASN B 2 277 ? 75.467 109.709 22.772 1.00 69.57  ? 265 ASN B O     1 
ATOM   6515 C  CB    . ASN B 2 277 ? 73.268 107.798 20.971 1.00 65.81  ? 265 ASN B CB    1 
ATOM   6516 C  CG    . ASN B 2 277 ? 73.716 108.829 19.925 1.00 65.68  ? 265 ASN B CG    1 
ATOM   6517 O  OD1   . ASN B 2 277 ? 74.897 108.934 19.610 1.00 64.50  ? 265 ASN B OD1   1 
ATOM   6518 N  ND2   . ASN B 2 277 ? 72.761 109.587 19.384 1.00 64.07  ? 265 ASN B ND2   1 
ATOM   6519 N  N     . TRP B 2 278 ? 73.257 109.734 23.198 1.00 70.28  ? 266 TRP B N     1 
ATOM   6520 C  CA    . TRP B 2 278 ? 73.258 111.094 23.696 1.00 71.25  ? 266 TRP B CA    1 
ATOM   6521 C  C     . TRP B 2 278 ? 74.175 111.208 24.914 1.00 72.12  ? 266 TRP B C     1 
ATOM   6522 O  O     . TRP B 2 278 ? 75.177 111.926 24.888 1.00 72.64  ? 266 TRP B O     1 
ATOM   6523 C  CB    . TRP B 2 278 ? 71.828 111.487 24.043 1.00 71.22  ? 266 TRP B CB    1 
ATOM   6524 C  CG    . TRP B 2 278 ? 71.713 112.691 24.876 1.00 71.73  ? 266 TRP B CG    1 
ATOM   6525 C  CD1   . TRP B 2 278 ? 71.660 113.983 24.448 1.00 71.59  ? 266 TRP B CD1   1 
ATOM   6526 C  CD2   . TRP B 2 278 ? 71.579 112.728 26.297 1.00 72.06  ? 266 TRP B CD2   1 
ATOM   6527 N  NE1   . TRP B 2 278 ? 71.494 114.828 25.521 1.00 73.18  ? 266 TRP B NE1   1 
ATOM   6528 C  CE2   . TRP B 2 278 ? 71.442 114.078 26.671 1.00 72.72  ? 266 TRP B CE2   1 
ATOM   6529 C  CE3   . TRP B 2 278 ? 71.559 111.747 27.293 1.00 72.34  ? 266 TRP B CE3   1 
ATOM   6530 C  CZ2   . TRP B 2 278 ? 71.289 114.474 27.995 1.00 73.31  ? 266 TRP B CZ2   1 
ATOM   6531 C  CZ3   . TRP B 2 278 ? 71.406 112.138 28.608 1.00 73.44  ? 266 TRP B CZ3   1 
ATOM   6532 C  CH2   . TRP B 2 278 ? 71.272 113.490 28.949 1.00 73.74  ? 266 TRP B CH2   1 
ATOM   6533 N  N     . ALA B 2 279 ? 73.845 110.473 25.968 1.00 71.65  ? 267 ALA B N     1 
ATOM   6534 C  CA    . ALA B 2 279 ? 74.649 110.472 27.174 1.00 70.75  ? 267 ALA B CA    1 
ATOM   6535 C  C     . ALA B 2 279 ? 76.131 110.409 26.849 1.00 70.31  ? 267 ALA B C     1 
ATOM   6536 O  O     . ALA B 2 279 ? 76.955 110.834 27.639 1.00 70.75  ? 267 ALA B O     1 
ATOM   6537 C  CB    . ALA B 2 279 ? 74.265 109.301 28.037 1.00 70.98  ? 267 ALA B CB    1 
ATOM   6538 N  N     . SER B 2 280 ? 76.475 109.882 25.686 1.00 70.04  ? 268 SER B N     1 
ATOM   6539 C  CA    . SER B 2 280 ? 77.879 109.708 25.346 1.00 71.75  ? 268 SER B CA    1 
ATOM   6540 C  C     . SER B 2 280 ? 78.576 111.042 25.057 1.00 72.24  ? 268 SER B C     1 
ATOM   6541 O  O     . SER B 2 280 ? 79.751 111.072 24.687 1.00 73.54  ? 268 SER B O     1 
ATOM   6542 C  CB    . SER B 2 280 ? 78.021 108.749 24.148 1.00 72.28  ? 268 SER B CB    1 
ATOM   6543 O  OG    . SER B 2 280 ? 78.562 109.391 23.004 1.00 70.98  ? 268 SER B OG    1 
ATOM   6544 N  N     . GLN B 2 281 ? 77.858 112.146 25.234 1.00 72.47  ? 269 GLN B N     1 
ATOM   6545 C  CA    . GLN B 2 281 ? 78.465 113.475 25.108 1.00 72.11  ? 269 GLN B CA    1 
ATOM   6546 C  C     . GLN B 2 281 ? 78.731 114.065 26.485 1.00 72.52  ? 269 GLN B C     1 
ATOM   6547 O  O     . GLN B 2 281 ? 79.542 114.971 26.632 1.00 72.60  ? 269 GLN B O     1 
ATOM   6548 C  CB    . GLN B 2 281 ? 77.545 114.440 24.355 1.00 71.66  ? 269 GLN B CB    1 
ATOM   6549 C  CG    . GLN B 2 281 ? 77.130 114.021 22.961 1.00 68.89  ? 269 GLN B CG    1 
ATOM   6550 C  CD    . GLN B 2 281 ? 75.870 114.733 22.531 1.00 67.29  ? 269 GLN B CD    1 
ATOM   6551 O  OE1   . GLN B 2 281 ? 74.944 114.891 23.324 1.00 66.34  ? 269 GLN B OE1   1 
ATOM   6552 N  NE2   . GLN B 2 281 ? 75.826 115.173 21.279 1.00 66.24  ? 269 GLN B NE2   1 
ATOM   6553 N  N     . ILE B 2 282 ? 78.013 113.571 27.486 1.00 73.27  ? 270 ILE B N     1 
ATOM   6554 C  CA    . ILE B 2 282 ? 78.230 113.987 28.862 1.00 74.09  ? 270 ILE B CA    1 
ATOM   6555 C  C     . ILE B 2 282 ? 79.234 113.037 29.496 1.00 76.39  ? 270 ILE B C     1 
ATOM   6556 O  O     . ILE B 2 282 ? 80.023 113.433 30.347 1.00 77.16  ? 270 ILE B O     1 
ATOM   6557 C  CB    . ILE B 2 282 ? 76.907 113.963 29.672 1.00 72.73  ? 270 ILE B CB    1 
ATOM   6558 C  CG1   . ILE B 2 282 ? 75.984 115.089 29.205 1.00 71.62  ? 270 ILE B CG1   1 
ATOM   6559 C  CG2   . ILE B 2 282 ? 77.183 114.112 31.156 1.00 71.92  ? 270 ILE B CG2   1 
ATOM   6560 C  CD1   . ILE B 2 282 ? 74.737 115.239 30.059 1.00 69.66  ? 270 ILE B CD1   1 
ATOM   6561 N  N     . TYR B 2 283 ? 79.199 111.780 29.069 1.00 79.20  ? 271 TYR B N     1 
ATOM   6562 C  CA    . TYR B 2 283 ? 80.137 110.775 29.548 1.00 82.68  ? 271 TYR B CA    1 
ATOM   6563 C  C     . TYR B 2 283 ? 80.887 110.200 28.362 1.00 85.26  ? 271 TYR B C     1 
ATOM   6564 O  O     . TYR B 2 283 ? 80.304 109.557 27.491 1.00 86.20  ? 271 TYR B O     1 
ATOM   6565 C  CB    . TYR B 2 283 ? 79.398 109.653 30.281 1.00 81.92  ? 271 TYR B CB    1 
ATOM   6566 C  CG    . TYR B 2 283 ? 78.639 110.110 31.504 1.00 82.57  ? 271 TYR B CG    1 
ATOM   6567 C  CD1   . TYR B 2 283 ? 77.428 110.781 31.386 1.00 83.22  ? 271 TYR B CD1   1 
ATOM   6568 C  CD2   . TYR B 2 283 ? 79.137 109.877 32.779 1.00 83.02  ? 271 TYR B CD2   1 
ATOM   6569 C  CE1   . TYR B 2 283 ? 76.733 111.210 32.505 1.00 84.05  ? 271 TYR B CE1   1 
ATOM   6570 C  CE2   . TYR B 2 283 ? 78.451 110.300 33.909 1.00 84.07  ? 271 TYR B CE2   1 
ATOM   6571 C  CZ    . TYR B 2 283 ? 77.249 110.969 33.766 1.00 84.88  ? 271 TYR B CZ    1 
ATOM   6572 O  OH    . TYR B 2 283 ? 76.571 111.408 34.885 1.00 84.61  ? 271 TYR B OH    1 
ATOM   6573 N  N     . PRO B 2 284 ? 82.201 110.424 28.319 1.00 87.82  ? 272 PRO B N     1 
ATOM   6574 C  CA    . PRO B 2 284 ? 83.038 110.113 27.155 1.00 89.88  ? 272 PRO B CA    1 
ATOM   6575 C  C     . PRO B 2 284 ? 83.153 108.622 26.829 1.00 91.29  ? 272 PRO B C     1 
ATOM   6576 O  O     . PRO B 2 284 ? 83.307 108.246 25.664 1.00 91.67  ? 272 PRO B O     1 
ATOM   6577 C  CB    . PRO B 2 284 ? 84.392 110.724 27.514 1.00 90.35  ? 272 PRO B CB    1 
ATOM   6578 C  CG    . PRO B 2 284 ? 84.075 111.754 28.579 1.00 90.46  ? 272 PRO B CG    1 
ATOM   6579 C  CD    . PRO B 2 284 ? 82.943 111.165 29.352 1.00 88.70  ? 272 PRO B CD    1 
ATOM   6580 N  N     . GLY B 2 285 ? 83.077 107.777 27.855 1.00 91.97  ? 273 GLY B N     1 
ATOM   6581 C  CA    . GLY B 2 285 ? 83.397 106.372 27.669 1.00 93.20  ? 273 GLY B CA    1 
ATOM   6582 C  C     . GLY B 2 285 ? 82.247 105.516 27.177 1.00 94.16  ? 273 GLY B C     1 
ATOM   6583 O  O     . GLY B 2 285 ? 82.458 104.458 26.586 1.00 93.17  ? 273 GLY B O     1 
ATOM   6584 N  N     . ILE B 2 286 ? 81.026 105.979 27.425 1.00 95.78  ? 274 ILE B N     1 
ATOM   6585 C  CA    . ILE B 2 286 ? 79.822 105.262 27.019 1.00 96.44  ? 274 ILE B CA    1 
ATOM   6586 C  C     . ILE B 2 286 ? 79.933 104.794 25.575 1.00 96.91  ? 274 ILE B C     1 
ATOM   6587 O  O     . ILE B 2 286 ? 80.013 105.614 24.656 1.00 96.53  ? 274 ILE B O     1 
ATOM   6588 C  CB    . ILE B 2 286 ? 78.577 106.164 27.123 1.00 96.51  ? 274 ILE B CB    1 
ATOM   6589 C  CG1   . ILE B 2 286 ? 78.436 106.709 28.541 1.00 96.23  ? 274 ILE B CG1   1 
ATOM   6590 C  CG2   . ILE B 2 286 ? 77.334 105.372 26.762 1.00 97.12  ? 274 ILE B CG2   1 
ATOM   6591 C  CD1   . ILE B 2 286 ? 78.011 105.674 29.550 1.00 95.88  ? 274 ILE B CD1   1 
ATOM   6592 N  N     . LYS B 2 287 ? 79.932 103.478 25.379 1.00 97.68  ? 275 LYS B N     1 
ATOM   6593 C  CA    . LYS B 2 287 ? 79.921 102.905 24.035 1.00 98.97  ? 275 LYS B CA    1 
ATOM   6594 C  C     . LYS B 2 287 ? 78.599 102.195 23.746 1.00 99.68  ? 275 LYS B C     1 
ATOM   6595 O  O     . LYS B 2 287 ? 77.965 101.656 24.654 1.00 100.20 ? 275 LYS B O     1 
ATOM   6596 C  CB    . LYS B 2 287 ? 81.084 101.920 23.864 1.00 98.80  ? 275 LYS B CB    1 
ATOM   6597 C  CG    . LYS B 2 287 ? 81.062 101.153 22.545 1.00 98.35  ? 275 LYS B CG    1 
ATOM   6598 C  CD    . LYS B 2 287 ? 82.458 100.979 21.974 1.00 97.80  ? 275 LYS B CD    1 
ATOM   6599 C  CE    . LYS B 2 287 ? 82.573 99.677  21.202 1.00 98.19  ? 275 LYS B CE    1 
ATOM   6600 N  NZ    . LYS B 2 287 ? 83.660 99.702  20.178 1.00 98.73  ? 275 LYS B NZ    1 
ATOM   6601 N  N     . VAL B 2 288 ? 78.189 102.200 22.480 1.00 99.52  ? 276 VAL B N     1 
ATOM   6602 C  CA    . VAL B 2 288 ? 76.925 101.593 22.075 1.00 99.22  ? 276 VAL B CA    1 
ATOM   6603 C  C     . VAL B 2 288 ? 77.103 100.645 20.897 1.00 99.74  ? 276 VAL B C     1 
ATOM   6604 O  O     . VAL B 2 288 ? 76.125 100.265 20.253 1.00 99.73  ? 276 VAL B O     1 
ATOM   6605 C  CB    . VAL B 2 288 ? 75.892 102.664 21.667 1.00 98.81  ? 276 VAL B CB    1 
ATOM   6606 C  CG1   . VAL B 2 288 ? 75.587 103.564 22.844 1.00 98.66  ? 276 VAL B CG1   1 
ATOM   6607 C  CG2   . VAL B 2 288 ? 76.418 103.477 20.496 1.00 97.74  ? 276 VAL B CG2   1 
ATOM   6608 N  N     . ARG B 2 289 ? 78.348 100.264 20.619 1.00 100.40 ? 277 ARG B N     1 
ATOM   6609 C  CA    . ARG B 2 289 ? 78.688 99.625  19.347 1.00 100.23 ? 277 ARG B CA    1 
ATOM   6610 C  C     . ARG B 2 289 ? 78.203 98.186  19.254 1.00 98.09  ? 277 ARG B C     1 
ATOM   6611 O  O     . ARG B 2 289 ? 77.933 97.686  18.161 1.00 97.69  ? 277 ARG B O     1 
ATOM   6612 C  CB    . ARG B 2 289 ? 80.203 99.668  19.118 1.00 103.02 ? 277 ARG B CB    1 
ATOM   6613 C  CG    . ARG B 2 289 ? 80.609 100.008 17.691 1.00 106.10 ? 277 ARG B CG    1 
ATOM   6614 C  CD    . ARG B 2 289 ? 80.067 98.987  16.702 1.00 109.27 ? 277 ARG B CD    1 
ATOM   6615 N  NE    . ARG B 2 289 ? 80.135 99.467  15.325 1.00 111.69 ? 277 ARG B NE    1 
ATOM   6616 C  CZ    . ARG B 2 289 ? 80.344 98.686  14.268 1.00 112.51 ? 277 ARG B CZ    1 
ATOM   6617 N  NH1   . ARG B 2 289 ? 80.507 97.379  14.423 1.00 112.21 ? 277 ARG B NH1   1 
ATOM   6618 N  NH2   . ARG B 2 289 ? 80.394 99.216  13.053 1.00 114.16 ? 277 ARG B NH2   1 
ATOM   6619 N  N     . GLN B 2 290 ? 78.090 97.522  20.398 1.00 95.39  ? 278 GLN B N     1 
ATOM   6620 C  CA    . GLN B 2 290 ? 77.607 96.155  20.409 1.00 94.07  ? 278 GLN B CA    1 
ATOM   6621 C  C     . GLN B 2 290 ? 76.083 96.073  20.372 1.00 92.72  ? 278 GLN B C     1 
ATOM   6622 O  O     . GLN B 2 290 ? 75.519 95.113  19.838 1.00 93.00  ? 278 GLN B O     1 
ATOM   6623 C  CB    . GLN B 2 290 ? 78.157 95.420  21.630 1.00 95.45  ? 278 GLN B CB    1 
ATOM   6624 C  CG    . GLN B 2 290 ? 79.645 95.163  21.531 1.00 97.88  ? 278 GLN B CG    1 
ATOM   6625 C  CD    . GLN B 2 290 ? 80.099 95.002  20.089 1.00 99.33  ? 278 GLN B CD    1 
ATOM   6626 O  OE1   . GLN B 2 290 ? 79.982 93.922  19.505 1.00 99.41  ? 278 GLN B OE1   1 
ATOM   6627 N  NE2   . GLN B 2 290 ? 80.613 96.082  19.505 1.00 100.01 ? 278 GLN B NE2   1 
ATOM   6628 N  N     . LEU B 2 291 ? 75.419 97.086  20.922 1.00 90.31  ? 279 LEU B N     1 
ATOM   6629 C  CA    . LEU B 2 291 ? 73.962 97.122  20.947 1.00 86.38  ? 279 LEU B CA    1 
ATOM   6630 C  C     . LEU B 2 291 ? 73.389 97.517  19.601 1.00 85.54  ? 279 LEU B C     1 
ATOM   6631 O  O     . LEU B 2 291 ? 72.299 97.096  19.242 1.00 85.51  ? 279 LEU B O     1 
ATOM   6632 C  CB    . LEU B 2 291 ? 73.486 98.094  22.016 1.00 83.35  ? 279 LEU B CB    1 
ATOM   6633 C  CG    . LEU B 2 291 ? 73.693 97.559  23.425 1.00 81.99  ? 279 LEU B CG    1 
ATOM   6634 C  CD1   . LEU B 2 291 ? 73.639 98.698  24.411 1.00 82.24  ? 279 LEU B CD1   1 
ATOM   6635 C  CD2   . LEU B 2 291 ? 72.637 96.515  23.733 1.00 81.05  ? 279 LEU B CD2   1 
ATOM   6636 N  N     . SER B 2 292 ? 74.138 98.319  18.854 1.00 85.51  ? 280 SER B N     1 
ATOM   6637 C  CA    . SER B 2 292 ? 73.684 98.828  17.564 1.00 86.30  ? 280 SER B CA    1 
ATOM   6638 C  C     . SER B 2 292 ? 73.733 97.766  16.476 1.00 86.60  ? 280 SER B C     1 
ATOM   6639 O  O     . SER B 2 292 ? 73.155 97.930  15.405 1.00 85.46  ? 280 SER B O     1 
ATOM   6640 C  CB    . SER B 2 292 ? 74.551 100.010 17.149 1.00 86.75  ? 280 SER B CB    1 
ATOM   6641 O  OG    . SER B 2 292 ? 74.702 100.909 18.231 1.00 87.96  ? 280 SER B OG    1 
ATOM   6642 N  N     . LYS B 2 293 ? 74.434 96.676  16.753 1.00 88.19  ? 281 LYS B N     1 
ATOM   6643 C  CA    . LYS B 2 293 ? 74.567 95.599  15.785 1.00 89.06  ? 281 LYS B CA    1 
ATOM   6644 C  C     . LYS B 2 293 ? 73.612 94.436  16.067 1.00 88.81  ? 281 LYS B C     1 
ATOM   6645 O  O     . LYS B 2 293 ? 73.524 93.494  15.272 1.00 89.19  ? 281 LYS B O     1 
ATOM   6646 C  CB    . LYS B 2 293 ? 76.011 95.103  15.758 1.00 90.41  ? 281 LYS B CB    1 
ATOM   6647 C  CG    . LYS B 2 293 ? 77.026 96.195  15.449 1.00 92.26  ? 281 LYS B CG    1 
ATOM   6648 C  CD    . LYS B 2 293 ? 78.350 95.601  14.982 1.00 93.31  ? 281 LYS B CD    1 
ATOM   6649 C  CE    . LYS B 2 293 ? 78.818 94.473  15.896 1.00 93.20  ? 281 LYS B CE    1 
ATOM   6650 N  NZ    . LYS B 2 293 ? 78.065 93.206  15.654 1.00 92.80  ? 281 LYS B NZ    1 
ATOM   6651 N  N     . LEU B 2 294 ? 72.903 94.505  17.194 1.00 86.98  ? 282 LEU B N     1 
ATOM   6652 C  CA    . LEU B 2 294 ? 71.704 93.689  17.406 1.00 84.95  ? 282 LEU B CA    1 
ATOM   6653 C  C     . LEU B 2 294 ? 70.560 94.170  16.499 1.00 84.54  ? 282 LEU B C     1 
ATOM   6654 O  O     . LEU B 2 294 ? 69.646 93.411  16.177 1.00 83.49  ? 282 LEU B O     1 
ATOM   6655 C  CB    . LEU B 2 294 ? 71.263 93.778  18.866 1.00 83.48  ? 282 LEU B CB    1 
ATOM   6656 C  CG    . LEU B 2 294 ? 72.200 93.199  19.920 1.00 82.15  ? 282 LEU B CG    1 
ATOM   6657 C  CD1   . LEU B 2 294 ? 71.771 93.672  21.297 1.00 82.13  ? 282 LEU B CD1   1 
ATOM   6658 C  CD2   . LEU B 2 294 ? 72.175 91.686  19.847 1.00 81.83  ? 282 LEU B CD2   1 
ATOM   6659 N  N     . LEU B 2 295 ? 70.626 95.442  16.103 1.00 84.72  ? 283 LEU B N     1 
ATOM   6660 C  CA    . LEU B 2 295 ? 69.693 96.036  15.144 1.00 84.69  ? 283 LEU B CA    1 
ATOM   6661 C  C     . LEU B 2 295 ? 70.216 95.788  13.725 1.00 84.83  ? 283 LEU B C     1 
ATOM   6662 O  O     . LEU B 2 295 ? 70.363 96.709  12.916 1.00 84.21  ? 283 LEU B O     1 
ATOM   6663 C  CB    . LEU B 2 295 ? 69.572 97.542  15.396 1.00 84.04  ? 283 LEU B CB    1 
ATOM   6664 C  CG    . LEU B 2 295 ? 69.499 97.985  16.862 1.00 84.09  ? 283 LEU B CG    1 
ATOM   6665 C  CD1   . LEU B 2 295 ? 69.616 99.501  16.947 1.00 83.18  ? 283 LEU B CD1   1 
ATOM   6666 C  CD2   . LEU B 2 295 ? 68.198 97.498  17.490 1.00 83.37  ? 283 LEU B CD2   1 
ATOM   6667 N  N     . ARG B 2 296 ? 70.507 94.526  13.442 1.00 84.84  ? 284 ARG B N     1 
ATOM   6668 C  CA    . ARG B 2 296 ? 71.101 94.132  12.174 1.00 84.24  ? 284 ARG B CA    1 
ATOM   6669 C  C     . ARG B 2 296 ? 69.993 93.980  11.140 1.00 81.93  ? 284 ARG B C     1 
ATOM   6670 O  O     . ARG B 2 296 ? 69.371 92.918  11.024 1.00 81.89  ? 284 ARG B O     1 
ATOM   6671 C  CB    . ARG B 2 296 ? 71.856 92.804  12.349 1.00 86.70  ? 284 ARG B CB    1 
ATOM   6672 C  CG    . ARG B 2 296 ? 72.478 92.227  11.081 1.00 88.93  ? 284 ARG B CG    1 
ATOM   6673 C  CD    . ARG B 2 296 ? 72.973 90.810  11.332 1.00 90.53  ? 284 ARG B CD    1 
ATOM   6674 N  NE    . ARG B 2 296 ? 74.273 90.556  10.715 1.00 93.13  ? 284 ARG B NE    1 
ATOM   6675 C  CZ    . ARG B 2 296 ? 75.394 91.212  11.015 1.00 94.16  ? 284 ARG B CZ    1 
ATOM   6676 N  NH1   . ARG B 2 296 ? 75.387 92.178  11.928 1.00 94.24  ? 284 ARG B NH1   1 
ATOM   6677 N  NH2   . ARG B 2 296 ? 76.532 90.892  10.412 1.00 94.32  ? 284 ARG B NH2   1 
ATOM   6678 N  N     . GLY B 2 297 ? 69.746 95.051  10.393 1.00 78.83  ? 285 GLY B N     1 
ATOM   6679 C  CA    . GLY B 2 297 ? 68.758 94.986  9.334  1.00 74.52  ? 285 GLY B CA    1 
ATOM   6680 C  C     . GLY B 2 297 ? 67.394 95.391  9.837  1.00 71.26  ? 285 GLY B C     1 
ATOM   6681 O  O     . GLY B 2 297 ? 67.267 95.889  10.959 1.00 71.79  ? 285 GLY B O     1 
ATOM   6682 N  N     . THR B 2 298 ? 66.368 95.170  9.025  1.00 67.19  ? 286 THR B N     1 
ATOM   6683 C  CA    . THR B 2 298 ? 65.088 95.821  9.263  1.00 64.02  ? 286 THR B CA    1 
ATOM   6684 C  C     . THR B 2 298 ? 64.075 95.034  10.083 1.00 60.79  ? 286 THR B C     1 
ATOM   6685 O  O     . THR B 2 298 ? 63.037 94.615  9.583  1.00 60.48  ? 286 THR B O     1 
ATOM   6686 C  CB    . THR B 2 298 ? 64.448 96.248  7.936  1.00 63.78  ? 286 THR B CB    1 
ATOM   6687 O  OG1   . THR B 2 298 ? 64.872 95.365  6.897  1.00 65.55  ? 286 THR B OG1   1 
ATOM   6688 C  CG2   . THR B 2 298 ? 64.864 97.653  7.578  1.00 65.48  ? 286 THR B CG2   1 
ATOM   6689 N  N     . LYS B 2 299 ? 64.369 94.869  11.363 1.00 57.16  ? 287 LYS B N     1 
ATOM   6690 C  CA    . LYS B 2 299 ? 63.473 94.154  12.240 1.00 55.53  ? 287 LYS B CA    1 
ATOM   6691 C  C     . LYS B 2 299 ? 62.217 94.983  12.480 1.00 54.34  ? 287 LYS B C     1 
ATOM   6692 O  O     . LYS B 2 299 ? 62.239 96.199  12.388 1.00 53.93  ? 287 LYS B O     1 
ATOM   6693 C  CB    . LYS B 2 299 ? 64.181 93.857  13.553 1.00 56.22  ? 287 LYS B CB    1 
ATOM   6694 C  CG    . LYS B 2 299 ? 65.518 93.165  13.364 1.00 58.92  ? 287 LYS B CG    1 
ATOM   6695 C  CD    . LYS B 2 299 ? 65.375 91.649  13.434 1.00 60.75  ? 287 LYS B CD    1 
ATOM   6696 C  CE    . LYS B 2 299 ? 66.642 90.953  12.985 1.00 60.72  ? 287 LYS B CE    1 
ATOM   6697 N  NZ    . LYS B 2 299 ? 66.917 91.201  11.542 1.00 62.28  ? 287 LYS B NZ    1 
ATOM   6698 N  N     . ALA B 2 300 ? 61.114 94.307  12.763 1.00 52.96  ? 288 ALA B N     1 
ATOM   6699 C  CA    . ALA B 2 300 ? 59.893 94.975  13.144 1.00 51.56  ? 288 ALA B CA    1 
ATOM   6700 C  C     . ALA B 2 300 ? 60.067 95.398  14.593 1.00 51.97  ? 288 ALA B C     1 
ATOM   6701 O  O     . ALA B 2 300 ? 60.863 94.814  15.319 1.00 52.83  ? 288 ALA B O     1 
ATOM   6702 C  CB    . ALA B 2 300 ? 58.722 94.029  13.006 1.00 51.02  ? 288 ALA B CB    1 
ATOM   6703 N  N     . LEU B 2 301 ? 59.318 96.407  15.017 1.00 50.81  ? 289 LEU B N     1 
ATOM   6704 C  CA    . LEU B 2 301 ? 59.573 97.038  16.296 1.00 48.37  ? 289 LEU B CA    1 
ATOM   6705 C  C     . LEU B 2 301 ? 59.387 96.147  17.514 1.00 49.04  ? 289 LEU B C     1 
ATOM   6706 O  O     . LEU B 2 301 ? 60.075 96.328  18.520 1.00 49.13  ? 289 LEU B O     1 
ATOM   6707 C  CB    . LEU B 2 301 ? 58.710 98.283  16.436 1.00 45.08  ? 289 LEU B CB    1 
ATOM   6708 C  CG    . LEU B 2 301 ? 59.527 99.559  16.312 1.00 43.74  ? 289 LEU B CG    1 
ATOM   6709 C  CD1   . LEU B 2 301 ? 60.688 99.294  15.380 1.00 42.65  ? 289 LEU B CD1   1 
ATOM   6710 C  CD2   . LEU B 2 301 ? 58.658 100.710 15.824 1.00 41.93  ? 289 LEU B CD2   1 
ATOM   6711 N  N     . THR B 2 302 ? 58.462 95.198  17.451 1.00 49.41  ? 290 THR B N     1 
ATOM   6712 C  CA    . THR B 2 302 ? 58.106 94.485  18.671 1.00 51.96  ? 290 THR B CA    1 
ATOM   6713 C  C     . THR B 2 302 ? 58.757 93.114  18.742 1.00 53.06  ? 290 THR B C     1 
ATOM   6714 O  O     . THR B 2 302 ? 58.592 92.380  19.719 1.00 50.28  ? 290 THR B O     1 
ATOM   6715 C  CB    . THR B 2 302 ? 56.563 94.371  18.835 1.00 52.28  ? 290 THR B CB    1 
ATOM   6716 O  OG1   . THR B 2 302 ? 56.010 93.530  17.815 1.00 55.28  ? 290 THR B OG1   1 
ATOM   6717 C  CG2   . THR B 2 302 ? 55.930 95.748  18.740 1.00 51.31  ? 290 THR B CG2   1 
ATOM   6718 N  N     . GLU B 2 303 ? 59.523 92.789  17.702 1.00 56.74  ? 291 GLU B N     1 
ATOM   6719 C  CA    . GLU B 2 303 ? 60.288 91.547  17.667 1.00 59.08  ? 291 GLU B CA    1 
ATOM   6720 C  C     . GLU B 2 303 ? 61.165 91.551  18.885 1.00 59.48  ? 291 GLU B C     1 
ATOM   6721 O  O     . GLU B 2 303 ? 61.736 92.588  19.213 1.00 59.45  ? 291 GLU B O     1 
ATOM   6722 C  CB    . GLU B 2 303 ? 61.171 91.474  16.418 1.00 60.34  ? 291 GLU B CB    1 
ATOM   6723 C  CG    . GLU B 2 303 ? 62.023 90.199  16.343 1.00 65.87  ? 291 GLU B CG    1 
ATOM   6724 C  CD    . GLU B 2 303 ? 62.780 90.056  15.021 1.00 69.13  ? 291 GLU B CD    1 
ATOM   6725 O  OE1   . GLU B 2 303 ? 63.799 89.319  14.984 1.00 68.87  ? 291 GLU B OE1   1 
ATOM   6726 O  OE2   . GLU B 2 303 ? 62.351 90.683  14.022 1.00 71.24  ? 291 GLU B OE2   1 
ATOM   6727 N  N     . VAL B 2 304 ? 61.269 90.413  19.566 1.00 59.94  ? 292 VAL B N     1 
ATOM   6728 C  CA    . VAL B 2 304 ? 62.209 90.324  20.673 1.00 60.61  ? 292 VAL B CA    1 
ATOM   6729 C  C     . VAL B 2 304 ? 63.608 89.978  20.190 1.00 62.98  ? 292 VAL B C     1 
ATOM   6730 O  O     . VAL B 2 304 ? 63.795 89.202  19.255 1.00 62.82  ? 292 VAL B O     1 
ATOM   6731 C  CB    . VAL B 2 304 ? 61.777 89.303  21.728 1.00 57.57  ? 292 VAL B CB    1 
ATOM   6732 C  CG1   . VAL B 2 304 ? 62.902 89.073  22.693 1.00 57.37  ? 292 VAL B CG1   1 
ATOM   6733 C  CG2   . VAL B 2 304 ? 60.587 89.822  22.493 1.00 57.21  ? 292 VAL B CG2   1 
ATOM   6734 N  N     . ILE B 2 305 ? 64.589 90.600  20.823 1.00 66.14  ? 293 ILE B N     1 
ATOM   6735 C  CA    . ILE B 2 305 ? 65.974 90.339  20.527 1.00 70.02  ? 293 ILE B CA    1 
ATOM   6736 C  C     . ILE B 2 305 ? 66.602 89.647  21.727 1.00 74.07  ? 293 ILE B C     1 
ATOM   6737 O  O     . ILE B 2 305 ? 66.589 90.160  22.849 1.00 73.93  ? 293 ILE B O     1 
ATOM   6738 C  CB    . ILE B 2 305 ? 66.732 91.655  20.225 1.00 69.97  ? 293 ILE B CB    1 
ATOM   6739 C  CG1   . ILE B 2 305 ? 66.099 92.353  19.020 1.00 68.96  ? 293 ILE B CG1   1 
ATOM   6740 C  CG2   . ILE B 2 305 ? 68.204 91.371  19.961 1.00 70.15  ? 293 ILE B CG2   1 
ATOM   6741 C  CD1   . ILE B 2 305 ? 65.834 91.429  17.855 1.00 68.03  ? 293 ILE B CD1   1 
ATOM   6742 N  N     . PRO B 2 306 ? 67.142 88.446  21.507 1.00 78.78  ? 294 PRO B N     1 
ATOM   6743 C  CA    . PRO B 2 306 ? 68.045 87.854  22.496 1.00 81.69  ? 294 PRO B CA    1 
ATOM   6744 C  C     . PRO B 2 306 ? 69.332 88.669  22.619 1.00 83.96  ? 294 PRO B C     1 
ATOM   6745 O  O     . PRO B 2 306 ? 70.161 88.702  21.703 1.00 83.10  ? 294 PRO B O     1 
ATOM   6746 C  CB    . PRO B 2 306 ? 68.296 86.445  21.955 1.00 81.91  ? 294 PRO B CB    1 
ATOM   6747 C  CG    . PRO B 2 306 ? 68.022 86.542  20.479 1.00 81.49  ? 294 PRO B CG    1 
ATOM   6748 C  CD    . PRO B 2 306 ? 66.936 87.573  20.336 1.00 80.13  ? 294 PRO B CD    1 
ATOM   6749 N  N     . LEU B 2 307 ? 69.486 89.336  23.757 1.00 86.95  ? 295 LEU B N     1 
ATOM   6750 C  CA    . LEU B 2 307 ? 70.716 90.053  24.050 1.00 90.90  ? 295 LEU B CA    1 
ATOM   6751 C  C     . LEU B 2 307 ? 71.892 89.076  24.020 1.00 92.95  ? 295 LEU B C     1 
ATOM   6752 O  O     . LEU B 2 307 ? 71.864 88.041  24.685 1.00 94.27  ? 295 LEU B O     1 
ATOM   6753 C  CB    . LEU B 2 307 ? 70.614 90.718  25.430 1.00 91.58  ? 295 LEU B CB    1 
ATOM   6754 C  CG    . LEU B 2 307 ? 70.071 92.154  25.494 1.00 92.51  ? 295 LEU B CG    1 
ATOM   6755 C  CD1   . LEU B 2 307 ? 71.225 93.144  25.405 1.00 92.67  ? 295 LEU B CD1   1 
ATOM   6756 C  CD2   . LEU B 2 307 ? 69.067 92.383  24.366 1.00 92.20  ? 295 LEU B CD2   1 
ATOM   6757 N  N     . THR B 2 308 ? 72.923 89.398  23.248 1.00 94.18  ? 296 THR B N     1 
ATOM   6758 C  CA    . THR B 2 308 ? 74.085 88.529  23.166 1.00 95.66  ? 296 THR B CA    1 
ATOM   6759 C  C     . THR B 2 308 ? 75.058 88.750  24.323 1.00 97.86  ? 296 THR B C     1 
ATOM   6760 O  O     . THR B 2 308 ? 74.788 89.520  25.246 1.00 97.54  ? 296 THR B O     1 
ATOM   6761 C  CB    . THR B 2 308 ? 74.828 88.745  21.854 1.00 95.19  ? 296 THR B CB    1 
ATOM   6762 O  OG1   . THR B 2 308 ? 75.344 90.081  21.809 1.00 95.30  ? 296 THR B OG1   1 
ATOM   6763 C  CG2   . THR B 2 308 ? 73.893 88.527  20.692 1.00 94.69  ? 296 THR B CG2   1 
ATOM   6764 N  N     . GLU B 2 309 ? 76.195 88.066  24.261 1.00 100.64 ? 297 GLU B N     1 
ATOM   6765 C  CA    . GLU B 2 309 ? 77.193 88.116  25.323 1.00 103.13 ? 297 GLU B CA    1 
ATOM   6766 C  C     . GLU B 2 309 ? 77.767 89.519  25.498 1.00 103.56 ? 297 GLU B C     1 
ATOM   6767 O  O     . GLU B 2 309 ? 77.619 90.128  26.561 1.00 102.63 ? 297 GLU B O     1 
ATOM   6768 C  CB    . GLU B 2 309 ? 78.319 87.128  25.011 1.00 105.24 ? 297 GLU B CB    1 
ATOM   6769 C  CG    . GLU B 2 309 ? 78.137 86.419  23.672 1.00 108.73 ? 297 GLU B CG    1 
ATOM   6770 C  CD    . GLU B 2 309 ? 79.063 85.224  23.490 1.00 110.69 ? 297 GLU B CD    1 
ATOM   6771 O  OE1   . GLU B 2 309 ? 78.989 84.276  24.303 1.00 111.26 ? 297 GLU B OE1   1 
ATOM   6772 O  OE2   . GLU B 2 309 ? 79.864 85.231  22.529 1.00 112.02 ? 297 GLU B OE2   1 
ATOM   6773 N  N     . GLU B 2 310 ? 78.415 90.029  24.453 1.00 104.20 ? 298 GLU B N     1 
ATOM   6774 C  CA    . GLU B 2 310 ? 79.035 91.349  24.510 1.00 105.01 ? 298 GLU B CA    1 
ATOM   6775 C  C     . GLU B 2 310 ? 77.988 92.435  24.662 1.00 105.24 ? 298 GLU B C     1 
ATOM   6776 O  O     . GLU B 2 310 ? 78.205 93.421  25.365 1.00 105.93 ? 298 GLU B O     1 
ATOM   6777 C  CB    . GLU B 2 310 ? 79.864 91.619  23.252 1.00 105.69 ? 298 GLU B CB    1 
ATOM   6778 C  CG    . GLU B 2 310 ? 79.198 91.200  21.955 1.00 107.46 ? 298 GLU B CG    1 
ATOM   6779 C  CD    . GLU B 2 310 ? 79.643 89.817  21.497 1.00 108.38 ? 298 GLU B CD    1 
ATOM   6780 O  OE1   . GLU B 2 310 ? 80.425 89.731  20.521 1.00 108.10 ? 298 GLU B OE1   1 
ATOM   6781 O  OE2   . GLU B 2 310 ? 79.213 88.818  22.118 1.00 108.17 ? 298 GLU B OE2   1 
ATOM   6782 N  N     . ALA B 2 311 ? 76.849 92.255  24.004 1.00 104.52 ? 299 ALA B N     1 
ATOM   6783 C  CA    . ALA B 2 311 ? 75.739 93.171  24.194 1.00 103.75 ? 299 ALA B CA    1 
ATOM   6784 C  C     . ALA B 2 311 ? 75.555 93.434  25.688 1.00 103.19 ? 299 ALA B C     1 
ATOM   6785 O  O     . ALA B 2 311 ? 75.877 94.514  26.175 1.00 102.01 ? 299 ALA B O     1 
ATOM   6786 C  CB    . ALA B 2 311 ? 74.470 92.580  23.604 1.00 104.16 ? 299 ALA B CB    1 
ATOM   6787 N  N     . GLU B 2 312 ? 75.062 92.431  26.412 1.00 103.35 ? 300 GLU B N     1 
ATOM   6788 C  CA    . GLU B 2 312 ? 74.716 92.584  27.823 1.00 103.74 ? 300 GLU B CA    1 
ATOM   6789 C  C     . GLU B 2 312 ? 75.905 93.041  28.653 1.00 103.70 ? 300 GLU B C     1 
ATOM   6790 O  O     . GLU B 2 312 ? 75.737 93.648  29.710 1.00 103.00 ? 300 GLU B O     1 
ATOM   6791 C  CB    . GLU B 2 312 ? 74.176 91.264  28.387 1.00 104.36 ? 300 GLU B CB    1 
ATOM   6792 C  CG    . GLU B 2 312 ? 73.895 91.283  29.889 1.00 105.88 ? 300 GLU B CG    1 
ATOM   6793 C  CD    . GLU B 2 312 ? 72.551 91.910  30.247 1.00 107.53 ? 300 GLU B CD    1 
ATOM   6794 O  OE1   . GLU B 2 312 ? 72.517 92.763  31.162 1.00 108.41 ? 300 GLU B OE1   1 
ATOM   6795 O  OE2   . GLU B 2 312 ? 71.528 91.549  29.623 1.00 107.87 ? 300 GLU B OE2   1 
ATOM   6796 N  N     . LEU B 2 313 ? 77.108 92.748  28.173 1.00 104.33 ? 301 LEU B N     1 
ATOM   6797 C  CA    . LEU B 2 313 ? 78.317 93.125  28.893 1.00 105.01 ? 301 LEU B CA    1 
ATOM   6798 C  C     . LEU B 2 313 ? 78.900 94.435  28.362 1.00 104.18 ? 301 LEU B C     1 
ATOM   6799 O  O     . LEU B 2 313 ? 80.016 94.814  28.705 1.00 104.17 ? 301 LEU B O     1 
ATOM   6800 C  CB    . LEU B 2 313 ? 79.361 92.000  28.808 1.00 106.69 ? 301 LEU B CB    1 
ATOM   6801 C  CG    . LEU B 2 313 ? 78.986 90.640  29.431 1.00 108.24 ? 301 LEU B CG    1 
ATOM   6802 C  CD1   . LEU B 2 313 ? 80.149 89.658  29.274 1.00 107.82 ? 301 LEU B CD1   1 
ATOM   6803 C  CD2   . LEU B 2 313 ? 78.629 90.811  30.911 1.00 107.82 ? 301 LEU B CD2   1 
ATOM   6804 N  N     . GLU B 2 314 ? 78.140 95.124  27.518 1.00 103.32 ? 302 GLU B N     1 
ATOM   6805 C  CA    . GLU B 2 314 ? 78.493 96.479  27.122 1.00 102.03 ? 302 GLU B CA    1 
ATOM   6806 C  C     . GLU B 2 314 ? 77.620 97.476  27.856 1.00 101.15 ? 302 GLU B C     1 
ATOM   6807 O  O     . GLU B 2 314 ? 78.096 98.517  28.288 1.00 101.96 ? 302 GLU B O     1 
ATOM   6808 C  CB    . GLU B 2 314 ? 78.313 96.678  25.620 1.00 102.50 ? 302 GLU B CB    1 
ATOM   6809 C  CG    . GLU B 2 314 ? 78.454 98.130  25.188 1.00 103.39 ? 302 GLU B CG    1 
ATOM   6810 C  CD    . GLU B 2 314 ? 78.120 98.348  23.720 1.00 104.86 ? 302 GLU B CD    1 
ATOM   6811 O  OE1   . GLU B 2 314 ? 77.272 97.607  23.182 1.00 105.58 ? 302 GLU B OE1   1 
ATOM   6812 O  OE2   . GLU B 2 314 ? 78.704 99.264  23.101 1.00 105.37 ? 302 GLU B OE2   1 
ATOM   6813 N  N     . LEU B 2 315 ? 76.337 97.156  27.992 1.00 99.89  ? 303 LEU B N     1 
ATOM   6814 C  CA    . LEU B 2 315 ? 75.413 98.026  28.709 1.00 98.18  ? 303 LEU B CA    1 
ATOM   6815 C  C     . LEU B 2 315 ? 75.550 97.799  30.206 1.00 97.73  ? 303 LEU B C     1 
ATOM   6816 O  O     . LEU B 2 315 ? 75.245 98.677  31.016 1.00 97.03  ? 303 LEU B O     1 
ATOM   6817 C  CB    . LEU B 2 315 ? 73.969 97.763  28.265 1.00 97.45  ? 303 LEU B CB    1 
ATOM   6818 C  CG    . LEU B 2 315 ? 73.191 96.569  28.816 1.00 96.04  ? 303 LEU B CG    1 
ATOM   6819 C  CD1   . LEU B 2 315 ? 72.237 97.025  29.903 1.00 95.72  ? 303 LEU B CD1   1 
ATOM   6820 C  CD2   . LEU B 2 315 ? 72.407 95.931  27.688 1.00 96.82  ? 303 LEU B CD2   1 
ATOM   6821 N  N     . ALA B 2 316 ? 76.018 96.611  30.568 1.00 97.85  ? 304 ALA B N     1 
ATOM   6822 C  CA    . ALA B 2 316 ? 76.357 96.324  31.952 1.00 97.13  ? 304 ALA B CA    1 
ATOM   6823 C  C     . ALA B 2 316 ? 77.470 97.271  32.374 1.00 96.35  ? 304 ALA B C     1 
ATOM   6824 O  O     . ALA B 2 316 ? 77.412 97.892  33.437 1.00 95.90  ? 304 ALA B O     1 
ATOM   6825 C  CB    . ALA B 2 316 ? 76.816 94.885  32.082 1.00 97.82  ? 304 ALA B CB    1 
ATOM   6826 N  N     . GLU B 2 317 ? 78.482 97.389  31.527 1.00 95.09  ? 305 GLU B N     1 
ATOM   6827 C  CA    . GLU B 2 317 ? 79.551 98.322  31.797 1.00 95.24  ? 305 GLU B CA    1 
ATOM   6828 C  C     . GLU B 2 317 ? 79.070 99.762  31.667 1.00 94.61  ? 305 GLU B C     1 
ATOM   6829 O  O     . GLU B 2 317 ? 79.326 100.582 32.543 1.00 94.82  ? 305 GLU B O     1 
ATOM   6830 C  CB    . GLU B 2 317 ? 80.716 98.062  30.851 1.00 97.14  ? 305 GLU B CB    1 
ATOM   6831 C  CG    . GLU B 2 317 ? 81.446 96.767  31.152 1.00 100.42 ? 305 GLU B CG    1 
ATOM   6832 C  CD    . GLU B 2 317 ? 82.956 96.926  31.114 1.00 102.59 ? 305 GLU B CD    1 
ATOM   6833 O  OE1   . GLU B 2 317 ? 83.446 97.710  30.266 1.00 104.36 ? 305 GLU B OE1   1 
ATOM   6834 O  OE2   . GLU B 2 317 ? 83.649 96.269  31.928 1.00 102.43 ? 305 GLU B OE2   1 
ATOM   6835 N  N     . ASN B 2 318 ? 78.368 100.070 30.580 1.00 93.71  ? 306 ASN B N     1 
ATOM   6836 C  CA    . ASN B 2 318 ? 77.867 101.427 30.365 1.00 92.23  ? 306 ASN B CA    1 
ATOM   6837 C  C     . ASN B 2 318 ? 77.124 101.917 31.603 1.00 91.93  ? 306 ASN B C     1 
ATOM   6838 O  O     . ASN B 2 318 ? 77.219 103.088 31.966 1.00 92.04  ? 306 ASN B O     1 
ATOM   6839 C  CB    . ASN B 2 318 ? 76.922 101.483 29.155 1.00 90.89  ? 306 ASN B CB    1 
