data_3KLT
# 
_entry.id   3KLT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KLT         
RCSB  RCSB056152   
WWPDB D_1000056152 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KLT 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nicolet, S.'    1 
'Strelkov, S.V.' 2 
# 
_citation.id                        primary 
_citation.title                     'Atomic structure of vimentin coil 2.' 
_citation.journal_abbrev            J.Struct.Biol. 
_citation.journal_volume            170 
_citation.page_first                369 
_citation.page_last                 376 
_citation.year                      2010 
_citation.journal_id_ASTM           JSBIEM 
_citation.country                   US 
_citation.journal_id_ISSN           1047-8477 
_citation.journal_id_CSD            0803 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20176112 
_citation.pdbx_database_id_DOI      10.1016/j.jsb.2010.02.012 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nicolet, S.'    1 
primary 'Herrmann, H.'   2 
primary 'Aebi, U.'       3 
primary 'Strelkov, S.V.' 4 
# 
_cell.entry_id           3KLT 
_cell.length_a           63.200 
_cell.length_b           30.100 
_cell.length_c           82.980 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.71 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KLT 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Vimentin                                8301.084 4 ? ? 'UNP residues 263-334' ? 
2 non-polymer syn 3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL 326.383  1 ? ? ?                      ? 
3 non-polymer syn 'SAMARIUM (III) ION'                    150.360  3 ? ? ?                      ? 
4 non-polymer syn 'HEXAETHYLENE GLYCOL'                   282.331  1 ? ? ?                      ? 
5 non-polymer syn 'CALCIUM ION'                           40.078   6 ? ? ?                      ? 
6 non-polymer syn 'TETRAETHYLENE GLYCOL'                  194.226  2 ? ? ?                      ? 
7 non-polymer syn 'PENTAETHYLENE GLYCOL'                  238.278  1 ? ? ?                      ? 
8 non-polymer syn 'TRIETHYLENE GLYCOL'                    150.173  1 ? ? ?                      ? 
9 water       nat water                                   18.015   7 ? ? ?                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALK 
_entity_poly.pdbx_seq_one_letter_code_can   PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALK 
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  ASP n 
1 3  LEU n 
1 4  THR n 
1 5  ALA n 
1 6  ALA n 
1 7  LEU n 
1 8  ARG n 
1 9  ASP n 
1 10 VAL n 
1 11 ARG n 
1 12 GLN n 
1 13 GLN n 
1 14 TYR n 
1 15 GLU n 
1 16 SER n 
1 17 VAL n 
1 18 ALA n 
1 19 ALA n 
1 20 LYS n 
1 21 ASN n 
1 22 LEU n 
1 23 GLN n 
1 24 GLU n 
1 25 ALA n 
1 26 GLU n 
1 27 GLU n 
1 28 TRP n 
1 29 TYR n 
1 30 LYS n 
1 31 SER n 
1 32 LYS n 
1 33 PHE n 
1 34 ALA n 
1 35 ASP n 
1 36 LEU n 
1 37 SER n 
1 38 GLU n 
1 39 ALA n 
1 40 ALA n 
1 41 ASN n 
1 42 ARG n 
1 43 ASN n 
1 44 ASN n 
1 45 ASP n 
1 46 ALA n 
1 47 LEU n 
1 48 ARG n 
1 49 GLN n 
1 50 ALA n 
1 51 LYS n 
1 52 GLN n 
1 53 GLU n 
1 54 SER n 
1 55 THR n 
1 56 GLU n 
1 57 TYR n 
1 58 ARG n 
1 59 ARG n 
1 60 GLN n 
1 61 VAL n 
1 62 GLN n 
1 63 SER n 
1 64 LEU n 
1 65 THR n 
1 66 CYS n 
1 67 GLU n 
1 68 VAL n 
1 69 ASP n 
1 70 ALA n 
1 71 LEU n 
1 72 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 VIM 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-TEV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VIME_HUMAN 
_struct_ref.pdbx_db_accession          P08670 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALK 
_struct_ref.pdbx_align_begin           263 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KLT A 1 ? 72 ? P08670 263 ? 334 ? 263 334 
2 1 3KLT B 1 ? 72 ? P08670 263 ? 334 ? 263 334 
3 1 3KLT C 1 ? 72 ? P08670 263 ? 334 ? 263 334 
4 1 3KLT D 1 ? 72 ? P08670 263 ? 334 ? 263 334 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL'                  PEG400                         'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                                 ?                              'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ?                              'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ?                              'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ?                              'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                           ?                              'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                ?                              'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                               ?                              'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ?                              'C5 H9 N O4'     147.129 
HOH non-polymer         . WATER                                   ?                              'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE                                 ?                              'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ?                              'C6 H15 N2 O2 1' 147.195 
P33 non-polymer         . 3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL 'HEPTAETHYLENE GLYCOL, PEG330' 'C14 H30 O8'     326.383 
P6G non-polymer         . 'HEXAETHYLENE GLYCOL'                   'POLYETHYLENE GLYCOL PEG400'   'C12 H26 O7'     282.331 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'                  ?                              'C8 H18 O5'      194.226 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                    ?                              'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE                           ?                              'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ?                              'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ?                              'C3 H7 N O3'     105.093 
SM  non-polymer         . 'SAMARIUM (III) ION'                    ?                              'Sm 3'           150.360 
THR 'L-peptide linking' y THREONINE                               ?                              'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ?                              'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ?                              'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ?                              'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3KLT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.density_percent_sol   46.95 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;0.1M Bis-Tris pH 6.5, 27% PEG monoethylether 550, 27mM CaCl2, 7.5% (v/v) glycerol, 10mM DTT , VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-07-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator with dual channel cut crystals (DCCM)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0720 1.0 
2 1.8449 1.0 
3 1.8457 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '1.0720, 1.8449, 1.8457' 
# 
_reflns.entry_id                     3KLT 
_reflns.observed_criterion_sigma_I   2.8 
_reflns.observed_criterion_sigma_F   2.8 
_reflns.d_resolution_low             44.44 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   15461 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.5 
_reflns.pdbx_Rmerge_I_obs            0.039 
_reflns.pdbx_Rsym_value              0.039 
_reflns.pdbx_netI_over_sigmaI        15.2 
_reflns.B_iso_Wilson_estimate        77.5 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3KLT 
_refine.ls_number_reflns_obs                     9176 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.473 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    94.48 
_refine.ls_R_factor_obs                          0.2935 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2910 
_refine.ls_R_factor_R_free                       0.3311 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.88 
_refine.ls_number_reflns_R_free                  909 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -6.1915 
_refine.aniso_B[2][2]                            -1.7878 
_refine.aniso_B[3][3]                            -4.9333 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            1.8148 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.330 
_refine.solvent_model_param_bsol                 43.795 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.94 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 36.77 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2290 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         102 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               2399 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        40.473 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 2404 'X-RAY DIFFRACTION' ? 
f_angle_d          0.369  ? ? 3199 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.511 ? ? 954  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.026  ? ? 339  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.001  ? ? 421  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
6 2.7001 2.8692  2245 0.3513 89.00 0.3954 . . 145 . . . . 'X-RAY DIFFRACTION' 
6 2.8692 3.0907  2403 0.3293 94.00 0.3740 . . 179 . . . . 'X-RAY DIFFRACTION' 
6 3.0907 3.4015  2486 0.3063 95.00 0.3871 . . 111 . . . . 'X-RAY DIFFRACTION' 
6 3.4015 3.8934  2484 0.2623 96.00 0.2995 . . 124 . . . . 'X-RAY DIFFRACTION' 
6 3.8934 4.9039  2487 0.2483 97.00 0.2971 . . 173 . . . . 'X-RAY DIFFRACTION' 
6 4.9039 40.4779 2447 0.2971 97.00 0.3202 . . 177 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KLT 
_struct.title                     'Crystal structure of a vimentin fragment' 
_struct.pdbx_descriptor           Vimentin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KLT 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
'2A, L2, alpha-helix, coiled-coil, parallel helices, Coiled coil, Intermediate filament, vimentin, STRUCTURAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 5 ? 
N N N 7 ? 
O N N 8 ? 
P N N 3 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 9 ? 
U N N 9 ? 
V N N 9 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 2 ? ALA A 70 ? ASP A 264 ALA A 332 1 ? 69 
HELX_P HELX_P2 2 ASP B 2 ? LYS B 72 ? ASP B 264 LYS B 334 1 ? 71 
HELX_P HELX_P3 3 ASP C 2 ? ASP C 69 ? ASP C 264 ASP C 331 1 ? 68 
HELX_P HELX_P4 4 LEU D 3 ? LEU D 71 ? LEU D 265 LEU D 333 1 ? 69 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           H 
_struct_conn.ptnr1_label_comp_id           SM 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           SM 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           N 
_struct_conn.ptnr2_label_comp_id           1PE 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           OH7 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            SM 
_struct_conn.ptnr1_auth_seq_id             1 
_struct_conn.ptnr2_auth_asym_id            D 
_struct_conn.ptnr2_auth_comp_id            1PE 
_struct_conn.ptnr2_auth_seq_id             3 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               3.479 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE P33 A 1' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE P6G B 4' 
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SM B 1'  
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PG4 C 2' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PG4 C 5' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 1PE D 3' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PGE D 6' 
AC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CA D 8'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  ALA A 18 ? ALA A 280 . ? 1_555 ? 
2  AC1 9  ASN A 21 ? ASN A 283 . ? 1_555 ? 
3  AC1 9  GLU A 24 ? GLU A 286 . ? 1_555 ? 
4  AC1 9  ALA A 25 ? ALA A 287 . ? 1_555 ? 
5  AC1 9  PG4 K .  ? PG4 C 2   . ? 1_555 ? 
6  AC1 9  ASN C 21 ? ASN C 283 . ? 1_555 ? 
7  AC1 9  GLU C 24 ? GLU C 286 . ? 1_555 ? 
8  AC1 9  TRP C 28 ? TRP C 290 . ? 1_555 ? 
9  AC1 9  TYR C 29 ? TYR C 291 . ? 1_555 ? 
10 AC2 8  VAL B 17 ? VAL B 279 . ? 1_555 ? 
11 AC2 8  ALA B 18 ? ALA B 280 . ? 1_555 ? 
12 AC2 8  ASN B 21 ? ASN B 283 . ? 1_555 ? 
13 AC2 8  PG4 K .  ? PG4 C 2   . ? 1_555 ? 
14 AC2 8  1PE N .  ? 1PE D 3   . ? 1_555 ? 
15 AC2 8  ASN D 21 ? ASN D 283 . ? 1_555 ? 
16 AC2 8  ALA D 25 ? ALA D 287 . ? 1_555 ? 
17 AC2 8  TYR D 29 ? TYR D 291 . ? 1_555 ? 
18 AC3 1  1PE N .  ? 1PE D 3   . ? 1_555 ? 
19 AC4 10 P33 E .  ? P33 A 1   . ? 1_555 ? 
20 AC4 10 GLU A 24 ? GLU A 286 . ? 1_555 ? 
21 AC4 10 ALA A 25 ? ALA A 287 . ? 1_555 ? 
22 AC4 10 TYR A 29 ? TYR A 291 . ? 1_555 ? 
23 AC4 10 P6G G .  ? P6G B 4   . ? 1_555 ? 
24 AC4 10 TYR C 14 ? TYR C 276 . ? 1_555 ? 
25 AC4 10 VAL C 17 ? VAL C 279 . ? 1_555 ? 
26 AC4 10 ALA C 18 ? ALA C 280 . ? 1_555 ? 
27 AC4 10 ASN C 21 ? ASN C 283 . ? 1_555 ? 
28 AC4 10 LEU C 22 ? LEU C 284 . ? 1_555 ? 
29 AC5 3  PHE B 33 ? PHE B 295 . ? 1_555 ? 
30 AC5 3  ARG C 11 ? ARG C 273 . ? 1_555 ? 
31 AC5 3  GLU C 15 ? GLU C 277 . ? 1_555 ? 
32 AC6 9  SM  H .  ? SM  B 1   . ? 1_555 ? 
33 AC6 9  P6G G .  ? P6G B 4   . ? 1_555 ? 
34 AC6 9  GLU B 24 ? GLU B 286 . ? 1_555 ? 
35 AC6 9  TRP B 28 ? TRP B 290 . ? 1_555 ? 
36 AC6 9  TYR B 29 ? TYR B 291 . ? 1_555 ? 
37 AC6 9  TYR D 14 ? TYR D 276 . ? 1_555 ? 
38 AC6 9  VAL D 17 ? VAL D 279 . ? 1_555 ? 
39 AC6 9  ALA D 18 ? ALA D 280 . ? 1_555 ? 
40 AC6 9  ASN D 21 ? ASN D 283 . ? 1_555 ? 
41 AC7 2  GLU C 27 ? GLU C 289 . ? 1_565 ? 
42 AC7 2  GLU D 24 ? GLU D 286 . ? 1_555 ? 
43 AC8 1  LYS D 32 ? LYS D 294 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KLT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KLT 
_atom_sites.fract_transf_matrix[1][1]   0.015823 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003569 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.033223 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012354 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
SM 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 2  ? 13.913  1.858  55.412  1.00 39.04  ? 264 ASP A N   1 
ATOM   2    C  CA  . ASP A 1 2  ? 13.834  3.196  54.835  1.00 54.62  ? 264 ASP A CA  1 
ATOM   3    C  C   . ASP A 1 2  ? 13.332  4.210  55.862  1.00 59.10  ? 264 ASP A C   1 
ATOM   4    O  O   . ASP A 1 2  ? 12.188  4.134  56.309  1.00 56.62  ? 264 ASP A O   1 
ATOM   5    C  CB  . ASP A 1 2  ? 12.921  3.189  53.609  1.00 49.03  ? 264 ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 2  ? 12.930  4.508  52.868  1.00 53.19  ? 264 ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 2  ? 13.719  5.399  53.246  1.00 57.58  ? 264 ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 2  ? 12.149  4.652  51.905  1.00 55.62  ? 264 ASP A OD2 1 
ATOM   9    N  N   . LEU A 1 3  ? 14.187  5.161  56.227  1.00 58.32  ? 265 LEU A N   1 
ATOM   10   C  CA  . LEU A 1 3  ? 13.855  6.128  57.271  1.00 47.93  ? 265 LEU A CA  1 
ATOM   11   C  C   . LEU A 1 3  ? 12.598  6.931  56.925  1.00 51.72  ? 265 LEU A C   1 
ATOM   12   O  O   . LEU A 1 3  ? 11.687  7.048  57.744  1.00 44.55  ? 265 LEU A O   1 
ATOM   13   C  CB  . LEU A 1 3  ? 15.038  7.067  57.534  1.00 50.52  ? 265 LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 3  ? 15.339  7.455  58.987  1.00 66.52  ? 265 LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 3  ? 16.417  8.532  59.056  1.00 34.42  ? 265 LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 3  ? 14.083  7.916  59.702  1.00 41.89  ? 265 LEU A CD2 1 
ATOM   17   N  N   . THR A 1 4  ? 12.552  7.481  55.714  1.00 54.34  ? 266 THR A N   1 
ATOM   18   C  CA  . THR A 1 4  ? 11.386  8.237  55.260  1.00 31.29  ? 266 THR A CA  1 
ATOM   19   C  C   . THR A 1 4  ? 10.115  7.395  55.320  1.00 34.10  ? 266 THR A C   1 
ATOM   20   O  O   . THR A 1 4  ? 9.081   7.847  55.811  1.00 50.38  ? 266 THR A O   1 
ATOM   21   C  CB  . THR A 1 4  ? 11.567  8.771  53.822  1.00 39.44  ? 266 THR A CB  1 
ATOM   22   O  OG1 . THR A 1 4  ? 12.327  9.985  53.852  1.00 38.20  ? 266 THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 4  ? 10.214  9.057  53.185  1.00 29.64  ? 266 THR A CG2 1 
ATOM   24   N  N   . ALA A 1 5  ? 10.202  6.168  54.817  1.00 36.38  ? 267 ALA A N   1 
ATOM   25   C  CA  . ALA A 1 5  ? 9.059   5.261  54.805  1.00 51.24  ? 267 ALA A CA  1 
ATOM   26   C  C   . ALA A 1 5  ? 8.667   4.845  56.217  1.00 46.76  ? 267 ALA A C   1 
ATOM   27   O  O   . ALA A 1 5  ? 7.486   4.661  56.515  1.00 30.91  ? 267 ALA A O   1 
ATOM   28   C  CB  . ALA A 1 5  ? 9.362   4.035  53.960  1.00 70.57  ? 267 ALA A CB  1 
ATOM   29   N  N   . ALA A 1 6  ? 9.667   4.697  57.080  1.00 32.51  ? 268 ALA A N   1 
ATOM   30   C  CA  . ALA A 1 6  ? 9.438   4.313  58.468  1.00 26.26  ? 268 ALA A CA  1 
ATOM   31   C  C   . ALA A 1 6  ? 8.868   5.480  59.272  1.00 40.06  ? 268 ALA A C   1 
ATOM   32   O  O   . ALA A 1 6  ? 7.967   5.302  60.092  1.00 42.45  ? 268 ALA A O   1 
ATOM   33   C  CB  . ALA A 1 6  ? 10.727  3.807  59.096  1.00 29.25  ? 268 ALA A CB  1 
ATOM   34   N  N   . LEU A 1 7  ? 9.398   6.675  59.032  1.00 42.63  ? 269 LEU A N   1 
ATOM   35   C  CA  . LEU A 1 7  ? 8.897   7.875  59.690  1.00 51.08  ? 269 LEU A CA  1 
ATOM   36   C  C   . LEU A 1 7  ? 7.409   8.039  59.425  1.00 46.17  ? 269 LEU A C   1 
ATOM   37   O  O   . LEU A 1 7  ? 6.634   8.308  60.342  1.00 35.83  ? 269 LEU A O   1 
ATOM   38   C  CB  . LEU A 1 7  ? 9.655   9.116  59.212  1.00 37.33  ? 269 LEU A CB  1 
ATOM   39   C  CG  . LEU A 1 7  ? 10.989  9.421  59.900  1.00 31.09  ? 269 LEU A CG  1 
ATOM   40   C  CD1 . LEU A 1 7  ? 11.674  10.617 59.254  1.00 40.94  ? 269 LEU A CD1 1 
ATOM   41   C  CD2 . LEU A 1 7  ? 10.794  9.657  61.391  1.00 16.87  ? 269 LEU A CD2 1 
ATOM   42   N  N   . ARG A 1 8  ? 7.018   7.878  58.164  1.00 42.14  ? 270 ARG A N   1 
ATOM   43   C  CA  . ARG A 1 8  ? 5.616   7.976  57.779  1.00 56.02  ? 270 ARG A CA  1 
ATOM   44   C  C   . ARG A 1 8  ? 4.789   6.906  58.487  1.00 49.99  ? 270 ARG A C   1 
ATOM   45   O  O   . ARG A 1 8  ? 3.687   7.173  58.966  1.00 51.73  ? 270 ARG A O   1 
ATOM   46   C  CB  . ARG A 1 8  ? 5.463   7.851  56.261  1.00 56.15  ? 270 ARG A CB  1 
ATOM   47   C  CG  . ARG A 1 8  ? 4.037   8.018  55.764  1.00 48.19  ? 270 ARG A CG  1 
ATOM   48   C  CD  . ARG A 1 8  ? 3.955   7.890  54.252  1.00 58.17  ? 270 ARG A CD  1 
ATOM   49   N  NE  . ARG A 1 8  ? 4.789   8.880  53.579  1.00 77.44  ? 270 ARG A NE  1 
ATOM   50   C  CZ  . ARG A 1 8  ? 5.992   8.626  53.073  1.00 66.32  ? 270 ARG A CZ  1 
ATOM   51   N  NH1 . ARG A 1 8  ? 6.504   7.406  53.160  1.00 63.08  ? 270 ARG A NH1 1 
ATOM   52   N  NH2 . ARG A 1 8  ? 6.680   9.590  52.478  1.00 54.65  ? 270 ARG A NH2 1 
ATOM   53   N  N   . ASP A 1 9  ? 5.333   5.696  58.557  1.00 46.55  ? 271 ASP A N   1 
ATOM   54   C  CA  . ASP A 1 9  ? 4.670   4.595  59.244  1.00 41.05  ? 271 ASP A CA  1 
ATOM   55   C  C   . ASP A 1 9  ? 4.405   4.953  60.702  1.00 57.49  ? 271 ASP A C   1 
ATOM   56   O  O   . ASP A 1 9  ? 3.258   4.950  61.155  1.00 46.05  ? 271 ASP A O   1 
ATOM   57   C  CB  . ASP A 1 9  ? 5.526   3.330  59.161  1.00 41.04  ? 271 ASP A CB  1 
ATOM   58   C  CG  . ASP A 1 9  ? 4.890   2.146  59.859  1.00 67.46  ? 271 ASP A CG  1 
ATOM   59   O  OD1 . ASP A 1 9  ? 3.650   2.135  60.007  1.00 71.35  ? 271 ASP A OD1 1 
ATOM   60   O  OD2 . ASP A 1 9  ? 5.633   1.225  60.258  1.00 64.51  ? 271 ASP A OD2 1 
ATOM   61   N  N   . VAL A 1 10 ? 5.474   5.267  61.429  1.00 56.90  ? 272 VAL A N   1 
ATOM   62   C  CA  . VAL A 1 10 ? 5.373   5.624  62.842  1.00 34.77  ? 272 VAL A CA  1 
ATOM   63   C  C   . VAL A 1 10 ? 4.434   6.808  63.055  1.00 48.04  ? 272 VAL A C   1 
ATOM   64   O  O   . VAL A 1 10 ? 3.609   6.801  63.967  1.00 42.54  ? 272 VAL A O   1 
ATOM   65   C  CB  . VAL A 1 10 ? 6.754   5.961  63.438  1.00 27.92  ? 272 VAL A CB  1 
ATOM   66   C  CG1 . VAL A 1 10 ? 6.610   6.479  64.857  1.00 17.84  ? 272 VAL A CG1 1 
ATOM   67   C  CG2 . VAL A 1 10 ? 7.660   4.739  63.402  1.00 44.04  ? 272 VAL A CG2 1 
ATOM   68   N  N   . ARG A 1 11 ? 4.566   7.822  62.207  1.00 46.27  ? 273 ARG A N   1 
ATOM   69   C  CA  . ARG A 1 11 ? 3.723   9.010  62.286  1.00 31.79  ? 273 ARG A CA  1 
ATOM   70   C  C   . ARG A 1 11 ? 2.248   8.636  62.248  1.00 41.84  ? 273 ARG A C   1 
ATOM   71   O  O   . ARG A 1 11 ? 1.432   9.234  62.948  1.00 51.48  ? 273 ARG A O   1 
ATOM   72   C  CB  . ARG A 1 11 ? 4.045   9.975  61.141  1.00 44.81  ? 273 ARG A CB  1 
ATOM   73   C  CG  . ARG A 1 11 ? 3.105   11.170 61.047  1.00 44.62  ? 273 ARG A CG  1 
ATOM   74   C  CD  . ARG A 1 11 ? 3.206   12.052 62.278  1.00 67.71  ? 273 ARG A CD  1 
ATOM   75   N  NE  . ARG A 1 11 ? 2.267   13.169 62.232  1.00 70.13  ? 273 ARG A NE  1 
ATOM   76   C  CZ  . ARG A 1 11 ? 2.143   14.078 63.194  1.00 66.07  ? 273 ARG A CZ  1 
ATOM   77   N  NH1 . ARG A 1 11 ? 2.901   14.003 64.281  1.00 51.84  ? 273 ARG A NH1 1 
ATOM   78   N  NH2 . ARG A 1 11 ? 1.262   15.061 63.071  1.00 54.73  ? 273 ARG A NH2 1 
ATOM   79   N  N   . GLN A 1 12 ? 1.914   7.649  61.423  1.00 50.83  ? 274 GLN A N   1 
ATOM   80   C  CA  . GLN A 1 12 ? 0.535   7.189  61.299  1.00 57.68  ? 274 GLN A CA  1 
ATOM   81   C  C   . GLN A 1 12 ? 0.107   6.416  62.539  1.00 39.23  ? 274 GLN A C   1 
ATOM   82   O  O   . GLN A 1 12 ? -1.007  6.587  63.034  1.00 47.47  ? 274 GLN A O   1 
ATOM   83   C  CB  . GLN A 1 12 ? 0.367   6.316  60.055  1.00 45.74  ? 274 GLN A CB  1 
ATOM   84   C  CG  . GLN A 1 12 ? 0.687   7.025  58.753  1.00 65.69  ? 274 GLN A CG  1 
ATOM   85   C  CD  . GLN A 1 12 ? 0.867   6.062  57.594  1.00 94.97  ? 274 GLN A CD  1 
ATOM   86   O  OE1 . GLN A 1 12 ? 0.660   4.856  57.734  1.00 86.66  ? 274 GLN A OE1 1 
ATOM   87   N  NE2 . GLN A 1 12 ? 1.255   6.593  56.441  1.00 79.71  ? 274 GLN A NE2 1 
ATOM   88   N  N   . GLN A 1 13 ? 0.998   5.566  63.038  1.00 33.50  ? 275 GLN A N   1 
ATOM   89   C  CA  . GLN A 1 13 ? 0.720   4.787  64.238  1.00 47.16  ? 275 GLN A CA  1 
ATOM   90   C  C   . GLN A 1 13 ? 0.484   5.692  65.444  1.00 45.67  ? 275 GLN A C   1 
ATOM   91   O  O   . GLN A 1 13 ? -0.371  5.410  66.284  1.00 41.71  ? 275 GLN A O   1 
ATOM   92   C  CB  . GLN A 1 13 ? 1.865   3.814  64.526  1.00 40.65  ? 275 GLN A CB  1 
ATOM   93   C  CG  . GLN A 1 13 ? 2.199   2.882  63.372  1.00 41.62  ? 275 GLN A CG  1 
ATOM   94   C  CD  . GLN A 1 13 ? 3.299   1.896  63.720  1.00 56.73  ? 275 GLN A CD  1 
ATOM   95   O  OE1 . GLN A 1 13 ? 3.221   1.192  64.728  1.00 48.57  ? 275 GLN A OE1 1 
ATOM   96   N  NE2 . GLN A 1 13 ? 4.328   1.837  62.883  1.00 55.94  ? 275 GLN A NE2 1 