ATOM   6840 C  CG    . ASN B 2 318 ? 77.660 101.508 27.819 1.00 89.90  ? 306 ASN B CG    1 
ATOM   6841 O  OD1   . ASN B 2 318 ? 78.574 102.307 27.608 1.00 89.60  ? 306 ASN B OD1   1 
ATOM   6842 N  ND2   . ASN B 2 318 ? 77.253 100.633 26.907 1.00 89.18  ? 306 ASN B ND2   1 
ATOM   6843 N  N     . ARG B 2 319 ? 76.389 101.019 32.251 1.00 91.98  ? 307 ARG B N     1 
ATOM   6844 C  CA    . ARG B 2 319 ? 75.593 101.394 33.415 1.00 92.46  ? 307 ARG B CA    1 
ATOM   6845 C  C     . ARG B 2 319 ? 76.501 101.665 34.607 1.00 93.08  ? 307 ARG B C     1 
ATOM   6846 O  O     . ARG B 2 319 ? 76.052 102.124 35.662 1.00 92.39  ? 307 ARG B O     1 
ATOM   6847 C  CB    . ARG B 2 319 ? 74.588 100.289 33.762 1.00 91.93  ? 307 ARG B CB    1 
ATOM   6848 C  CG    . ARG B 2 319 ? 73.455 100.747 34.689 1.00 90.82  ? 307 ARG B CG    1 
ATOM   6849 C  CD    . ARG B 2 319 ? 72.187 99.969  34.410 1.00 89.31  ? 307 ARG B CD    1 
ATOM   6850 N  NE    . ARG B 2 319 ? 72.500 98.686  33.786 1.00 89.09  ? 307 ARG B NE    1 
ATOM   6851 C  CZ    . ARG B 2 319 ? 71.611 97.736  33.519 1.00 88.33  ? 307 ARG B CZ    1 
ATOM   6852 N  NH1   . ARG B 2 319 ? 70.329 97.914  33.821 1.00 87.30  ? 307 ARG B NH1   1 
ATOM   6853 N  NH2   . ARG B 2 319 ? 72.008 96.605  32.948 1.00 87.54  ? 307 ARG B NH2   1 
ATOM   6854 N  N     . GLU B 2 320 ? 77.786 101.379 34.426 1.00 94.07  ? 308 GLU B N     1 
ATOM   6855 C  CA    . GLU B 2 320 ? 78.795 101.689 35.435 1.00 94.37  ? 308 GLU B CA    1 
ATOM   6856 C  C     . GLU B 2 320 ? 79.280 103.121 35.256 1.00 93.06  ? 308 GLU B C     1 
ATOM   6857 O  O     . GLU B 2 320 ? 79.396 103.875 36.222 1.00 92.60  ? 308 GLU B O     1 
ATOM   6858 C  CB    . GLU B 2 320 ? 79.980 100.725 35.312 1.00 95.70  ? 308 GLU B CB    1 
ATOM   6859 C  CG    . GLU B 2 320 ? 80.847 100.645 36.557 1.00 97.37  ? 308 GLU B CG    1 
ATOM   6860 C  CD    . GLU B 2 320 ? 81.525 99.294  36.702 1.00 97.98  ? 308 GLU B CD    1 
ATOM   6861 O  OE1   . GLU B 2 320 ? 80.827 98.310  37.043 1.00 97.61  ? 308 GLU B OE1   1 
ATOM   6862 O  OE2   . GLU B 2 320 ? 82.754 99.220  36.473 1.00 98.17  ? 308 GLU B OE2   1 
ATOM   6863 N  N     . ILE B 2 321 ? 79.555 103.494 34.012 1.00 91.53  ? 309 ILE B N     1 
ATOM   6864 C  CA    . ILE B 2 321 ? 79.982 104.847 33.727 1.00 90.36  ? 309 ILE B CA    1 
ATOM   6865 C  C     . ILE B 2 321 ? 78.964 105.834 34.270 1.00 89.41  ? 309 ILE B C     1 
ATOM   6866 O  O     . ILE B 2 321 ? 79.330 106.849 34.848 1.00 89.85  ? 309 ILE B O     1 
ATOM   6867 C  CB    . ILE B 2 321 ? 80.147 105.077 32.222 1.00 90.73  ? 309 ILE B CB    1 
ATOM   6868 C  CG1   . ILE B 2 321 ? 81.165 104.089 31.657 1.00 90.66  ? 309 ILE B CG1   1 
ATOM   6869 C  CG2   . ILE B 2 321 ? 80.635 106.495 31.960 1.00 91.25  ? 309 ILE B CG2   1 
ATOM   6870 C  CD1   . ILE B 2 321 ? 81.702 104.493 30.295 1.00 90.58  ? 309 ILE B CD1   1 
ATOM   6871 N  N     . LEU B 2 322 ? 77.684 105.526 34.102 1.00 89.09  ? 310 LEU B N     1 
ATOM   6872 C  CA    . LEU B 2 322 ? 76.619 106.428 34.546 1.00 88.95  ? 310 LEU B CA    1 
ATOM   6873 C  C     . LEU B 2 322 ? 76.561 106.578 36.064 1.00 88.47  ? 310 LEU B C     1 
ATOM   6874 O  O     . LEU B 2 322 ? 75.786 107.379 36.585 1.00 87.28  ? 310 LEU B O     1 
ATOM   6875 C  CB    . LEU B 2 322 ? 75.261 105.936 34.038 1.00 88.54  ? 310 LEU B CB    1 
ATOM   6876 C  CG    . LEU B 2 322 ? 75.113 105.795 32.525 1.00 87.25  ? 310 LEU B CG    1 
ATOM   6877 C  CD1   . LEU B 2 322 ? 73.770 105.181 32.213 1.00 86.95  ? 310 LEU B CD1   1 
ATOM   6878 C  CD2   . LEU B 2 322 ? 75.248 107.151 31.865 1.00 86.88  ? 310 LEU B CD2   1 
ATOM   6879 N  N     . LYS B 2 323 ? 77.376 105.799 36.765 1.00 89.10  ? 311 LYS B N     1 
ATOM   6880 C  CA    . LYS B 2 323 ? 77.453 105.889 38.216 1.00 90.52  ? 311 LYS B CA    1 
ATOM   6881 C  C     . LYS B 2 323 ? 78.384 107.033 38.607 1.00 91.92  ? 311 LYS B C     1 
ATOM   6882 O  O     . LYS B 2 323 ? 78.043 107.880 39.433 1.00 91.88  ? 311 LYS B O     1 
ATOM   6883 C  CB    . LYS B 2 323 ? 77.995 104.582 38.796 1.00 90.55  ? 311 LYS B CB    1 
ATOM   6884 C  CG    . LYS B 2 323 ? 77.439 103.327 38.158 1.00 90.43  ? 311 LYS B CG    1 
ATOM   6885 C  CD    . LYS B 2 323 ? 77.994 102.087 38.833 1.00 90.26  ? 311 LYS B CD    1 
ATOM   6886 C  CE    . LYS B 2 323 ? 77.465 101.964 40.250 1.00 90.63  ? 311 LYS B CE    1 
ATOM   6887 N  NZ    . LYS B 2 323 ? 77.420 100.547 40.709 1.00 90.43  ? 311 LYS B NZ    1 
ATOM   6888 N  N     . GLU B 2 324 ? 79.563 107.043 37.994 1.00 93.27  ? 312 GLU B N     1 
ATOM   6889 C  CA    . GLU B 2 324 ? 80.622 107.993 38.319 1.00 95.01  ? 312 GLU B CA    1 
ATOM   6890 C  C     . GLU B 2 324 ? 80.203 109.438 38.017 1.00 95.81  ? 312 GLU B C     1 
ATOM   6891 O  O     . GLU B 2 324 ? 79.471 109.696 37.055 1.00 96.92  ? 312 GLU B O     1 
ATOM   6892 C  CB    . GLU B 2 324 ? 81.877 107.631 37.515 1.00 96.23  ? 312 GLU B CB    1 
ATOM   6893 C  CG    . GLU B 2 324 ? 82.221 106.133 37.547 1.00 98.07  ? 312 GLU B CG    1 
ATOM   6894 C  CD    . GLU B 2 324 ? 83.019 105.670 36.328 1.00 99.26  ? 312 GLU B CD    1 
ATOM   6895 O  OE1   . GLU B 2 324 ? 83.187 106.480 35.385 1.00 99.36  ? 312 GLU B OE1   1 
ATOM   6896 O  OE2   . GLU B 2 324 ? 83.474 104.497 36.316 1.00 98.48  ? 312 GLU B OE2   1 
ATOM   6897 N  N     . PRO B 2 325 ? 80.657 110.400 38.843 1.00 95.48  ? 313 PRO B N     1 
ATOM   6898 C  CA    . PRO B 2 325 ? 80.428 111.833 38.596 1.00 94.77  ? 313 PRO B CA    1 
ATOM   6899 C  C     . PRO B 2 325 ? 81.004 112.319 37.259 1.00 94.12  ? 313 PRO B C     1 
ATOM   6900 O  O     . PRO B 2 325 ? 81.769 111.609 36.604 1.00 94.28  ? 313 PRO B O     1 
ATOM   6901 C  CB    . PRO B 2 325 ? 81.103 112.515 39.790 1.00 94.75  ? 313 PRO B CB    1 
ATOM   6902 C  CG    . PRO B 2 325 ? 81.087 111.477 40.869 1.00 95.13  ? 313 PRO B CG    1 
ATOM   6903 C  CD    . PRO B 2 325 ? 81.287 110.164 40.154 1.00 95.23  ? 313 PRO B CD    1 
ATOM   6904 N  N     . VAL B 2 326 ? 80.635 113.527 36.848 1.00 93.21  ? 314 VAL B N     1 
ATOM   6905 C  CA    . VAL B 2 326 ? 81.295 114.132 35.705 1.00 91.57  ? 314 VAL B CA    1 
ATOM   6906 C  C     . VAL B 2 326 ? 82.606 114.700 36.214 1.00 91.72  ? 314 VAL B C     1 
ATOM   6907 O  O     . VAL B 2 326 ? 82.648 115.362 37.254 1.00 90.63  ? 314 VAL B O     1 
ATOM   6908 C  CB    . VAL B 2 326 ? 80.489 115.281 35.111 1.00 90.70  ? 314 VAL B CB    1 
ATOM   6909 C  CG1   . VAL B 2 326 ? 80.787 115.387 33.630 1.00 89.76  ? 314 VAL B CG1   1 
ATOM   6910 C  CG2   . VAL B 2 326 ? 79.019 115.084 35.377 1.00 89.44  ? 314 VAL B CG2   1 
ATOM   6911 N  N     . HIS B 2 327 ? 83.679 114.435 35.484 1.00 92.06  ? 315 HIS B N     1 
ATOM   6912 C  CA    . HIS B 2 327 ? 85.002 114.841 35.929 1.00 92.42  ? 315 HIS B CA    1 
ATOM   6913 C  C     . HIS B 2 327 ? 85.427 116.158 35.278 1.00 90.70  ? 315 HIS B C     1 
ATOM   6914 O  O     . HIS B 2 327 ? 85.348 116.317 34.058 1.00 91.39  ? 315 HIS B O     1 
ATOM   6915 C  CB    . HIS B 2 327 ? 86.025 113.745 35.607 1.00 95.05  ? 315 HIS B CB    1 
ATOM   6916 C  CG    . HIS B 2 327 ? 87.354 113.951 36.267 1.00 98.55  ? 315 HIS B CG    1 
ATOM   6917 N  ND1   . HIS B 2 327 ? 88.347 114.734 35.717 1.00 99.91  ? 315 HIS B ND1   1 
ATOM   6918 C  CD2   . HIS B 2 327 ? 87.841 113.497 37.447 1.00 99.04  ? 315 HIS B CD2   1 
ATOM   6919 C  CE1   . HIS B 2 327 ? 89.389 114.756 36.530 1.00 100.08 ? 315 HIS B CE1   1 
ATOM   6920 N  NE2   . HIS B 2 327 ? 89.107 114.013 37.587 1.00 99.98  ? 315 HIS B NE2   1 
ATOM   6921 N  N     . GLY B 2 328 ? 85.877 117.102 36.096 1.00 87.91  ? 316 GLY B N     1 
ATOM   6922 C  CA    . GLY B 2 328 ? 86.373 118.348 35.551 1.00 83.54  ? 316 GLY B CA    1 
ATOM   6923 C  C     . GLY B 2 328 ? 85.242 119.258 35.133 1.00 80.54  ? 316 GLY B C     1 
ATOM   6924 O  O     . GLY B 2 328 ? 85.085 119.561 33.955 1.00 78.98  ? 316 GLY B O     1 
ATOM   6925 N  N     . VAL B 2 329 ? 84.440 119.677 36.105 1.00 78.48  ? 317 VAL B N     1 
ATOM   6926 C  CA    . VAL B 2 329 ? 83.461 120.729 35.885 1.00 77.23  ? 317 VAL B CA    1 
ATOM   6927 C  C     . VAL B 2 329 ? 83.471 121.704 37.056 1.00 76.76  ? 317 VAL B C     1 
ATOM   6928 O  O     . VAL B 2 329 ? 83.214 121.317 38.199 1.00 75.46  ? 317 VAL B O     1 
ATOM   6929 C  CB    . VAL B 2 329 ? 82.051 120.151 35.726 1.00 77.86  ? 317 VAL B CB    1 
ATOM   6930 C  CG1   . VAL B 2 329 ? 81.039 121.275 35.593 1.00 77.28  ? 317 VAL B CG1   1 
ATOM   6931 C  CG2   . VAL B 2 329 ? 82.002 119.254 34.505 1.00 78.27  ? 317 VAL B CG2   1 
ATOM   6932 N  N     . TYR B 2 330 ? 83.766 122.968 36.754 1.00 76.32  ? 318 TYR B N     1 
ATOM   6933 C  CA    . TYR B 2 330 ? 84.054 123.975 37.773 1.00 76.17  ? 318 TYR B CA    1 
ATOM   6934 C  C     . TYR B 2 330 ? 83.315 125.284 37.526 1.00 76.71  ? 318 TYR B C     1 
ATOM   6935 O  O     . TYR B 2 330 ? 83.314 125.808 36.416 1.00 77.51  ? 318 TYR B O     1 
ATOM   6936 C  CB    . TYR B 2 330 ? 85.560 124.236 37.817 1.00 74.99  ? 318 TYR B CB    1 
ATOM   6937 C  CG    . TYR B 2 330 ? 86.348 122.971 38.006 1.00 73.73  ? 318 TYR B CG    1 
ATOM   6938 C  CD1   . TYR B 2 330 ? 86.660 122.511 39.278 1.00 73.32  ? 318 TYR B CD1   1 
ATOM   6939 C  CD2   . TYR B 2 330 ? 86.695 122.182 36.917 1.00 73.24  ? 318 TYR B CD2   1 
ATOM   6940 C  CE1   . TYR B 2 330 ? 87.288 121.292 39.464 1.00 74.51  ? 318 TYR B CE1   1 
ATOM   6941 C  CE2   . TYR B 2 330 ? 87.318 120.963 37.089 1.00 74.48  ? 318 TYR B CE2   1 
ATOM   6942 C  CZ    . TYR B 2 330 ? 87.612 120.516 38.367 1.00 75.54  ? 318 TYR B CZ    1 
ATOM   6943 O  OH    . TYR B 2 330 ? 88.200 119.277 38.548 1.00 77.72  ? 318 TYR B OH    1 
ATOM   6944 N  N     . TYR B 2 331 ? 82.697 125.812 38.574 1.00 77.27  ? 319 TYR B N     1 
ATOM   6945 C  CA    . TYR B 2 331 ? 81.919 127.038 38.474 1.00 78.66  ? 319 TYR B CA    1 
ATOM   6946 C  C     . TYR B 2 331 ? 82.807 128.226 38.166 1.00 78.18  ? 319 TYR B C     1 
ATOM   6947 O  O     . TYR B 2 331 ? 83.859 128.397 38.763 1.00 78.26  ? 319 TYR B O     1 
ATOM   6948 C  CB    . TYR B 2 331 ? 81.164 127.277 39.782 1.00 81.24  ? 319 TYR B CB    1 
ATOM   6949 C  CG    . TYR B 2 331 ? 80.588 128.669 39.967 1.00 84.97  ? 319 TYR B CG    1 
ATOM   6950 C  CD1   . TYR B 2 331 ? 79.720 129.224 39.030 1.00 86.08  ? 319 TYR B CD1   1 
ATOM   6951 C  CD2   . TYR B 2 331 ? 80.855 129.400 41.122 1.00 85.98  ? 319 TYR B CD2   1 
ATOM   6952 C  CE1   . TYR B 2 331 ? 79.131 130.469 39.248 1.00 87.07  ? 319 TYR B CE1   1 
ATOM   6953 C  CE2   . TYR B 2 331 ? 80.271 130.639 41.348 1.00 87.10  ? 319 TYR B CE2   1 
ATOM   6954 C  CZ    . TYR B 2 331 ? 79.409 131.168 40.411 1.00 87.10  ? 319 TYR B CZ    1 
ATOM   6955 O  OH    . TYR B 2 331 ? 78.819 132.389 40.648 1.00 85.75  ? 319 TYR B OH    1 
ATOM   6956 N  N     . ASP B 2 332 ? 82.374 129.041 37.216 1.00 78.63  ? 320 ASP B N     1 
ATOM   6957 C  CA    . ASP B 2 332 ? 83.058 130.285 36.889 1.00 79.76  ? 320 ASP B CA    1 
ATOM   6958 C  C     . ASP B 2 332 ? 82.141 131.419 37.349 1.00 80.29  ? 320 ASP B C     1 
ATOM   6959 O  O     . ASP B 2 332 ? 81.166 131.753 36.678 1.00 81.55  ? 320 ASP B O     1 
ATOM   6960 C  CB    . ASP B 2 332 ? 83.304 130.368 35.366 1.00 79.24  ? 320 ASP B CB    1 
ATOM   6961 C  CG    . ASP B 2 332 ? 84.238 131.518 34.966 1.00 78.27  ? 320 ASP B CG    1 
ATOM   6962 O  OD1   . ASP B 2 332 ? 84.333 132.505 35.724 1.00 78.06  ? 320 ASP B OD1   1 
ATOM   6963 O  OD2   . ASP B 2 332 ? 84.872 131.433 33.887 1.00 75.80  ? 320 ASP B OD2   1 
ATOM   6964 N  N     . PRO B 2 333 ? 82.441 132.021 38.509 1.00 80.12  ? 321 PRO B N     1 
ATOM   6965 C  CA    . PRO B 2 333 ? 81.607 133.121 39.003 1.00 78.60  ? 321 PRO B CA    1 
ATOM   6966 C  C     . PRO B 2 333 ? 81.515 134.267 38.005 1.00 77.25  ? 321 PRO B C     1 
ATOM   6967 O  O     . PRO B 2 333 ? 80.577 135.056 38.048 1.00 77.59  ? 321 PRO B O     1 
ATOM   6968 C  CB    . PRO B 2 333 ? 82.288 133.539 40.303 1.00 79.03  ? 321 PRO B CB    1 
ATOM   6969 C  CG    . PRO B 2 333 ? 83.706 133.060 40.165 1.00 80.22  ? 321 PRO B CG    1 
ATOM   6970 C  CD    . PRO B 2 333 ? 83.643 131.812 39.337 1.00 80.71  ? 321 PRO B CD    1 
ATOM   6971 N  N     . SER B 2 334 ? 82.486 134.355 37.103 1.00 75.49  ? 322 SER B N     1 
ATOM   6972 C  CA    . SER B 2 334 ? 82.441 135.360 36.047 1.00 74.16  ? 322 SER B CA    1 
ATOM   6973 C  C     . SER B 2 334 ? 81.369 134.995 35.033 1.00 73.61  ? 322 SER B C     1 
ATOM   6974 O  O     . SER B 2 334 ? 80.583 135.842 34.627 1.00 75.36  ? 322 SER B O     1 
ATOM   6975 C  CB    . SER B 2 334 ? 83.787 135.459 35.332 1.00 73.73  ? 322 SER B CB    1 
ATOM   6976 O  OG    . SER B 2 334 ? 83.766 134.737 34.111 1.00 72.27  ? 322 SER B OG    1 
ATOM   6977 N  N     . LYS B 2 335 ? 81.335 133.729 34.633 1.00 72.25  ? 323 LYS B N     1 
ATOM   6978 C  CA    . LYS B 2 335 ? 80.433 133.283 33.582 1.00 70.74  ? 323 LYS B CA    1 
ATOM   6979 C  C     . LYS B 2 335 ? 78.990 133.126 34.029 1.00 71.42  ? 323 LYS B C     1 
ATOM   6980 O  O     . LYS B 2 335 ? 78.666 133.237 35.209 1.00 71.29  ? 323 LYS B O     1 
ATOM   6981 C  CB    . LYS B 2 335 ? 80.922 131.968 32.999 1.00 69.27  ? 323 LYS B CB    1 
ATOM   6982 C  CG    . LYS B 2 335 ? 82.186 132.109 32.191 1.00 69.20  ? 323 LYS B CG    1 
ATOM   6983 C  CD    . LYS B 2 335 ? 82.382 130.908 31.300 1.00 68.88  ? 323 LYS B CD    1 
ATOM   6984 C  CE    . LYS B 2 335 ? 83.706 130.977 30.590 1.00 69.19  ? 323 LYS B CE    1 
ATOM   6985 N  NZ    . LYS B 2 335 ? 83.914 129.761 29.775 1.00 70.70  ? 323 LYS B NZ    1 
ATOM   6986 N  N     . ASP B 2 336 ? 78.118 132.868 33.066 1.00 72.17  ? 324 ASP B N     1 
ATOM   6987 C  CA    . ASP B 2 336 ? 76.695 132.851 33.338 1.00 73.39  ? 324 ASP B CA    1 
ATOM   6988 C  C     . ASP B 2 336 ? 76.204 131.463 33.731 1.00 72.33  ? 324 ASP B C     1 
ATOM   6989 O  O     . ASP B 2 336 ? 76.518 130.463 33.080 1.00 71.73  ? 324 ASP B O     1 
ATOM   6990 C  CB    . ASP B 2 336 ? 75.927 133.350 32.112 1.00 76.51  ? 324 ASP B CB    1 
ATOM   6991 C  CG    . ASP B 2 336 ? 75.064 134.561 32.419 1.00 79.00  ? 324 ASP B CG    1 
ATOM   6992 O  OD1   . ASP B 2 336 ? 74.177 134.451 33.299 1.00 79.93  ? 324 ASP B OD1   1 
ATOM   6993 O  OD2   . ASP B 2 336 ? 75.276 135.618 31.780 1.00 79.39  ? 324 ASP B OD2   1 
ATOM   6994 N  N     . LEU B 2 337 ? 75.428 131.423 34.808 1.00 70.34  ? 325 LEU B N     1 
ATOM   6995 C  CA    . LEU B 2 337 ? 74.791 130.198 35.274 1.00 68.17  ? 325 LEU B CA    1 
ATOM   6996 C  C     . LEU B 2 337 ? 73.505 129.936 34.474 1.00 66.17  ? 325 LEU B C     1 
ATOM   6997 O  O     . LEU B 2 337 ? 72.687 130.838 34.283 1.00 66.36  ? 325 LEU B O     1 
ATOM   6998 C  CB    . LEU B 2 337 ? 74.465 130.344 36.762 1.00 69.11  ? 325 LEU B CB    1 
ATOM   6999 C  CG    . LEU B 2 337 ? 74.842 129.192 37.688 1.00 69.10  ? 325 LEU B CG    1 
ATOM   7000 C  CD1   . LEU B 2 337 ? 76.147 128.574 37.226 1.00 69.26  ? 325 LEU B CD1   1 
ATOM   7001 C  CD2   . LEU B 2 337 ? 74.945 129.704 39.118 1.00 68.48  ? 325 LEU B CD2   1 
ATOM   7002 N  N     . ILE B 2 338 ? 73.335 128.703 34.010 1.00 62.50  ? 326 ILE B N     1 
ATOM   7003 C  CA    . ILE B 2 338 ? 72.214 128.347 33.152 1.00 60.33  ? 326 ILE B CA    1 
ATOM   7004 C  C     . ILE B 2 338 ? 71.467 127.129 33.674 1.00 60.22  ? 326 ILE B C     1 
ATOM   7005 O  O     . ILE B 2 338 ? 71.974 126.011 33.600 1.00 60.14  ? 326 ILE B O     1 
ATOM   7006 C  CB    . ILE B 2 338 ? 72.688 127.995 31.750 1.00 60.07  ? 326 ILE B CB    1 
ATOM   7007 C  CG1   . ILE B 2 338 ? 73.392 129.183 31.124 1.00 59.52  ? 326 ILE B CG1   1 
ATOM   7008 C  CG2   . ILE B 2 338 ? 71.515 127.560 30.895 1.00 60.03  ? 326 ILE B CG2   1 
ATOM   7009 C  CD1   . ILE B 2 338 ? 73.905 128.887 29.727 1.00 60.67  ? 326 ILE B CD1   1 
ATOM   7010 N  N     . ALA B 2 339 ? 70.257 127.336 34.184 1.00 59.67  ? 327 ALA B N     1 
ATOM   7011 C  CA    . ALA B 2 339 ? 69.392 126.215 34.536 1.00 58.37  ? 327 ALA B CA    1 
ATOM   7012 C  C     . ALA B 2 339 ? 68.601 125.831 33.292 1.00 58.20  ? 327 ALA B C     1 
ATOM   7013 O  O     . ALA B 2 339 ? 68.388 126.654 32.405 1.00 59.13  ? 327 ALA B O     1 
ATOM   7014 C  CB    . ALA B 2 339 ? 68.449 126.602 35.664 1.00 57.77  ? 327 ALA B CB    1 
ATOM   7015 N  N     . GLU B 2 340 ? 68.192 124.574 33.216 1.00 56.91  ? 328 GLU B N     1 
ATOM   7016 C  CA    . GLU B 2 340 ? 67.440 124.082 32.077 1.00 55.90  ? 328 GLU B CA    1 
ATOM   7017 C  C     . GLU B 2 340 ? 66.488 123.024 32.617 1.00 55.42  ? 328 GLU B C     1 
ATOM   7018 O  O     . GLU B 2 340 ? 66.874 122.194 33.439 1.00 54.22  ? 328 GLU B O     1 
ATOM   7019 C  CB    . GLU B 2 340 ? 68.398 123.489 31.042 1.00 56.46  ? 328 GLU B CB    1 
ATOM   7020 C  CG    . GLU B 2 340 ? 67.734 122.909 29.799 1.00 58.18  ? 328 GLU B CG    1 
ATOM   7021 C  CD    . GLU B 2 340 ? 68.734 122.648 28.678 1.00 58.94  ? 328 GLU B CD    1 
ATOM   7022 O  OE1   . GLU B 2 340 ? 68.704 121.541 28.091 1.00 56.27  ? 328 GLU B OE1   1 
ATOM   7023 O  OE2   . GLU B 2 340 ? 69.548 123.556 28.384 1.00 58.11  ? 328 GLU B OE2   1 
ATOM   7024 N  N     . ILE B 2 341 ? 65.235 123.070 32.186 1.00 54.66  ? 329 ILE B N     1 
ATOM   7025 C  CA    . ILE B 2 341 ? 64.231 122.224 32.801 1.00 54.87  ? 329 ILE B CA    1 
ATOM   7026 C  C     . ILE B 2 341 ? 63.437 121.437 31.776 1.00 56.16  ? 329 ILE B C     1 
ATOM   7027 O  O     . ILE B 2 341 ? 63.300 121.860 30.626 1.00 56.92  ? 329 ILE B O     1 
ATOM   7028 C  CB    . ILE B 2 341 ? 63.274 123.044 33.661 1.00 52.35  ? 329 ILE B CB    1 
ATOM   7029 C  CG1   . ILE B 2 341 ? 64.068 123.836 34.693 1.00 51.80  ? 329 ILE B CG1   1 
ATOM   7030 C  CG2   . ILE B 2 341 ? 62.332 122.132 34.386 1.00 51.02  ? 329 ILE B CG2   1 
ATOM   7031 C  CD1   . ILE B 2 341 ? 63.237 124.798 35.513 1.00 51.59  ? 329 ILE B CD1   1 
ATOM   7032 N  N     . GLN B 2 342 ? 62.946 120.275 32.206 1.00 56.94  ? 330 GLN B N     1 
ATOM   7033 C  CA    . GLN B 2 342 ? 62.135 119.392 31.380 1.00 57.92  ? 330 GLN B CA    1 
ATOM   7034 C  C     . GLN B 2 342 ? 60.955 118.915 32.199 1.00 59.70  ? 330 GLN B C     1 
ATOM   7035 O  O     . GLN B 2 342 ? 61.087 118.608 33.386 1.00 58.42  ? 330 GLN B O     1 
ATOM   7036 C  CB    . GLN B 2 342 ? 62.935 118.171 30.916 1.00 56.80  ? 330 GLN B CB    1 
ATOM   7037 C  CG    . GLN B 2 342 ? 64.201 118.491 30.128 1.00 55.47  ? 330 GLN B CG    1 
ATOM   7038 C  CD    . GLN B 2 342 ? 65.428 118.614 31.008 1.00 53.71  ? 330 GLN B CD    1 
ATOM   7039 O  OE1   . GLN B 2 342 ? 65.799 117.675 31.700 1.00 52.42  ? 330 GLN B OE1   1 
ATOM   7040 N  NE2   . GLN B 2 342 ? 66.059 119.780 30.987 1.00 53.36  ? 330 GLN B NE2   1 
ATOM   7041 N  N     . LYS B 2 343 ? 59.798 118.868 31.551 1.00 62.52  ? 331 LYS B N     1 
ATOM   7042 C  CA    . LYS B 2 343 ? 58.609 118.280 32.137 1.00 64.36  ? 331 LYS B CA    1 
ATOM   7043 C  C     . LYS B 2 343 ? 58.706 116.794 31.889 1.00 65.67  ? 331 LYS B C     1 
ATOM   7044 O  O     . LYS B 2 343 ? 58.771 116.368 30.746 1.00 66.49  ? 331 LYS B O     1 
ATOM   7045 C  CB    . LYS B 2 343 ? 57.366 118.834 31.449 1.00 64.25  ? 331 LYS B CB    1 
ATOM   7046 C  CG    . LYS B 2 343 ? 56.116 118.046 31.721 1.00 67.26  ? 331 LYS B CG    1 
ATOM   7047 C  CD    . LYS B 2 343 ? 55.270 117.899 30.465 1.00 68.86  ? 331 LYS B CD    1 
ATOM   7048 C  CE    . LYS B 2 343 ? 54.308 119.064 30.317 1.00 70.61  ? 331 LYS B CE    1 
ATOM   7049 N  NZ    . LYS B 2 343 ? 53.250 119.008 31.368 1.00 71.34  ? 331 LYS B NZ    1 
ATOM   7050 N  N     . GLN B 2 344 ? 58.737 116.006 32.955 1.00 68.14  ? 332 GLN B N     1 
ATOM   7051 C  CA    . GLN B 2 344 ? 58.743 114.553 32.818 1.00 70.72  ? 332 GLN B CA    1 
ATOM   7052 C  C     . GLN B 2 344 ? 57.324 114.047 32.933 1.00 71.85  ? 332 GLN B C     1 
ATOM   7053 O  O     . GLN B 2 344 ? 56.984 112.982 32.424 1.00 71.20  ? 332 GLN B O     1 
ATOM   7054 C  CB    . GLN B 2 344 ? 59.597 113.917 33.913 1.00 72.42  ? 332 GLN B CB    1 
ATOM   7055 C  CG    . GLN B 2 344 ? 61.082 114.135 33.729 1.00 75.36  ? 332 GLN B CG    1 
ATOM   7056 C  CD    . GLN B 2 344 ? 61.600 113.458 32.481 1.00 77.47  ? 332 GLN B CD    1 
ATOM   7057 O  OE1   . GLN B 2 344 ? 61.304 112.284 32.231 1.00 79.18  ? 332 GLN B OE1   1 
ATOM   7058 N  NE2   . GLN B 2 344 ? 62.375 114.193 31.682 1.00 77.90  ? 332 GLN B NE2   1 
ATOM   7059 N  N     . GLY B 2 345 ? 56.499 114.833 33.613 1.00 73.87  ? 333 GLY B N     1 
ATOM   7060 C  CA    . GLY B 2 345 ? 55.138 114.426 33.872 1.00 76.51  ? 333 GLY B CA    1 
ATOM   7061 C  C     . GLY B 2 345 ? 55.011 113.860 35.267 1.00 78.07  ? 333 GLY B C     1 
ATOM   7062 O  O     . GLY B 2 345 ? 56.014 113.594 35.937 1.00 77.84  ? 333 GLY B O     1 
ATOM   7063 N  N     . GLN B 2 346 ? 53.771 113.675 35.704 1.00 79.62  ? 334 GLN B N     1 
ATOM   7064 C  CA    . GLN B 2 346 ? 53.508 113.215 37.056 1.00 81.10  ? 334 GLN B CA    1 
ATOM   7065 C  C     . GLN B 2 346 ? 54.191 114.122 38.059 1.00 80.43  ? 334 GLN B C     1 
ATOM   7066 O  O     . GLN B 2 346 ? 54.758 113.655 39.048 1.00 80.28  ? 334 GLN B O     1 
ATOM   7067 C  CB    . GLN B 2 346 ? 53.998 111.781 37.233 1.00 83.70  ? 334 GLN B CB    1 
ATOM   7068 C  CG    . GLN B 2 346 ? 52.993 110.759 36.745 1.00 88.16  ? 334 GLN B CG    1 
ATOM   7069 C  CD    . GLN B 2 346 ? 51.593 111.038 37.273 1.00 90.26  ? 334 GLN B CD    1 
ATOM   7070 O  OE1   . GLN B 2 346 ? 51.192 110.499 38.308 1.00 91.64  ? 334 GLN B OE1   1 
ATOM   7071 N  NE2   . GLN B 2 346 ? 50.845 111.886 36.566 1.00 89.99  ? 334 GLN B NE2   1 
ATOM   7072 N  N     . GLY B 2 347 ? 54.143 115.423 37.787 1.00 79.20  ? 335 GLY B N     1 
ATOM   7073 C  CA    . GLY B 2 347 ? 54.626 116.390 38.750 1.00 77.91  ? 335 GLY B CA    1 
ATOM   7074 C  C     . GLY B 2 347 ? 56.105 116.234 39.027 1.00 76.81  ? 335 GLY B C     1 
ATOM   7075 O  O     . GLY B 2 347 ? 56.611 116.745 40.029 1.00 77.16  ? 335 GLY B O     1 
ATOM   7076 N  N     . GLN B 2 348 ? 56.796 115.523 38.140 1.00 75.31  ? 336 GLN B N     1 
ATOM   7077 C  CA    . GLN B 2 348 ? 58.240 115.353 38.242 1.00 73.41  ? 336 GLN B CA    1 
ATOM   7078 C  C     . GLN B 2 348 ? 58.925 116.159 37.135 1.00 70.07  ? 336 GLN B C     1 
ATOM   7079 O  O     . GLN B 2 348 ? 58.672 115.939 35.954 1.00 69.73  ? 336 GLN B O     1 
ATOM   7080 C  CB    . GLN B 2 348 ? 58.603 113.861 38.117 1.00 75.90  ? 336 GLN B CB    1 
ATOM   7081 C  CG    . GLN B 2 348 ? 58.153 112.974 39.298 1.00 79.20  ? 336 GLN B CG    1 
ATOM   7082 C  CD    . GLN B 2 348 ? 59.315 112.513 40.207 1.00 81.92  ? 336 GLN B CD    1 
ATOM   7083 O  OE1   . GLN B 2 348 ? 59.109 111.774 41.186 1.00 81.72  ? 336 GLN B OE1   1 
ATOM   7084 N  NE2   . GLN B 2 348 ? 60.534 112.950 39.882 1.00 81.28  ? 336 GLN B NE2   1 
ATOM   7085 N  N     . TRP B 2 349 ? 59.781 117.100 37.518 1.00 66.51  ? 337 TRP B N     1 
ATOM   7086 C  CA    . TRP B 2 349 ? 60.509 117.911 36.541 1.00 63.12  ? 337 TRP B CA    1 
ATOM   7087 C  C     . TRP B 2 349 ? 61.989 117.713 36.765 1.00 59.56  ? 337 TRP B C     1 
ATOM   7088 O  O     . TRP B 2 349 ? 62.454 117.799 37.885 1.00 59.78  ? 337 TRP B O     1 
ATOM   7089 C  CB    . TRP B 2 349 ? 60.184 119.400 36.716 1.00 64.26  ? 337 TRP B CB    1 
ATOM   7090 C  CG    . TRP B 2 349 ? 58.720 119.718 36.704 1.00 65.17  ? 337 TRP B CG    1 
ATOM   7091 C  CD1   . TRP B 2 349 ? 57.830 119.506 37.714 1.00 65.69  ? 337 TRP B CD1   1 
ATOM   7092 C  CD2   . TRP B 2 349 ? 57.968 120.267 35.616 1.00 65.75  ? 337 TRP B CD2   1 
ATOM   7093 N  NE1   . TRP B 2 349 ? 56.570 119.883 37.322 1.00 65.77  ? 337 TRP B NE1   1 
ATOM   7094 C  CE2   . TRP B 2 349 ? 56.629 120.353 36.040 1.00 66.26  ? 337 TRP B CE2   1 
ATOM   7095 C  CE3   . TRP B 2 349 ? 58.296 120.692 34.331 1.00 66.05  ? 337 TRP B CE3   1 
ATOM   7096 C  CZ2   . TRP B 2 349 ? 55.620 120.848 35.215 1.00 66.92  ? 337 TRP B CZ2   1 
ATOM   7097 C  CZ3   . TRP B 2 349 ? 57.289 121.183 33.519 1.00 67.37  ? 337 TRP B CZ3   1 
ATOM   7098 C  CH2   . TRP B 2 349 ? 55.971 121.256 33.962 1.00 66.21  ? 337 TRP B CH2   1 
ATOM   7099 N  N     . THR B 2 350 ? 62.737 117.449 35.707 1.00 56.78  ? 338 THR B N     1 
ATOM   7100 C  CA    . THR B 2 350 ? 64.178 117.273 35.850 1.00 53.74  ? 338 THR B CA    1 
ATOM   7101 C  C     . THR B 2 350 ? 64.901 118.551 35.433 1.00 53.71  ? 338 THR B C     1 
ATOM   7102 O  O     . THR B 2 350 ? 64.453 119.253 34.538 1.00 54.69  ? 338 THR B O     1 
ATOM   7103 C  CB    . THR B 2 350 ? 64.695 116.097 34.982 1.00 50.89  ? 338 THR B CB    1 
ATOM   7104 O  OG1   . THR B 2 350 ? 64.522 116.409 33.596 1.00 47.58  ? 338 THR B OG1   1 
ATOM   7105 C  CG2   . THR B 2 350 ? 63.938 114.820 35.303 1.00 46.47  ? 338 THR B CG2   1 
ATOM   7106 N  N     . TYR B 2 351 ? 66.018 118.857 36.084 1.00 53.89  ? 339 TYR B N     1 
ATOM   7107 C  CA    . TYR B 2 351 ? 66.795 120.050 35.746 1.00 52.94  ? 339 TYR B CA    1 
ATOM   7108 C  C     . TYR B 2 351 ? 68.307 119.830 35.748 1.00 52.53  ? 339 TYR B C     1 
ATOM   7109 O  O     . TYR B 2 351 ? 68.832 118.979 36.468 1.00 52.68  ? 339 TYR B O     1 
ATOM   7110 C  CB    . TYR B 2 351 ? 66.466 121.180 36.718 1.00 52.37  ? 339 TYR B CB    1 
ATOM   7111 C  CG    . TYR B 2 351 ? 66.966 120.964 38.129 1.00 51.94  ? 339 TYR B CG    1 
ATOM   7112 C  CD1   . TYR B 2 351 ? 66.142 120.420 39.106 1.00 52.13  ? 339 TYR B CD1   1 
ATOM   7113 C  CD2   . TYR B 2 351 ? 68.252 121.346 38.494 1.00 52.95  ? 339 TYR B CD2   1 
ATOM   7114 C  CE1   . TYR B 2 351 ? 66.582 120.269 40.407 1.00 53.78  ? 339 TYR B CE1   1 
ATOM   7115 C  CE2   . TYR B 2 351 ? 68.702 121.204 39.794 1.00 53.24  ? 339 TYR B CE2   1 
ATOM   7116 C  CZ    . TYR B 2 351 ? 67.865 120.668 40.745 1.00 54.39  ? 339 TYR B CZ    1 
ATOM   7117 O  OH    . TYR B 2 351 ? 68.311 120.554 42.040 1.00 55.70  ? 339 TYR B OH    1 
ATOM   7118 N  N     . GLN B 2 352 ? 69.006 120.615 34.943 1.00 52.08  ? 340 GLN B N     1 
ATOM   7119 C  CA    . GLN B 2 352 ? 70.451 120.701 35.047 1.00 52.22  ? 340 GLN B CA    1 
ATOM   7120 C  C     . GLN B 2 352 ? 70.839 122.140 35.292 1.00 53.22  ? 340 GLN B C     1 
ATOM   7121 O  O     . GLN B 2 352 ? 70.224 123.039 34.738 1.00 53.83  ? 340 GLN B O     1 
ATOM   7122 C  CB    . GLN B 2 352 ? 71.104 120.230 33.760 1.00 50.56  ? 340 GLN B CB    1 
ATOM   7123 C  CG    . GLN B 2 352 ? 70.628 118.881 33.310 1.00 52.24  ? 340 GLN B CG    1 
ATOM   7124 C  CD    . GLN B 2 352 ? 69.245 118.927 32.697 1.00 51.88  ? 340 GLN B CD    1 
ATOM   7125 O  OE1   . GLN B 2 352 ? 69.046 119.509 31.624 1.00 52.75  ? 340 GLN B OE1   1 
ATOM   7126 N  NE2   . GLN B 2 352 ? 68.282 118.313 33.371 1.00 48.25  ? 340 GLN B NE2   1 
ATOM   7127 N  N     . ILE B 2 353 ? 71.850 122.363 36.125 1.00 54.50  ? 341 ILE B N     1 
ATOM   7128 C  CA    . ILE B 2 353 ? 72.623 123.597 36.040 1.00 55.35  ? 341 ILE B CA    1 
ATOM   7129 C  C     . ILE B 2 353 ? 73.894 123.341 35.257 1.00 56.17  ? 341 ILE B C     1 
ATOM   7130 O  O     . ILE B 2 353 ? 74.427 122.236 35.281 1.00 55.63  ? 341 ILE B O     1 
ATOM   7131 C  CB    . ILE B 2 353 ? 73.022 124.127 37.404 1.00 54.75  ? 341 ILE B CB    1 
ATOM   7132 C  CG1   . ILE B 2 353 ? 71.810 124.754 38.095 1.00 54.36  ? 341 ILE B CG1   1 
ATOM   7133 C  CG2   . ILE B 2 353 ? 74.139 125.132 37.233 1.00 54.84  ? 341 ILE B CG2   1 
ATOM   7134 C  CD1   . ILE B 2 353 ? 70.647 123.814 38.236 1.00 53.35  ? 341 ILE B CD1   1 
ATOM   7135 N  N     . TYR B 2 354 ? 74.375 124.355 34.554 1.00 57.32  ? 342 TYR B N     1 
ATOM   7136 C  CA    . TYR B 2 354 ? 75.520 124.159 33.693 1.00 59.55  ? 342 TYR B CA    1 
ATOM   7137 C  C     . TYR B 2 354 ? 75.994 125.465 33.095 1.00 60.75  ? 342 TYR B C     1 
ATOM   7138 O  O     . TYR B 2 354 ? 75.226 126.398 32.965 1.00 61.69  ? 342 TYR B O     1 
ATOM   7139 C  CB    . TYR B 2 354 ? 75.160 123.162 32.597 1.00 60.23  ? 342 TYR B CB    1 
ATOM   7140 C  CG    . TYR B 2 354 ? 74.371 123.722 31.440 1.00 62.75  ? 342 TYR B CG    1 
ATOM   7141 C  CD1   . TYR B 2 354 ? 75.021 124.291 30.350 1.00 63.84  ? 342 TYR B CD1   1 
ATOM   7142 C  CD2   . TYR B 2 354 ? 72.985 123.624 31.401 1.00 63.71  ? 342 TYR B CD2   1 
ATOM   7143 C  CE1   . TYR B 2 354 ? 74.318 124.742 29.252 1.00 65.14  ? 342 TYR B CE1   1 
ATOM   7144 C  CE2   . TYR B 2 354 ? 72.267 124.073 30.302 1.00 64.97  ? 342 TYR B CE2   1 
ATOM   7145 C  CZ    . TYR B 2 354 ? 72.944 124.630 29.229 1.00 66.17  ? 342 TYR B CZ    1 
ATOM   7146 O  OH    . TYR B 2 354 ? 72.260 125.070 28.122 1.00 67.34  ? 342 TYR B OH    1 
ATOM   7147 N  N     . GLN B 2 355 ? 77.269 125.545 32.745 1.00 63.74  ? 343 GLN B N     1 
ATOM   7148 C  CA    . GLN B 2 355 ? 77.778 126.757 32.130 1.00 66.68  ? 343 GLN B CA    1 
ATOM   7149 C  C     . GLN B 2 355 ? 78.283 126.468 30.744 1.00 68.61  ? 343 GLN B C     1 
ATOM   7150 O  O     . GLN B 2 355 ? 77.968 127.182 29.807 1.00 68.61  ? 343 GLN B O     1 
ATOM   7151 C  CB    . GLN B 2 355 ? 78.895 127.358 32.967 1.00 67.95  ? 343 GLN B CB    1 
ATOM   7152 C  CG    . GLN B 2 355 ? 78.404 128.050 34.217 1.00 69.41  ? 343 GLN B CG    1 
ATOM   7153 C  CD    . GLN B 2 355 ? 79.536 128.415 35.142 1.00 69.94  ? 343 GLN B CD    1 
ATOM   7154 O  OE1   . GLN B 2 355 ? 80.642 127.885 35.017 1.00 70.38  ? 343 GLN B OE1   1 
ATOM   7155 N  NE2   . GLN B 2 355 ? 79.272 129.321 36.078 1.00 69.08  ? 343 GLN B NE2   1 
ATOM   7156 N  N     . GLU B 2 356 ? 79.068 125.415 30.598 1.00 72.28  ? 344 GLU B N     1 
ATOM   7157 C  CA    . GLU B 2 356 ? 79.335 124.920 29.259 1.00 76.38  ? 344 GLU B CA    1 
ATOM   7158 C  C     . GLU B 2 356 ? 78.418 123.743 28.996 1.00 77.25  ? 344 GLU B C     1 
ATOM   7159 O  O     . GLU B 2 356 ? 78.345 122.806 29.791 1.00 77.70  ? 344 GLU B O     1 
ATOM   7160 C  CB    . GLU B 2 356 ? 80.805 124.510 29.108 1.00 78.95  ? 344 GLU B CB    1 
ATOM   7161 C  CG    . GLU B 2 356 ? 81.795 125.652 29.351 1.00 82.92  ? 344 GLU B CG    1 
ATOM   7162 C  CD    . GLU B 2 356 ? 81.356 126.972 28.716 1.00 85.81  ? 344 GLU B CD    1 
ATOM   7163 O  OE1   . GLU B 2 356 ? 80.457 126.958 27.844 1.00 86.33  ? 344 GLU B OE1   1 
ATOM   7164 O  OE2   . GLU B 2 356 ? 81.913 128.030 29.089 1.00 86.83  ? 344 GLU B OE2   1 
ATOM   7165 N  N     . PRO B 2 357 ? 77.689 123.780 27.873 1.00 78.23  ? 345 PRO B N     1 
ATOM   7166 C  CA    . PRO B 2 357 ? 76.673 122.757 27.615 1.00 78.59  ? 345 PRO B CA    1 
ATOM   7167 C  C     . PRO B 2 357 ? 77.248 121.343 27.737 1.00 78.86  ? 345 PRO B C     1 
ATOM   7168 O  O     . PRO B 2 357 ? 78.250 121.008 27.093 1.00 78.09  ? 345 PRO B O     1 
ATOM   7169 C  CB    . PRO B 2 357 ? 76.196 123.078 26.195 1.00 78.12  ? 345 PRO B CB    1 
ATOM   7170 C  CG    . PRO B 2 357 ? 76.501 124.535 26.021 1.00 77.91  ? 345 PRO B CG    1 
ATOM   7171 C  CD    . PRO B 2 357 ? 77.777 124.762 26.777 1.00 78.14  ? 345 PRO B CD    1 
ATOM   7172 N  N     . PHE B 2 358 ? 76.605 120.535 28.581 1.00 78.33  ? 346 PHE B N     1 
ATOM   7173 C  CA    . PHE B 2 358 ? 77.018 119.159 28.836 1.00 78.07  ? 346 PHE B CA    1 
ATOM   7174 C  C     . PHE B 2 358 ? 77.915 119.014 30.059 1.00 77.22  ? 346 PHE B C     1 
ATOM   7175 O  O     . PHE B 2 358 ? 78.120 117.905 30.563 1.00 77.42  ? 346 PHE B O     1 
ATOM   7176 C  CB    . PHE B 2 358 ? 77.719 118.571 27.611 1.00 78.23  ? 346 PHE B CB    1 
ATOM   7177 C  CG    . PHE B 2 358 ? 76.799 118.323 26.461 1.00 79.01  ? 346 PHE B CG    1 
ATOM   7178 C  CD1   . PHE B 2 358 ? 75.529 117.813 26.677 1.00 79.56  ? 346 PHE B CD1   1 
ATOM   7179 C  CD2   . PHE B 2 358 ? 77.207 118.572 25.167 1.00 79.47  ? 346 PHE B CD2   1 
ATOM   7180 C  CE1   . PHE B 2 358 ? 74.679 117.564 25.625 1.00 78.94  ? 346 PHE B CE1   1 
ATOM   7181 C  CE2   . PHE B 2 358 ? 76.360 118.324 24.107 1.00 80.31  ? 346 PHE B CE2   1 
ATOM   7182 C  CZ    . PHE B 2 358 ? 75.094 117.813 24.338 1.00 79.68  ? 346 PHE B CZ    1 
ATOM   7183 N  N     . LYS B 2 359 ? 78.449 120.127 30.543 1.00 75.64  ? 347 LYS B N     1 
ATOM   7184 C  CA    . LYS B 2 359 ? 79.216 120.094 31.782 1.00 73.94  ? 347 LYS B CA    1 
ATOM   7185 C  C     . LYS B 2 359 ? 78.380 120.587 32.963 1.00 72.08  ? 347 LYS B C     1 
ATOM   7186 O  O     . LYS B 2 359 ? 78.626 121.660 33.515 1.00 72.96  ? 347 LYS B O     1 
ATOM   7187 C  CB    . LYS B 2 359 ? 80.493 120.927 31.628 1.00 72.78  ? 347 LYS B CB    1 
ATOM   7188 C  CG    . LYS B 2 359 ? 81.470 120.348 30.618 1.00 71.25  ? 347 LYS B CG    1 
ATOM   7189 C  CD    . LYS B 2 359 ? 82.170 121.446 29.844 1.00 72.95  ? 347 LYS B CD    1 
ATOM   7190 C  CE    . LYS B 2 359 ? 83.403 120.930 29.100 1.00 74.37  ? 347 LYS B CE    1 
ATOM   7191 N  NZ    . LYS B 2 359 ? 84.518 120.498 30.008 1.00 72.85  ? 347 LYS B NZ    1 
ATOM   7192 N  N     . ASN B 2 360 ? 77.397 119.780 33.353 1.00 69.18  ? 348 ASN B N     1 
ATOM   7193 C  CA    . ASN B 2 360 ? 76.417 120.189 34.348 1.00 68.08  ? 348 ASN B CA    1 
ATOM   7194 C  C     . ASN B 2 360 ? 76.991 120.261 35.766 1.00 68.01  ? 348 ASN B C     1 
ATOM   7195 O  O     . ASN B 2 360 ? 77.437 119.266 36.320 1.00 67.58  ? 348 ASN B O     1 
ATOM   7196 C  CB    . ASN B 2 360 ? 75.226 119.226 34.330 1.00 66.09  ? 348 ASN B CB    1 
ATOM   7197 C  CG    . ASN B 2 360 ? 74.620 119.071 32.953 1.00 63.71  ? 348 ASN B CG    1 
ATOM   7198 O  OD1   . ASN B 2 360 ? 74.114 120.025 32.369 1.00 63.04  ? 348 ASN B OD1   1 
ATOM   7199 N  ND2   . ASN B 2 360 ? 74.666 117.862 32.428 1.00 63.20  ? 348 ASN B ND2   1 
ATOM   7200 N  N     . LEU B 2 361 ? 76.962 121.445 36.358 1.00 68.88  ? 349 LEU B N     1 
ATOM   7201 C  CA    . LEU B 2 361 ? 77.409 121.612 37.736 1.00 69.42  ? 349 LEU B CA    1 
ATOM   7202 C  C     . LEU B 2 361 ? 76.579 120.765 38.687 1.00 68.85  ? 349 LEU B C     1 
ATOM   7203 O  O     . LEU B 2 361 ? 77.027 120.409 39.777 1.00 69.92  ? 349 LEU B O     1 
ATOM   7204 C  CB    . LEU B 2 361 ? 77.309 123.081 38.146 1.00 69.73  ? 349 LEU B CB    1 
ATOM   7205 C  CG    . LEU B 2 361 ? 78.228 124.019 37.365 1.00 70.55  ? 349 LEU B CG    1 
ATOM   7206 C  CD1   . LEU B 2 361 ? 77.981 125.462 37.781 1.00 69.96  ? 349 LEU B CD1   1 
ATOM   7207 C  CD2   . LEU B 2 361 ? 79.675 123.607 37.612 1.00 69.76  ? 349 LEU B CD2   1 
ATOM   7208 N  N     . LYS B 2 362 ? 75.362 120.451 38.266 1.00 68.81  ? 350 LYS B N     1 
ATOM   7209 C  CA    . LYS B 2 362 ? 74.437 119.673 39.080 1.00 68.20  ? 350 LYS B CA    1 
ATOM   7210 C  C     . LYS B 2 362 ? 73.293 119.225 38.187 1.00 67.32  ? 350 LYS B C     1 
ATOM   7211 O  O     . LYS B 2 362 ? 73.060 119.805 37.130 1.00 67.60  ? 350 LYS B O     1 
ATOM   7212 C  CB    . LYS B 2 362 ? 73.906 120.532 40.235 1.00 67.80  ? 350 LYS B CB    1 
ATOM   7213 C  CG    . LYS B 2 362 ? 72.994 119.808 41.205 1.00 69.03  ? 350 LYS B CG    1 
ATOM   7214 C  CD    . LYS B 2 362 ? 72.679 120.689 42.402 1.00 70.82  ? 350 LYS B CD    1 
ATOM   7215 C  CE    . LYS B 2 362 ? 72.377 119.860 43.656 1.00 73.56  ? 350 LYS B CE    1 
ATOM   7216 N  NZ    . LYS B 2 362 ? 70.982 119.307 43.707 1.00 75.46  ? 350 LYS B NZ    1 
ATOM   7217 N  N     . THR B 2 363 ? 72.595 118.178 38.603 1.00 66.69  ? 351 THR B N     1 
ATOM   7218 C  CA    . THR B 2 363 ? 71.370 117.758 37.936 1.00 66.25  ? 351 THR B CA    1 
ATOM   7219 C  C     . THR B 2 363 ? 70.447 117.279 39.039 1.00 67.05  ? 351 THR B C     1 
ATOM   7220 O  O     . THR B 2 363 ? 70.914 116.746 40.041 1.00 68.67  ? 351 THR B O     1 
ATOM   7221 C  CB    . THR B 2 363 ? 71.631 116.597 36.964 1.00 65.38  ? 351 THR B CB    1 
ATOM   7222 O  OG1   . THR B 2 363 ? 72.033 115.439 37.705 1.00 65.38  ? 351 THR B OG1   1 
ATOM   7223 C  CG2   . THR B 2 363 ? 72.729 116.960 35.980 1.00 64.32  ? 351 THR B CG2   1 
ATOM   7224 N  N     . GLY B 2 364 ? 69.145 117.470 38.883 1.00 67.32  ? 352 GLY B N     1 
ATOM   7225 C  CA    . GLY B 2 364 ? 68.252 117.089 39.961 1.00 68.79  ? 352 GLY B CA    1 
ATOM   7226 C  C     . GLY B 2 364 ? 66.856 116.782 39.492 1.00 69.92  ? 352 GLY B C     1 
ATOM   7227 O  O     . GLY B 2 364 ? 66.552 116.926 38.316 1.00 68.37  ? 352 GLY B O     1 
ATOM   7228 N  N     . LYS B 2 365 ? 66.002 116.344 40.408 1.00 72.75  ? 353 LYS B N     1 
ATOM   7229 C  CA    . LYS B 2 365 ? 64.588 116.240 40.099 1.00 76.15  ? 353 LYS B CA    1 
ATOM   7230 C  C     . LYS B 2 365 ? 63.749 116.953 41.137 1.00 78.85  ? 353 LYS B C     1 
ATOM   7231 O  O     . LYS B 2 365 ? 64.034 116.903 42.333 1.00 78.59  ? 353 LYS B O     1 
ATOM   7232 C  CB    . LYS B 2 365 ? 64.146 114.775 39.982 1.00 76.40  ? 353 LYS B CB    1 
ATOM   7233 C  CG    . LYS B 2 365 ? 63.848 114.042 41.290 1.00 78.49  ? 353 LYS B CG    1 
ATOM   7234 C  CD    . LYS B 2 365 ? 63.311 112.614 41.003 1.00 80.12  ? 353 LYS B CD    1 
ATOM   7235 C  CE    . LYS B 2 365 ? 63.118 111.754 42.278 1.00 80.61  ? 353 LYS B CE    1 
ATOM   7236 N  NZ    . LYS B 2 365 ? 62.957 110.279 42.003 1.00 78.11  ? 353 LYS B NZ    1 
ATOM   7237 N  N     . TYR B 2 366 ? 62.722 117.642 40.651 1.00 82.63  ? 354 TYR B N     1 
ATOM   7238 C  CA    . TYR B 2 366 ? 61.680 118.204 41.493 1.00 85.37  ? 354 TYR B CA    1 
ATOM   7239 C  C     . TYR B 2 366 ? 60.492 117.253 41.405 1.00 86.51  ? 354 TYR B C     1 
ATOM   7240 O  O     . TYR B 2 366 ? 59.611 117.408 40.565 1.00 86.16  ? 354 TYR B O     1 
ATOM   7241 C  CB    . TYR B 2 366 ? 61.288 119.597 40.986 1.00 87.24  ? 354 TYR B CB    1 
ATOM   7242 C  CG    . TYR B 2 366 ? 60.527 120.431 41.995 1.00 90.28  ? 354 TYR B CG    1 
ATOM   7243 C  CD1   . TYR B 2 366 ? 61.101 120.769 43.223 1.00 92.10  ? 354 TYR B CD1   1 
ATOM   7244 C  CD2   . TYR B 2 366 ? 59.224 120.856 41.741 1.00 90.57  ? 354 TYR B CD2   1 
ATOM   7245 C  CE1   . TYR B 2 366 ? 60.392 121.502 44.175 1.00 92.29  ? 354 TYR B CE1   1 
ATOM   7246 C  CE2   . TYR B 2 366 ? 58.508 121.591 42.687 1.00 91.09  ? 354 TYR B CE2   1 
ATOM   7247 C  CZ    . TYR B 2 366 ? 59.098 121.905 43.900 1.00 91.70  ? 354 TYR B CZ    1 
ATOM   7248 O  OH    . TYR B 2 366 ? 58.390 122.595 44.855 1.00 92.11  ? 354 TYR B OH    1 
ATOM   7249 N  N     . ALA B 2 367 ? 60.496 116.246 42.268 1.00 89.05  ? 355 ALA B N     1 
ATOM   7250 C  CA    . ALA B 2 367 ? 59.417 115.273 42.311 1.00 91.58  ? 355 ALA B CA    1 
ATOM   7251 C  C     . ALA B 2 367 ? 58.271 115.836 43.135 1.00 93.20  ? 355 ALA B C     1 
ATOM   7252 O  O     . ALA B 2 367 ? 58.444 116.228 44.292 1.00 93.30  ? 355 ALA B O     1 
ATOM   7253 C  CB    . ALA B 2 367 ? 59.910 113.955 42.923 1.00 91.86  ? 355 ALA B CB    1 
ATOM   7254 N  N     . ARG B 2 368 ? 57.101 115.893 42.520 1.00 95.23  ? 356 ARG B N     1 
ATOM   7255 C  CA    . ARG B 2 368 ? 55.871 116.132 43.247 1.00 97.26  ? 356 ARG B CA    1 
ATOM   7256 C  C     . ARG B 2 368 ? 55.013 114.894 43.074 1.00 98.74  ? 356 ARG B C     1 
ATOM   7257 O  O     . ARG B 2 368 ? 55.051 114.248 42.029 1.00 99.60  ? 356 ARG B O     1 
ATOM   7258 C  CB    . ARG B 2 368 ? 55.170 117.377 42.702 1.00 96.84  ? 356 ARG B CB    1 
ATOM   7259 C  CG    . ARG B 2 368 ? 55.788 118.663 43.226 1.00 96.75  ? 356 ARG B CG    1 
ATOM   7260 C  CD    . ARG B 2 368 ? 55.110 119.906 42.676 1.00 97.47  ? 356 ARG B CD    1 
ATOM   7261 N  NE    . ARG B 2 368 ? 55.432 121.091 43.470 1.00 97.85  ? 356 ARG B NE    1 
ATOM   7262 C  CZ    . ARG B 2 368 ? 55.001 121.287 44.713 1.00 98.75  ? 356 ARG B CZ    1 
ATOM   7263 N  NH1   . ARG B 2 368 ? 54.230 120.377 45.297 1.00 99.51  ? 356 ARG B NH1   1 
ATOM   7264 N  NH2   . ARG B 2 368 ? 55.342 122.384 45.378 1.00 98.61  ? 356 ARG B NH2   1 
ATOM   7265 N  N     . MET B 2 369 ? 54.256 114.541 44.103 1.00 100.03 ? 357 MET B N     1 
ATOM   7266 C  CA    . MET B 2 369 ? 53.611 113.236 44.120 1.00 101.68 ? 357 MET B CA    1 
ATOM   7267 C  C     . MET B 2 369 ? 52.671 113.043 42.924 1.00 101.73 ? 357 MET B C     1 
ATOM   7268 O  O     . MET B 2 369 ? 53.075 112.524 41.880 1.00 100.50 ? 357 MET B O     1 
ATOM   7269 C  CB    . MET B 2 369 ? 52.842 113.049 45.433 1.00 102.92 ? 357 MET B CB    1 
ATOM   7270 C  CG    . MET B 2 369 ? 53.669 113.343 46.692 1.00 104.11 ? 357 MET B CG    1 
ATOM   7271 S  SD    . MET B 2 369 ? 54.698 111.983 47.290 1.00 105.90 ? 357 MET B SD    1 
ATOM   7272 C  CE    . MET B 2 369 ? 53.466 110.846 47.863 1.00 105.17 ? 357 MET B CE    1 
ATOM   7273 N  N     . ARG B 2 370 ? 51.419 113.462 43.081 1.00 102.16 ? 358 ARG B N     1 
ATOM   7274 C  CA    . ARG B 2 370 ? 50.413 113.232 42.051 1.00 102.73 ? 358 ARG B CA    1 
ATOM   7275 C  C     . ARG B 2 370 ? 49.642 114.502 41.708 1.00 103.08 ? 358 ARG B C     1 
ATOM   7276 O  O     . ARG B 2 370 ? 49.390 114.722 40.502 1.00 102.75 ? 358 ARG B O     1 
ATOM   7277 C  CB    . ARG B 2 370 ? 49.453 112.135 42.496 1.00 102.37 ? 358 ARG B CB    1 
ATOM   7278 N  N     . THR B 2 374 ? 46.476 119.236 40.093 1.00 86.37  ? 362 THR B N     1 
ATOM   7279 C  CA    . THR B 2 374 ? 47.880 119.504 39.642 1.00 85.80  ? 362 THR B CA    1 
ATOM   7280 C  C     . THR B 2 374 ? 47.960 120.631 38.610 1.00 84.03  ? 362 THR B C     1 
ATOM   7281 O  O     . THR B 2 374 ? 47.489 120.499 37.477 1.00 83.23  ? 362 THR B O     1 
ATOM   7282 C  CB    . THR B 2 374 ? 48.540 118.228 39.049 1.00 86.56  ? 362 THR B CB    1 
ATOM   7283 O  OG1   . THR B 2 374 ? 48.765 117.276 40.099 1.00 88.14  ? 362 THR B OG1   1 
ATOM   7284 C  CG2   . THR B 2 374 ? 49.870 118.564 38.388 1.00 86.44  ? 362 THR B CG2   1 
ATOM   7285 N  N     . ASN B 2 375 ? 48.569 121.736 39.030 1.00 82.13  ? 363 ASN B N     1 
ATOM   7286 C  CA    . ASN B 2 375 ? 48.735 122.924 38.204 1.00 79.86  ? 363 ASN B CA    1 
ATOM   7287 C  C     . ASN B 2 375 ? 50.129 122.964 37.565 1.00 78.85  ? 363 ASN B C     1 
ATOM   7288 O  O     . ASN B 2 375 ? 51.131 123.282 38.223 1.00 78.29  ? 363 ASN B O     1 
ATOM   7289 C  CB    . ASN B 2 375 ? 48.517 124.166 39.067 1.00 79.58  ? 363 ASN B CB    1 
ATOM   7290 C  CG    . ASN B 2 375 ? 48.686 125.447 38.296 1.00 79.19  ? 363 ASN B CG    1 
ATOM   7291 O  OD1   . ASN B 2 375 ? 49.722 125.683 37.681 1.00 78.79  ? 363 ASN B OD1   1 
ATOM   7292 N  ND2   . ASN B 2 375 ? 47.665 126.289 38.326 1.00 78.70  ? 363 ASN B ND2   1 
ATOM   7293 N  N     . ASP B 2 376 ? 50.178 122.647 36.273 1.00 76.33  ? 364 ASP B N     1 
ATOM   7294 C  CA    . ASP B 2 376 ? 51.433 122.556 35.541 1.00 74.27  ? 364 ASP B CA    1 
ATOM   7295 C  C     . ASP B 2 376 ? 52.294 123.808 35.713 1.00 73.09  ? 364 ASP B C     1 
ATOM   7296 O  O     . ASP B 2 376 ? 53.519 123.738 35.710 1.00 73.13  ? 364 ASP B O     1 
ATOM   7297 C  CB    . ASP B 2 376 ? 51.138 122.342 34.058 1.00 74.37  ? 364 ASP B CB    1 
ATOM   7298 C  CG    . ASP B 2 376 ? 51.851 121.136 33.490 1.00 75.30  ? 364 ASP B CG    1 
ATOM   7299 O  OD1   . ASP B 2 376 ? 52.346 120.304 34.278 1.00 76.51  ? 364 ASP B OD1   1 
ATOM   7300 O  OD2   . ASP B 2 376 ? 51.916 121.019 32.250 1.00 75.96  ? 364 ASP B OD2   1 
ATOM   7301 N  N     . VAL B 2 377 ? 51.642 124.956 35.862 1.00 71.79  ? 365 VAL B N     1 
ATOM   7302 C  CA    . VAL B 2 377 ? 52.328 126.241 35.848 1.00 69.25  ? 365 VAL B CA    1 
ATOM   7303 C  C     . VAL B 2 377 ? 52.801 126.630 37.251 1.00 68.42  ? 365 VAL B C     1 
ATOM   7304 O  O     . VAL B 2 377 ? 53.892 127.182 37.422 1.00 68.28  ? 365 VAL B O     1 
ATOM   7305 C  CB    . VAL B 2 377 ? 51.403 127.360 35.260 1.00 68.23  ? 365 VAL B CB    1 
ATOM   7306 C  CG1   . VAL B 2 377 ? 52.146 128.682 35.185 1.00 68.01  ? 365 VAL B CG1   1 
ATOM   7307 C  CG2   . VAL B 2 377 ? 50.924 126.972 33.875 1.00 66.58  ? 365 VAL B CG2   1 
ATOM   7308 N  N     . LYS B 2 378 ? 51.994 126.339 38.262 1.00 66.96  ? 366 LYS B N     1 
ATOM   7309 C  CA    . LYS B 2 378 ? 52.444 126.574 39.622 1.00 66.46  ? 366 LYS B CA    1 
ATOM   7310 C  C     . LYS B 2 378 ? 53.627 125.665 39.853 1.00 64.68  ? 366 LYS B C     1 
ATOM   7311 O  O     . LYS B 2 378 ? 54.646 126.080 40.382 1.00 63.78  ? 366 LYS B O     1 
ATOM   7312 C  CB    . LYS B 2 378 ? 51.342 126.254 40.636 1.00 68.15  ? 366 LYS B CB    1 
ATOM   7313 C  CG    . LYS B 2 378 ? 51.773 126.446 42.093 1.00 68.12  ? 366 LYS B CG    1 
ATOM   7314 C  CD    . LYS B 2 378 ? 50.574 126.509 43.038 1.00 69.94  ? 366 LYS B CD    1 
ATOM   7315 C  CE    . LYS B 2 378 ? 51.012 126.655 44.491 1.00 70.42  ? 366 LYS B CE    1 
ATOM   7316 N  NZ    . LYS B 2 378 ? 49.878 126.910 45.423 1.00 71.26  ? 366 LYS B NZ    1 
ATOM   7317 N  N     . GLN B 2 379 ? 53.484 124.417 39.432 1.00 63.93  ? 367 GLN B N     1 
ATOM   7318 C  CA    . GLN B 2 379 ? 54.551 123.434 39.567 1.00 63.25  ? 367 GLN B CA    1 
ATOM   7319 C  C     . GLN B 2 379 ? 55.883 124.017 39.072 1.00 62.72  ? 367 GLN B C     1 
ATOM   7320 O  O     . GLN B 2 379 ? 56.875 124.052 39.801 1.00 61.76  ? 367 GLN B O     1 
ATOM   7321 C  CB    . GLN B 2 379 ? 54.182 122.185 38.756 1.00 63.15  ? 367 GLN B CB    1 
ATOM   7322 C  CG    . GLN B 2 379 ? 54.533 120.853 39.420 1.00 63.44  ? 367 GLN B CG    1 
ATOM   7323 C  CD    . GLN B 2 379 ? 53.596 119.722 39.012 1.00 62.46  ? 367 GLN B CD    1 
ATOM   7324 O  OE1   . GLN B 2 379 ? 52.746 119.291 39.798 1.00 61.12  ? 367 GLN B OE1   1 
ATOM   7325 N  NE2   . GLN B 2 379 ? 53.744 119.239 37.776 1.00 60.89  ? 367 GLN B NE2   1 
ATOM   7326 N  N     . LEU B 2 380 ? 55.882 124.503 37.837 1.00 61.82  ? 368 LEU B N     1 
ATOM   7327 C  CA    . LEU B 2 380 ? 57.109 124.864 37.151 1.00 60.99  ? 368 LEU B CA    1 
ATOM   7328 C  C     . LEU B 2 380 ? 57.667 126.193 37.633 1.00 62.18  ? 368 LEU B C     1 
ATOM   7329 O  O     . LEU B 2 380 ? 58.867 126.439 37.544 1.00 61.69  ? 368 LEU B O     1 
ATOM   7330 C  CB    . LEU B 2 380 ? 56.856 124.897 35.642 1.00 59.70  ? 368 LEU B CB    1 
ATOM   7331 C  CG    . LEU B 2 380 ? 57.989 125.224 34.661 1.00 58.68  ? 368 LEU B CG    1 
ATOM   7332 C  CD1   . LEU B 2 380 ? 57.952 126.697 34.371 1.00 58.35  ? 368 LEU B CD1   1 
ATOM   7333 C  CD2   . LEU B 2 380 ? 59.352 124.806 35.208 1.00 57.98  ? 368 LEU B CD2   1 
ATOM   7334 N  N     . THR B 2 381 ? 56.803 127.055 38.151 1.00 63.65  ? 369 THR B N     1 
ATOM   7335 C  CA    . THR B 2 381 ? 57.284 128.295 38.740 1.00 64.70  ? 369 THR B CA    1 
ATOM   7336 C  C     . THR B 2 381 ? 57.953 127.982 40.077 1.00 64.38  ? 369 THR B C     1 
ATOM   7337 O  O     . THR B 2 381 ? 58.976 128.566 40.425 1.00 64.96  ? 369 THR B O     1 
ATOM   7338 C  CB    . THR B 2 381 ? 56.131 129.319 38.944 1.00 65.63  ? 369 THR B CB    1 
ATOM   7339 O  OG1   . THR B 2 381 ? 56.643 130.501 39.566 1.00 66.11  ? 369 THR B OG1   1 
ATOM   7340 C  CG2   . THR B 2 381 ? 55.050 128.744 39.827 1.00 67.01  ? 369 THR B CG2   1 
ATOM   7341 N  N     . GLU B 2 382 ? 57.388 127.037 40.818 1.00 63.99  ? 370 GLU B N     1 
ATOM   7342 C  CA    . GLU B 2 382 ? 57.968 126.646 42.095 1.00 63.02  ? 370 GLU B CA    1 
ATOM   7343 C  C     . GLU B 2 382 ? 59.285 125.933 41.866 1.00 61.92  ? 370 GLU B C     1 
ATOM   7344 O  O     . GLU B 2 382 ? 60.250 126.127 42.603 1.00 61.88  ? 370 GLU B O     1 
ATOM   7345 C  CB    . GLU B 2 382 ? 57.002 125.743 42.851 1.00 63.42  ? 370 GLU B CB    1 
ATOM   7346 C  CG    . GLU B 2 382 ? 55.800 126.498 43.403 1.00 64.86  ? 370 GLU B CG    1 
ATOM   7347 C  CD    . GLU B 2 382 ? 54.692 125.584 43.888 1.00 64.73  ? 370 GLU B CD    1 
ATOM   7348 O  OE1   . GLU B 2 382 ? 54.762 124.367 43.606 1.00 64.99  ? 370 GLU B OE1   1 
ATOM   7349 O  OE2   . GLU B 2 382 ? 53.755 126.087 44.550 1.00 64.06  ? 370 GLU B OE2   1 
ATOM   7350 N  N     . ALA B 2 383 ? 59.328 125.125 40.820 1.00 60.01  ? 371 ALA B N     1 
ATOM   7351 C  CA    . ALA B 2 383 ? 60.573 124.509 40.416 1.00 59.16  ? 371 ALA B CA    1 
ATOM   7352 C  C     . ALA B 2 383 ? 61.689 125.523 40.171 1.00 58.65  ? 371 ALA B C     1 
ATOM   7353 O  O     . ALA B 2 383 ? 62.859 125.210 40.373 1.00 57.60  ? 371 ALA B O     1 
ATOM   7354 C  CB    . ALA B 2 383 ? 60.354 123.671 39.178 1.00 59.35  ? 371 ALA B CB    1 
ATOM   7355 N  N     . VAL B 2 384 ? 61.361 126.732 39.732 1.00 59.10  ? 372 VAL B N     1 
ATOM   7356 C  CA    . VAL B 2 384 ? 62.448 127.662 39.449 1.00 61.60  ? 372 VAL B CA    1 
ATOM   7357 C  C     . VAL B 2 384 ? 62.825 128.448 40.687 1.00 62.52  ? 372 VAL B C     1 
ATOM   7358 O  O     . VAL B 2 384 ? 63.858 129.110 40.717 1.00 62.90  ? 372 VAL B O     1 
ATOM   7359 C  CB    . VAL B 2 384 ? 62.121 128.672 38.319 1.00 61.74  ? 372 VAL B CB    1 
ATOM   7360 C  CG1   . VAL B 2 384 ? 61.090 128.091 37.377 1.00 61.48  ? 372 VAL B CG1   1 
ATOM   7361 C  CG2   . VAL B 2 384 ? 61.701 130.003 38.909 1.00 61.30  ? 372 VAL B CG2   1 
ATOM   7362 N  N     . GLN B 2 385 ? 61.995 128.378 41.716 1.00 63.41  ? 373 GLN B N     1 
ATOM   7363 C  CA    . GLN B 2 385 ? 62.365 129.010 42.966 1.00 64.45  ? 373 GLN B CA    1 
ATOM   7364 C  C     . GLN B 2 385 ? 63.255 128.082 43.781 1.00 63.94  ? 373 GLN B C     1 
ATOM   7365 O  O     . GLN B 2 385 ? 64.243 128.517 44.378 1.00 63.89  ? 373 GLN B O     1 
ATOM   7366 C  CB    . GLN B 2 385 ? 61.114 129.395 43.752 1.00 65.39  ? 373 GLN B CB    1 
ATOM   7367 C  CG    . GLN B 2 385 ? 60.357 130.544 43.120 1.00 67.10  ? 373 GLN B CG    1 
ATOM   7368 C  CD    . GLN B 2 385 ? 59.064 130.858 43.837 1.00 68.73  ? 373 GLN B CD    1 
ATOM   7369 O  OE1   . GLN B 2 385 ? 59.026 131.730 44.703 1.00 68.69  ? 373 GLN B OE1   1 
ATOM   7370 N  NE2   . GLN B 2 385 ? 57.991 130.150 43.479 1.00 69.02  ? 373 GLN B NE2   1 
ATOM   7371 N  N     . LYS B 2 386 ? 62.921 126.798 43.791 1.00 62.77  ? 374 LYS B N     1 
ATOM   7372 C  CA    . LYS B 2 386 ? 63.713 125.846 44.550 1.00 62.92  ? 374 LYS B CA    1 
ATOM   7373 C  C     . LYS B 2 386 ? 65.116 125.844 43.978 1.00 61.92  ? 374 LYS B C     1 
ATOM   7374 O  O     . LYS B 2 386 ? 66.091 125.964 44.708 1.00 62.55  ? 374 LYS B O     1 
ATOM   7375 C  CB    . LYS B 2 386 ? 63.111 124.443 44.452 1.00 65.89  ? 374 LYS B CB    1 
ATOM   7376 C  CG    . LYS B 2 386 ? 63.085 123.671 45.782 1.00 67.76  ? 374 LYS B CG    1 
ATOM   7377 C  CD    . LYS B 2 386 ? 64.440 123.687 46.469 1.00 67.84  ? 374 LYS B CD    1 
ATOM   7378 C  CE    . LYS B 2 386 ? 64.345 123.176 47.900 1.00 68.76  ? 374 LYS B CE    1 
ATOM   7379 N  NZ    . LYS B 2 386 ? 64.311 121.685 47.975 1.00 68.88  ? 374 LYS B NZ    1 
ATOM   7380 N  N     . ILE B 2 387 ? 65.205 125.726 42.659 1.00 60.86  ? 375 ILE B N     1 
ATOM   7381 C  CA    . ILE B 2 387 ? 66.487 125.728 41.957 1.00 58.60  ? 375 ILE B CA    1 
ATOM   7382 C  C     . ILE B 2 387 ? 67.287 127.007 42.195 1.00 60.07  ? 375 ILE B C     1 
ATOM   7383 O  O     . ILE B 2 387 ? 68.474 126.962 42.495 1.00 60.34  ? 375 ILE B O     1 
ATOM   7384 C  CB    . ILE B 2 387 ? 66.265 125.552 40.440 1.00 55.68  ? 375 ILE B CB    1 
ATOM   7385 C  CG1   . ILE B 2 387 ? 65.583 124.216 40.189 1.00 54.18  ? 375 ILE B CG1   1 
ATOM   7386 C  CG2   . ILE B 2 387 ? 67.580 125.681 39.674 1.00 50.74  ? 375 ILE B CG2   1 
ATOM   7387 C  CD1   . ILE B 2 387 ? 65.435 123.898 38.731 1.00 57.49  ? 375 ILE B CD1   1 
ATOM   7388 N  N     . THR B 2 388 ? 66.638 128.152 42.056 1.00 62.27  ? 376 THR B N     1 
ATOM   7389 C  CA    . THR B 2 388 ? 67.354 129.409 42.126 1.00 64.52  ? 376 THR B CA    1 
ATOM   7390 C  C     . THR B 2 388 ? 68.048 129.486 43.473 1.00 65.42  ? 376 THR B C     1 
ATOM   7391 O  O     . THR B 2 388 ? 69.260 129.685 43.547 1.00 64.98  ? 376 THR B O     1 
ATOM   7392 C  CB    . THR B 2 388 ? 66.390 130.600 41.952 1.00 65.19  ? 376 THR B CB    1 
ATOM   7393 O  OG1   . THR B 2 388 ? 65.787 130.529 40.656 1.00 65.59  ? 376 THR B OG1   1 
ATOM   7394 C  CG2   . THR B 2 388 ? 67.133 131.923 42.075 1.00 66.08  ? 376 THR B CG2   1 
ATOM   7395 N  N     . THR B 2 389 ? 67.272 129.299 44.535 1.00 67.08  ? 377 THR B N     1 
ATOM   7396 C  CA    . THR B 2 389 ? 67.817 129.256 45.881 1.00 68.76  ? 377 THR B CA    1 
ATOM   7397 C  C     . THR B 2 389 ? 69.094 128.425 45.887 1.00 69.98  ? 377 THR B C     1 
ATOM   7398 O  O     . THR B 2 389 ? 70.169 128.943 46.174 1.00 71.39  ? 377 THR B O     1 
ATOM   7399 C  CB    . THR B 2 389 ? 66.844 128.606 46.857 1.00 68.85  ? 377 THR B CB    1 
ATOM   7400 O  OG1   . THR B 2 389 ? 65.550 129.199 46.714 1.00 69.48  ? 377 THR B OG1   1 
ATOM   7401 C  CG2   . THR B 2 389 ? 67.333 128.800 48.274 1.00 69.11  ? 377 THR B CG2   1 
ATOM   7402 N  N     . GLU B 2 390 ? 68.972 127.139 45.563 1.00 69.78  ? 378 GLU B N     1 
ATOM   7403 C  CA    . GLU B 2 390 ? 70.126 126.249 45.543 1.00 69.88  ? 378 GLU B CA    1 
ATOM   7404 C  C     . GLU B 2 390 ? 71.291 126.954 44.877 1.00 71.12  ? 378 GLU B C     1 
ATOM   7405 O  O     . GLU B 2 390 ? 72.411 126.956 45.391 1.00 72.05  ? 378 GLU B O     1 
ATOM   7406 C  CB    . GLU B 2 390 ? 69.804 124.961 44.782 1.00 69.65  ? 378 GLU B CB    1 
ATOM   7407 C  CG    . GLU B 2 390 ? 68.643 124.179 45.376 1.00 70.97  ? 378 GLU B CG    1 
ATOM   7408 C  CD    . GLU B 2 390 ? 68.366 122.871 44.654 1.00 70.80  ? 378 GLU B CD    1 
ATOM   7409 O  OE1   . GLU B 2 390 ? 69.267 122.373 43.945 1.00 69.78  ? 378 GLU B OE1   1 
ATOM   7410 O  OE2   . GLU B 2 390 ? 67.239 122.347 44.802 1.00 70.73  ? 378 GLU B OE2   1 
ATOM   7411 N  N     . SER B 2 391 ? 71.022 127.578 43.739 1.00 71.54  ? 379 SER B N     1 
ATOM   7412 C  CA    . SER B 2 391 ? 72.081 128.235 42.998 1.00 71.92  ? 379 SER B CA    1 
ATOM   7413 C  C     . SER B 2 391 ? 72.725 129.319 43.860 1.00 72.44  ? 379 SER B C     1 
ATOM   7414 O  O     . SER B 2 391 ? 73.944 129.341 44.031 1.00 72.65  ? 379 SER B O     1 
ATOM   7415 C  CB    . SER B 2 391 ? 71.524 128.832 41.709 1.00 71.19  ? 379 SER B CB    1 
ATOM   7416 O  OG    . SER B 2 391 ? 72.576 129.142 40.812 1.00 71.30  ? 379 SER B OG    1 
ATOM   7417 N  N     . ILE B 2 392 ? 71.902 130.208 44.410 1.00 72.72  ? 380 ILE B N     1 
ATOM   7418 C  CA    . ILE B 2 392 ? 72.390 131.244 45.317 1.00 72.96  ? 380 ILE B CA    1 
ATOM   7419 C  C     . ILE B 2 392 ? 73.199 130.609 46.442 1.00 72.03  ? 380 ILE B C     1 
ATOM   7420 O  O     . ILE B 2 392 ? 74.274 131.087 46.786 1.00 71.45  ? 380 ILE B O     1 
ATOM   7421 C  CB    . ILE B 2 392 ? 71.220 132.044 45.957 1.00 74.17  ? 380 ILE B CB    1 
ATOM   7422 C  CG1   . ILE B 2 392 ? 70.497 132.885 44.902 1.00 76.53  ? 380 ILE B CG1   1 
ATOM   7423 C  CG2   . ILE B 2 392 ? 71.745 132.941 47.057 1.00 73.45  ? 380 ILE B CG2   1 
ATOM   7424 C  CD1   . ILE B 2 392 ? 69.246 133.609 45.438 1.00 76.66  ? 380 ILE B CD1   1 
ATOM   7425 N  N     . VAL B 2 393 ? 72.669 129.526 47.006 1.00 71.39  ? 381 VAL B N     1 
ATOM   7426 C  CA    . VAL B 2 393 ? 73.252 128.887 48.191 1.00 70.91  ? 381 VAL B CA    1 
ATOM   7427 C  C     . VAL B 2 393 ? 74.590 128.237 47.833 1.00 70.69  ? 381 VAL B C     1 
ATOM   7428 O  O     . VAL B 2 393 ? 75.600 128.412 48.520 1.00 69.41  ? 381 VAL B O     1 
ATOM   7429 C  CB    . VAL B 2 393 ? 72.300 127.794 48.762 1.00 69.75  ? 381 VAL B CB    1 
ATOM   7430 C  CG1   . VAL B 2 393 ? 72.923 127.138 49.960 1.00 67.70  ? 381 VAL B CG1   1 
ATOM   7431 C  CG2   . VAL B 2 393 ? 70.965 128.405 49.141 1.00 69.04  ? 381 VAL B CG2   1 
ATOM   7432 N  N     . ILE B 2 394 ? 74.585 127.499 46.734 1.00 69.46  ? 382 ILE B N     1 
ATOM   7433 C  CA    . ILE B 2 394 ? 75.779 126.841 46.256 1.00 68.75  ? 382 ILE B CA    1 
ATOM   7434 C  C     . ILE B 2 394 ? 76.762 127.769 45.528 1.00 69.18  ? 382 ILE B C     1 
ATOM   7435 O  O     . ILE B 2 394 ? 77.962 127.692 45.771 1.00 69.77  ? 382 ILE B O     1 
ATOM   7436 C  CB    . ILE B 2 394 ? 75.386 125.682 45.349 1.00 68.06  ? 382 ILE B CB    1 
ATOM   7437 C  CG1   . ILE B 2 394 ? 74.600 124.654 46.171 1.00 67.78  ? 382 ILE B CG1   1 
ATOM   7438 C  CG2   . ILE B 2 394 ? 76.615 125.083 44.714 1.00 67.11  ? 382 ILE B CG2   1 
ATOM   7439 C  CD1   . ILE B 2 394 ? 73.601 123.839 45.374 1.00 67.74  ? 382 ILE B CD1   1 
ATOM   7440 N  N     . TRP B 2 395 ? 76.273 128.649 44.654 1.00 68.99  ? 383 TRP B N     1 
ATOM   7441 C  CA    . TRP B 2 395 ? 77.171 129.514 43.887 1.00 68.82  ? 383 TRP B CA    1 
ATOM   7442 C  C     . TRP B 2 395 ? 77.037 131.002 44.148 1.00 67.95  ? 383 TRP B C     1 
ATOM   7443 O  O     . TRP B 2 395 ? 77.905 131.791 43.745 1.00 67.73  ? 383 TRP B O     1 
ATOM   7444 C  CB    . TRP B 2 395 ? 77.005 129.263 42.393 1.00 70.39  ? 383 TRP B CB    1 
ATOM   7445 C  CG    . TRP B 2 395 ? 77.236 127.857 42.042 1.00 71.74  ? 383 TRP B CG    1 
ATOM   7446 C  CD1   . TRP B 2 395 ? 78.436 127.215 41.956 1.00 71.48  ? 383 TRP B CD1   1 
ATOM   7447 C  CD2   . TRP B 2 395 ? 76.233 126.880 41.777 1.00 72.79  ? 383 TRP B CD2   1 
ATOM   7448 N  NE1   . TRP B 2 395 ? 78.241 125.891 41.656 1.00 71.70  ? 383 TRP B NE1   1 
ATOM   7449 C  CE2   . TRP B 2 395 ? 76.898 125.660 41.540 1.00 72.94  ? 383 TRP B CE2   1 
ATOM   7450 C  CE3   . TRP B 2 395 ? 74.837 126.919 41.716 1.00 72.30  ? 383 TRP B CE3   1 
ATOM   7451 C  CZ2   . TRP B 2 395 ? 76.208 124.488 41.249 1.00 73.18  ? 383 TRP B CZ2   1 
ATOM   7452 C  CZ3   . TRP B 2 395 ? 74.156 125.757 41.426 1.00 72.68  ? 383 TRP B CZ3   1 
ATOM   7453 C  CH2   . TRP B 2 395 ? 74.840 124.557 41.196 1.00 73.67  ? 383 TRP B CH2   1 
ATOM   7454 N  N     . GLY B 2 396 ? 75.948 131.392 44.798 1.00 66.38  ? 384 GLY B N     1 
ATOM   7455 C  CA    . GLY B 2 396 ? 75.822 132.769 45.232 1.00 66.34  ? 384 GLY B CA    1 
ATOM   7456 C  C     . GLY B 2 396 ? 75.349 133.719 44.154 1.00 65.85  ? 384 GLY B C     1 
ATOM   7457 O  O     . GLY B 2 396 ? 75.238 134.923 44.384 1.00 67.12  ? 384 GLY B O     1 
ATOM   7458 N  N     . LYS B 2 397 ? 75.084 133.185 42.970 1.00 64.46  ? 385 LYS B N     1 
ATOM   7459 C  CA    . LYS B 2 397 ? 74.325 133.916 41.975 1.00 62.31  ? 385 LYS B CA    1 
ATOM   7460 C  C     . LYS B 2 397 ? 73.090 133.105 41.570 1.00 61.24  ? 385 LYS B C     1 
ATOM   7461 O  O     . LYS B 2 397 ? 72.826 132.048 42.133 1.00 60.13  ? 385 LYS B O     1 
ATOM   7462 C  CB    . LYS B 2 397 ? 75.204 134.239 40.760 1.00 60.35  ? 385 LYS B CB    1 
ATOM   7463 C  CG    . LYS B 2 397 ? 75.684 133.047 39.978 1.00 60.94  ? 385 LYS B CG    1 
ATOM   7464 C  CD    . LYS B 2 397 ? 76.159 133.464 38.595 1.00 60.07  ? 385 LYS B CD    1 
ATOM   7465 C  CE    . LYS B 2 397 ? 77.404 134.312 38.687 1.00 60.89  ? 385 LYS B CE    1 
ATOM   7466 N  NZ    . LYS B 2 397 ? 77.646 135.109 37.452 1.00 63.39  ? 385 LYS B NZ    1 
ATOM   7467 N  N     . THR B 2 398 ? 72.318 133.621 40.620 1.00 60.07  ? 386 THR B N     1 
ATOM   7468 C  CA    . THR B 2 398 ? 71.139 132.917 40.141 1.00 58.95  ? 386 THR B CA    1 
ATOM   7469 C  C     . THR B 2 398 ? 71.334 132.546 38.679 1.00 59.20  ? 386 THR B C     1 
ATOM   7470 O  O     . THR B 2 398 ? 72.076 133.211 37.949 1.00 59.13  ? 386 THR B O     1 
ATOM   7471 C  CB    . THR B 2 398 ? 69.897 133.786 40.247 1.00 57.88  ? 386 THR B CB    1 
ATOM   7472 O  OG1   . THR B 2 398 ? 70.068 134.941 39.424 1.00 57.60  ? 386 THR B OG1   1 
ATOM   7473 C  CG2   . THR B 2 398 ? 69.679 134.223 41.673 1.00 57.23  ? 386 THR B CG2   1 
ATOM   7474 N  N     . PRO B 2 399 ? 70.671 131.471 38.232 1.00 58.17  ? 387 PRO B N     1 
ATOM   7475 C  CA    . PRO B 2 399 ? 70.747 131.024 36.841 1.00 57.85  ? 387 PRO B CA    1 
ATOM   7476 C  C     . PRO B 2 399 ? 69.985 131.988 35.948 1.00 57.53  ? 387 PRO B C     1 
ATOM   7477 O  O     . PRO B 2 399 ? 69.235 132.829 36.434 1.00 58.77  ? 387 PRO B O     1 
ATOM   7478 C  CB    . PRO B 2 399 ? 70.081 129.646 36.863 1.00 56.66  ? 387 PRO B CB    1 
ATOM   7479 C  CG    . PRO B 2 399 ? 70.006 129.267 38.300 1.00 57.88  ? 387 PRO B CG    1 
ATOM   7480 C  CD    . PRO B 2 399 ? 69.846 130.564 39.037 1.00 57.71  ? 387 PRO B CD    1 
ATOM   7481 N  N     . LYS B 2 400 ? 70.193 131.868 34.644 1.00 56.07  ? 388 LYS B N     1 
ATOM   7482 C  CA    . LYS B 2 400 ? 69.181 132.255 33.680 1.00 54.28  ? 388 LYS B CA    1 
ATOM   7483 C  C     . LYS B 2 400 ? 68.498 130.960 33.246 1.00 52.87  ? 388 LYS B C     1 
ATOM   7484 O  O     . LYS B 2 400 ? 69.160 130.039 32.769 1.00 52.86  ? 388 LYS B O     1 
ATOM   7485 C  CB    . LYS B 2 400 ? 69.835 132.933 32.483 1.00 55.09  ? 388 LYS B CB    1 
ATOM   7486 C  CG    . LYS B 2 400 ? 68.860 133.403 31.421 1.00 57.52  ? 388 LYS B CG    1 
ATOM   7487 C  CD    . LYS B 2 400 ? 69.506 133.378 30.040 1.00 57.98  ? 388 LYS B CD    1 
ATOM   7488 C  CE    . LYS B 2 400 ? 68.624 134.028 28.985 1.00 57.45  ? 388 LYS B CE    1 
ATOM   7489 N  NZ    . LYS B 2 400 ? 68.376 135.468 29.269 1.00 58.38  ? 388 LYS B NZ    1 
ATOM   7490 N  N     . PHE B 2 401 ? 67.183 130.880 33.422 1.00 51.11  ? 389 PHE B N     1 