ATOM   97   N  N   . TYR A 1 14 ? 1.246   6.780  65.523  1.00 39.90  ? 276 TYR A N   1 
ATOM   98   C  CA  . TYR A 1 14 ? 1.095   7.735  66.613  1.00 42.31  ? 276 TYR A CA  1 
ATOM   99   C  C   . TYR A 1 14 ? -0.255  8.438  66.540  1.00 45.44  ? 276 TYR A C   1 
ATOM   100  O  O   . TYR A 1 14 ? -0.942  8.586  67.547  1.00 47.63  ? 276 TYR A O   1 
ATOM   101  C  CB  . TYR A 1 14 ? 2.218   8.773  66.598  1.00 57.47  ? 276 TYR A CB  1 
ATOM   102  C  CG  . TYR A 1 14 ? 1.941   9.939  67.518  1.00 52.17  ? 276 TYR A CG  1 
ATOM   103  C  CD1 . TYR A 1 14 ? 2.152   9.830  68.885  1.00 55.62  ? 276 TYR A CD1 1 
ATOM   104  C  CD2 . TYR A 1 14 ? 1.448   11.141 67.023  1.00 51.77  ? 276 TYR A CD2 1 
ATOM   105  C  CE1 . TYR A 1 14 ? 1.890   10.882 69.733  1.00 49.78  ? 276 TYR A CE1 1 
ATOM   106  C  CE2 . TYR A 1 14 ? 1.184   12.202 67.865  1.00 37.66  ? 276 TYR A CE2 1 
ATOM   107  C  CZ  . TYR A 1 14 ? 1.407   12.065 69.221  1.00 53.21  ? 276 TYR A CZ  1 
ATOM   108  O  OH  . TYR A 1 14 ? 1.148   13.110 70.076  1.00 48.81  ? 276 TYR A OH  1 
ATOM   109  N  N   . GLU A 1 15 ? -0.627  8.876  65.342  1.00 54.86  ? 277 GLU A N   1 
ATOM   110  C  CA  . GLU A 1 15 ? -1.912  9.532  65.145  1.00 44.35  ? 277 GLU A CA  1 
ATOM   111  C  C   . GLU A 1 15 ? -3.043  8.544  65.386  1.00 47.47  ? 277 GLU A C   1 
ATOM   112  O  O   . GLU A 1 15 ? -4.133  8.926  65.812  1.00 60.09  ? 277 GLU A O   1 
ATOM   113  C  CB  . GLU A 1 15 ? -2.013  10.120 63.737  1.00 62.24  ? 277 GLU A CB  1 
ATOM   114  C  CG  . GLU A 1 15 ? -1.143  11.346 63.506  1.00 64.52  ? 277 GLU A CG  1 
ATOM   115  C  CD  . GLU A 1 15 ? -1.329  11.937 62.119  1.00 91.24  ? 277 GLU A CD  1 
ATOM   116  O  OE1 . GLU A 1 15 ? -1.873  11.234 61.240  1.00 93.87  ? 277 GLU A OE1 1 
ATOM   117  O  OE2 . GLU A 1 15 ? -0.931  13.103 61.906  1.00 85.03  ? 277 GLU A OE2 1 
ATOM   118  N  N   . SER A 1 16 ? -2.775  7.272  65.111  1.00 28.43  ? 278 SER A N   1 
ATOM   119  C  CA  . SER A 1 16 ? -3.761  6.221  65.320  1.00 38.28  ? 278 SER A CA  1 
ATOM   120  C  C   . SER A 1 16 ? -4.088  6.055  66.799  1.00 56.58  ? 278 SER A C   1 
ATOM   121  O  O   . SER A 1 16 ? -5.249  6.120  67.202  1.00 56.01  ? 278 SER A O   1 
ATOM   122  C  CB  . SER A 1 16 ? -3.257  4.893  64.755  1.00 40.78  ? 278 SER A CB  1 
ATOM   123  O  OG  . SER A 1 16 ? -4.120  3.829  65.116  1.00 45.50  ? 278 SER A OG  1 
ATOM   124  N  N   . VAL A 1 17 ? -3.053  5.838  67.603  1.00 49.28  ? 279 VAL A N   1 
ATOM   125  C  CA  . VAL A 1 17 ? -3.227  5.593  69.029  1.00 55.87  ? 279 VAL A CA  1 
ATOM   126  C  C   . VAL A 1 17 ? -3.568  6.868  69.793  1.00 56.20  ? 279 VAL A C   1 
ATOM   127  O  O   . VAL A 1 17 ? -4.442  6.863  70.660  1.00 43.25  ? 279 VAL A O   1 
ATOM   128  C  CB  . VAL A 1 17 ? -1.970  4.962  69.648  1.00 38.98  ? 279 VAL A CB  1 
ATOM   129  C  CG1 . VAL A 1 17 ? -2.264  4.493  71.062  1.00 41.34  ? 279 VAL A CG1 1 
ATOM   130  C  CG2 . VAL A 1 17 ? -1.486  3.807  68.791  1.00 56.24  ? 279 VAL A CG2 1 
ATOM   131  N  N   . ALA A 1 18 ? -2.877  7.957  69.470  1.00 33.90  ? 280 ALA A N   1 
ATOM   132  C  CA  . ALA A 1 18 ? -3.091  9.228  70.155  1.00 39.70  ? 280 ALA A CA  1 
ATOM   133  C  C   . ALA A 1 18 ? -4.569  9.600  70.188  1.00 50.63  ? 280 ALA A C   1 
ATOM   134  O  O   . ALA A 1 18 ? -5.040  10.213 71.147  1.00 56.02  ? 280 ALA A O   1 
ATOM   135  C  CB  . ALA A 1 18 ? -2.275  10.333 69.506  1.00 27.74  ? 280 ALA A CB  1 
ATOM   136  N  N   . ALA A 1 19 ? -5.296  9.227  69.139  1.00 49.54  ? 281 ALA A N   1 
ATOM   137  C  CA  . ALA A 1 19 ? -6.730  9.485  69.075  1.00 50.74  ? 281 ALA A CA  1 
ATOM   138  C  C   . ALA A 1 19 ? -7.497  8.525  69.983  1.00 63.98  ? 281 ALA A C   1 
ATOM   139  O  O   . ALA A 1 19 ? -8.396  8.935  70.717  1.00 57.10  ? 281 ALA A O   1 
ATOM   140  C  CB  . ALA A 1 19 ? -7.226  9.379  67.642  1.00 63.93  ? 281 ALA A CB  1 
ATOM   141  N  N   . LYS A 1 20 ? -7.138  7.245  69.929  1.00 29.65  ? 282 LYS A N   1 
ATOM   142  C  CA  . LYS A 1 20 ? -7.752  6.245  70.793  1.00 37.15  ? 282 LYS A CA  1 
ATOM   143  C  C   . LYS A 1 20 ? -7.566  6.618  72.260  1.00 56.51  ? 282 LYS A C   1 
ATOM   144  O  O   . LYS A 1 20 ? -8.536  6.716  73.013  1.00 47.39  ? 282 LYS A O   1 
ATOM   145  C  CB  . LYS A 1 20 ? -7.165  4.855  70.527  1.00 30.50  ? 282 LYS A CB  1 
ATOM   146  C  CG  . LYS A 1 20 ? -7.364  3.880  71.683  1.00 45.40  ? 282 LYS A CG  1 
ATOM   147  C  CD  . LYS A 1 20 ? -6.703  2.538  71.413  1.00 75.35  ? 282 LYS A CD  1 
ATOM   148  C  CE  . LYS A 1 20 ? -7.531  1.691  70.464  1.00 82.78  ? 282 LYS A CE  1 
ATOM   149  N  NZ  . LYS A 1 20 ? -7.020  0.294  70.396  1.00 96.78  ? 282 LYS A NZ  1 
ATOM   150  N  N   . ASN A 1 21 ? -6.312  6.822  72.654  1.00 54.61  ? 283 ASN A N   1 
ATOM   151  C  CA  . ASN A 1 21 ? -5.976  7.174  74.029  1.00 37.33  ? 283 ASN A CA  1 
ATOM   152  C  C   . ASN A 1 21 ? -6.692  8.435  74.497  1.00 47.97  ? 283 ASN A C   1 
ATOM   153  O  O   . ASN A 1 21 ? -7.182  8.502  75.625  1.00 46.59  ? 283 ASN A O   1 
ATOM   154  C  CB  . ASN A 1 21 ? -4.462  7.342  74.183  1.00 39.27  ? 283 ASN A CB  1 
ATOM   155  C  CG  . ASN A 1 21 ? -3.729  6.015  74.220  1.00 43.39  ? 283 ASN A CG  1 
ATOM   156  O  OD1 . ASN A 1 21 ? -4.340  4.963  74.404  1.00 36.22  ? 283 ASN A OD1 1 
ATOM   157  N  ND2 . ASN A 1 21 ? -2.412  6.058  74.049  1.00 43.66  ? 283 ASN A ND2 1 
ATOM   158  N  N   . LEU A 1 22 ? -6.747  9.432  73.621  1.00 48.89  ? 284 LEU A N   1 
ATOM   159  C  CA  . LEU A 1 22 ? -7.430  10.684 73.925  1.00 41.75  ? 284 LEU A CA  1 
ATOM   160  C  C   . LEU A 1 22 ? -8.892  10.450 74.295  1.00 43.32  ? 284 LEU A C   1 
ATOM   161  O  O   . LEU A 1 22 ? -9.530  11.304 74.905  1.00 48.33  ? 284 LEU A O   1 
ATOM   162  C  CB  . LEU A 1 22 ? -7.335  11.645 72.739  1.00 50.21  ? 284 LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 22 ? -8.041  12.993 72.899  1.00 78.65  ? 284 LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 22 ? -7.633  13.670 74.203  1.00 63.82  ? 284 LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 22 ? -7.761  13.891 71.702  1.00 51.06  ? 284 LEU A CD2 1 
ATOM   166  N  N   . GLN A 1 23 ? -9.418  9.287  73.925  1.00 47.83  ? 285 GLN A N   1 
ATOM   167  C  CA  . GLN A 1 23 ? -10.807 8.950  74.217  1.00 63.32  ? 285 GLN A CA  1 
ATOM   168  C  C   . GLN A 1 23 ? -10.929 8.084  75.466  1.00 64.29  ? 285 GLN A C   1 
ATOM   169  O  O   . GLN A 1 23 ? -11.834 8.282  76.277  1.00 60.63  ? 285 GLN A O   1 
ATOM   170  C  CB  . GLN A 1 23 ? -11.458 8.257  73.017  1.00 77.56  ? 285 GLN A CB  1 
ATOM   171  C  CG  . GLN A 1 23 ? -11.766 9.192  71.856  1.00 88.87  ? 285 GLN A CG  1 
ATOM   172  C  CD  . GLN A 1 23 ? -12.753 10.282 72.234  1.00 108.79 ? 285 GLN A CD  1 
ATOM   173  O  OE1 . GLN A 1 23 ? -13.514 10.141 73.192  1.00 103.13 ? 285 GLN A OE1 1 
ATOM   174  N  NE2 . GLN A 1 23 ? -12.748 11.375 71.479  1.00 98.52  ? 285 GLN A NE2 1 
ATOM   175  N  N   . GLU A 1 24 ? -10.020 7.126  75.619  1.00 44.63  ? 286 GLU A N   1 
ATOM   176  C  CA  . GLU A 1 24 ? -10.022 6.272  76.801  1.00 60.74  ? 286 GLU A CA  1 
ATOM   177  C  C   . GLU A 1 24 ? -9.763  7.088  78.064  1.00 69.64  ? 286 GLU A C   1 
ATOM   178  O  O   . GLU A 1 24 ? -10.033 6.630  79.175  1.00 77.77  ? 286 GLU A O   1 
ATOM   179  C  CB  . GLU A 1 24 ? -8.979  5.161  76.672  1.00 66.36  ? 286 GLU A CB  1 
ATOM   180  C  CG  . GLU A 1 24 ? -9.332  4.080  75.666  1.00 82.13  ? 286 GLU A CG  1 
ATOM   181  C  CD  . GLU A 1 24 ? -8.268  3.003  75.571  1.00 100.53 ? 286 GLU A CD  1 
ATOM   182  O  OE1 . GLU A 1 24 ? -7.077  3.314  75.790  1.00 83.88  ? 286 GLU A OE1 1 
ATOM   183  O  OE2 . GLU A 1 24 ? -8.623  1.844  75.271  1.00 105.10 ? 286 GLU A OE2 1 
ATOM   184  N  N   . ALA A 1 25 ? -9.237  8.297  77.886  1.00 58.91  ? 287 ALA A N   1 
ATOM   185  C  CA  . ALA A 1 25 ? -8.965  9.193  79.005  1.00 49.56  ? 287 ALA A CA  1 
ATOM   186  C  C   . ALA A 1 25 ? -10.047 10.262 79.116  1.00 68.77  ? 287 ALA A C   1 
ATOM   187  O  O   . ALA A 1 25 ? -10.448 10.645 80.214  1.00 78.49  ? 287 ALA A O   1 
ATOM   188  C  CB  . ALA A 1 25 ? -7.600  9.838  78.845  1.00 60.86  ? 287 ALA A CB  1 
ATOM   189  N  N   . GLU A 1 26 ? -10.510 10.748 77.969  1.00 69.65  ? 288 GLU A N   1 
ATOM   190  C  CA  . GLU A 1 26 ? -11.574 11.744 77.935  1.00 58.36  ? 288 GLU A CA  1 
ATOM   191  C  C   . GLU A 1 26 ? -12.852 11.174 78.533  1.00 53.25  ? 288 GLU A C   1 
ATOM   192  O  O   . GLU A 1 26 ? -13.642 11.902 79.132  1.00 57.31  ? 288 GLU A O   1 
ATOM   193  C  CB  . GLU A 1 26 ? -11.820 12.221 76.503  1.00 67.73  ? 288 GLU A CB  1 
ATOM   194  C  CG  . GLU A 1 26 ? -12.870 13.311 76.367  1.00 67.84  ? 288 GLU A CG  1 
ATOM   195  C  CD  . GLU A 1 26 ? -12.865 13.948 74.989  1.00 99.30  ? 288 GLU A CD  1 
ATOM   196  O  OE1 . GLU A 1 26 ? -13.917 13.927 74.317  1.00 107.69 ? 288 GLU A OE1 1 
ATOM   197  O  OE2 . GLU A 1 26 ? -11.803 14.458 74.572  1.00 68.02  ? 288 GLU A OE2 1 
ATOM   198  N  N   . GLU A 1 27 ? -13.049 9.869  78.368  1.00 53.05  ? 289 GLU A N   1 
ATOM   199  C  CA  . GLU A 1 27 ? -14.207 9.192  78.937  1.00 55.63  ? 289 GLU A CA  1 
ATOM   200  C  C   . GLU A 1 27 ? -13.966 8.867  80.402  1.00 64.69  ? 289 GLU A C   1 
ATOM   201  O  O   . GLU A 1 27 ? -14.838 9.074  81.244  1.00 75.18  ? 289 GLU A O   1 
ATOM   202  C  CB  . GLU A 1 27 ? -14.517 7.907  78.168  1.00 84.99  ? 289 GLU A CB  1 
ATOM   203  C  CG  . GLU A 1 27 ? -14.979 8.138  76.740  1.00 113.96 ? 289 GLU A CG  1 
ATOM   204  C  CD  . GLU A 1 27 ? -15.312 6.845  76.018  1.00 129.36 ? 289 GLU A CD  1 
ATOM   205  O  OE1 . GLU A 1 27 ? -14.997 5.763  76.557  1.00 119.26 ? 289 GLU A OE1 1 
ATOM   206  O  OE2 . GLU A 1 27 ? -15.886 6.911  74.911  1.00 124.94 ? 289 GLU A OE2 1 
ATOM   207  N  N   . TRP A 1 28 ? -12.776 8.358  80.698  1.00 75.05  ? 290 TRP A N   1 
ATOM   208  C  CA  . TRP A 1 28 ? -12.411 7.997  82.062  1.00 73.20  ? 290 TRP A CA  1 
ATOM   209  C  C   . TRP A 1 28 ? -12.507 9.197  83.004  1.00 63.89  ? 290 TRP A C   1 
ATOM   210  O  O   . TRP A 1 28 ? -13.217 9.153  84.008  1.00 41.85  ? 290 TRP A O   1 
ATOM   211  C  CB  . TRP A 1 28 ? -11.000 7.410  82.093  1.00 41.07  ? 290 TRP A CB  1 
ATOM   212  C  CG  . TRP A 1 28 ? -10.668 6.711  83.370  1.00 63.14  ? 290 TRP A CG  1 
ATOM   213  C  CD1 . TRP A 1 28 ? -10.823 5.383  83.642  1.00 64.24  ? 290 TRP A CD1 1 
ATOM   214  C  CD2 . TRP A 1 28 ? -10.120 7.301  84.555  1.00 65.15  ? 290 TRP A CD2 1 
ATOM   215  N  NE1 . TRP A 1 28 ? -10.406 5.110  84.922  1.00 55.36  ? 290 TRP A NE1 1 
ATOM   216  C  CE2 . TRP A 1 28 ? -9.971  6.271  85.502  1.00 57.24  ? 290 TRP A CE2 1 
ATOM   217  C  CE3 . TRP A 1 28 ? -9.743  8.602  84.901  1.00 74.18  ? 290 TRP A CE3 1 
ATOM   218  C  CZ2 . TRP A 1 28 ? -9.459  6.502  86.777  1.00 62.88  ? 290 TRP A CZ2 1 
ATOM   219  C  CZ3 . TRP A 1 28 ? -9.236  8.827  86.168  1.00 49.78  ? 290 TRP A CZ3 1 
ATOM   220  C  CH2 . TRP A 1 28 ? -9.099  7.783  87.090  1.00 39.35  ? 290 TRP A CH2 1 
ATOM   221  N  N   . TYR A 1 29 ? -11.796 10.269 82.671  1.00 66.38  ? 291 TYR A N   1 
ATOM   222  C  CA  . TYR A 1 29 ? -11.814 11.486 83.479  1.00 64.34  ? 291 TYR A CA  1 
ATOM   223  C  C   . TYR A 1 29 ? -13.218 12.072 83.609  1.00 48.65  ? 291 TYR A C   1 
ATOM   224  O  O   . TYR A 1 29 ? -13.494 12.849 84.525  1.00 40.43  ? 291 TYR A O   1 
ATOM   225  C  CB  . TYR A 1 29 ? -10.859 12.531 82.898  1.00 69.40  ? 291 TYR A CB  1 
ATOM   226  C  CG  . TYR A 1 29 ? -9.408  12.301 83.253  1.00 81.91  ? 291 TYR A CG  1 
ATOM   227  C  CD1 . TYR A 1 29 ? -8.926  12.621 84.514  1.00 75.38  ? 291 TYR A CD1 1 
ATOM   228  C  CD2 . TYR A 1 29 ? -8.520  11.769 82.326  1.00 79.66  ? 291 TYR A CD2 1 
ATOM   229  C  CE1 . TYR A 1 29 ? -7.602  12.416 84.845  1.00 65.16  ? 291 TYR A CE1 1 
ATOM   230  C  CE2 . TYR A 1 29 ? -7.193  11.561 82.649  1.00 68.65  ? 291 TYR A CE2 1 
ATOM   231  C  CZ  . TYR A 1 29 ? -6.740  11.887 83.910  1.00 68.44  ? 291 TYR A CZ  1 
ATOM   232  O  OH  . TYR A 1 29 ? -5.421  11.683 84.238  1.00 82.78  ? 291 TYR A OH  1 
ATOM   233  N  N   . LYS A 1 30 ? -14.101 11.698 82.689  1.00 70.68  ? 292 LYS A N   1 
ATOM   234  C  CA  . LYS A 1 30 ? -15.473 12.186 82.715  1.00 63.79  ? 292 LYS A CA  1 
ATOM   235  C  C   . LYS A 1 30 ? -16.365 11.306 83.584  1.00 64.87  ? 292 LYS A C   1 
ATOM   236  O  O   . LYS A 1 30 ? -17.328 11.789 84.176  1.00 81.87  ? 292 LYS A O   1 
ATOM   237  C  CB  . LYS A 1 30 ? -16.045 12.288 81.300  1.00 72.47  ? 292 LYS A CB  1 
ATOM   238  C  CG  . LYS A 1 30 ? -15.669 13.563 80.564  1.00 97.64  ? 292 LYS A CG  1 
ATOM   239  C  CD  . LYS A 1 30 ? -16.240 13.566 79.155  1.00 109.38 ? 292 LYS A CD  1 
ATOM   240  C  CE  . LYS A 1 30 ? -17.750 13.376 79.166  1.00 104.62 ? 292 LYS A CE  1 
ATOM   241  N  NZ  . LYS A 1 30 ? -18.309 13.347 77.786  1.00 99.68  ? 292 LYS A NZ  1 
ATOM   242  N  N   . SER A 1 31 ? -16.043 10.018 83.660  1.00 42.17  ? 293 SER A N   1 
ATOM   243  C  CA  . SER A 1 31 ? -16.816 9.096  84.485  1.00 37.96  ? 293 SER A CA  1 
ATOM   244  C  C   . SER A 1 31 ? -16.470 9.289  85.957  1.00 64.73  ? 293 SER A C   1 
ATOM   245  O  O   . SER A 1 31 ? -17.286 9.017  86.838  1.00 80.56  ? 293 SER A O   1 
ATOM   246  C  CB  . SER A 1 31 ? -16.574 7.640  84.067  1.00 47.21  ? 293 SER A CB  1 
ATOM   247  O  OG  . SER A 1 31 ? -15.367 7.138  84.615  1.00 46.29  ? 293 SER A OG  1 
ATOM   248  N  N   . LYS A 1 32 ? -15.257 9.768  86.214  1.00 48.80  ? 294 LYS A N   1 
ATOM   249  C  CA  . LYS A 1 32 ? -14.781 9.964  87.579  1.00 47.09  ? 294 LYS A CA  1 
ATOM   250  C  C   . LYS A 1 32 ? -15.285 11.266 88.181  1.00 57.92  ? 294 LYS A C   1 
ATOM   251  O  O   . LYS A 1 32 ? -15.700 11.306 89.340  1.00 48.81  ? 294 LYS A O   1 
ATOM   252  C  CB  . LYS A 1 32 ? -13.254 9.904  87.635  1.00 48.32  ? 294 LYS A CB  1 
ATOM   253  C  CG  . LYS A 1 32 ? -12.711 8.526  87.965  1.00 46.74  ? 294 LYS A CG  1 
ATOM   254  C  CD  . LYS A 1 32 ? -13.573 7.433  87.352  1.00 52.22  ? 294 LYS A CD  1 
ATOM   255  C  CE  . LYS A 1 32 ? -13.108 6.060  87.800  1.00 46.99  ? 294 LYS A CE  1 
ATOM   256  N  NZ  . LYS A 1 32 ? -14.041 4.982  87.371  1.00 70.30  ? 294 LYS A NZ  1 
ATOM   257  N  N   . PHE A 1 33 ? -15.250 12.333 87.391  1.00 38.78  ? 295 PHE A N   1 
ATOM   258  C  CA  . PHE A 1 33 ? -15.791 13.607 87.837  1.00 46.66  ? 295 PHE A CA  1 
ATOM   259  C  C   . PHE A 1 33 ? -17.273 13.444 88.148  1.00 55.70  ? 295 PHE A C   1 
ATOM   260  O  O   . PHE A 1 33 ? -17.877 14.286 88.810  1.00 53.96  ? 295 PHE A O   1 
ATOM   261  C  CB  . PHE A 1 33 ? -15.589 14.692 86.777  1.00 71.14  ? 295 PHE A CB  1 
ATOM   262  C  CG  . PHE A 1 33 ? -16.233 16.004 87.129  1.00 82.79  ? 295 PHE A CG  1 
ATOM   263  C  CD1 . PHE A 1 33 ? -15.596 16.893 87.976  1.00 75.95  ? 295 PHE A CD1 1 
ATOM   264  C  CD2 . PHE A 1 33 ? -17.480 16.343 86.628  1.00 100.84 ? 295 PHE A CD2 1 
ATOM   265  C  CE1 . PHE A 1 33 ? -16.185 18.100 88.312  1.00 90.66  ? 295 PHE A CE1 1 
ATOM   266  C  CE2 . PHE A 1 33 ? -18.075 17.554 86.963  1.00 106.17 ? 295 PHE A CE2 1 
ATOM   267  C  CZ  . PHE A 1 33 ? -17.424 18.431 87.806  1.00 107.78 ? 295 PHE A CZ  1 
ATOM   268  N  N   . ALA A 1 34 ? -17.852 12.351 87.659  1.00 70.12  ? 296 ALA A N   1 
ATOM   269  C  CA  . ALA A 1 34 ? -19.248 12.027 87.921  1.00 69.54  ? 296 ALA A CA  1 
ATOM   270  C  C   . ALA A 1 34 ? -19.418 11.443 89.320  1.00 59.05  ? 296 ALA A C   1 
ATOM   271  O  O   . ALA A 1 34 ? -20.268 11.893 90.089  1.00 62.20  ? 296 ALA A O   1 
ATOM   272  C  CB  . ALA A 1 34 ? -19.766 11.056 86.876  1.00 59.06  ? 296 ALA A CB  1 
ATOM   273  N  N   . ASP A 1 35 ? -18.605 10.440 89.639  1.00 55.76  ? 297 ASP A N   1 
ATOM   274  C  CA  . ASP A 1 35 ? -18.646 9.796  90.949  1.00 66.06  ? 297 ASP A CA  1 
ATOM   275  C  C   . ASP A 1 35 ? -18.499 10.821 92.066  1.00 60.31  ? 297 ASP A C   1 
ATOM   276  O  O   . ASP A 1 35 ? -19.232 10.789 93.053  1.00 50.44  ? 297 ASP A O   1 
ATOM   277  C  CB  . ASP A 1 35 ? -17.546 8.740  91.065  1.00 16.63  ? 297 ASP A CB  1 
ATOM   278  C  CG  . ASP A 1 35 ? -17.610 7.707  89.959  1.00 61.18  ? 297 ASP A CG  1 
ATOM   279  O  OD1 . ASP A 1 35 ? -18.607 7.698  89.207  1.00 54.01  ? 297 ASP A OD1 1 
ATOM   280  O  OD2 . ASP A 1 35 ? -16.662 6.903  89.840  1.00 65.87  ? 297 ASP A OD2 1 
ATOM   281  N  N   . LEU A 1 36 ? -17.548 11.733 91.903  1.00 49.78  ? 298 LEU A N   1 
ATOM   282  C  CA  . LEU A 1 36 ? -17.332 12.788 92.880  1.00 53.16  ? 298 LEU A CA  1 
ATOM   283  C  C   . LEU A 1 36 ? -18.516 13.744 92.895  1.00 57.82  ? 298 LEU A C   1 
ATOM   284  O  O   . LEU A 1 36 ? -18.911 14.240 93.948  1.00 65.48  ? 298 LEU A O   1 
ATOM   285  C  CB  . LEU A 1 36 ? -16.048 13.556 92.561  1.00 54.57  ? 298 LEU A CB  1 
ATOM   286  C  CG  . LEU A 1 36 ? -14.787 12.727 92.299  1.00 48.27  ? 298 LEU A CG  1 
ATOM   287  C  CD1 . LEU A 1 36 ? -13.622 13.627 91.907  1.00 29.25  ? 298 LEU A CD1 1 
ATOM   288  C  CD2 . LEU A 1 36 ? -14.428 11.864 93.503  1.00 16.84  ? 298 LEU A CD2 1 
ATOM   289  N  N   . SER A 1 37 ? -19.076 14.001 91.717  1.00 56.24  ? 299 SER A N   1 
ATOM   290  C  CA  . SER A 1 37 ? -20.175 14.949 91.582  1.00 56.42  ? 299 SER A CA  1 
ATOM   291  C  C   . SER A 1 37 ? -21.469 14.410 92.184  1.00 65.32  ? 299 SER A C   1 
ATOM   292  O  O   . SER A 1 37 ? -22.276 15.168 92.723  1.00 61.48  ? 299 SER A O   1 
ATOM   293  C  CB  . SER A 1 37 ? -20.389 15.319 90.112  1.00 70.66  ? 299 SER A CB  1 
ATOM   294  O  OG  . SER A 1 37 ? -21.286 16.408 89.985  1.00 84.07  ? 299 SER A OG  1 
ATOM   295  N  N   . GLU A 1 38 ? -21.665 13.100 92.087  1.00 46.69  ? 300 GLU A N   1 
ATOM   296  C  CA  . GLU A 1 38 ? -22.851 12.477 92.659  1.00 50.98  ? 300 GLU A CA  1 
ATOM   297  C  C   . GLU A 1 38 ? -22.691 12.333 94.168  1.00 59.27  ? 300 GLU A C   1 
ATOM   298  O  O   . GLU A 1 38 ? -23.653 12.484 94.921  1.00 62.08  ? 300 GLU A O   1 
ATOM   299  C  CB  . GLU A 1 38 ? -23.119 11.113 92.020  1.00 51.16  ? 300 GLU A CB  1 
ATOM   300  C  CG  . GLU A 1 38 ? -22.135 10.029 92.423  1.00 61.46  ? 300 GLU A CG  1 
ATOM   301  C  CD  . GLU A 1 38 ? -22.556 8.653  91.949  1.00 77.81  ? 300 GLU A CD  1 
ATOM   302  O  OE1 . GLU A 1 38 ? -23.105 8.549  90.832  1.00 91.78  ? 300 GLU A OE1 1 
ATOM   303  O  OE2 . GLU A 1 38 ? -22.334 7.675  92.693  1.00 60.06  ? 300 GLU A OE2 1 
ATOM   304  N  N   . ALA A 1 39 ? -21.466 12.051 94.601  1.00 61.57  ? 301 ALA A N   1 
ATOM   305  C  CA  . ALA A 1 39 ? -21.163 11.918 96.019  1.00 57.11  ? 301 ALA A CA  1 
ATOM   306  C  C   . ALA A 1 39 ? -21.343 13.255 96.723  1.00 42.40  ? 301 ALA A C   1 
ATOM   307  O  O   . ALA A 1 39 ? -21.909 13.321 97.811  1.00 33.82  ? 301 ALA A O   1 
ATOM   308  C  CB  . ALA A 1 39 ? -19.750 11.396 96.214  1.00 46.93  ? 301 ALA A CB  1 
ATOM   309  N  N   . ALA A 1 40 ? -20.866 14.320 96.089  1.00 50.45  ? 302 ALA A N   1 
ATOM   310  C  CA  . ALA A 1 40 ? -20.998 15.660 96.646  1.00 68.37  ? 302 ALA A CA  1 
ATOM   311  C  C   . ALA A 1 40 ? -22.463 16.068 96.777  1.00 62.30  ? 302 ALA A C   1 
ATOM   312  O  O   . ALA A 1 40 ? -22.833 16.807 97.691  1.00 43.24  ? 302 ALA A O   1 
ATOM   313  C  CB  . ALA A 1 40 ? -20.236 16.666 95.795  1.00 57.06  ? 302 ALA A CB  1 
ATOM   314  N  N   . ASN A 1 41 ? -23.294 15.582 95.860  1.00 63.05  ? 303 ASN A N   1 
ATOM   315  C  CA  . ASN A 1 41 ? -24.721 15.885 95.896  1.00 88.10  ? 303 ASN A CA  1 
ATOM   316  C  C   . ASN A 1 41 ? -25.444 15.177 97.039  1.00 72.30  ? 303 ASN A C   1 
ATOM   317  O  O   . ASN A 1 41 ? -26.282 15.774 97.715  1.00 55.32  ? 303 ASN A O   1 
ATOM   318  C  CB  . ASN A 1 41 ? -25.384 15.563 94.555  1.00 87.01  ? 303 ASN A CB  1 
ATOM   319  C  CG  . ASN A 1 41 ? -25.055 16.586 93.481  1.00 81.25  ? 303 ASN A CG  1 
ATOM   320  O  OD1 . ASN A 1 41 ? -24.199 17.449 93.672  1.00 87.46  ? 303 ASN A OD1 1 
ATOM   321  N  ND2 . ASN A 1 41 ? -25.739 16.495 92.346  1.00 66.23  ? 303 ASN A ND2 1 
ATOM   322  N  N   . ARG A 1 42 ? -25.115 13.906 97.254  1.00 58.54  ? 304 ARG A N   1 
ATOM   323  C  CA  . ARG A 1 42 ? -25.669 13.158 98.377  1.00 42.27  ? 304 ARG A CA  1 
ATOM   324  C  C   . ARG A 1 42 ? -25.188 13.769 99.686  1.00 66.66  ? 304 ARG A C   1 
ATOM   325  O  O   . ARG A 1 42 ? -25.948 13.901 100.644 1.00 71.24  ? 304 ARG A O   1 
ATOM   326  C  CB  . ARG A 1 42 ? -25.255 11.687 98.309  1.00 45.62  ? 304 ARG A CB  1 
ATOM   327  C  CG  . ARG A 1 42 ? -25.865 10.919 97.150  1.00 80.78  ? 304 ARG A CG  1 
ATOM   328  C  CD  . ARG A 1 42 ? -25.527 9.437  97.231  1.00 68.54  ? 304 ARG A CD  1 
ATOM   329  N  NE  . ARG A 1 42 ? -24.086 9.201  97.211  1.00 79.83  ? 304 ARG A NE  1 
ATOM   330  C  CZ  . ARG A 1 42 ? -23.352 9.168  96.104  1.00 69.12  ? 304 ARG A CZ  1 
ATOM   331  N  NH1 . ARG A 1 42 ? -23.923 9.361  94.923  1.00 44.30  ? 304 ARG A NH1 1 
ATOM   332  N  NH2 . ARG A 1 42 ? -22.046 8.946  96.176  1.00 64.27  ? 304 ARG A NH2 1 
ATOM   333  N  N   . ASN A 1 43 ? -23.914 14.143 99.713  1.00 51.41  ? 305 ASN A N   1 
ATOM   334  C  CA  . ASN A 1 43 ? -23.324 14.780 100.880 1.00 57.94  ? 305 ASN A CA  1 
ATOM   335  C  C   . ASN A 1 43 ? -24.053 16.079 101.212 1.00 41.09  ? 305 ASN A C   1 
ATOM   336  O  O   . ASN A 1 43 ? -24.544 16.260 102.326 1.00 58.33  ? 305 ASN A O   1 
ATOM   337  C  CB  . ASN A 1 43 ? -21.838 15.047 100.639 1.00 33.96  ? 305 ASN A CB  1 
ATOM   338  C  CG  . ASN A 1 43 ? -21.033 15.074 101.920 1.00 54.26  ? 305 ASN A CG  1 
ATOM   339  O  OD1 . ASN A 1 43 ? -21.589 15.038 103.018 1.00 84.20  ? 305 ASN A OD1 1 
ATOM   340  N  ND2 . ASN A 1 43 ? -19.713 15.133 101.787 1.00 58.85  ? 305 ASN A ND2 1 
ATOM   341  N  N   . ASN A 1 44 ? -24.128 16.980 100.237 1.00 57.35  ? 306 ASN A N   1 
ATOM   342  C  CA  . ASN A 1 44 ? -24.853 18.233 100.414 1.00 79.79  ? 306 ASN A CA  1 
ATOM   343  C  C   . ASN A 1 44 ? -26.285 17.998 100.881 1.00 68.28  ? 306 ASN A C   1 
ATOM   344  O  O   . ASN A 1 44 ? -26.894 18.870 101.503 1.00 71.05  ? 306 ASN A O   1 
ATOM   345  C  CB  . ASN A 1 44 ? -24.849 19.054 99.121  1.00 79.35  ? 306 ASN A CB  1 
ATOM   346  C  CG  . ASN A 1 44 ? -23.521 19.739 98.869  1.00 71.51  ? 306 ASN A CG  1 
ATOM   347  O  OD1 . ASN A 1 44 ? -22.639 19.745 99.728  1.00 79.91  ? 306 ASN A OD1 1 
ATOM   348  N  ND2 . ASN A 1 44 ? -23.374 20.325 97.686  1.00 83.41  ? 306 ASN A ND2 1 
ATOM   349  N  N   . ASP A 1 45 ? -26.813 16.816 100.577 1.00 70.63  ? 307 ASP A N   1 
ATOM   350  C  CA  . ASP A 1 45 ? -28.162 16.442 100.983 1.00 80.31  ? 307 ASP A CA  1 
ATOM   351  C  C   . ASP A 1 45 ? -28.209 16.048 102.457 1.00 61.77  ? 307 ASP A C   1 
ATOM   352  O  O   . ASP A 1 45 ? -29.016 16.575 103.222 1.00 60.20  ? 307 ASP A O   1 