ATOM   7491 C  CA    . PHE B 2 401 ? 66.445 129.657 33.095 1.00 50.57  ? 389 PHE B CA    1 
ATOM   7492 C  C     . PHE B 2 401 ? 66.035 129.555 31.644 1.00 50.56  ? 389 PHE B C     1 
ATOM   7493 O  O     . PHE B 2 401 ? 65.777 130.560 30.992 1.00 52.07  ? 389 PHE B O     1 
ATOM   7494 C  CB    . PHE B 2 401 ? 65.200 129.536 33.958 1.00 47.94  ? 389 PHE B CB    1 
ATOM   7495 C  CG    . PHE B 2 401 ? 65.501 129.292 35.386 1.00 47.00  ? 389 PHE B CG    1 
ATOM   7496 C  CD1   . PHE B 2 401 ? 66.009 130.305 36.173 1.00 45.93  ? 389 PHE B CD1   1 
ATOM   7497 C  CD2   . PHE B 2 401 ? 65.286 128.047 35.946 1.00 46.71  ? 389 PHE B CD2   1 
ATOM   7498 C  CE1   . PHE B 2 401 ? 66.297 130.084 37.493 1.00 46.69  ? 389 PHE B CE1   1 
ATOM   7499 C  CE2   . PHE B 2 401 ? 65.571 127.814 37.267 1.00 46.58  ? 389 PHE B CE2   1 
ATOM   7500 C  CZ    . PHE B 2 401 ? 66.077 128.834 38.046 1.00 46.60  ? 389 PHE B CZ    1 
ATOM   7501 N  N     . LYS B 2 402 ? 65.986 128.329 31.140 1.00 50.16  ? 390 LYS B N     1 
ATOM   7502 C  CA    . LYS B 2 402 ? 65.484 128.073 29.802 1.00 49.92  ? 390 LYS B CA    1 
ATOM   7503 C  C     . LYS B 2 402 ? 64.256 127.215 30.024 1.00 49.76  ? 390 LYS B C     1 
ATOM   7504 O  O     . LYS B 2 402 ? 64.358 126.028 30.315 1.00 50.27  ? 390 LYS B O     1 
ATOM   7505 C  CB    . LYS B 2 402 ? 66.524 127.324 28.963 1.00 50.56  ? 390 LYS B CB    1 
ATOM   7506 C  CG    . LYS B 2 402 ? 67.926 127.913 29.035 1.00 52.62  ? 390 LYS B CG    1 
ATOM   7507 C  CD    . LYS B 2 402 ? 68.575 128.070 27.664 1.00 54.16  ? 390 LYS B CD    1 
ATOM   7508 C  CE    . LYS B 2 402 ? 68.821 126.728 27.003 1.00 57.13  ? 390 LYS B CE    1 
ATOM   7509 N  NZ    . LYS B 2 402 ? 69.786 126.834 25.870 1.00 60.84  ? 390 LYS B NZ    1 
ATOM   7510 N  N     . LEU B 2 403 ? 63.088 127.833 29.907 1.00 49.58  ? 391 LEU B N     1 
ATOM   7511 C  CA    . LEU B 2 403 ? 61.858 127.224 30.372 1.00 47.40  ? 391 LEU B CA    1 
ATOM   7512 C  C     . LEU B 2 403 ? 61.138 126.490 29.254 1.00 46.73  ? 391 LEU B C     1 
ATOM   7513 O  O     . LEU B 2 403 ? 61.176 126.900 28.095 1.00 44.93  ? 391 LEU B O     1 
ATOM   7514 C  CB    . LEU B 2 403 ? 60.977 128.304 30.982 1.00 46.60  ? 391 LEU B CB    1 
ATOM   7515 C  CG    . LEU B 2 403 ? 61.686 129.074 32.102 1.00 46.37  ? 391 LEU B CG    1 
ATOM   7516 C  CD1   . LEU B 2 403 ? 61.002 130.399 32.337 1.00 46.12  ? 391 LEU B CD1   1 
ATOM   7517 C  CD2   . LEU B 2 403 ? 61.685 128.240 33.373 1.00 46.11  ? 391 LEU B CD2   1 
ATOM   7518 N  N     . PRO B 2 404 ? 60.516 125.356 29.593 1.00 47.82  ? 392 PRO B N     1 
ATOM   7519 C  CA    . PRO B 2 404 ? 59.700 124.477 28.752 1.00 49.88  ? 392 PRO B CA    1 
ATOM   7520 C  C     . PRO B 2 404 ? 58.228 124.897 28.837 1.00 51.78  ? 392 PRO B C     1 
ATOM   7521 O  O     . PRO B 2 404 ? 57.359 124.131 29.286 1.00 53.14  ? 392 PRO B O     1 
ATOM   7522 C  CB    . PRO B 2 404 ? 59.936 123.111 29.368 1.00 49.51  ? 392 PRO B CB    1 
ATOM   7523 C  CG    . PRO B 2 404 ? 60.009 123.435 30.841 1.00 47.94  ? 392 PRO B CG    1 
ATOM   7524 C  CD    . PRO B 2 404 ? 60.610 124.828 30.964 1.00 48.25  ? 392 PRO B CD    1 
ATOM   7525 N  N     . ILE B 2 405 ? 57.966 126.133 28.434 1.00 50.61  ? 393 ILE B N     1 
ATOM   7526 C  CA    . ILE B 2 405 ? 56.629 126.675 28.459 1.00 49.36  ? 393 ILE B CA    1 
ATOM   7527 C  C     . ILE B 2 405 ? 56.597 127.811 27.448 1.00 52.12  ? 393 ILE B C     1 
ATOM   7528 O  O     . ILE B 2 405 ? 57.642 128.369 27.105 1.00 52.10  ? 393 ILE B O     1 
ATOM   7529 C  CB    . ILE B 2 405 ? 56.284 127.221 29.837 1.00 45.88  ? 393 ILE B CB    1 
ATOM   7530 C  CG1   . ILE B 2 405 ? 54.813 127.613 29.872 1.00 44.36  ? 393 ILE B CG1   1 
ATOM   7531 C  CG2   . ILE B 2 405 ? 57.141 128.433 30.142 1.00 42.99  ? 393 ILE B CG2   1 
ATOM   7532 C  CD1   . ILE B 2 405 ? 54.414 128.291 31.130 1.00 44.08  ? 393 ILE B CD1   1 
ATOM   7533 N  N     . GLN B 2 406 ? 55.404 128.140 26.962 1.00 53.92  ? 394 GLN B N     1 
ATOM   7534 C  CA    . GLN B 2 406 ? 55.244 129.202 25.979 1.00 56.15  ? 394 GLN B CA    1 
ATOM   7535 C  C     . GLN B 2 406 ? 55.127 130.569 26.659 1.00 55.87  ? 394 GLN B C     1 
ATOM   7536 O  O     . GLN B 2 406 ? 54.461 130.707 27.685 1.00 54.83  ? 394 GLN B O     1 
ATOM   7537 C  CB    . GLN B 2 406 ? 54.012 128.917 25.133 1.00 59.97  ? 394 GLN B CB    1 
ATOM   7538 C  CG    . GLN B 2 406 ? 53.513 130.097 24.324 1.00 68.37  ? 394 GLN B CG    1 
ATOM   7539 C  CD    . GLN B 2 406 ? 52.021 129.996 24.033 1.00 72.57  ? 394 GLN B CD    1 
ATOM   7540 O  OE1   . GLN B 2 406 ? 51.190 130.514 24.793 1.00 73.81  ? 394 GLN B OE1   1 
ATOM   7541 N  NE2   . GLN B 2 406 ? 51.671 129.318 22.932 1.00 74.48  ? 394 GLN B NE2   1 
ATOM   7542 N  N     . LYS B 2 407 ? 55.783 131.576 26.089 1.00 55.53  ? 395 LYS B N     1 
ATOM   7543 C  CA    . LYS B 2 407 ? 55.903 132.864 26.763 1.00 55.57  ? 395 LYS B CA    1 
ATOM   7544 C  C     . LYS B 2 407 ? 54.563 133.354 27.284 1.00 56.57  ? 395 LYS B C     1 
ATOM   7545 O  O     . LYS B 2 407 ? 54.407 133.597 28.479 1.00 56.80  ? 395 LYS B O     1 
ATOM   7546 C  CB    . LYS B 2 407 ? 56.487 133.910 25.822 1.00 54.10  ? 395 LYS B CB    1 
ATOM   7547 C  CG    . LYS B 2 407 ? 56.632 135.266 26.464 1.00 52.57  ? 395 LYS B CG    1 
ATOM   7548 C  CD    . LYS B 2 407 ? 57.538 136.164 25.655 1.00 51.79  ? 395 LYS B CD    1 
ATOM   7549 C  CE    . LYS B 2 407 ? 58.226 137.184 26.551 1.00 52.11  ? 395 LYS B CE    1 
ATOM   7550 N  NZ    . LYS B 2 407 ? 57.844 138.589 26.231 1.00 51.93  ? 395 LYS B NZ    1 
ATOM   7551 N  N     . GLU B 2 408 ? 53.602 133.492 26.377 1.00 58.19  ? 396 GLU B N     1 
ATOM   7552 C  CA    . GLU B 2 408 ? 52.230 133.859 26.725 1.00 59.36  ? 396 GLU B CA    1 
ATOM   7553 C  C     . GLU B 2 408 ? 51.723 133.170 27.990 1.00 57.22  ? 396 GLU B C     1 
ATOM   7554 O  O     . GLU B 2 408 ? 51.171 133.809 28.884 1.00 53.66  ? 396 GLU B O     1 
ATOM   7555 C  CB    . GLU B 2 408 ? 51.305 133.518 25.561 1.00 64.59  ? 396 GLU B CB    1 
ATOM   7556 C  CG    . GLU B 2 408 ? 50.901 134.709 24.708 1.00 73.62  ? 396 GLU B CG    1 
ATOM   7557 C  CD    . GLU B 2 408 ? 49.562 135.304 25.139 1.00 79.62  ? 396 GLU B CD    1 
ATOM   7558 O  OE1   . GLU B 2 408 ? 48.582 134.528 25.307 1.00 82.36  ? 396 GLU B OE1   1 
ATOM   7559 O  OE2   . GLU B 2 408 ? 49.493 136.546 25.310 1.00 82.07  ? 396 GLU B OE2   1 
ATOM   7560 N  N     . THR B 2 409 ? 51.924 131.859 28.057 1.00 56.92  ? 397 THR B N     1 
ATOM   7561 C  CA    . THR B 2 409 ? 51.436 131.054 29.167 1.00 56.77  ? 397 THR B CA    1 
ATOM   7562 C  C     . THR B 2 409 ? 52.143 131.392 30.477 1.00 57.40  ? 397 THR B C     1 
ATOM   7563 O  O     . THR B 2 409 ? 51.500 131.730 31.473 1.00 57.42  ? 397 THR B O     1 
ATOM   7564 C  CB    . THR B 2 409 ? 51.652 129.580 28.895 1.00 56.97  ? 397 THR B CB    1 
ATOM   7565 O  OG1   . THR B 2 409 ? 51.095 129.243 27.619 1.00 57.33  ? 397 THR B OG1   1 
ATOM   7566 C  CG2   . THR B 2 409 ? 50.980 128.757 29.974 1.00 59.15  ? 397 THR B CG2   1 
ATOM   7567 N  N     . TRP B 2 410 ? 53.470 131.299 30.473 1.00 57.27  ? 398 TRP B N     1 
ATOM   7568 C  CA    . TRP B 2 410 ? 54.269 131.660 31.640 1.00 56.67  ? 398 TRP B CA    1 
ATOM   7569 C  C     . TRP B 2 410 ? 53.827 133.008 32.178 1.00 57.22  ? 398 TRP B C     1 
ATOM   7570 O  O     . TRP B 2 410 ? 53.658 133.184 33.386 1.00 57.00  ? 398 TRP B O     1 
ATOM   7571 C  CB    . TRP B 2 410 ? 55.753 131.717 31.260 1.00 55.83  ? 398 TRP B CB    1 
ATOM   7572 C  CG    . TRP B 2 410 ? 56.675 132.153 32.363 1.00 54.85  ? 398 TRP B CG    1 
ATOM   7573 C  CD1   . TRP B 2 410 ? 57.346 133.330 32.439 1.00 54.48  ? 398 TRP B CD1   1 
ATOM   7574 C  CD2   . TRP B 2 410 ? 57.043 131.409 33.533 1.00 54.99  ? 398 TRP B CD2   1 
ATOM   7575 N  NE1   . TRP B 2 410 ? 58.108 133.371 33.576 1.00 54.52  ? 398 TRP B NE1   1 
ATOM   7576 C  CE2   . TRP B 2 410 ? 57.937 132.200 34.266 1.00 54.08  ? 398 TRP B CE2   1 
ATOM   7577 C  CE3   . TRP B 2 410 ? 56.705 130.147 34.029 1.00 56.58  ? 398 TRP B CE3   1 
ATOM   7578 C  CZ2   . TRP B 2 410 ? 58.494 131.778 35.462 1.00 54.32  ? 398 TRP B CZ2   1 
ATOM   7579 C  CZ3   . TRP B 2 410 ? 57.263 129.731 35.220 1.00 54.51  ? 398 TRP B CZ3   1 
ATOM   7580 C  CH2   . TRP B 2 410 ? 58.144 130.542 35.920 1.00 53.93  ? 398 TRP B CH2   1 
ATOM   7581 N  N     . GLU B 2 411 ? 53.620 133.950 31.261 1.00 57.92  ? 399 GLU B N     1 
ATOM   7582 C  CA    . GLU B 2 411 ? 53.426 135.349 31.615 1.00 58.45  ? 399 GLU B CA    1 
ATOM   7583 C  C     . GLU B 2 411 ? 52.037 135.715 32.088 1.00 57.99  ? 399 GLU B C     1 
ATOM   7584 O  O     . GLU B 2 411 ? 51.880 136.667 32.854 1.00 57.26  ? 399 GLU B O     1 
ATOM   7585 C  CB    . GLU B 2 411 ? 53.797 136.231 30.442 1.00 58.62  ? 399 GLU B CB    1 
ATOM   7586 C  CG    . GLU B 2 411 ? 55.269 136.472 30.357 1.00 62.14  ? 399 GLU B CG    1 
ATOM   7587 C  CD    . GLU B 2 411 ? 55.603 137.410 29.244 1.00 65.47  ? 399 GLU B CD    1 
ATOM   7588 O  OE1   . GLU B 2 411 ? 56.801 137.703 29.045 1.00 66.25  ? 399 GLU B OE1   1 
ATOM   7589 O  OE2   . GLU B 2 411 ? 54.649 137.854 28.566 1.00 68.33  ? 399 GLU B OE2   1 
ATOM   7590 N  N     . THR B 2 412 ? 51.036 134.970 31.628 1.00 57.51  ? 400 THR B N     1 
ATOM   7591 C  CA    . THR B 2 412 ? 49.679 135.139 32.128 1.00 56.57  ? 400 THR B CA    1 
ATOM   7592 C  C     . THR B 2 412 ? 49.646 134.841 33.632 1.00 56.80  ? 400 THR B C     1 
ATOM   7593 O  O     . THR B 2 412 ? 49.012 135.570 34.398 1.00 54.17  ? 400 THR B O     1 
ATOM   7594 C  CB    . THR B 2 412 ? 48.672 134.194 31.385 1.00 57.43  ? 400 THR B CB    1 
ATOM   7595 O  OG1   . THR B 2 412 ? 48.593 134.547 29.998 1.00 56.31  ? 400 THR B OG1   1 
ATOM   7596 C  CG2   . THR B 2 412 ? 47.278 134.304 31.982 1.00 57.46  ? 400 THR B CG2   1 
ATOM   7597 N  N     . TRP B 2 413 ? 50.348 133.791 34.065 1.00 57.76  ? 401 TRP B N     1 
ATOM   7598 C  CA    . TRP B 2 413 ? 50.089 133.240 35.396 1.00 58.75  ? 401 TRP B CA    1 
ATOM   7599 C  C     . TRP B 2 413 ? 51.164 133.211 36.463 1.00 58.80  ? 401 TRP B C     1 
ATOM   7600 O  O     . TRP B 2 413 ? 50.863 132.927 37.613 1.00 57.72  ? 401 TRP B O     1 
ATOM   7601 C  CB    . TRP B 2 413 ? 49.512 131.838 35.269 1.00 59.14  ? 401 TRP B CB    1 
ATOM   7602 C  CG    . TRP B 2 413 ? 48.066 131.895 34.980 1.00 61.35  ? 401 TRP B CG    1 
ATOM   7603 C  CD1   . TRP B 2 413 ? 47.096 132.497 35.743 1.00 61.36  ? 401 TRP B CD1   1 
ATOM   7604 C  CD2   . TRP B 2 413 ? 47.414 131.403 33.811 1.00 61.59  ? 401 TRP B CD2   1 
ATOM   7605 N  NE1   . TRP B 2 413 ? 45.882 132.411 35.110 1.00 62.36  ? 401 TRP B NE1   1 
ATOM   7606 C  CE2   . TRP B 2 413 ? 46.049 131.746 33.925 1.00 63.47  ? 401 TRP B CE2   1 
ATOM   7607 C  CE3   . TRP B 2 413 ? 47.849 130.708 32.681 1.00 62.25  ? 401 TRP B CE3   1 
ATOM   7608 C  CZ2   . TRP B 2 413 ? 45.121 131.416 32.938 1.00 65.00  ? 401 TRP B CZ2   1 
ATOM   7609 C  CZ3   . TRP B 2 413 ? 46.926 130.382 31.705 1.00 63.92  ? 401 TRP B CZ3   1 
ATOM   7610 C  CH2   . TRP B 2 413 ? 45.578 130.735 31.838 1.00 66.23  ? 401 TRP B CH2   1 
ATOM   7611 N  N     . TRP B 2 414 ? 52.406 133.506 36.114 1.00 60.45  ? 402 TRP B N     1 
ATOM   7612 C  CA    . TRP B 2 414 ? 53.491 133.158 37.012 1.00 62.37  ? 402 TRP B CA    1 
ATOM   7613 C  C     . TRP B 2 414 ? 53.605 134.030 38.253 1.00 64.29  ? 402 TRP B C     1 
ATOM   7614 O  O     . TRP B 2 414 ? 54.121 133.584 39.271 1.00 66.63  ? 402 TRP B O     1 
ATOM   7615 C  CB    . TRP B 2 414 ? 54.819 133.160 36.269 1.00 61.13  ? 402 TRP B CB    1 
ATOM   7616 C  CG    . TRP B 2 414 ? 55.318 134.510 36.010 1.00 60.67  ? 402 TRP B CG    1 
ATOM   7617 C  CD1   . TRP B 2 414 ? 55.088 135.254 34.904 1.00 60.02  ? 402 TRP B CD1   1 
ATOM   7618 C  CD2   . TRP B 2 414 ? 56.159 135.297 36.865 1.00 60.60  ? 402 TRP B CD2   1 
ATOM   7619 N  NE1   . TRP B 2 414 ? 55.735 136.457 35.005 1.00 61.36  ? 402 TRP B NE1   1 
ATOM   7620 C  CE2   . TRP B 2 414 ? 56.401 136.511 36.201 1.00 60.71  ? 402 TRP B CE2   1 
ATOM   7621 C  CE3   . TRP B 2 414 ? 56.730 135.094 38.123 1.00 61.08  ? 402 TRP B CE3   1 
ATOM   7622 C  CZ2   . TRP B 2 414 ? 57.196 137.527 36.752 1.00 59.82  ? 402 TRP B CZ2   1 
ATOM   7623 C  CZ3   . TRP B 2 414 ? 57.520 136.107 38.671 1.00 62.20  ? 402 TRP B CZ3   1 
ATOM   7624 C  CH2   . TRP B 2 414 ? 57.744 137.307 37.982 1.00 59.38  ? 402 TRP B CH2   1 
ATOM   7625 N  N     . THR B 2 415 ? 53.142 135.268 38.198 1.00 66.59  ? 403 THR B N     1 
ATOM   7626 C  CA    . THR B 2 415 ? 53.262 136.121 39.376 1.00 68.84  ? 403 THR B CA    1 
ATOM   7627 C  C     . THR B 2 415 ? 52.255 135.736 40.455 1.00 70.15  ? 403 THR B C     1 
ATOM   7628 O  O     . THR B 2 415 ? 52.287 136.278 41.562 1.00 70.69  ? 403 THR B O     1 
ATOM   7629 C  CB    . THR B 2 415 ? 53.064 137.613 39.037 1.00 69.36  ? 403 THR B CB    1 
ATOM   7630 O  OG1   . THR B 2 415 ? 51.788 137.800 38.409 1.00 69.28  ? 403 THR B OG1   1 
ATOM   7631 C  CG2   . THR B 2 415 ? 54.176 138.104 38.126 1.00 68.07  ? 403 THR B CG2   1 
ATOM   7632 N  N     . GLU B 2 416 ? 51.366 134.801 40.129 1.00 71.26  ? 404 GLU B N     1 
ATOM   7633 C  CA    . GLU B 2 416 ? 50.339 134.349 41.068 1.00 72.95  ? 404 GLU B CA    1 
ATOM   7634 C  C     . GLU B 2 416 ? 50.927 133.358 42.085 1.00 72.16  ? 404 GLU B C     1 
ATOM   7635 O  O     . GLU B 2 416 ? 50.290 133.039 43.091 1.00 72.73  ? 404 GLU B O     1 
ATOM   7636 C  CB    . GLU B 2 416 ? 49.181 133.687 40.299 1.00 75.97  ? 404 GLU B CB    1 
ATOM   7637 C  CG    . GLU B 2 416 ? 47.802 133.754 40.982 1.00 81.04  ? 404 GLU B CG    1 
ATOM   7638 C  CD    . GLU B 2 416 ? 47.041 135.050 40.669 1.00 84.87  ? 404 GLU B CD    1 
ATOM   7639 O  OE1   . GLU B 2 416 ? 47.662 136.142 40.728 1.00 86.47  ? 404 GLU B OE1   1 
ATOM   7640 O  OE2   . GLU B 2 416 ? 45.823 134.979 40.362 1.00 85.13  ? 404 GLU B OE2   1 
ATOM   7641 N  N     . TYR B 2 417 ? 52.143 132.880 41.818 1.00 70.64  ? 405 TYR B N     1 
ATOM   7642 C  CA    . TYR B 2 417 ? 52.764 131.832 42.625 1.00 67.77  ? 405 TYR B CA    1 
ATOM   7643 C  C     . TYR B 2 417 ? 54.175 132.189 43.069 1.00 66.18  ? 405 TYR B C     1 
ATOM   7644 O  O     . TYR B 2 417 ? 54.837 131.417 43.762 1.00 66.49  ? 405 TYR B O     1 
ATOM   7645 C  CB    . TYR B 2 417 ? 52.817 130.530 41.840 1.00 68.20  ? 405 TYR B CB    1 
ATOM   7646 C  CG    . TYR B 2 417 ? 51.545 130.209 41.095 1.00 69.18  ? 405 TYR B CG    1 
ATOM   7647 C  CD1   . TYR B 2 417 ? 50.320 130.190 41.742 1.00 68.14  ? 405 TYR B CD1   1 
ATOM   7648 C  CD2   . TYR B 2 417 ? 51.579 129.899 39.742 1.00 70.09  ? 405 TYR B CD2   1 
ATOM   7649 C  CE1   . TYR B 2 417 ? 49.168 129.868 41.064 1.00 69.53  ? 405 TYR B CE1   1 
ATOM   7650 C  CE2   . TYR B 2 417 ? 50.436 129.579 39.056 1.00 70.36  ? 405 TYR B CE2   1 
ATOM   7651 C  CZ    . TYR B 2 417 ? 49.232 129.562 39.718 1.00 70.92  ? 405 TYR B CZ    1 
ATOM   7652 O  OH    . TYR B 2 417 ? 48.093 129.227 39.018 1.00 72.04  ? 405 TYR B OH    1 
ATOM   7653 N  N     . TRP B 2 418 ? 54.642 133.356 42.660 1.00 63.94  ? 406 TRP B N     1 
ATOM   7654 C  CA    . TRP B 2 418 ? 55.957 133.799 43.062 1.00 62.74  ? 406 TRP B CA    1 
ATOM   7655 C  C     . TRP B 2 418 ? 55.940 134.230 44.523 1.00 62.93  ? 406 TRP B C     1 
ATOM   7656 O  O     . TRP B 2 418 ? 54.905 134.648 45.040 1.00 62.74  ? 406 TRP B O     1 
ATOM   7657 C  CB    . TRP B 2 418 ? 56.414 134.951 42.180 1.00 61.77  ? 406 TRP B CB    1 
ATOM   7658 C  CG    . TRP B 2 418 ? 57.872 135.097 42.177 1.00 59.25  ? 406 TRP B CG    1 
ATOM   7659 C  CD1   . TRP B 2 418 ? 58.604 136.034 42.836 1.00 59.82  ? 406 TRP B CD1   1 
ATOM   7660 C  CD2   . TRP B 2 418 ? 58.801 134.260 41.495 1.00 58.82  ? 406 TRP B CD2   1 
ATOM   7661 N  NE1   . TRP B 2 418 ? 59.943 135.834 42.605 1.00 60.98  ? 406 TRP B NE1   1 
ATOM   7662 C  CE2   . TRP B 2 418 ? 60.089 134.749 41.782 1.00 60.12  ? 406 TRP B CE2   1 
ATOM   7663 C  CE3   . TRP B 2 418 ? 58.669 133.143 40.668 1.00 58.32  ? 406 TRP B CE3   1 
ATOM   7664 C  CZ2   . TRP B 2 418 ? 61.243 134.155 41.269 1.00 59.48  ? 406 TRP B CZ2   1 
ATOM   7665 C  CZ3   . TRP B 2 418 ? 59.810 132.555 40.160 1.00 58.22  ? 406 TRP B CZ3   1 
ATOM   7666 C  CH2   . TRP B 2 418 ? 61.083 133.061 40.462 1.00 59.11  ? 406 TRP B CH2   1 
ATOM   7667 N  N     . GLN B 2 419 ? 57.098 134.125 45.175 1.00 63.25  ? 407 GLN B N     1 
ATOM   7668 C  CA    . GLN B 2 419 ? 57.204 134.156 46.634 1.00 61.54  ? 407 GLN B CA    1 
ATOM   7669 C  C     . GLN B 2 419 ? 58.542 134.715 47.070 1.00 61.30  ? 407 GLN B C     1 
ATOM   7670 O  O     . GLN B 2 419 ? 58.801 134.832 48.260 1.00 62.20  ? 407 GLN B O     1 
ATOM   7671 C  CB    . GLN B 2 419 ? 57.081 132.750 47.207 1.00 61.27  ? 407 GLN B CB    1 
ATOM   7672 C  CG    . GLN B 2 419 ? 55.689 132.174 47.160 1.00 63.55  ? 407 GLN B CG    1 
ATOM   7673 C  CD    . GLN B 2 419 ? 54.866 132.629 48.334 1.00 64.99  ? 407 GLN B CD    1 
ATOM   7674 O  OE1   . GLN B 2 419 ? 54.635 133.828 48.507 1.00 66.39  ? 407 GLN B OE1   1 
ATOM   7675 N  NE2   . GLN B 2 419 ? 54.426 131.680 49.162 1.00 64.17  ? 407 GLN B NE2   1 
ATOM   7676 N  N     . ALA B 2 420 ? 59.399 135.035 46.107 1.00 60.36  ? 408 ALA B N     1 
ATOM   7677 C  CA    . ALA B 2 420 ? 60.755 135.462 46.410 1.00 59.72  ? 408 ALA B CA    1 
ATOM   7678 C  C     . ALA B 2 420 ? 60.837 136.970 46.539 1.00 60.84  ? 408 ALA B C     1 
ATOM   7679 O  O     . ALA B 2 420 ? 59.816 137.650 46.623 1.00 61.90  ? 408 ALA B O     1 
ATOM   7680 C  CB    . ALA B 2 420 ? 61.698 134.987 45.328 1.00 59.62  ? 408 ALA B CB    1 
ATOM   7681 N  N     . THR B 2 421 ? 62.063 137.486 46.567 1.00 61.34  ? 409 THR B N     1 
ATOM   7682 C  CA    . THR B 2 421 ? 62.310 138.923 46.498 1.00 61.05  ? 409 THR B CA    1 
ATOM   7683 C  C     . THR B 2 421 ? 63.293 139.174 45.371 1.00 60.73  ? 409 THR B C     1 
ATOM   7684 O  O     . THR B 2 421 ? 63.540 140.309 44.989 1.00 61.36  ? 409 THR B O     1 
ATOM   7685 C  CB    . THR B 2 421 ? 62.931 139.474 47.799 1.00 61.96  ? 409 THR B CB    1 
ATOM   7686 O  OG1   . THR B 2 421 ? 64.271 138.983 47.941 1.00 61.57  ? 409 THR B OG1   1 
ATOM   7687 C  CG2   . THR B 2 421 ? 62.103 139.052 49.003 1.00 62.34  ? 409 THR B CG2   1 
ATOM   7688 N  N     . TRP B 2 422 ? 63.871 138.100 44.857 1.00 60.26  ? 410 TRP B N     1 
ATOM   7689 C  CA    . TRP B 2 422 ? 64.705 138.182 43.675 1.00 60.78  ? 410 TRP B CA    1 
ATOM   7690 C  C     . TRP B 2 422 ? 63.893 137.621 42.530 1.00 59.71  ? 410 TRP B C     1 
ATOM   7691 O  O     . TRP B 2 422 ? 62.869 136.969 42.745 1.00 60.06  ? 410 TRP B O     1 
ATOM   7692 C  CB    . TRP B 2 422 ? 65.988 137.362 43.864 1.00 63.39  ? 410 TRP B CB    1 
ATOM   7693 C  CG    . TRP B 2 422 ? 65.806 136.206 44.791 1.00 66.94  ? 410 TRP B CG    1 
ATOM   7694 C  CD1   . TRP B 2 422 ? 66.074 136.180 46.130 1.00 68.21  ? 410 TRP B CD1   1 
ATOM   7695 C  CD2   . TRP B 2 422 ? 65.224 134.932 44.476 1.00 68.64  ? 410 TRP B CD2   1 
ATOM   7696 N  NE1   . TRP B 2 422 ? 65.685 134.977 46.669 1.00 68.51  ? 410 TRP B NE1   1 
ATOM   7697 C  CE2   . TRP B 2 422 ? 65.160 134.196 45.674 1.00 68.90  ? 410 TRP B CE2   1 
ATOM   7698 C  CE3   . TRP B 2 422 ? 64.747 134.347 43.299 1.00 69.31  ? 410 TRP B CE3   1 
ATOM   7699 C  CZ2   . TRP B 2 422 ? 64.637 132.904 45.725 1.00 68.59  ? 410 TRP B CZ2   1 
ATOM   7700 C  CZ3   . TRP B 2 422 ? 64.229 133.064 43.356 1.00 68.64  ? 410 TRP B CZ3   1 
ATOM   7701 C  CH2   . TRP B 2 422 ? 64.177 132.359 44.558 1.00 68.72  ? 410 TRP B CH2   1 
ATOM   7702 N  N     . ILE B 2 423 ? 64.341 137.891 41.313 1.00 58.20  ? 411 ILE B N     1 
ATOM   7703 C  CA    . ILE B 2 423 ? 63.748 137.291 40.127 1.00 56.88  ? 411 ILE B CA    1 
ATOM   7704 C  C     . ILE B 2 423 ? 64.887 136.918 39.193 1.00 56.05  ? 411 ILE B C     1 
ATOM   7705 O  O     . ILE B 2 423 ? 65.678 137.768 38.783 1.00 56.22  ? 411 ILE B O     1 
ATOM   7706 C  CB    . ILE B 2 423 ? 62.793 138.280 39.402 1.00 57.14  ? 411 ILE B CB    1 
ATOM   7707 C  CG1   . ILE B 2 423 ? 61.734 138.786 40.380 1.00 57.73  ? 411 ILE B CG1   1 
ATOM   7708 C  CG2   . ILE B 2 423 ? 62.112 137.596 38.229 1.00 54.39  ? 411 ILE B CG2   1 
ATOM   7709 C  CD1   . ILE B 2 423 ? 60.674 139.651 39.750 1.00 60.07  ? 411 ILE B CD1   1 
ATOM   7710 N  N     . PRO B 2 424 ? 64.996 135.631 38.863 1.00 54.61  ? 412 PRO B N     1 
ATOM   7711 C  CA    . PRO B 2 424 ? 66.018 135.116 37.953 1.00 55.06  ? 412 PRO B CA    1 
ATOM   7712 C  C     . PRO B 2 424 ? 65.654 135.534 36.548 1.00 56.29  ? 412 PRO B C     1 
ATOM   7713 O  O     . PRO B 2 424 ? 64.470 135.695 36.243 1.00 58.52  ? 412 PRO B O     1 
ATOM   7714 C  CB    . PRO B 2 424 ? 65.900 133.618 38.112 1.00 55.51  ? 412 PRO B CB    1 
ATOM   7715 C  CG    . PRO B 2 424 ? 64.445 133.420 38.417 1.00 55.07  ? 412 PRO B CG    1 
ATOM   7716 C  CD    . PRO B 2 424 ? 64.054 134.583 39.277 1.00 54.73  ? 412 PRO B CD    1 
ATOM   7717 N  N     . GLU B 2 425 ? 66.646 135.705 35.686 1.00 54.62  ? 413 GLU B N     1 
ATOM   7718 C  CA    . GLU B 2 425 ? 66.335 135.883 34.288 1.00 54.52  ? 413 GLU B CA    1 
ATOM   7719 C  C     . GLU B 2 425 ? 65.717 134.597 33.762 1.00 54.31  ? 413 GLU B C     1 
ATOM   7720 O  O     . GLU B 2 425 ? 65.866 133.544 34.353 1.00 54.11  ? 413 GLU B O     1 
ATOM   7721 C  CB    . GLU B 2 425 ? 67.590 136.210 33.513 1.00 55.65  ? 413 GLU B CB    1 
ATOM   7722 C  CG    . GLU B 2 425 ? 68.027 137.639 33.657 1.00 58.55  ? 413 GLU B CG    1 
ATOM   7723 C  CD    . GLU B 2 425 ? 69.303 137.893 32.893 1.00 61.97  ? 413 GLU B CD    1 
ATOM   7724 O  OE1   . GLU B 2 425 ? 70.324 137.241 33.217 1.00 63.31  ? 413 GLU B OE1   1 
ATOM   7725 O  OE2   . GLU B 2 425 ? 69.283 138.728 31.965 1.00 61.62  ? 413 GLU B OE2   1 
ATOM   7726 N  N     . TRP B 2 426 ? 64.999 134.683 32.659 1.00 54.62  ? 414 TRP B N     1 
ATOM   7727 C  CA    . TRP B 2 426 ? 64.571 133.480 31.977 1.00 55.48  ? 414 TRP B CA    1 
ATOM   7728 C  C     . TRP B 2 426 ? 64.435 133.712 30.483 1.00 56.19  ? 414 TRP B C     1 
ATOM   7729 O  O     . TRP B 2 426 ? 64.532 134.843 30.008 1.00 56.74  ? 414 TRP B O     1 
ATOM   7730 C  CB    . TRP B 2 426 ? 63.254 132.949 32.576 1.00 56.07  ? 414 TRP B CB    1 
ATOM   7731 C  CG    . TRP B 2 426 ? 62.155 133.965 32.816 1.00 55.37  ? 414 TRP B CG    1 
ATOM   7732 C  CD1   . TRP B 2 426 ? 61.586 134.786 31.895 1.00 55.38  ? 414 TRP B CD1   1 
ATOM   7733 C  CD2   . TRP B 2 426 ? 61.480 134.228 34.053 1.00 55.22  ? 414 TRP B CD2   1 
ATOM   7734 N  NE1   . TRP B 2 426 ? 60.599 135.544 32.476 1.00 55.46  ? 414 TRP B NE1   1 
ATOM   7735 C  CE2   . TRP B 2 426 ? 60.515 135.219 33.803 1.00 54.98  ? 414 TRP B CE2   1 
ATOM   7736 C  CE3   . TRP B 2 426 ? 61.597 133.718 35.351 1.00 55.36  ? 414 TRP B CE3   1 
ATOM   7737 C  CZ2   . TRP B 2 426 ? 59.677 135.715 34.794 1.00 54.54  ? 414 TRP B CZ2   1 
ATOM   7738 C  CZ3   . TRP B 2 426 ? 60.764 134.209 36.335 1.00 53.66  ? 414 TRP B CZ3   1 
ATOM   7739 C  CH2   . TRP B 2 426 ? 59.816 135.197 36.052 1.00 55.00  ? 414 TRP B CH2   1 
ATOM   7740 N  N     . GLU B 2 427 ? 64.262 132.628 29.741 1.00 57.08  ? 415 GLU B N     1 
ATOM   7741 C  CA    . GLU B 2 427 ? 63.897 132.707 28.333 1.00 59.95  ? 415 GLU B CA    1 
ATOM   7742 C  C     . GLU B 2 427 ? 63.177 131.422 28.005 1.00 60.88  ? 415 GLU B C     1 
ATOM   7743 O  O     . GLU B 2 427 ? 63.301 130.447 28.729 1.00 61.65  ? 415 GLU B O     1 
ATOM   7744 C  CB    . GLU B 2 427 ? 65.132 132.878 27.438 1.00 60.30  ? 415 GLU B CB    1 
ATOM   7745 C  CG    . GLU B 2 427 ? 65.966 131.628 27.207 1.00 62.81  ? 415 GLU B CG    1 
ATOM   7746 C  CD    . GLU B 2 427 ? 67.280 131.931 26.492 1.00 64.43  ? 415 GLU B CD    1 
ATOM   7747 O  OE1   . GLU B 2 427 ? 68.233 131.140 26.638 1.00 65.29  ? 415 GLU B OE1   1 
ATOM   7748 O  OE2   . GLU B 2 427 ? 67.363 132.962 25.784 1.00 64.46  ? 415 GLU B OE2   1 
ATOM   7749 N  N     . PHE B 2 428 ? 62.400 131.416 26.938 1.00 62.78  ? 416 PHE B N     1 
ATOM   7750 C  CA    . PHE B 2 428 ? 61.533 130.282 26.702 1.00 66.67  ? 416 PHE B CA    1 
ATOM   7751 C  C     . PHE B 2 428 ? 62.075 129.354 25.626 1.00 70.67  ? 416 PHE B C     1 
ATOM   7752 O  O     . PHE B 2 428 ? 62.641 129.805 24.627 1.00 71.16  ? 416 PHE B O     1 
ATOM   7753 C  CB    . PHE B 2 428 ? 60.143 130.793 26.357 1.00 65.52  ? 416 PHE B CB    1 
ATOM   7754 C  CG    . PHE B 2 428 ? 59.621 131.764 27.355 1.00 64.16  ? 416 PHE B CG    1 
ATOM   7755 C  CD1   . PHE B 2 428 ? 59.260 131.337 28.616 1.00 64.12  ? 416 PHE B CD1   1 
ATOM   7756 C  CD2   . PHE B 2 428 ? 59.564 133.111 27.064 1.00 64.32  ? 416 PHE B CD2   1 
ATOM   7757 C  CE1   . PHE B 2 428 ? 58.857 132.236 29.575 1.00 64.25  ? 416 PHE B CE1   1 
ATOM   7758 C  CE2   . PHE B 2 428 ? 59.161 134.019 28.017 1.00 64.39  ? 416 PHE B CE2   1 
ATOM   7759 C  CZ    . PHE B 2 428 ? 58.809 133.580 29.275 1.00 64.42  ? 416 PHE B CZ    1 
ATOM   7760 N  N     . VAL B 2 429 ? 61.919 128.050 25.844 1.00 74.49  ? 417 VAL B N     1 
ATOM   7761 C  CA    . VAL B 2 429 ? 62.477 127.067 24.929 1.00 78.42  ? 417 VAL B CA    1 
ATOM   7762 C  C     . VAL B 2 429 ? 61.424 126.169 24.305 1.00 81.82  ? 417 VAL B C     1 
ATOM   7763 O  O     . VAL B 2 429 ? 60.424 125.820 24.933 1.00 81.44  ? 417 VAL B O     1 
ATOM   7764 C  CB    . VAL B 2 429 ? 63.490 126.173 25.634 1.00 77.94  ? 417 VAL B CB    1 
ATOM   7765 C  CG1   . VAL B 2 429 ? 64.181 125.281 24.621 1.00 78.74  ? 417 VAL B CG1   1 
ATOM   7766 C  CG2   . VAL B 2 429 ? 64.491 127.020 26.373 1.00 79.10  ? 417 VAL B CG2   1 
ATOM   7767 N  N     . ASN B 2 430 ? 61.669 125.792 23.056 1.00 86.33  ? 418 ASN B N     1 
ATOM   7768 C  CA    . ASN B 2 430 ? 60.851 124.797 22.383 1.00 90.46  ? 418 ASN B CA    1 
ATOM   7769 C  C     . ASN B 2 430 ? 61.602 123.468 22.269 1.00 92.27  ? 418 ASN B C     1 
ATOM   7770 O  O     . ASN B 2 430 ? 62.144 123.139 21.217 1.00 92.71  ? 418 ASN B O     1 
ATOM   7771 C  CB    . ASN B 2 430 ? 60.464 125.310 20.996 1.00 91.45  ? 418 ASN B CB    1 
ATOM   7772 C  CG    . ASN B 2 430 ? 58.969 125.451 20.832 1.00 92.87  ? 418 ASN B CG    1 
ATOM   7773 O  OD1   . ASN B 2 430 ? 58.264 124.457 20.631 1.00 93.20  ? 418 ASN B OD1   1 
ATOM   7774 N  ND2   . ASN B 2 430 ? 58.470 126.685 20.929 1.00 92.22  ? 418 ASN B ND2   1 
ATOM   7775 N  N     . THR B 2 431 ? 61.627 122.702 23.355 1.00 94.69  ? 419 THR B N     1 
ATOM   7776 C  CA    . THR B 2 431 ? 62.483 121.523 23.419 1.00 97.38  ? 419 THR B CA    1 
ATOM   7777 C  C     . THR B 2 431 ? 62.088 120.396 22.466 1.00 99.35  ? 419 THR B C     1 
ATOM   7778 O  O     . THR B 2 431 ? 60.916 120.236 22.098 1.00 98.77  ? 419 THR B O     1 
ATOM   7779 C  CB    . THR B 2 431 ? 62.545 120.939 24.854 1.00 97.38  ? 419 THR B CB    1 
ATOM   7780 O  OG1   . THR B 2 431 ? 63.287 119.710 24.839 1.00 98.58  ? 419 THR B OG1   1 
ATOM   7781 C  CG2   . THR B 2 431 ? 61.151 120.673 25.393 1.00 96.89  ? 419 THR B CG2   1 
ATOM   7782 N  N     . PRO B 2 432 ? 63.085 119.606 22.038 1.00 101.09 ? 420 PRO B N     1 
ATOM   7783 C  CA    . PRO B 2 432 ? 62.838 118.314 21.397 1.00 102.13 ? 420 PRO B CA    1 
ATOM   7784 C  C     . PRO B 2 432 ? 62.402 117.301 22.444 1.00 102.80 ? 420 PRO B C     1 
ATOM   7785 O  O     . PRO B 2 432 ? 62.940 117.263 23.554 1.00 102.29 ? 420 PRO B O     1 
ATOM   7786 C  CB    . PRO B 2 432 ? 64.186 117.955 20.777 1.00 102.40 ? 420 PRO B CB    1 
ATOM   7787 C  CG    . PRO B 2 432 ? 65.187 118.658 21.635 1.00 102.49 ? 420 PRO B CG    1 
ATOM   7788 C  CD    . PRO B 2 432 ? 64.522 119.934 22.087 1.00 101.92 ? 420 PRO B CD    1 
ATOM   7789 N  N     . PRO B 2 433 ? 61.410 116.470 22.101 1.00 103.79 ? 421 PRO B N     1 
ATOM   7790 C  CA    . PRO B 2 433 ? 60.876 115.458 23.020 1.00 104.15 ? 421 PRO B CA    1 
ATOM   7791 C  C     . PRO B 2 433 ? 61.901 114.379 23.363 1.00 104.03 ? 421 PRO B C     1 
ATOM   7792 O  O     . PRO B 2 433 ? 61.628 113.477 24.153 1.00 104.29 ? 421 PRO B O     1 
ATOM   7793 C  CB    . PRO B 2 433 ? 59.663 114.897 22.275 1.00 104.10 ? 421 PRO B CB    1 
ATOM   7794 C  CG    . PRO B 2 433 ? 59.944 115.174 20.826 1.00 104.31 ? 421 PRO B CG    1 
ATOM   7795 C  CD    . PRO B 2 433 ? 60.740 116.449 20.789 1.00 103.73 ? 421 PRO B CD    1 
ATOM   7796 N  N     . LEU B 2 434 ? 63.083 114.481 22.762 1.00 104.02 ? 422 LEU B N     1 
ATOM   7797 C  CA    . LEU B 2 434 ? 64.146 113.511 22.992 1.00 103.38 ? 422 LEU B CA    1 
ATOM   7798 C  C     . LEU B 2 434 ? 64.723 113.678 24.392 1.00 103.53 ? 422 LEU B C     1 
ATOM   7799 O  O     . LEU B 2 434 ? 64.794 112.715 25.149 1.00 103.38 ? 422 LEU B O     1 
ATOM   7800 C  CB    . LEU B 2 434 ? 65.257 113.679 21.950 1.00 102.42 ? 422 LEU B CB    1 
ATOM   7801 C  CG    . LEU B 2 434 ? 64.864 113.482 20.483 1.00 101.77 ? 422 LEU B CG    1 
ATOM   7802 C  CD1   . LEU B 2 434 ? 64.214 112.124 20.311 1.00 100.66 ? 422 LEU B CD1   1 
ATOM   7803 C  CD2   . LEU B 2 434 ? 63.913 114.581 20.051 1.00 101.29 ? 422 LEU B CD2   1 
ATOM   7804 N  N     . VAL B 2 435 ? 65.124 114.902 24.734 1.00 104.17 ? 423 VAL B N     1 
ATOM   7805 C  CA    . VAL B 2 435 ? 65.687 115.188 26.055 1.00 104.27 ? 423 VAL B CA    1 
ATOM   7806 C  C     . VAL B 2 435 ? 64.604 115.003 27.114 1.00 104.55 ? 423 VAL B C     1 
ATOM   7807 O  O     . VAL B 2 435 ? 64.892 114.777 28.288 1.00 104.09 ? 423 VAL B O     1 
ATOM   7808 C  CB    . VAL B 2 435 ? 66.240 116.636 26.138 1.00 103.94 ? 423 VAL B CB    1 
ATOM   7809 C  CG1   . VAL B 2 435 ? 66.986 116.839 27.451 1.00 102.97 ? 423 VAL B CG1   1 
ATOM   7810 C  CG2   . VAL B 2 435 ? 67.157 116.910 24.964 1.00 103.23 ? 423 VAL B CG2   1 
ATOM   7811 N  N     . LYS B 2 436 ? 63.352 115.101 26.685 1.00 105.50 ? 424 LYS B N     1 
ATOM   7812 C  CA    . LYS B 2 436 ? 62.224 114.710 27.520 1.00 106.54 ? 424 LYS B CA    1 
ATOM   7813 C  C     . LYS B 2 436 ? 62.428 113.269 27.972 1.00 107.33 ? 424 LYS B C     1 
ATOM   7814 O  O     . LYS B 2 436 ? 61.859 112.834 28.969 1.00 107.98 ? 424 LYS B O     1 
ATOM   7815 C  CB    . LYS B 2 436 ? 60.921 114.832 26.716 1.00 106.13 ? 424 LYS B CB    1 
ATOM   7816 C  CG    . LYS B 2 436 ? 59.729 114.062 27.275 1.00 105.78 ? 424 LYS B CG    1 
ATOM   7817 C  CD    . LYS B 2 436 ? 58.622 113.936 26.222 1.00 105.62 ? 424 LYS B CD    1 
ATOM   7818 C  CE    . LYS B 2 436 ? 57.456 113.080 26.709 1.00 104.94 ? 424 LYS B CE    1 
ATOM   7819 N  NZ    . LYS B 2 436 ? 56.395 112.919 25.670 1.00 103.51 ? 424 LYS B NZ    1 
ATOM   7820 N  N     . LEU B 2 437 ? 63.262 112.544 27.232 1.00 107.95 ? 425 LEU B N     1 
ATOM   7821 C  CA    . LEU B 2 437 ? 63.294 111.087 27.289 1.00 108.55 ? 425 LEU B CA    1 
ATOM   7822 C  C     . LEU B 2 437 ? 64.668 110.558 27.710 1.00 109.39 ? 425 LEU B C     1 
ATOM   7823 O  O     . LEU B 2 437 ? 64.905 109.352 27.707 1.00 109.49 ? 425 LEU B O     1 
ATOM   7824 C  CB    . LEU B 2 437 ? 62.908 110.521 25.915 1.00 107.93 ? 425 LEU B CB    1 
ATOM   7825 C  CG    . LEU B 2 437 ? 62.427 109.073 25.804 1.00 107.34 ? 425 LEU B CG    1 
ATOM   7826 C  CD1   . LEU B 2 437 ? 61.299 108.827 26.794 1.00 107.21 ? 425 LEU B CD1   1 
ATOM   7827 C  CD2   . LEU B 2 437 ? 61.960 108.801 24.384 1.00 106.22 ? 425 LEU B CD2   1 
ATOM   7828 N  N     . TRP B 2 438 ? 65.573 111.464 28.066 1.00 110.65 ? 426 TRP B N     1 
ATOM   7829 C  CA    . TRP B 2 438 ? 66.929 111.084 28.460 1.00 111.67 ? 426 TRP B CA    1 
ATOM   7830 C  C     . TRP B 2 438 ? 67.088 111.094 29.980 1.00 112.81 ? 426 TRP B C     1 
ATOM   7831 O  O     . TRP B 2 438 ? 68.129 110.703 30.511 1.00 112.47 ? 426 TRP B O     1 
ATOM   7832 C  CB    . TRP B 2 438 ? 67.956 112.036 27.829 1.00 111.31 ? 426 TRP B CB    1 
ATOM   7833 C  CG    . TRP B 2 438 ? 68.014 112.024 26.305 1.00 110.95 ? 426 TRP B CG    1 
ATOM   7834 C  CD1   . TRP B 2 438 ? 68.488 113.024 25.497 1.00 110.36 ? 426 TRP B CD1   1 
ATOM   7835 C  CD2   . TRP B 2 438 ? 67.611 110.960 25.424 1.00 111.04 ? 426 TRP B CD2   1 
ATOM   7836 N  NE1   . TRP B 2 438 ? 68.410 112.649 24.176 1.00 109.93 ? 426 TRP B NE1   1 
ATOM   7837 C  CE2   . TRP B 2 438 ? 67.875 111.389 24.103 1.00 110.52 ? 426 TRP B CE2   1 
ATOM   7838 C  CE3   . TRP B 2 438 ? 67.052 109.690 25.621 1.00 111.21 ? 426 TRP B CE3   1 
ATOM   7839 C  CZ2   . TRP B 2 438 ? 67.601 110.591 22.988 1.00 110.40 ? 426 TRP B CZ2   1 
ATOM   7840 C  CZ3   . TRP B 2 438 ? 66.779 108.898 24.508 1.00 110.76 ? 426 TRP B CZ3   1 
ATOM   7841 C  CH2   . TRP B 2 438 ? 67.054 109.354 23.211 1.00 109.88 ? 426 TRP B CH2   1 
ATOM   7842 N  N     . TYR B 2 439 ? 66.050 111.548 30.673 1.00 114.60 ? 427 TYR B N     1 
ATOM   7843 C  CA    . TYR B 2 439 ? 66.037 111.550 32.131 1.00 116.77 ? 427 TYR B CA    1 
ATOM   7844 C  C     . TYR B 2 439 ? 64.855 110.747 32.674 1.00 118.27 ? 427 TYR B C     1 
ATOM   7845 O  O     . TYR B 2 439 ? 64.422 110.950 33.810 1.00 117.65 ? 427 TYR B O     1 
ATOM   7846 C  CB    . TYR B 2 439 ? 65.963 112.985 32.649 1.00 116.91 ? 427 TYR B CB    1 
ATOM   7847 C  CG    . TYR B 2 439 ? 67.061 113.884 32.126 1.00 118.02 ? 427 TYR B CG    1 
ATOM   7848 C  CD1   . TYR B 2 439 ? 68.289 113.967 32.773 1.00 119.02 ? 427 TYR B CD1   1 
ATOM   7849 C  CD2   . TYR B 2 439 ? 66.865 114.665 30.995 1.00 118.78 ? 427 TYR B CD2   1 
ATOM   7850 C  CE1   . TYR B 2 439 ? 69.294 114.809 32.308 1.00 118.84 ? 427 TYR B CE1   1 
ATOM   7851 C  CE2   . TYR B 2 439 ? 67.863 115.511 30.522 1.00 119.28 ? 427 TYR B CE2   1 
ATOM   7852 C  CZ    . TYR B 2 439 ? 69.074 115.578 31.182 1.00 118.94 ? 427 TYR B CZ    1 
ATOM   7853 O  OH    . TYR B 2 439 ? 70.061 116.416 30.713 1.00 118.24 ? 427 TYR B OH    1 
ATOM   7854 N  N     . GLN B 2 440 ? 64.335 109.837 31.856 1.00 120.38 ? 428 GLN B N     1 
ATOM   7855 C  CA    . GLN B 2 440 ? 63.196 109.015 32.248 1.00 123.10 ? 428 GLN B CA    1 
ATOM   7856 C  C     . GLN B 2 440 ? 63.573 107.997 33.328 1.00 125.42 ? 428 GLN B C     1 
ATOM   7857 O  O     . GLN B 2 440 ? 64.630 107.367 33.255 1.00 126.24 ? 428 GLN B O     1 
ATOM   7858 C  CB    . GLN B 2 440 ? 62.625 108.285 31.024 1.00 122.13 ? 428 GLN B CB    1 
ATOM   7859 C  CG    . GLN B 2 440 ? 61.514 109.040 30.299 1.00 121.29 ? 428 GLN B CG    1 
ATOM   7860 C  CD    . GLN B 2 440 ? 60.211 109.051 31.083 1.00 120.93 ? 428 GLN B CD    1 
ATOM   7861 O  OE1   . GLN B 2 440 ? 59.281 109.794 30.762 1.00 120.01 ? 428 GLN B OE1   1 
ATOM   7862 N  NE2   . GLN B 2 440 ? 60.139 108.222 32.117 1.00 120.29 ? 428 GLN B NE2   1 
ATOM   7863 N  N     . LEU B 2 441 ? 62.701 107.850 34.327 1.00 127.39 ? 429 LEU B N     1 
ATOM   7864 C  CA    . LEU B 2 441 ? 62.836 106.819 35.366 1.00 128.66 ? 429 LEU B CA    1 
ATOM   7865 C  C     . LEU B 2 441 ? 61.790 105.724 35.080 1.00 129.24 ? 429 LEU B C     1 
ATOM   7866 O  O     . LEU B 2 441 ? 61.120 105.760 34.042 1.00 129.44 ? 429 LEU B O     1 
ATOM   7867 C  CB    . LEU B 2 441 ? 62.605 107.448 36.761 1.00 128.61 ? 429 LEU B CB    1 
ATOM   7868 C  CG    . LEU B 2 441 ? 63.226 106.874 38.050 1.00 128.08 ? 429 LEU B CG    1 
ATOM   7869 C  CD1   . LEU B 2 441 ? 63.390 107.990 39.081 1.00 127.81 ? 429 LEU B CD1   1 
ATOM   7870 C  CD2   . LEU B 2 441 ? 62.356 105.765 38.618 1.00 127.32 ? 429 LEU B CD2   1 
ATOM   7871 N  N     . GLU B 2 442 ? 61.670 104.751 35.985 1.00 129.35 ? 430 GLU B N     1 
ATOM   7872 C  CA    . GLU B 2 442 ? 60.574 103.775 35.956 1.00 128.84 ? 430 GLU B CA    1 
ATOM   7873 C  C     . GLU B 2 442 ? 60.670 102.810 37.142 1.00 129.20 ? 430 GLU B C     1 
ATOM   7874 O  O     . GLU B 2 442 ? 60.807 101.589 36.897 1.00 129.36 ? 430 GLU B O     1 
ATOM   7875 C  CB    . GLU B 2 442 ? 60.583 102.977 34.643 1.00 127.25 ? 430 GLU B CB    1 
ATOM   7876 P  P     . DG  C 3 4   ? 78.422 132.816 13.614 1.00 108.54 ? 805 DG  P P     1 
ATOM   7877 O  OP1   . DG  C 3 4   ? 77.772 131.753 14.494 1.00 109.32 ? 805 DG  P OP1   1 
ATOM   7878 O  OP2   . DG  C 3 4   ? 79.617 133.485 14.278 1.00 108.13 ? 805 DG  P OP2   1 
ATOM   7879 O  "O5'" . DG  C 3 4   ? 79.025 132.004 12.338 1.00 106.70 ? 805 DG  P "O5'" 1 
ATOM   7880 C  "C5'" . DG  C 3 4   ? 79.948 132.632 11.429 1.00 103.88 ? 805 DG  P "C5'" 1 
ATOM   7881 C  "C4'" . DG  C 3 4   ? 80.246 131.705 10.274 1.00 100.91 ? 805 DG  P "C4'" 1 
ATOM   7882 O  "O4'" . DG  C 3 4   ? 80.736 130.452 10.798 1.00 98.62  ? 805 DG  P "O4'" 1 
ATOM   7883 C  "C3'" . DG  C 3 4   ? 79.026 131.352 9.433  1.00 99.72  ? 805 DG  P "C3'" 1 
ATOM   7884 O  "O3'" . DG  C 3 4   ? 79.076 132.132 8.238  1.00 100.18 ? 805 DG  P "O3'" 1 
ATOM   7885 C  "C2'" . DG  C 3 4   ? 79.322 129.935 8.971  1.00 98.10  ? 805 DG  P "C2'" 1 
ATOM   7886 C  "C1'" . DG  C 3 4   ? 80.258 129.364 10.028 1.00 95.79  ? 805 DG  P "C1'" 1 
ATOM   7887 N  N9    . DG  C 3 4   ? 79.641 128.420 10.952 1.00 91.85  ? 805 DG  P N9    1 
ATOM   7888 C  C8    . DG  C 3 4   ? 79.577 128.529 12.319 1.00 90.63  ? 805 DG  P C8    1 
ATOM   7889 N  N7    . DG  C 3 4   ? 78.987 127.513 12.886 1.00 89.40  ? 805 DG  P N7    1 
ATOM   7890 C  C5    . DG  C 3 4   ? 78.634 126.690 11.828 1.00 88.67  ? 805 DG  P C5    1 
ATOM   7891 C  C6    . DG  C 3 4   ? 77.969 125.442 11.822 1.00 87.65  ? 805 DG  P C6    1 
ATOM   7892 O  O6    . DG  C 3 4   ? 77.549 124.789 12.785 1.00 86.94  ? 805 DG  P O6    1 
ATOM   7893 N  N1    . DG  C 3 4   ? 77.811 124.954 10.528 1.00 86.84  ? 805 DG  P N1    1 
ATOM   7894 C  C2    . DG  C 3 4   ? 78.245 125.588 9.388  1.00 86.41  ? 805 DG  P C2    1 
ATOM   7895 N  N2    . DG  C 3 4   ? 78.008 124.956 8.230  1.00 85.56  ? 805 DG  P N2    1 
ATOM   7896 N  N3    . DG  C 3 4   ? 78.866 126.752 9.382  1.00 86.82  ? 805 DG  P N3    1 
ATOM   7897 C  C4    . DG  C 3 4   ? 79.026 127.241 10.626 1.00 89.23  ? 805 DG  P C4    1 
ATOM   7898 P  P     . DT  C 3 5   ? 77.717 132.733 7.628  1.00 101.08 ? 806 DT  P P     1 
ATOM   7899 O  OP1   . DT  C 3 5   ? 78.071 133.745 6.593  1.00 100.65 ? 806 DT  P OP1   1 
ATOM   7900 O  OP2   . DT  C 3 5   ? 76.811 133.105 8.752  1.00 99.97  ? 806 DT  P OP2   1 
ATOM   7901 O  "O5'" . DT  C 3 5   ? 77.072 131.488 6.881  1.00 99.21  ? 806 DT  P "O5'" 1 
ATOM   7902 C  "C5'" . DT  C 3 5   ? 77.669 130.948 5.703  1.00 92.75  ? 806 DT  P "C5'" 1 
ATOM   7903 C  "C4'" . DT  C 3 5   ? 76.849 129.776 5.228  1.00 87.18  ? 806 DT  P "C4'" 1 
ATOM   7904 O  "O4'" . DT  C 3 5   ? 76.975 128.716 6.200  1.00 83.82  ? 806 DT  P "O4'" 1 
ATOM   7905 C  "C3'" . DT  C 3 5   ? 75.361 130.094 5.175  1.00 85.59  ? 806 DT  P "C3'" 1 
ATOM   7906 O  "O3'" . DT  C 3 5   ? 74.993 130.369 3.824  1.00 86.73  ? 806 DT  P "O3'" 1 
ATOM   7907 C  "C2'" . DT  C 3 5   ? 74.714 128.759 5.504  1.00 82.69  ? 806 DT  P "C2'" 1 
ATOM   7908 C  "C1'" . DT  C 3 5   ? 75.750 128.018 6.340  1.00 79.21  ? 806 DT  P "C1'" 1 
ATOM   7909 N  N1    . DT  C 3 5   ? 75.458 127.919 7.786  1.00 73.34  ? 806 DT  P N1    1 
ATOM   7910 C  C2    . DT  C 3 5   ? 74.945 126.733 8.261  1.00 69.89  ? 806 DT  P C2    1 
ATOM   7911 O  O2    . DT  C 3 5   ? 74.689 125.785 7.543  1.00 68.38  ? 806 DT  P O2    1 
ATOM   7912 N  N3    . DT  C 3 5   ? 74.741 126.696 9.614  1.00 67.71  ? 806 DT  P N3    1 
ATOM   7913 C  C4    . DT  C 3 5   ? 74.980 127.704 10.519 1.00 69.03  ? 806 DT  P C4    1 
ATOM   7914 O  O4    . DT  C 3 5   ? 74.747 127.517 11.710 1.00 68.73  ? 806 DT  P O4    1 
ATOM   7915 C  C5    . DT  C 3 5   ? 75.504 128.931 9.954  1.00 69.17  ? 806 DT  P C5    1 
ATOM   7916 C  C7    . DT  C 3 5   ? 75.794 130.080 10.862 1.00 68.62  ? 806 DT  P C7    1 
ATOM   7917 C  C6    . DT  C 3 5   ? 75.708 128.978 8.631  1.00 70.33  ? 806 DT  P C6    1 
ATOM   7918 P  P     . DC  C 3 6   ? 73.450 130.652 3.463  1.00 87.92  ? 807 DC  P P     1 
ATOM   7919 O  OP1   . DC  C 3 6   ? 73.373 131.403 2.175  1.00 85.36  ? 807 DC  P OP1   1 
ATOM   7920 O  OP2   . DC  C 3 6   ? 72.739 131.180 4.667  1.00 84.95  ? 807 DC  P OP2   1 
ATOM   7921 O  "O5'" . DC  C 3 6   ? 72.918 129.185 3.173  1.00 86.04  ? 807 DC  P "O5'" 1 
ATOM   7922 C  "C5'" . DC  C 3 6   ? 71.545 128.882 3.287  1.00 81.49  ? 807 DC  P "C5'" 1 
ATOM   7923 C  "C4'" . DC  C 3 6   ? 71.379 127.443 3.688  1.00 75.92  ? 807 DC  P "C4'" 1 
ATOM   7924 O  "O4'" . DC  C 3 6   ? 72.166 127.207 4.867  1.00 74.01  ? 807 DC  P "O4'" 1 
ATOM   7925 C  "C3'" . DC  C 3 6   ? 69.954 127.098 4.069  1.00 75.18  ? 807 DC  P "C3'" 1 
ATOM   7926 O  "O3'" . DC  C 3 6   ? 69.391 126.402 2.976  1.00 76.12  ? 807 DC  P "O3'" 1 
ATOM   7927 C  "C2'" . DC  C 3 6   ? 70.132 126.030 5.128  1.00 75.22  ? 807 DC  P "C2'" 1 
ATOM   7928 C  "C1'" . DC  C 3 6   ? 71.497 126.310 5.733  1.00 72.50  ? 807 DC  P "C1'" 1 
ATOM   7929 N  N1    . DC  C 3 6   ? 71.472 126.917 7.074  1.00 68.39  ? 807 DC  P N1    1 
ATOM   7930 C  C2    . DC  C 3 6   ? 71.109 126.127 8.165  1.00 67.30  ? 807 DC  P C2    1 
ATOM   7931 O  O2    . DC  C 3 6   ? 70.758 124.943 7.963  1.00 66.37  ? 807 DC  P O2    1 
ATOM   7932 N  N3    . DC  C 3 6   ? 71.150 126.664 9.404  1.00 65.70  ? 807 DC  P N3    1 
ATOM   7933 C  C4    . DC  C 3 6   ? 71.522 127.933 9.570  1.00 65.64  ? 807 DC  P C4    1 
ATOM   7934 N  N4    . DC  C 3 6   ? 71.568 128.416 10.818 1.00 65.78  ? 807 DC  P N4    1 
ATOM   7935 C  C5    . DC  C 3 6   ? 71.867 128.764 8.472  1.00 64.19  ? 807 DC  P C5    1 
ATOM   7936 C  C6    . DC  C 3 6   ? 71.823 128.223 7.255  1.00 65.54  ? 807 DC  P C6    1 
ATOM   7937 P  P     . DC  C 3 7   ? 68.132 127.028 2.225  1.00 78.10  ? 808 DC  P P     1 
ATOM   7938 O  OP1   . DC  C 3 7   ? 68.305 126.781 0.769  1.00 76.62  ? 808 DC  P OP1   1 
ATOM   7939 O  OP2   . DC  C 3 7   ? 67.940 128.417 2.729  1.00 76.87  ? 808 DC  P OP2   1 
ATOM   7940 O  "O5'" . DC  C 3 7   ? 66.925 126.158 2.771  1.00 75.70  ? 808 DC  P "O5'" 1 
ATOM   7941 C  "C5'" . DC  C 3 7   ? 66.126 126.635 3.840  1.00 72.55  ? 808 DC  P "C5'" 1 
ATOM   7942 C  "C4'" . DC  C 3 7   ? 66.179 125.663 4.993  1.00 69.40  ? 808 DC  P "C4'" 1 
ATOM   7943 O  "O4'" . DC  C 3 7   ? 67.262 126.008 5.877  1.00 68.29  ? 808 DC  P "O4'" 1 
ATOM   7944 C  "C3'" . DC  C 3 7   ? 64.929 125.738 5.850  1.00 68.27  ? 808 DC  P "C3'" 1 
ATOM   7945 O  "O3'" . DC  C 3 7   ? 64.178 124.591 5.482  1.00 67.78  ? 808 DC  P "O3'" 1 
ATOM   7946 C  "C2'" . DC  C 3 7   ? 65.422 125.410 7.249  1.00 66.18  ? 808 DC  P "C2'" 1 
ATOM   7947 C  "C1'" . DC  C 3 7   ? 66.903 125.738 7.223  1.00 64.48  ? 808 DC  P "C1'" 1 
ATOM   7948 N  N1    . DC  C 3 7   ? 67.375 126.847 8.070  1.00 59.65  ? 808 DC  P N1    1 
ATOM   7949 C  C2    . DC  C 3 7   ? 67.378 126.670 9.443  1.00 58.34  ? 808 DC  P C2    1 
ATOM   7950 O  O2    . DC  C 3 7   ? 66.935 125.616 9.904  1.00 60.54  ? 808 DC  P O2    1 
ATOM   7951 N  N3    . DC  C 3 7   ? 67.869 127.644 10.236 1.00 56.28  ? 808 DC  P N3    1 
ATOM   7952 C  C4    . DC  C 3 7   ? 68.336 128.767 9.700  1.00 55.43  ? 808 DC  P C4    1 
ATOM   7953 N  N4    . DC  C 3 7   ? 68.824 129.690 10.526 1.00 56.08  ? 808 DC  P N4    1 
ATOM   7954 C  C5    . DC  C 3 7   ? 68.325 128.989 8.298  1.00 54.62  ? 808 DC  P C5    1 
ATOM   7955 C  C6    . DC  C 3 7   ? 67.834 128.013 7.526  1.00 57.89  ? 808 DC  P C6    1 
ATOM   7956 P  P     . DC  C 3 8   ? 62.596 124.685 5.411  1.00 66.41  ? 809 DC  P P     1 
ATOM   7957 O  OP1   . DC  C 3 8   ? 62.134 123.330 5.039  1.00 66.50  ? 809 DC  P OP1   1 
ATOM   7958 O  OP2   . DC  C 3 8   ? 62.211 125.848 4.575  1.00 67.21  ? 809 DC  P OP2   1 
ATOM   7959 O  "O5'" . DC  C 3 8   ? 62.225 124.968 6.931  1.00 66.39  ? 809 DC  P "O5'" 1 
ATOM   7960 C  "C5'" . DC  C 3 8   ? 62.354 123.922 7.872  1.00 64.14  ? 809 DC  P "C5'" 1 
ATOM   7961 C  "C4'" . DC  C 3 8   ? 62.184 124.421 9.287  1.00 65.30  ? 809 DC  P "C4'" 1 
ATOM   7962 O  "O4'" . DC  C 3 8   ? 63.333 125.210 9.667  1.00 65.16  ? 809 DC  P "O4'" 1 
ATOM   7963 C  "C3'" . DC  C 3 8   ? 60.971 125.337 9.499  1.00 63.90  ? 809 DC  P "C3'" 1 
ATOM   7964 O  "O3'" . DC  C 3 8   ? 59.970 124.541 10.147 1.00 64.60  ? 809 DC  P "O3'" 1 
ATOM   7965 C  "C2'" . DC  C 3 8   ? 61.415 126.248 10.629 1.00 64.29  ? 809 DC  P "C2'" 1 
ATOM   7966 C  "C1'" . DC  C 3 8   ? 62.928 126.157 10.634 1.00 63.60  ? 809 DC  P "C1'" 1 
ATOM   7967 N  N1    . DC  C 3 8   ? 63.731 127.376 10.524 1.00 60.62  ? 809 DC  P N1    1 
ATOM   7968 C  C2    . DC  C 3 8   ? 64.275 127.881 11.699 1.00 59.01  ? 809 DC  P C2    1 
ATOM   7969 O  O2    . DC  C 3 8   ? 64.063 127.265 12.756 1.00 58.40  ? 809 DC  P O2    1 
ATOM   7970 N  N3    . DC  C 3 8   ? 65.005 129.010 11.662 1.00 56.74  ? 809 DC  P N3    1 
ATOM   7971 C  C4    . DC  C 3 8   ? 65.203 129.632 10.502 1.00 58.02  ? 809 DC  P C4    1 
ATOM   7972 N  N4    . DC  C 3 8   ? 65.933 130.752 10.512 1.00 58.42  ? 809 DC  P N4    1 
ATOM   7973 C  C5    . DC  C 3 8   ? 64.663 129.135 9.279  1.00 58.76  ? 809 DC  P C5    1 
ATOM   7974 C  C6    . DC  C 3 8   ? 63.940 128.010 9.335  1.00 59.63  ? 809 DC  P C6    1 
ATOM   7975 P  P     . DT  C 3 9   ? 58.597 125.201 10.650 1.00 62.97  ? 810 DT  P P     1 
ATOM   7976 O  OP1   . DT  C 3 9   ? 57.749 124.058 11.023 1.00 65.86  ? 810 DT  P OP1   1 
ATOM   7977 O  OP2   . DT  C 3 9   ? 58.101 126.195 9.677  1.00 63.94  ? 810 DT  P OP2   1 
ATOM   7978 O  "O5'" . DT  C 3 9   ? 58.965 125.916 12.016 1.00 63.70  ? 810 DT  P "O5'" 1 
ATOM   7979 C  "C5'" . DT  C 3 9   ? 59.125 125.144 13.192 1.00 65.10  ? 810 DT  P "C5'" 1 
ATOM   7980 C  "C4'" . DT  C 3 9   ? 59.424 126.037 14.371 1.00 67.14  ? 810 DT  P "C4'" 1 
ATOM   7981 O  "O4'" . DT  C 3 9   ? 60.678 126.723 14.144 1.00 68.29  ? 810 DT  P "O4'" 1 
ATOM   7982 C  "C3'" . DT  C 3 9   ? 58.392 127.143 14.570 1.00 67.45  ? 810 DT  P "C3'" 1 
ATOM   7983 O  "O3'" . DT  C 3 9   ? 57.558 126.750 15.663 1.00 69.02  ? 810 DT  P "O3'" 1 
ATOM   7984 C  "C2'" . DT  C 3 9   ? 59.211 128.279 15.158 1.00 66.45  ? 810 DT  P "C2'" 1 
ATOM   7985 C  "C1'" . DT  C 3 9   ? 60.642 128.008 14.732 1.00 65.37  ? 810 DT  P "C1'" 1 
ATOM   7986 N  N1    . DT  C 3 9   ? 61.269 128.978 13.814 1.00 63.69  ? 810 DT  P N1    1 
ATOM   7987 C  C2    . DT  C 3 9   ? 62.187 129.833 14.371 1.00 62.97  ? 810 DT  P C2    1 
ATOM   7988 O  O2    . DT  C 3 9   ? 62.490 129.800 15.556 1.00 62.31  ? 810 DT  P O2    1 
ATOM   7989 N  N3    . DT  C 3 9   ? 62.743 130.729 13.495 1.00 62.63  ? 810 DT  P N3    1 
ATOM   7990 C  C4    . DT  C 3 9   ? 62.482 130.848 12.144 1.00 63.56  ? 810 DT  P C4    1 
ATOM   7991 O  O4    . DT  C 3 9   ? 63.068 131.704 11.475 1.00 64.96  ? 810 DT  P O4    1 
ATOM   7992 C  C5    . DT  C 3 9   ? 61.511 129.920 11.622 1.00 63.04  ? 810 DT  P C5    1 
ATOM   7993 C  C7    . DT  C 3 9   ? 61.167 129.986 10.167 1.00 60.81  ? 810 DT  P C7    1 
ATOM   7994 C  C6    . DT  C 3 9   ? 60.956 129.038 12.472 1.00 62.53  ? 810 DT  P C6    1 
ATOM   7995 P  P     . DG  C 3 10  ? 56.384 127.723 16.168 1.00 70.89  ? 811 DG  P P     1 
ATOM   7996 O  OP1   . DG  C 3 10  ? 55.557 126.936 17.118 1.00 68.84  ? 811 DG  P OP1   1 
ATOM   7997 O  OP2   . DG  C 3 10  ? 55.748 128.359 14.984 1.00 69.69  ? 811 DG  P OP2   1 
ATOM   7998 O  "O5'" . DG  C 3 10  ? 57.148 128.845 17.005 1.00 69.98  ? 811 DG  P "O5'" 1 
ATOM   7999 C  "C5'" . DG  C 3 10  ? 57.767 128.524 18.248 1.00 69.21  ? 811 DG  P "C5'" 1 
ATOM   8000 C  "C4'" . DG  C 3 10  ? 58.471 129.734 18.817 1.00 69.13  ? 811 DG  P "C4'" 1 
ATOM   8001 O  "O4'" . DG  C 3 10  ? 59.545 130.104 17.921 1.00 67.40  ? 811 DG  P "O4'" 1 
ATOM   8002 C  "C3'" . DG  C 3 10  ? 57.594 130.980 18.940 1.00 69.98  ? 811 DG  P "C3'" 1 
ATOM   8003 O  "O3'" . DG  C 3 10  ? 57.179 131.137 20.302 1.00 73.03  ? 811 DG  P "O3'" 1 
ATOM   8004 C  "C2'" . DG  C 3 10  ? 58.582 132.116 18.728 1.00 67.98  ? 811 DG  P "C2'" 1 
ATOM   8005 C  "C1'" . DG  C 3 10  ? 59.705 131.514 17.895 1.00 65.46  ? 811 DG  P "C1'" 1 
ATOM   8006 N  N9    . DG  C 3 10  ? 59.767 131.956 16.501 1.00 61.47  ? 811 DG  P N9    1 
ATOM   8007 C  C8    . DG  C 3 10  ? 59.078 131.468 15.414 1.00 60.68  ? 811 DG  P C8    1 
ATOM   8008 N  N7    . DG  C 3 10  ? 59.391 132.070 14.298 1.00 58.11  ? 811 DG  P N7    1 
ATOM   8009 C  C5    . DG  C 3 10  ? 60.332 133.014 14.674 1.00 59.35  ? 811 DG  P C5    1 
ATOM   8010 C  C6    . DG  C 3 10  ? 61.040 133.976 13.903 1.00 60.79  ? 811 DG  P C6    1 
ATOM   8011 O  O6    . DG  C 3 10  ? 60.988 134.185 12.687 1.00 62.78  ? 811 DG  P O6    1 
ATOM   8012 N  N1    . DG  C 3 10  ? 61.884 134.742 14.696 1.00 60.94  ? 811 DG  P N1    1 
ATOM   8013 C  C2    . DG  C 3 10  ? 62.032 134.601 16.055 1.00 61.02  ? 811 DG  P C2    1 
ATOM   8014 N  N2    . DG  C 3 10  ? 62.891 135.426 16.654 1.00 61.92  ? 811 DG  P N2    1 
ATOM   8015 N  N3    . DG  C 3 10  ? 61.387 133.711 16.777 1.00 60.06  ? 811 DG  P N3    1 
ATOM   8016 C  C4    . DG  C 3 10  ? 60.562 132.958 16.032 1.00 59.70  ? 811 DG  P C4    1 
ATOM   8017 P  P     . DT  C 3 11  ? 56.396 132.471 20.755 1.00 75.90  ? 812 DT  P P     1 
ATOM   8018 O  OP1   . DT  C 3 11  ? 55.846 132.217 22.110 1.00 76.41  ? 812 DT  P OP1   1 
ATOM   8019 O  OP2   . DT  C 3 11  ? 55.486 132.929 19.675 1.00 76.33  ? 812 DT  P OP2   1 
ATOM   8020 O  "O5'" . DT  C 3 11  ? 57.561 133.543 20.896 1.00 75.30  ? 812 DT  P "O5'" 1 
ATOM   8021 C  "C5'" . DT  C 3 11  ? 57.266 134.922 20.945 1.00 74.75  ? 812 DT  P "C5'" 1 
ATOM   8022 C  "C4'" . DT  C 3 11  ? 58.537 135.725 20.833 1.00 74.16  ? 812 DT  P "C4'" 1 
ATOM   8023 O  "O4'" . DT  C 3 11  ? 59.262 135.291 19.667 1.00 73.17  ? 812 DT  P "O4'" 1 
ATOM   8024 C  "C3'" . DT  C 3 11  ? 58.295 137.211 20.631 1.00 75.00  ? 812 DT  P "C3'" 1 
ATOM   8025 O  "O3'" . DT  C 3 11  ? 58.456 137.871 21.878 1.00 78.17  ? 812 DT  P "O3'" 1 
ATOM   8026 C  "C2'" . DT  C 3 11  ? 59.478 137.644 19.784 1.00 72.63  ? 812 DT  P "C2'" 1 
ATOM   8027 C  "C1'" . DT  C 3 11  ? 59.881 136.393 19.021 1.00 70.88  ? 812 DT  P "C1'" 1 
ATOM   8028 N  N1    . DT  C 3 11  ? 59.449 136.370 17.608 1.00 68.47  ? 812 DT  P N1    1 
ATOM   8029 C  C2    . DT  C 3 11  ? 60.039 137.235 16.714 1.00 68.95  ? 812 DT  P C2    1 
ATOM   8030 O  O2    . DT  C 3 11  ? 60.883 138.060 17.034 1.00 70.57  ? 812 DT  P O2    1 
ATOM   8031 N  N3    . DT  C 3 11  ? 59.605 137.098 15.417 1.00 68.06  ? 812 DT  P N3    1 
ATOM   8032 C  C4    . DT  C 3 11  ? 58.659 136.212 14.942 1.00 66.16  ? 812 DT  P C4    1 
ATOM   8033 O  O4    . DT  C 3 11  ? 58.381 136.197 13.744 1.00 66.36  ? 812 DT  P O4    1 
ATOM   8034 C  C5    . DT  C 3 11  ? 58.068 135.352 15.937 1.00 64.56  ? 812 DT  P C5    1 
ATOM   8035 C  C7    . DT  C 3 11  ? 57.028 134.366 15.516 1.00 64.31  ? 812 DT  P C7    1 
ATOM   8036 C  C6    . DT  C 3 11  ? 58.482 135.477 17.202 1.00 65.86  ? 812 DT  P C6    1 
ATOM   8037 P  P     . DT  C 3 12  ? 57.443 139.044 22.270 1.00 81.07  ? 813 DT  P P     1 
ATOM   8038 O  OP1   . DT  C 3 12  ? 57.451 139.200 23.748 1.00 81.40  ? 813 DT  P OP1   1 
ATOM   8039 O  OP2   . DT  C 3 12  ? 56.161 138.776 21.564 1.00 78.77  ? 813 DT  P OP2   1 
ATOM   8040 O  "O5'" . DT  C 3 12  ? 58.146 140.321 21.638 1.00 80.43  ? 813 DT  P "O5'" 1 
ATOM   8041 C  "C5'" . DT  C 3 12  ? 59.537 140.535 21.834 1.00 78.85  ? 813 DT  P "C5'" 1 
ATOM   8042 C  "C4'" . DT  C 3 12  ? 60.110 141.316 20.676 1.00 79.94  ? 813 DT  P "C4'" 1 
ATOM   8043 O  "O4'" . DT  C 3 12  ? 59.966 140.543 19.462 1.00 79.31  ? 813 DT  P "O4'" 1 
ATOM   8044 C  "C3'" . DT  C 3 12  ? 59.373 142.629 20.411 1.00 80.50  ? 813 DT  P "C3'" 1 
ATOM   8045 O  "O3'" . DT  C 3 12  ? 60.204 143.683 20.918 1.00 81.33  ? 813 DT  P "O3'" 1 
ATOM   8046 C  "C2'" . DT  C 3 12  ? 59.493 142.804 18.903 1.00 79.74  ? 813 DT  P "C2'" 1 
ATOM   8047 C  "C1'" . DT  C 3 12  ? 59.761 141.412 18.358 1.00 77.68  ? 813 DT  P "C1'" 1 
ATOM   8048 N  N1    . DT  C 3 12  ? 58.796 140.797 17.428 1.00 75.34  ? 813 DT  P N1    1 
ATOM   8049 C  C2    . DT  C 3 12  ? 59.026 140.976 16.082 1.00 73.28  ? 813 DT  P C2    1 
ATOM   8050 O  O2    . DT  C 3 12  ? 59.929 141.665 15.652 1.00 71.86  ? 813 DT  P O2    1 
ATOM   8051 N  N3    . DT  C 3 12  ? 58.158 140.313 15.257 1.00 72.77  ? 813 DT  P N3    1 
ATOM   8052 C  C4    . DT  C 3 12  ? 57.102 139.508 15.630 1.00 72.37  ? 813 DT  P C4    1 
ATOM   8053 O  O4    . DT  C 3 12  ? 56.418 138.958 14.770 1.00 71.65  ? 813 DT  P O4    1 
ATOM   8054 C  C5    . DT  C 3 12  ? 56.898 139.383 17.057 1.00 72.79  ? 813 DT  P C5    1 
ATOM   8055 C  C7    . DT  C 3 12  ? 55.774 138.530 17.554 1.00 72.97  ? 813 DT  P C7    1 
ATOM   8056 C  C6    . DT  C 3 12  ? 57.737 140.036 17.876 1.00 74.44  ? 813 DT  P C6    1 
ATOM   8057 P  P     . DC  C 3 13  ? 59.647 145.185 20.999 1.00 82.58  ? 814 DC  P P     1 
ATOM   8058 O  OP1   . DC  C 3 13  ? 60.675 145.981 21.717 1.00 82.56  ? 814 DC  P OP1   1 
ATOM   8059 O  OP2   . DC  C 3 13  ? 58.241 145.168 21.485 1.00 81.81  ? 814 DC  P OP2   1 
ATOM   8060 O  "O5'" . DC  C 3 13  ? 59.659 145.689 19.496 1.00 82.55  ? 814 DC  P "O5'" 1 
ATOM   8061 C  "C5'" . DC  C 3 13  ? 60.876 145.751 18.776 1.00 84.39  ? 814 DC  P "C5'" 1 
ATOM   8062 C  "C4'" . DC  C 3 13  ? 60.593 146.031 17.322 1.00 85.72  ? 814 DC  P "C4'" 1 
ATOM   8063 O  "O4'" . DC  C 3 13  ? 59.910 144.901 16.738 1.00 85.13  ? 814 DC  P "O4'" 1 
ATOM   8064 C  "C3'" . DC  C 3 13  ? 59.651 147.215 17.139 1.00 86.40  ? 814 DC  P "C3'" 1 
ATOM   8065 O  "O3'" . DC  C 3 13  ? 60.464 148.320 16.741 1.00 87.64  ? 814 DC  P "O3'" 1 
ATOM   8066 C  "C2'" . DC  C 3 13  ? 58.877 146.864 15.876 1.00 86.06  ? 814 DC  P "C2'" 1 
ATOM   8067 C  "C1'" . DC  C 3 13  ? 58.989 145.351 15.760 1.00 84.72  ? 814 DC  P "C1'" 1 
ATOM   8068 N  N1    . DC  C 3 13  ? 57.775 144.525 15.842 1.00 83.45  ? 814 DC  P N1    1 
ATOM   8069 C  C2    . DC  C 3 13  ? 57.152 144.179 14.652 1.00 83.29  ? 814 DC  P C2    1 
ATOM   8070 O  O2    . DC  C 3 13  ? 57.575 144.685 13.601 1.00 84.05  ? 814 DC  P O2    1 
ATOM   8071 N  N3    . DC  C 3 13  ? 56.111 143.315 14.671 1.00 81.70  ? 814 DC  P N3    1 
ATOM   8072 C  C4    . DC  C 3 13  ? 55.674 142.825 15.830 1.00 81.40  ? 814 DC  P C4    1 
ATOM   8073 N  N4    . DC  C 3 13  ? 54.662 141.959 15.794 1.00 80.63  ? 814 DC  P N4    1 
ATOM   8074 C  C5    . DC  C 3 13  ? 56.260 143.203 17.075 1.00 81.45  ? 814 DC  P C5    1 
ATOM   8075 C  C6    . DC  C 3 13  ? 57.296 144.056 17.035 1.00 82.71  ? 814 DC  P C6    1 
ATOM   8076 P  P     . DG  C 3 14  ? 59.842 149.791 16.688 1.00 88.04  ? 815 DG  P P     1 
ATOM   8077 O  OP1   . DG  C 3 14  ? 60.850 150.745 17.219 1.00 87.34  ? 815 DG  P OP1   1 
ATOM   8078 O  OP2   . DG  C 3 14  ? 58.477 149.741 17.281 1.00 87.23  ? 815 DG  P OP2   1 
ATOM   8079 O  "O5'" . DG  C 3 14  ? 59.720 150.061 15.131 1.00 86.68  ? 815 DG  P "O5'" 1 
ATOM   8080 C  "C5'" . DG  C 3 14  ? 58.620 150.781 14.609 1.00 84.37  ? 815 DG  P "C5'" 1 
ATOM   8081 C  "C4'" . DG  C 3 14  ? 58.213 150.186 13.287 1.00 82.36  ? 815 DG  P "C4'" 1 
ATOM   8082 O  "O4'" . DG  C 3 14  ? 57.833 148.810 13.479 1.00 81.03  ? 815 DG  P "O4'" 1 
ATOM   8083 C  "C3'" . DG  C 3 14  ? 57.001 150.865 12.676 1.00 81.32  ? 815 DG  P "C3'" 1 
ATOM   8084 O  "O3'" . DG  C 3 14  ? 57.526 151.659 11.624 1.00 81.76  ? 815 DG  P "O3'" 1 
ATOM   8085 C  "C2'" . DG  C 3 14  ? 56.300 149.742 11.930 1.00 80.06  ? 815 DG  P "C2'" 1 
ATOM   8086 C  "C1'" . DG  C 3 14  ? 56.788 148.472 12.595 1.00 78.12  ? 815 DG  P "C1'" 1 
ATOM   8087 N  N9    . DG  C 3 14  ? 55.830 147.654 13.320 1.00 75.54  ? 815 DG  P N9    1 
ATOM   8088 C  C8    . DG  C 3 14  ? 55.564 147.647 14.668 1.00 75.63  ? 815 DG  P C8    1 
ATOM   8089 N  N7    . DG  C 3 14  ? 54.737 146.697 15.018 1.00 74.27  ? 815 DG  P N7    1 
ATOM   8090 C  C5    . DG  C 3 14  ? 54.424 146.066 13.823 1.00 72.63  ? 815 DG  P C5    1 
ATOM   8091 C  C6    . DG  C 3 14  ? 53.584 144.959 13.557 1.00 71.49  ? 815 DG  P C6    1 
ATOM   8092 O  O6    . DG  C 3 14  ? 52.925 144.278 14.354 1.00 70.04  ? 815 DG  P O6    1 
ATOM   8093 N  N1    . DG  C 3 14  ? 53.552 144.663 12.200 1.00 72.07  ? 815 DG  P N1    1 
ATOM   8094 C  C2    . DG  C 3 14  ? 54.241 145.344 11.224 1.00 72.43  ? 815 DG  P C2    1 
ATOM   8095 N  N2    . DG  C 3 14  ? 54.089 144.920 9.962  1.00 71.61  ? 815 DG  P N2    1 
ATOM   8096 N  N3    . DG  C 3 14  ? 55.026 146.368 11.462 1.00 72.43  ? 815 DG  P N3    1 
ATOM   8097 C  C4    . DG  C 3 14  ? 55.071 146.669 12.769 1.00 73.42  ? 815 DG  P C4    1 
ATOM   8098 P  P     . DG  C 3 15  ? 56.617 152.779 10.956 1.00 82.33  ? 816 DG  P P     1 
ATOM   8099 O  OP1   . DG  C 3 15  ? 57.422 153.367 9.858  1.00 82.98  ? 816 DG  P OP1   1 
ATOM   8100 O  OP2   . DG  C 3 15  ? 56.064 153.648 12.027 1.00 83.27  ? 816 DG  P OP2   1 
ATOM   8101 O  "O5'" . DG  C 3 15  ? 55.423 151.951 10.326 1.00 79.42  ? 816 DG  P "O5'" 1 
ATOM   8102 C  "C5'" . DG  C 3 15  ? 55.533 151.410 9.027  1.00 74.42  ? 816 DG  P "C5'" 1 
ATOM   8103 C  "C4'" . DG  C 3 15  ? 54.197 150.849 8.623  1.00 70.92  ? 816 DG  P "C4'" 1 
ATOM   8104 O  "O4'" . DG  C 3 15  ? 53.973 149.647 9.392  1.00 70.62  ? 816 DG  P "O4'" 1 
ATOM   8105 C  "C3'" . DG  C 3 15  ? 53.080 151.790 9.050  1.00 68.90  ? 816 DG  P "C3'" 1 
ATOM   8106 O  "O3'" . DG  C 3 15  ? 52.580 152.486 7.924  1.00 69.30  ? 816 DG  P "O3'" 1 
ATOM   8107 C  "C2'" . DG  C 3 15  ? 51.931 150.849 9.343  1.00 68.77  ? 816 DG  P "C2'" 1 
ATOM   8108 C  "C1'" . DG  C 3 15  ? 52.590 149.525 9.664  1.00 67.25  ? 816 DG  P "C1'" 1 
ATOM   8109 N  N9    . DG  C 3 15  ? 52.394 149.028 11.024 1.00 63.51  ? 816 DG  P N9    1 
ATOM   8110 C  C8    . DG  C 3 15  ? 52.849 149.530 12.223 1.00 61.01  ? 816 DG  P C8    1 
ATOM   8111 N  N7    . DG  C 3 15  ? 52.434 148.837 13.251 1.00 58.74  ? 816 DG  P N7    1 
ATOM   8112 C  C5    . DG  C 3 15  ? 51.673 147.818 12.687 1.00 57.43  ? 816 DG  P C5    1 
ATOM   8113 C  C6    . DG  C 3 15  ? 50.955 146.748 13.285 1.00 55.55  ? 816 DG  P C6    1 
ATOM   8114 O  O6    . DG  C 3 15  ? 50.835 146.473 14.483 1.00 56.55  ? 816 DG  P O6    1 
ATOM   8115 N  N1    . DG  C 3 15  ? 50.329 145.958 12.329 1.00 53.41  ? 816 DG  P N1    1 
ATOM   8116 C  C2    . DG  C 3 15  ? 50.380 146.173 10.975 1.00 56.51  ? 816 DG  P C2    1 
ATOM   8117 N  N2    . DG  C 3 15  ? 49.717 145.330 10.187 1.00 55.69  ? 816 DG  P N2    1 
ATOM   8118 N  N3    . DG  C 3 15  ? 51.037 147.155 10.418 1.00 58.24  ? 816 DG  P N3    1 
ATOM   8119 C  C4    . DG  C 3 15  ? 51.653 147.928 11.320 1.00 59.61  ? 816 DG  P C4    1 
ATOM   8120 P  P     . DG  C 3 16  ? 51.246 153.359 8.080  1.00 70.39  ? 817 DG  P P     1 
ATOM   8121 O  OP1   . DG  C 3 16  ? 51.248 154.357 6.984  1.00 70.37  ? 817 DG  P OP1   1 
ATOM   8122 O  OP2   . DG  C 3 16  ? 51.138 153.815 9.489  1.00 70.49  ? 817 DG  P OP2   1 
ATOM   8123 O  "O5'" . DG  C 3 16  ? 50.073 152.317 7.818  1.00 67.41  ? 817 DG  P "O5'" 1 
ATOM   8124 C  "C5'" . DG  C 3 16  ? 49.715 151.951 6.498  1.00 62.23  ? 817 DG  P "C5'" 1 
ATOM   8125 C  "C4'" . DG  C 3 16  ? 48.448 151.132 6.510  1.00 60.63  ? 817 DG  P "C4'" 1 
ATOM   8126 O  "O4'" . DG  C 3 16  ? 48.725 149.872 7.164  1.00 59.03  ? 817 DG  P "O4'" 1 
ATOM   8127 C  "C3'" . DG  C 3 16  ? 47.304 151.750 7.301  1.00 58.96  ? 817 DG  P "C3'" 1 
ATOM   8128 O  "O3'" . DG  C 3 16  ? 46.364 152.366 6.436  1.00 58.23  ? 817 DG  P "O3'" 1 
ATOM   8129 C  "C2'" . DG  C 3 16  ? 46.553 150.531 7.806  1.00 59.02  ? 817 DG  P "C2'" 1 
ATOM   8130 C  "C1'" . DG  C 3 16  ? 47.604 149.443 7.921  1.00 57.68  ? 817 DG  P "C1'" 1 
ATOM   8131 N  N9    . DG  C 3 16  ? 48.027 149.276 9.309  1.00 56.79  ? 817 DG  P N9    1 
ATOM   8132 C  C8    . DG  C 3 16  ? 48.943 150.038 9.996  1.00 54.31  ? 817 DG  P C8    1 
ATOM   8133 N  N7    . DG  C 3 16  ? 49.047 149.703 11.252 1.00 52.97  ? 817 DG  P N7    1 
ATOM   8134 C  C5    . DG  C 3 16  ? 48.159 148.646 11.402 1.00 52.83  ? 817 DG  P C5    1 
ATOM   8135 C  C6    . DG  C 3 16  ? 47.826 147.900 12.538 1.00 52.93  ? 817 DG  P C6    1 
ATOM   8136 O  O6    . DG  C 3 16  ? 48.251 148.035 13.687 1.00 54.98  ? 817 DG  P O6    1 
ATOM   8137 N  N1    . DG  C 3 16  ? 46.884 146.916 12.250 1.00 52.76  ? 817 DG  P N1    1 
ATOM   8138 C  C2    . DG  C 3 16  ? 46.323 146.690 11.015 1.00 54.30  ? 817 DG  P C2    1 
ATOM   8139 N  N2    . DG  C 3 16  ? 45.428 145.684 10.922 1.00 54.39  ? 817 DG  P N2    1 
ATOM   8140 N  N3    . DG  C 3 16  ? 46.617 147.396 9.946  1.00 55.82  ? 817 DG  P N3    1 