ATOM   353  C  CB  . ASP A 1 45 ? -28.686 15.296 100.115 1.00 75.58  ? 307 ASP A CB  1 
ATOM   354  C  CG  . ASP A 1 45 ? -30.035 14.778 100.582 1.00 108.20 ? 307 ASP A CG  1 
ATOM   355  O  OD1 . ASP A 1 45 ? -30.319 13.580 100.365 1.00 103.10 ? 307 ASP A OD1 1 
ATOM   356  O  OD2 . ASP A 1 45 ? -30.810 15.565 101.168 1.00 108.36 ? 307 ASP A OD2 1 
ATOM   357  N  N   . ALA A 1 46 ? -27.343 15.115 102.844 1.00 57.93  ? 308 ALA A N   1 
ATOM   358  C  CA  . ALA A 1 46 ? -27.275 14.649 104.224 1.00 41.66  ? 308 ALA A CA  1 
ATOM   359  C  C   . ALA A 1 46 ? -27.183 15.815 105.200 1.00 66.65  ? 308 ALA A C   1 
ATOM   360  O  O   . ALA A 1 46 ? -27.747 15.766 106.294 1.00 48.67  ? 308 ALA A O   1 
ATOM   361  C  CB  . ALA A 1 46 ? -26.095 13.706 104.409 1.00 38.85  ? 308 ALA A CB  1 
ATOM   362  N  N   . LEU A 1 47 ? -26.467 16.861 104.798 1.00 57.23  ? 309 LEU A N   1 
ATOM   363  C  CA  . LEU A 1 47 ? -26.346 18.060 105.618 1.00 63.19  ? 309 LEU A CA  1 
ATOM   364  C  C   . LEU A 1 47 ? -27.679 18.798 105.673 1.00 61.56  ? 309 LEU A C   1 
ATOM   365  O  O   . LEU A 1 47 ? -28.167 19.137 106.747 1.00 60.67  ? 309 LEU A O   1 
ATOM   366  C  CB  . LEU A 1 47 ? -25.260 18.985 105.069 1.00 31.31  ? 309 LEU A CB  1 
ATOM   367  C  CG  . LEU A 1 47 ? -24.857 20.147 105.980 1.00 32.47  ? 309 LEU A CG  1 
ATOM   368  C  CD1 . LEU A 1 47 ? -24.201 19.629 107.253 1.00 43.42  ? 309 LEU A CD1 1 
ATOM   369  C  CD2 . LEU A 1 47 ? -23.933 21.110 105.252 1.00 35.78  ? 309 LEU A CD2 1 
ATOM   370  N  N   . ARG A 1 48 ? -28.267 19.033 104.504 1.00 69.86  ? 310 ARG A N   1 
ATOM   371  C  CA  . ARG A 1 48 ? -29.558 19.704 104.414 1.00 61.71  ? 310 ARG A CA  1 
ATOM   372  C  C   . ARG A 1 48 ? -30.618 18.920 105.178 1.00 72.96  ? 310 ARG A C   1 
ATOM   373  O  O   . ARG A 1 48 ? -31.681 19.446 105.497 1.00 83.13  ? 310 ARG A O   1 
ATOM   374  C  CB  . ARG A 1 48 ? -29.972 19.874 102.949 1.00 73.64  ? 310 ARG A CB  1 
ATOM   375  C  CG  . ARG A 1 48 ? -31.255 20.668 102.749 1.00 100.42 ? 310 ARG A CG  1 
ATOM   376  C  CD  . ARG A 1 48 ? -31.579 20.841 101.273 1.00 92.54  ? 310 ARG A CD  1 
ATOM   377  N  NE  . ARG A 1 48 ? -32.835 21.558 101.069 1.00 94.60  ? 310 ARG A NE  1 
ATOM   378  C  CZ  . ARG A 1 48 ? -32.935 22.880 100.971 1.00 95.99  ? 310 ARG A CZ  1 
ATOM   379  N  NH1 . ARG A 1 48 ? -31.851 23.638 101.055 1.00 98.30  ? 310 ARG A NH1 1 
ATOM   380  N  NH2 . ARG A 1 48 ? -34.121 23.444 100.790 1.00 63.28  ? 310 ARG A NH2 1 
ATOM   381  N  N   . GLN A 1 49 ? -30.317 17.658 105.470 1.00 62.51  ? 311 GLN A N   1 
ATOM   382  C  CA  . GLN A 1 49 ? -31.242 16.797 106.196 1.00 76.90  ? 311 GLN A CA  1 
ATOM   383  C  C   . GLN A 1 49 ? -30.946 16.847 107.692 1.00 76.84  ? 311 GLN A C   1 
ATOM   384  O  O   . GLN A 1 49 ? -31.860 16.882 108.517 1.00 64.23  ? 311 GLN A O   1 
ATOM   385  C  CB  . GLN A 1 49 ? -31.153 15.361 105.672 1.00 78.45  ? 311 GLN A CB  1 
ATOM   386  C  CG  . GLN A 1 49 ? -32.363 14.494 105.985 1.00 93.95  ? 311 GLN A CG  1 
ATOM   387  C  CD  . GLN A 1 49 ? -32.302 13.870 107.366 1.00 113.92 ? 311 GLN A CD  1 
ATOM   388  O  OE1 . GLN A 1 49 ? -31.254 13.861 108.012 1.00 91.32  ? 311 GLN A OE1 1 
ATOM   389  N  NE2 . GLN A 1 49 ? -33.429 13.337 107.822 1.00 108.78 ? 311 GLN A NE2 1 
ATOM   390  N  N   . ALA A 1 50 ? -29.661 16.864 108.034 1.00 69.25  ? 312 ALA A N   1 
ATOM   391  C  CA  . ALA A 1 50 ? -29.238 16.952 109.427 1.00 48.43  ? 312 ALA A CA  1 
ATOM   392  C  C   . ALA A 1 50 ? -29.526 18.338 109.993 1.00 50.80  ? 312 ALA A C   1 
ATOM   393  O  O   . ALA A 1 50 ? -29.823 18.484 111.176 1.00 72.64  ? 312 ALA A O   1 
ATOM   394  C  CB  . ALA A 1 50 ? -27.761 16.620 109.558 1.00 40.73  ? 312 ALA A CB  1 
ATOM   395  N  N   . LYS A 1 51 ? -29.435 19.352 109.140 1.00 53.43  ? 313 LYS A N   1 
ATOM   396  C  CA  . LYS A 1 51 ? -29.744 20.719 109.539 1.00 66.72  ? 313 LYS A CA  1 
ATOM   397  C  C   . LYS A 1 51 ? -31.233 20.865 109.831 1.00 64.71  ? 313 LYS A C   1 
ATOM   398  O  O   . LYS A 1 51 ? -31.625 21.496 110.814 1.00 57.08  ? 313 LYS A O   1 
ATOM   399  C  CB  . LYS A 1 51 ? -29.329 21.705 108.445 1.00 49.32  ? 313 LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 51 ? -27.831 21.799 108.223 1.00 65.89  ? 313 LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 51 ? -27.110 22.273 109.477 1.00 106.18 ? 313 LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 51 ? -25.612 22.408 109.242 1.00 92.97  ? 313 LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 51 ? -24.881 22.837 110.471 1.00 81.57  ? 313 LYS A NZ  1 
ATOM   404  N  N   . GLN A 1 52 ? -32.057 20.279 108.968 1.00 54.54  ? 314 GLN A N   1 
ATOM   405  C  CA  . GLN A 1 52 ? -33.504 20.342 109.126 1.00 62.22  ? 314 GLN A CA  1 
ATOM   406  C  C   . GLN A 1 52 ? -33.961 19.531 110.333 1.00 57.25  ? 314 GLN A C   1 
ATOM   407  O  O   . GLN A 1 52 ? -34.953 19.871 110.977 1.00 62.69  ? 314 GLN A O   1 
ATOM   408  C  CB  . GLN A 1 52 ? -34.206 19.870 107.850 1.00 83.91  ? 314 GLN A CB  1 
ATOM   409  C  CG  . GLN A 1 52 ? -34.096 20.857 106.698 1.00 86.61  ? 314 GLN A CG  1 
ATOM   410  C  CD  . GLN A 1 52 ? -34.394 20.228 105.350 1.00 100.75 ? 314 GLN A CD  1 
ATOM   411  O  OE1 . GLN A 1 52 ? -34.665 19.029 105.254 1.00 85.86  ? 314 GLN A OE1 1 
ATOM   412  N  NE2 . GLN A 1 52 ? -34.337 21.036 104.298 1.00 96.50  ? 314 GLN A NE2 1 
ATOM   413  N  N   . GLU A 1 53 ? -33.234 18.459 110.634 1.00 51.97  ? 315 GLU A N   1 
ATOM   414  C  CA  . GLU A 1 53 ? -33.481 17.695 111.850 1.00 55.64  ? 315 GLU A CA  1 
ATOM   415  C  C   . GLU A 1 53 ? -33.111 18.539 113.061 1.00 67.30  ? 315 GLU A C   1 
ATOM   416  O  O   . GLU A 1 53 ? -33.820 18.553 114.067 1.00 55.80  ? 315 GLU A O   1 
ATOM   417  C  CB  . GLU A 1 53 ? -32.658 16.407 111.863 1.00 56.24  ? 315 GLU A CB  1 
ATOM   418  C  CG  . GLU A 1 53 ? -33.203 15.288 110.993 1.00 86.87  ? 315 GLU A CG  1 
ATOM   419  C  CD  . GLU A 1 53 ? -32.492 13.968 111.238 1.00 107.99 ? 315 GLU A CD  1 
ATOM   420  O  OE1 . GLU A 1 53 ? -31.682 13.894 112.186 1.00 111.61 ? 315 GLU A OE1 1 
ATOM   421  O  OE2 . GLU A 1 53 ? -32.745 13.005 110.485 1.00 103.18 ? 315 GLU A OE2 1 
ATOM   422  N  N   . SER A 1 54 ? -31.987 19.241 112.951 1.00 55.30  ? 316 SER A N   1 
ATOM   423  C  CA  . SER A 1 54 ? -31.488 20.084 114.029 1.00 52.10  ? 316 SER A CA  1 
ATOM   424  C  C   . SER A 1 54 ? -32.499 21.168 114.382 1.00 54.86  ? 316 SER A C   1 
ATOM   425  O  O   . SER A 1 54 ? -32.560 21.621 115.524 1.00 78.69  ? 316 SER A O   1 
ATOM   426  C  CB  . SER A 1 54 ? -30.150 20.715 113.632 1.00 69.90  ? 316 SER A CB  1 
ATOM   427  O  OG  . SER A 1 54 ? -29.518 21.335 114.739 1.00 62.39  ? 316 SER A OG  1 
ATOM   428  N  N   . THR A 1 55 ? -33.291 21.581 113.398 1.00 61.23  ? 317 THR A N   1 
ATOM   429  C  CA  . THR A 1 55 ? -34.315 22.596 113.616 1.00 64.21  ? 317 THR A CA  1 
ATOM   430  C  C   . THR A 1 55 ? -35.688 21.962 113.812 1.00 55.15  ? 317 THR A C   1 
ATOM   431  O  O   . THR A 1 55 ? -36.643 22.639 114.188 1.00 60.35  ? 317 THR A O   1 
ATOM   432  C  CB  . THR A 1 55 ? -34.386 23.598 112.449 1.00 85.99  ? 317 THR A CB  1 
ATOM   433  O  OG1 . THR A 1 55 ? -34.774 22.917 111.250 1.00 67.46  ? 317 THR A OG1 1 
ATOM   434  C  CG2 . THR A 1 55 ? -33.036 24.272 112.240 1.00 83.80  ? 317 THR A CG2 1 
ATOM   435  N  N   . GLU A 1 56 ? -35.781 20.662 113.550 1.00 65.08  ? 318 GLU A N   1 
ATOM   436  C  CA  . GLU A 1 56 ? -37.028 19.931 113.748 1.00 48.93  ? 318 GLU A CA  1 
ATOM   437  C  C   . GLU A 1 56 ? -37.172 19.526 115.212 1.00 75.71  ? 318 GLU A C   1 
ATOM   438  O  O   . GLU A 1 56 ? -38.256 19.625 115.791 1.00 51.51  ? 318 GLU A O   1 
ATOM   439  C  CB  . GLU A 1 56 ? -37.083 18.700 112.842 1.00 70.21  ? 318 GLU A CB  1 
ATOM   440  C  CG  . GLU A 1 56 ? -38.383 17.916 112.934 1.00 87.00  ? 318 GLU A CG  1 
ATOM   441  C  CD  . GLU A 1 56 ? -38.483 16.829 111.881 1.00 102.08 ? 318 GLU A CD  1 
ATOM   442  O  OE1 . GLU A 1 56 ? -37.937 17.019 110.773 1.00 72.74  ? 318 GLU A OE1 1 
ATOM   443  O  OE2 . GLU A 1 56 ? -39.115 15.788 112.159 1.00 111.46 ? 318 GLU A OE2 1 
ATOM   444  N  N   . TYR A 1 57 ? -36.071 19.071 115.803 1.00 74.41  ? 319 TYR A N   1 
ATOM   445  C  CA  . TYR A 1 57 ? -36.036 18.768 117.229 1.00 41.24  ? 319 TYR A CA  1 
ATOM   446  C  C   . TYR A 1 57 ? -35.918 20.061 118.026 1.00 50.74  ? 319 TYR A C   1 
ATOM   447  O  O   . TYR A 1 57 ? -36.311 20.127 119.189 1.00 49.12  ? 319 TYR A O   1 
ATOM   448  C  CB  . TYR A 1 57 ? -34.865 17.840 117.560 1.00 48.19  ? 319 TYR A CB  1 
ATOM   449  C  CG  . TYR A 1 57 ? -35.025 16.431 117.035 1.00 58.09  ? 319 TYR A CG  1 
ATOM   450  C  CD1 . TYR A 1 57 ? -36.121 15.654 117.393 1.00 66.25  ? 319 TYR A CD1 1 
ATOM   451  C  CD2 . TYR A 1 57 ? -34.072 15.871 116.197 1.00 66.20  ? 319 TYR A CD2 1 
ATOM   452  C  CE1 . TYR A 1 57 ? -36.267 14.362 116.918 1.00 72.41  ? 319 TYR A CE1 1 
ATOM   453  C  CE2 . TYR A 1 57 ? -34.208 14.582 115.719 1.00 77.53  ? 319 TYR A CE2 1 
ATOM   454  C  CZ  . TYR A 1 57 ? -35.307 13.832 116.082 1.00 72.08  ? 319 TYR A CZ  1 
ATOM   455  O  OH  . TYR A 1 57 ? -35.443 12.548 115.607 1.00 76.33  ? 319 TYR A OH  1 
ATOM   456  N  N   . ARG A 1 58 ? -35.369 21.088 117.386 1.00 68.12  ? 320 ARG A N   1 
ATOM   457  C  CA  . ARG A 1 58 ? -35.181 22.386 118.021 1.00 66.45  ? 320 ARG A CA  1 
ATOM   458  C  C   . ARG A 1 58 ? -36.520 23.004 118.402 1.00 60.19  ? 320 ARG A C   1 
ATOM   459  O  O   . ARG A 1 58 ? -36.675 23.543 119.497 1.00 62.40  ? 320 ARG A O   1 
ATOM   460  C  CB  . ARG A 1 58 ? -34.407 23.329 117.094 1.00 78.81  ? 320 ARG A CB  1 
ATOM   461  C  CG  . ARG A 1 58 ? -34.018 24.656 117.726 1.00 84.03  ? 320 ARG A CG  1 
ATOM   462  C  CD  . ARG A 1 58 ? -33.056 25.428 116.834 1.00 94.57  ? 320 ARG A CD  1 
ATOM   463  N  NE  . ARG A 1 58 ? -33.641 25.741 115.533 1.00 114.44 ? 320 ARG A NE  1 
ATOM   464  C  CZ  . ARG A 1 58 ? -34.273 26.875 115.252 1.00 128.97 ? 320 ARG A CZ  1 
ATOM   465  N  NH1 . ARG A 1 58 ? -34.401 27.812 116.181 1.00 113.02 ? 320 ARG A NH1 1 
ATOM   466  N  NH2 . ARG A 1 58 ? -34.776 27.075 114.042 1.00 121.84 ? 320 ARG A NH2 1 
ATOM   467  N  N   . ARG A 1 59 ? -37.485 22.923 117.492 1.00 65.92  ? 321 ARG A N   1 
ATOM   468  C  CA  . ARG A 1 59 ? -38.814 23.468 117.738 1.00 53.68  ? 321 ARG A CA  1 
ATOM   469  C  C   . ARG A 1 59 ? -39.577 22.619 118.750 1.00 53.19  ? 321 ARG A C   1 
ATOM   470  O  O   . ARG A 1 59 ? -40.385 23.135 119.521 1.00 79.06  ? 321 ARG A O   1 
ATOM   471  C  CB  . ARG A 1 59 ? -39.609 23.563 116.435 1.00 58.94  ? 321 ARG A CB  1 
ATOM   472  C  CG  . ARG A 1 59 ? -38.928 24.365 115.338 1.00 79.76  ? 321 ARG A CG  1 
ATOM   473  C  CD  . ARG A 1 59 ? -39.912 24.725 114.234 1.00 108.22 ? 321 ARG A CD  1 
ATOM   474  N  NE  . ARG A 1 59 ? -39.242 25.089 112.988 1.00 97.59  ? 321 ARG A NE  1 
ATOM   475  C  CZ  . ARG A 1 59 ? -38.689 26.274 112.751 1.00 91.32  ? 321 ARG A CZ  1 
ATOM   476  N  NH1 . ARG A 1 59 ? -38.714 27.220 113.680 1.00 100.03 ? 321 ARG A NH1 1 
ATOM   477  N  NH2 . ARG A 1 59 ? -38.104 26.511 111.585 1.00 90.69  ? 321 ARG A NH2 1 
ATOM   478  N  N   . GLN A 1 60 ? -39.320 21.315 118.739 1.00 64.80  ? 322 GLN A N   1 
ATOM   479  C  CA  . GLN A 1 60 ? -39.991 20.400 119.655 1.00 68.26  ? 322 GLN A CA  1 
ATOM   480  C  C   . GLN A 1 60 ? -39.722 20.808 121.099 1.00 65.33  ? 322 GLN A C   1 
ATOM   481  O  O   . GLN A 1 60 ? -40.625 20.808 121.934 1.00 57.22  ? 322 GLN A O   1 
ATOM   482  C  CB  . GLN A 1 60 ? -39.532 18.961 119.408 1.00 60.55  ? 322 GLN A CB  1 
ATOM   483  C  CG  . GLN A 1 60 ? -40.480 17.904 119.949 1.00 78.02  ? 322 GLN A CG  1 
ATOM   484  C  CD  . GLN A 1 60 ? -40.061 16.494 119.573 1.00 95.18  ? 322 GLN A CD  1 
ATOM   485  O  OE1 . GLN A 1 60 ? -38.879 16.217 119.367 1.00 78.05  ? 322 GLN A OE1 1 
ATOM   486  N  NE2 . GLN A 1 60 ? -41.033 15.593 119.484 1.00 95.28  ? 322 GLN A NE2 1 
ATOM   487  N  N   . VAL A 1 61 ? -38.471 21.154 121.382 1.00 51.08  ? 323 VAL A N   1 
ATOM   488  C  CA  . VAL A 1 61 ? -38.092 21.677 122.688 1.00 62.09  ? 323 VAL A CA  1 
ATOM   489  C  C   . VAL A 1 61 ? -38.888 22.941 123.007 1.00 84.11  ? 323 VAL A C   1 
ATOM   490  O  O   . VAL A 1 61 ? -39.301 23.164 124.148 1.00 51.44  ? 323 VAL A O   1 
ATOM   491  C  CB  . VAL A 1 61 ? -36.582 21.994 122.741 1.00 31.42  ? 323 VAL A CB  1 
ATOM   492  C  CG1 . VAL A 1 61 ? -36.263 22.895 123.926 1.00 76.50  ? 323 VAL A CG1 1 
ATOM   493  C  CG2 . VAL A 1 61 ? -35.770 20.706 122.801 1.00 36.79  ? 323 VAL A CG2 1 
ATOM   494  N  N   . GLN A 1 62 ? -39.111 23.753 121.979 1.00 70.19  ? 324 GLN A N   1 
ATOM   495  C  CA  . GLN A 1 62 ? -39.795 25.031 122.125 1.00 65.69  ? 324 GLN A CA  1 
ATOM   496  C  C   . GLN A 1 62 ? -41.268 24.846 122.465 1.00 66.34  ? 324 GLN A C   1 
ATOM   497  O  O   . GLN A 1 62 ? -41.964 25.809 122.782 1.00 88.42  ? 324 GLN A O   1 
ATOM   498  C  CB  . GLN A 1 62 ? -39.656 25.853 120.842 1.00 70.80  ? 324 GLN A CB  1 
ATOM   499  C  CG  . GLN A 1 62 ? -39.998 27.325 120.993 1.00 83.22  ? 324 GLN A CG  1 
ATOM   500  C  CD  . GLN A 1 62 ? -39.706 28.116 119.734 1.00 104.02 ? 324 GLN A CD  1 
ATOM   501  O  OE1 . GLN A 1 62 ? -39.644 27.557 118.639 1.00 83.10  ? 324 GLN A OE1 1 
ATOM   502  N  NE2 . GLN A 1 62 ? -39.521 29.422 119.882 1.00 110.38 ? 324 GLN A NE2 1 
ATOM   503  N  N   . SER A 1 63 ? -41.743 23.608 122.397 1.00 50.77  ? 325 SER A N   1 
ATOM   504  C  CA  . SER A 1 63 ? -43.137 23.321 122.713 1.00 57.63  ? 325 SER A CA  1 
ATOM   505  C  C   . SER A 1 63 ? -43.295 22.610 124.054 1.00 63.98  ? 325 SER A C   1 
ATOM   506  O  O   . SER A 1 63 ? -44.160 22.967 124.853 1.00 51.73  ? 325 SER A O   1 
ATOM   507  C  CB  . SER A 1 63 ? -43.780 22.503 121.597 1.00 64.38  ? 325 SER A CB  1 
ATOM   508  O  OG  . SER A 1 63 ? -43.869 23.267 120.408 1.00 68.88  ? 325 SER A OG  1 
ATOM   509  N  N   . LEU A 1 64 ? -42.464 21.599 124.291 1.00 67.54  ? 326 LEU A N   1 
ATOM   510  C  CA  . LEU A 1 64 ? -42.471 20.888 125.567 1.00 71.69  ? 326 LEU A CA  1 
ATOM   511  C  C   . LEU A 1 64 ? -42.236 21.851 126.729 1.00 73.87  ? 326 LEU A C   1 
ATOM   512  O  O   . LEU A 1 64 ? -42.821 21.704 127.801 1.00 66.27  ? 326 LEU A O   1 
ATOM   513  C  CB  . LEU A 1 64 ? -41.423 19.774 125.573 1.00 54.71  ? 326 LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 64 ? -41.709 18.591 124.647 1.00 70.47  ? 326 LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 64 ? -40.572 17.583 124.696 1.00 41.93  ? 326 LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 64 ? -43.032 17.935 125.015 1.00 65.44  ? 326 LEU A CD2 1 
ATOM   517  N  N   . THR A 1 65 ? -41.373 22.836 126.506 1.00 79.02  ? 327 THR A N   1 
ATOM   518  C  CA  . THR A 1 65 ? -41.156 23.895 127.480 1.00 52.77  ? 327 THR A CA  1 
ATOM   519  C  C   . THR A 1 65 ? -42.465 24.644 127.692 1.00 55.67  ? 327 THR A C   1 
ATOM   520  O  O   . THR A 1 65 ? -42.867 24.917 128.822 1.00 50.08  ? 327 THR A O   1 
ATOM   521  C  CB  . THR A 1 65 ? -40.086 24.887 126.992 1.00 66.80  ? 327 THR A CB  1 
ATOM   522  O  OG1 . THR A 1 65 ? -38.895 24.175 126.638 1.00 70.24  ? 327 THR A OG1 1 
ATOM   523  C  CG2 . THR A 1 65 ? -39.762 25.905 128.078 1.00 91.48  ? 327 THR A CG2 1 
ATOM   524  N  N   . CYS A 1 66 ? -43.127 24.964 126.585 1.00 73.13  ? 328 CYS A N   1 
ATOM   525  C  CA  . CYS A 1 66 ? -44.402 25.671 126.609 1.00 70.23  ? 328 CYS A CA  1 
ATOM   526  C  C   . CYS A 1 66 ? -45.470 24.888 127.367 1.00 79.04  ? 328 CYS A C   1 
ATOM   527  O  O   . CYS A 1 66 ? -46.461 25.458 127.823 1.00 97.09  ? 328 CYS A O   1 
ATOM   528  C  CB  . CYS A 1 66 ? -44.874 25.957 125.180 1.00 71.01  ? 328 CYS A CB  1 
ATOM   529  S  SG  . CYS A 1 66 ? -46.509 26.722 125.057 1.00 115.41 ? 328 CYS A SG  1 
ATOM   530  N  N   . GLU A 1 67 ? -45.266 23.581 127.499 1.00 76.44  ? 329 GLU A N   1 
ATOM   531  C  CA  . GLU A 1 67 ? -46.219 22.731 128.203 1.00 69.36  ? 329 GLU A CA  1 
ATOM   532  C  C   . GLU A 1 67 ? -45.840 22.551 129.669 1.00 76.05  ? 329 GLU A C   1 
ATOM   533  O  O   . GLU A 1 67 ? -46.703 22.564 130.546 1.00 85.74  ? 329 GLU A O   1 
ATOM   534  C  CB  . GLU A 1 67 ? -46.341 21.369 127.515 1.00 80.34  ? 329 GLU A CB  1 
ATOM   535  C  CG  . GLU A 1 67 ? -47.053 21.413 126.172 1.00 98.67  ? 329 GLU A CG  1 
ATOM   536  C  CD  . GLU A 1 67 ? -48.500 21.855 126.294 1.00 116.97 ? 329 GLU A CD  1 
ATOM   537  O  OE1 . GLU A 1 67 ? -49.091 22.254 125.267 1.00 103.77 ? 329 GLU A OE1 1 
ATOM   538  O  OE2 . GLU A 1 67 ? -49.050 21.805 127.415 1.00 106.28 ? 329 GLU A OE2 1 
ATOM   539  N  N   . VAL A 1 68 ? -44.548 22.381 129.927 1.00 63.87  ? 330 VAL A N   1 
ATOM   540  C  CA  . VAL A 1 68 ? -44.055 22.226 131.291 1.00 84.14  ? 330 VAL A CA  1 
ATOM   541  C  C   . VAL A 1 68 ? -44.343 23.465 132.136 1.00 100.63 ? 330 VAL A C   1 
ATOM   542  O  O   . VAL A 1 68 ? -44.710 23.357 133.307 1.00 96.07  ? 330 VAL A O   1 
ATOM   543  C  CB  . VAL A 1 68 ? -42.543 21.933 131.313 1.00 53.10  ? 330 VAL A CB  1 
ATOM   544  C  CG1 . VAL A 1 68 ? -42.005 22.010 132.734 1.00 78.82  ? 330 VAL A CG1 1 
ATOM   545  C  CG2 . VAL A 1 68 ? -42.260 20.570 130.705 1.00 63.48  ? 330 VAL A CG2 1 
ATOM   546  N  N   . ASP A 1 69 ? -44.177 24.639 131.535 1.00 98.64  ? 331 ASP A N   1 
ATOM   547  C  CA  . ASP A 1 69 ? -44.407 25.899 132.233 1.00 94.05  ? 331 ASP A CA  1 
ATOM   548  C  C   . ASP A 1 69 ? -45.889 26.122 132.519 1.00 97.15  ? 331 ASP A C   1 
ATOM   549  O  O   . ASP A 1 69 ? -46.268 26.476 133.636 1.00 97.05  ? 331 ASP A O   1 
ATOM   550  C  CB  . ASP A 1 69 ? -43.843 27.071 131.424 1.00 93.70  ? 331 ASP A CB  1 
ATOM   551  C  CG  . ASP A 1 69 ? -42.328 27.043 131.334 1.00 99.17  ? 331 ASP A CG  1 
ATOM   552  O  OD1 . ASP A 1 69 ? -41.708 26.191 132.003 1.00 84.95  ? 331 ASP A OD1 1 
ATOM   553  O  OD2 . ASP A 1 69 ? -41.755 27.874 130.596 1.00 95.51  ? 331 ASP A OD2 1 
ATOM   554  N  N   . ALA A 1 70 ? -46.722 25.907 131.507 1.00 97.26  ? 332 ALA A N   1 
ATOM   555  C  CA  . ALA A 1 70 ? -48.158 26.135 131.633 1.00 103.52 ? 332 ALA A CA  1 
ATOM   556  C  C   . ALA A 1 70 ? -48.824 25.099 132.534 1.00 98.68  ? 332 ALA A C   1 
ATOM   557  O  O   . ALA A 1 70 ? -50.043 25.101 132.704 1.00 88.89  ? 332 ALA A O   1 
ATOM   558  C  CB  . ALA A 1 70 ? -48.815 26.149 130.260 1.00 86.32  ? 332 ALA A CB  1 
ATOM   559  N  N   . LEU A 1 71 ? -48.016 24.216 133.112 1.00 103.37 ? 333 LEU A N   1 
ATOM   560  C  CA  . LEU A 1 71 ? -48.528 23.172 133.990 1.00 95.59  ? 333 LEU A CA  1 
ATOM   561  C  C   . LEU A 1 71 ? -47.797 23.195 135.329 1.00 108.16 ? 333 LEU A C   1 
ATOM   562  O  O   . LEU A 1 71 ? -48.035 22.353 136.195 1.00 109.73 ? 333 LEU A O   1 
ATOM   563  C  CB  . LEU A 1 71 ? -48.383 21.802 133.323 1.00 95.92  ? 333 LEU A CB  1 
ATOM   564  C  CG  . LEU A 1 71 ? -49.202 20.653 133.915 1.00 119.12 ? 333 LEU A CG  1 
ATOM   565  C  CD1 . LEU A 1 71 ? -50.674 21.032 134.002 1.00 112.59 ? 333 LEU A CD1 1 
ATOM   566  C  CD2 . LEU A 1 71 ? -49.015 19.383 133.098 1.00 96.84  ? 333 LEU A CD2 1 
ATOM   567  N  N   . LYS A 1 72 ? -46.910 24.171 135.493 1.00 112.04 ? 334 LYS A N   1 
ATOM   568  C  CA  . LYS A 1 72 ? -46.115 24.293 136.709 1.00 117.20 ? 334 LYS A CA  1 
ATOM   569  C  C   . LYS A 1 72 ? -45.614 25.721 136.896 1.00 113.07 ? 334 LYS A C   1 
ATOM   570  O  O   . LYS A 1 72 ? -46.304 26.682 136.557 1.00 95.21  ? 334 LYS A O   1 
ATOM   571  C  CB  . LYS A 1 72 ? -44.934 23.322 136.677 1.00 20.00  ? 334 LYS A CB  1 
ATOM   572  C  CG  . LYS A 1 72 ? -45.333 21.855 136.738 1.00 20.00  ? 334 LYS A CG  1 
ATOM   573  C  CD  . LYS A 1 72 ? -44.117 20.948 136.677 1.00 20.00  ? 334 LYS A CD  1 
ATOM   574  C  CE  . LYS A 1 72 ? -44.514 19.483 136.762 1.00 20.00  ? 334 LYS A CE  1 
ATOM   575  N  NZ  . LYS A 1 72 ? -43.333 18.581 136.680 1.00 20.00  ? 334 LYS A NZ  1 
ATOM   576  N  N   . ASP B 1 2  ? 23.957  12.648 59.758  1.00 84.05  ? 264 ASP B N   1 
ATOM   577  C  CA  . ASP B 1 2  ? 23.757  12.743 61.198  1.00 65.33  ? 264 ASP B CA  1 
ATOM   578  C  C   . ASP B 1 2  ? 22.456  12.067 61.618  1.00 60.62  ? 264 ASP B C   1 
ATOM   579  O  O   . ASP B 1 2  ? 21.772  12.540 62.525  1.00 69.33  ? 264 ASP B O   1 
ATOM   580  C  CB  . ASP B 1 2  ? 23.749  14.210 61.640  1.00 89.47  ? 264 ASP B CB  1 
ATOM   581  C  CG  . ASP B 1 2  ? 22.583  14.992 61.058  1.00 87.56  ? 264 ASP B CG  1 
ATOM   582  O  OD1 . ASP B 1 2  ? 22.309  16.107 61.553  1.00 63.55  ? 264 ASP B OD1 1 
ATOM   583  O  OD2 . ASP B 1 2  ? 21.938  14.495 60.109  1.00 54.31  ? 264 ASP B OD2 1 
ATOM   584  N  N   . LEU B 1 3  ? 22.113  10.967 60.953  1.00 61.71  ? 265 LEU B N   1 
ATOM   585  C  CA  . LEU B 1 3  ? 20.881  10.244 61.255  1.00 56.80  ? 265 LEU B CA  1 
ATOM   586  C  C   . LEU B 1 3  ? 20.815  9.819  62.717  1.00 55.47  ? 265 LEU B C   1 
ATOM   587  O  O   . LEU B 1 3  ? 19.981  10.310 63.479  1.00 43.00  ? 265 LEU B O   1 
ATOM   588  C  CB  . LEU B 1 3  ? 20.742  9.011  60.363  1.00 41.47  ? 265 LEU B CB  1 
ATOM   589  C  CG  . LEU B 1 3  ? 20.576  9.267  58.869  1.00 48.16  ? 265 LEU B CG  1 
ATOM   590  C  CD1 . LEU B 1 3  ? 20.117  7.997  58.175  1.00 30.24  ? 265 LEU B CD1 1 
ATOM   591  C  CD2 . LEU B 1 3  ? 19.582  10.393 58.647  1.00 66.68  ? 265 LEU B CD2 1 
ATOM   592  N  N   . THR B 1 4  ? 21.695  8.901  63.102  1.00 34.66  ? 266 THR B N   1 
ATOM   593  C  CA  . THR B 1 4  ? 21.726  8.401  64.473  1.00 68.01  ? 266 THR B CA  1 
ATOM   594  C  C   . THR B 1 4  ? 21.749  9.537  65.493  1.00 35.23  ? 266 THR B C   1 
ATOM   595  O  O   . THR B 1 4  ? 21.278  9.380  66.622  1.00 31.75  ? 266 THR B O   1 
ATOM   596  C  CB  . THR B 1 4  ? 22.935  7.477  64.712  1.00 66.66  ? 266 THR B CB  1 
ATOM   597  O  OG1 . THR B 1 4  ? 24.134  8.130  64.279  1.00 78.13  ? 266 THR B OG1 1 
ATOM   598  C  CG2 . THR B 1 4  ? 22.765  6.177  63.947  1.00 53.07  ? 266 THR B CG2 1 
ATOM   599  N  N   . ALA B 1 5  ? 22.302  10.677 65.086  1.00 51.06  ? 267 ALA B N   1 
ATOM   600  C  CA  . ALA B 1 5  ? 22.383  11.850 65.946  1.00 37.97  ? 267 ALA B CA  1 
ATOM   601  C  C   . ALA B 1 5  ? 21.016  12.511 66.081  1.00 51.07  ? 267 ALA B C   1 
ATOM   602  O  O   . ALA B 1 5  ? 20.532  12.737 67.190  1.00 64.80  ? 267 ALA B O   1 
ATOM   603  C  CB  . ALA B 1 5  ? 23.405  12.836 65.402  1.00 30.97  ? 267 ALA B CB  1 
ATOM   604  N  N   . ALA B 1 6  ? 20.395  12.819 64.946  1.00 27.49  ? 268 ALA B N   1 
ATOM   605  C  CA  . ALA B 1 6  ? 19.071  13.430 64.945  1.00 22.08  ? 268 ALA B CA  1 
ATOM   606  C  C   . ALA B 1 6  ? 18.064  12.582 65.718  1.00 33.12  ? 268 ALA B C   1 
ATOM   607  O  O   . ALA B 1 6  ? 17.141  13.110 66.339  1.00 47.25  ? 268 ALA B O   1 