ATOM   8141 C  C4    . DG  C 3 16  ? 47.538 148.355 10.210 1.00 55.43  ? 817 DG  P C4    1 
ATOM   8142 P  P     . DC  C 3 17  ? 45.201 153.264 7.070  1.00 58.74  ? 818 DC  P P     1 
ATOM   8143 O  OP1   . DC  C 3 17  ? 44.384 153.872 5.981  1.00 57.75  ? 818 DC  P OP1   1 
ATOM   8144 O  OP2   . DC  C 3 17  ? 45.863 154.134 8.075  1.00 58.49  ? 818 DC  P OP2   1 
ATOM   8145 O  "O5'" . DC  C 3 17  ? 44.285 152.204 7.825  1.00 55.90  ? 818 DC  P "O5'" 1 
ATOM   8146 C  "C5'" . DC  C 3 17  ? 43.489 151.284 7.092  1.00 51.00  ? 818 DC  P "C5'" 1 
ATOM   8147 C  "C4'" . DC  C 3 17  ? 42.606 150.494 8.026  1.00 48.33  ? 818 DC  P "C4'" 1 
ATOM   8148 O  "O4'" . DC  C 3 17  ? 43.425 149.560 8.749  1.00 49.44  ? 818 DC  P "O4'" 1 
ATOM   8149 C  "C3'" . DC  C 3 17  ? 41.922 151.325 9.101  1.00 45.77  ? 818 DC  P "C3'" 1 
ATOM   8150 O  "O3'" . DC  C 3 17  ? 40.574 151.567 8.755  1.00 45.08  ? 818 DC  P "O3'" 1 
ATOM   8151 C  "C2'" . DC  C 3 17  ? 41.789 150.352 10.251 1.00 45.77  ? 818 DC  P "C2'" 1 
ATOM   8152 C  "C1'" . DC  C 3 17  ? 42.936 149.390 10.071 1.00 47.83  ? 818 DC  P "C1'" 1 
ATOM   8153 N  N1    . DC  C 3 17  ? 44.007 149.737 11.001 1.00 48.00  ? 818 DC  P N1    1 
ATOM   8154 C  C2    . DC  C 3 17  ? 44.038 149.097 12.216 1.00 47.13  ? 818 DC  P C2    1 
ATOM   8155 O  O2    . DC  C 3 17  ? 43.212 148.194 12.420 1.00 46.11  ? 818 DC  P O2    1 
ATOM   8156 N  N3    . DC  C 3 17  ? 44.956 149.477 13.140 1.00 46.14  ? 818 DC  P N3    1 
ATOM   8157 C  C4    . DC  C 3 17  ? 45.820 150.454 12.861 1.00 44.95  ? 818 DC  P C4    1 
ATOM   8158 N  N4    . DC  C 3 17  ? 46.683 150.819 13.806 1.00 44.57  ? 818 DC  P N4    1 
ATOM   8159 C  C5    . DC  C 3 17  ? 45.833 151.101 11.601 1.00 44.87  ? 818 DC  P C5    1 
ATOM   8160 C  C6    . DC  C 3 17  ? 44.923 150.707 10.703 1.00 46.55  ? 818 DC  P C6    1 
ATOM   8161 P  P     . DG  C 3 18  ? 39.744 152.638 9.591  1.00 43.31  ? 819 DG  P P     1 
ATOM   8162 O  OP1   . DG  C 3 18  ? 38.485 152.918 8.873  1.00 45.47  ? 819 DG  P OP1   1 
ATOM   8163 O  OP2   . DG  C 3 18  ? 40.667 153.752 9.928  1.00 41.56  ? 819 DG  P OP2   1 
ATOM   8164 O  "O5'" . DG  C 3 18  ? 39.362 151.838 10.899 1.00 42.23  ? 819 DG  P "O5'" 1 
ATOM   8165 C  "C5'" . DG  C 3 18  ? 38.589 150.655 10.804 1.00 44.72  ? 819 DG  P "C5'" 1 
ATOM   8166 C  "C4'" . DG  C 3 18  ? 38.230 150.181 12.187 1.00 44.36  ? 819 DG  P "C4'" 1 
ATOM   8167 O  "O4'" . DG  C 3 18  ? 39.398 149.586 12.789 1.00 45.03  ? 819 DG  P "O4'" 1 
ATOM   8168 C  "C3'" . DG  C 3 18  ? 37.845 151.333 13.096 1.00 42.60  ? 819 DG  P "C3'" 1 
ATOM   8169 O  "O3'" . DG  C 3 18  ? 36.431 151.438 13.165 1.00 38.91  ? 819 DG  P "O3'" 1 
ATOM   8170 C  "C2'" . DG  C 3 18  ? 38.300 150.845 14.460 1.00 44.46  ? 819 DG  P "C2'" 1 
ATOM   8171 C  "C1'" . DG  C 3 18  ? 39.460 149.901 14.169 1.00 45.59  ? 819 DG  P "C1'" 1 
ATOM   8172 N  N9    . DG  C 3 18  ? 40.746 150.541 14.403 1.00 47.99  ? 819 DG  P N9    1 
ATOM   8173 C  C8    . DG  C 3 18  ? 41.477 151.270 13.498 1.00 47.91  ? 819 DG  P C8    1 
ATOM   8174 N  N7    . DG  C 3 18  ? 42.567 151.771 14.007 1.00 49.11  ? 819 DG  P N7    1 
ATOM   8175 C  C5    . DG  C 3 18  ? 42.563 151.333 15.325 1.00 50.41  ? 819 DG  P C5    1 
ATOM   8176 C  C6    . DG  C 3 18  ? 43.493 151.564 16.379 1.00 50.67  ? 819 DG  P C6    1 
ATOM   8177 O  O6    . DG  C 3 18  ? 44.536 152.228 16.362 1.00 49.92  ? 819 DG  P O6    1 
ATOM   8178 N  N1    . DG  C 3 18  ? 43.100 150.928 17.549 1.00 52.10  ? 819 DG  P N1    1 
ATOM   8179 C  C2    . DG  C 3 18  ? 41.965 150.168 17.692 1.00 52.60  ? 819 DG  P C2    1 
ATOM   8180 N  N2    . DG  C 3 18  ? 41.765 149.631 18.896 1.00 53.55  ? 819 DG  P N2    1 
ATOM   8181 N  N3    . DG  C 3 18  ? 41.092 149.949 16.723 1.00 52.02  ? 819 DG  P N3    1 
ATOM   8182 C  C4    . DG  C 3 18  ? 41.450 150.560 15.576 1.00 49.98  ? 819 DG  P C4    1 
ATOM   8183 P  P     . DC  C 3 19  ? 35.775 152.858 13.494 1.00 41.73  ? 820 DC  P P     1 
ATOM   8184 O  OP1   . DC  C 3 19  ? 34.297 152.738 13.396 1.00 42.19  ? 820 DC  P OP1   1 
ATOM   8185 O  OP2   . DC  C 3 19  ? 36.495 153.889 12.707 1.00 37.32  ? 820 DC  P OP2   1 
ATOM   8186 O  "O5'" . DC  C 3 19  ? 36.097 153.067 15.034 1.00 39.46  ? 820 DC  P "O5'" 1 
ATOM   8187 C  "C5'" . DC  C 3 19  ? 35.468 152.246 16.011 1.00 39.41  ? 820 DC  P "C5'" 1 
ATOM   8188 C  "C4'" . DC  C 3 19  ? 35.957 152.591 17.396 1.00 37.55  ? 820 DC  P "C4'" 1 
ATOM   8189 O  "O4'" . DC  C 3 19  ? 37.275 152.017 17.593 1.00 35.87  ? 820 DC  P "O4'" 1 
ATOM   8190 C  "C3'" . DC  C 3 19  ? 36.159 154.085 17.594 1.00 35.78  ? 820 DC  P "C3'" 1 
ATOM   8191 O  "O3'" . DC  C 3 19  ? 35.048 154.710 18.220 1.00 35.34  ? 820 DC  P "O3'" 1 
ATOM   8192 C  "C2'" . DC  C 3 19  ? 37.260 154.129 18.631 1.00 34.98  ? 820 DC  P "C2'" 1 
ATOM   8193 C  "C1'" . DC  C 3 19  ? 38.061 152.870 18.409 1.00 35.93  ? 820 DC  P "C1'" 1 
ATOM   8194 N  N1    . DC  C 3 19  ? 39.286 153.255 17.694 1.00 36.28  ? 820 DC  P N1    1 
ATOM   8195 C  C2    . DC  C 3 19  ? 40.446 153.430 18.440 1.00 35.33  ? 820 DC  P C2    1 
ATOM   8196 O  O2    . DC  C 3 19  ? 40.440 153.093 19.621 1.00 38.80  ? 820 DC  P O2    1 
ATOM   8197 N  N3    . DC  C 3 19  ? 41.537 153.965 17.860 1.00 33.85  ? 820 DC  P N3    1 
ATOM   8198 C  C4    . DC  C 3 19  ? 41.508 154.302 16.574 1.00 34.38  ? 820 DC  P C4    1 
ATOM   8199 N  N4    . DC  C 3 19  ? 42.594 154.867 16.061 1.00 33.98  ? 820 DC  P N4    1 
ATOM   8200 C  C5    . DC  C 3 19  ? 40.360 154.073 15.762 1.00 36.17  ? 820 DC  P C5    1 
ATOM   8201 C  C6    . DC  C 3 19  ? 39.280 153.534 16.357 1.00 36.34  ? 820 DC  P C6    1 
ATOM   8202 P  P     . DC  C 3 20  ? 35.010 156.294 18.307 1.00 37.65  ? 821 DC  P P     1 
ATOM   8203 O  OP1   . DC  C 3 20  ? 33.608 156.685 18.602 1.00 39.84  ? 821 DC  P OP1   1 
ATOM   8204 O  OP2   . DC  C 3 20  ? 35.684 156.872 17.109 1.00 38.31  ? 821 DC  P OP2   1 
ATOM   8205 O  "O5'" . DC  C 3 20  ? 35.930 156.594 19.568 1.00 38.63  ? 821 DC  P "O5'" 1 
ATOM   8206 C  "C5'" . DC  C 3 20  ? 35.856 155.778 20.735 1.00 41.60  ? 821 DC  P "C5'" 1 
ATOM   8207 C  "C4'" . DC  C 3 20  ? 36.870 156.234 21.756 1.00 44.89  ? 821 DC  P "C4'" 1 
ATOM   8208 O  "O4'" . DC  C 3 20  ? 38.198 155.829 21.374 1.00 46.31  ? 821 DC  P "O4'" 1 
ATOM   8209 C  "C3'" . DC  C 3 20  ? 36.934 157.750 21.876 1.00 45.47  ? 821 DC  P "C3'" 1 
ATOM   8210 O  "O3'" . DC  C 3 20  ? 36.268 158.086 23.084 1.00 49.19  ? 821 DC  P "O3'" 1 
ATOM   8211 C  "C2'" . DC  C 3 20  ? 38.377 158.022 22.252 1.00 44.65  ? 821 DC  P "C2'" 1 
ATOM   8212 C  "C1'" . DC  C 3 20  ? 39.144 156.812 21.768 1.00 44.08  ? 821 DC  P "C1'" 1 
ATOM   8213 N  N1    . DC  C 3 20  ? 40.038 157.073 20.642 1.00 42.19  ? 821 DC  P N1    1 
ATOM   8214 C  C2    . DC  C 3 20  ? 41.347 157.410 20.916 1.00 41.14  ? 821 DC  P C2    1 
ATOM   8215 O  O2    . DC  C 3 20  ? 41.700 157.499 22.085 1.00 43.05  ? 821 DC  P O2    1 
ATOM   8216 N  N3    . DC  C 3 20  ? 42.195 157.636 19.910 1.00 40.92  ? 821 DC  P N3    1 
ATOM   8217 C  C4    . DC  C 3 20  ? 41.776 157.544 18.662 1.00 39.79  ? 821 DC  P C4    1 
ATOM   8218 N  N4    . DC  C 3 20  ? 42.665 157.770 17.702 1.00 39.18  ? 821 DC  P N4    1 
ATOM   8219 C  C5    . DC  C 3 20  ? 40.429 157.213 18.344 1.00 40.08  ? 821 DC  P C5    1 
ATOM   8220 C  C6    . DC  C 3 20  ? 39.602 156.984 19.356 1.00 38.74  ? 821 DC  P C6    1 
HETATM 8221 C  C1    . URT C 3 21  ? 38.906 161.517 23.875 1.00 48.81  ? 822 URT P C1    1 
HETATM 8222 F  F1    . URT C 3 21  ? 40.765 164.287 22.542 1.00 51.50  ? 822 URT P F1    1 
HETATM 8223 N  N1    . URT C 3 21  ? 41.251 161.548 21.424 1.00 49.17  ? 822 URT P N1    1 
HETATM 8224 O  O1    . URT C 3 21  ? 40.104 160.885 23.388 1.00 50.52  ? 822 URT P O1    1 
HETATM 8225 P  P1    . URT C 3 21  ? 35.661 159.545 22.698 1.00 48.83  ? 822 URT P P1    1 
HETATM 8226 C  C2    . URT C 3 21  ? 39.106 162.940 23.560 1.00 49.69  ? 822 URT P C2    1 
HETATM 8227 N  N2    . URT C 3 21  ? 40.906 160.978 19.233 1.00 49.23  ? 822 URT P N2    1 
HETATM 8228 O  O2    . URT C 3 21  ? 37.851 161.052 23.150 1.00 50.38  ? 822 URT P O2    1 
HETATM 8229 C  C3    . URT C 3 21  ? 40.265 163.101 22.972 1.00 49.90  ? 822 URT P C3    1 
HETATM 8230 N  N3    . URT C 3 21  ? 43.671 161.932 21.419 1.00 48.72  ? 822 URT P N3    1 
HETATM 8231 C  C4    . URT C 3 21  ? 40.965 161.846 22.822 1.00 49.51  ? 822 URT P C4    1 
HETATM 8232 N  N4    . URT C 3 21  ? 44.603 161.573 19.203 1.00 46.77  ? 822 URT P N4    1 
HETATM 8233 C  C5    . URT C 3 21  ? 42.456 161.599 20.837 1.00 48.22  ? 822 URT P C5    1 
HETATM 8234 N  N5    . URT C 3 21  ? 43.344 160.950 17.364 1.00 45.83  ? 822 URT P N5    1 
HETATM 8235 C  C6    . URT C 3 21  ? 42.224 161.244 19.456 1.00 47.88  ? 822 URT P C6    1 
HETATM 8236 C  C7    . URT C 3 21  ? 40.370 161.169 20.418 1.00 50.32  ? 822 URT P C7    1 
HETATM 8237 C  C8    . URT C 3 21  ? 44.687 161.892 20.538 1.00 45.62  ? 822 URT P C8    1 
HETATM 8238 O  O4    . URT C 3 21  ? 35.953 159.864 21.297 1.00 50.83  ? 822 URT P O4    1 
HETATM 8239 C  C9    . URT C 3 21  ? 43.386 161.246 18.644 1.00 47.05  ? 822 URT P C9    1 
HETATM 8240 C  C10   . URT C 3 21  ? 36.745 160.556 23.885 1.00 51.80  ? 822 URT P C10   1 
HETATM 8241 O  O8    . URT C 3 21  ? 34.291 159.558 23.246 1.00 52.56  ? 822 URT P O8    1 
ATOM   8242 P  P     . DG  D 4 3   ? 40.922 163.337 1.468  1.00 166.90 ? 703 DG  T P     1 
ATOM   8243 O  OP1   . DG  D 4 3   ? 41.676 162.063 1.831  1.00 167.08 ? 703 DG  T OP1   1 
ATOM   8244 O  OP2   . DG  D 4 3   ? 39.935 163.761 2.548  1.00 166.74 ? 703 DG  T OP2   1 
ATOM   8245 O  "O5'" . DG  D 4 3   ? 42.050 164.516 1.407  1.00 165.13 ? 703 DG  T "O5'" 1 
ATOM   8246 C  "C5'" . DG  D 4 3   ? 43.237 164.379 0.593  1.00 161.48 ? 703 DG  T "C5'" 1 
ATOM   8247 C  "C4'" . DG  D 4 3   ? 44.359 165.221 1.157  1.00 158.03 ? 703 DG  T "C4'" 1 
ATOM   8248 O  "O4'" . DG  D 4 3   ? 43.929 166.604 1.211  1.00 158.29 ? 703 DG  T "O4'" 1 
ATOM   8249 C  "C3'" . DG  D 4 3   ? 44.746 164.846 2.589  1.00 155.47 ? 703 DG  T "C3'" 1 
ATOM   8250 O  "O3'" . DG  D 4 3   ? 46.151 165.016 2.819  1.00 149.39 ? 703 DG  T "O3'" 1 
ATOM   8251 C  "C2'" . DG  D 4 3   ? 43.942 165.816 3.434  1.00 156.95 ? 703 DG  T "C2'" 1 
ATOM   8252 C  "C1'" . DG  D 4 3   ? 43.886 167.058 2.560  1.00 158.52 ? 703 DG  T "C1'" 1 
ATOM   8253 N  N9    . DG  D 4 3   ? 42.657 167.827 2.737  1.00 159.20 ? 703 DG  T N9    1 
ATOM   8254 C  C8    . DG  D 4 3   ? 41.426 167.343 3.112  1.00 159.46 ? 703 DG  T C8    1 
ATOM   8255 N  N7    . DG  D 4 3   ? 40.514 168.273 3.197  1.00 159.52 ? 703 DG  T N7    1 
ATOM   8256 C  C5    . DG  D 4 3   ? 41.181 169.440 2.855  1.00 159.56 ? 703 DG  T C5    1 
ATOM   8257 C  C6    . DG  D 4 3   ? 40.712 170.774 2.769  1.00 159.75 ? 703 DG  T C6    1 
ATOM   8258 O  O6    . DG  D 4 3   ? 39.573 171.206 2.985  1.00 159.82 ? 703 DG  T O6    1 
ATOM   8259 N  N1    . DG  D 4 3   ? 41.724 171.648 2.387  1.00 159.70 ? 703 DG  T N1    1 
ATOM   8260 C  C2    . DG  D 4 3   ? 43.021 171.284 2.124  1.00 159.49 ? 703 DG  T C2    1 
ATOM   8261 N  N2    . DG  D 4 3   ? 43.849 172.266 1.773  1.00 159.25 ? 703 DG  T N2    1 
ATOM   8262 N  N3    . DG  D 4 3   ? 43.472 170.045 2.199  1.00 159.49 ? 703 DG  T N3    1 
ATOM   8263 C  C4    . DG  D 4 3   ? 42.506 169.182 2.568  1.00 159.43 ? 703 DG  T C4    1 
ATOM   8264 P  P     . DG  D 4 4   ? 46.868 164.194 4.005  1.00 144.08 ? 704 DG  T P     1 
ATOM   8265 O  OP1   . DG  D 4 4   ? 46.822 162.752 3.643  1.00 144.33 ? 704 DG  T OP1   1 
ATOM   8266 O  OP2   . DG  D 4 4   ? 46.288 164.647 5.298  1.00 144.03 ? 704 DG  T OP2   1 
ATOM   8267 O  "O5'" . DG  D 4 4   ? 48.390 164.663 3.952  1.00 138.86 ? 704 DG  T "O5'" 1 
ATOM   8268 C  "C5'" . DG  D 4 4   ? 49.446 163.789 4.365  1.00 128.79 ? 704 DG  T "C5'" 1 
ATOM   8269 C  "C4'" . DG  D 4 4   ? 50.351 164.497 5.347  1.00 121.44 ? 704 DG  T "C4'" 1 
ATOM   8270 O  "O4'" . DG  D 4 4   ? 50.898 165.672 4.707  1.00 119.32 ? 704 DG  T "O4'" 1 
ATOM   8271 C  "C3'" . DG  D 4 4   ? 49.668 164.997 6.619  1.00 116.31 ? 704 DG  T "C3'" 1 
ATOM   8272 O  "O3'" . DG  D 4 4   ? 49.920 164.038 7.666  1.00 108.34 ? 704 DG  T "O3'" 1 
ATOM   8273 C  "C2'" . DG  D 4 4   ? 50.437 166.265 6.960  1.00 116.03 ? 704 DG  T "C2'" 1 
ATOM   8274 C  "C1'" . DG  D 4 4   ? 51.004 166.748 5.626  1.00 116.61 ? 704 DG  T "C1'" 1 
ATOM   8275 N  N9    . DG  D 4 4   ? 50.343 167.904 5.025  1.00 115.65 ? 704 DG  T N9    1 
ATOM   8276 C  C8    . DG  D 4 4   ? 50.959 168.995 4.462  1.00 115.76 ? 704 DG  T C8    1 
ATOM   8277 N  N7    . DG  D 4 4   ? 50.118 169.883 4.000  1.00 114.52 ? 704 DG  T N7    1 
ATOM   8278 C  C5    . DG  D 4 4   ? 48.869 169.346 4.272  1.00 113.62 ? 704 DG  T C5    1 
ATOM   8279 C  C6    . DG  D 4 4   ? 47.573 169.858 4.004  1.00 112.50 ? 704 DG  T C6    1 
ATOM   8280 O  O6    . DG  D 4 4   ? 47.260 170.928 3.465  1.00 111.33 ? 704 DG  T O6    1 
ATOM   8281 N  N1    . DG  D 4 4   ? 46.583 168.988 4.441  1.00 112.07 ? 704 DG  T N1    1 
ATOM   8282 C  C2    . DG  D 4 4   ? 46.806 167.784 5.062  1.00 112.90 ? 704 DG  T C2    1 
ATOM   8283 N  N2    . DG  D 4 4   ? 45.716 167.092 5.415  1.00 112.92 ? 704 DG  T N2    1 
ATOM   8284 N  N3    . DG  D 4 4   ? 48.008 167.296 5.321  1.00 113.51 ? 704 DG  T N3    1 
ATOM   8285 C  C4    . DG  D 4 4   ? 48.987 168.122 4.903  1.00 114.28 ? 704 DG  T C4    1 
ATOM   8286 P  P     . DT  D 4 5   ? 51.318 164.051 8.467  1.00 102.14 ? 705 DT  T P     1 
ATOM   8287 O  OP1   . DT  D 4 5   ? 52.373 164.590 7.573  1.00 102.13 ? 705 DT  T OP1   1 
ATOM   8288 O  OP2   . DT  D 4 5   ? 51.500 162.711 9.071  1.00 101.58 ? 705 DT  T OP2   1 
ATOM   8289 O  "O5'" . DT  D 4 5   ? 51.084 165.079 9.662  1.00 98.94  ? 705 DT  T "O5'" 1 
ATOM   8290 C  "C5'" . DT  D 4 5   ? 52.192 165.735 10.279 1.00 92.46  ? 705 DT  T "C5'" 1 
ATOM   8291 C  "C4'" . DT  D 4 5   ? 52.014 165.792 11.778 1.00 86.60  ? 705 DT  T "C4'" 1 
ATOM   8292 O  "O4'" . DT  D 4 5   ? 50.836 166.580 12.067 1.00 86.20  ? 705 DT  T "O4'" 1 
ATOM   8293 C  "C3'" . DT  D 4 5   ? 51.767 164.441 12.446 1.00 82.33  ? 705 DT  T "C3'" 1 
ATOM   8294 O  "O3'" . DT  D 4 5   ? 52.957 163.951 13.063 1.00 74.10  ? 705 DT  T "O3'" 1 
ATOM   8295 C  "C2'" . DT  D 4 5   ? 50.892 164.807 13.628 1.00 83.75  ? 705 DT  T "C2'" 1 
ATOM   8296 C  "C1'" . DT  D 4 5   ? 50.158 166.063 13.202 1.00 85.73  ? 705 DT  T "C1'" 1 
ATOM   8297 N  N1    . DT  D 4 5   ? 48.787 165.750 12.804 1.00 86.50  ? 705 DT  T N1    1 
ATOM   8298 C  C2    . DT  D 4 5   ? 47.783 165.900 13.734 1.00 87.65  ? 705 DT  T C2    1 
ATOM   8299 O  O2    . DT  D 4 5   ? 47.974 166.314 14.869 1.00 87.50  ? 705 DT  T O2    1 
ATOM   8300 N  N3    . DT  D 4 5   ? 46.536 165.545 13.284 1.00 88.55  ? 705 DT  T N3    1 
ATOM   8301 C  C4    . DT  D 4 5   ? 46.205 165.071 12.027 1.00 88.66  ? 705 DT  T C4    1 
ATOM   8302 O  O4    . DT  D 4 5   ? 45.037 164.793 11.766 1.00 89.95  ? 705 DT  T O4    1 
ATOM   8303 C  C5    . DT  D 4 5   ? 47.312 164.946 11.102 1.00 88.37  ? 705 DT  T C5    1 
ATOM   8304 C  C7    . DT  D 4 5   ? 47.054 164.437 9.717  1.00 89.05  ? 705 DT  T C7    1 
ATOM   8305 C  C6    . DT  D 4 5   ? 48.529 165.292 11.533 1.00 86.90  ? 705 DT  T C6    1 
ATOM   8306 P  P     . DT  D 4 6   ? 52.906 162.582 13.911 1.00 67.88  ? 706 DT  T P     1 
ATOM   8307 O  OP1   . DT  D 4 6   ? 54.312 162.237 14.242 1.00 67.64  ? 706 DT  T OP1   1 
ATOM   8308 O  OP2   . DT  D 4 6   ? 52.034 161.586 13.248 1.00 65.43  ? 706 DT  T OP2   1 
ATOM   8309 O  "O5'" . DT  D 4 6   ? 52.199 162.997 15.267 1.00 62.90  ? 706 DT  T "O5'" 1 
ATOM   8310 C  "C5'" . DT  D 4 6   ? 52.861 163.858 16.174 1.00 54.35  ? 706 DT  T "C5'" 1 
ATOM   8311 C  "C4'" . DT  D 4 6   ? 52.387 163.584 17.576 1.00 48.70  ? 706 DT  T "C4'" 1 
ATOM   8312 O  "O4'" . DT  D 4 6   ? 51.040 164.085 17.713 1.00 45.00  ? 706 DT  T "O4'" 1 
ATOM   8313 C  "C3'" . DT  D 4 6   ? 52.275 162.100 17.861 1.00 44.30  ? 706 DT  T "C3'" 1 
ATOM   8314 O  "O3'" . DT  D 4 6   ? 53.399 161.634 18.580 1.00 40.94  ? 706 DT  T "O3'" 1 
ATOM   8315 C  "C2'" . DT  D 4 6   ? 51.154 162.049 18.874 1.00 44.48  ? 706 DT  T "C2'" 1 
ATOM   8316 C  "C1'" . DT  D 4 6   ? 50.294 163.251 18.564 1.00 42.82  ? 706 DT  T "C1'" 1 
ATOM   8317 N  N1    . DT  D 4 6   ? 49.103 162.835 17.846 1.00 45.26  ? 706 DT  T N1    1 
ATOM   8318 C  C2    . DT  D 4 6   ? 47.920 162.720 18.552 1.00 46.75  ? 706 DT  T C2    1 
ATOM   8319 O  O2    . DT  D 4 6   ? 47.805 163.018 19.730 1.00 48.00  ? 706 DT  T O2    1 
ATOM   8320 N  N3    . DT  D 4 6   ? 46.873 162.231 17.823 1.00 46.21  ? 706 DT  T N3    1 
ATOM   8321 C  C4    . DT  D 4 6   ? 46.878 161.874 16.497 1.00 45.74  ? 706 DT  T C4    1 
ATOM   8322 O  O4    . DT  D 4 6   ? 45.857 161.437 15.994 1.00 47.06  ? 706 DT  T O4    1 
ATOM   8323 C  C5    . DT  D 4 6   ? 48.145 162.052 15.808 1.00 45.53  ? 706 DT  T C5    1 
ATOM   8324 C  C7    . DT  D 4 6   ? 48.246 161.692 14.363 1.00 43.32  ? 706 DT  T C7    1 
ATOM   8325 C  C6    . DT  D 4 6   ? 49.177 162.532 16.507 1.00 44.50  ? 706 DT  T C6    1 
ATOM   8326 P  P     . DG  D 4 7   ? 53.571 160.061 18.806 1.00 42.35  ? 707 DG  T P     1 
ATOM   8327 O  OP1   . DG  D 4 7   ? 54.952 159.839 19.317 1.00 43.80  ? 707 DG  T OP1   1 
ATOM   8328 O  OP2   . DG  D 4 7   ? 53.105 159.339 17.609 1.00 39.77  ? 707 DG  T OP2   1 
ATOM   8329 O  "O5'" . DG  D 4 7   ? 52.554 159.741 19.980 1.00 40.40  ? 707 DG  T "O5'" 1 
ATOM   8330 C  "C5'" . DG  D 4 7   ? 52.866 160.139 21.302 1.00 39.87  ? 707 DG  T "C5'" 1 
ATOM   8331 C  "C4'" . DG  D 4 7   ? 51.841 159.606 22.269 1.00 39.93  ? 707 DG  T "C4'" 1 
ATOM   8332 O  "O4'" . DG  D 4 7   ? 50.611 160.334 22.052 1.00 40.59  ? 707 DG  T "O4'" 1 
ATOM   8333 C  "C3'" . DG  D 4 7   ? 51.467 158.151 22.030 1.00 38.86  ? 707 DG  T "C3'" 1 
ATOM   8334 O  "O3'" . DG  D 4 7   ? 52.164 157.231 22.857 1.00 38.45  ? 707 DG  T "O3'" 1 
ATOM   8335 C  "C2'" . DG  D 4 7   ? 50.038 158.096 22.529 1.00 39.00  ? 707 DG  T "C2'" 1 
ATOM   8336 C  "C1'" . DG  D 4 7   ? 49.495 159.480 22.261 1.00 41.17  ? 707 DG  T "C1'" 1 
ATOM   8337 N  N9    . DG  D 4 7   ? 48.713 159.421 21.034 1.00 41.17  ? 707 DG  T N9    1 
ATOM   8338 C  C8    . DG  D 4 7   ? 49.171 159.491 19.750 1.00 41.31  ? 707 DG  T C8    1 
ATOM   8339 N  N7    . DG  D 4 7   ? 48.239 159.268 18.865 1.00 44.45  ? 707 DG  T N7    1 
ATOM   8340 C  C5    . DG  D 4 7   ? 47.094 159.065 19.617 1.00 44.70  ? 707 DG  T C5    1 
ATOM   8341 C  C6    . DG  D 4 7   ? 45.773 158.769 19.216 1.00 44.25  ? 707 DG  T C6    1 
ATOM   8342 O  O6    . DG  D 4 7   ? 45.335 158.626 18.087 1.00 44.23  ? 707 DG  T O6    1 
ATOM   8343 N  N1    . DG  D 4 7   ? 44.923 158.643 20.303 1.00 44.56  ? 707 DG  T N1    1 
ATOM   8344 C  C2    . DG  D 4 7   ? 45.292 158.786 21.610 1.00 45.27  ? 707 DG  T C2    1 
ATOM   8345 N  N2    . DG  D 4 7   ? 44.328 158.626 22.519 1.00 46.36  ? 707 DG  T N2    1 
ATOM   8346 N  N3    . DG  D 4 7   ? 46.520 159.066 22.000 1.00 46.23  ? 707 DG  T N3    1 
ATOM   8347 C  C4    . DG  D 4 7   ? 47.365 159.187 20.956 1.00 44.42  ? 707 DG  T C4    1 
ATOM   8348 P  P     . DG  D 4 8   ? 52.059 155.660 22.520 1.00 39.36  ? 708 DG  T P     1 
ATOM   8349 O  OP1   . DG  D 4 8   ? 53.074 154.974 23.350 1.00 41.36  ? 708 DG  T OP1   1 
ATOM   8350 O  OP2   . DG  D 4 8   ? 52.057 155.458 21.061 1.00 35.26  ? 708 DG  T OP2   1 
ATOM   8351 O  "O5'" . DG  D 4 8   ? 50.616 155.262 23.056 1.00 38.24  ? 708 DG  T "O5'" 1 
ATOM   8352 C  "C5'" . DG  D 4 8   ? 50.267 155.524 24.403 1.00 35.31  ? 708 DG  T "C5'" 1 
ATOM   8353 C  "C4'" . DG  D 4 8   ? 48.920 154.930 24.723 1.00 36.45  ? 708 DG  T "C4'" 1 
ATOM   8354 O  "O4'" . DG  D 4 8   ? 47.892 155.747 24.127 1.00 36.81  ? 708 DG  T "O4'" 1 
ATOM   8355 C  "C3'" . DG  D 4 8   ? 48.703 153.541 24.144 1.00 35.86  ? 708 DG  T "C3'" 1 
ATOM   8356 O  "O3'" . DG  D 4 8   ? 48.921 152.553 25.113 1.00 36.97  ? 708 DG  T "O3'" 1 
ATOM   8357 C  "C2'" . DG  D 4 8   ? 47.202 153.495 23.947 1.00 37.95  ? 708 DG  T "C2'" 1 
ATOM   8358 C  "C1'" . DG  D 4 8   ? 46.811 154.933 23.690 1.00 38.52  ? 708 DG  T "C1'" 1 
ATOM   8359 N  N9    . DG  D 4 8   ? 46.667 155.116 22.257 1.00 41.74  ? 708 DG  T N9    1 
ATOM   8360 C  C8    . DG  D 4 8   ? 47.658 155.422 21.364 1.00 42.98  ? 708 DG  T C8    1 
ATOM   8361 N  N7    . DG  D 4 8   ? 47.243 155.444 20.127 1.00 46.95  ? 708 DG  T N7    1 
ATOM   8362 C  C5    . DG  D 4 8   ? 45.888 155.152 20.217 1.00 47.86  ? 708 DG  T C5    1 
ATOM   8363 C  C6    . DG  D 4 8   ? 44.896 155.042 19.200 1.00 49.65  ? 708 DG  T C6    1 
ATOM   8364 O  O6    . DG  D 4 8   ? 45.019 155.191 17.963 1.00 49.88  ? 708 DG  T O6    1 
ATOM   8365 N  N1    . DG  D 4 8   ? 43.652 154.735 19.744 1.00 50.17  ? 708 DG  T N1    1 
ATOM   8366 C  C2    . DG  D 4 8   ? 43.391 154.563 21.082 1.00 47.89  ? 708 DG  T C2    1 
ATOM   8367 N  N2    . DG  D 4 8   ? 42.123 154.281 21.410 1.00 47.00  ? 708 DG  T N2    1 
ATOM   8368 N  N3    . DG  D 4 8   ? 44.304 154.664 22.029 1.00 46.78  ? 708 DG  T N3    1 
ATOM   8369 C  C4    . DG  D 4 8   ? 45.518 154.959 21.530 1.00 45.50  ? 708 DG  T C4    1 
ATOM   8370 P  P     . DC  D 4 9   ? 49.625 151.190 24.693 1.00 39.30  ? 709 DC  T P     1 
ATOM   8371 O  OP1   . DC  D 4 9   ? 50.430 150.743 25.870 1.00 42.27  ? 709 DC  T OP1   1 
ATOM   8372 O  OP2   . DC  D 4 9   ? 50.274 151.396 23.388 1.00 41.96  ? 709 DC  T OP2   1 
ATOM   8373 O  "O5'" . DC  D 4 9   ? 48.419 150.178 24.504 1.00 38.63  ? 709 DC  T "O5'" 1 
ATOM   8374 C  "C5'" . DC  D 4 9   ? 47.570 149.862 25.599 1.00 35.06  ? 709 DC  T "C5'" 1 
ATOM   8375 C  "C4'" . DC  D 4 9   ? 46.231 149.370 25.101 1.00 32.75  ? 709 DC  T "C4'" 1 
ATOM   8376 O  "O4'" . DC  D 4 9   ? 45.620 150.447 24.357 1.00 28.16  ? 709 DC  T "O4'" 1 
ATOM   8377 C  "C3'" . DC  D 4 9   ? 46.320 148.228 24.100 1.00 33.57  ? 709 DC  T "C3'" 1 
ATOM   8378 O  "O3'" . DC  D 4 9   ? 46.113 146.954 24.672 1.00 37.66  ? 709 DC  T "O3'" 1 
ATOM   8379 C  "C2'" . DC  D 4 9   ? 45.091 148.437 23.245 1.00 31.91  ? 709 DC  T "C2'" 1 
ATOM   8380 C  "C1'" . DC  D 4 9   ? 44.888 149.926 23.266 1.00 31.05  ? 709 DC  T "C1'" 1 
ATOM   8381 N  N1    . DC  D 4 9   ? 45.419 150.518 22.044 1.00 31.30  ? 709 DC  T N1    1 
ATOM   8382 C  C2    . DC  D 4 9   ? 44.585 150.594 20.961 1.00 33.10  ? 709 DC  T C2    1 
ATOM   8383 O  O2    . DC  D 4 9   ? 43.440 150.158 21.073 1.00 34.08  ? 709 DC  T O2    1 
ATOM   8384 N  N3    . DC  D 4 9   ? 45.029 151.138 19.820 1.00 37.45  ? 709 DC  T N3    1 
ATOM   8385 C  C4    . DC  D 4 9   ? 46.278 151.586 19.743 1.00 38.47  ? 709 DC  T C4    1 
ATOM   8386 N  N4    . DC  D 4 9   ? 46.673 152.126 18.580 1.00 44.15  ? 709 DC  T N4    1 
ATOM   8387 C  C5    . DC  D 4 9   ? 47.170 151.508 20.844 1.00 33.88  ? 709 DC  T C5    1 
ATOM   8388 C  C6    . DC  D 4 9   ? 46.700 150.971 21.966 1.00 31.32  ? 709 DC  T C6    1 
ATOM   8389 P  P     . DG  D 4 10  ? 46.680 145.667 23.900 1.00 43.81  ? 710 DG  T P     1 
ATOM   8390 O  OP1   . DG  D 4 10  ? 46.739 144.590 24.903 1.00 43.88  ? 710 DG  T OP1   1 
ATOM   8391 O  OP2   . DG  D 4 10  ? 47.902 146.045 23.126 1.00 40.00  ? 710 DG  T OP2   1 
ATOM   8392 O  "O5'" . DG  D 4 10  ? 45.561 145.292 22.836 1.00 42.46  ? 710 DG  T "O5'" 1 
ATOM   8393 C  "C5'" . DG  D 4 10  ? 44.209 145.079 23.218 1.00 42.86  ? 710 DG  T "C5'" 1 
ATOM   8394 C  "C4'" . DG  D 4 10  ? 43.358 144.900 21.982 1.00 44.70  ? 710 DG  T "C4'" 1 
ATOM   8395 O  "O4'" . DG  D 4 10  ? 43.247 146.174 21.311 1.00 45.03  ? 710 DG  T "O4'" 1 
ATOM   8396 C  "C3'" . DG  D 4 10  ? 43.990 143.968 20.957 1.00 47.52  ? 710 DG  T "C3'" 1 
ATOM   8397 O  "O3'" . DG  D 4 10  ? 43.419 142.668 21.040 1.00 50.70  ? 710 DG  T "O3'" 1 
ATOM   8398 C  "C2'" . DG  D 4 10  ? 43.491 144.524 19.635 1.00 48.07  ? 710 DG  T "C2'" 1 
ATOM   8399 C  "C1'" . DG  D 4 10  ? 43.252 146.001 19.902 1.00 46.63  ? 710 DG  T "C1'" 1 
ATOM   8400 N  N9    . DG  D 4 10  ? 44.295 146.854 19.336 1.00 48.21  ? 710 DG  T N9    1 
ATOM   8401 C  C8    . DG  D 4 10  ? 45.460 147.288 19.928 1.00 48.76  ? 710 DG  T C8    1 
ATOM   8402 N  N7    . DG  D 4 10  ? 46.192 148.029 19.137 1.00 48.17  ? 710 DG  T N7    1 
ATOM   8403 C  C5    . DG  D 4 10  ? 45.462 148.087 17.958 1.00 49.71  ? 710 DG  T C5    1 
ATOM   8404 C  C6    . DG  D 4 10  ? 45.734 148.750 16.726 1.00 50.82  ? 710 DG  T C6    1 
ATOM   8405 O  O6    . DG  D 4 10  ? 46.707 149.440 16.413 1.00 50.85  ? 710 DG  T O6    1 
ATOM   8406 N  N1    . DG  D 4 10  ? 44.720 148.540 15.805 1.00 52.29  ? 710 DG  T N1    1 
ATOM   8407 C  C2    . DG  D 4 10  ? 43.591 147.792 16.028 1.00 53.71  ? 710 DG  T C2    1 
ATOM   8408 N  N2    . DG  D 4 10  ? 42.725 147.693 15.018 1.00 55.47  ? 710 DG  T N2    1 
ATOM   8409 N  N3    . DG  D 4 10  ? 43.326 147.179 17.161 1.00 53.12  ? 710 DG  T N3    1 
ATOM   8410 C  C4    . DG  D 4 10  ? 44.293 147.367 18.073 1.00 49.94  ? 710 DG  T C4    1 
ATOM   8411 P  P     . DC  D 4 11  ? 44.256 141.415 20.502 1.00 53.06  ? 711 DC  T P     1 
ATOM   8412 O  OP1   . DC  D 4 11  ? 43.654 140.225 21.146 1.00 51.74  ? 711 DC  T OP1   1 
ATOM   8413 O  OP2   . DC  D 4 11  ? 45.705 141.678 20.648 1.00 51.37  ? 711 DC  T OP2   1 
ATOM   8414 O  "O5'" . DC  D 4 11  ? 43.925 141.398 18.950 1.00 51.60  ? 711 DC  T "O5'" 1 
ATOM   8415 C  "C5'" . DC  D 4 11  ? 42.603 141.152 18.520 1.00 53.93  ? 711 DC  T "C5'" 1 
ATOM   8416 C  "C4'" . DC  D 4 11  ? 42.465 141.466 17.054 1.00 56.31  ? 711 DC  T "C4'" 1 
ATOM   8417 O  "O4'" . DC  D 4 11  ? 42.891 142.827 16.850 1.00 57.23  ? 711 DC  T "O4'" 1 
ATOM   8418 C  "C3'" . DC  D 4 11  ? 43.380 140.627 16.171 1.00 59.37  ? 711 DC  T "C3'" 1 
ATOM   8419 O  "O3'" . DC  D 4 11  ? 42.567 139.624 15.548 1.00 67.47  ? 711 DC  T "O3'" 1 
ATOM   8420 C  "C2'" . DC  D 4 11  ? 43.701 141.563 15.019 1.00 58.03  ? 711 DC  T "C2'" 1 
ATOM   8421 C  "C1'" . DC  D 4 11  ? 43.473 142.956 15.569 1.00 56.52  ? 711 DC  T "C1'" 1 
ATOM   8422 N  N1    . DC  D 4 11  ? 44.634 143.837 15.670 1.00 54.31  ? 711 DC  T N1    1 
ATOM   8423 C  C2    . DC  D 4 11  ? 44.938 144.643 14.579 1.00 53.64  ? 711 DC  T C2    1 
ATOM   8424 O  O2    . DC  D 4 11  ? 44.219 144.572 13.565 1.00 53.13  ? 711 DC  T O2    1 
ATOM   8425 N  N3    . DC  D 4 11  ? 45.996 145.480 14.654 1.00 52.15  ? 711 DC  T N3    1 
ATOM   8426 C  C4    . DC  D 4 11  ? 46.731 145.526 15.767 1.00 50.46  ? 711 DC  T C4    1 
ATOM   8427 N  N4    . DC  D 4 11  ? 47.752 146.370 15.803 1.00 47.67  ? 711 DC  T N4    1 
ATOM   8428 C  C5    . DC  D 4 11  ? 46.442 144.709 16.894 1.00 50.32  ? 711 DC  T C5    1 
ATOM   8429 C  C6    . DC  D 4 11  ? 45.396 143.884 16.802 1.00 52.98  ? 711 DC  T C6    1 
ATOM   8430 P  P     . DC  D 4 12  ? 43.256 138.391 14.769 1.00 72.88  ? 712 DC  T P     1 
ATOM   8431 O  OP1   . DC  D 4 12  ? 42.182 137.415 14.463 1.00 71.24  ? 712 DC  T OP1   1 
ATOM   8432 O  OP2   . DC  D 4 12  ? 44.500 137.942 15.470 1.00 69.40  ? 712 DC  T OP2   1 
ATOM   8433 O  "O5'" . DC  D 4 12  ? 43.699 139.021 13.383 1.00 72.84  ? 712 DC  T "O5'" 1 
ATOM   8434 C  "C5'" . DC  D 4 12  ? 44.941 138.664 12.814 1.00 72.55  ? 712 DC  T "C5'" 1 
ATOM   8435 C  "C4'" . DC  D 4 12  ? 45.262 139.573 11.655 1.00 72.14  ? 712 DC  T "C4'" 1 
ATOM   8436 O  "O4'" . DC  D 4 12  ? 45.337 140.932 12.122 1.00 71.08  ? 712 DC  T "O4'" 1 
ATOM   8437 C  "C3'" . DC  D 4 12  ? 46.615 139.285 11.033 1.00 73.58  ? 712 DC  T "C3'" 1 
ATOM   8438 O  "O3'" . DC  D 4 12  ? 46.400 138.507 9.868  1.00 75.92  ? 712 DC  T "O3'" 1 
ATOM   8439 C  "C2'" . DC  D 4 12  ? 47.065 140.644 10.533 1.00 71.50  ? 712 DC  T "C2'" 1 
ATOM   8440 C  "C1'" . DC  D 4 12  ? 46.373 141.629 11.454 1.00 71.04  ? 712 DC  T "C1'" 1 
ATOM   8441 N  N1    . DC  D 4 12  ? 47.276 142.172 12.477 1.00 70.55  ? 712 DC  T N1    1 
ATOM   8442 C  C2    . DC  D 4 12  ? 48.238 143.071 12.080 1.00 70.46  ? 712 DC  T C2    1 
ATOM   8443 O  O2    . DC  D 4 12  ? 48.291 143.375 10.883 1.00 71.52  ? 712 DC  T O2    1 
ATOM   8444 N  N3    . DC  D 4 12  ? 49.085 143.588 12.998 1.00 68.41  ? 712 DC  T N3    1 
ATOM   8445 C  C4    . DC  D 4 12  ? 48.988 143.226 14.268 1.00 68.24  ? 712 DC  T C4    1 
ATOM   8446 N  N4    . DC  D 4 12  ? 49.843 143.756 15.130 1.00 68.90  ? 712 DC  T N4    1 
ATOM   8447 C  C5    . DC  D 4 12  ? 48.009 142.301 14.708 1.00 69.56  ? 712 DC  T C5    1 
ATOM   8448 C  C6    . DC  D 4 12  ? 47.178 141.800 13.787 1.00 70.61  ? 712 DC  T C6    1 
ATOM   8449 P  P     . DC  D 4 13  ? 47.435 137.350 9.506  1.00 75.67  ? 713 DC  T P     1 
ATOM   8450 O  OP1   . DC  D 4 13  ? 46.715 136.427 8.583  1.00 74.75  ? 713 DC  T OP1   1 
ATOM   8451 O  OP2   . DC  D 4 13  ? 48.025 136.830 10.762 1.00 74.79  ? 713 DC  T OP2   1 
ATOM   8452 O  "O5'" . DC  D 4 13  ? 48.565 138.147 8.730  1.00 74.61  ? 713 DC  T "O5'" 1 
ATOM   8453 C  "C5'" . DC  D 4 13  ? 48.248 138.831 7.530  1.00 77.65  ? 713 DC  T "C5'" 1 
ATOM   8454 C  "C4'" . DC  D 4 13  ? 49.409 139.697 7.116  1.00 80.36  ? 713 DC  T "C4'" 1 
ATOM   8455 O  "O4'" . DC  D 4 13  ? 49.500 140.809 8.031  1.00 81.16  ? 713 DC  T "O4'" 1 
ATOM   8456 C  "C3'" . DC  D 4 13  ? 50.755 138.981 7.205  1.00 81.33  ? 713 DC  T "C3'" 1 
ATOM   8457 O  "O3'" . DC  D 4 13  ? 51.188 138.612 5.892  1.00 82.22  ? 713 DC  T "O3'" 1 
ATOM   8458 C  "C2'" . DC  D 4 13  ? 51.710 140.102 7.561  1.00 80.69  ? 713 DC  T "C2'" 1 
ATOM   8459 C  "C1'" . DC  D 4 13  ? 50.857 141.148 8.250  1.00 79.81  ? 713 DC  T "C1'" 1 
ATOM   8460 N  N1    . DC  D 4 13  ? 51.080 141.245 9.694  1.00 78.80  ? 713 DC  T N1    1 
ATOM   8461 C  C2    . DC  D 4 13  ? 51.824 142.313 10.156 1.00 77.40  ? 713 DC  T C2    1 
ATOM   8462 O  O2    . DC  D 4 13  ? 52.278 143.109 9.326  1.00 76.76  ? 713 DC  T O2    1 
ATOM   8463 N  N3    . DC  D 4 13  ? 52.035 142.455 11.482 1.00 76.67  ? 713 DC  T N3    1 
ATOM   8464 C  C4    . DC  D 4 13  ? 51.525 141.569 12.333 1.00 76.90  ? 713 DC  T C4    1 
ATOM   8465 N  N4    . DC  D 4 13  ? 51.747 141.762 13.631 1.00 75.93  ? 713 DC  T N4    1 
ATOM   8466 C  C5    . DC  D 4 13  ? 50.763 140.448 11.887 1.00 77.31  ? 713 DC  T C5    1 
ATOM   8467 C  C6    . DC  D 4 13  ? 50.566 140.325 10.567 1.00 77.70  ? 713 DC  T C6    1 
ATOM   8468 P  P     . DG  D 4 14  ? 52.227 137.406 5.711  1.00 82.75  ? 714 DG  T P     1 
ATOM   8469 O  OP1   . DG  D 4 14  ? 51.709 136.580 4.592  1.00 82.93  ? 714 DG  T OP1   1 
ATOM   8470 O  OP2   . DG  D 4 14  ? 52.494 136.775 7.033  1.00 82.46  ? 714 DG  T OP2   1 
ATOM   8471 O  "O5'" . DG  D 4 14  ? 53.562 138.124 5.237  1.00 81.03  ? 714 DG  T "O5'" 1 
ATOM   8472 C  "C5'" . DG  D 4 14  ? 53.508 139.324 4.486  1.00 80.50  ? 714 DG  T "C5'" 1 
ATOM   8473 C  "C4'" . DG  D 4 14  ? 54.461 140.328 5.080  1.00 80.28  ? 714 DG  T "C4'" 1 
ATOM   8474 O  "O4'" . DG  D 4 14  ? 54.043 140.594 6.431  1.00 80.01  ? 714 DG  T "O4'" 1 
ATOM   8475 C  "C3'" . DG  D 4 14  ? 55.876 139.777 5.208  1.00 81.54  ? 714 DG  T "C3'" 1 
ATOM   8476 O  "O3'" . DG  D 4 14  ? 56.658 140.417 4.205  1.00 85.23  ? 714 DG  T "O3'" 1 
ATOM   8477 C  "C2'" . DG  D 4 14  ? 56.411 140.436 6.467  1.00 80.32  ? 714 DG  T "C2'" 1 
ATOM   8478 C  "C1'" . DG  D 4 14  ? 55.174 140.848 7.242  1.00 78.48  ? 714 DG  T "C1'" 1 
ATOM   8479 N  N9    . DG  D 4 14  ? 54.931 140.348 8.595  1.00 75.72  ? 714 DG  T N9    1 
ATOM   8480 C  C8    . DG  D 4 14  ? 54.277 139.202 9.000  1.00 74.74  ? 714 DG  T C8    1 
ATOM   8481 N  N7    . DG  D 4 14  ? 54.149 139.119 10.299 1.00 72.96  ? 714 DG  T N7    1 
ATOM   8482 C  C5    . DG  D 4 14  ? 54.778 140.264 10.777 1.00 71.46  ? 714 DG  T C5    1 
ATOM   8483 C  C6    . DG  D 4 14  ? 54.960 140.736 12.105 1.00 70.65  ? 714 DG  T C6    1 
ATOM   8484 O  O6    . DG  D 4 14  ? 54.582 140.225 13.174 1.00 69.50  ? 714 DG  T O6    1 
ATOM   8485 N  N1    . DG  D 4 14  ? 55.661 141.941 12.121 1.00 69.97  ? 714 DG  T N1    1 
ATOM   8486 C  C2    . DG  D 4 14  ? 56.122 142.603 11.005 1.00 70.11  ? 714 DG  T C2    1 
ATOM   8487 N  N2    . DG  D 4 14  ? 56.783 143.751 11.207 1.00 68.99  ? 714 DG  T N2    1 
ATOM   8488 N  N3    . DG  D 4 14  ? 55.952 142.176 9.776  1.00 69.85  ? 714 DG  T N3    1 
ATOM   8489 C  C4    . DG  D 4 14  ? 55.279 141.013 9.734  1.00 72.23  ? 714 DG  T C4    1 
ATOM   8490 P  P     . DA  D 4 15  ? 58.134 139.883 3.897  1.00 89.54  ? 715 DA  T P     1 
ATOM   8491 O  OP1   . DA  D 4 15  ? 58.461 140.203 2.480  1.00 88.78  ? 715 DA  T OP1   1 
ATOM   8492 O  OP2   . DA  D 4 15  ? 58.205 138.477 4.383  1.00 88.92  ? 715 DA  T OP2   1 
ATOM   8493 O  "O5'" . DA  D 4 15  ? 59.069 140.770 4.819  1.00 88.53  ? 715 DA  T "O5'" 1 
ATOM   8494 C  "C5'" . DA  D 4 15  ? 59.292 142.139 4.527  1.00 89.17  ? 715 DA  T "C5'" 1 
ATOM   8495 C  "C4'" . DA  D 4 15  ? 60.057 142.755 5.667  1.00 89.62  ? 715 DA  T "C4'" 1 
ATOM   8496 O  "O4'" . DA  D 4 15  ? 59.268 142.587 6.857  1.00 88.91  ? 715 DA  T "O4'" 1 
ATOM   8497 C  "C3'" . DA  D 4 15  ? 61.372 142.047 5.950  1.00 90.32  ? 715 DA  T "C3'" 1 
ATOM   8498 O  "O3'" . DA  D 4 15  ? 62.399 142.896 5.453  1.00 94.06  ? 715 DA  T "O3'" 1 
ATOM   8499 C  "C2'" . DA  D 4 15  ? 61.515 142.165 7.456  1.00 88.83  ? 715 DA  T "C2'" 1 
ATOM   8500 C  "C1'" . DA  D 4 15  ? 60.093 142.319 7.972  1.00 86.73  ? 715 DA  T "C1'" 1 
ATOM   8501 N  N9    . DA  D 4 15  ? 59.511 141.175 8.664  1.00 83.20  ? 715 DA  T N9    1 
ATOM   8502 C  C8    . DA  D 4 15  ? 59.010 140.013 8.130  1.00 82.20  ? 715 DA  T C8    1 
ATOM   8503 N  N7    . DA  D 4 15  ? 58.462 139.216 9.016  1.00 81.46  ? 715 DA  T N7    1 
ATOM   8504 C  C5    . DA  D 4 15  ? 58.636 139.891 10.220 1.00 80.27  ? 715 DA  T C5    1 
ATOM   8505 C  C6    . DA  D 4 15  ? 58.275 139.582 11.545 1.00 78.99  ? 715 DA  T C6    1 
ATOM   8506 N  N6    . DA  D 4 15  ? 57.623 138.475 11.910 1.00 77.34  ? 715 DA  T N6    1 
ATOM   8507 N  N1    . DA  D 4 15  ? 58.610 140.473 12.502 1.00 78.57  ? 715 DA  T N1    1 
ATOM   8508 C  C2    . DA  D 4 15  ? 59.256 141.589 12.148 1.00 79.13  ? 715 DA  T C2    1 
ATOM   8509 N  N3    . DA  D 4 15  ? 59.643 141.992 10.944 1.00 79.39  ? 715 DA  T N3    1 
ATOM   8510 C  C4    . DA  D 4 15  ? 59.299 141.086 10.013 1.00 80.68  ? 715 DA  T C4    1 
ATOM   8511 P  P     . DA  D 4 16  ? 63.931 142.538 5.740  1.00 97.51  ? 716 DA  T P     1 
ATOM   8512 O  OP1   . DA  D 4 16  ? 64.721 143.045 4.585  1.00 97.93  ? 716 DA  T OP1   1 
ATOM   8513 O  OP2   . DA  D 4 16  ? 64.024 141.100 6.124  1.00 96.51  ? 716 DA  T OP2   1 
ATOM   8514 O  "O5'" . DA  D 4 16  ? 64.289 143.428 7.010  1.00 95.88  ? 716 DA  T "O5'" 1 
ATOM   8515 C  "C5'" . DA  D 4 16  ? 65.315 143.023 7.899  1.00 95.44  ? 716 DA  T "C5'" 1 
ATOM   8516 C  "C4'" . DA  D 4 16  ? 64.856 143.189 9.326  1.00 94.91  ? 716 DA  T "C4'" 1 
ATOM   8517 O  "O4'" . DA  D 4 16  ? 63.562 142.564 9.484  1.00 93.85  ? 716 DA  T "O4'" 1 
ATOM   8518 C  "C3'" . DA  D 4 16  ? 65.765 142.455 10.297 1.00 95.83  ? 716 DA  T "C3'" 1 
ATOM   8519 O  "O3'" . DA  D 4 16  ? 66.630 143.393 10.913 1.00 98.94  ? 716 DA  T "O3'" 1 
ATOM   8520 C  "C2'" . DA  D 4 16  ? 64.830 142.051 11.422 1.00 93.88  ? 716 DA  T "C2'" 1 
ATOM   8521 C  "C1'" . DA  D 4 16  ? 63.455 142.000 10.783 1.00 91.80  ? 716 DA  T "C1'" 1 
ATOM   8522 N  N9    . DA  D 4 16  ? 62.839 140.676 10.683 1.00 88.40  ? 716 DA  T N9    1 
ATOM   8523 C  C8    . DA  D 4 16  ? 62.637 139.866 9.589  1.00 86.50  ? 716 DA  T C8    1 
ATOM   8524 N  N7    . DA  D 4 16  ? 61.986 138.760 9.865  1.00 84.45  ? 716 DA  T N7    1 
ATOM   8525 C  C5    . DA  D 4 16  ? 61.757 138.841 11.234 1.00 83.74  ? 716 DA  T C5    1 
ATOM   8526 C  C6    . DA  D 4 16  ? 61.106 137.989 12.143 1.00 82.52  ? 716 DA  T C6    1 
ATOM   8527 N  N6    . DA  D 4 16  ? 60.529 136.840 11.799 1.00 82.31  ? 716 DA  T N6    1 
ATOM   8528 N  N1    . DA  D 4 16  ? 61.061 138.368 13.438 1.00 81.47  ? 716 DA  T N1    1 
ATOM   8529 C  C2    . DA  D 4 16  ? 61.629 139.521 13.788 1.00 82.42  ? 716 DA  T C2    1 
ATOM   8530 N  N3    . DA  D 4 16  ? 62.264 140.408 13.032 1.00 83.35  ? 716 DA  T N3    1 
ATOM   8531 C  C4    . DA  D 4 16  ? 62.292 140.004 11.749 1.00 85.09  ? 716 DA  T C4    1 
ATOM   8532 P  P     . DC  D 4 17  ? 68.118 142.945 11.276 1.00 102.05 ? 717 DC  T P     1 
ATOM   8533 O  OP1   . DC  D 4 17  ? 68.483 143.603 12.561 1.00 102.40 ? 717 DC  T OP1   1 
ATOM   8534 O  OP2   . DC  D 4 17  ? 68.951 143.168 10.063 1.00 102.60 ? 717 DC  T OP2   1 
ATOM   8535 O  "O5'" . DC  D 4 17  ? 67.962 141.375 11.515 1.00 100.86 ? 717 DC  T "O5'" 1 
ATOM   8536 C  "C5'" . DC  D 4 17  ? 68.686 140.696 12.541 1.00 97.74  ? 717 DC  T "C5'" 1 
ATOM   8537 C  "C4'" . DC  D 4 17  ? 67.825 140.553 13.776 1.00 95.66  ? 717 DC  T "C4'" 1 
ATOM   8538 O  "O4'" . DC  D 4 17  ? 66.458 140.302 13.383 1.00 94.29  ? 717 DC  T "O4'" 1 
ATOM   8539 C  "C3'" . DC  D 4 17  ? 68.215 139.387 14.676 1.00 95.46  ? 717 DC  T "C3'" 1 
ATOM   8540 O  "O3'" . DC  D 4 17  ? 68.956 139.883 15.784 1.00 96.00  ? 717 DC  T "O3'" 1 
ATOM   8541 C  "C2'" . DC  D 4 17  ? 66.890 138.963 15.291 1.00 93.30  ? 717 DC  T "C2'" 1 
ATOM   8542 C  "C1'" . DC  D 4 17  ? 65.835 139.402 14.288 1.00 92.03  ? 717 DC  T "C1'" 1 
ATOM   8543 N  N1    . DC  D 4 17  ? 65.226 138.312 13.501 1.00 89.10  ? 717 DC  T N1    1 
ATOM   8544 C  C2    . DC  D 4 17  ? 64.447 137.365 14.162 1.00 86.15  ? 717 DC  T C2    1 
ATOM   8545 O  O2    . DC  D 4 17  ? 64.314 137.456 15.388 1.00 84.27  ? 717 DC  T O2    1 
ATOM   8546 N  N3    . DC  D 4 17  ? 63.859 136.382 13.452 1.00 84.03  ? 717 DC  T N3    1 
ATOM   8547 C  C4    . DC  D 4 17  ? 64.026 136.319 12.134 1.00 84.77  ? 717 DC  T C4    1 
ATOM   8548 N  N4    . DC  D 4 17  ? 63.419 135.333 11.483 1.00 85.82  ? 717 DC  T N4    1 
ATOM   8549 C  C5    . DC  D 4 17  ? 64.823 137.264 11.429 1.00 85.04  ? 717 DC  T C5    1 
ATOM   8550 C  C6    . DC  D 4 17  ? 65.403 138.234 12.145 1.00 87.34  ? 717 DC  T C6    1 
ATOM   8551 P  P     . DA  D 4 18  ? 70.263 139.093 16.268 1.00 96.72  ? 718 DA  T P     1 
ATOM   8552 O  OP1   . DA  D 4 18  ? 71.046 140.020 17.126 1.00 96.65  ? 718 DA  T OP1   1 
ATOM   8553 O  OP2   . DA  D 4 18  ? 70.896 138.472 15.071 1.00 95.44  ? 718 DA  T OP2   1 
ATOM   8554 O  "O5'" . DA  D 4 18  ? 69.688 137.945 17.205 1.00 92.28  ? 718 DA  T "O5'" 1 
ATOM   8555 C  "C5'" . DA  D 4 18  ? 69.125 138.267 18.468 1.00 86.38  ? 718 DA  T "C5'" 1 
ATOM   8556 C  "C4'" . DA  D 4 18  ? 68.389 137.070 19.014 1.00 82.88  ? 718 DA  T "C4'" 1 
ATOM   8557 O  "O4'" . DA  D 4 18  ? 67.358 136.717 18.075 1.00 80.48  ? 718 DA  T "O4'" 1 
ATOM   8558 C  "C3'" . DA  D 4 18  ? 69.252 135.823 19.179 1.00 81.51  ? 718 DA  T "C3'" 1 
ATOM   8559 O  "O3'" . DA  D 4 18  ? 69.548 135.742 20.582 1.00 83.62  ? 718 DA  T "O3'" 1 
ATOM   8560 C  "C2'" . DA  D 4 18  ? 68.286 134.690 18.886 1.00 79.82  ? 718 DA  T "C2'" 1 
ATOM   8561 C  "C1'" . DA  D 4 18  ? 67.198 135.313 18.019 1.00 78.15  ? 718 DA  T "C1'" 1 
ATOM   8562 N  N9    . DA  D 4 18  ? 67.100 134.930 16.605 1.00 73.57  ? 718 DA  T N9    1 
ATOM   8563 C  C8    . DA  D 4 18  ? 67.836 135.379 15.536 1.00 71.58  ? 718 DA  T C8    1 
ATOM   8564 N  N7    . DA  D 4 18  ? 67.420 134.919 14.377 1.00 69.96  ? 718 DA  T N7    1 
ATOM   8565 C  C5    . DA  D 4 18  ? 66.354 134.091 14.710 1.00 69.96  ? 718 DA  T C5    1 
ATOM   8566 C  C6    . DA  D 4 18  ? 65.470 133.306 13.930 1.00 68.78  ? 718 DA  T C6    1 
ATOM   8567 N  N6    . DA  D 4 18  ? 65.513 133.224 12.597 1.00 68.04  ? 718 DA  T N6    1 
ATOM   8568 N  N1    . DA  D 4 18  ? 64.524 132.597 14.581 1.00 66.71  ? 718 DA  T N1    1 
ATOM   8569 C  C2    . DA  D 4 18  ? 64.469 132.673 15.913 1.00 67.90  ? 718 DA  T C2    1 
ATOM   8570 N  N3    . DA  D 4 18  ? 65.228 133.374 16.751 1.00 69.16  ? 718 DA  T N3    1 
ATOM   8571 C  C4    . DA  D 4 18  ? 66.163 134.070 16.079 1.00 70.97  ? 718 DA  T C4    1 
ATOM   8572 P  P     . DG  D 4 19  ? 69.637 134.317 21.328 1.00 85.48  ? 719 DG  T P     1 
ATOM   8573 O  OP1   . DG  D 4 19  ? 68.248 133.860 21.593 1.00 85.05  ? 719 DG  T OP1   1 
ATOM   8574 O  OP2   . DG  D 4 19  ? 70.592 134.433 22.458 1.00 86.12  ? 719 DG  T OP2   1 
ATOM   8575 O  "O5'" . DG  D 4 19  ? 70.321 133.338 20.282 1.00 83.92  ? 719 DG  T "O5'" 1 
ATOM   8576 C  "C5'" . DG  D 4 19  ? 70.531 131.966 20.610 1.00 80.70  ? 719 DG  T "C5'" 1 
ATOM   8577 C  "C4'" . DG  D 4 19  ? 69.217 131.218 20.571 1.00 78.36  ? 719 DG  T "C4'" 1 
ATOM   8578 O  "O4'" . DG  D 4 19  ? 68.353 131.795 19.573 1.00 77.17  ? 719 DG  T "O4'" 1 
ATOM   8579 C  "C3'" . DG  D 4 19  ? 69.326 129.737 20.244 1.00 77.86  ? 719 DG  T "C3'" 1 
ATOM   8580 O  "O3'" . DG  D 4 19  ? 69.141 129.021 21.463 1.00 77.78  ? 719 DG  T "O3'" 1 
ATOM   8581 C  "C2'" . DG  D 4 19  ? 68.045 129.455 19.475 1.00 76.57  ? 719 DG  T "C2'" 1 
ATOM   8582 C  "C1'" . DG  D 4 19  ? 67.630 130.796 18.885 1.00 74.78  ? 719 DG  T "C1'" 1 
ATOM   8583 N  N9    . DG  D 4 19  ? 67.906 130.985 17.466 1.00 71.69  ? 719 DG  T N9    1 
ATOM   8584 C  C8    . DG  D 4 19  ? 68.840 131.834 16.924 1.00 71.07  ? 719 DG  T C8    1 
ATOM   8585 N  N7    . DG  D 4 19  ? 68.828 131.850 15.621 1.00 68.58  ? 719 DG  T N7    1 
ATOM   8586 C  C5    . DG  D 4 19  ? 67.837 130.948 15.282 1.00 68.04  ? 719 DG  T C5    1 
ATOM   8587 C  C6    . DG  D 4 19  ? 67.374 130.556 14.024 1.00 67.00  ? 719 DG  T C6    1 
ATOM   8588 O  O6    . DG  D 4 19  ? 67.757 130.945 12.916 1.00 67.21  ? 719 DG  T O6    1 
ATOM   8589 N  N1    . DG  D 4 19  ? 66.359 129.612 14.126 1.00 66.49  ? 719 DG  T N1    1 
ATOM   8590 C  C2    . DG  D 4 19  ? 65.861 129.110 15.306 1.00 67.85  ? 719 DG  T C2    1 
ATOM   8591 N  N2    . DG  D 4 19  ? 64.892 128.196 15.205 1.00 68.76  ? 719 DG  T N2    1 
ATOM   8592 N  N3    . DG  D 4 19  ? 66.286 129.477 16.497 1.00 67.74  ? 719 DG  T N3    1 
ATOM   8593 C  C4    . DG  D 4 19  ? 67.267 130.393 16.411 1.00 69.50  ? 719 DG  T C4    1 
ATOM   8594 P  P     . DG  D 4 20  ? 70.094 127.782 21.803 1.00 78.17  ? 720 DG  T P     1 
ATOM   8595 O  OP1   . DG  D 4 20  ? 69.882 127.451 23.234 1.00 78.43  ? 720 DG  T OP1   1 
ATOM   8596 O  OP2   . DG  D 4 20  ? 71.465 128.084 21.311 1.00 79.47  ? 720 DG  T OP2   1 
ATOM   8597 O  "O5'" . DG  D 4 20  ? 69.522 126.607 20.899 1.00 78.18  ? 720 DG  T "O5'" 1 
ATOM   8598 C  "C5'" . DG  D 4 20  ? 68.301 125.947 21.225 1.00 77.35  ? 720 DG  T "C5'" 1 
ATOM   8599 C  "C4'" . DG  D 4 20  ? 67.861 125.098 20.058 1.00 76.08  ? 720 DG  T "C4'" 1 
ATOM   8600 O  "O4'" . DG  D 4 20  ? 67.600 125.972 18.945 1.00 74.03  ? 720 DG  T "O4'" 1 
ATOM   8601 C  "C3'" . DG  D 4 20  ? 68.952 124.149 19.572 1.00 78.18  ? 720 DG  T "C3'" 1 
ATOM   8602 O  "O3'" . DG  D 4 20  ? 68.597 122.833 19.988 1.00 83.22  ? 720 DG  T "O3'" 1 
ATOM   8603 C  "C2'" . DG  D 4 20  ? 68.711 124.069 18.077 1.00 75.88  ? 720 DG  T "C2'" 1 
ATOM   8604 C  "C1'" . DG  D 4 20  ? 67.962 125.341 17.737 1.00 72.39  ? 720 DG  T "C1'" 1 
ATOM   8605 N  N9    . DG  D 4 20  ? 68.634 126.317 16.891 1.00 69.08  ? 720 DG  T N9    1 
ATOM   8606 C  C8    . DG  D 4 20  ? 69.516 127.307 17.256 1.00 67.51  ? 720 DG  T C8    1 
ATOM   8607 N  N7    . DG  D 4 20  ? 69.872 128.067 16.253 1.00 66.72  ? 720 DG  T N7    1 
ATOM   8608 C  C5    . DG  D 4 20  ? 69.198 127.531 15.160 1.00 65.09  ? 720 DG  T C5    1 
ATOM   8609 C  C6    . DG  D 4 20  ? 69.171 127.932 13.790 1.00 63.05  ? 720 DG  T C6    1 
ATOM   8610 O  O6    . DG  D 4 20  ? 69.746 128.885 13.247 1.00 60.64  ? 720 DG  T O6    1 
ATOM   8611 N  N1    . DG  D 4 20  ? 68.357 127.095 13.031 1.00 61.97  ? 720 DG  T N1    1 
ATOM   8612 C  C2    . DG  D 4 20  ? 67.654 126.019 13.519 1.00 62.50  ? 720 DG  T C2    1 
ATOM   8613 N  N2    . DG  D 4 20  ? 66.929 125.323 12.634 1.00 61.13  ? 720 DG  T N2    1 
ATOM   8614 N  N3    . DG  D 4 20  ? 67.660 125.648 14.784 1.00 63.49  ? 720 DG  T N3    1 
ATOM   8615 C  C4    . DG  D 4 20  ? 68.447 126.440 15.541 1.00 66.76  ? 720 DG  T C4    1 
ATOM   8616 P  P     . DG  D 4 21  ? 69.676 121.655 19.885 1.00 85.36  ? 721 DG  T P     1 
ATOM   8617 O  OP1   . DG  D 4 21  ? 69.285 120.630 20.891 1.00 85.71  ? 721 DG  T OP1   1 
ATOM   8618 O  OP2   . DG  D 4 21  ? 71.024 122.280 19.948 1.00 85.54  ? 721 DG  T OP2   1 
ATOM   8619 O  "O5'" . DG  D 4 21  ? 69.475 121.076 18.418 1.00 82.94  ? 721 DG  T "O5'" 1 
ATOM   8620 C  "C5'" . DG  D 4 21  ? 68.299 120.358 18.073 1.00 83.09  ? 721 DG  T "C5'" 1 
ATOM   8621 C  "C4'" . DG  D 4 21  ? 68.219 120.188 16.573 1.00 82.77  ? 721 DG  T "C4'" 1 
ATOM   8622 O  "O4'" . DG  D 4 21  ? 68.285 121.494 15.966 1.00 81.38  ? 721 DG  T "O4'" 1 
ATOM   8623 C  "C3'" . DG  D 4 21  ? 69.373 119.396 15.959 1.00 82.77  ? 721 DG  T "C3'" 1 
ATOM   8624 O  "O3'" . DG  D 4 21  ? 68.833 118.118 15.609 1.00 86.69  ? 721 DG  T "O3'" 1 
ATOM   8625 C  "C2'" . DG  D 4 21  ? 69.559 120.042 14.596 1.00 80.53  ? 721 DG  T "C2'" 1 
ATOM   8626 C  "C1'" . DG  D 4 21  ? 68.955 121.424 14.725 1.00 77.75  ? 721 DG  T "C1'" 1 
ATOM   8627 N  N9    . DG  D 4 21  ? 69.812 122.597 14.589 1.00 73.20  ? 721 DG  T N9    1 
ATOM   8628 C  C8    . DG  D 4 21  ? 70.528 123.246 15.569 1.00 71.80  ? 721 DG  T C8    1 
ATOM   8629 N  N7    . DG  D 4 21  ? 71.114 124.333 15.137 1.00 69.50  ? 721 DG  T N7    1 
ATOM   8630 C  C5    . DG  D 4 21  ? 70.785 124.387 13.789 1.00 68.14  ? 721 DG  T C5    1 
ATOM   8631 C  C6    . DG  D 4 21  ? 71.124 125.335 12.800 1.00 66.30  ? 721 DG  T C6    1 
ATOM   8632 O  O6    . DG  D 4 21  ? 71.805 126.352 12.921 1.00 67.39  ? 721 DG  T O6    1 
ATOM   8633 N  N1    . DG  D 4 21  ? 70.581 125.003 11.560 1.00 63.90  ? 721 DG  T N1    1 
ATOM   8634 C  C2    . DG  D 4 21  ? 69.810 123.896 11.304 1.00 64.01  ? 721 DG  T C2    1 
ATOM   8635 N  N2    . DG  D 4 21  ? 69.381 123.737 10.040 1.00 60.83  ? 721 DG  T N2    1 
ATOM   8636 N  N3    . DG  D 4 21  ? 69.485 123.005 12.223 1.00 65.43  ? 721 DG  T N3    1 
ATOM   8637 C  C4    . DG  D 4 21  ? 70.001 123.312 13.433 1.00 69.26  ? 721 DG  T C4    1 
ATOM   8638 P  P     . DA  D 4 22  ? 69.722 117.049 14.797 1.00 90.24  ? 722 DA  T P     1 
ATOM   8639 O  OP1   . DA  D 4 22  ? 68.808 115.904 14.488 1.00 88.16  ? 722 DA  T OP1   1 
ATOM   8640 O  OP2   . DA  D 4 22  ? 70.987 116.813 15.553 1.00 89.98  ? 722 DA  T OP2   1 
ATOM   8641 O  "O5'" . DA  D 4 22  ? 70.099 117.765 13.423 1.00 88.63  ? 722 DA  T "O5'" 1 
ATOM   8642 C  "C5'" . DA  D 4 22  ? 69.373 117.488 12.233 1.00 88.16  ? 722 DA  T "C5'" 1 
ATOM   8643 C  "C4'" . DA  D 4 22  ? 70.152 117.953 11.025 1.00 88.42  ? 722 DA  T "C4'" 1 
ATOM   8644 O  "O4'" . DA  D 4 22  ? 70.405 119.369 11.157 1.00 86.73  ? 722 DA  T "O4'" 1 
ATOM   8645 C  "C3'" . DA  D 4 22  ? 71.534 117.312 10.903 1.00 90.72  ? 722 DA  T "C3'" 1 
ATOM   8646 O  "O3'" . DA  D 4 22  ? 71.456 116.285 9.903  1.00 95.54  ? 722 DA  T "O3'" 1 
ATOM   8647 C  "C2'" . DA  D 4 22  ? 72.370 118.400 10.247 1.00 87.71  ? 722 DA  T "C2'" 1 
ATOM   8648 C  "C1'" . DA  D 4 22  ? 71.654 119.698 10.573 1.00 84.84  ? 722 DA  T "C1'" 1 
ATOM   8649 N  N9    . DA  D 4 22  ? 72.343 120.670 11.425 1.00 81.16  ? 722 DA  T N9    1 
ATOM   8650 C  C8    . DA  D 4 22  ? 72.679 120.616 12.757 1.00 79.77  ? 722 DA  T C8    1 
ATOM   8651 N  N7    . DA  D 4 22  ? 73.281 121.701 13.193 1.00 77.89  ? 722 DA  T N7    1 
ATOM   8652 C  C5    . DA  D 4 22  ? 73.350 122.519 12.071 1.00 76.24  ? 722 DA  T C5    1 
ATOM   8653 C  C6    . DA  D 4 22  ? 73.873 123.812 11.862 1.00 75.06  ? 722 DA  T C6    1 
ATOM   8654 N  N6    . DA  D 4 22  ? 74.446 124.555 12.809 1.00 74.21  ? 722 DA  T N6    1 
ATOM   8655 N  N1    . DA  D 4 22  ? 73.782 124.328 10.620 1.00 74.97  ? 722 DA  T N1    1 
ATOM   8656 C  C2    . DA  D 4 22  ? 73.202 123.598 9.660  1.00 76.02  ? 722 DA  T C2    1 
ATOM   8657 N  N3    . DA  D 4 22  ? 72.672 122.383 9.731  1.00 76.34  ? 722 DA  T N3    1 
ATOM   8658 C  C4    . DA  D 4 22  ? 72.781 121.893 10.979 1.00 77.83  ? 722 DA  T C4    1 
ATOM   8659 P  P     . DC  D 4 23  ? 72.789 115.785 9.151  1.00 98.35  ? 723 DC  T P     1 
ATOM   8660 O  OP1   . DC  D 4 23  ? 72.543 114.378 8.751  1.00 98.28  ? 723 DC  T OP1   1 
ATOM   8661 O  OP2   . DC  D 4 23  ? 73.983 116.115 9.983  1.00 96.85  ? 723 DC  T OP2   1 
ATOM   8662 O  "O5'" . DC  D 4 23  ? 72.816 116.668 7.824  1.00 98.24  ? 723 DC  T "O5'" 1 
ATOM   8663 C  "C5'" . DC  D 4 23  ? 74.035 116.920 7.131  1.00 99.75  ? 723 DC  T "C5'" 1 
ATOM   8664 C  "C4'" . DC  D 4 23  ? 74.125 118.381 6.762  1.00 100.01 ? 723 DC  T "C4'" 1 
ATOM   8665 O  "O4'" . DC  D 4 23  ? 74.069 119.173 7.965  1.00 98.69  ? 723 DC  T "O4'" 1 
ATOM   8666 C  "C3'" . DC  D 4 23  ? 75.454 118.740 6.109  1.00 102.05 ? 723 DC  T "C3'" 1 
ATOM   8667 O  "O3'" . DC  D 4 23  ? 75.187 118.948 4.727  1.00 107.55 ? 723 DC  T "O3'" 1 
ATOM   8668 C  "C2'" . DC  D 4 23  ? 75.704 120.165 6.566  1.00 100.17 ? 723 DC  T "C2'" 1 
ATOM   8669 C  "C1'" . DC  D 4 23  ? 74.865 120.330 7.812  1.00 97.97  ? 723 DC  T "C1'" 1 
ATOM   8670 N  N1    . DC  D 4 23  ? 75.525 120.643 9.090  1.00 95.82  ? 723 DC  T N1    1 
ATOM   8671 C  C2    . DC  D 4 23  ? 76.262 121.829 9.185  1.00 93.78  ? 723 DC  T C2    1 
ATOM   8672 O  O2    . DC  D 4 23  ? 76.431 122.510 8.165  1.00 92.59  ? 723 DC  T O2    1 
ATOM   8673 N  N3    . DC  D 4 23  ? 76.768 122.200 10.379 1.00 92.60  ? 723 DC  T N3    1 
ATOM   8674 C  C4    . DC  D 4 23  ? 76.579 121.428 11.450 1.00 93.80  ? 723 DC  T C4    1 
ATOM   8675 N  N4    . DC  D 4 23  ? 77.076 121.846 12.614 1.00 94.59  ? 723 DC  T N4    1 
ATOM   8676 C  C5    . DC  D 4 23  ? 75.871 120.191 11.374 1.00 93.99  ? 723 DC  T C5    1 
ATOM   8677 C  C6    . DC  D 4 23  ? 75.374 119.835 10.182 1.00 95.08  ? 723 DC  T C6    1 
ATOM   8678 P  P     . DT  D 4 24  ? 76.104 118.240 3.626  1.00 112.14 ? 724 DT  T P     1 
ATOM   8679 O  OP1   . DT  D 4 24  ? 75.467 118.525 2.316  1.00 112.27 ? 724 DT  T OP1   1 
ATOM   8680 O  OP2   . DT  D 4 24  ? 76.334 116.834 4.052  1.00 111.61 ? 724 DT  T OP2   1 
ATOM   8681 O  "O5'" . DT  D 4 24  ? 77.484 119.028 3.698  1.00 116.10 ? 724 DT  T "O5'" 1 
ATOM   8682 C  "C5'" . DT  D 4 24  ? 77.518 120.447 3.568  1.00 122.15 ? 724 DT  T "C5'" 1 
ATOM   8683 C  "C4'" . DT  D 4 24  ? 78.878 120.978 3.959  1.00 126.20 ? 724 DT  T "C4'" 1 
ATOM   8684 O  "O4'" . DT  D 4 24  ? 79.118 120.708 5.361  1.00 127.48 ? 724 DT  T "O4'" 1 
ATOM   8685 C  "C3'" . DT  D 4 24  ? 80.033 120.316 3.213  1.00 128.43 ? 724 DT  T "C3'" 1 
ATOM   8686 O  "O3'" . DT  D 4 24  ? 80.478 121.228 2.206  1.00 131.29 ? 724 DT  T "O3'" 1 
ATOM   8687 C  "C2'" . DT  D 4 24  ? 81.169 120.346 4.226  1.00 128.70 ? 724 DT  T "C2'" 1 
ATOM   8688 C  "C1'" . DT  D 4 24  ? 80.493 120.433 5.586  1.00 128.25 ? 724 DT  T "C1'" 1 
ATOM   8689 N  N1    . DT  D 4 24  ? 80.591 119.240 6.447  1.00 127.91 ? 724 DT  T N1    1 
ATOM   8690 C  C2    . DT  D 4 24  ? 81.610 119.194 7.370  1.00 127.80 ? 724 DT  T C2    1 
ATOM   8691 O  O2    . DT  D 4 24  ? 82.436 120.081 7.497  1.00 127.95 ? 724 DT  T O2    1 
ATOM   8692 N  N3    . DT  D 4 24  ? 81.623 118.069 8.150  1.00 127.91 ? 724 DT  T N3    1 
ATOM   8693 C  C4    . DT  D 4 24  ? 80.748 117.006 8.092  1.00 128.53 ? 724 DT  T C4    1 
ATOM   8694 O  O4    . DT  D 4 24  ? 80.890 116.062 8.859  1.00 129.73 ? 724 DT  T O4    1 
ATOM   8695 C  C5    . DT  D 4 24  ? 79.709 117.114 7.092  1.00 128.36 ? 724 DT  T C5    1 
ATOM   8696 C  C7    . DT  D 4 24  ? 78.714 116.005 6.952  1.00 127.94 ? 724 DT  T C7    1 
ATOM   8697 C  C6    . DT  D 4 24  ? 79.686 118.211 6.328  1.00 128.01 ? 724 DT  T C6    1 
ATOM   8698 P  P     . DG  D 4 25  ? 81.085 120.665 0.832  1.00 133.36 ? 725 DG  T P     1 
ATOM   8699 O  OP1   . DG  D 4 25  ? 80.645 121.581 -0.256 1.00 132.85 ? 725 DG  T OP1   1 
ATOM   8700 O  OP2   . DG  D 4 25  ? 80.740 119.218 0.768  1.00 133.47 ? 725 DG  T OP2   1 
ATOM   8701 O  "O5'" . DG  D 4 25  ? 82.664 120.804 1.017  1.00 134.39 ? 725 DG  T "O5'" 1 
ATOM   8702 C  "C5'" . DG  D 4 25  ? 83.563 119.834 0.468  1.00 135.53 ? 725 DG  T "C5'" 1 
ATOM   8703 C  "C4'" . DG  D 4 25  ? 84.789 119.708 1.343  1.00 135.52 ? 725 DG  T "C4'" 1 
ATOM   8704 O  "O4'" . DG  D 4 25  ? 84.368 119.435 2.697  1.00 136.36 ? 725 DG  T "O4'" 1 
ATOM   8705 C  "C3'" . DG  D 4 25  ? 85.662 118.518 0.964  1.00 135.24 ? 725 DG  T "C3'" 1 
ATOM   8706 O  "O3'" . DG  D 4 25  ? 86.586 118.894 -0.065 1.00 133.56 ? 725 DG  T "O3'" 1 
ATOM   8707 C  "C2'" . DG  D 4 25  ? 86.315 118.126 2.278  1.00 135.74 ? 725 DG  T "C2'" 1 
ATOM   8708 C  "C1'" . DG  D 4 25  ? 85.325 118.606 3.343  1.00 136.94 ? 725 DG  T "C1'" 1 
ATOM   8709 N  N9    . DG  D 4 25  ? 84.605 117.573 4.083  1.00 138.39 ? 725 DG  T N9    1 
ATOM   8710 C  C8    . DG  D 4 25  ? 83.807 116.580 3.567  1.00 138.76 ? 725 DG  T C8    1 
ATOM   8711 N  N7    . DG  D 4 25  ? 83.296 115.802 4.485  1.00 139.14 ? 725 DG  T N7    1 
ATOM   8712 C  C5    . DG  D 4 25  ? 83.785 116.311 5.683  1.00 139.41 ? 725 DG  T C5    1 
ATOM   8713 C  C6    . DG  D 4 25  ? 83.576 115.880 7.028  1.00 139.26 ? 725 DG  T C6    1 
ATOM   8714 O  O6    . DG  D 4 25  ? 82.895 114.933 7.438  1.00 138.76 ? 725 DG  T O6    1 
ATOM   8715 N  N1    . DG  D 4 25  ? 84.263 116.683 7.937  1.00 139.54 ? 725 DG  T N1    1 
ATOM   8716 C  C2    . DG  D 4 25  ? 85.048 117.762 7.603  1.00 139.67 ? 725 DG  T C2    1 
ATOM   8717 N  N2    . DG  D 4 25  ? 85.629 118.412 8.628  1.00 139.05 ? 725 DG  T N2    1 
ATOM   8718 N  N3    . DG  D 4 25  ? 85.252 118.174 6.357  1.00 139.79 ? 725 DG  T N3    1 
ATOM   8719 C  C4    . DG  D 4 25  ? 84.593 117.406 5.454  1.00 139.47 ? 725 DG  T C4    1 
HETATM 8720 MG MG    . MG  E 5 .   ? 67.709 111.745 7.954  1.00 21.66  ? 601 MG  A MG    1 
HETATM 8721 S  S     . SO4 F 6 .   ? 50.438 149.990 16.843 1.00 112.09 ? 3   SO4 P S     1 
HETATM 8722 O  O1    . SO4 F 6 .   ? 51.852 149.593 16.673 1.00 110.39 ? 3   SO4 P O1    1 
HETATM 8723 O  O2    . SO4 F 6 .   ? 49.852 149.292 18.004 1.00 111.54 ? 3   SO4 P O2    1 
HETATM 8724 O  O3    . SO4 F 6 .   ? 50.335 151.444 17.081 1.00 111.64 ? 3   SO4 P O3    1 
HETATM 8725 O  O4    . SO4 F 6 .   ? 49.694 149.641 15.617 1.00 111.26 ? 3   SO4 P O4    1 
HETATM 8726 S  S     . SO4 G 6 .   ? 48.313 156.375 16.060 1.00 103.73 ? 2   SO4 T S     1 
HETATM 8727 O  O1    . SO4 G 6 .   ? 49.736 156.752 15.913 1.00 102.45 ? 2   SO4 T O1    1 
HETATM 8728 O  O2    . SO4 G 6 .   ? 47.920 156.480 17.474 1.00 103.49 ? 2   SO4 T O2    1 
HETATM 8729 O  O3    . SO4 G 6 .   ? 47.473 157.287 15.265 1.00 102.76 ? 2   SO4 T O3    1 
HETATM 8730 O  O4    . SO4 G 6 .   ? 48.109 154.985 15.606 1.00 103.10 ? 2   SO4 T O4    1 
HETATM 8731 O  O     . HOH H 7 .   ? 53.930 133.086 7.130  1.00 67.55  ? 561 HOH A O     1 
HETATM 8732 O  O     . HOH H 7 .   ? 36.831 150.673 25.237 1.00 49.73  ? 562 HOH A O     1 
HETATM 8733 O  O     . HOH H 7 .   ? 48.513 162.343 40.958 1.00 50.81  ? 563 HOH A O     1 
HETATM 8734 O  O     . HOH H 7 .   ? 32.337 160.544 48.409 1.00 40.94  ? 564 HOH A O     1 
HETATM 8735 O  O     . HOH H 7 .   ? 38.053 140.451 20.719 1.00 37.18  ? 565 HOH A O     1 
HETATM 8736 O  O     . HOH H 7 .   ? 50.996 97.605  7.667  1.00 40.29  ? 566 HOH A O     1 
HETATM 8737 O  O     . HOH H 7 .   ? 65.662 159.366 26.628 1.00 48.63  ? 567 HOH A O     1 
HETATM 8738 O  O     . HOH H 7 .   ? 59.937 118.687 -5.343 1.00 66.66  ? 568 HOH A O     1 
HETATM 8739 O  O     . HOH H 7 .   ? 32.108 162.073 24.328 1.00 48.04  ? 569 HOH A O     1 
HETATM 8740 O  O     . HOH H 7 .   ? 55.751 154.862 26.902 1.00 55.62  ? 570 HOH A O     1 
HETATM 8741 O  O     . HOH H 7 .   ? 34.398 147.075 44.404 1.00 40.66  ? 571 HOH A O     1 
HETATM 8742 O  O     . HOH H 7 .   ? 75.898 113.328 -1.052 1.00 45.57  ? 572 HOH A O     1 
HETATM 8743 O  O     . HOH H 7 .   ? 18.739 150.340 30.715 1.00 43.82  ? 573 HOH A O     1 
HETATM 8744 O  O     . HOH H 7 .   ? 39.499 141.925 22.907 1.00 45.97  ? 574 HOH A O     1 
HETATM 8745 O  O     . HOH H 7 .   ? 62.835 172.438 31.383 1.00 45.97  ? 575 HOH A O     1 
HETATM 8746 O  O     . HOH I 7 .   ? 73.493 133.503 35.775 1.00 63.74  ? 441 HOH B O     1 
HETATM 8747 O  O     . HOH I 7 .   ? 63.186 144.849 34.089 1.00 44.05  ? 442 HOH B O     1 
HETATM 8748 O  O     . HOH I 7 .   ? 65.982 142.002 40.756 1.00 45.66  ? 443 HOH B O     1 
HETATM 8749 O  O     . HOH I 7 .   ? 83.816 126.144 60.925 1.00 51.29  ? 444 HOH B O     1 
HETATM 8750 O  O     . HOH J 7 .   ? 54.133 127.874 18.724 1.00 41.29  ? 6   HOH P O     1 
HETATM 8751 O  O     . HOH J 7 .   ? 37.422 153.113 22.910 1.00 42.81  ? 23  HOH P O     1 
HETATM 8752 O  O     . HOH K 7 .   ? 45.132 165.110 16.362 1.00 49.38  ? 27  HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 CYS 258 258 258 CYS CYS A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 ASN 447 447 447 ASN ASN A . n 
A 1 448 ARG 448 448 448 ARG ARG A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 ARG 461 461 461 ARG ARG A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 TYR 483 483 483 TYR TYR A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 LYS 540 540 540 LYS LYS A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASN 545 545 545 ASN ASN A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 VAL 552 552 552 VAL VAL A . n 
A 1 553 SER 553 553 553 SER SER A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ILE 556 556 ?   ?   ?   A . n 
A 1 557 ARG 557 557 ?   ?   ?   A . n 
A 1 558 LYS 558 558 ?   ?   ?   A . n 
A 1 559 VAL 559 559 ?   ?   ?   A . n 
A 1 560 LEU 560 560 ?   ?   ?   A . n 
B 2 1   MET 1   -11 ?   ?   ?   B . n 
B 2 2   GLY 2   -10 ?   ?   ?   B . n 
B 2 3   SER 3   -9  ?   ?   ?   B . n 
B 2 4   SER 4   -8  ?   ?   ?   B . n 
B 2 5   HIS 5   -7  ?   ?   ?   B . n 
B 2 6   HIS 6   -6  ?   ?   ?   B . n 
B 2 7   HIS 7   -5  ?   ?   ?   B . n 
B 2 8   HIS 8   -4  ?   ?   ?   B . n 
B 2 9   HIS 9   -3  ?   ?   ?   B . n 
B 2 10  HIS 10  -2  ?   ?   ?   B . n 
B 2 11  SER 11  -1  ?   ?   ?   B . n 
B 2 12  SER 12  0   ?   ?   ?   B . n 
B 2 13  PRO 13  1   ?   ?   ?   B . n 
B 2 14  ILE 14  2   ?   ?   ?   B . n 
B 2 15  SER 15  3   ?   ?   ?   B . n 
B 2 16  PRO 16  4   4   PRO PRO B . n 
B 2 17  ILE 17  5   5   ILE ILE B . n 
B 2 18  GLU 18  6   6   GLU GLU B . n 
B 2 19  THR 19  7   7   THR THR B . n 
B 2 20  VAL 20  8   8   VAL VAL B . n 
B 2 21  PRO 21  9   9   PRO PRO B . n 
B 2 22  VAL 22  10  10  VAL VAL B . n 
B 2 23  LYS 23  11  11  LYS LYS B . n 
B 2 24  LEU 24  12  12  LEU LEU B . n 
B 2 25  LYS 25  13  13  LYS LYS B . n 
B 2 26  PRO 26  14  14  PRO PRO B . n 
B 2 27  GLY 27  15  15  GLY GLY B . n 
B 2 28  MET 28  16  16  MET MET B . n 
B 2 29  ASP 29  17  17  ASP ASP B . n 
B 2 30  GLY 30  18  18  GLY GLY B . n 
B 2 31  PRO 31  19  19  PRO PRO B . n 
B 2 32  LYS 32  20  20  LYS LYS B . n 
B 2 33  VAL 33  21  21  VAL VAL B . n 
B 2 34  LYS 34  22  22  LYS LYS B . n 
B 2 35  GLN 35  23  23  GLN GLN B . n 
B 2 36  TRP 36  24  24  TRP TRP B . n 
B 2 37  PRO 37  25  25  PRO PRO B . n 
B 2 38  LEU 38  26  26  LEU LEU B . n 
B 2 39  THR 39  27  27  THR THR B . n 
B 2 40  GLU 40  28  28  GLU GLU B . n 
B 2 41  GLU 41  29  29  GLU GLU B . n 
B 2 42  LYS 42  30  30  LYS LYS B . n 
B 2 43  ILE 43  31  31  ILE ILE B . n 
B 2 44  LYS 44  32  32  LYS LYS B . n 
B 2 45  ALA 45  33  33  ALA ALA B . n 
B 2 46  LEU 46  34  34  LEU LEU B . n 
B 2 47  VAL 47  35  35  VAL VAL B . n 
B 2 48  GLU 48  36  36  GLU GLU B . n 
B 2 49  ILE 49  37  37  ILE ILE B . n 
B 2 50  CYS 50  38  38  CYS CYS B . n 
B 2 51  THR 51  39  39  THR THR B . n 
B 2 52  GLU 52  40  40  GLU GLU B . n 
B 2 53  MET 53  41  41  MET MET B . n 
B 2 54  GLU 54  42  42  GLU GLU B . n 
B 2 55  LYS 55  43  43  LYS LYS B . n 
B 2 56  GLU 56  44  44  GLU GLU B . n 
B 2 57  GLY 57  45  45  GLY GLY B . n 
B 2 58  LYS 58  46  46  LYS LYS B . n 
B 2 59  ILE 59  47  47  ILE ILE B . n 
B 2 60  SER 60  48  48  SER SER B . n 
B 2 61  LYS 61  49  49  LYS LYS B . n 
B 2 62  ILE 62  50  50  ILE ILE B . n 
B 2 63  GLY 63  51  51  GLY GLY B . n 
B 2 64  PRO 64  52  52  PRO PRO B . n 
B 2 65  GLU 65  53  53  GLU GLU B . n 
B 2 66  ASN 66  54  54  ASN ASN B . n 
B 2 67  PRO 67  55  55  PRO PRO B . n 
B 2 68  TYR 68  56  56  TYR TYR B . n 
B 2 69  ASN 69  57  57  ASN ASN B . n 
B 2 70  THR 70  58  58  THR THR B . n 
B 2 71  PRO 71  59  59  PRO PRO B . n 