ATOM   608  C  CB  . ALA B 1 6  ? 18.594  13.659 63.522  1.00 27.91  ? 268 ALA B CB  1 
ATOM   609  N  N   . LEU B 1 7  ? 18.242  11.266 65.669  1.00 32.61  ? 269 LEU B N   1 
ATOM   610  C  CA  . LEU B 1 7  ? 17.382  10.351 66.408  1.00 23.57  ? 269 LEU B CA  1 
ATOM   611  C  C   . LEU B 1 7  ? 17.661  10.429 67.899  1.00 35.82  ? 269 LEU B C   1 
ATOM   612  O  O   . LEU B 1 7  ? 16.733  10.502 68.709  1.00 31.98  ? 269 LEU B O   1 
ATOM   613  C  CB  . LEU B 1 7  ? 17.569  8.915  65.919  1.00 37.99  ? 269 LEU B CB  1 
ATOM   614  C  CG  . LEU B 1 7  ? 16.670  8.461  64.769  1.00 44.39  ? 269 LEU B CG  1 
ATOM   615  C  CD1 . LEU B 1 7  ? 17.131  7.116  64.239  1.00 55.28  ? 269 LEU B CD1 1 
ATOM   616  C  CD2 . LEU B 1 7  ? 15.223  8.397  65.229  1.00 33.96  ? 269 LEU B CD2 1 
ATOM   617  N  N   . ARG B 1 8  ? 18.942  10.407 68.256  1.00 29.87  ? 270 ARG B N   1 
ATOM   618  C  CA  . ARG B 1 8  ? 19.345  10.453 69.657  1.00 32.07  ? 270 ARG B CA  1 
ATOM   619  C  C   . ARG B 1 8  ? 18.909  11.758 70.313  1.00 37.76  ? 270 ARG B C   1 
ATOM   620  O  O   . ARG B 1 8  ? 18.442  11.767 71.452  1.00 41.32  ? 270 ARG B O   1 
ATOM   621  C  CB  . ARG B 1 8  ? 20.858  10.265 69.793  1.00 51.76  ? 270 ARG B CB  1 
ATOM   622  C  CG  . ARG B 1 8  ? 21.394  10.500 71.195  1.00 54.93  ? 270 ARG B CG  1 
ATOM   623  C  CD  . ARG B 1 8  ? 22.650  9.689  71.452  1.00 46.50  ? 270 ARG B CD  1 
ATOM   624  N  NE  . ARG B 1 8  ? 23.598  9.778  70.347  1.00 79.77  ? 270 ARG B NE  1 
ATOM   625  C  CZ  . ARG B 1 8  ? 24.596  10.653 70.287  1.00 99.52  ? 270 ARG B CZ  1 
ATOM   626  N  NH1 . ARG B 1 8  ? 24.778  11.521 71.271  1.00 95.96  ? 270 ARG B NH1 1 
ATOM   627  N  NH2 . ARG B 1 8  ? 25.412  10.659 69.241  1.00 75.67  ? 270 ARG B NH2 1 
ATOM   628  N  N   . ASP B 1 9  ? 19.055  12.858 69.582  1.00 29.90  ? 271 ASP B N   1 
ATOM   629  C  CA  . ASP B 1 9  ? 18.639  14.164 70.081  1.00 27.86  ? 271 ASP B CA  1 
ATOM   630  C  C   . ASP B 1 9  ? 17.157  14.150 70.441  1.00 35.79  ? 271 ASP B C   1 
ATOM   631  O  O   . ASP B 1 9  ? 16.761  14.629 71.503  1.00 37.21  ? 271 ASP B O   1 
ATOM   632  C  CB  . ASP B 1 9  ? 18.927  15.258 69.046  1.00 38.58  ? 271 ASP B CB  1 
ATOM   633  C  CG  . ASP B 1 9  ? 18.521  16.641 69.526  1.00 80.81  ? 271 ASP B CG  1 
ATOM   634  O  OD1 . ASP B 1 9  ? 18.372  16.831 70.752  1.00 63.16  ? 271 ASP B OD1 1 
ATOM   635  O  OD2 . ASP B 1 9  ? 18.348  17.539 68.675  1.00 75.45  ? 271 ASP B OD2 1 
ATOM   636  N  N   . VAL B 1 10 ? 16.346  13.585 69.554  1.00 42.71  ? 272 VAL B N   1 
ATOM   637  C  CA  . VAL B 1 10 ? 14.906  13.499 69.770  1.00 21.72  ? 272 VAL B CA  1 
ATOM   638  C  C   . VAL B 1 10 ? 14.564  12.575 70.937  1.00 36.53  ? 272 VAL B C   1 
ATOM   639  O  O   . VAL B 1 10 ? 13.615  12.827 71.676  1.00 37.49  ? 272 VAL B O   1 
ATOM   640  C  CB  . VAL B 1 10 ? 14.185  13.014 68.497  1.00 30.75  ? 272 VAL B CB  1 
ATOM   641  C  CG1 . VAL B 1 10 ? 12.701  12.793 68.762  1.00 11.57  ? 272 VAL B CG1 1 
ATOM   642  C  CG2 . VAL B 1 10 ? 14.391  14.010 67.367  1.00 37.02  ? 272 VAL B CG2 1 
ATOM   643  N  N   . ARG B 1 11 ? 15.337  11.504 71.103  1.00 37.43  ? 273 ARG B N   1 
ATOM   644  C  CA  . ARG B 1 11 ? 15.100  10.566 72.198  1.00 33.54  ? 273 ARG B CA  1 
ATOM   645  C  C   . ARG B 1 11 ? 15.397  11.231 73.533  1.00 32.26  ? 273 ARG B C   1 
ATOM   646  O  O   . ARG B 1 11 ? 14.725  10.970 74.532  1.00 23.55  ? 273 ARG B O   1 
ATOM   647  C  CB  . ARG B 1 11 ? 15.952  9.300  72.047  1.00 39.70  ? 273 ARG B CB  1 
ATOM   648  C  CG  . ARG B 1 11 ? 15.448  8.123  72.884  1.00 47.23  ? 273 ARG B CG  1 
ATOM   649  C  CD  . ARG B 1 11 ? 16.502  7.034  73.078  1.00 28.96  ? 273 ARG B CD  1 
ATOM   650  N  NE  . ARG B 1 11 ? 17.268  6.783  71.862  1.00 46.81  ? 273 ARG B NE  1 
ATOM   651  C  CZ  . ARG B 1 11 ? 18.561  7.060  71.720  1.00 68.54  ? 273 ARG B CZ  1 
ATOM   652  N  NH1 . ARG B 1 11 ? 19.249  7.587  72.725  1.00 55.59  ? 273 ARG B NH1 1 
ATOM   653  N  NH2 . ARG B 1 11 ? 19.167  6.803  70.570  1.00 54.00  ? 273 ARG B NH2 1 
ATOM   654  N  N   . GLN B 1 12 ? 16.419  12.083 73.542  1.00 40.08  ? 274 GLN B N   1 
ATOM   655  C  CA  . GLN B 1 12 ? 16.812  12.807 74.745  1.00 23.48  ? 274 GLN B CA  1 
ATOM   656  C  C   . GLN B 1 12 ? 15.795  13.889 75.069  1.00 34.79  ? 274 GLN B C   1 
ATOM   657  O  O   . GLN B 1 12 ? 15.416  14.075 76.224  1.00 29.86  ? 274 GLN B O   1 
ATOM   658  C  CB  . GLN B 1 12 ? 18.201  13.423 74.576  1.00 18.06  ? 274 GLN B CB  1 
ATOM   659  C  CG  . GLN B 1 12 ? 19.317  12.394 74.485  1.00 53.97  ? 274 GLN B CG  1 
ATOM   660  C  CD  . GLN B 1 12 ? 20.664  13.011 74.163  1.00 62.63  ? 274 GLN B CD  1 
ATOM   661  O  OE1 . GLN B 1 12 ? 20.810  14.233 74.133  1.00 67.02  ? 274 GLN B OE1 1 
ATOM   662  N  NE2 . GLN B 1 12 ? 21.658  12.165 73.917  1.00 69.23  ? 274 GLN B NE2 1 
ATOM   663  N  N   . GLN B 1 13 ? 15.354  14.600 74.037  1.00 33.43  ? 275 GLN B N   1 
ATOM   664  C  CA  . GLN B 1 13 ? 14.320  15.610 74.202  1.00 22.86  ? 275 GLN B CA  1 
ATOM   665  C  C   . GLN B 1 13 ? 13.047  14.977 74.742  1.00 26.39  ? 275 GLN B C   1 
ATOM   666  O  O   . GLN B 1 13 ? 12.408  15.523 75.638  1.00 48.72  ? 275 GLN B O   1 
ATOM   667  C  CB  . GLN B 1 13 ? 14.034  16.313 72.876  1.00 24.34  ? 275 GLN B CB  1 
ATOM   668  C  CG  . GLN B 1 13 ? 15.211  17.091 72.319  1.00 20.55  ? 275 GLN B CG  1 
ATOM   669  C  CD  . GLN B 1 13 ? 14.866  17.834 71.049  1.00 45.97  ? 275 GLN B CD  1 
ATOM   670  O  OE1 . GLN B 1 13 ? 13.789  18.420 70.931  1.00 26.42  ? 275 GLN B OE1 1 
ATOM   671  N  NE2 . GLN B 1 13 ? 15.783  17.818 70.086  1.00 35.66  ? 275 GLN B NE2 1 
ATOM   672  N  N   . TYR B 1 14 ? 12.687  13.819 74.200  1.00 21.05  ? 276 TYR B N   1 
ATOM   673  C  CA  . TYR B 1 14 ? 11.513  13.100 74.676  1.00 14.34  ? 276 TYR B CA  1 
ATOM   674  C  C   . TYR B 1 14 ? 11.662  12.739 76.154  1.00 20.33  ? 276 TYR B C   1 
ATOM   675  O  O   . TYR B 1 14 ? 10.818  13.096 76.977  1.00 24.20  ? 276 TYR B O   1 
ATOM   676  C  CB  . TYR B 1 14 ? 11.255  11.844 73.836  1.00 18.25  ? 276 TYR B CB  1 
ATOM   677  C  CG  . TYR B 1 14 ? 10.198  10.947 74.430  1.00 23.72  ? 276 TYR B CG  1 
ATOM   678  C  CD1 . TYR B 1 14 ? 8.856   11.124 74.123  1.00 30.04  ? 276 TYR B CD1 1 
ATOM   679  C  CD2 . TYR B 1 14 ? 10.542  9.936  75.314  1.00 20.17  ? 276 TYR B CD2 1 
ATOM   680  C  CE1 . TYR B 1 14 ? 7.885   10.310 74.678  1.00 32.34  ? 276 TYR B CE1 1 
ATOM   681  C  CE2 . TYR B 1 14 ? 9.583   9.120  75.872  1.00 25.00  ? 276 TYR B CE2 1 
ATOM   682  C  CZ  . TYR B 1 14 ? 8.257   9.308  75.552  1.00 30.70  ? 276 TYR B CZ  1 
ATOM   683  O  OH  . TYR B 1 14 ? 7.305   8.489  76.115  1.00 53.04  ? 276 TYR B OH  1 
ATOM   684  N  N   . GLU B 1 15 ? 12.743  12.041 76.485  1.00 26.77  ? 277 GLU B N   1 
ATOM   685  C  CA  . GLU B 1 15 ? 12.988  11.616 77.862  1.00 37.15  ? 277 GLU B CA  1 
ATOM   686  C  C   . GLU B 1 15 ? 13.008  12.795 78.831  1.00 29.37  ? 277 GLU B C   1 
ATOM   687  O  O   . GLU B 1 15 ? 12.546  12.688 79.967  1.00 35.37  ? 277 GLU B O   1 
ATOM   688  C  CB  . GLU B 1 15 ? 14.290  10.819 77.956  1.00 29.98  ? 277 GLU B CB  1 
ATOM   689  C  CG  . GLU B 1 15 ? 14.204  9.431  77.329  1.00 47.65  ? 277 GLU B CG  1 
ATOM   690  C  CD  . GLU B 1 15 ? 15.566  8.826  77.044  1.00 62.73  ? 277 GLU B CD  1 
ATOM   691  O  OE1 . GLU B 1 15 ? 16.579  9.539  77.204  1.00 57.25  ? 277 GLU B OE1 1 
ATOM   692  O  OE2 . GLU B 1 15 ? 15.625  7.640  76.655  1.00 79.46  ? 277 GLU B OE2 1 
ATOM   693  N  N   . SER B 1 16 ? 13.534  13.921 78.364  1.00 25.62  ? 278 SER B N   1 
ATOM   694  C  CA  . SER B 1 16 ? 13.570  15.146 79.150  1.00 18.18  ? 278 SER B CA  1 
ATOM   695  C  C   . SER B 1 16 ? 12.162  15.698 79.364  1.00 46.22  ? 278 SER B C   1 
ATOM   696  O  O   . SER B 1 16 ? 11.758  15.978 80.493  1.00 37.24  ? 278 SER B O   1 
ATOM   697  C  CB  . SER B 1 16 ? 14.444  16.185 78.448  1.00 19.65  ? 278 SER B CB  1 
ATOM   698  O  OG  . SER B 1 16 ? 14.260  17.475 79.003  1.00 65.59  ? 278 SER B OG  1 
ATOM   699  N  N   . VAL B 1 17 ? 11.414  15.845 78.275  1.00 34.57  ? 279 VAL B N   1 
ATOM   700  C  CA  . VAL B 1 17 ? 10.051  16.364 78.346  1.00 35.83  ? 279 VAL B CA  1 
ATOM   701  C  C   . VAL B 1 17 ? 9.123   15.417 79.105  1.00 35.81  ? 279 VAL B C   1 
ATOM   702  O  O   . VAL B 1 17 ? 8.280   15.856 79.885  1.00 39.04  ? 279 VAL B O   1 
ATOM   703  C  CB  . VAL B 1 17 ? 9.472   16.636 76.942  1.00 24.23  ? 279 VAL B CB  1 
ATOM   704  C  CG1 . VAL B 1 17 ? 8.036   17.110 77.045  1.00 45.43  ? 279 VAL B CG1 1 
ATOM   705  C  CG2 . VAL B 1 17 ? 10.316  17.663 76.214  1.00 31.76  ? 279 VAL B CG2 1 
ATOM   706  N  N   . ALA B 1 18 ? 9.277   14.117 78.873  1.00 21.98  ? 280 ALA B N   1 
ATOM   707  C  CA  . ALA B 1 18 ? 8.466   13.119 79.565  1.00 31.42  ? 280 ALA B CA  1 
ATOM   708  C  C   . ALA B 1 18 ? 8.607   13.242 81.079  1.00 32.55  ? 280 ALA B C   1 
ATOM   709  O  O   . ALA B 1 18 ? 7.641   13.058 81.818  1.00 22.43  ? 280 ALA B O   1 
ATOM   710  C  CB  . ALA B 1 18 ? 8.837   11.715 79.108  1.00 11.80  ? 280 ALA B CB  1 
ATOM   711  N  N   . ALA B 1 19 ? 9.815   13.559 81.537  1.00 23.96  ? 281 ALA B N   1 
ATOM   712  C  CA  . ALA B 1 19 ? 10.071  13.709 82.965  1.00 25.04  ? 281 ALA B CA  1 
ATOM   713  C  C   . ALA B 1 19 ? 9.286   14.881 83.545  1.00 29.19  ? 281 ALA B C   1 
ATOM   714  O  O   . ALA B 1 19 ? 8.503   14.706 84.478  1.00 40.44  ? 281 ALA B O   1 
ATOM   715  C  CB  . ALA B 1 19 ? 11.557  13.880 83.225  1.00 25.76  ? 281 ALA B CB  1 
ATOM   716  N  N   . LYS B 1 20 ? 9.501   16.070 82.988  1.00 22.41  ? 282 LYS B N   1 
ATOM   717  C  CA  . LYS B 1 20 ? 8.811   17.276 83.440  1.00 24.80  ? 282 LYS B CA  1 
ATOM   718  C  C   . LYS B 1 20 ? 7.295   17.130 83.346  1.00 27.01  ? 282 LYS B C   1 
ATOM   719  O  O   . LYS B 1 20 ? 6.560   17.636 84.196  1.00 27.62  ? 282 LYS B O   1 
ATOM   720  C  CB  . LYS B 1 20 ? 9.285   18.496 82.644  1.00 23.33  ? 282 LYS B CB  1 
ATOM   721  C  CG  . LYS B 1 20 ? 10.772  18.774 82.789  1.00 69.11  ? 282 LYS B CG  1 
ATOM   722  C  CD  . LYS B 1 20 ? 11.253  19.825 81.809  1.00 55.87  ? 282 LYS B CD  1 
ATOM   723  C  CE  . LYS B 1 20 ? 12.756  20.027 81.920  1.00 75.01  ? 282 LYS B CE  1 
ATOM   724  N  NZ  . LYS B 1 20 ? 13.279  20.957 80.881  1.00 101.18 ? 282 LYS B NZ  1 
ATOM   725  N  N   . ASN B 1 21 ? 6.831   16.430 82.316  1.00 18.62  ? 283 ASN B N   1 
ATOM   726  C  CA  . ASN B 1 21 ? 5.405   16.165 82.161  1.00 11.79  ? 283 ASN B CA  1 
ATOM   727  C  C   . ASN B 1 21 ? 4.873   15.301 83.296  1.00 16.89  ? 283 ASN B C   1 
ATOM   728  O  O   . ASN B 1 21 ? 3.720   15.431 83.702  1.00 36.99  ? 283 ASN B O   1 
ATOM   729  C  CB  . ASN B 1 21 ? 5.120   15.491 80.818  1.00 24.21  ? 283 ASN B CB  1 
ATOM   730  C  CG  . ASN B 1 21 ? 5.173   16.464 79.651  1.00 30.74  ? 283 ASN B CG  1 
ATOM   731  O  OD1 . ASN B 1 21 ? 5.227   16.055 78.491  1.00 44.26  ? 283 ASN B OD1 1 
ATOM   732  N  ND2 . ASN B 1 21 ? 5.156   17.757 79.953  1.00 22.32  ? 283 ASN B ND2 1 
ATOM   733  N  N   . LEU B 1 22 ? 5.730   14.424 83.806  1.00 27.58  ? 284 LEU B N   1 
ATOM   734  C  CA  . LEU B 1 22 ? 5.359   13.501 84.872  1.00 22.46  ? 284 LEU B CA  1 
ATOM   735  C  C   . LEU B 1 22 ? 5.349   14.180 86.239  1.00 32.11  ? 284 LEU B C   1 
ATOM   736  O  O   . LEU B 1 22 ? 4.543   13.840 87.104  1.00 41.49  ? 284 LEU B O   1 
ATOM   737  C  CB  . LEU B 1 22 ? 6.322   12.314 84.899  1.00 26.20  ? 284 LEU B CB  1 
ATOM   738  C  CG  . LEU B 1 22 ? 6.129   11.301 86.031  1.00 54.12  ? 284 LEU B CG  1 
ATOM   739  C  CD1 . LEU B 1 22 ? 4.729   10.707 85.996  1.00 31.44  ? 284 LEU B CD1 1 
ATOM   740  C  CD2 . LEU B 1 22 ? 7.182   10.209 85.961  1.00 79.10  ? 284 LEU B CD2 1 
ATOM   741  N  N   . GLN B 1 23 ? 6.243   15.143 86.428  1.00 33.58  ? 285 GLN B N   1 
ATOM   742  C  CA  . GLN B 1 23 ? 6.374   15.813 87.718  1.00 39.92  ? 285 GLN B CA  1 
ATOM   743  C  C   . GLN B 1 23 ? 5.417   16.993 87.867  1.00 36.17  ? 285 GLN B C   1 
ATOM   744  O  O   . GLN B 1 23 ? 5.097   17.402 88.983  1.00 44.48  ? 285 GLN B O   1 
ATOM   745  C  CB  . GLN B 1 23 ? 7.823   16.243 87.956  1.00 24.72  ? 285 GLN B CB  1 
ATOM   746  C  CG  . GLN B 1 23 ? 8.828   15.115 87.745  1.00 77.82  ? 285 GLN B CG  1 
ATOM   747  C  CD  . GLN B 1 23 ? 8.368   13.786 88.338  1.00 94.01  ? 285 GLN B CD  1 
ATOM   748  O  OE1 . GLN B 1 23 ? 7.731   13.744 89.394  1.00 59.73  ? 285 GLN B OE1 1 
ATOM   749  N  NE2 . GLN B 1 23 ? 8.700   12.693 87.659  1.00 78.37  ? 285 GLN B NE2 1 
ATOM   750  N  N   . GLU B 1 24 ? 4.961   17.530 86.740  1.00 33.32  ? 286 GLU B N   1 
ATOM   751  C  CA  . GLU B 1 24 ? 3.970   18.598 86.752  1.00 24.51  ? 286 GLU B CA  1 
ATOM   752  C  C   . GLU B 1 24 ? 2.584   18.000 86.942  1.00 29.96  ? 286 GLU B C   1 
ATOM   753  O  O   . GLU B 1 24 ? 1.700   18.619 87.531  1.00 34.01  ? 286 GLU B O   1 
ATOM   754  C  CB  . GLU B 1 24 ? 4.031   19.405 85.457  1.00 26.49  ? 286 GLU B CB  1 
ATOM   755  C  CG  . GLU B 1 24 ? 5.263   20.285 85.340  1.00 31.33  ? 286 GLU B CG  1 
ATOM   756  C  CD  . GLU B 1 24 ? 5.340   21.004 84.009  1.00 45.65  ? 286 GLU B CD  1 
ATOM   757  O  OE1 . GLU B 1 24 ? 4.488   20.739 83.134  1.00 45.44  ? 286 GLU B OE1 1 
ATOM   758  O  OE2 . GLU B 1 24 ? 6.257   21.834 83.839  1.00 49.20  ? 286 GLU B OE2 1 
ATOM   759  N  N   . ALA B 1 25 ? 2.410   16.780 86.448  1.00 30.25  ? 287 ALA B N   1 
ATOM   760  C  CA  . ALA B 1 25 ? 1.147   16.072 86.586  1.00 17.41  ? 287 ALA B CA  1 
ATOM   761  C  C   . ALA B 1 25 ? 0.935   15.620 88.025  1.00 33.88  ? 287 ALA B C   1 
ATOM   762  O  O   . ALA B 1 25 ? -0.141  15.804 88.591  1.00 46.80  ? 287 ALA B O   1 
ATOM   763  C  CB  . ALA B 1 25 ? 1.111   14.879 85.649  1.00 15.17  ? 287 ALA B CB  1 
ATOM   764  N  N   . GLU B 1 26 ? 1.968   15.024 88.611  1.00 35.02  ? 288 GLU B N   1 
ATOM   765  C  CA  . GLU B 1 26 ? 1.888   14.535 89.983  1.00 25.12  ? 288 GLU B CA  1 
ATOM   766  C  C   . GLU B 1 26 ? 1.549   15.660 90.950  1.00 34.25  ? 288 GLU B C   1 
ATOM   767  O  O   . GLU B 1 26 ? 0.768   15.470 91.879  1.00 40.19  ? 288 GLU B O   1 
ATOM   768  C  CB  . GLU B 1 26 ? 3.192   13.855 90.402  1.00 38.59  ? 288 GLU B CB  1 
ATOM   769  C  CG  . GLU B 1 26 ? 3.390   12.474 89.806  1.00 36.83  ? 288 GLU B CG  1 
ATOM   770  C  CD  . GLU B 1 26 ? 4.544   11.722 90.441  1.00 91.16  ? 288 GLU B CD  1 
ATOM   771  O  OE1 . GLU B 1 26 ? 4.697   10.517 90.152  1.00 99.09  ? 288 GLU B OE1 1 
ATOM   772  O  OE2 . GLU B 1 26 ? 5.294   12.334 91.230  1.00 79.03  ? 288 GLU B OE2 1 
ATOM   773  N  N   . GLU B 1 27 ? 2.139   16.830 90.729  1.00 43.74  ? 289 GLU B N   1 
ATOM   774  C  CA  . GLU B 1 27 ? 1.837   18.001 91.546  1.00 34.44  ? 289 GLU B CA  1 
ATOM   775  C  C   . GLU B 1 27 ? 0.389   18.441 91.360  1.00 29.78  ? 289 GLU B C   1 
ATOM   776  O  O   . GLU B 1 27 ? -0.375  18.519 92.321  1.00 35.38  ? 289 GLU B O   1 
ATOM   777  C  CB  . GLU B 1 27 ? 2.766   19.164 91.194  1.00 27.45  ? 289 GLU B CB  1 
ATOM   778  C  CG  . GLU B 1 27 ? 4.238   18.890 91.425  1.00 47.44  ? 289 GLU B CG  1 
ATOM   779  C  CD  . GLU B 1 27 ? 5.124   19.992 90.876  1.00 74.85  ? 289 GLU B CD  1 
ATOM   780  O  OE1 . GLU B 1 27 ? 4.747   21.179 90.996  1.00 37.48  ? 289 GLU B OE1 1 
ATOM   781  O  OE2 . GLU B 1 27 ? 6.198   19.668 90.326  1.00 81.80  ? 289 GLU B OE2 1 
ATOM   782  N  N   . TRP B 1 28 ? 0.028   18.735 90.115  1.00 21.63  ? 290 TRP B N   1 
ATOM   783  C  CA  . TRP B 1 28 ? -1.307  19.217 89.786  1.00 21.31  ? 290 TRP B CA  1 
ATOM   784  C  C   . TRP B 1 28 ? -2.390  18.356 90.430  1.00 33.38  ? 290 TRP B C   1 
ATOM   785  O  O   . TRP B 1 28 ? -3.248  18.864 91.150  1.00 34.02  ? 290 TRP B O   1 
ATOM   786  C  CB  . TRP B 1 28 ? -1.493  19.268 88.268  1.00 22.56  ? 290 TRP B CB  1 
ATOM   787  C  CG  . TRP B 1 28 ? -2.706  20.025 87.839  1.00 29.83  ? 290 TRP B CG  1 
ATOM   788  C  CD1 . TRP B 1 28 ? -2.811  21.374 87.665  1.00 22.32  ? 290 TRP B CD1 1 
ATOM   789  C  CD2 . TRP B 1 28 ? -3.991  19.479 87.526  1.00 30.80  ? 290 TRP B CD2 1 
ATOM   790  N  NE1 . TRP B 1 28 ? -4.083  21.702 87.264  1.00 39.21  ? 290 TRP B NE1 1 
ATOM   791  C  CE2 . TRP B 1 28 ? -4.828  20.555 87.171  1.00 33.66  ? 290 TRP B CE2 1 
ATOM   792  C  CE3 . TRP B 1 28 ? -4.517  18.183 87.511  1.00 42.07  ? 290 TRP B CE3 1 
ATOM   793  C  CZ2 . TRP B 1 28 ? -6.160  20.377 86.806  1.00 33.56  ? 290 TRP B CZ2 1 
ATOM   794  C  CZ3 . TRP B 1 28 ? -5.839  18.008 87.149  1.00 54.78  ? 290 TRP B CZ3 1 
ATOM   795  C  CH2 . TRP B 1 28 ? -6.646  19.099 86.802  1.00 36.79  ? 290 TRP B CH2 1 
ATOM   796  N  N   . TYR B 1 29 ? -2.341  17.052 90.175  1.00 23.13  ? 291 TYR B N   1 
ATOM   797  C  CA  . TYR B 1 29 ? -3.316  16.131 90.751  1.00 32.15  ? 291 TYR B CA  1 
ATOM   798  C  C   . TYR B 1 29 ? -3.250  16.108 92.274  1.00 42.53  ? 291 TYR B C   1 
ATOM   799  O  O   . TYR B 1 29 ? -4.279  16.143 92.947  1.00 39.37  ? 291 TYR B O   1 
ATOM   800  C  CB  . TYR B 1 29 ? -3.130  14.718 90.193  1.00 22.61  ? 291 TYR B CB  1 
ATOM   801  C  CG  . TYR B 1 29 ? -3.630  14.557 88.775  1.00 42.59  ? 291 TYR B CG  1 
ATOM   802  C  CD1 . TYR B 1 29 ? -4.984  14.647 88.480  1.00 40.30  ? 291 TYR B CD1 1 
ATOM   803  C  CD2 . TYR B 1 29 ? -2.748  14.314 87.730  1.00 43.17  ? 291 TYR B CD2 1 
ATOM   804  C  CE1 . TYR B 1 29 ? -5.445  14.503 87.186  1.00 47.96  ? 291 TYR B CE1 1 
ATOM   805  C  CE2 . TYR B 1 29 ? -3.200  14.166 86.434  1.00 43.37  ? 291 TYR B CE2 1 
ATOM   806  C  CZ  . TYR B 1 29 ? -4.547  14.262 86.167  1.00 44.82  ? 291 TYR B CZ  1 
ATOM   807  O  OH  . TYR B 1 29 ? -4.990  14.116 84.873  1.00 63.13  ? 291 TYR B OH  1 
ATOM   808  N  N   . LYS B 1 30 ? -2.036  16.058 92.812  1.00 31.10  ? 292 LYS B N   1 
ATOM   809  C  CA  . LYS B 1 30 ? -1.841  16.004 94.257  1.00 21.79  ? 292 LYS B CA  1 
ATOM   810  C  C   . LYS B 1 30 ? -2.523  17.176 94.960  1.00 36.63  ? 292 LYS B C   1 
ATOM   811  O  O   . LYS B 1 30 ? -3.100  17.016 96.035  1.00 56.41  ? 292 LYS B O   1 
ATOM   812  C  CB  . LYS B 1 30 ? -0.349  15.982 94.593  1.00 25.61  ? 292 LYS B CB  1 
ATOM   813  C  CG  . LYS B 1 30 ? -0.041  15.820 96.065  1.00 57.42  ? 292 LYS B CG  1 
ATOM   814  C  CD  . LYS B 1 30 ? 1.447   15.988 96.336  1.00 83.09  ? 292 LYS B CD  1 
ATOM   815  C  CE  . LYS B 1 30 ? 1.956   17.340 95.841  1.00 96.48  ? 292 LYS B CE  1 
ATOM   816  N  NZ  . LYS B 1 30 ? 3.407   17.538 96.133  1.00 58.75  ? 292 LYS B NZ  1 
ATOM   817  N  N   . SER B 1 31 ? -2.462  18.352 94.343  1.00 36.29  ? 293 SER B N   1 
ATOM   818  C  CA  . SER B 1 31 ? -3.058  19.547 94.928  1.00 33.35  ? 293 SER B CA  1 
ATOM   819  C  C   . SER B 1 31 ? -4.570  19.561 94.730  1.00 35.81  ? 293 SER B C   1 
ATOM   820  O  O   . SER B 1 31 ? -5.320  19.881 95.649  1.00 47.76  ? 293 SER B O   1 
ATOM   821  C  CB  . SER B 1 31 ? -2.441  20.812 94.328  1.00 33.02  ? 293 SER B CB  1 
ATOM   822  O  OG  . SER B 1 31 ? -3.076  21.156 93.110  1.00 49.15  ? 293 SER B OG  1 
ATOM   823  N  N   . LYS B 1 32 ? -5.014  19.215 93.526  1.00 30.21  ? 294 LYS B N   1 
ATOM   824  C  CA  . LYS B 1 32 ? -6.441  19.177 93.230  1.00 38.93  ? 294 LYS B CA  1 
ATOM   825  C  C   . LYS B 1 32 ? -7.145  18.177 94.140  1.00 39.79  ? 294 LYS B C   1 
ATOM   826  O  O   . LYS B 1 32 ? -8.257  18.426 94.609  1.00 49.25  ? 294 LYS B O   1 
ATOM   827  C  CB  . LYS B 1 32 ? -6.686  18.835 91.758  1.00 31.65  ? 294 LYS B CB  1 
ATOM   828  C  CG  . LYS B 1 32 ? -6.082  19.831 90.787  1.00 52.35  ? 294 LYS B CG  1 
ATOM   829  C  CD  . LYS B 1 32 ? -6.303  21.257 91.259  1.00 24.37  ? 294 LYS B CD  1 
ATOM   830  C  CE  . LYS B 1 32 ? -5.441  22.233 90.481  1.00 29.77  ? 294 LYS B CE  1 
ATOM   831  N  NZ  . LYS B 1 32 ? -5.450  23.589 91.095  1.00 49.33  ? 294 LYS B NZ  1 
ATOM   832  N  N   . PHE B 1 33 ? -6.492  17.046 94.384  1.00 39.77  ? 295 PHE B N   1 
ATOM   833  C  CA  . PHE B 1 33 ? -7.010  16.059 95.319  1.00 46.51  ? 295 PHE B CA  1 
ATOM   834  C  C   . PHE B 1 33 ? -7.102  16.675 96.710  1.00 53.47  ? 295 PHE B C   1 
ATOM   835  O  O   . PHE B 1 33 ? -8.146  16.611 97.360  1.00 47.11  ? 295 PHE B O   1 
ATOM   836  C  CB  . PHE B 1 33 ? -6.117  14.817 95.350  1.00 50.21  ? 295 PHE B CB  1 
ATOM   837  C  CG  . PHE B 1 33 ? -6.496  13.829 96.417  1.00 71.33  ? 295 PHE B CG  1 
ATOM   838  C  CD1 . PHE B 1 33 ? -5.863  13.840 97.650  1.00 62.49  ? 295 PHE B CD1 1 
ATOM   839  C  CD2 . PHE B 1 33 ? -7.493  12.893 96.190  1.00 53.86  ? 295 PHE B CD2 1 
ATOM   840  C  CE1 . PHE B 1 33 ? -6.215  12.935 98.634  1.00 61.84  ? 295 PHE B CE1 1 
ATOM   841  C  CE2 . PHE B 1 33 ? -7.848  11.985 97.172  1.00 62.29  ? 295 PHE B CE2 1 
ATOM   842  C  CZ  . PHE B 1 33 ? -7.208  12.008 98.394  1.00 64.15  ? 295 PHE B CZ  1 
ATOM   843  N  N   . ALA B 1 34 ? -6.003  17.275 97.159  1.00 44.76  ? 296 ALA B N   1 
ATOM   844  C  CA  . ALA B 1 34 ? -5.970  17.944 98.453  1.00 40.90  ? 296 ALA B CA  1 
ATOM   845  C  C   . ALA B 1 34 ? -7.132  18.922 98.586  1.00 58.93  ? 296 ALA B C   1 
ATOM   846  O  O   . ALA B 1 34 ? -7.903  18.853 99.545  1.00 56.42  ? 296 ALA B O   1 
ATOM   847  C  CB  . ALA B 1 34 ? -4.646  18.661 98.647  1.00 22.55  ? 296 ALA B CB  1 
ATOM   848  N  N   . ASP B 1 35 ? -7.253  19.830 97.621  1.00 46.75  ? 297 ASP B N   1 
ATOM   849  C  CA  . ASP B 1 35 ? -8.337  20.806 97.619  1.00 52.54  ? 297 ASP B CA  1 
ATOM   850  C  C   . ASP B 1 35 ? -9.680  20.130 97.861  1.00 44.98  ? 297 ASP B C   1 
ATOM   851  O  O   . ASP B 1 35 ? -10.442 20.538 98.736  1.00 59.87  ? 297 ASP B O   1 
ATOM   852  C  CB  . ASP B 1 35 ? -8.372  21.568 96.293  1.00 38.69  ? 297 ASP B CB  1 
ATOM   853  C  CG  . ASP B 1 35 ? -7.257  22.586 96.177  1.00 48.37  ? 297 ASP B CG  1 
ATOM   854  O  OD1 . ASP B 1 35 ? -6.560  22.826 97.185  1.00 60.95  ? 297 ASP B OD1 1 
ATOM   855  O  OD2 . ASP B 1 35 ? -7.081  23.151 95.076  1.00 55.35  ? 297 ASP B OD2 1 
ATOM   856  N  N   . LEU B 1 36 ? -9.965  19.095 97.078  1.00 43.57  ? 298 LEU B N   1 
ATOM   857  C  CA  . LEU B 1 36 ? -11.218 18.359 97.203  1.00 49.87  ? 298 LEU B CA  1 
ATOM   858  C  C   . LEU B 1 36 ? -11.352 17.707 98.574  1.00 40.19  ? 298 LEU B C   1 
ATOM   859  O  O   . LEU B 1 36 ? -12.438 17.678 99.153  1.00 51.92  ? 298 LEU B O   1 
ATOM   860  C  CB  . LEU B 1 36 ? -11.339 17.305 96.100  1.00 37.91  ? 298 LEU B CB  1 
ATOM   861  C  CG  . LEU B 1 36 ? -11.467 17.845 94.675  1.00 35.68  ? 298 LEU B CG  1 
ATOM   862  C  CD1 . LEU B 1 36 ? -11.571 16.704 93.678  1.00 41.06  ? 298 LEU B CD1 1 
ATOM   863  C  CD2 . LEU B 1 36 ? -12.671 18.763 94.571  1.00 38.54  ? 298 LEU B CD2 1 