B 2 72  VAL 72  60  60  VAL VAL B . n 
B 2 73  PHE 73  61  61  PHE PHE B . n 
B 2 74  ALA 74  62  62  ALA ALA B . n 
B 2 75  ILE 75  63  63  ILE ILE B . n 
B 2 76  LYS 76  64  64  LYS LYS B . n 
B 2 77  LYS 77  65  65  LYS LYS B . n 
B 2 78  LYS 78  66  66  LYS LYS B . n 
B 2 79  ASP 79  67  67  ASP ASP B . n 
B 2 80  SER 80  68  68  SER SER B . n 
B 2 81  THR 81  69  69  THR THR B . n 
B 2 82  LYS 82  70  70  LYS LYS B . n 
B 2 83  TRP 83  71  71  TRP TRP B . n 
B 2 84  ARG 84  72  72  ARG ARG B . n 
B 2 85  LYS 85  73  73  LYS LYS B . n 
B 2 86  LEU 86  74  74  LEU LEU B . n 
B 2 87  VAL 87  75  75  VAL VAL B . n 
B 2 88  ASP 88  76  76  ASP ASP B . n 
B 2 89  PHE 89  77  77  PHE PHE B . n 
B 2 90  ARG 90  78  78  ARG ARG B . n 
B 2 91  GLU 91  79  79  GLU GLU B . n 
B 2 92  LEU 92  80  80  LEU LEU B . n 
B 2 93  ASN 93  81  81  ASN ASN B . n 
B 2 94  LYS 94  82  82  LYS LYS B . n 
B 2 95  ARG 95  83  83  ARG ARG B . n 
B 2 96  THR 96  84  84  THR THR B . n 
B 2 97  GLN 97  85  85  GLN GLN B . n 
B 2 98  ASP 98  86  86  ASP ASP B . n 
B 2 99  PHE 99  87  87  PHE PHE B . n 
B 2 100 TRP 100 88  88  TRP TRP B . n 
B 2 101 GLU 101 89  89  GLU GLU B . n 
B 2 102 VAL 102 90  90  VAL VAL B . n 
B 2 103 GLN 103 91  91  GLN GLN B . n 
B 2 104 LEU 104 92  92  LEU LEU B . n 
B 2 105 GLY 105 93  93  GLY GLY B . n 
B 2 106 ILE 106 94  94  ILE ILE B . n 
B 2 107 PRO 107 95  95  PRO PRO B . n 
B 2 108 HIS 108 96  96  HIS HIS B . n 
B 2 109 PRO 109 97  97  PRO PRO B . n 
B 2 110 ALA 110 98  98  ALA ALA B . n 
B 2 111 GLY 111 99  99  GLY GLY B . n 
B 2 112 LEU 112 100 100 LEU LEU B . n 
B 2 113 LYS 113 101 101 LYS LYS B . n 
B 2 114 LYS 114 102 102 LYS LYS B . n 
B 2 115 LYS 115 103 103 LYS LYS B . n 
B 2 116 LYS 116 104 104 LYS LYS B . n 
B 2 117 SER 117 105 105 SER SER B . n 
B 2 118 VAL 118 106 106 VAL VAL B . n 
B 2 119 THR 119 107 107 THR THR B . n 
B 2 120 VAL 120 108 108 VAL VAL B . n 
B 2 121 LEU 121 109 109 LEU LEU B . n 
B 2 122 ASP 122 110 110 ASP ASP B . n 
B 2 123 VAL 123 111 111 VAL VAL B . n 
B 2 124 GLY 124 112 112 GLY GLY B . n 
B 2 125 ASP 125 113 113 ASP ASP B . n 
B 2 126 ALA 126 114 114 ALA ALA B . n 
B 2 127 TYR 127 115 115 TYR TYR B . n 
B 2 128 PHE 128 116 116 PHE PHE B . n 
B 2 129 SER 129 117 117 SER SER B . n 
B 2 130 VAL 130 118 118 VAL VAL B . n 
B 2 131 PRO 131 119 119 PRO PRO B . n 
B 2 132 LEU 132 120 120 LEU LEU B . n 
B 2 133 ASP 133 121 121 ASP ASP B . n 
B 2 134 GLU 134 122 122 GLU GLU B . n 
B 2 135 ASP 135 123 123 ASP ASP B . n 
B 2 136 PHE 136 124 124 PHE PHE B . n 
B 2 137 ARG 137 125 125 ARG ARG B . n 
B 2 138 LYS 138 126 126 LYS LYS B . n 
B 2 139 TYR 139 127 127 TYR TYR B . n 
B 2 140 THR 140 128 128 THR THR B . n 
B 2 141 ALA 141 129 129 ALA ALA B . n 
B 2 142 PHE 142 130 130 PHE PHE B . n 
B 2 143 THR 143 131 131 THR THR B . n 
B 2 144 ILE 144 132 132 ILE ILE B . n 
B 2 145 PRO 145 133 133 PRO PRO B . n 
B 2 146 SER 146 134 134 SER SER B . n 
B 2 147 ILE 147 135 135 ILE ILE B . n 
B 2 148 ASN 148 136 136 ASN ASN B . n 
B 2 149 ASN 149 137 137 ASN ASN B . n 
B 2 150 GLU 150 138 138 GLU GLU B . n 
B 2 151 THR 151 139 139 THR THR B . n 
B 2 152 PRO 152 140 140 PRO PRO B . n 
B 2 153 GLY 153 141 141 GLY GLY B . n 
B 2 154 ILE 154 142 142 ILE ILE B . n 
B 2 155 ARG 155 143 143 ARG ARG B . n 
B 2 156 TYR 156 144 144 TYR TYR B . n 
B 2 157 GLN 157 145 145 GLN GLN B . n 
B 2 158 TYR 158 146 146 TYR TYR B . n 
B 2 159 ASN 159 147 147 ASN ASN B . n 
B 2 160 VAL 160 148 148 VAL VAL B . n 
B 2 161 LEU 161 149 149 LEU LEU B . n 
B 2 162 PRO 162 150 150 PRO PRO B . n 
B 2 163 GLN 163 151 151 GLN GLN B . n 
B 2 164 GLY 164 152 152 GLY GLY B . n 
B 2 165 TRP 165 153 153 TRP TRP B . n 
B 2 166 LYS 166 154 154 LYS LYS B . n 
B 2 167 GLY 167 155 155 GLY GLY B . n 
B 2 168 SER 168 156 156 SER SER B . n 
B 2 169 PRO 169 157 157 PRO PRO B . n 
B 2 170 ALA 170 158 158 ALA ALA B . n 
B 2 171 ILE 171 159 159 ILE ILE B . n 
B 2 172 PHE 172 160 160 PHE PHE B . n 
B 2 173 GLN 173 161 161 GLN GLN B . n 
B 2 174 SER 174 162 162 SER SER B . n 
B 2 175 SER 175 163 163 SER SER B . n 
B 2 176 MET 176 164 164 MET MET B . n 
B 2 177 THR 177 165 165 THR THR B . n 
B 2 178 LYS 178 166 166 LYS LYS B . n 
B 2 179 ILE 179 167 167 ILE ILE B . n 
B 2 180 LEU 180 168 168 LEU LEU B . n 
B 2 181 GLU 181 169 169 GLU GLU B . n 
B 2 182 PRO 182 170 170 PRO PRO B . n 
B 2 183 PHE 183 171 171 PHE PHE B . n 
B 2 184 ARG 184 172 172 ARG ARG B . n 
B 2 185 LYS 185 173 173 LYS LYS B . n 
B 2 186 GLN 186 174 174 GLN GLN B . n 
B 2 187 ASN 187 175 175 ASN ASN B . n 
B 2 188 PRO 188 176 176 PRO PRO B . n 
B 2 189 ASP 189 177 177 ASP ASP B . n 
B 2 190 ILE 190 178 178 ILE ILE B . n 
B 2 191 VAL 191 179 179 VAL VAL B . n 
B 2 192 ILE 192 180 180 ILE ILE B . n 
B 2 193 TYR 193 181 181 TYR TYR B . n 
B 2 194 GLN 194 182 182 GLN GLN B . n 
B 2 195 TYR 195 183 183 TYR TYR B . n 
B 2 196 MET 196 184 184 MET MET B . n 
B 2 197 ASP 197 185 185 ASP ASP B . n 
B 2 198 ASP 198 186 186 ASP ASP B . n 
B 2 199 LEU 199 187 187 LEU LEU B . n 
B 2 200 TYR 200 188 188 TYR TYR B . n 
B 2 201 VAL 201 189 189 VAL VAL B . n 
B 2 202 GLY 202 190 190 GLY GLY B . n 
B 2 203 SER 203 191 191 SER SER B . n 
B 2 204 ASP 204 192 192 ASP ASP B . n 
B 2 205 LEU 205 193 193 LEU LEU B . n 
B 2 206 GLU 206 194 194 GLU GLU B . n 
B 2 207 ILE 207 195 195 ILE ILE B . n 
B 2 208 GLY 208 196 196 GLY GLY B . n 
B 2 209 GLN 209 197 197 GLN GLN B . n 
B 2 210 HIS 210 198 198 HIS HIS B . n 
B 2 211 ARG 211 199 199 ARG ARG B . n 
B 2 212 THR 212 200 200 THR THR B . n 
B 2 213 LYS 213 201 201 LYS LYS B . n 
B 2 214 ILE 214 202 202 ILE ILE B . n 
B 2 215 GLU 215 203 203 GLU GLU B . n 
B 2 216 GLU 216 204 204 GLU GLU B . n 
B 2 217 LEU 217 205 205 LEU LEU B . n 
B 2 218 ARG 218 206 206 ARG ARG B . n 
B 2 219 GLN 219 207 207 GLN GLN B . n 
B 2 220 HIS 220 208 208 HIS HIS B . n 
B 2 221 LEU 221 209 209 LEU LEU B . n 
B 2 222 LEU 222 210 210 LEU LEU B . n 
B 2 223 ARG 223 211 211 ARG ARG B . n 
B 2 224 TRP 224 212 212 TRP TRP B . n 
B 2 225 GLY 225 213 213 GLY GLY B . n 
B 2 226 LEU 226 214 214 LEU LEU B . n 
B 2 227 THR 227 215 ?   ?   ?   B . n 
B 2 228 THR 228 216 ?   ?   ?   B . n 
B 2 229 PRO 229 217 ?   ?   ?   B . n 
B 2 230 ASP 230 218 ?   ?   ?   B . n 
B 2 231 LYS 231 219 ?   ?   ?   B . n 
B 2 232 LYS 232 220 ?   ?   ?   B . n 
B 2 233 HIS 233 221 ?   ?   ?   B . n 
B 2 234 GLN 234 222 ?   ?   ?   B . n 
B 2 235 LYS 235 223 ?   ?   ?   B . n 
B 2 236 GLU 236 224 ?   ?   ?   B . n 
B 2 237 PRO 237 225 ?   ?   ?   B . n 
B 2 238 PRO 238 226 ?   ?   ?   B . n 
B 2 239 PHE 239 227 ?   ?   ?   B . n 
B 2 240 LEU 240 228 ?   ?   ?   B . n 
B 2 241 TRP 241 229 ?   ?   ?   B . n 
B 2 242 MET 242 230 ?   ?   ?   B . n 
B 2 243 GLY 243 231 ?   ?   ?   B . n 
B 2 244 TYR 244 232 232 TYR TYR B . n 
B 2 245 GLU 245 233 233 GLU GLU B . n 
B 2 246 LEU 246 234 234 LEU LEU B . n 
B 2 247 HIS 247 235 235 HIS HIS B . n 
B 2 248 PRO 248 236 236 PRO PRO B . n 
B 2 249 ASP 249 237 237 ASP ASP B . n 
B 2 250 LYS 250 238 238 LYS LYS B . n 
B 2 251 TRP 251 239 239 TRP TRP B . n 
B 2 252 THR 252 240 240 THR THR B . n 
B 2 253 VAL 253 241 241 VAL VAL B . n 
B 2 254 GLN 254 242 242 GLN GLN B . n 
B 2 255 PRO 255 243 243 PRO PRO B . n 
B 2 256 ILE 256 244 244 ILE ILE B . n 
B 2 257 VAL 257 245 245 VAL VAL B . n 
B 2 258 LEU 258 246 246 LEU LEU B . n 
B 2 259 PRO 259 247 247 PRO PRO B . n 
B 2 260 GLU 260 248 248 GLU GLU B . n 
B 2 261 LYS 261 249 249 LYS LYS B . n 
B 2 262 ASP 262 250 250 ASP ASP B . n 
B 2 263 SER 263 251 251 SER SER B . n 
B 2 264 TRP 264 252 252 TRP TRP B . n 
B 2 265 THR 265 253 253 THR THR B . n 
B 2 266 VAL 266 254 254 VAL VAL B . n 
B 2 267 ASN 267 255 255 ASN ASN B . n 
B 2 268 ASP 268 256 256 ASP ASP B . n 
B 2 269 ILE 269 257 257 ILE ILE B . n 
B 2 270 GLN 270 258 258 GLN GLN B . n 
B 2 271 LYS 271 259 259 LYS LYS B . n 
B 2 272 LEU 272 260 260 LEU LEU B . n 
B 2 273 VAL 273 261 261 VAL VAL B . n 
B 2 274 GLY 274 262 262 GLY GLY B . n 
B 2 275 LYS 275 263 263 LYS LYS B . n 
B 2 276 LEU 276 264 264 LEU LEU B . n 
B 2 277 ASN 277 265 265 ASN ASN B . n 
B 2 278 TRP 278 266 266 TRP TRP B . n 
B 2 279 ALA 279 267 267 ALA ALA B . n 
B 2 280 SER 280 268 268 SER SER B . n 
B 2 281 GLN 281 269 269 GLN GLN B . n 
B 2 282 ILE 282 270 270 ILE ILE B . n 
B 2 283 TYR 283 271 271 TYR TYR B . n 
B 2 284 PRO 284 272 272 PRO PRO B . n 
B 2 285 GLY 285 273 273 GLY GLY B . n 
B 2 286 ILE 286 274 274 ILE ILE B . n 
B 2 287 LYS 287 275 275 LYS LYS B . n 
B 2 288 VAL 288 276 276 VAL VAL B . n 
B 2 289 ARG 289 277 277 ARG ARG B . n 
B 2 290 GLN 290 278 278 GLN GLN B . n 
B 2 291 LEU 291 279 279 LEU LEU B . n 
B 2 292 SER 292 280 280 SER SER B . n 
B 2 293 LYS 293 281 281 LYS LYS B . n 
B 2 294 LEU 294 282 282 LEU LEU B . n 
B 2 295 LEU 295 283 283 LEU LEU B . n 
B 2 296 ARG 296 284 284 ARG ARG B . n 
B 2 297 GLY 297 285 285 GLY GLY B . n 
B 2 298 THR 298 286 286 THR THR B . n 
B 2 299 LYS 299 287 287 LYS LYS B . n 
B 2 300 ALA 300 288 288 ALA ALA B . n 
B 2 301 LEU 301 289 289 LEU LEU B . n 
B 2 302 THR 302 290 290 THR THR B . n 
B 2 303 GLU 303 291 291 GLU GLU B . n 
B 2 304 VAL 304 292 292 VAL VAL B . n 
B 2 305 ILE 305 293 293 ILE ILE B . n 
B 2 306 PRO 306 294 294 PRO PRO B . n 
B 2 307 LEU 307 295 295 LEU LEU B . n 
B 2 308 THR 308 296 296 THR THR B . n 
B 2 309 GLU 309 297 297 GLU GLU B . n 
B 2 310 GLU 310 298 298 GLU GLU B . n 
B 2 311 ALA 311 299 299 ALA ALA B . n 
B 2 312 GLU 312 300 300 GLU GLU B . n 
B 2 313 LEU 313 301 301 LEU LEU B . n 
B 2 314 GLU 314 302 302 GLU GLU B . n 
B 2 315 LEU 315 303 303 LEU LEU B . n 
B 2 316 ALA 316 304 304 ALA ALA B . n 
B 2 317 GLU 317 305 305 GLU GLU B . n 
B 2 318 ASN 318 306 306 ASN ASN B . n 
B 2 319 ARG 319 307 307 ARG ARG B . n 
B 2 320 GLU 320 308 308 GLU GLU B . n 
B 2 321 ILE 321 309 309 ILE ILE B . n 
B 2 322 LEU 322 310 310 LEU LEU B . n 
B 2 323 LYS 323 311 311 LYS LYS B . n 
B 2 324 GLU 324 312 312 GLU GLU B . n 
B 2 325 PRO 325 313 313 PRO PRO B . n 
B 2 326 VAL 326 314 314 VAL VAL B . n 
B 2 327 HIS 327 315 315 HIS HIS B . n 
B 2 328 GLY 328 316 316 GLY GLY B . n 
B 2 329 VAL 329 317 317 VAL VAL B . n 
B 2 330 TYR 330 318 318 TYR TYR B . n 
B 2 331 TYR 331 319 319 TYR TYR B . n 
B 2 332 ASP 332 320 320 ASP ASP B . n 
B 2 333 PRO 333 321 321 PRO PRO B . n 
B 2 334 SER 334 322 322 SER SER B . n 
B 2 335 LYS 335 323 323 LYS LYS B . n 
B 2 336 ASP 336 324 324 ASP ASP B . n 
B 2 337 LEU 337 325 325 LEU LEU B . n 
B 2 338 ILE 338 326 326 ILE ILE B . n 
B 2 339 ALA 339 327 327 ALA ALA B . n 
B 2 340 GLU 340 328 328 GLU GLU B . n 
B 2 341 ILE 341 329 329 ILE ILE B . n 
B 2 342 GLN 342 330 330 GLN GLN B . n 
B 2 343 LYS 343 331 331 LYS LYS B . n 
B 2 344 GLN 344 332 332 GLN GLN B . n 
B 2 345 GLY 345 333 333 GLY GLY B . n 
B 2 346 GLN 346 334 334 GLN GLN B . n 
B 2 347 GLY 347 335 335 GLY GLY B . n 
B 2 348 GLN 348 336 336 GLN GLN B . n 
B 2 349 TRP 349 337 337 TRP TRP B . n 
B 2 350 THR 350 338 338 THR THR B . n 
B 2 351 TYR 351 339 339 TYR TYR B . n 
B 2 352 GLN 352 340 340 GLN GLN B . n 
B 2 353 ILE 353 341 341 ILE ILE B . n 
B 2 354 TYR 354 342 342 TYR TYR B . n 
B 2 355 GLN 355 343 343 GLN GLN B . n 
B 2 356 GLU 356 344 344 GLU GLU B . n 
B 2 357 PRO 357 345 345 PRO PRO B . n 
B 2 358 PHE 358 346 346 PHE PHE B . n 
B 2 359 LYS 359 347 347 LYS LYS B . n 
B 2 360 ASN 360 348 348 ASN ASN B . n 
B 2 361 LEU 361 349 349 LEU LEU B . n 
B 2 362 LYS 362 350 350 LYS LYS B . n 
B 2 363 THR 363 351 351 THR THR B . n 
B 2 364 GLY 364 352 352 GLY GLY B . n 
B 2 365 LYS 365 353 353 LYS LYS B . n 
B 2 366 TYR 366 354 354 TYR TYR B . n 
B 2 367 ALA 367 355 355 ALA ALA B . n 
B 2 368 ARG 368 356 356 ARG ARG B . n 
B 2 369 MET 369 357 357 MET MET B . n 
B 2 370 ARG 370 358 358 ARG ALA B . n 
B 2 371 GLY 371 359 ?   ?   ?   B . n 
B 2 372 ALA 372 360 ?   ?   ?   B . n 
B 2 373 HIS 373 361 ?   ?   ?   B . n 
B 2 374 THR 374 362 362 THR THR B . n 
B 2 375 ASN 375 363 363 ASN ASN B . n 
B 2 376 ASP 376 364 364 ASP ASP B . n 
B 2 377 VAL 377 365 365 VAL VAL B . n 
B 2 378 LYS 378 366 366 LYS LYS B . n 
B 2 379 GLN 379 367 367 GLN GLN B . n 
B 2 380 LEU 380 368 368 LEU LEU B . n 
B 2 381 THR 381 369 369 THR THR B . n 
B 2 382 GLU 382 370 370 GLU GLU B . n 
B 2 383 ALA 383 371 371 ALA ALA B . n 
B 2 384 VAL 384 372 372 VAL VAL B . n 
B 2 385 GLN 385 373 373 GLN GLN B . n 
B 2 386 LYS 386 374 374 LYS LYS B . n 
B 2 387 ILE 387 375 375 ILE ILE B . n 
B 2 388 THR 388 376 376 THR THR B . n 
B 2 389 THR 389 377 377 THR THR B . n 
B 2 390 GLU 390 378 378 GLU GLU B . n 
B 2 391 SER 391 379 379 SER SER B . n 
B 2 392 ILE 392 380 380 ILE ILE B . n 
B 2 393 VAL 393 381 381 VAL VAL B . n 
B 2 394 ILE 394 382 382 ILE ILE B . n 
B 2 395 TRP 395 383 383 TRP TRP B . n 
B 2 396 GLY 396 384 384 GLY GLY B . n 
B 2 397 LYS 397 385 385 LYS LYS B . n 
B 2 398 THR 398 386 386 THR THR B . n 
B 2 399 PRO 399 387 387 PRO PRO B . n 
B 2 400 LYS 400 388 388 LYS LYS B . n 
B 2 401 PHE 401 389 389 PHE PHE B . n 
B 2 402 LYS 402 390 390 LYS LYS B . n 
B 2 403 LEU 403 391 391 LEU LEU B . n 
B 2 404 PRO 404 392 392 PRO PRO B . n 
B 2 405 ILE 405 393 393 ILE ILE B . n 
B 2 406 GLN 406 394 394 GLN GLN B . n 
B 2 407 LYS 407 395 395 LYS LYS B . n 
B 2 408 GLU 408 396 396 GLU GLU B . n 
B 2 409 THR 409 397 397 THR THR B . n 
B 2 410 TRP 410 398 398 TRP TRP B . n 
B 2 411 GLU 411 399 399 GLU GLU B . n 
B 2 412 THR 412 400 400 THR THR B . n 
B 2 413 TRP 413 401 401 TRP TRP B . n 
B 2 414 TRP 414 402 402 TRP TRP B . n 
B 2 415 THR 415 403 403 THR THR B . n 
B 2 416 GLU 416 404 404 GLU GLU B . n 
B 2 417 TYR 417 405 405 TYR TYR B . n 
B 2 418 TRP 418 406 406 TRP TRP B . n 
B 2 419 GLN 419 407 407 GLN GLN B . n 
B 2 420 ALA 420 408 408 ALA ALA B . n 
B 2 421 THR 421 409 409 THR THR B . n 
B 2 422 TRP 422 410 410 TRP TRP B . n 
B 2 423 ILE 423 411 411 ILE ILE B . n 
B 2 424 PRO 424 412 412 PRO PRO B . n 
B 2 425 GLU 425 413 413 GLU GLU B . n 
B 2 426 TRP 426 414 414 TRP TRP B . n 
B 2 427 GLU 427 415 415 GLU GLU B . n 
B 2 428 PHE 428 416 416 PHE PHE B . n 
B 2 429 VAL 429 417 417 VAL VAL B . n 
B 2 430 ASN 430 418 418 ASN ASN B . n 
B 2 431 THR 431 419 419 THR THR B . n 
B 2 432 PRO 432 420 420 PRO PRO B . n 
B 2 433 PRO 433 421 421 PRO PRO B . n 
B 2 434 LEU 434 422 422 LEU LEU B . n 
B 2 435 VAL 435 423 423 VAL VAL B . n 
B 2 436 LYS 436 424 424 LYS LYS B . n 
B 2 437 LEU 437 425 425 LEU LEU B . n 
B 2 438 TRP 438 426 426 TRP TRP B . n 
B 2 439 TYR 439 427 427 TYR TYR B . n 
B 2 440 GLN 440 428 428 GLN GLN B . n 
B 2 441 LEU 441 429 429 LEU LEU B . n 
B 2 442 GLU 442 430 430 GLU GLU B . n 
B 2 443 LYS 443 431 ?   ?   ?   B . n 
B 2 444 GLU 444 432 ?   ?   ?   B . n 
B 2 445 PRO 445 433 ?   ?   ?   B . n 
B 2 446 ILE 446 434 ?   ?   ?   B . n 
B 2 447 VAL 447 435 ?   ?   ?   B . n 
B 2 448 GLY 448 436 ?   ?   ?   B . n 
B 2 449 ALA 449 437 ?   ?   ?   B . n 
B 2 450 GLU 450 438 ?   ?   ?   B . n 
B 2 451 THR 451 439 ?   ?   ?   B . n 
B 2 452 PHE 452 440 ?   ?   ?   B . n 
C 3 1   DA  1   802 ?   ?   ?   P . n 
C 3 2   DC  2   803 ?   ?   ?   P . n 
C 3 3   DA  3   804 ?   ?   ?   P . n 
C 3 4   DG  4   805 805 DG  G   P . n 
C 3 5   DT  5   806 806 DT  T   P . n 
C 3 6   DC  6   807 807 DC  C   P . n 
C 3 7   DC  7   808 808 DC  C   P . n 
C 3 8   DC  8   809 809 DC  C   P . n 
C 3 9   DT  9   810 810 DT  T   P . n 
C 3 10  DG  10  811 811 DG  G   P . n 
C 3 11  DT  11  812 812 DT  T   P . n 
C 3 12  DT  12  813 813 DT  T   P . n 
C 3 13  DC  13  814 814 DC  C   P . n 
C 3 14  DG  14  815 815 DG  G   P . n 
C 3 15  DG  15  816 816 DG  G   P . n 
C 3 16  DG  16  817 817 DG  G   P . n 
C 3 17  DC  17  818 818 DC  C   P . n 
C 3 18  DG  18  819 819 DG  G   P . n 
C 3 19  DC  19  820 820 DC  C   P . n 
C 3 20  DC  20  821 821 DC  C   P . n 
C 3 21  URT 21  822 822 URT URT P . n 
D 4 1   DA  1   701 ?   ?   ?   T . n 
D 4 2   DT  2   702 ?   ?   ?   T . n 
D 4 3   DG  3   703 703 DG  G   T . n 
D 4 4   DG  4   704 704 DG  G   T . n 
D 4 5   DT  5   705 705 DT  T   T . n 
D 4 6   DT  6   706 706 DT  T   T . n 
D 4 7   DG  7   707 707 DG  G   T . n 
D 4 8   DG  8   708 708 DG  G   T . n 
D 4 9   DC  9   709 709 DC  C   T . n 
D 4 10  DG  10  710 710 DG  G   T . n 
D 4 11  DC  11  711 711 DC  C   T . n 
D 4 12  DC  12  712 712 DC  C   T . n 
D 4 13  DC  13  713 713 DC  C   T . n 
D 4 14  DG  14  714 714 DG  G   T . n 
D 4 15  DA  15  715 715 DA  A   T . n 
D 4 16  DA  16  716 716 DA  A   T . n 
D 4 17  DC  17  717 717 DC  C   T . n 
D 4 18  DA  18  718 718 DA  A   T . n 
D 4 19  DG  19  719 719 DG  G   T . n 
D 4 20  DG  20  720 720 DG  G   T . n 
D 4 21  DG  21  721 721 DG  G   T . n 
D 4 22  DA  22  722 722 DA  A   T . n 
D 4 23  DC  23  723 723 DC  C   T . n 
D 4 24  DT  24  724 724 DT  T   T . n 
D 4 25  DG  25  725 725 DG  G   T . n 
D 4 26  DT  26  726 ?   ?   ?   T . n 
D 4 27  DG  27  727 ?   ?   ?   T . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13040 ? 
1 MORE         -104  ? 
1 'SSA (A^2)'  47000 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 78.1  ? 
2  OD2 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 81.6  ? 
3  OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 118.7 ? 
4  OD2 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 60.7  ? 
5  OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 55.5  ? 
6  OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 64.1  ? 
7  OD2 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 55.7  ? 
8  OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 74.4  ? 
9  OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 133.0 ? 
10 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 104.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-03-23 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BOS      'data collection' .    ? 1 
EPMR     phasing           .    ? 2 
CNX      refinement        2005 ? 3 
HKL-2000 'data reduction'  .    ? 4 
HKL-2000 'data scaling'    .    ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    56 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    143 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NZ 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     173 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NZ 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    LYS 
_pdbx_validate_symm_contact.auth_seq_id_2     173 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_656 
_pdbx_validate_symm_contact.dist              2.01 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C     B GLY 18  ? ? N     B PRO 19  ? ? CA B PRO 19  ? ? 129.31 119.30 10.01 1.50 Y 
2 1 C     B LEU 391 ? ? N     B PRO 392 ? ? CA B PRO 392 ? ? 128.50 119.30 9.20  1.50 Y 
3 1 "O4'" P DC  809 ? ? "C1'" P DC  809 ? ? N1 P DC  809 ? ? 110.46 108.30 2.16  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 3   ? ? -38.85  129.13  
2  1 PRO A 4   ? ? -66.70  3.31    
3  1 LYS A 66  ? ? 52.30   76.09   
4  1 ASP A 67  ? ? 59.17   5.44    
5  1 LYS A 73  ? ? -46.45  157.00  
6  1 LEU A 74  ? ? -173.00 119.42  
7  1 ILE A 135 ? ? -54.54  -6.62   
8  1 ASN A 136 ? ? -168.87 -145.77 
9  1 GLU A 138 ? ? -40.03  -71.24  
10 1 VAL A 148 ? ? -114.11 -163.55 
11 1 LYS A 154 ? ? -16.08  -40.13  
12 1 MET A 184 ? ? 45.12   -122.30 
13 1 ASP A 192 ? ? -97.25  51.90   
14 1 PRO A 217 ? ? -53.63  -167.42 
15 1 LYS A 223 ? ? 19.10   64.49   
16 1 GLU A 224 ? ? -148.56 54.68   
17 1 SER A 280 ? ? -80.98  40.62   
18 1 ARG A 284 ? ? -64.03  62.24   
19 1 GLU A 291 ? ? -28.55  144.32  
20 1 GLN A 334 ? ? -68.49  97.26   
21 1 THR A 351 ? ? -139.40 -159.72 
22 1 ALA A 355 ? ? -162.77 44.32   
23 1 PRO A 392 ? ? -77.26  46.16   
24 1 PRO A 412 ? ? -75.73  -165.26 
25 1 GLU A 413 ? ? -28.29  113.63  
26 1 THR A 472 ? ? -119.87 -163.98 
27 1 ILE B 5   ? ? -171.25 -92.38  
28 1 LYS B 13  ? ? -39.46  134.96  
29 1 PRO B 14  ? ? -53.90  90.33   
30 1 PHE B 61  ? ? -129.26 -164.31 
31 1 LYS B 66  ? ? -159.06 -143.73 
32 1 ASP B 76  ? ? -66.49  71.40   
33 1 GLN B 85  ? ? -49.66  152.42  
34 1 PHE B 87  ? ? -166.04 12.08   
35 1 PRO B 97  ? ? -59.74  99.18   
36 1 ALA B 98  ? ? -49.67  -18.78  
37 1 VAL B 111 ? ? -147.51 21.82   
38 1 ASP B 113 ? ? -63.30  5.95    
39 1 ASP B 121 ? ? -36.90  139.47  
40 1 PHE B 160 ? ? -76.05  23.95   
41 1 ILE B 167 ? ? -48.32  -17.04  
42 1 PRO B 170 ? ? -56.20  -76.30  
43 1 ASN B 175 ? ? -153.65 63.54   
44 1 PRO B 176 ? ? -56.13  -6.53   
45 1 MET B 184 ? ? 53.65   -147.14 
46 1 LEU B 193 ? ? -39.08  164.57  
47 1 LEU B 209 ? ? -96.50  -72.30  
48 1 TRP B 212 ? ? -84.22  -74.81  
49 1 LEU B 234 ? ? -178.98 110.29  
50 1 ASP B 237 ? ? -71.45  31.43   
51 1 LYS B 238 ? ? -146.93 40.26   
52 1 TRP B 239 ? ? -97.02  32.12   
53 1 THR B 240 ? ? -23.79  135.09  
54 1 ALA B 299 ? ? -45.54  -71.53  
55 1 PHE B 346 ? ? 94.88   -14.82  
56 1 LYS B 347 ? ? -100.77 70.28   
57 1 MET B 357 ? ? -59.27  -87.85  
58 1 GLN B 407 ? ? -150.99 -2.21   
59 1 ASN B 418 ? ? -106.17 79.48   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP A 218 ? ? LYS A 219 ? ? 128.04  
2 1 THR A 286 ? ? LYS A 287 ? ? -128.86 
3 1 LYS A 287 ? ? ALA A 288 ? ? 142.44  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DC 
_pdbx_validate_planes.auth_asym_id    P 
_pdbx_validate_planes.auth_seq_id     820 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.072 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ASP 86  ? CG  ? B ASP 98  CG  
2  1 Y 1 B ASP 86  ? OD1 ? B ASP 98  OD1 
3  1 Y 1 B ASP 86  ? OD2 ? B ASP 98  OD2 
4  1 Y 1 B ARG 358 ? CG  ? B ARG 370 CG  
5  1 Y 1 B ARG 358 ? CD  ? B ARG 370 CD  
6  1 Y 1 B ARG 358 ? NE  ? B ARG 370 NE  
7  1 Y 1 B ARG 358 ? CZ  ? B ARG 370 CZ  
8  1 Y 1 B ARG 358 ? NH1 ? B ARG 370 NH1 
9  1 Y 1 B ARG 358 ? NH2 ? B ARG 370 NH2 
10 1 Y 1 B GLU 430 ? CG  ? B GLU 442 CG  
11 1 Y 1 B GLU 430 ? CD  ? B GLU 442 CD  
12 1 Y 1 B GLU 430 ? OE1 ? B GLU 442 OE1 
13 1 Y 1 B GLU 430 ? OE2 ? B GLU 442 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE 556 ? A ILE 556 
2  1 Y 1 A ARG 557 ? A ARG 557 
3  1 Y 1 A LYS 558 ? A LYS 558 
4  1 Y 1 A VAL 559 ? A VAL 559 
5  1 Y 1 A LEU 560 ? A LEU 560 
6  1 Y 1 B MET -11 ? B MET 1   
7  1 Y 1 B GLY -10 ? B GLY 2   
8  1 Y 1 B SER -9  ? B SER 3   
9  1 Y 1 B SER -8  ? B SER 4   
10 1 Y 1 B HIS -7  ? B HIS 5   
11 1 Y 1 B HIS -6  ? B HIS 6   
12 1 Y 1 B HIS -5  ? B HIS 7   
13 1 Y 1 B HIS -4  ? B HIS 8   
14 1 Y 1 B HIS -3  ? B HIS 9   
15 1 Y 1 B HIS -2  ? B HIS 10  
16 1 Y 1 B SER -1  ? B SER 11  
17 1 Y 1 B SER 0   ? B SER 12  
18 1 Y 1 B PRO 1   ? B PRO 13  
19 1 Y 1 B ILE 2   ? B ILE 14  
20 1 Y 1 B SER 3   ? B SER 15  
21 1 Y 1 B THR 215 ? B THR 227 
22 1 Y 1 B THR 216 ? B THR 228 
23 1 Y 1 B PRO 217 ? B PRO 229 
24 1 Y 1 B ASP 218 ? B ASP 230 
25 1 Y 1 B LYS 219 ? B LYS 231 
26 1 Y 1 B LYS 220 ? B LYS 232 
27 1 Y 1 B HIS 221 ? B HIS 233 
28 1 Y 1 B GLN 222 ? B GLN 234 
29 1 Y 1 B LYS 223 ? B LYS 235 
30 1 Y 1 B GLU 224 ? B GLU 236 
31 1 Y 1 B PRO 225 ? B PRO 237 
32 1 Y 1 B PRO 226 ? B PRO 238 
33 1 Y 1 B PHE 227 ? B PHE 239 
34 1 Y 1 B LEU 228 ? B LEU 240 
35 1 Y 1 B TRP 229 ? B TRP 241 
36 1 Y 1 B MET 230 ? B MET 242 
37 1 Y 1 B GLY 231 ? B GLY 243 
38 1 Y 1 B GLY 359 ? B GLY 371 
39 1 Y 1 B ALA 360 ? B ALA 372 
40 1 Y 1 B HIS 361 ? B HIS 373 
41 1 Y 1 B LYS 431 ? B LYS 443 
42 1 Y 1 B GLU 432 ? B GLU 444 
43 1 Y 1 B PRO 433 ? B PRO 445 
44 1 Y 1 B ILE 434 ? B ILE 446 
45 1 Y 1 B VAL 435 ? B VAL 447 
46 1 Y 1 B GLY 436 ? B GLY 448 
47 1 Y 1 B ALA 437 ? B ALA 449 
48 1 Y 1 B GLU 438 ? B GLU 450 
49 1 Y 1 B THR 439 ? B THR 451 
50 1 Y 1 B PHE 440 ? B PHE 452 
51 1 Y 1 P DA  802 ? C DA  1   
52 1 Y 1 P DC  803 ? C DC  2   
53 1 Y 1 P DA  804 ? C DA  3   
54 1 Y 1 T DA  701 ? D DA  1   
55 1 Y 1 T DT  702 ? D DT  2   
56 1 Y 1 T DT  726 ? D DT  26  
57 1 Y 1 T DG  727 ? D DG  27  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3KK3 'double helix'        
3KK3 'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 23 1_555 -0.205 -0.150 0.645  5.339   -15.738 -2.788 1  P_DG805:DC723_T P 805 ? T 723 ? 19 1 
1 C DT 5  1_555 D DA 22 1_555 -0.139 -0.130 0.240  -4.854  -21.137 7.084  2  P_DT806:DA722_T P 806 ? T 722 ? 20 1 
1 C DC 6  1_555 D DG 21 1_555 0.085  -0.236 0.372  -7.355  -23.096 0.410  3  P_DC807:DG721_T P 807 ? T 721 ? 19 1 
1 C DC 7  1_555 D DG 20 1_555 -0.029 -0.127 0.584  -6.999  -13.550 0.556  4  P_DC808:DG720_T P 808 ? T 720 ? 19 1 
1 C DC 8  1_555 D DG 19 1_555 0.273  -0.227 0.637  -3.161  -15.551 -0.505 5  P_DC809:DG719_T P 809 ? T 719 ? 19 1 
1 C DT 9  1_555 D DA 18 1_555 -0.118 -0.104 0.045  -3.236  -18.149 4.831  6  P_DT810:DA718_T P 810 ? T 718 ? 20 1 
1 C DG 10 1_555 D DC 17 1_555 0.024  -0.227 0.687  0.392   -17.599 -2.068 7  P_DG811:DC717_T P 811 ? T 717 ? 19 1 
1 C DT 11 1_555 D DA 16 1_555 -0.266 -0.249 0.701  -5.524  -23.963 -4.259 8  P_DT812:DA716_T P 812 ? T 716 ? 20 1 
1 C DT 12 1_555 D DA 15 1_555 -0.200 -0.124 0.345  -4.074  -25.848 2.877  9  P_DT813:DA715_T P 813 ? T 715 ? 20 1 
1 C DC 13 1_555 D DG 14 1_555 0.123  -0.087 0.978  -18.204 -12.393 2.757  10 P_DC814:DG714_T P 814 ? T 714 ? 19 1 
1 C DG 14 1_555 D DC 13 1_555 -0.255 -0.258 0.181  -0.403  -12.675 2.034  11 P_DG815:DC713_T P 815 ? T 713 ? 19 1 
1 C DG 15 1_555 D DC 12 1_555 0.005  -0.276 0.885  13.133  -8.486  3.072  12 P_DG816:DC712_T P 816 ? T 712 ? 19 1 
1 C DG 16 1_555 D DC 11 1_555 -0.147 -0.177 -0.233 0.042   -12.108 -5.351 13 P_DG817:DC711_T P 817 ? T 711 ? 19 1 
1 C DC 17 1_555 D DG 10 1_555 0.045  -0.159 -0.267 3.388   -11.815 4.060  14 P_DC818:DG710_T P 818 ? T 710 ? 19 1 
1 C DG 18 1_555 D DC 9  1_555 -0.372 -0.044 -0.063 -7.178  -10.436 2.842  15 P_DG819:DC709_T P 819 ? T 709 ? 19 1 
1 C DC 19 1_555 D DG 8  1_555 0.300  -0.082 -0.313 -2.802  -10.653 5.962  16 P_DC820:DG708_T P 820 ? T 708 ? 19 1 
1 C DC 20 1_555 D DG 7  1_555 -0.093 -0.121 -0.307 -2.690  -3.456  -1.766 17 P_DC821:DG707_T P 821 ? T 707 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 23 1_555 C DT 5  1_555 D DA 22 1_555 -0.423 -0.852 3.641 6.734  -1.846 37.875 -1.038 1.568  3.553 -2.815 
-10.267 38.490 1  PP_DG805DT806:DA722DC723_TT P 805 ? T 723 ? P 806 ? T 722 ? 
1 C DT 5  1_555 D DA 22 1_555 C DC 6  1_555 D DG 21 1_555 -0.046 -0.479 3.286 -1.434 2.222  35.194 -1.119 -0.136 3.249 3.668  
2.367   35.290 2  PP_DT806DC807:DG721DA722_TT P 806 ? T 722 ? P 807 ? T 721 ? 
1 C DC 6  1_555 D DG 21 1_555 C DC 7  1_555 D DG 20 1_555 0.774  -0.518 3.166 1.883  6.738  31.282 -2.104 -1.076 3.032 12.303 
-3.437  32.036 3  PP_DC807DC808:DG720DG721_TT P 807 ? T 721 ? P 808 ? T 720 ? 
1 C DC 7  1_555 D DG 20 1_555 C DC 8  1_555 D DG 19 1_555 0.368  -0.575 3.068 1.075  9.707  37.627 -1.953 -0.433 2.848 14.747 
-1.633  38.830 4  PP_DC808DC809:DG719DG720_TT P 808 ? T 720 ? P 809 ? T 719 ? 
1 C DC 8  1_555 D DG 19 1_555 C DT 9  1_555 D DA 18 1_555 -0.100 -0.593 3.067 4.306  4.451  30.676 -1.878 0.938  2.914 8.306  
-8.036  31.280 5  PP_DC809DT810:DA718DG719_TT P 809 ? T 719 ? P 810 ? T 718 ? 
1 C DT 9  1_555 D DA 18 1_555 C DG 10 1_555 D DC 17 1_555 0.074  -0.317 3.201 -7.489 2.974  39.063 -0.801 -0.951 3.104 4.391  
11.057  39.854 6  PP_DT810DG811:DC717DA718_TT P 810 ? T 718 ? P 811 ? T 717 ? 
1 C DG 10 1_555 D DC 17 1_555 C DT 11 1_555 D DA 16 1_555 -0.452 -1.423 3.315 -1.926 2.028  30.512 -3.095 0.475  3.237 3.843  
3.650   30.637 7  PP_DG811DT812:DA716DC717_TT P 811 ? T 717 ? P 812 ? T 716 ? 
1 C DT 11 1_555 D DA 16 1_555 C DT 12 1_555 D DA 15 1_555 -0.016 -0.489 3.120 5.417  -2.481 33.950 -0.456 0.836  3.107 -4.208 
-9.189  34.454 8  PP_DT812DT813:DA715DA716_TT P 812 ? T 716 ? P 813 ? T 715 ? 
1 C DT 12 1_555 D DA 15 1_555 C DC 13 1_555 D DG 14 1_555 0.525  0.134  3.623 -4.567 1.221  42.049 0.049  -1.241 3.552 1.695  
6.341   42.302 9  PP_DT813DC814:DG714DA715_TT P 813 ? T 715 ? P 814 ? T 714 ? 
1 C DC 13 1_555 D DG 14 1_555 C DG 14 1_555 D DC 13 1_555 -0.419 0.007  2.816 4.694  1.245  27.733 -0.233 1.798  2.707 2.572  
-9.698  28.147 10 PP_DC814DG815:DC713DG714_TT P 814 ? T 714 ? P 815 ? T 713 ? 
1 C DG 14 1_555 D DC 13 1_555 C DG 15 1_555 D DC 12 1_555 0.297  -0.562 2.836 -7.453 6.897  35.790 -1.658 -1.305 2.577 10.954 
11.837  37.157 11 PP_DG815DG816:DC712DC713_TT P 815 ? T 713 ? P 816 ? T 712 ? 
1 C DG 15 1_555 D DC 12 1_555 C DG 16 1_555 D DC 11 1_555 -1.123 -0.835 3.540 2.194  10.977 34.729 -2.915 2.112  3.070 17.826 
-3.562  36.435 12 PP_DG816DG817:DC711DC712_TT P 816 ? T 712 ? P 817 ? T 711 ? 
1 C DG 16 1_555 D DC 11 1_555 C DC 17 1_555 D DG 10 1_555 0.633  -1.002 3.161 -0.725 7.939  32.689 -2.938 -1.204 2.833 13.850 
1.264   33.621 13 PP_DG817DC818:DG710DC711_TT P 817 ? T 711 ? P 818 ? T 710 ? 
1 C DC 17 1_555 D DG 10 1_555 C DG 18 1_555 D DC 9  1_555 -0.117 -1.348 3.464 -1.711 11.053 31.628 -4.147 -0.077 2.848 19.531 
3.024   33.500 14 PP_DC818DG819:DC709DG710_TT P 818 ? T 710 ? P 819 ? T 709 ? 
1 C DG 18 1_555 D DC 9  1_555 C DC 19 1_555 D DG 8  1_555 0.368  -0.633 3.307 0.907  12.258 33.214 -2.819 -0.475 2.908 20.588 
-1.523  35.355 15 PP_DG819DC820:DG708DC709_TT P 819 ? T 709 ? P 820 ? T 708 ? 
1 C DC 19 1_555 D DG 8  1_555 C DC 20 1_555 D DG 7  1_555 -0.215 -1.818 3.433 -0.242 10.352 25.515 -6.225 0.397  2.518 22.303 
0.522   27.503 16 PP_DC820DC821:DG707DG708_TT P 820 ? T 708 ? P 821 ? T 707 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION' MG  
6 'SULFATE ION'   SO4 
7 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1  601 601 MG  MG  A . 
F 6 SO4 1  3   3   SO4 SO4 P . 
G 6 SO4 1  2   2   SO4 SO4 T . 
H 7 HOH 1  561 1   HOH HOH A . 
H 7 HOH 2  562 2   HOH HOH A . 
H 7 HOH 3  563 3   HOH HOH A . 
H 7 HOH 4  564 4   HOH HOH A . 
H 7 HOH 5  565 5   HOH HOH A . 
H 7 HOH 6  566 7   HOH HOH A . 
H 7 HOH 7  567 11  HOH HOH A . 
H 7 HOH 8  568 13  HOH HOH A . 
H 7 HOH 9  569 14  HOH HOH A . 
H 7 HOH 10 570 16  HOH HOH A . 
H 7 HOH 11 571 19  HOH HOH A . 
H 7 HOH 12 572 20  HOH HOH A . 
H 7 HOH 13 573 25  HOH HOH A . 
H 7 HOH 14 574 26  HOH HOH A . 
H 7 HOH 15 575 28  HOH HOH A . 
I 7 HOH 1  441 8   HOH HOH B . 
I 7 HOH 2  442 10  HOH HOH B . 
I 7 HOH 3  443 21  HOH HOH B . 
I 7 HOH 4  444 24  HOH HOH B . 
J 7 HOH 1  6   6   HOH HOH P . 
J 7 HOH 2  23  23  HOH HOH P . 
K 7 HOH 1  27  27  HOH HOH T . 
#