ATOM   864  N  N   . SER B 1 37 ? -10.247 17.184 99.092  1.00 42.11  ? 299 SER B N   1 
ATOM   865  C  CA  . SER B 1 37 ? -10.249 16.592 100.422 1.00 51.24  ? 299 SER B CA  1 
ATOM   866  C  C   . SER B 1 37 ? -10.606 17.631 101.481 1.00 57.67  ? 299 SER B C   1 
ATOM   867  O  O   . SER B 1 37 ? -11.356 17.347 102.414 1.00 38.23  ? 299 SER B O   1 
ATOM   868  C  CB  . SER B 1 37 ? -8.891  15.965 100.729 1.00 44.26  ? 299 SER B CB  1 
ATOM   869  O  OG  . SER B 1 37 ? -8.674  14.820 99.923  1.00 55.52  ? 299 SER B OG  1 
ATOM   870  N  N   . GLU B 1 38 ? -10.067 18.836 101.329 1.00 66.98  ? 300 GLU B N   1 
ATOM   871  C  CA  . GLU B 1 38 ? -10.352 19.927 102.253 1.00 54.84  ? 300 GLU B CA  1 
ATOM   872  C  C   . GLU B 1 38 ? -11.848 20.211 102.304 1.00 58.61  ? 300 GLU B C   1 
ATOM   873  O  O   . GLU B 1 38 ? -12.435 20.313 103.381 1.00 69.36  ? 300 GLU B O   1 
ATOM   874  C  CB  . GLU B 1 38 ? -9.600  21.193 101.834 1.00 58.48  ? 300 GLU B CB  1 
ATOM   875  C  CG  . GLU B 1 38 ? -8.095  21.017 101.685 1.00 89.39  ? 300 GLU B CG  1 
ATOM   876  C  CD  . GLU B 1 38 ? -7.400  22.303 101.270 1.00 109.77 ? 300 GLU B CD  1 
ATOM   877  O  OE1 . GLU B 1 38 ? -7.958  23.389 101.534 1.00 101.94 ? 300 GLU B OE1 1 
ATOM   878  O  OE2 . GLU B 1 38 ? -6.298  22.231 100.683 1.00 85.82  ? 300 GLU B OE2 1 
ATOM   879  N  N   . ALA B 1 39 ? -12.457 20.339 101.130 1.00 41.50  ? 301 ALA B N   1 
ATOM   880  C  CA  . ALA B 1 39 ? -13.876 20.663 101.025 1.00 54.56  ? 301 ALA B CA  1 
ATOM   881  C  C   . ALA B 1 39 ? -14.756 19.542 101.569 1.00 66.42  ? 301 ALA B C   1 
ATOM   882  O  O   . ALA B 1 39 ? -15.801 19.795 102.173 1.00 72.17  ? 301 ALA B O   1 
ATOM   883  C  CB  . ALA B 1 39 ? -14.240 20.972 99.579  1.00 30.13  ? 301 ALA B CB  1 
ATOM   884  N  N   . ALA B 1 40 ? -14.329 18.303 101.347 1.00 48.61  ? 302 ALA B N   1 
ATOM   885  C  CA  . ALA B 1 40 ? -15.070 17.141 101.820 1.00 38.79  ? 302 ALA B CA  1 
ATOM   886  C  C   . ALA B 1 40 ? -14.909 16.990 103.327 1.00 51.32  ? 302 ALA B C   1 
ATOM   887  O  O   . ALA B 1 40 ? -15.763 16.411 103.996 1.00 49.18  ? 302 ALA B O   1 
ATOM   888  C  CB  . ALA B 1 40 ? -14.603 15.888 101.105 1.00 45.39  ? 302 ALA B CB  1 
ATOM   889  N  N   . ASN B 1 41 ? -13.805 17.511 103.853 1.00 50.71  ? 303 ASN B N   1 
ATOM   890  C  CA  . ASN B 1 41 ? -13.552 17.502 105.287 1.00 44.91  ? 303 ASN B CA  1 
ATOM   891  C  C   . ASN B 1 41 ? -14.404 18.543 106.001 1.00 68.13  ? 303 ASN B C   1 
ATOM   892  O  O   . ASN B 1 41 ? -15.127 18.226 106.947 1.00 61.68  ? 303 ASN B O   1 
ATOM   893  C  CB  . ASN B 1 41 ? -12.068 17.751 105.571 1.00 54.01  ? 303 ASN B CB  1 
ATOM   894  C  CG  . ASN B 1 41 ? -11.220 16.513 105.369 1.00 55.68  ? 303 ASN B CG  1 
ATOM   895  O  OD1 . ASN B 1 41 ? -11.722 15.389 105.400 1.00 57.54  ? 303 ASN B OD1 1 
ATOM   896  N  ND2 . ASN B 1 41 ? -9.922  16.713 105.170 1.00 64.12  ? 303 ASN B ND2 1 
ATOM   897  N  N   . ARG B 1 42 ? -14.308 19.787 105.543 1.00 61.52  ? 304 ARG B N   1 
ATOM   898  C  CA  . ARG B 1 42 ? -15.098 20.875 106.102 1.00 47.82  ? 304 ARG B CA  1 
ATOM   899  C  C   . ARG B 1 42 ? -16.573 20.499 106.124 1.00 54.25  ? 304 ARG B C   1 
ATOM   900  O  O   . ARG B 1 42 ? -17.240 20.626 107.151 1.00 75.44  ? 304 ARG B O   1 
ATOM   901  C  CB  . ARG B 1 42 ? -14.895 22.154 105.290 1.00 61.77  ? 304 ARG B CB  1 
ATOM   902  C  CG  . ARG B 1 42 ? -13.464 22.664 105.285 1.00 92.28  ? 304 ARG B CG  1 
ATOM   903  C  CD  . ARG B 1 42 ? -13.299 23.818 104.312 1.00 87.39  ? 304 ARG B CD  1 
ATOM   904  N  NE  . ARG B 1 42 ? -14.214 24.915 104.609 1.00 95.92  ? 304 ARG B NE  1 
ATOM   905  C  CZ  . ARG B 1 42 ? -14.317 26.018 103.877 1.00 109.05 ? 304 ARG B CZ  1 
ATOM   906  N  NH1 . ARG B 1 42 ? -13.560 26.175 102.800 1.00 95.44  ? 304 ARG B NH1 1 
ATOM   907  N  NH2 . ARG B 1 42 ? -15.179 26.965 104.223 1.00 111.15 ? 304 ARG B NH2 1 
ATOM   908  N  N   . ASN B 1 43 ? -17.073 20.033 104.984 1.00 53.50  ? 305 ASN B N   1 
ATOM   909  C  CA  . ASN B 1 43 ? -18.461 19.605 104.880 1.00 44.41  ? 305 ASN B CA  1 
ATOM   910  C  C   . ASN B 1 43 ? -18.760 18.500 105.886 1.00 53.89  ? 305 ASN B C   1 
ATOM   911  O  O   . ASN B 1 43 ? -19.766 18.550 106.592 1.00 52.67  ? 305 ASN B O   1 
ATOM   912  C  CB  . ASN B 1 43 ? -18.776 19.128 103.461 1.00 53.97  ? 305 ASN B CB  1 
ATOM   913  C  CG  . ASN B 1 43 ? -20.256 18.867 103.249 1.00 65.94  ? 305 ASN B CG  1 
ATOM   914  O  OD1 . ASN B 1 43 ? -20.667 17.736 102.991 1.00 33.60  ? 305 ASN B OD1 1 
ATOM   915  N  ND2 . ASN B 1 43 ? -21.066 19.915 103.365 1.00 43.55  ? 305 ASN B ND2 1 
ATOM   916  N  N   . ASN B 1 44 ? -17.874 17.509 105.944 1.00 51.75  ? 306 ASN B N   1 
ATOM   917  C  CA  . ASN B 1 44 ? -17.993 16.411 106.897 1.00 45.11  ? 306 ASN B CA  1 
ATOM   918  C  C   . ASN B 1 44 ? -18.187 16.915 108.323 1.00 65.37  ? 306 ASN B C   1 
ATOM   919  O  O   . ASN B 1 44 ? -19.087 16.465 109.031 1.00 62.99  ? 306 ASN B O   1 
ATOM   920  C  CB  . ASN B 1 44 ? -16.757 15.512 106.831 1.00 56.69  ? 306 ASN B CB  1 
ATOM   921  C  CG  . ASN B 1 44 ? -16.859 14.309 107.749 1.00 82.52  ? 306 ASN B CG  1 
ATOM   922  O  OD1 . ASN B 1 44 ? -17.823 13.545 107.686 1.00 62.78  ? 306 ASN B OD1 1 
ATOM   923  N  ND2 . ASN B 1 44 ? -15.857 14.129 108.603 1.00 82.66  ? 306 ASN B ND2 1 
ATOM   924  N  N   . ASP B 1 45 ? -17.335 17.848 108.737 1.00 73.69  ? 307 ASP B N   1 
ATOM   925  C  CA  . ASP B 1 45 ? -17.430 18.442 110.066 1.00 55.98  ? 307 ASP B CA  1 
ATOM   926  C  C   . ASP B 1 45 ? -18.798 19.075 110.279 1.00 65.88  ? 307 ASP B C   1 
ATOM   927  O  O   . ASP B 1 45 ? -19.432 18.874 111.315 1.00 69.48  ? 307 ASP B O   1 
ATOM   928  C  CB  . ASP B 1 45 ? -16.333 19.488 110.271 1.00 57.32  ? 307 ASP B CB  1 
ATOM   929  C  CG  . ASP B 1 45 ? -14.965 18.868 110.471 1.00 81.89  ? 307 ASP B CG  1 
ATOM   930  O  OD1 . ASP B 1 45 ? -14.888 17.636 110.670 1.00 81.70  ? 307 ASP B OD1 1 
ATOM   931  O  OD2 . ASP B 1 45 ? -13.965 19.615 110.435 1.00 75.62  ? 307 ASP B OD2 1 
ATOM   932  N  N   . ALA B 1 46 ? -19.244 19.841 109.288 1.00 61.05  ? 308 ALA B N   1 
ATOM   933  C  CA  . ALA B 1 46 ? -20.544 20.496 109.341 1.00 46.30  ? 308 ALA B CA  1 
ATOM   934  C  C   . ALA B 1 46 ? -21.646 19.478 109.606 1.00 46.58  ? 308 ALA B C   1 
ATOM   935  O  O   . ALA B 1 46 ? -22.664 19.798 110.217 1.00 55.73  ? 308 ALA B O   1 
ATOM   936  C  CB  . ALA B 1 46 ? -20.812 21.242 108.044 1.00 41.04  ? 308 ALA B CB  1 
ATOM   937  N  N   . LEU B 1 47 ? -21.435 18.250 109.144 1.00 65.12  ? 309 LEU B N   1 
ATOM   938  C  CA  . LEU B 1 47 ? -22.403 17.178 109.339 1.00 76.12  ? 309 LEU B CA  1 
ATOM   939  C  C   . LEU B 1 47 ? -22.375 16.667 110.776 1.00 64.82  ? 309 LEU B C   1 
ATOM   940  O  O   . LEU B 1 47 ? -23.414 16.564 111.425 1.00 65.91  ? 309 LEU B O   1 
ATOM   941  C  CB  . LEU B 1 47 ? -22.141 16.027 108.364 1.00 39.86  ? 309 LEU B CB  1 
ATOM   942  C  CG  . LEU B 1 47 ? -23.224 14.949 108.303 1.00 50.38  ? 309 LEU B CG  1 
ATOM   943  C  CD1 . LEU B 1 47 ? -24.538 15.531 107.804 1.00 39.44  ? 309 LEU B CD1 1 
ATOM   944  C  CD2 . LEU B 1 47 ? -22.780 13.794 107.422 1.00 62.58  ? 309 LEU B CD2 1 
ATOM   945  N  N   . ARG B 1 48 ? -21.180 16.344 111.263 1.00 59.67  ? 310 ARG B N   1 
ATOM   946  C  CA  . ARG B 1 48 ? -21.016 15.866 112.631 1.00 71.30  ? 310 ARG B CA  1 
ATOM   947  C  C   . ARG B 1 48 ? -21.515 16.897 113.636 1.00 86.86  ? 310 ARG B C   1 
ATOM   948  O  O   . ARG B 1 48 ? -22.161 16.552 114.626 1.00 80.76  ? 310 ARG B O   1 
ATOM   949  C  CB  . ARG B 1 48 ? -19.552 15.524 112.918 1.00 71.92  ? 310 ARG B CB  1 
ATOM   950  C  CG  . ARG B 1 48 ? -19.049 14.267 112.225 1.00 81.65  ? 310 ARG B CG  1 
ATOM   951  C  CD  . ARG B 1 48 ? -17.749 13.770 112.845 1.00 78.31  ? 310 ARG B CD  1 
ATOM   952  N  NE  . ARG B 1 48 ? -16.689 14.774 112.796 1.00 101.02 ? 310 ARG B NE  1 
ATOM   953  C  CZ  . ARG B 1 48 ? -16.388 15.596 113.797 1.00 100.57 ? 310 ARG B CZ  1 
ATOM   954  N  NH1 . ARG B 1 48 ? -17.066 15.538 114.935 1.00 92.64  ? 310 ARG B NH1 1 
ATOM   955  N  NH2 . ARG B 1 48 ? -15.406 16.477 113.660 1.00 87.17  ? 310 ARG B NH2 1 
ATOM   956  N  N   . GLN B 1 49 ? -21.210 18.164 113.375 1.00 75.81  ? 311 GLN B N   1 
ATOM   957  C  CA  . GLN B 1 49 ? -21.648 19.251 114.240 1.00 66.26  ? 311 GLN B CA  1 
ATOM   958  C  C   . GLN B 1 49 ? -23.171 19.325 114.278 1.00 68.83  ? 311 GLN B C   1 
ATOM   959  O  O   . GLN B 1 49 ? -23.763 19.630 115.313 1.00 91.71  ? 311 GLN B O   1 
ATOM   960  C  CB  . GLN B 1 49 ? -21.055 20.581 113.767 1.00 68.20  ? 311 GLN B CB  1 
ATOM   961  C  CG  . GLN B 1 49 ? -21.350 21.766 114.676 1.00 93.72  ? 311 GLN B CG  1 
ATOM   962  C  CD  . GLN B 1 49 ? -22.723 22.364 114.437 1.00 96.05  ? 311 GLN B CD  1 
ATOM   963  O  OE1 . GLN B 1 49 ? -23.391 22.046 113.452 1.00 79.14  ? 311 GLN B OE1 1 
ATOM   964  N  NE2 . GLN B 1 49 ? -23.149 23.241 115.338 1.00 98.51  ? 311 GLN B NE2 1 
ATOM   965  N  N   . ALA B 1 50 ? -23.799 19.036 113.142 1.00 61.35  ? 312 ALA B N   1 
ATOM   966  C  CA  . ALA B 1 50 ? -25.253 19.063 113.039 1.00 58.25  ? 312 ALA B CA  1 
ATOM   967  C  C   . ALA B 1 50 ? -25.886 17.833 113.683 1.00 66.17  ? 312 ALA B C   1 
ATOM   968  O  O   . ALA B 1 50 ? -26.943 17.925 114.305 1.00 64.44  ? 312 ALA B O   1 
ATOM   969  C  CB  . ALA B 1 50 ? -25.680 19.181 111.583 1.00 65.77  ? 312 ALA B CB  1 
ATOM   970  N  N   . LYS B 1 51 ? -25.237 16.682 113.528 1.00 67.69  ? 313 LYS B N   1 
ATOM   971  C  CA  . LYS B 1 51 ? -25.726 15.441 114.122 1.00 76.48  ? 313 LYS B CA  1 
ATOM   972  C  C   . LYS B 1 51 ? -25.681 15.497 115.648 1.00 72.42  ? 313 LYS B C   1 
ATOM   973  O  O   . LYS B 1 51 ? -26.642 15.124 116.320 1.00 60.72  ? 313 LYS B O   1 
ATOM   974  C  CB  . LYS B 1 51 ? -24.922 14.239 113.616 1.00 59.04  ? 313 LYS B CB  1 
ATOM   975  C  CG  . LYS B 1 51 ? -25.323 13.748 112.232 1.00 68.24  ? 313 LYS B CG  1 
ATOM   976  C  CD  . LYS B 1 51 ? -24.572 12.474 111.866 1.00 79.99  ? 313 LYS B CD  1 
ATOM   977  C  CE  . LYS B 1 51 ? -25.045 11.902 110.538 1.00 91.54  ? 313 LYS B CE  1 
ATOM   978  N  NZ  . LYS B 1 51 ? -26.473 11.480 110.582 1.00 100.08 ? 313 LYS B NZ  1 
ATOM   979  N  N   . GLN B 1 52 ? -24.560 15.964 116.188 1.00 77.79  ? 314 GLN B N   1 
ATOM   980  C  CA  . GLN B 1 52 ? -24.407 16.100 117.632 1.00 85.56  ? 314 GLN B CA  1 
ATOM   981  C  C   . GLN B 1 52 ? -25.414 17.103 118.184 1.00 84.48  ? 314 GLN B C   1 
ATOM   982  O  O   . GLN B 1 52 ? -25.800 17.034 119.351 1.00 79.54  ? 314 GLN B O   1 
ATOM   983  C  CB  . GLN B 1 52 ? -22.982 16.535 117.984 1.00 94.91  ? 314 GLN B CB  1 
ATOM   984  C  CG  . GLN B 1 52 ? -21.913 15.511 117.637 1.00 112.22 ? 314 GLN B CG  1 
ATOM   985  C  CD  . GLN B 1 52 ? -20.509 16.017 117.911 1.00 125.35 ? 314 GLN B CD  1 
ATOM   986  O  OE1 . GLN B 1 52 ? -20.319 17.157 118.334 1.00 125.40 ? 314 GLN B OE1 1 
ATOM   987  N  NE2 . GLN B 1 52 ? -19.516 15.169 117.668 1.00 99.95  ? 314 GLN B NE2 1 
ATOM   988  N  N   . GLU B 1 53 ? -25.836 18.033 117.334 1.00 61.74  ? 315 GLU B N   1 
ATOM   989  C  CA  . GLU B 1 53 ? -26.807 19.047 117.724 1.00 55.56  ? 315 GLU B CA  1 
ATOM   990  C  C   . GLU B 1 53 ? -28.203 18.439 117.833 1.00 48.41  ? 315 GLU B C   1 
ATOM   991  O  O   . GLU B 1 53 ? -28.912 18.661 118.816 1.00 69.61  ? 315 GLU B O   1 
ATOM   992  C  CB  . GLU B 1 53 ? -26.802 20.200 116.718 1.00 39.39  ? 315 GLU B CB  1 
ATOM   993  C  CG  . GLU B 1 53 ? -27.474 21.469 117.216 1.00 45.02  ? 315 GLU B CG  1 
ATOM   994  C  CD  . GLU B 1 53 ? -27.172 22.669 116.338 1.00 89.44  ? 315 GLU B CD  1 
ATOM   995  O  OE1 . GLU B 1 53 ? -27.835 23.716 116.502 1.00 80.37  ? 315 GLU B OE1 1 
ATOM   996  O  OE2 . GLU B 1 53 ? -26.269 22.565 115.482 1.00 88.35  ? 315 GLU B OE2 1 
ATOM   997  N  N   . SER B 1 54 ? -28.590 17.666 116.824 1.00 61.27  ? 316 SER B N   1 
ATOM   998  C  CA  . SER B 1 54 ? -29.883 16.992 116.831 1.00 72.12  ? 316 SER B CA  1 
ATOM   999  C  C   . SER B 1 54 ? -29.996 16.001 117.985 1.00 69.71  ? 316 SER B C   1 
ATOM   1000 O  O   . SER B 1 54 ? -31.009 15.961 118.682 1.00 59.24  ? 316 SER B O   1 
ATOM   1001 C  CB  . SER B 1 54 ? -30.126 16.277 115.500 1.00 53.58  ? 316 SER B CB  1 
ATOM   1002 O  OG  . SER B 1 54 ? -30.382 17.208 114.463 1.00 63.35  ? 316 SER B OG  1 
ATOM   1003 N  N   . THR B 1 55 ? -28.953 15.199 118.176 1.00 83.08  ? 317 THR B N   1 
ATOM   1004 C  CA  . THR B 1 55 ? -28.922 14.227 119.262 1.00 80.49  ? 317 THR B CA  1 
ATOM   1005 C  C   . THR B 1 55 ? -28.964 14.931 120.613 1.00 82.21  ? 317 THR B C   1 
ATOM   1006 O  O   . THR B 1 55 ? -29.536 14.418 121.573 1.00 68.04  ? 317 THR B O   1 
ATOM   1007 C  CB  . THR B 1 55 ? -27.671 13.328 119.186 1.00 79.71  ? 317 THR B CB  1 
ATOM   1008 O  OG1 . THR B 1 55 ? -27.793 12.426 118.079 1.00 79.17  ? 317 THR B OG1 1 
ATOM   1009 C  CG2 . THR B 1 55 ? -27.511 12.521 120.466 1.00 83.35  ? 317 THR B CG2 1 
ATOM   1010 N  N   . GLU B 1 56 ? -28.358 16.113 120.678 1.00 78.42  ? 318 GLU B N   1 
ATOM   1011 C  CA  . GLU B 1 56 ? -28.378 16.919 121.892 1.00 70.91  ? 318 GLU B CA  1 
ATOM   1012 C  C   . GLU B 1 56 ? -29.803 17.305 122.268 1.00 65.59  ? 318 GLU B C   1 
ATOM   1013 O  O   . GLU B 1 56 ? -30.220 17.134 123.413 1.00 76.90  ? 318 GLU B O   1 
ATOM   1014 C  CB  . GLU B 1 56 ? -27.537 18.184 121.712 1.00 88.61  ? 318 GLU B CB  1 
ATOM   1015 C  CG  . GLU B 1 56 ? -27.686 19.188 122.842 1.00 99.03  ? 318 GLU B CG  1 
ATOM   1016 C  CD  . GLU B 1 56 ? -27.170 20.565 122.470 1.00 106.97 ? 318 GLU B CD  1 
ATOM   1017 O  OE1 . GLU B 1 56 ? -26.503 20.689 121.421 1.00 97.99  ? 318 GLU B OE1 1 
ATOM   1018 O  OE2 . GLU B 1 56 ? -27.435 21.523 123.226 1.00 109.91 ? 318 GLU B OE2 1 
ATOM   1019 N  N   . TYR B 1 57 ? -30.545 17.832 121.299 1.00 63.15  ? 319 TYR B N   1 
ATOM   1020 C  CA  . TYR B 1 57 ? -31.923 18.246 121.538 1.00 64.33  ? 319 TYR B CA  1 
ATOM   1021 C  C   . TYR B 1 57 ? -32.813 17.050 121.865 1.00 66.02  ? 319 TYR B C   1 
ATOM   1022 O  O   . TYR B 1 57 ? -33.673 17.125 122.742 1.00 53.05  ? 319 TYR B O   1 
ATOM   1023 C  CB  . TYR B 1 57 ? -32.483 19.006 120.333 1.00 54.97  ? 319 TYR B CB  1 
ATOM   1024 C  CG  . TYR B 1 57 ? -31.782 20.314 120.041 1.00 72.33  ? 319 TYR B CG  1 
ATOM   1025 C  CD1 . TYR B 1 57 ? -31.464 20.678 118.739 1.00 70.33  ? 319 TYR B CD1 1 
ATOM   1026 C  CD2 . TYR B 1 57 ? -31.433 21.182 121.068 1.00 89.09  ? 319 TYR B CD2 1 
ATOM   1027 C  CE1 . TYR B 1 57 ? -30.825 21.873 118.466 1.00 71.15  ? 319 TYR B CE1 1 
ATOM   1028 C  CE2 . TYR B 1 57 ? -30.791 22.379 120.805 1.00 90.99  ? 319 TYR B CE2 1 
ATOM   1029 C  CZ  . TYR B 1 57 ? -30.490 22.718 119.503 1.00 89.01  ? 319 TYR B CZ  1 
ATOM   1030 O  OH  . TYR B 1 57 ? -29.851 23.907 119.235 1.00 87.88  ? 319 TYR B OH  1 
ATOM   1031 N  N   . ARG B 1 58 ? -32.604 15.947 121.154 1.00 56.43  ? 320 ARG B N   1 
ATOM   1032 C  CA  . ARG B 1 58 ? -33.371 14.733 121.401 1.00 70.66  ? 320 ARG B CA  1 
ATOM   1033 C  C   . ARG B 1 58 ? -33.269 14.311 122.861 1.00 48.85  ? 320 ARG B C   1 
ATOM   1034 O  O   . ARG B 1 58 ? -34.246 13.854 123.447 1.00 51.87  ? 320 ARG B O   1 
ATOM   1035 C  CB  . ARG B 1 58 ? -32.917 13.599 120.479 1.00 68.60  ? 320 ARG B CB  1 
ATOM   1036 C  CG  . ARG B 1 58 ? -33.540 13.640 119.097 1.00 59.49  ? 320 ARG B CG  1 
ATOM   1037 C  CD  . ARG B 1 58 ? -32.975 12.547 118.205 1.00 76.19  ? 320 ARG B CD  1 
ATOM   1038 N  NE  . ARG B 1 58 ? -33.151 11.218 118.783 1.00 85.93  ? 320 ARG B NE  1 
ATOM   1039 C  CZ  . ARG B 1 58 ? -32.750 10.094 118.198 1.00 101.27 ? 320 ARG B CZ  1 
ATOM   1040 N  NH1 . ARG B 1 58 ? -32.150 10.139 117.018 1.00 100.74 ? 320 ARG B NH1 1 
ATOM   1041 N  NH2 . ARG B 1 58 ? -32.949 8.927  118.793 1.00 93.32  ? 320 ARG B NH2 1 
ATOM   1042 N  N   . ARG B 1 59 ? -32.081 14.462 123.442 1.00 54.21  ? 321 ARG B N   1 
ATOM   1043 C  CA  . ARG B 1 59 ? -31.881 14.180 124.858 1.00 55.83  ? 321 ARG B CA  1 
ATOM   1044 C  C   . ARG B 1 59 ? -32.885 14.978 125.677 1.00 74.59  ? 321 ARG B C   1 
ATOM   1045 O  O   . ARG B 1 59 ? -33.560 14.438 126.555 1.00 56.47  ? 321 ARG B O   1 
ATOM   1046 C  CB  . ARG B 1 59 ? -30.462 14.554 125.289 1.00 49.17  ? 321 ARG B CB  1 
ATOM   1047 C  CG  . ARG B 1 59 ? -29.360 13.750 124.626 1.00 95.17  ? 321 ARG B CG  1 
ATOM   1048 C  CD  . ARG B 1 59 ? -27.991 14.292 125.011 1.00 107.72 ? 321 ARG B CD  1 
ATOM   1049 N  NE  . ARG B 1 59 ? -26.902 13.597 124.330 1.00 120.10 ? 321 ARG B NE  1 
ATOM   1050 C  CZ  . ARG B 1 59 ? -25.631 13.984 124.369 1.00 107.05 ? 321 ARG B CZ  1 
ATOM   1051 N  NH1 . ARG B 1 59 ? -25.286 15.066 125.055 1.00 76.00  ? 321 ARG B NH1 1 
ATOM   1052 N  NH2 . ARG B 1 59 ? -24.706 13.292 123.719 1.00 109.06 ? 321 ARG B NH2 1 
ATOM   1053 N  N   . GLN B 1 60 ? -32.972 16.271 125.378 1.00 58.58  ? 322 GLN B N   1 
ATOM   1054 C  CA  . GLN B 1 60 ? -33.911 17.157 126.052 1.00 56.02  ? 322 GLN B CA  1 
ATOM   1055 C  C   . GLN B 1 60 ? -35.343 16.680 125.847 1.00 56.64  ? 322 GLN B C   1 
ATOM   1056 O  O   . GLN B 1 60 ? -36.076 16.471 126.810 1.00 77.45  ? 322 GLN B O   1 
ATOM   1057 C  CB  . GLN B 1 60 ? -33.755 18.592 125.546 1.00 43.84  ? 322 GLN B CB  1 
ATOM   1058 C  CG  . GLN B 1 60 ? -32.352 19.156 125.695 1.00 40.08  ? 322 GLN B CG  1 
ATOM   1059 C  CD  . GLN B 1 60 ? -32.244 20.583 125.191 1.00 60.69  ? 322 GLN B CD  1 
ATOM   1060 O  OE1 . GLN B 1 60 ? -33.251 21.264 125.002 1.00 63.67  ? 322 GLN B OE1 1 
ATOM   1061 N  NE2 . GLN B 1 60 ? -31.017 21.043 124.972 1.00 68.30  ? 322 GLN B NE2 1 
ATOM   1062 N  N   . VAL B 1 61 ? -35.734 16.505 124.589 1.00 46.74  ? 323 VAL B N   1 
ATOM   1063 C  CA  . VAL B 1 61 ? -37.086 16.068 124.259 1.00 40.98  ? 323 VAL B CA  1 
ATOM   1064 C  C   . VAL B 1 61 ? -37.484 14.823 125.048 1.00 52.71  ? 323 VAL B C   1 
ATOM   1065 O  O   . VAL B 1 61 ? -38.657 14.624 125.355 1.00 65.62  ? 323 VAL B O   1 
ATOM   1066 C  CB  . VAL B 1 61 ? -37.236 15.782 122.753 1.00 36.38  ? 323 VAL B CB  1 
ATOM   1067 C  CG1 . VAL B 1 61 ? -38.633 15.256 122.450 1.00 45.80  ? 323 VAL B CG1 1 
ATOM   1068 C  CG2 . VAL B 1 61 ? -36.949 17.035 121.945 1.00 43.11  ? 323 VAL B CG2 1 
ATOM   1069 N  N   . GLN B 1 62 ? -36.503 13.990 125.378 1.00 60.76  ? 324 GLN B N   1 
ATOM   1070 C  CA  . GLN B 1 62 ? -36.758 12.769 126.135 1.00 72.88  ? 324 GLN B CA  1 
ATOM   1071 C  C   . GLN B 1 62 ? -37.058 13.059 127.606 1.00 78.17  ? 324 GLN B C   1 
ATOM   1072 O  O   . GLN B 1 62 ? -38.097 12.651 128.128 1.00 51.66  ? 324 GLN B O   1 
ATOM   1073 C  CB  . GLN B 1 62 ? -35.577 11.801 126.011 1.00 48.93  ? 324 GLN B CB  1 
ATOM   1074 C  CG  . GLN B 1 62 ? -35.368 11.262 124.606 1.00 85.10  ? 324 GLN B CG  1 
ATOM   1075 C  CD  . GLN B 1 62 ? -34.285 10.202 124.545 1.00 95.65  ? 324 GLN B CD  1 
ATOM   1076 O  OE1 . GLN B 1 62 ? -33.950 9.581  125.554 1.00 90.03  ? 324 GLN B OE1 1 
ATOM   1077 N  NE2 . GLN B 1 62 ? -33.733 9.988  123.356 1.00 81.81  ? 324 GLN B NE2 1 
ATOM   1078 N  N   . SER B 1 63 ? -36.143 13.763 128.267 1.00 49.16  ? 325 SER B N   1 
ATOM   1079 C  CA  . SER B 1 63 ? -36.287 14.074 129.686 1.00 64.35  ? 325 SER B CA  1 
ATOM   1080 C  C   . SER B 1 63 ? -37.354 15.137 129.914 1.00 83.65  ? 325 SER B C   1 
ATOM   1081 O  O   . SER B 1 63 ? -38.051 15.126 130.932 1.00 57.20  ? 325 SER B O   1 
ATOM   1082 C  CB  . SER B 1 63 ? -34.949 14.534 130.272 1.00 74.07  ? 325 SER B CB  1 
ATOM   1083 O  OG  . SER B 1 63 ? -34.546 15.773 129.718 1.00 61.58  ? 325 SER B OG  1 
ATOM   1084 N  N   . LEU B 1 64 ? -37.469 16.058 128.963 1.00 59.95  ? 326 LEU B N   1 
ATOM   1085 C  CA  . LEU B 1 64 ? -38.459 17.123 129.044 1.00 44.15  ? 326 LEU B CA  1 
ATOM   1086 C  C   . LEU B 1 64 ? -39.869 16.543 128.964 1.00 57.27  ? 326 LEU B C   1 
ATOM   1087 O  O   . LEU B 1 64 ? -40.817 17.116 129.496 1.00 51.75  ? 326 LEU B O   1 
ATOM   1088 C  CB  . LEU B 1 64 ? -38.237 18.140 127.925 1.00 42.28  ? 326 LEU B CB  1 
ATOM   1089 C  CG  . LEU B 1 64 ? -38.880 19.518 128.084 1.00 66.98  ? 326 LEU B CG  1 
ATOM   1090 C  CD1 . LEU B 1 64 ? -38.597 20.085 129.466 1.00 65.16  ? 326 LEU B CD1 1 
ATOM   1091 C  CD2 . LEU B 1 64 ? -38.386 20.465 127.002 1.00 85.57  ? 326 LEU B CD2 1 
ATOM   1092 N  N   . THR B 1 65 ? -39.999 15.399 128.301 1.00 68.11  ? 327 THR B N   1 
ATOM   1093 C  CA  . THR B 1 65 ? -41.277 14.702 128.223 1.00 65.01  ? 327 THR B CA  1 
ATOM   1094 C  C   . THR B 1 65 ? -41.576 13.990 129.536 1.00 62.16  ? 327 THR B C   1 
ATOM   1095 O  O   . THR B 1 65 ? -42.715 13.980 130.002 1.00 68.60  ? 327 THR B O   1 
ATOM   1096 C  CB  . THR B 1 65 ? -41.303 13.680 127.069 1.00 70.48  ? 327 THR B CB  1 
ATOM   1097 O  OG1 . THR B 1 65 ? -41.397 14.374 125.819 1.00 60.05  ? 327 THR B OG1 1 
ATOM   1098 C  CG2 . THR B 1 65 ? -42.500 12.751 127.211 1.00 66.30  ? 327 THR B CG2 1 
ATOM   1099 N  N   . CYS B 1 66 ? -40.543 13.401 130.132 1.00 53.04  ? 328 CYS B N   1 
ATOM   1100 C  CA  . CYS B 1 66 ? -40.687 12.712 131.409 1.00 52.75  ? 328 CYS B CA  1 
ATOM   1101 C  C   . CYS B 1 66 ? -41.131 13.672 132.505 1.00 72.33  ? 328 CYS B C   1 
ATOM   1102 O  O   . CYS B 1 66 ? -41.672 13.251 133.527 1.00 70.36  ? 328 CYS B O   1 
ATOM   1103 C  CB  . CYS B 1 66 ? -39.378 12.030 131.809 1.00 57.02  ? 328 CYS B CB  1 
ATOM   1104 S  SG  . CYS B 1 66 ? -38.902 10.652 130.745 1.00 101.53 ? 328 CYS B SG  1 
ATOM   1105 N  N   . GLU B 1 67 ? -40.890 14.961 132.291 1.00 76.59  ? 329 GLU B N   1 
ATOM   1106 C  CA  . GLU B 1 67 ? -41.359 15.989 133.211 1.00 45.56  ? 329 GLU B CA  1 
ATOM   1107 C  C   . GLU B 1 67 ? -42.824 16.306 132.939 1.00 48.03  ? 329 GLU B C   1 
ATOM   1108 O  O   . GLU B 1 67 ? -43.593 16.563 133.863 1.00 88.93  ? 329 GLU B O   1 
ATOM   1109 C  CB  . GLU B 1 67 ? -40.511 17.256 133.092 1.00 57.16  ? 329 GLU B CB  1 
ATOM   1110 C  CG  . GLU B 1 67 ? -39.089 17.101 133.602 1.00 72.55  ? 329 GLU B CG  1 
ATOM   1111 C  CD  . GLU B 1 67 ? -38.319 18.406 133.574 1.00 83.97  ? 329 GLU B CD  1 
ATOM   1112 O  OE1 . GLU B 1 67 ? -37.085 18.375 133.768 1.00 98.39  ? 329 GLU B OE1 1 
ATOM   1113 O  OE2 . GLU B 1 67 ? -38.950 19.462 133.355 1.00 70.43  ? 329 GLU B OE2 1 
ATOM   1114 N  N   . VAL B 1 68 ? -43.207 16.286 131.667 1.00 49.34  ? 330 VAL B N   1 
ATOM   1115 C  CA  . VAL B 1 68 ? -44.607 16.456 131.296 1.00 66.57  ? 330 VAL B CA  1 
ATOM   1116 C  C   . VAL B 1 68 ? -45.428 15.289 131.833 1.00 74.07  ? 330 VAL B C   1 
ATOM   1117 O  O   . VAL B 1 68 ? -46.612 15.435 132.132 1.00 79.72  ? 330 VAL B O   1 
ATOM   1118 C  CB  . VAL B 1 68 ? -44.784 16.558 129.767 1.00 48.64  ? 330 VAL B CB  1 
ATOM   1119 C  CG1 . VAL B 1 68 ? -46.247 16.394 129.382 1.00 65.40  ? 330 VAL B CG1 1 
ATOM   1120 C  CG2 . VAL B 1 68 ? -44.244 17.882 129.261 1.00 40.56  ? 330 VAL B CG2 1 
ATOM   1121 N  N   . ASP B 1 69 ? -44.786 14.132 131.957 1.00 73.42  ? 331 ASP B N   1 
ATOM   1122 C  CA  . ASP B 1 69 ? -45.434 12.951 132.512 1.00 83.77  ? 331 ASP B CA  1 
ATOM   1123 C  C   . ASP B 1 69 ? -45.457 13.008 134.035 1.00 89.41  ? 331 ASP B C   1 
ATOM   1124 O  O   . ASP B 1 69 ? -46.519 12.925 134.652 1.00 101.24 ? 331 ASP B O   1 
ATOM   1125 C  CB  . ASP B 1 69 ? -44.719 11.681 132.050 1.00 78.52  ? 331 ASP B CB  1 
ATOM   1126 C  CG  . ASP B 1 69 ? -44.895 11.420 130.568 1.00 86.91  ? 331 ASP B CG  1 
ATOM   1127 O  OD1 . ASP B 1 69 ? -45.838 11.979 129.970 1.00 77.05  ? 331 ASP B OD1 1 
ATOM   1128 O  OD2 . ASP B 1 69 ? -44.090 10.650 130.002 1.00 82.41  ? 331 ASP B OD2 1 
ATOM   1129 N  N   . ALA B 1 70 ? -44.278 13.149 134.634 1.00 82.68  ? 332 ALA B N   1 
ATOM   1130 C  CA  . ALA B 1 70 ? -44.155 13.215 136.085 1.00 86.22  ? 332 ALA B CA  1 
ATOM   1131 C  C   . ALA B 1 70 ? -45.106 14.253 136.670 1.00 93.27  ? 332 ALA B C   1 
ATOM   1132 O  O   . ALA B 1 70 ? -45.735 14.021 137.702 1.00 92.15  ? 332 ALA B O   1 
ATOM   1133 C  CB  . ALA B 1 70 ? -42.720 13.523 136.484 1.00 76.56  ? 332 ALA B CB  1 
ATOM   1134 N  N   . LEU B 1 71 ? -45.203 15.397 136.002 1.00 92.62  ? 333 LEU B N   1 
ATOM   1135 C  CA  . LEU B 1 71 ? -46.092 16.467 136.435 1.00 87.06  ? 333 LEU B CA  1 
ATOM   1136 C  C   . LEU B 1 71 ? -47.552 16.072 136.231 1.00 101.94 ? 333 LEU B C   1 
ATOM   1137 O  O   . LEU B 1 71 ? -48.340 16.057 137.177 1.00 111.26 ? 333 LEU B O   1 
ATOM   1138 C  CB  . LEU B 1 71 ? -45.776 17.755 135.675 1.00 69.73  ? 333 LEU B CB  1 
ATOM   1139 C  CG  . LEU B 1 71 ? -46.565 19.004 136.062 1.00 103.48 ? 333 LEU B CG  1 
ATOM   1140 C  CD1 . LEU B 1 71 ? -46.597 19.177 137.573 1.00 105.43 ? 333 LEU B CD1 1 
ATOM   1141 C  CD2 . LEU B 1 71 ? -45.965 20.226 135.389 1.00 104.10 ? 333 LEU B CD2 1 
ATOM   1142 N  N   . LYS B 1 72 ? -47.905 15.748 134.991 1.00 102.22 ? 334 LYS B N   1 
ATOM   1143 C  CA  . LYS B 1 72 ? -49.259 15.310 134.669 1.00 101.36 ? 334 LYS B CA  1 
ATOM   1144 C  C   . LYS B 1 72 ? -49.524 13.897 135.180 1.00 106.26 ? 334 LYS B C   1 
ATOM   1145 O  O   . LYS B 1 72 ? -49.262 13.585 136.343 1.00 101.56 ? 334 LYS B O   1 
ATOM   1146 C  CB  . LYS B 1 72 ? -49.495 15.374 133.159 1.00 20.00  ? 334 LYS B CB  1 
ATOM   1147 C  CG  . LYS B 1 72 ? -49.499 16.784 132.589 1.00 20.00  ? 334 LYS B CG  1 
ATOM   1148 C  CD  . LYS B 1 72 ? -49.714 16.772 131.086 1.00 20.00  ? 334 LYS B CD  1 
ATOM   1149 C  CE  . LYS B 1 72 ? -49.742 18.182 130.520 1.00 20.00  ? 334 LYS B CE  1 
ATOM   1150 N  NZ  . LYS B 1 72 ? -49.928 18.184 129.043 1.00 20.00  ? 334 LYS B NZ  1 
ATOM   1151 N  N   . PRO C 1 1  ? -22.556 6.798  100.175 1.00 92.15  ? 263 PRO C N   1 
ATOM   1152 C  CA  . PRO C 1 1  ? -21.159 6.861  99.732  1.00 88.91  ? 263 PRO C CA  1 
ATOM   1153 C  C   . PRO C 1 1  ? -20.522 8.212  100.045 1.00 87.95  ? 263 PRO C C   1 
ATOM   1154 O  O   . PRO C 1 1  ? -20.790 9.194  99.352  1.00 88.03  ? 263 PRO C O   1 
ATOM   1155 C  CB  . PRO C 1 1  ? -21.267 6.667  98.218  1.00 80.41  ? 263 PRO C CB  1 
ATOM   1156 C  CG  . PRO C 1 1  ? -22.519 5.886  98.030  1.00 77.69  ? 263 PRO C CG  1 
ATOM   1157 C  CD  . PRO C 1 1  ? -23.461 6.362  99.097  1.00 80.49  ? 263 PRO C CD  1 
ATOM   1158 N  N   . ASP C 1 2  ? -19.687 8.251  101.079 1.00 100.98 ? 264 ASP C N   1 
ATOM   1159 C  CA  . ASP C 1 2  ? -19.016 9.481  101.485 1.00 82.58  ? 264 ASP C CA  1 
ATOM   1160 C  C   . ASP C 1 2  ? -18.158 10.054 100.365 1.00 67.27  ? 264 ASP C C   1 
ATOM   1161 O  O   . ASP C 1 2  ? -17.494 9.314  99.638  1.00 63.69  ? 264 ASP C O   1 
ATOM   1162 C  CB  . ASP C 1 2  ? -18.149 9.234  102.721 1.00 76.35  ? 264 ASP C CB  1 
ATOM   1163 C  CG  . ASP C 1 2  ? -18.966 9.096  103.990 1.00 107.45 ? 264 ASP C CG  1 
ATOM   1164 O  OD1 . ASP C 1 2  ? -18.863 8.044  104.655 1.00 119.14 ? 264 ASP C OD1 1 
ATOM   1165 O  OD2 . ASP C 1 2  ? -19.717 10.039 104.319 1.00 105.58 ? 264 ASP C OD2 1 
ATOM   1166 N  N   . LEU C 1 3  ? -18.175 11.376 100.234 1.00 64.02  ? 265 LEU C N   1 
ATOM   1167 C  CA  . LEU C 1 3  ? -17.349 12.053 99.245  1.00 47.31  ? 265 LEU C CA  1 
ATOM   1168 C  C   . LEU C 1 3  ? -15.870 11.787 99.509  1.00 51.87  ? 265 LEU C C   1 
ATOM   1169 O  O   . LEU C 1 3  ? -15.084 11.638 98.577  1.00 68.40  ? 265 LEU C O   1 
ATOM   1170 C  CB  . LEU C 1 3  ? -17.626 13.557 99.248  1.00 33.74  ? 265 LEU C CB  1 
ATOM   1171 C  CG  . LEU C 1 3  ? -16.755 14.406 98.319  1.00 53.71  ? 265 LEU C CG  1 
ATOM   1172 C  CD1 . LEU C 1 3  ? -16.807 13.872 96.895  1.00 51.95  ? 265 LEU C CD1 1 
ATOM   1173 C  CD2 . LEU C 1 3  ? -17.175 15.868 98.367  1.00 44.04  ? 265 LEU C CD2 1 
ATOM   1174 N  N   . THR C 1 4  ? -15.500 11.723 100.785 1.00 53.42  ? 266 THR C N   1 
ATOM   1175 C  CA  . THR C 1 4  ? -14.127 11.423 101.171 1.00 52.79  ? 266 THR C CA  1 
ATOM   1176 C  C   . THR C 1 4  ? -13.778 9.988  100.798 1.00 48.91  ? 266 THR C C   1 
ATOM   1177 O  O   . THR C 1 4  ? -12.625 9.674  100.509 1.00 57.45  ? 266 THR C O   1 
ATOM   1178 C  CB  . THR C 1 4  ? -13.903 11.619 102.682 1.00 47.56  ? 266 THR C CB  1 
ATOM   1179 O  OG1 . THR C 1 4  ? -14.829 10.807 103.413 1.00 67.64  ? 266 THR C OG1 1 
ATOM   1180 C  CG2 . THR C 1 4  ? -14.102 13.076 103.068 1.00 51.37  ? 266 THR C CG2 1 
ATOM   1181 N  N   . ALA C 1 5  ? -14.784 9.120  100.808 1.00 54.61  ? 267 ALA C N   1 
ATOM   1182 C  CA  . ALA C 1 5  ? -14.595 7.730  100.416 1.00 68.99  ? 267 ALA C CA  1 
ATOM   1183 C  C   . ALA C 1 5  ? -14.601 7.612  98.896  1.00 58.23  ? 267 ALA C C   1 
ATOM   1184 O  O   . ALA C 1 5  ? -13.982 6.713  98.327  1.00 45.29  ? 267 ALA C O   1 
ATOM   1185 C  CB  . ALA C 1 5  ? -15.677 6.858  101.025 1.00 77.96  ? 267 ALA C CB  1 
ATOM   1186 N  N   . ALA C 1 6  ? -15.310 8.529  98.247  1.00 45.95  ? 268 ALA C N   1 
ATOM   1187 C  CA  . ALA C 1 6  ? -15.363 8.577  96.794  1.00 40.63  ? 268 ALA C CA  1 
ATOM   1188 C  C   . ALA C 1 6  ? -14.094 9.213  96.245  1.00 60.71  ? 268 ALA C C   1 
ATOM   1189 O  O   . ALA C 1 6  ? -13.583 8.802  95.205  1.00 73.66  ? 268 ALA C O   1 
ATOM   1190 C  CB  . ALA C 1 6  ? -16.592 9.349  96.332  1.00 47.68  ? 268 ALA C CB  1 
ATOM   1191 N  N   . LEU C 1 7  ? -13.590 10.218 96.955  1.00 39.69  ? 269 LEU C N   1 
ATOM   1192 C  CA  . LEU C 1 7  ? -12.359 10.894 96.562  1.00 41.27  ? 269 LEU C CA  1 
ATOM   1193 C  C   . LEU C 1 7  ? -11.162 9.958  96.680  1.00 48.71  ? 269 LEU C C   1 
ATOM   1194 O  O   . LEU C 1 7  ? -10.341 9.870  95.767  1.00 57.74  ? 269 LEU C O   1 
ATOM   1195 C  CB  . LEU C 1 7  ? -12.133 12.142 97.417  1.00 37.07  ? 269 LEU C CB  1 
ATOM   1196 C  CG  . LEU C 1 7  ? -13.052 13.334 97.147  1.00 56.71  ? 269 LEU C CG  1 
ATOM   1197 C  CD1 . LEU C 1 7  ? -12.974 14.351 98.278  1.00 34.78  ? 269 LEU C CD1 1 
ATOM   1198 C  CD2 . LEU C 1 7  ? -12.717 13.982 95.812  1.00 37.94  ? 269 LEU C CD2 1 
ATOM   1199 N  N   . ARG C 1 8  ? -11.066 9.260  97.807  1.00 38.78  ? 270 ARG C N   1 
ATOM   1200 C  CA  . ARG C 1 8  ? -9.980  8.314  98.024  1.00 60.14  ? 270 ARG C CA  1 
ATOM   1201 C  C   . ARG C 1 8  ? -10.080 7.163  97.034  1.00 50.98  ? 270 ARG C C   1 
ATOM   1202 O  O   . ARG C 1 8  ? -9.070  6.657  96.550  1.00 49.39  ? 270 ARG C O   1 
ATOM   1203 C  CB  . ARG C 1 8  ? -10.010 7.773  99.454  1.00 81.76  ? 270 ARG C CB  1 
ATOM   1204 C  CG  . ARG C 1 8  ? -11.257 6.974  99.784  1.00 75.84  ? 270 ARG C CG  1 
ATOM   1205 C  CD  . ARG C 1 8  ? -11.105 6.203  101.085 1.00 109.08 ? 270 ARG C CD  1 
ATOM   1206 N  NE  . ARG C 1 8  ? -10.210 5.057  100.953 1.00 110.04 ? 270 ARG C NE  1 
ATOM   1207 C  CZ  . ARG C 1 8  ? -8.980  5.005  101.454 1.00 110.32 ? 270 ARG C CZ  1 
ATOM   1208 N  NH1 . ARG C 1 8  ? -8.493  6.037  102.129 1.00 93.66  ? 270 ARG C NH1 1 
ATOM   1209 N  NH2 . ARG C 1 8  ? -8.237  3.919  101.283 1.00 110.78 ? 270 ARG C NH2 1 
ATOM   1210 N  N   . ASP C 1 9  ? -11.309 6.756  96.735  1.00 54.48  ? 271 ASP C N   1 
ATOM   1211 C  CA  . ASP C 1 9  ? -11.543 5.659  95.807  1.00 58.27  ? 271 ASP C CA  1 
ATOM   1212 C  C   . ASP C 1 9  ? -10.955 6.004  94.444  1.00 52.69  ? 271 ASP C C   1 
ATOM   1213 O  O   . ASP C 1 9  ? -10.309 5.171  93.806  1.00 57.23  ? 271 ASP C O   1 
ATOM   1214 C  CB  . ASP C 1 9  ? -13.041 5.371  95.687  1.00 46.91  ? 271 ASP C CB  1 
ATOM   1215 C  CG  . ASP C 1 9  ? -13.330 3.940  95.271  1.00 61.05  ? 271 ASP C CG  1 
ATOM   1216 O  OD1 . ASP C 1 9  ? -14.139 3.276  95.952  1.00 61.36  ? 271 ASP C OD1 1 
ATOM   1217 O  OD2 . ASP C 1 9  ? -12.742 3.477  94.272  1.00 72.85  ? 271 ASP C OD2 1 
ATOM   1218 N  N   . VAL C 1 10 ? -11.176 7.242  94.014  1.00 52.47  ? 272 VAL C N   1 
ATOM   1219 C  CA  . VAL C 1 10 ? -10.646 7.727  92.746  1.00 41.52  ? 272 VAL C CA  1 
ATOM   1220 C  C   . VAL C 1 10 ? -9.122  7.813  92.778  1.00 42.74  ? 272 VAL C C   1 
ATOM   1221 O  O   . VAL C 1 10 ? -8.459  7.595  91.765  1.00 50.74  ? 272 VAL C O   1 
ATOM   1222 C  CB  . VAL C 1 10 ? -11.229 9.109  92.386  1.00 38.28  ? 272 VAL C CB  1 
ATOM   1223 C  CG1 . VAL C 1 10 ? -10.493 9.710  91.196  1.00 42.06  ? 272 VAL C CG1 1 
ATOM   1224 C  CG2 . VAL C 1 10 ? -12.719 8.995  92.097  1.00 42.58  ? 272 VAL C CG2 1 
ATOM   1225 N  N   . ARG C 1 11 ? -8.570  8.120  93.947  1.00 29.05  ? 273 ARG C N   1 
ATOM   1226 C  CA  . ARG C 1 11 ? -7.127  8.300  94.074  1.00 43.58  ? 273 ARG C CA  1 
ATOM   1227 C  C   . ARG C 1 11 ? -6.374  6.982  93.914  1.00 33.35  ? 273 ARG C C   1 
ATOM   1228 O  O   . ARG C 1 11 ? -5.282  6.953  93.349  1.00 43.48  ? 273 ARG C O   1 
ATOM   1229 C  CB  . ARG C 1 11 ? -6.768  8.963  95.408  1.00 45.23  ? 273 ARG C CB  1 
ATOM   1230 C  CG  . ARG C 1 11 ? -5.357  9.536  95.440  1.00 62.41  ? 273 ARG C CG  1 
ATOM   1231 C  CD  . ARG C 1 11 ? -4.987  10.096 96.806  1.00 76.86  ? 273 ARG C CD  1 
ATOM   1232 N  NE  . ARG C 1 11 ? -3.779  10.915 96.738  1.00 98.66  ? 273 ARG C NE  1 
ATOM   1233 C  CZ  . ARG C 1 11 ? -3.166  11.442 97.793  1.00 101.18 ? 273 ARG C CZ  1 
ATOM   1234 N  NH1 . ARG C 1 11 ? -3.642  11.235 99.013  1.00 87.14  ? 273 ARG C NH1 1 
ATOM   1235 N  NH2 . ARG C 1 11 ? -2.072  12.175 97.628  1.00 74.95  ? 273 ARG C NH2 1 
ATOM   1236 N  N   . GLN C 1 12 ? -6.953  5.896  94.419  1.00 52.40  ? 274 GLN C N   1 
ATOM   1237 C  CA  . GLN C 1 12 ? -6.354  4.577  94.251  1.00 59.15  ? 274 GLN C CA  1 
ATOM   1238 C  C   . GLN C 1 12 ? -6.440  4.166  92.789  1.00 49.37  ? 274 GLN C C   1 
ATOM   1239 O  O   . GLN C 1 12 ? -5.492  3.618  92.228  1.00 39.18  ? 274 GLN C O   1 
ATOM   1240 C  CB  . GLN C 1 12 ? -7.042  3.532  95.136  1.00 42.88  ? 274 GLN C CB  1 
ATOM   1241 C  CG  . GLN C 1 12 ? -6.592  3.535  96.589  1.00 70.11  ? 274 GLN C CG  1 
ATOM   1242 C  CD  . GLN C 1 12 ? -7.450  4.425  97.468  1.00 98.79  ? 274 GLN C CD  1 
ATOM   1243 O  OE1 . GLN C 1 12 ? -8.664  4.240  97.561  1.00 108.25 ? 274 GLN C OE1 1 
ATOM   1244 N  NE2 . GLN C 1 12 ? -6.820  5.387  98.131  1.00 80.82  ? 274 GLN C NE2 1 
ATOM   1245 N  N   . GLN C 1 13 ? -7.586  4.440  92.178  1.00 38.67  ? 275 GLN C N   1 
ATOM   1246 C  CA  . GLN C 1 13 ? -7.797  4.123  90.774  1.00 45.43  ? 275 GLN C CA  1 
ATOM   1247 C  C   . GLN C 1 13 ? -6.825  4.893  89.887  1.00 57.02  ? 275 GLN C C   1 
ATOM   1248 O  O   . GLN C 1 13 ? -6.182  4.315  89.011  1.00 46.81  ? 275 GLN C O   1 
ATOM   1249 C  CB  . GLN C 1 13 ? -9.240  4.425  90.372  1.00 30.67  ? 275 GLN C CB  1 
ATOM   1250 C  CG  . GLN C 1 13 ? -10.271 3.599  91.120  1.00 44.47  ? 275 GLN C CG  1 
ATOM   1251 C  CD  . GLN C 1 13 ? -11.652 3.689  90.499  1.00 80.07  ? 275 GLN C CD  1 
ATOM   1252 O  OE1 . GLN C 1 13 ? -11.789 3.902  89.294  1.00 55.69  ? 275 GLN C OE1 1 
ATOM   1253 N  NE2 . GLN C 1 13 ? -12.682 3.517  91.318  1.00 87.44  ? 275 GLN C NE2 1 
ATOM   1254 N  N   . TYR C 1 14 ? -6.722  6.199  90.117  1.00 55.97  ? 276 TYR C N   1 
ATOM   1255 C  CA  . TYR C 1 14 ? -5.810  7.033  89.343  1.00 44.68  ? 276 TYR C CA  1 
ATOM   1256 C  C   . TYR C 1 14 ? -4.369  6.554  89.485  1.00 39.02  ? 276 TYR C C   1 
ATOM   1257 O  O   . TYR C 1 14 ? -3.675  6.331  88.493  1.00 33.34  ? 276 TYR C O   1 
ATOM   1258 C  CB  . TYR C 1 14 ? -5.913  8.505  89.756  1.00 30.36  ? 276 TYR C CB  1 
ATOM   1259 C  CG  . TYR C 1 14 ? -4.793  9.346  89.181  1.00 38.45  ? 276 TYR C CG  1 
ATOM   1260 C  CD1 . TYR C 1 14 ? -4.897  9.904  87.915  1.00 50.26  ? 276 TYR C CD1 1 
ATOM   1261 C  CD2 . TYR C 1 14 ? -3.623  9.560  89.895  1.00 32.90  ? 276 TYR C CD2 1 
ATOM   1262 C  CE1 . TYR C 1 14 ? -3.874  10.658 87.381  1.00 48.69  ? 276 TYR C CE1 1 
ATOM   1263 C  CE2 . TYR C 1 14 ? -2.594  10.312 89.369  1.00 57.99  ? 276 TYR C CE2 1 
ATOM   1264 C  CZ  . TYR C 1 14 ? -2.724  10.859 88.111  1.00 47.35  ? 276 TYR C CZ  1 
ATOM   1265 O  OH  . TYR C 1 14 ? -1.701  11.611 87.580  1.00 58.12  ? 276 TYR C OH  1 
ATOM   1266 N  N   . GLU C 1 15 ? -3.927  6.394  90.727  1.00 27.46  ? 277 GLU C N   1 
ATOM   1267 C  CA  . GLU C 1 15 ? -2.551  5.997  90.997  1.00 46.78  ? 277 GLU C CA  1 
ATOM   1268 C  C   . GLU C 1 15 ? -2.185  4.690  90.304  1.00 46.79  ? 277 GLU C C   1 
ATOM   1269 O  O   . GLU C 1 15 ? -1.052  4.517  89.858  1.00 39.24  ? 277 GLU C O   1 
ATOM   1270 C  CB  . GLU C 1 15 ? -2.299  5.897  92.502  1.00 33.54  ? 277 GLU C CB  1 
ATOM   1271 C  CG  . GLU C 1 15 ? -2.188  7.248  93.197  1.00 62.25  ? 277 GLU C CG  1 
ATOM   1272 C  CD  . GLU C 1 15 ? -1.802  7.128  94.660  1.00 90.44  ? 277 GLU C CD  1 
ATOM   1273 O  OE1 . GLU C 1 15 ? -1.810  5.996  95.187  1.00 92.70  ? 277 GLU C OE1 1 
ATOM   1274 O  OE2 . GLU C 1 15 ? -1.490  8.164  95.285  1.00 81.77  ? 277 GLU C OE2 1 
ATOM   1275 N  N   . SER C 1 16 ? -3.146  3.776  90.212  1.00 46.90  ? 278 SER C N   1 
ATOM   1276 C  CA  . SER C 1 16 ? -2.916  2.493  89.555  1.00 43.01  ? 278 SER C CA  1 
ATOM   1277 C  C   . SER C 1 16 ? -2.905  2.643  88.039  1.00 57.31  ? 278 SER C C   1 
ATOM   1278 O  O   . SER C 1 16 ? -1.962  2.217  87.369  1.00 51.54  ? 278 SER C O   1 
ATOM   1279 C  CB  . SER C 1 16 ? -3.974  1.470  89.974  1.00 44.92  ? 278 SER C CB  1 
ATOM   1280 O  OG  . SER C 1 16 ? -3.737  1.003  91.290  1.00 84.82  ? 278 SER C OG  1 
ATOM   1281 N  N   . VAL C 1 17 ? -3.958  3.251  87.503  1.00 36.20  ? 279 VAL C N   1 
ATOM   1282 C  CA  . VAL C 1 17 ? -4.071  3.460  86.064  1.00 35.15  ? 279 VAL C CA  1 
ATOM   1283 C  C   . VAL C 1 17 ? -2.899  4.275  85.522  1.00 44.14  ? 279 VAL C C   1 
ATOM   1284 O  O   . VAL C 1 17 ? -2.287  3.905  84.521  1.00 50.95  ? 279 VAL C O   1 
ATOM   1285 C  CB  . VAL C 1 17 ? -5.390  4.159  85.698  1.00 49.67  ? 279 VAL C CB  1 
ATOM   1286 C  CG1 . VAL C 1 17 ? -5.413  4.508  84.221  1.00 42.46  ? 279 VAL C CG1 1 
ATOM   1287 C  CG2 . VAL C 1 17 ? -6.575  3.276  86.060  1.00 44.89  ? 279 VAL C CG2 1 
ATOM   1288 N  N   . ALA C 1 18 ? -2.593  5.385  86.186  1.00 44.26  ? 280 ALA C N   1 
ATOM   1289 C  CA  . ALA C 1 18 ? -1.465  6.224  85.795  1.00 47.34  ? 280 ALA C CA  1 
ATOM   1290 C  C   . ALA C 1 18 ? -0.170  5.420  85.778  1.00 34.18  ? 280 ALA C C   1 
ATOM   1291 O  O   . ALA C 1 18 ? 0.718   5.678  84.970  1.00 52.76  ? 280 ALA C O   1 
ATOM   1292 C  CB  . ALA C 1 18 ? -1.337  7.416  86.730  1.00 51.27  ? 280 ALA C CB  1 
ATOM   1293 N  N   . ALA C 1 19 ? -0.069  4.445  86.675  1.00 30.25  ? 281 ALA C N   1 
ATOM   1294 C  CA  . ALA C 1 19 ? 1.105   3.581  86.737  1.00 45.14  ? 281 ALA C CA  1 
ATOM   1295 C  C   . ALA C 1 19 ? 1.152   2.626  85.545  1.00 45.29  ? 281 ALA C C   1 
ATOM   1296 O  O   . ALA C 1 19 ? 2.225   2.293  85.044  1.00 29.85  ? 281 ALA C O   1 
ATOM   1297 C  CB  . ALA C 1 19 ? 1.124   2.806  88.045  1.00 49.84  ? 281 ALA C CB  1 
ATOM   1298 N  N   . LYS C 1 20 ? -0.018  2.189  85.092  1.00 50.27  ? 282 LYS C N   1 
ATOM   1299 C  CA  . LYS C 1 20 ? -0.103  1.280  83.957  1.00 40.93  ? 282 LYS C CA  1 
ATOM   1300 C  C   . LYS C 1 20 ? 0.182   2.014  82.653  1.00 43.74  ? 282 LYS C C   1 
ATOM   1301 O  O   . LYS C 1 20 ? 0.904   1.513  81.792  1.00 58.59  ? 282 LYS C O   1 
ATOM   1302 C  CB  . LYS C 1 20 ? -1.487  0.633  83.894  1.00 64.61  ? 282 LYS C CB  1 
ATOM   1303 C  CG  . LYS C 1 20 ? -1.620  -0.444 82.825  1.00 77.70  ? 282 LYS C CG  1 
ATOM   1304 C  CD  . LYS C 1 20 ? -3.055  -0.933 82.703  1.00 91.90  ? 282 LYS C CD  1 
ATOM   1305 C  CE  . LYS C 1 20 ? -3.951  0.137  82.099  1.00 89.56  ? 282 LYS C CE  1 
ATOM   1306 N  NZ  . LYS C 1 20 ? -3.556  0.484  80.703  1.00 86.25  ? 282 LYS C NZ  1 
ATOM   1307 N  N   . ASN C 1 21 ? -0.398  3.202  82.514  1.00 46.38  ? 283 ASN C N   1 
ATOM   1308 C  CA  . ASN C 1 21 ? -0.209  4.014  81.317  1.00 39.75  ? 283 ASN C CA  1 
ATOM   1309 C  C   . ASN C 1 21 ? 1.261   4.352  81.063  1.00 39.24  ? 283 ASN C C   1 
ATOM   1310 O  O   . ASN C 1 21 ? 1.745   4.242  79.936  1.00 34.36  ? 283 ASN C O   1 
ATOM   1311 C  CB  . ASN C 1 21 ? -1.046  5.293  81.402  1.00 49.93  ? 283 ASN C CB  1 
ATOM   1312 C  CG  . ASN C 1 21 ? -2.533  5.030  81.236  1.00 37.60  ? 283 ASN C CG  1 
ATOM   1313 O  OD1 . ASN C 1 21 ? -3.366  5.884  81.543  1.00 63.42  ? 283 ASN C OD1 1 
ATOM   1314 N  ND2 . ASN C 1 21 ? -2.872  3.843  80.748  1.00 47.43  ? 283 ASN C ND2 1 
ATOM   1315 N  N   . LEU C 1 22 ? 1.967   4.762  82.113  1.00 35.56  ? 284 LEU C N   1 
ATOM   1316 C  CA  . LEU C 1 22 ? 3.391   5.064  82.000  1.00 43.17  ? 284 LEU C CA  1 
ATOM   1317 C  C   . LEU C 1 22 ? 4.174   3.882  81.439  1.00 41.42  ? 284 LEU C C   1 
ATOM   1318 O  O   . LEU C 1 22 ? 4.914   4.022  80.465  1.00 43.35  ? 284 LEU C O   1 
ATOM   1319 C  CB  . LEU C 1 22 ? 3.968   5.480  83.355  1.00 37.49  ? 284 LEU C CB  1 
ATOM   1320 C  CG  . LEU C 1 22 ? 4.009   6.978  83.674  1.00 78.47  ? 284 LEU C CG  1 
ATOM   1321 C  CD1 . LEU C 1 22 ? 2.614   7.572  83.791  1.00 59.49  ? 284 LEU C CD1 1 
ATOM   1322 C  CD2 . LEU C 1 22 ? 4.806   7.230  84.944  1.00 90.71  ? 284 LEU C CD2 1 
ATOM   1323 N  N   . GLN C 1 23 ? 4.010   2.722  82.066  1.00 50.79  ? 285 GLN C N   1 
ATOM   1324 C  CA  . GLN C 1 23 ? 4.697   1.511  81.637  1.00 37.93  ? 285 GLN C CA  1 
ATOM   1325 C  C   . GLN C 1 23 ? 4.455   1.237  80.157  1.00 45.20  ? 285 GLN C C   1 
ATOM   1326 O  O   . GLN C 1 23 ? 5.398   1.036  79.391  1.00 43.08  ? 285 GLN C O   1 
ATOM   1327 C  CB  . GLN C 1 23 ? 4.243   0.315  82.478  1.00 51.28  ? 285 GLN C CB  1 
ATOM   1328 C  CG  . GLN C 1 23 ? 5.002   0.129  83.783  1.00 52.28  ? 285 GLN C CG  1 
ATOM   1329 C  CD  . GLN C 1 23 ? 6.296   -0.645 83.600  1.00 82.42  ? 285 GLN C CD  1 
ATOM   1330 O  OE1 . GLN C 1 23 ? 7.277   -0.125 83.065  1.00 76.54  ? 285 GLN C OE1 1 
ATOM   1331 N  NE2 . GLN C 1 23 ? 6.306   -1.894 84.051  1.00 86.74  ? 285 GLN C NE2 1 
ATOM   1332 N  N   . GLU C 1 24 ? 3.186   1.238  79.761  1.00 26.82  ? 286 GLU C N   1 
ATOM   1333 C  CA  . GLU C 1 24 ? 2.816   0.975  78.376  1.00 27.03  ? 286 GLU C CA  1 
ATOM   1334 C  C   . GLU C 1 24 ? 3.420   2.007  77.428  1.00 41.78  ? 286 GLU C C   1 
ATOM   1335 O  O   . GLU C 1 24 ? 3.963   1.659  76.377  1.00 40.87  ? 286 GLU C O   1 
ATOM   1336 C  CB  . GLU C 1 24 ? 1.294   0.957  78.227  1.00 36.48  ? 286 GLU C CB  1 
ATOM   1337 C  CG  . GLU C 1 24 ? 0.612   -0.201 78.934  1.00 42.81  ? 286 GLU C CG  1 
ATOM   1338 C  CD  . GLU C 1 24 ? -0.880  -0.240 78.674  1.00 71.48  ? 286 GLU C CD  1 
ATOM   1339 O  OE1 . GLU C 1 24 ? -1.422  0.757  78.152  1.00 56.49  ? 286 GLU C OE1 1 
ATOM   1340 O  OE2 . GLU C 1 24 ? -1.513  -1.268 78.993  1.00 93.37  ? 286 GLU C OE2 1 
ATOM   1341 N  N   . ALA C 1 25 ? 3.325   3.277  77.807  1.00 35.87  ? 287 ALA C N   1 
ATOM   1342 C  CA  . ALA C 1 25 ? 3.840   4.361  76.978  1.00 37.80  ? 287 ALA C CA  1 
ATOM   1343 C  C   . ALA C 1 25 ? 5.347   4.242  76.777  1.00 23.75  ? 287 ALA C C   1 
ATOM   1344 O  O   . ALA C 1 25 ? 5.846   4.422  75.668  1.00 34.10  ? 287 ALA C O   1 
ATOM   1345 C  CB  . ALA C 1 25 ? 3.483   5.713  77.584  1.00 25.51  ? 287 ALA C CB  1 
ATOM   1346 N  N   . GLU C 1 26 ? 6.067   3.931  77.848  1.00 33.30  ? 288 GLU C N   1 
ATOM   1347 C  CA  . GLU C 1 26 ? 7.516   3.790  77.769  1.00 44.42  ? 288 GLU C CA  1 
ATOM   1348 C  C   . GLU C 1 26 ? 7.912   2.670  76.808  1.00 47.28  ? 288 GLU C C   1 
ATOM   1349 O  O   . GLU C 1 26 ? 8.825   2.826  75.998  1.00 44.73  ? 288 GLU C O   1 
ATOM   1350 C  CB  . GLU C 1 26 ? 8.111   3.537  79.155  1.00 33.42  ? 288 GLU C CB  1 
ATOM   1351 C  CG  . GLU C 1 26 ? 9.626   3.456  79.161  1.00 59.87  ? 288 GLU C CG  1 
ATOM   1352 C  CD  . GLU C 1 26 ? 10.185  2.996  80.491  1.00 65.75  ? 288 GLU C CD  1 
ATOM   1353 O  OE1 . GLU C 1 26 ? 9.445   3.031  81.497  1.00 68.32  ? 288 GLU C OE1 1 
ATOM   1354 O  OE2 . GLU C 1 26 ? 11.368  2.600  80.529  1.00 64.85  ? 288 GLU C OE2 1 
ATOM   1355 N  N   . GLU C 1 27 ? 7.214   1.544  76.899  1.00 39.91  ? 289 GLU C N   1 
ATOM   1356 C  CA  . GLU C 1 27 ? 7.482   0.405  76.030  1.00 40.09  ? 289 GLU C CA  1 
ATOM   1357 C  C   . GLU C 1 27 ? 7.123   0.725  74.582  1.00 50.97  ? 289 GLU C C   1 
ATOM   1358 O  O   . GLU C 1 27 ? 7.797   0.280  73.653  1.00 54.33  ? 289 GLU C O   1 
ATOM   1359 C  CB  . GLU C 1 27 ? 6.703   -0.823 76.507  1.00 58.13  ? 289 GLU C CB  1 
ATOM   1360 C  CG  . GLU C 1 27 ? 7.022   -1.257 77.929  1.00 40.23  ? 289 GLU C CG  1 
ATOM   1361 C  CD  . GLU C 1 27 ? 6.206   -2.463 78.364  1.00 72.17  ? 289 GLU C CD  1 
ATOM   1362 O  OE1 . GLU C 1 27 ? 5.984   -3.361 77.525  1.00 86.84  ? 289 GLU C OE1 1 
ATOM   1363 O  OE2 . GLU C 1 27 ? 5.789   -2.516 79.541  1.00 57.37  ? 289 GLU C OE2 1 
ATOM   1364 N  N   . TRP C 1 28 ? 6.058   1.497  74.396  1.00 42.94  ? 290 TRP C N   1 
ATOM   1365 C  CA  . TRP C 1 28 ? 5.608   1.861  73.059  1.00 27.08  ? 290 TRP C CA  1 
ATOM   1366 C  C   . TRP C 1 28 ? 6.655   2.692  72.331  1.00 39.23  ? 290 TRP C C   1 
ATOM   1367 O  O   . TRP C 1 28 ? 7.051   2.367  71.211  1.00 35.31  ? 290 TRP C O   1 
ATOM   1368 C  CB  . TRP C 1 28 ? 4.296   2.639  73.131  1.00 29.41  ? 290 TRP C CB  1 
ATOM   1369 C  CG  . TRP C 1 28 ? 3.643   2.838  71.796  1.00 31.69  ? 290 TRP C CG  1 
ATOM   1370 C  CD1 . TRP C 1 28 ? 2.754   2.002  71.190  1.00 33.83  ? 290 TRP C CD1 1 
ATOM   1371 C  CD2 . TRP C 1 28 ? 3.825   3.949  70.908  1.00 52.51  ? 290 TRP C CD2 1 
ATOM   1372 N  NE1 . TRP C 1 28 ? 2.369   2.521  69.977  1.00 45.21  ? 290 TRP C NE1 1 
ATOM   1373 C  CE2 . TRP C 1 28 ? 3.009   3.714  69.778  1.00 30.11  ? 290 TRP C CE2 1 
ATOM   1374 C  CE3 . TRP C 1 28 ? 4.591   5.116  70.950  1.00 43.09  ? 290 TRP C CE3 1 
ATOM   1375 C  CZ2 . TRP C 1 28 ? 2.944   4.602  68.709  1.00 26.17  ? 290 TRP C CZ2 1 
ATOM   1376 C  CZ3 . TRP C 1 28 ? 4.524   5.997  69.886  1.00 36.70  ? 290 TRP C CZ3 1 
ATOM   1377 C  CH2 . TRP C 1 28 ? 3.706   5.735  68.780  1.00 35.74  ? 290 TRP C CH2 1 
ATOM   1378 N  N   . TYR C 1 29 ? 7.091   3.773  72.971  1.00 42.61  ? 291 TYR C N   1 
ATOM   1379 C  CA  . TYR C 1 29 ? 8.077   4.666  72.374  1.00 36.77  ? 291 TYR C CA  1 
ATOM   1380 C  C   . TYR C 1 29 ? 9.416   3.963  72.189  1.00 29.31  ? 291 TYR C C   1 
ATOM   1381 O  O   . TYR C 1 29 ? 10.167  4.283  71.269  1.00 33.40  ? 291 TYR C O   1 
ATOM   1382 C  CB  . TYR C 1 29 ? 8.232   5.950  73.199  1.00 37.62  ? 291 TYR C CB  1 
ATOM   1383 C  CG  . TYR C 1 29 ? 7.057   6.896  73.067  1.00 26.69  ? 291 TYR C CG  1 
ATOM   1384 C  CD1 . TYR C 1 29 ? 6.956   7.764  71.987  1.00 24.44  ? 291 TYR C CD1 1 
ATOM   1385 C  CD2 . TYR C 1 29 ? 6.043   6.910  74.013  1.00 45.43  ? 291 TYR C CD2 1 
ATOM   1386 C  CE1 . TYR C 1 29 ? 5.880   8.624  71.858  1.00 29.51  ? 291 TYR C CE1 1 
ATOM   1387 C  CE2 . TYR C 1 29 ? 4.964   7.767  73.894  1.00 42.70  ? 291 TYR C CE2 1 
ATOM   1388 C  CZ  . TYR C 1 29 ? 4.887   8.621  72.814  1.00 57.11  ? 291 TYR C CZ  1 
ATOM   1389 O  OH  . TYR C 1 29 ? 3.814   9.476  72.690  1.00 47.64  ? 291 TYR C OH  1 
ATOM   1390 N  N   . LYS C 1 30 ? 9.709   3.002  73.060  1.00 45.19  ? 292 LYS C N   1 
ATOM   1391 C  CA  . LYS C 1 30 ? 10.909  2.188  72.913  1.00 39.46  ? 292 LYS C CA  1 
ATOM   1392 C  C   . LYS C 1 30 ? 10.886  1.455  71.579  1.00 36.68  ? 292 LYS C C   1 
ATOM   1393 O  O   . LYS C 1 30 ? 11.866  1.467  70.833  1.00 36.87  ? 292 LYS C O   1 
ATOM   1394 C  CB  . LYS C 1 30 ? 11.032  1.185  74.062  1.00 35.56  ? 292 LYS C CB  1 
ATOM   1395 C  CG  . LYS C 1 30 ? 11.538  1.780  75.364  1.00 83.68  ? 292 LYS C CG  1 
ATOM   1396 C  CD  . LYS C 1 30 ? 11.385  0.800  76.517  1.00 101.14 ? 292 LYS C CD  1 
ATOM   1397 C  CE  . LYS C 1 30 ? 12.126  -0.504 76.247  1.00 92.79  ? 292 LYS C CE  1 
ATOM   1398 N  NZ  . LYS C 1 30 ? 11.971  -1.465 77.374  1.00 77.87  ? 292 LYS C NZ  1 
ATOM   1399 N  N   . SER C 1 31 ? 9.752   0.830  71.280  1.00 25.61  ? 293 SER C N   1 
ATOM   1400 C  CA  . SER C 1 31 ? 9.595   0.077  70.044  1.00 28.86  ? 293 SER C CA  1 
ATOM   1401 C  C   . SER C 1 31 ? 9.726   0.973  68.813  1.00 40.13  ? 293 SER C C   1 
ATOM   1402 O  O   . SER C 1 31 ? 10.376  0.604  67.834  1.00 30.24  ? 293 SER C O   1 
ATOM   1403 C  CB  . SER C 1 31 ? 8.247   -0.646 70.029  1.00 28.10  ? 293 SER C CB  1 
ATOM   1404 O  OG  . SER C 1 31 ? 8.082   -1.457 71.181  1.00 90.98  ? 293 SER C OG  1 
ATOM   1405 N  N   . LYS C 1 32 ? 9.109   2.149  68.867  1.00 23.38  ? 294 LYS C N   1 
ATOM   1406 C  CA  . LYS C 1 32 ? 9.125   3.076  67.738  1.00 21.04  ? 294 LYS C CA  1 
ATOM   1407 C  C   . LYS C 1 32 ? 10.520  3.638  67.494  1.00 31.04  ? 294 LYS C C   1 
ATOM   1408 O  O   . LYS C 1 32 ? 11.004  3.645  66.359  1.00 21.97  ? 294 LYS C O   1 
ATOM   1409 C  CB  . LYS C 1 32 ? 8.104   4.200  67.939  1.00 26.85  ? 294 LYS C CB  1 
ATOM   1410 C  CG  . LYS C 1 32 ? 6.691   3.683  68.159  1.00 42.33  ? 294 LYS C CG  1 
ATOM   1411 C  CD  . LYS C 1 32 ? 6.381   2.542  67.199  1.00 31.78  ? 294 LYS C CD  1 
ATOM   1412 C  CE  . LYS C 1 32 ? 5.210   1.698  67.679  1.00 36.71  ? 294 LYS C CE  1 
ATOM   1413 N  NZ  . LYS C 1 32 ? 5.122   0.407  66.939  1.00 47.83  ? 294 LYS C NZ  1 
ATOM   1414 N  N   . PHE C 1 33 ? 11.166  4.102  68.559  1.00 23.67  ? 295 PHE C N   1 
ATOM   1415 C  CA  . PHE C 1 33 ? 12.541  4.568  68.453  1.00 40.13  ? 295 PHE C CA  1 
ATOM   1416 C  C   . PHE C 1 33 ? 13.419  3.454  67.894  1.00 43.04  ? 295 PHE C C   1 
ATOM   1417 O  O   . PHE C 1 33 ? 14.388  3.715  67.186  1.00 45.50  ? 295 PHE C O   1 
ATOM   1418 C  CB  . PHE C 1 33 ? 13.076  5.035  69.808  1.00 35.02  ? 295 PHE C CB  1 
ATOM   1419 C  CG  . PHE C 1 33 ? 12.663  6.433  70.177  1.00 58.68  ? 295 PHE C CG  1 
ATOM   1420 C  CD1 . PHE C 1 33 ? 13.281  7.527  69.592  1.00 51.87  ? 295 PHE C CD1 1 
ATOM   1421 C  CD2 . PHE C 1 33 ? 11.673  6.655  71.121  1.00 64.93  ? 295 PHE C CD2 1 
ATOM   1422 C  CE1 . PHE C 1 33 ? 12.909  8.815  69.934  1.00 46.75  ? 295 PHE C CE1 1 
ATOM   1423 C  CE2 . PHE C 1 33 ? 11.300  7.938  71.463  1.00 23.52  ? 295 PHE C CE2 1 
ATOM   1424 C  CZ  . PHE C 1 33 ? 11.918  9.016  70.870  1.00 29.23  ? 295 PHE C CZ  1 
ATOM   1425 N  N   . ALA C 1 34 ? 13.066  2.210  68.209  1.00 46.65  ? 296 ALA C N   1 
ATOM   1426 C  CA  . ALA C 1 34 ? 13.785  1.045  67.699  1.00 35.64  ? 296 ALA C CA  1 
ATOM   1427 C  C   . ALA C 1 34 ? 13.621  0.906  66.186  1.00 37.94  ? 296 ALA C C   1 
ATOM   1428 O  O   . ALA C 1 34 ? 14.601  0.776  65.453  1.00 27.22  ? 296 ALA C O   1 
ATOM   1429 C  CB  . ALA C 1 34 ? 13.306  -0.217 68.400  1.00 30.99  ? 296 ALA C CB  1 
ATOM   1430 N  N   . ASP C 1 35 ? 12.374  0.931  65.726  1.00 31.44  ? 297 ASP C N   1 
ATOM   1431 C  CA  . ASP C 1 35 ? 12.080  0.840  64.300  1.00 26.67  ? 297 ASP C CA  1 
ATOM   1432 C  C   . ASP C 1 35 ? 12.899  1.862  63.518  1.00 35.57  ? 297 ASP C C   1 
ATOM   1433 O  O   . ASP C 1 35 ? 13.599  1.519  62.566  1.00 40.94  ? 297 ASP C O   1 
ATOM   1434 C  CB  . ASP C 1 35 ? 10.587  1.066  64.039  1.00 32.06  ? 297 ASP C CB  1 
ATOM   1435 C  CG  . ASP C 1 35 ? 9.712   0.007  64.682  1.00 45.42  ? 297 ASP C CG  1 
ATOM   1436 O  OD1 . ASP C 1 35 ? 10.250  -0.851 65.413  1.00 44.45  ? 297 ASP C OD1 1 
ATOM   1437 O  OD2 . ASP C 1 35 ? 8.483   0.034  64.457  1.00 55.88  ? 297 ASP C OD2 1 
ATOM   1438 N  N   . LEU C 1 36 ? 12.798  3.122  63.931  1.00 36.08  ? 298 LEU C N   1 
ATOM   1439 C  CA  . LEU C 1 36 ? 13.500  4.215  63.272  1.00 26.05  ? 298 LEU C CA  1 
ATOM   1440 C  C   . LEU C 1 36 ? 15.007  4.012  63.303  1.00 30.63  ? 298 LEU C C   1 
ATOM   1441 O  O   . LEU C 1 36 ? 15.688  4.241  62.304  1.00 48.31  ? 298 LEU C O   1 
ATOM   1442 C  CB  . LEU C 1 36 ? 13.136  5.552  63.922  1.00 46.38  ? 298 LEU C CB  1 
ATOM   1443 C  CG  . LEU C 1 36 ? 11.661  5.953  63.857  1.00 39.32  ? 298 LEU C CG  1 
ATOM   1444 C  CD1 . LEU C 1 36 ? 11.388  7.149  64.757  1.00 32.31  ? 298 LEU C CD1 1 
ATOM   1445 C  CD2 . LEU C 1 36 ? 11.237  6.237  62.422  1.00 28.82  ? 298 LEU C CD2 1 
ATOM   1446 N  N   . SER C 1 37 ? 15.523  3.590  64.453  1.00 29.98  ? 299 SER C N   1 
ATOM   1447 C  CA  . SER C 1 37 ? 16.954  3.344  64.602  1.00 29.41  ? 299 SER C CA  1 
ATOM   1448 C  C   . SER C 1 37 ? 17.457  2.313  63.590  1.00 40.62  ? 299 SER C C   1 
ATOM   1449 O  O   . SER C 1 37 ? 18.504  2.493  62.972  1.00 28.41  ? 299 SER C O   1 
ATOM   1450 C  CB  . SER C 1 37 ? 17.274  2.881  66.022  1.00 38.31  ? 299 SER C CB  1 
ATOM   1451 O  OG  . SER C 1 37 ? 17.028  3.911  66.961  1.00 67.87  ? 299 SER C OG  1 
ATOM   1452 N  N   . GLU C 1 38 ? 16.702  1.232  63.426  1.00 32.11  ? 300 GLU C N   1 
ATOM   1453 C  CA  . GLU C 1 38 ? 17.053  0.187  62.473  1.00 38.37  ? 300 GLU C CA  1 
ATOM   1454 C  C   . GLU C 1 38 ? 17.057  0.742  61.052  1.00 44.51  ? 300 GLU C C   1 
ATOM   1455 O  O   . GLU C 1 38 ? 17.975  0.478  60.272  1.00 27.15  ? 300 GLU C O   1 
ATOM   1456 C  CB  . GLU C 1 38 ? 16.074  -0.985 62.589  1.00 42.16  ? 300 GLU C CB  1 
ATOM   1457 C  CG  . GLU C 1 38 ? 15.991  -1.589 63.983  1.00 45.64  ? 300 GLU C CG  1 
ATOM   1458 C  CD  . GLU C 1 38 ? 14.835  -2.562 64.122  1.00 80.78  ? 300 GLU C CD  1 
ATOM   1459 O  OE1 . GLU C 1 38 ? 14.305  -3.007 63.081  1.00 81.41  ? 300 GLU C OE1 1 
ATOM   1460 O  OE2 . GLU C 1 38 ? 14.456  -2.882 65.269  1.00 59.25  ? 300 GLU C OE2 1 
ATOM   1461 N  N   . ALA C 1 39 ? 16.023  1.511  60.726  1.00 34.59  ? 301 ALA C N   1 
ATOM   1462 C  CA  . ALA C 1 39 ? 15.899  2.114  59.406  1.00 41.06  ? 301 ALA C CA  1 
ATOM   1463 C  C   . ALA C 1 39 ? 17.029  3.108  59.158  1.00 47.23  ? 301 ALA C C   1 
ATOM   1464 O  O   . ALA C 1 39 ? 17.535  3.223  58.042  1.00 31.62  ? 301 ALA C O   1 
ATOM   1465 C  CB  . ALA C 1 39 ? 14.546  2.796  59.264  1.00 42.72  ? 301 ALA C CB  1 
ATOM   1466 N  N   . ALA C 1 40 ? 17.422  3.822  60.207  1.00 40.05  ? 302 ALA C N   1 
ATOM   1467 C  CA  . ALA C 1 40 ? 18.505  4.793  60.107  1.00 27.22  ? 302 ALA C CA  1 
ATOM   1468 C  C   . ALA C 1 40 ? 19.827  4.114  59.762  1.00 31.70  ? 302 ALA C C   1 
ATOM   1469 O  O   . ALA C 1 40 ? 20.515  4.524  58.828  1.00 34.43  ? 302 ALA C O   1 
ATOM   1470 C  CB  . ALA C 1 40 ? 18.632  5.583  61.399  1.00 20.95  ? 302 ALA C CB  1 
ATOM   1471 N  N   . ASN C 1 41 ? 20.180  3.083  60.525  1.00 48.68  ? 303 ASN C N   1 
ATOM   1472 C  CA  . ASN C 1 41 ? 21.397  2.320  60.266  1.00 34.68  ? 303 ASN C CA  1 
ATOM   1473 C  C   . ASN C 1 41 ? 21.363  1.708  58.873  1.00 37.84  ? 303 ASN C C   1 
ATOM   1474 O  O   . ASN C 1 41 ? 22.376  1.651  58.175  1.00 30.52  ? 303 ASN C O   1 
ATOM   1475 C  CB  . ASN C 1 41 ? 21.569  1.215  61.309  1.00 18.71  ? 303 ASN C CB  1 
ATOM   1476 C  CG  . ASN C 1 41 ? 21.782  1.759  62.707  1.00 20.22  ? 303 ASN C CG  1 
ATOM   1477 O  OD1 . ASN C 1 41 ? 22.498  2.740  62.898  1.00 32.58  ? 303 ASN C OD1 1 
ATOM   1478 N  ND2 . ASN C 1 41 ? 21.163  1.121  63.696  1.00 45.64  ? 303 ASN C ND2 1 
ATOM   1479 N  N   . ARG C 1 42 ? 20.182  1.247  58.478  1.00 30.74  ? 304 ARG C N   1 
ATOM   1480 C  CA  . ARG C 1 42 ? 19.985  0.660  57.163  1.00 23.04  ? 304 ARG C CA  1 
ATOM   1481 C  C   . ARG C 1 42 ? 20.329  1.690  56.093  1.00 37.13  ? 304 ARG C C   1 
ATOM   1482 O  O   . ARG C 1 42 ? 21.079  1.403  55.157  1.00 51.35  ? 304 ARG C O   1 
ATOM   1483 C  CB  . ARG C 1 42 ? 18.536  0.197  57.016  1.00 30.12  ? 304 ARG C CB  1 
ATOM   1484 C  CG  . ARG C 1 42 ? 18.371  -1.191 56.432  1.00 42.89  ? 304 ARG C CG  1 
ATOM   1485 C  CD  . ARG C 1 42 ? 17.189  -1.907 57.071  1.00 50.88  ? 304 ARG C CD  1 
ATOM   1486 N  NE  . ARG C 1 42 ? 15.937  -1.180 56.880  1.00 64.62  ? 304 ARG C NE  1 
ATOM   1487 C  CZ  . ARG C 1 42 ? 14.875  -1.297 57.671  1.00 59.35  ? 304 ARG C CZ  1 
ATOM   1488 N  NH1 . ARG C 1 42 ? 14.912  -2.107 58.720  1.00 42.63  ? 304 ARG C NH1 1 
ATOM   1489 N  NH2 . ARG C 1 42 ? 13.777  -0.596 57.417  1.00 71.63  ? 304 ARG C NH2 1 
ATOM   1490 N  N   . ASN C 1 43 ? 19.779  2.892  56.244  1.00 37.17  ? 305 ASN C N   1 
ATOM   1491 C  CA  . ASN C 1 43 ? 20.101  4.004  55.357  1.00 26.32  ? 305 ASN C CA  1 
ATOM   1492 C  C   . ASN C 1 43 ? 21.587  4.332  55.423  1.00 40.13  ? 305 ASN C C   1 
ATOM   1493 O  O   . ASN C 1 43 ? 22.216  4.641  54.410  1.00 49.02  ? 305 ASN C O   1 
ATOM   1494 C  CB  . ASN C 1 43 ? 19.290  5.249  55.729  1.00 37.35  ? 305 ASN C CB  1 
ATOM   1495 C  CG  . ASN C 1 43 ? 17.807  5.099  55.430  1.00 46.98  ? 305 ASN C CG  1 
ATOM   1496 O  OD1 . ASN C 1 43 ? 17.282  3.988  55.370  1.00 56.10  ? 305 ASN C OD1 1 
ATOM   1497 N  ND2 . ASN C 1 43 ? 17.125  6.225  55.245  1.00 33.40  ? 305 ASN C ND2 1 
ATOM   1498 N  N   . ASN C 1 44 ? 22.135  4.269  56.632  1.00 38.58  ? 306 ASN C N   1 
ATOM   1499 C  CA  . ASN C 1 44 ? 23.552  4.529  56.858  1.00 32.76  ? 306 ASN C CA  1 
ATOM   1500 C  C   . ASN C 1 44 ? 24.448  3.580  56.073  1.00 41.24  ? 306 ASN C C   1 
ATOM   1501 O  O   . ASN C 1 44 ? 25.436  4.003  55.469  1.00 38.12  ? 306 ASN C O   1 
ATOM   1502 C  CB  . ASN C 1 44 ? 23.879  4.429  58.348  1.00 35.66  ? 306 ASN C CB  1 
ATOM   1503 C  CG  . ASN C 1 44 ? 23.365  5.615  59.138  1.00 54.74  ? 306 ASN C CG  1 
ATOM   1504 O  OD1 . ASN C 1 44 ? 22.873  5.465  60.257  1.00 57.89  ? 306 ASN C OD1 1 
ATOM   1505 N  ND2 . ASN C 1 44 ? 23.473  6.803  58.557  1.00 45.27  ? 306 ASN C ND2 1 
ATOM   1506 N  N   . ASP C 1 45 ? 24.094  2.298  56.090  1.00 45.90  ? 307 ASP C N   1 
ATOM   1507 C  CA  . ASP C 1 45 ? 24.851  1.277  55.377  1.00 38.19  ? 307 ASP C CA  1 
ATOM   1508 C  C   . ASP C 1 45 ? 24.844  1.556  53.881  1.00 39.90  ? 307 ASP C C   1 
ATOM   1509 O  O   . ASP C 1 45 ? 25.879  1.490  53.221  1.00 44.43  ? 307 ASP C O   1 
ATOM   1510 C  CB  . ASP C 1 45 ? 24.269  -0.109 55.653  1.00 37.57  ? 307 ASP C CB  1 
ATOM   1511 C  CG  . ASP C 1 45 ? 24.381  -0.508 57.114  1.00 60.68  ? 307 ASP C CG  1 
ATOM   1512 O  OD1 . ASP C 1 45 ? 25.282  0.010  57.812  1.00 34.41  ? 307 ASP C OD1 1 
ATOM   1513 O  OD2 . ASP C 1 45 ? 23.566  -1.344 57.559  1.00 51.22  ? 307 ASP C OD2 1 
ATOM   1514 N  N   . ALA C 1 46 ? 23.668  1.877  53.355  1.00 35.00  ? 308 ALA C N   1 
ATOM   1515 C  CA  . ALA C 1 46 ? 23.520  2.164  51.936  1.00 39.49  ? 308 ALA C CA  1 
ATOM   1516 C  C   . ALA C 1 46 ? 24.470  3.278  51.512  1.00 45.19  ? 308 ALA C C   1 
ATOM   1517 O  O   . ALA C 1 46 ? 25.223  3.131  50.553  1.00 41.78  ? 308 ALA C O   1 
ATOM   1518 C  CB  . ALA C 1 46 ? 22.080  2.537  51.619  1.00 32.54  ? 308 ALA C CB  1 
ATOM   1519 N  N   . LEU C 1 47 ? 24.436  4.388  52.240  1.00 48.74  ? 309 LEU C N   1 
ATOM   1520 C  CA  . LEU C 1 47 ? 25.307  5.518  51.948  1.00 34.94  ? 309 LEU C CA  1 
ATOM   1521 C  C   . LEU C 1 47 ? 26.769  5.110  52.084  1.00 54.14  ? 309 LEU C C   1 
ATOM   1522 O  O   . LEU C 1 47 ? 27.628  5.582  51.338  1.00 49.30  ? 309 LEU C O   1 
ATOM   1523 C  CB  . LEU C 1 47 ? 24.992  6.688  52.883  1.00 28.71  ? 309 LEU C CB  1 
ATOM   1524 C  CG  . LEU C 1 47 ? 25.706  8.011  52.605  1.00 36.66  ? 309 LEU C CG  1 
ATOM   1525 C  CD1 . LEU C 1 47 ? 25.502  8.433  51.160  1.00 41.60  ? 309 LEU C CD1 1 
ATOM   1526 C  CD2 . LEU C 1 47 ? 25.222  9.095  53.556  1.00 45.38  ? 309 LEU C CD2 1 
ATOM   1527 N  N   . ARG C 1 48 ? 27.041  4.228  53.041  1.00 61.68  ? 310 ARG C N   1 
ATOM   1528 C  CA  . ARG C 1 48 ? 28.394  3.733  53.279  1.00 45.59  ? 310 ARG C CA  1 
ATOM   1529 C  C   . ARG C 1 48 ? 28.934  2.949  52.086  1.00 56.06  ? 310 ARG C C   1 
ATOM   1530 O  O   . ARG C 1 48 ? 30.042  3.202  51.617  1.00 46.00  ? 310 ARG C O   1 
ATOM   1531 C  CB  . ARG C 1 48 ? 28.426  2.858  54.535  1.00 42.99  ? 310 ARG C CB  1 
ATOM   1532 C  CG  . ARG C 1 48 ? 29.686  2.023  54.682  1.00 81.84  ? 310 ARG C CG  1 
ATOM   1533 C  CD  . ARG C 1 48 ? 30.886  2.877  55.060  1.00 97.48  ? 310 ARG C CD  1 
ATOM   1534 N  NE  . ARG C 1 48 ? 30.842  3.297  56.458  1.00 108.62 ? 310 ARG C NE  1 
ATOM   1535 C  CZ  . ARG C 1 48 ? 31.863  3.849  57.105  1.00 115.09 ? 310 ARG C CZ  1 
ATOM   1536 N  NH1 . ARG C 1 48 ? 33.017  4.047  56.482  1.00 113.06 ? 310 ARG C NH1 1 
ATOM   1537 N  NH2 . ARG C 1 48 ? 31.734  4.199  58.378  1.00 100.69 ? 310 ARG C NH2 1 
ATOM   1538 N  N   . GLN C 1 49 ? 28.144  2.000  51.594  1.00 26.70  ? 311 GLN C N   1 
ATOM   1539 C  CA  . GLN C 1 49 ? 28.561  1.169  50.469  1.00 42.59  ? 311 GLN C CA  1 
ATOM   1540 C  C   . GLN C 1 49 ? 28.566  1.945  49.155  1.00 51.38  ? 311 GLN C C   1 
ATOM   1541 O  O   . GLN C 1 49 ? 29.423  1.723  48.301  1.00 48.25  ? 311 GLN C O   1 
ATOM   1542 C  CB  . GLN C 1 49 ? 27.670  -0.071 50.347  1.00 42.61  ? 311 GLN C CB  1 
ATOM   1543 C  CG  . GLN C 1 49 ? 26.214  0.233  50.050  1.00 73.66  ? 311 GLN C CG  1 
ATOM   1544 C  CD  . GLN C 1 49 ? 25.368  -1.021 49.947  1.00 89.94  ? 311 GLN C CD  1 
ATOM   1545 O  OE1 . GLN C 1 49 ? 24.229  -1.056 50.414  1.00 87.85  ? 311 GLN C OE1 1 
ATOM   1546 N  NE2 . GLN C 1 49 ? 25.926  -2.063 49.341  1.00 89.13  ? 311 GLN C NE2 1 
ATOM   1547 N  N   . ALA C 1 50 ? 27.607  2.853  48.997  1.00 41.49  ? 312 ALA C N   1 
ATOM   1548 C  CA  . ALA C 1 50 ? 27.530  3.671  47.793  1.00 29.30  ? 312 ALA C CA  1 
ATOM   1549 C  C   . ALA C 1 50 ? 28.801  4.496  47.632  1.00 42.32  ? 312 ALA C C   1 
ATOM   1550 O  O   . ALA C 1 50 ? 29.309  4.664  46.523  1.00 56.29  ? 312 ALA C O   1 
ATOM   1551 C  CB  . ALA C 1 50 ? 26.307  4.575  47.837  1.00 34.44  ? 312 ALA C CB  1 
ATOM   1552 N  N   . LYS C 1 51 ? 29.313  5.003  48.749  1.00 44.05  ? 313 LYS C N   1 
ATOM   1553 C  CA  . LYS C 1 51 ? 30.553  5.769  48.743  1.00 48.78  ? 313 LYS C CA  1 
ATOM   1554 C  C   . LYS C 1 51 ? 31.754  4.874  48.438  1.00 41.32  ? 313 LYS C C   1 
ATOM   1555 O  O   . LYS C 1 51 ? 32.729  5.315  47.830  1.00 59.95  ? 313 LYS C O   1 
ATOM   1556 C  CB  . LYS C 1 51 ? 30.748  6.479  50.083  1.00 45.23  ? 313 LYS C CB  1 
ATOM   1557 C  CG  . LYS C 1 51 ? 29.805  7.650  50.310  1.00 45.52  ? 313 LYS C CG  1 
ATOM   1558 C  CD  . LYS C 1 51 ? 29.883  8.150  51.744  1.00 80.04  ? 313 LYS C CD  1 
ATOM   1559 C  CE  . LYS C 1 51 ? 29.148  9.470  51.917  1.00 77.71  ? 313 LYS C CE  1 
ATOM   1560 N  NZ  . LYS C 1 51 ? 29.788  10.575 51.145  1.00 87.66  ? 313 LYS C NZ  1 
ATOM   1561 N  N   . GLN C 1 52 ? 31.679  3.617  48.863  1.00 47.67  ? 314 GLN C N   1 
ATOM   1562 C  CA  . GLN C 1 52 ? 32.729  2.648  48.565  1.00 49.33  ? 314 GLN C CA  1 
ATOM   1563 C  C   . GLN C 1 52 ? 32.895  2.465  47.062  1.00 54.75  ? 314 GLN C C   1 
ATOM   1564 O  O   . GLN C 1 52 ? 34.006  2.543  46.539  1.00 56.37  ? 314 GLN C O   1 
ATOM   1565 C  CB  . GLN C 1 52 ? 32.436  1.300  49.229  1.00 56.93  ? 314 GLN C CB  1 
ATOM   1566 C  CG  . GLN C 1 52 ? 32.917  1.195  50.665  1.00 88.45  ? 314 GLN C CG  1 
ATOM   1567 C  CD  . GLN C 1 52 ? 34.431  1.183  50.773  1.00 105.42 ? 314 GLN C CD  1 
ATOM   1568 O  OE1 . GLN C 1 52 ? 35.135  0.974  49.783  1.00 78.95  ? 314 GLN C OE1 1 
ATOM   1569 N  NE2 . GLN C 1 52 ? 34.939  1.405  51.979  1.00 102.37 ? 314 GLN C NE2 1 
ATOM   1570 N  N   . GLU C 1 53 ? 31.785  2.216  46.373  1.00 42.79  ? 315 GLU C N   1 
ATOM   1571 C  CA  . GLU C 1 53 ? 31.803  2.063  44.924  1.00 39.63  ? 315 GLU C CA  1 
ATOM   1572 C  C   . GLU C 1 53 ? 32.523  3.235  44.272  1.00 50.99  ? 315 GLU C C   1 
ATOM   1573 O  O   . GLU C 1 53 ? 33.418  3.047  43.450  1.00 67.67  ? 315 GLU C O   1 
ATOM   1574 C  CB  . GLU C 1 53 ? 30.381  1.973  44.373  1.00 38.74  ? 315 GLU C CB  1 
ATOM   1575 C  CG  . GLU C 1 53 ? 29.518  0.904  45.018  1.00 48.31  ? 315 GLU C CG  1 
ATOM   1576 C  CD  . GLU C 1 53 ? 28.126  0.844  44.417  1.00 74.59  ? 315 GLU C CD  1 
ATOM   1577 O  OE1 . GLU C 1 53 ? 27.204  0.335  45.090  1.00 80.80  ? 315 GLU C OE1 1 
ATOM   1578 O  OE2 . GLU C 1 53 ? 27.953  1.310  43.271  1.00 53.04  ? 315 GLU C OE2 1 
ATOM   1579 N  N   . SER C 1 54 ? 32.120  4.444  44.648  1.00 56.16  ? 316 SER C N   1 
ATOM   1580 C  CA  . SER C 1 54 ? 32.696  5.663  44.092  1.00 49.18  ? 316 SER C CA  1 
ATOM   1581 C  C   . SER C 1 54 ? 34.211  5.723  44.263  1.00 56.08  ? 316 SER C C   1 
ATOM   1582 O  O   . SER C 1 54 ? 34.947  5.879  43.289  1.00 64.60  ? 316 SER C O   1 
ATOM   1583 C  CB  . SER C 1 54 ? 32.047  6.894  44.728  1.00 52.24  ? 316 SER C CB  1 
ATOM   1584 O  OG  . SER C 1 54 ? 32.630  8.087  44.236  1.00 64.64  ? 316 SER C OG  1 
ATOM   1585 N  N   . THR C 1 55 ? 34.673  5.600  45.504  1.00 61.61  ? 317 THR C N   1 
ATOM   1586 C  CA  . THR C 1 55 ? 36.100  5.676  45.791  1.00 62.84  ? 317 THR C CA  1 
ATOM   1587 C  C   . THR C 1 55 ? 36.844  4.492  45.179  1.00 76.55  ? 317 THR C C   1 
ATOM   1588 O  O   . THR C 1 55 ? 38.036  4.582  44.887  1.00 88.75  ? 317 THR C O   1 
ATOM   1589 C  CB  . THR C 1 55 ? 36.377  5.738  47.305  1.00 65.15  ? 317 THR C CB  1 
ATOM   1590 O  OG1 . THR C 1 55 ? 37.777  5.950  47.527  1.00 98.86  ? 317 THR C OG1 1 
ATOM   1591 C  CG2 . THR C 1 55 ? 35.949  4.446  47.981  1.00 78.69  ? 317 THR C CG2 1 
ATOM   1592 N  N   . GLU C 1 56 ? 36.130  3.388  44.980  1.00 71.35  ? 318 GLU C N   1 
ATOM   1593 C  CA  . GLU C 1 56 ? 36.710  2.206  44.355  1.00 75.06  ? 318 GLU C CA  1 
ATOM   1594 C  C   . GLU C 1 56 ? 36.923  2.445  42.863  1.00 84.34  ? 318 GLU C C   1 
ATOM   1595 O  O   . GLU C 1 56 ? 37.938  2.036  42.295  1.00 81.29  ? 318 GLU C O   1 
ATOM   1596 C  CB  . GLU C 1 56 ? 35.814  0.986  44.572  1.00 66.34  ? 318 GLU C CB  1 
ATOM   1597 C  CG  . GLU C 1 56 ? 36.484  -0.337 44.243  1.00 100.05 ? 318 GLU C CG  1 
ATOM   1598 C  CD  . GLU C 1 56 ? 37.493  -0.760 45.297  1.00 117.00 ? 318 GLU C CD  1 
ATOM   1599 O  OE1 . GLU C 1 56 ? 37.226  -0.545 46.499  1.00 97.01  ? 318 GLU C OE1 1 
ATOM   1600 O  OE2 . GLU C 1 56 ? 38.549  -1.314 44.924  1.00 111.85 ? 318 GLU C OE2 1 
ATOM   1601 N  N   . TYR C 1 57 ? 35.960  3.110  42.233  1.00 74.02  ? 319 TYR C N   1 
ATOM   1602 C  CA  . TYR C 1 57 ? 36.085  3.476  40.829  1.00 38.18  ? 319 TYR C CA  1 
ATOM   1603 C  C   . TYR C 1 57 ? 37.167  4.535  40.655  1.00 69.10  ? 319 TYR C C   1 
ATOM   1604 O  O   . TYR C 1 57 ? 37.914  4.520  39.678  1.00 87.40  ? 319 TYR C O   1 
ATOM   1605 C  CB  . TYR C 1 57 ? 34.754  3.990  40.280  1.00 47.03  ? 319 TYR C CB  1 
ATOM   1606 C  CG  . TYR C 1 57 ? 33.702  2.918  40.092  1.00 49.78  ? 319 TYR C CG  1 
ATOM   1607 C  CD1 . TYR C 1 57 ? 34.029  1.681  39.549  1.00 56.18  ? 319 TYR C CD1 1 
ATOM   1608 C  CD2 . TYR C 1 57 ? 32.378  3.151  40.435  1.00 55.52  ? 319 TYR C CD2 1 
ATOM   1609 C  CE1 . TYR C 1 57 ? 33.069  0.703  39.369  1.00 70.71  ? 319 TYR C CE1 1 
ATOM   1610 C  CE2 . TYR C 1 57 ? 31.411  2.181  40.258  1.00 54.86  ? 319 TYR C CE2 1 
ATOM   1611 C  CZ  . TYR C 1 57 ? 31.761  0.959  39.724  1.00 61.92  ? 319 TYR C CZ  1 
ATOM   1612 O  OH  . TYR C 1 57 ? 30.797  -0.008 39.547  1.00 75.99  ? 319 TYR C OH  1 
ATOM   1613 N  N   . ARG C 1 58 ? 37.246  5.452  41.613  1.00 77.02  ? 320 ARG C N   1 
ATOM   1614 C  CA  . ARG C 1 58 ? 38.265  6.491  41.593  1.00 56.60  ? 320 ARG C CA  1 
ATOM   1615 C  C   . ARG C 1 58 ? 39.651  5.862  41.656  1.00 63.77  ? 320 ARG C C   1 
ATOM   1616 O  O   . ARG C 1 58 ? 40.584  6.325  41.000  1.00 85.36  ? 320 ARG C O   1 
ATOM   1617 C  CB  . ARG C 1 58 ? 38.068  7.459  42.762  1.00 71.57  ? 320 ARG C CB  1 
ATOM   1618 C  CG  . ARG C 1 58 ? 38.998  8.660  42.735  1.00 82.46  ? 320 ARG C CG  1 
ATOM   1619 C  CD  . ARG C 1 58 ? 38.556  9.732  43.721  1.00 77.49  ? 320 ARG C CD  1 
ATOM   1620 N  NE  . ARG C 1 58 ? 38.548  9.248  45.099  1.00 79.71  ? 320 ARG C NE  1 
ATOM   1621 C  CZ  . ARG C 1 58 ? 39.599  9.290  45.912  1.00 99.06  ? 320 ARG C CZ  1 
ATOM   1622 N  NH1 . ARG C 1 58 ? 40.749  9.792  45.484  1.00 104.01 ? 320 ARG C NH1 1 
ATOM   1623 N  NH2 . ARG C 1 58 ? 39.502  8.829  47.151  1.00 90.24  ? 320 ARG C NH2 1 
ATOM   1624 N  N   . ARG C 1 59 ? 39.778  4.801  42.447  1.00 62.13  ? 321 ARG C N   1 
ATOM   1625 C  CA  . ARG C 1 59 ? 41.034  4.068  42.553  1.00 88.86  ? 321 ARG C CA  1 
ATOM   1626 C  C   . ARG C 1 59 ? 41.390  3.416  41.221  1.00 89.72  ? 321 ARG C C   1 
ATOM   1627 O  O   . ARG C 1 59 ? 42.540  3.459  40.785  1.00 95.11  ? 321 ARG C O   1 
ATOM   1628 C  CB  . ARG C 1 59 ? 40.950  3.004  43.651  1.00 89.97  ? 321 ARG C CB  1 
ATOM   1629 C  CG  . ARG C 1 59 ? 40.950  3.559  45.068  1.00 101.45 ? 321 ARG C CG  1 
ATOM   1630 C  CD  . ARG C 1 59 ? 42.245  4.296  45.374  1.00 119.82 ? 321 ARG C CD  1 
ATOM   1631 N  NE  . ARG C 1 59 ? 42.391  4.597  46.796  1.00 131.70 ? 321 ARG C NE  1 
ATOM   1632 C  CZ  . ARG C 1 59 ? 41.990  5.727  47.369  1.00 120.09 ? 321 ARG C CZ  1 
ATOM   1633 N  NH1 . ARG C 1 59 ? 41.413  6.673  46.642  1.00 97.85  ? 321 ARG C NH1 1 
ATOM   1634 N  NH2 . ARG C 1 59 ? 42.167  5.912  48.671  1.00 86.97  ? 321 ARG C NH2 1 
ATOM   1635 N  N   . GLN C 1 60 ? 40.393  2.813  40.582  1.00 97.12  ? 322 GLN C N   1 
ATOM   1636 C  CA  . GLN C 1 60 ? 40.587  2.175  39.286  1.00 85.69  ? 322 GLN C CA  1 
ATOM   1637 C  C   . GLN C 1 60 ? 40.994  3.192  38.226  1.00 88.68  ? 322 GLN C C   1 
ATOM   1638 O  O   . GLN C 1 60 ? 41.814  2.899  37.355  1.00 94.85  ? 322 GLN C O   1 
ATOM   1639 C  CB  . GLN C 1 60 ? 39.313  1.449  38.845  1.00 69.23  ? 322 GLN C CB  1 
ATOM   1640 C  CG  . GLN C 1 60 ? 38.905  0.289  39.742  1.00 81.99  ? 322 GLN C CG  1 
ATOM   1641 C  CD  . GLN C 1 60 ? 37.765  -0.524 39.158  1.00 89.69  ? 322 GLN C CD  1 
ATOM   1642 O  OE1 . GLN C 1 60 ? 37.375  -0.330 38.006  1.00 85.36  ? 322 GLN C OE1 1 
ATOM   1643 N  NE2 . GLN C 1 60 ? 37.224  -1.443 39.951  1.00 95.75  ? 322 GLN C NE2 1 
ATOM   1644 N  N   . VAL C 1 61 ? 40.415  4.386  38.307  1.00 64.21  ? 323 VAL C N   1 
ATOM   1645 C  CA  . VAL C 1 61 ? 40.701  5.447  37.348  1.00 66.68  ? 323 VAL C CA  1 
ATOM   1646 C  C   . VAL C 1 61 ? 42.178  5.824  37.332  1.00 69.60  ? 323 VAL C C   1 
ATOM   1647 O  O   . VAL C 1 61 ? 42.805  5.866  36.274  1.00 87.16  ? 323 VAL C O   1 
ATOM   1648 C  CB  . VAL C 1 61 ? 39.868  6.707  37.638  1.00 55.40  ? 323 VAL C CB  1 
ATOM   1649 C  CG1 . VAL C 1 61 ? 40.451  7.905  36.908  1.00 65.78  ? 323 VAL C CG1 1 
ATOM   1650 C  CG2 . VAL C 1 61 ? 38.413  6.482  37.246  1.00 42.54  ? 323 VAL C CG2 1 
ATOM   1651 N  N   . GLN C 1 62 ? 42.730  6.097  38.509  1.00 92.84  ? 324 GLN C N   1 
ATOM   1652 C  CA  . GLN C 1 62 ? 44.134  6.475  38.621  1.00 103.41 ? 324 GLN C CA  1 
ATOM   1653 C  C   . GLN C 1 62 ? 45.048  5.251  38.635  1.00 95.63  ? 324 GLN C C   1 
ATOM   1654 O  O   . GLN C 1 62 ? 46.268  5.373  38.734  1.00 107.07 ? 324 GLN C O   1 
ATOM   1655 C  CB  . GLN C 1 62 ? 44.357  7.344  39.861  1.00 109.52 ? 324 GLN C CB  1 
ATOM   1656 C  CG  . GLN C 1 62 ? 43.736  8.732  39.750  1.00 94.43  ? 324 GLN C CG  1 
ATOM   1657 C  CD  . GLN C 1 62 ? 43.827  9.523  41.040  1.00 112.47 ? 324 GLN C CD  1 
ATOM   1658 O  OE1 . GLN C 1 62 ? 43.898  8.951  42.128  1.00 118.90 ? 324 GLN C OE1 1 
ATOM   1659 N  NE2 . GLN C 1 62 ? 43.821  10.847 40.926  1.00 100.83 ? 324 GLN C NE2 1 
ATOM   1660 N  N   . SER C 1 63 ? 44.446  4.070  38.534  1.00 94.70  ? 325 SER C N   1 
ATOM   1661 C  CA  . SER C 1 63 ? 45.201  2.833  38.382  1.00 98.54  ? 325 SER C CA  1 
ATOM   1662 C  C   . SER C 1 63 ? 45.497  2.611  36.906  1.00 105.38 ? 325 SER C C   1 
ATOM   1663 O  O   . SER C 1 63 ? 46.627  2.304  36.522  1.00 91.05  ? 325 SER C O   1 
ATOM   1664 C  CB  . SER C 1 63 ? 44.413  1.649  38.941  1.00 95.46  ? 325 SER C CB  1 
ATOM   1665 O  OG  . SER C 1 63 ? 45.032  0.420  38.601  1.00 92.17  ? 325 SER C OG  1 
ATOM   1666 N  N   . LEU C 1 64 ? 44.465  2.769  36.084  1.00 102.20 ? 326 LEU C N   1 
ATOM   1667 C  CA  . LEU C 1 64 ? 44.609  2.677  34.638  1.00 93.87  ? 326 LEU C CA  1 
ATOM   1668 C  C   . LEU C 1 64 ? 45.484  3.815  34.130  1.00 99.21  ? 326 LEU C C   1 
ATOM   1669 O  O   . LEU C 1 64 ? 46.359  3.608  33.289  1.00 103.91 ? 326 LEU C O   1 
ATOM   1670 C  CB  . LEU C 1 64 ? 43.238  2.728  33.963  1.00 73.65  ? 326 LEU C CB  1 
ATOM   1671 C  CG  . LEU C 1 64 ? 42.238  1.644  34.372  1.00 83.18  ? 326 LEU C CG  1 
ATOM   1672 C  CD1 . LEU C 1 64 ? 40.838  1.986  33.883  1.00 47.94  ? 326 LEU C CD1 1 
ATOM   1673 C  CD2 . LEU C 1 64 ? 42.679  0.281  33.857  1.00 79.30  ? 326 LEU C CD2 1 
ATOM   1674 N  N   . THR C 1 65 ? 45.243  5.016  34.648  1.00 103.68 ? 327 THR C N   1 
ATOM   1675 C  CA  . THR C 1 65 ? 46.020  6.192  34.271  1.00 99.93  ? 327 THR C CA  1 
ATOM   1676 C  C   . THR C 1 65 ? 47.494  5.987  34.596  1.00 102.57 ? 327 THR C C   1 
ATOM   1677 O  O   . THR C 1 65 ? 48.371  6.389  33.831  1.00 108.31 ? 327 THR C O   1 
ATOM   1678 C  CB  . THR C 1 65 ? 45.522  7.460  34.993  1.00 101.16 ? 327 THR C CB  1 
ATOM   1679 O  OG1 . THR C 1 65 ? 44.152  7.704  34.648  1.00 96.08  ? 327 THR C OG1 1 
ATOM   1680 C  CG2 . THR C 1 65 ? 46.360  8.665  34.596  1.00 97.65  ? 327 THR C CG2 1 
ATOM   1681 N  N   . CYS C 1 66 ? 47.757  5.357  35.736  1.00 112.15 ? 328 CYS C N   1 
ATOM   1682 C  CA  . CYS C 1 66 ? 49.119  5.044  36.151  1.00 122.88 ? 328 CYS C CA  1 
ATOM   1683 C  C   . CYS C 1 66 ? 49.772  4.075  35.170  1.00 123.03 ? 328 CYS C C   1 
ATOM   1684 O  O   . CYS C 1 66 ? 50.984  3.858  35.206  1.00 119.97 ? 328 CYS C O   1 
ATOM   1685 C  CB  . CYS C 1 66 ? 49.122  4.449  37.561  1.00 115.13 ? 328 CYS C CB  1 
ATOM   1686 S  SG  . CYS C 1 66 ? 50.753  3.968  38.180  1.00 137.40 ? 328 CYS C SG  1 
ATOM   1687 N  N   . GLU C 1 67 ? 48.960  3.500  34.290  1.00 123.85 ? 329 GLU C N   1 
ATOM   1688 C  CA  . GLU C 1 67 ? 49.439  2.523  33.320  1.00 115.11 ? 329 GLU C CA  1 
ATOM   1689 C  C   . GLU C 1 67 ? 49.382  3.065  31.890  1.00 110.04 ? 329 GLU C C   1 
ATOM   1690 O  O   . GLU C 1 67 ? 50.016  2.521  30.986  1.00 108.85 ? 329 GLU C O   1 
ATOM   1691 C  CB  . GLU C 1 67 ? 48.644  1.220  33.449  1.00 112.42 ? 329 GLU C CB  1 
ATOM   1692 C  CG  . GLU C 1 67 ? 49.040  0.131  32.470  1.00 119.14 ? 329 GLU C CG  1 
ATOM   1693 C  CD  . GLU C 1 67 ? 48.178  0.136  31.226  1.00 120.99 ? 329 GLU C CD  1 
ATOM   1694 O  OE1 . GLU C 1 67 ? 46.966  0.412  31.347  1.00 113.86 ? 329 GLU C OE1 1 
ATOM   1695 O  OE2 . GLU C 1 67 ? 48.709  -0.139 30.130  1.00 113.87 ? 329 GLU C OE2 1 
ATOM   1696 N  N   . VAL C 1 68 ? 48.630  4.144  31.693  1.00 110.36 ? 330 VAL C N   1 
ATOM   1697 C  CA  . VAL C 1 68 ? 48.553  4.793  30.388  1.00 108.95 ? 330 VAL C CA  1 
ATOM   1698 C  C   . VAL C 1 68 ? 49.841  5.557  30.098  1.00 109.24 ? 330 VAL C C   1 
ATOM   1699 O  O   . VAL C 1 68 ? 50.221  5.744  28.942  1.00 99.73  ? 330 VAL C O   1 
ATOM   1700 C  CB  . VAL C 1 68 ? 47.363  5.770  30.307  1.00 93.84  ? 330 VAL C CB  1 
ATOM   1701 C  CG1 . VAL C 1 68 ? 47.238  6.341  28.903  1.00 59.05  ? 330 VAL C CG1 1 
ATOM   1702 C  CG2 . VAL C 1 68 ? 46.077  5.077  30.714  1.00 92.23  ? 330 VAL C CG2 1 
ATOM   1703 N  N   . ASP C 1 69 ? 50.509  5.995  31.160  1.00 118.04 ? 331 ASP C N   1 
ATOM   1704 C  CA  . ASP C 1 69 ? 51.742  6.766  31.035  1.00 126.67 ? 331 ASP C CA  1 
ATOM   1705 C  C   . ASP C 1 69 ? 52.882  5.928  30.462  1.00 131.26 ? 331 ASP C C   1 
ATOM   1706 O  O   . ASP C 1 69 ? 53.514  6.315  29.479  1.00 134.18 ? 331 ASP C O   1 
ATOM   1707 C  CB  . ASP C 1 69 ? 52.143  7.349  32.391  1.00 122.94 ? 331 ASP C CB  1 
ATOM   1708 C  CG  . ASP C 1 69 ? 51.099  8.299  32.947  1.00 119.12 ? 331 ASP C CG  1 
ATOM   1709 O  OD1 . ASP C 1 69 ? 50.323  8.866  32.149  1.00 99.71  ? 331 ASP C OD1 1 
ATOM   1710 O  OD2 . ASP C 1 69 ? 51.055  8.480  34.182  1.00 116.50 ? 331 ASP C OD2 1 
ATOM   1711 N  N   . ALA C 1 70 ? 53.140  4.780  31.081  1.00 126.64 ? 332 ALA C N   1 
ATOM   1712 C  CA  . ALA C 1 70 ? 54.195  3.883  30.622  1.00 120.17 ? 332 ALA C CA  1 
ATOM   1713 C  C   . ALA C 1 70 ? 53.848  3.288  29.262  1.00 115.16 ? 332 ALA C C   1 
ATOM   1714 O  O   . ALA C 1 70 ? 54.658  2.592  28.651  1.00 116.38 ? 332 ALA C O   1 
ATOM   1715 C  CB  . ALA C 1 70 ? 54.434  2.780  31.642  1.00 102.12 ? 332 ALA C CB  1 
ATOM   1716 N  N   . LEU C 1 71 ? 52.637  3.571  28.794  1.00 113.75 ? 333 LEU C N   1 
ATOM   1717 C  CA  . LEU C 1 71 ? 52.159  3.045  27.521  1.00 116.52 ? 333 LEU C CA  1 
ATOM   1718 C  C   . LEU C 1 71 ? 52.628  3.909  26.355  1.00 117.05 ? 333 LEU C C   1 
ATOM   1719 O  O   . LEU C 1 71 ? 53.668  3.644  25.752  1.00 112.25 ? 333 LEU C O   1 
ATOM   1720 C  CB  . LEU C 1 71 ? 50.633  2.952  27.530  1.00 112.31 ? 333 LEU C CB  1 
ATOM   1721 C  CG  . LEU C 1 71 ? 49.982  2.158  26.396  1.00 100.84 ? 333 LEU C CG  1 
ATOM   1722 C  CD1 . LEU C 1 71 ? 50.681  0.822  26.205  1.00 94.64  ? 333 LEU C CD1 1 
ATOM   1723 C  CD2 . LEU C 1 71 ? 48.501  1.957  26.674  1.00 96.54  ? 333 LEU C CD2 1 
ATOM   1724 N  N   . LEU D 1 3  ? -19.158 19.925 99.117  1.00 48.27  ? 265 LEU D N   1 
ATOM   1725 C  CA  . LEU D 1 3  ? -19.574 21.158 98.458  1.00 69.19  ? 265 LEU D CA  1 
ATOM   1726 C  C   . LEU D 1 3  ? -19.180 21.128 96.981  1.00 76.86  ? 265 LEU D C   1 
ATOM   1727 O  O   . LEU D 1 3  ? -18.105 20.644 96.625  1.00 73.00  ? 265 LEU D O   1 
ATOM   1728 C  CB  . LEU D 1 3  ? -18.967 22.371 99.166  1.00 88.11  ? 265 LEU D CB  1 
ATOM   1729 C  CG  . LEU D 1 3  ? -19.709 23.706 99.052  1.00 89.67  ? 265 LEU D CG  1 
ATOM   1730 C  CD1 . LEU D 1 3  ? -19.379 24.610 100.232 1.00 66.85  ? 265 LEU D CD1 1 
ATOM   1731 C  CD2 . LEU D 1 3  ? -19.395 24.400 97.740  1.00 66.18  ? 265 LEU D CD2 1 
ATOM   1732 N  N   . THR D 1 4  ? -20.055 21.644 96.125  1.00 86.63  ? 266 THR D N   1 
ATOM   1733 C  CA  . THR D 1 4  ? -19.881 21.500 94.681  1.00 87.17  ? 266 THR D CA  1 
ATOM   1734 C  C   . THR D 1 4  ? -19.100 22.637 94.023  1.00 72.31  ? 266 THR D C   1 
ATOM   1735 O  O   . THR D 1 4  ? -18.672 22.514 92.876  1.00 77.00  ? 266 THR D O   1 
ATOM   1736 C  CB  . THR D 1 4  ? -21.236 21.332 93.964  1.00 80.53  ? 266 THR D CB  1 
ATOM   1737 O  OG1 . THR D 1 4  ? -22.156 22.320 94.441  1.00 72.67  ? 266 THR D OG1 1 
ATOM   1738 C  CG2 . THR D 1 4  ? -21.809 19.946 94.226  1.00 56.06  ? 266 THR D CG2 1 
ATOM   1739 N  N   . ALA D 1 5  ? -18.919 23.740 94.742  1.00 90.29  ? 267 ALA D N   1 
ATOM   1740 C  CA  . ALA D 1 5  ? -18.127 24.850 94.224  1.00 96.53  ? 267 ALA D CA  1 
ATOM   1741 C  C   . ALA D 1 5  ? -16.667 24.432 94.105  1.00 64.53  ? 267 ALA D C   1 
ATOM   1742 O  O   . ALA D 1 5  ? -15.915 24.984 93.303  1.00 67.22  ? 267 ALA D O   1 
ATOM   1743 C  CB  . ALA D 1 5  ? -18.265 26.076 95.114  1.00 81.90  ? 267 ALA D CB  1 
ATOM   1744 N  N   . ALA D 1 6  ? -16.273 23.448 94.908  1.00 63.71  ? 268 ALA D N   1 
ATOM   1745 C  CA  . ALA D 1 6  ? -14.917 22.917 94.863  1.00 80.93  ? 268 ALA D CA  1 
ATOM   1746 C  C   . ALA D 1 6  ? -14.726 22.053 93.622  1.00 64.78  ? 268 ALA D C   1 
ATOM   1747 O  O   . ALA D 1 6  ? -13.686 22.112 92.965  1.00 64.99  ? 268 ALA D O   1 
ATOM   1748 C  CB  . ALA D 1 6  ? -14.619 22.117 96.121  1.00 39.92  ? 268 ALA D CB  1 
ATOM   1749 N  N   . LEU D 1 7  ? -15.740 21.253 93.306  1.00 35.61  ? 269 LEU D N   1 
ATOM   1750 C  CA  . LEU D 1 7  ? -15.710 20.402 92.121  1.00 39.75  ? 269 LEU D CA  1 
ATOM   1751 C  C   . LEU D 1 7  ? -15.775 21.223 90.838  1.00 49.84  ? 269 LEU D C   1 
ATOM   1752 O  O   . LEU D 1 7  ? -14.974 21.028 89.924  1.00 61.60  ? 269 LEU D O   1 
ATOM   1753 C  CB  . LEU D 1 7  ? -16.858 19.391 92.151  1.00 55.02  ? 269 LEU D CB  1 
ATOM   1754 C  CG  . LEU D 1 7  ? -16.603 18.105 92.940  1.00 77.42  ? 269 LEU D CG  1 
ATOM   1755 C  CD1 . LEU D 1 7  ? -17.865 17.263 93.017  1.00 55.74  ? 269 LEU D CD1 1 
ATOM   1756 C  CD2 . LEU D 1 7  ? -15.457 17.307 92.325  1.00 63.05  ? 269 LEU D CD2 1 
ATOM   1757 N  N   . ARG D 1 8  ? -16.734 22.140 90.772  1.00 60.03  ? 270 ARG D N   1 
ATOM   1758 C  CA  . ARG D 1 8  ? -16.903 22.979 89.594  1.00 67.94  ? 270 ARG D CA  1 
ATOM   1759 C  C   . ARG D 1 8  ? -15.614 23.731 89.289  1.00 75.94  ? 270 ARG D C   1 
ATOM   1760 O  O   . ARG D 1 8  ? -15.263 23.940 88.128  1.00 82.98  ? 270 ARG D O   1 
ATOM   1761 C  CB  . ARG D 1 8  ? -18.062 23.959 89.790  1.00 78.01  ? 270 ARG D CB  1 
ATOM   1762 C  CG  . ARG D 1 8  ? -18.480 24.675 88.515  1.00 90.91  ? 270 ARG D CG  1 
ATOM   1763 C  CD  . ARG D 1 8  ? -19.909 25.186 88.608  1.00 105.55 ? 270 ARG D CD  1 
ATOM   1764 N  NE  . ARG D 1 8  ? -20.021 26.405 89.404  1.00 116.05 ? 270 ARG D NE  1 
ATOM   1765 C  CZ  . ARG D 1 8  ? -20.094 27.629 88.889  1.00 124.83 ? 270 ARG D CZ  1 
ATOM   1766 N  NH1 . ARG D 1 8  ? -20.069 27.801 87.574  1.00 105.02 ? 270 ARG D NH1 1 
ATOM   1767 N  NH2 . ARG D 1 8  ? -20.196 28.681 89.689  1.00 127.87 ? 270 ARG D NH2 1 
ATOM   1768 N  N   . ASP D 1 9  ? -14.912 24.131 90.345  1.00 77.45  ? 271 ASP D N   1 
ATOM   1769 C  CA  . ASP D 1 9  ? -13.643 24.831 90.206  1.00 44.26  ? 271 ASP D CA  1 
ATOM   1770 C  C   . ASP D 1 9  ? -12.595 23.912 89.593  1.00 57.35  ? 271 ASP D C   1 
ATOM   1771 O  O   . ASP D 1 9  ? -11.835 24.319 88.714  1.00 70.68  ? 271 ASP D O   1 
ATOM   1772 C  CB  . ASP D 1 9  ? -13.164 25.339 91.568  1.00 65.29  ? 271 ASP D CB  1 
ATOM   1773 C  CG  . ASP D 1 9  ? -11.966 26.263 91.459  1.00 89.50  ? 271 ASP D CG  1 
ATOM   1774 O  OD1 . ASP D 1 9  ? -11.533 26.550 90.323  1.00 95.22  ? 271 ASP D OD1 1 
ATOM   1775 O  OD2 . ASP D 1 9  ? -11.457 26.705 92.511  1.00 77.56  ? 271 ASP D OD2 1 
ATOM   1776 N  N   . VAL D 1 10 ? -12.571 22.665 90.055  1.00 71.14  ? 272 VAL D N   1 
ATOM   1777 C  CA  . VAL D 1 10 ? -11.582 21.690 89.605  1.00 64.84  ? 272 VAL D CA  1 
ATOM   1778 C  C   . VAL D 1 10 ? -11.732 21.319 88.131  1.00 48.22  ? 272 VAL D C   1 
ATOM   1779 O  O   . VAL D 1 10 ? -10.763 21.372 87.374  1.00 52.49  ? 272 VAL D O   1 
ATOM   1780 C  CB  . VAL D 1 10 ? -11.615 20.411 90.468  1.00 45.79  ? 272 VAL D CB  1 
ATOM   1781 C  CG1 . VAL D 1 10 ? -10.971 19.247 89.730  1.00 36.26  ? 272 VAL D CG1 1 
ATOM   1782 C  CG2 . VAL D 1 10 ? -10.924 20.660 91.801  1.00 45.19  ? 272 VAL D CG2 1 
ATOM   1783 N  N   . ARG D 1 11 ? -12.941 20.942 87.725  1.00 44.53  ? 273 ARG D N   1 
ATOM   1784 C  CA  . ARG D 1 11 ? -13.169 20.509 86.350  1.00 53.09  ? 273 ARG D CA  1 
ATOM   1785 C  C   . ARG D 1 11 ? -12.803 21.598 85.344  1.00 39.54  ? 273 ARG D C   1 
ATOM   1786 O  O   . ARG D 1 11 ? -12.196 21.319 84.313  1.00 35.65  ? 273 ARG D O   1 
ATOM   1787 C  CB  . ARG D 1 11 ? -14.620 20.071 86.142  1.00 46.11  ? 273 ARG D CB  1 
ATOM   1788 C  CG  . ARG D 1 11 ? -14.875 19.432 84.783  1.00 70.80  ? 273 ARG D CG  1 
ATOM   1789 C  CD  . ARG D 1 11 ? -16.362 19.277 84.501  1.00 93.03  ? 273 ARG D CD  1 
ATOM   1790 N  NE  . ARG D 1 11 ? -16.622 18.924 83.107  1.00 103.37 ? 273 ARG D NE  1 
ATOM   1791 C  CZ  . ARG D 1 11 ? -16.857 17.689 82.675  1.00 106.63 ? 273 ARG D CZ  1 
ATOM   1792 N  NH1 . ARG D 1 11 ? -16.870 16.675 83.530  1.00 99.79  ? 273 ARG D NH1 1 
ATOM   1793 N  NH2 . ARG D 1 11 ? -17.081 17.468 81.387  1.00 92.75  ? 273 ARG D NH2 1 
ATOM   1794 N  N   . GLN D 1 12 ? -13.173 22.837 85.647  1.00 58.10  ? 274 GLN D N   1 
ATOM   1795 C  CA  . GLN D 1 12 ? -12.864 23.955 84.764  1.00 55.70  ? 274 GLN D CA  1 
ATOM   1796 C  C   . GLN D 1 12 ? -11.358 24.184 84.688  1.00 49.70  ? 274 GLN D C   1 
ATOM   1797 O  O   . GLN D 1 12 ? -10.843 24.679 83.684  1.00 57.48  ? 274 GLN D O   1 
ATOM   1798 C  CB  . GLN D 1 12 ? -13.580 25.224 85.230  1.00 71.98  ? 274 GLN D CB  1 
ATOM   1799 C  CG  . GLN D 1 12 ? -15.096 25.111 85.210  1.00 95.09  ? 274 GLN D CG  1 
ATOM   1800 C  CD  . GLN D 1 12 ? -15.787 26.400 85.606  1.00 109.03 ? 274 GLN D CD  1 
ATOM   1801 O  OE1 . GLN D 1 12 ? -15.167 27.463 85.650  1.00 101.00 ? 274 GLN D OE1 1 
ATOM   1802 N  NE2 . GLN D 1 12 ? -17.081 26.312 85.896  1.00 110.71 ? 274 GLN D NE2 1 
ATOM   1803 N  N   . GLN D 1 13 ? -10.658 23.822 85.758  1.00 67.08  ? 275 GLN D N   1 
ATOM   1804 C  CA  . GLN D 1 13 ? -9.204  23.904 85.781  1.00 52.14  ? 275 GLN D CA  1 
ATOM   1805 C  C   . GLN D 1 13 ? -8.595  22.770 84.965  1.00 54.45  ? 275 GLN D C   1 
ATOM   1806 O  O   . GLN D 1 13 ? -7.585  22.951 84.283  1.00 44.81  ? 275 GLN D O   1 
ATOM   1807 C  CB  . GLN D 1 13 ? -8.685  23.848 87.217  1.00 39.95  ? 275 GLN D CB  1 
ATOM   1808 C  CG  . GLN D 1 13 ? -8.852  25.142 87.993  1.00 59.70  ? 275 GLN D CG  1 
ATOM   1809 C  CD  . GLN D 1 13 ? -8.197  25.084 89.359  1.00 85.86  ? 275 GLN D CD  1 
ATOM   1810 O  OE1 . GLN D 1 13 ? -8.021  24.009 89.929  1.00 73.10  ? 275 GLN D OE1 1 
ATOM   1811 N  NE2 . GLN D 1 13 ? -7.829  26.245 89.891  1.00 100.55 ? 275 GLN D NE2 1 
ATOM   1812 N  N   . TYR D 1 14 ? -9.223  21.600 85.042  1.00 50.36  ? 276 TYR D N   1 
ATOM   1813 C  CA  . TYR D 1 14 ? -8.758  20.420 84.324  1.00 40.43  ? 276 TYR D CA  1 
ATOM   1814 C  C   . TYR D 1 14 ? -8.775  20.625 82.816  1.00 45.60  ? 276 TYR D C   1 
ATOM   1815 O  O   . TYR D 1 14 ? -7.788  20.359 82.135  1.00 56.84  ? 276 TYR D O   1 
ATOM   1816 C  CB  . TYR D 1 14 ? -9.614  19.204 84.685  1.00 42.72  ? 276 TYR D CB  1 
ATOM   1817 C  CG  . TYR D 1 14 ? -9.349  17.991 83.820  1.00 58.98  ? 276 TYR D CG  1 
ATOM   1818 C  CD1 . TYR D 1 14 ? -8.289  17.136 84.096  1.00 61.24  ? 276 TYR D CD1 1 
ATOM   1819 C  CD2 . TYR D 1 14 ? -10.157 17.701 82.728  1.00 58.93  ? 276 TYR D CD2 1 
ATOM   1820 C  CE1 . TYR D 1 14 ? -8.040  16.026 83.309  1.00 52.57  ? 276 TYR D CE1 1 
ATOM   1821 C  CE2 . TYR D 1 14 ? -9.917  16.592 81.934  1.00 59.66  ? 276 TYR D CE2 1 
ATOM   1822 C  CZ  . TYR D 1 14 ? -8.857  15.760 82.231  1.00 83.86  ? 276 TYR D CZ  1 
ATOM   1823 O  OH  . TYR D 1 14 ? -8.615  14.658 81.445  1.00 83.56  ? 276 TYR D OH  1 
ATOM   1824 N  N   . GLU D 1 15 ? -9.905  21.090 82.297  1.00 48.72  ? 277 GLU D N   1 
ATOM   1825 C  CA  . GLU D 1 15 ? -10.080 21.235 80.858  1.00 53.16  ? 277 GLU D CA  1 
ATOM   1826 C  C   . GLU D 1 15 ? -9.218  22.356 80.289  1.00 48.63  ? 277 GLU D C   1 
ATOM   1827 O  O   . GLU D 1 15 ? -8.644  22.223 79.210  1.00 31.28  ? 277 GLU D O   1 
ATOM   1828 C  CB  . GLU D 1 15 ? -11.553 21.465 80.526  1.00 65.80  ? 277 GLU D CB  1 
ATOM   1829 C  CG  . GLU D 1 15 ? -12.427 20.253 80.781  1.00 61.64  ? 277 GLU D CG  1 
ATOM   1830 C  CD  . GLU D 1 15 ? -13.899 20.599 80.791  1.00 88.69  ? 277 GLU D CD  1 
ATOM   1831 O  OE1 . GLU D 1 15 ? -14.226 21.802 80.721  1.00 75.88  ? 277 GLU D OE1 1 
ATOM   1832 O  OE2 . GLU D 1 15 ? -14.730 19.671 80.874  1.00 103.47 ? 277 GLU D OE2 1 
ATOM   1833 N  N   . SER D 1 16 ? -9.127  23.462 81.019  1.00 41.12  ? 278 SER D N   1 
ATOM   1834 C  CA  . SER D 1 16 ? -8.289  24.574 80.593  1.00 36.61  ? 278 SER D CA  1 
ATOM   1835 C  C   . SER D 1 16 ? -6.845  24.119 80.432  1.00 56.85  ? 278 SER D C   1 
ATOM   1836 O  O   . SER D 1 16 ? -6.113  24.635 79.585  1.00 58.43  ? 278 SER D O   1 
ATOM   1837 C  CB  . SER D 1 16 ? -8.369  25.729 81.594  1.00 46.15  ? 278 SER D CB  1 
ATOM   1838 O  OG  . SER D 1 16 ? -7.588  26.832 81.166  1.00 73.76  ? 278 SER D OG  1 
ATOM   1839 N  N   . VAL D 1 17 ? -6.443  23.152 81.254  1.00 49.84  ? 279 VAL D N   1 
ATOM   1840 C  CA  . VAL D 1 17 ? -5.097  22.593 81.192  1.00 45.89  ? 279 VAL D CA  1 
ATOM   1841 C  C   . VAL D 1 17 ? -5.015  21.467 80.169  1.00 44.12  ? 279 VAL D C   1 
ATOM   1842 O  O   . VAL D 1 17 ? -4.058  21.383 79.401  1.00 50.15  ? 279 VAL D O   1 
ATOM   1843 C  CB  . VAL D 1 17 ? -4.646  22.054 82.559  1.00 42.70  ? 279 VAL D CB  1 
ATOM   1844 C  CG1 . VAL D 1 17 ? -3.294  21.368 82.440  1.00 50.70  ? 279 VAL D CG1 1 
ATOM   1845 C  CG2 . VAL D 1 17 ? -4.585  23.180 83.577  1.00 65.10  ? 279 VAL D CG2 1 
ATOM   1846 N  N   . ALA D 1 18 ? -6.024  20.601 80.168  1.00 24.23  ? 280 ALA D N   1 
ATOM   1847 C  CA  . ALA D 1 18 ? -6.086  19.488 79.229  1.00 34.99  ? 280 ALA D CA  1 
ATOM   1848 C  C   . ALA D 1 18 ? -6.048  20.000 77.795  1.00 47.71  ? 280 ALA D C   1 
ATOM   1849 O  O   . ALA D 1 18 ? -5.367  19.435 76.941  1.00 63.69  ? 280 ALA D O   1 
ATOM   1850 C  CB  . ALA D 1 18 ? -7.340  18.662 79.468  1.00 26.21  ? 280 ALA D CB  1 
ATOM   1851 N  N   . ALA D 1 19 ? -6.781  21.079 77.540  1.00 40.94  ? 281 ALA D N   1 
ATOM   1852 C  CA  . ALA D 1 19 ? -6.794  21.705 76.224  1.00 38.94  ? 281 ALA D CA  1 
ATOM   1853 C  C   . ALA D 1 19 ? -5.400  22.197 75.861  1.00 40.84  ? 281 ALA D C   1 
ATOM   1854 O  O   . ALA D 1 19 ? -4.849  21.826 74.822  1.00 42.78  ? 281 ALA D O   1 
ATOM   1855 C  CB  . ALA D 1 19 ? -7.791  22.858 76.192  1.00 32.07  ? 281 ALA D CB  1 
ATOM   1856 N  N   . LYS D 1 20 ? -4.835  23.027 76.732  1.00 23.86  ? 282 LYS D N   1 
ATOM   1857 C  CA  . LYS D 1 20 ? -3.506  23.586 76.518  1.00 26.55  ? 282 LYS D CA  1 
ATOM   1858 C  C   . LYS D 1 20 ? -2.462  22.483 76.359  1.00 59.02  ? 282 LYS D C   1 
ATOM   1859 O  O   . LYS D 1 20 ? -1.468  22.651 75.655  1.00 47.68  ? 282 LYS D O   1 
ATOM   1860 C  CB  . LYS D 1 20 ? -3.128  24.509 77.678  1.00 49.16  ? 282 LYS D CB  1 
ATOM   1861 C  CG  . LYS D 1 20 ? -1.791  25.208 77.514  1.00 81.01  ? 282 LYS D CG  1 
ATOM   1862 C  CD  . LYS D 1 20 ? -1.807  26.179 76.344  1.00 89.78  ? 282 LYS D CD  1 
ATOM   1863 C  CE  . LYS D 1 20 ? -0.443  26.821 76.148  1.00 73.13  ? 282 LYS D CE  1 
ATOM   1864 N  NZ  . LYS D 1 20 ? -0.453  27.850 75.072  1.00 101.62 ? 282 LYS D NZ  1 
ATOM   1865 N  N   . ASN D 1 21 ? -2.699  21.350 77.012  1.00 64.90  ? 283 ASN D N   1 
ATOM   1866 C  CA  . ASN D 1 21 ? -1.777  20.221 76.954  1.00 32.51  ? 283 ASN D CA  1 
ATOM   1867 C  C   . ASN D 1 21 ? -1.787  19.514 75.603  1.00 50.33  ? 283 ASN D C   1 
ATOM   1868 O  O   . ASN D 1 21 ? -0.734  19.133 75.091  1.00 46.54  ? 283 ASN D O   1 
ATOM   1869 C  CB  . ASN D 1 21 ? -2.078  19.220 78.071  1.00 39.10  ? 283 ASN D CB  1 
ATOM   1870 C  CG  . ASN D 1 21 ? -1.418  19.593 79.383  1.00 37.73  ? 283 ASN D CG  1 
ATOM   1871 O  OD1 . ASN D 1 21 ? -0.529  20.444 79.427  1.00 35.70  ? 283 ASN D OD1 1 
ATOM   1872 N  ND2 . ASN D 1 21 ? -1.846  18.949 80.463  1.00 35.10  ? 283 ASN D ND2 1 
ATOM   1873 N  N   . LEU D 1 22 ? -2.975  19.331 75.032  1.00 53.78  ? 284 LEU D N   1 
ATOM   1874 C  CA  . LEU D 1 22 ? -3.101  18.684 73.728  1.00 44.72  ? 284 LEU D CA  1 
ATOM   1875 C  C   . LEU D 1 22 ? -2.483  19.528 72.616  1.00 47.56  ? 284 LEU D C   1 
ATOM   1876 O  O   . LEU D 1 22 ? -1.761  19.013 71.762  1.00 46.49  ? 284 LEU D O   1 
ATOM   1877 C  CB  . LEU D 1 22 ? -4.567  18.383 73.402  1.00 44.20  ? 284 LEU D CB  1 
ATOM   1878 C  CG  . LEU D 1 22 ? -5.146  17.058 73.906  1.00 79.78  ? 284 LEU D CG  1 
ATOM   1879 C  CD1 . LEU D 1 22 ? -4.882  16.856 75.392  1.00 93.00  ? 284 LEU D CD1 1 
ATOM   1880 C  CD2 . LEU D 1 22 ? -6.636  16.987 73.607  1.00 88.94  ? 284 LEU D CD2 1 
ATOM   1881 N  N   . GLN D 1 23 ? -2.762  20.827 72.634  1.00 45.84  ? 285 GLN D N   1 
ATOM   1882 C  CA  . GLN D 1 23 ? -2.237  21.726 71.614  1.00 49.28  ? 285 GLN D CA  1 
ATOM   1883 C  C   . GLN D 1 23 ? -0.711  21.768 71.644  1.00 50.00  ? 285 GLN D C   1 
ATOM   1884 O  O   . GLN D 1 23 ? -0.064  21.771 70.598  1.00 62.97  ? 285 GLN D O   1 
ATOM   1885 C  CB  . GLN D 1 23 ? -2.808  23.137 71.787  1.00 71.83  ? 285 GLN D CB  1 
ATOM   1886 C  CG  . GLN D 1 23 ? -2.125  23.959 72.870  1.00 100.69 ? 285 GLN D CG  1 
ATOM   1887 C  CD  . GLN D 1 23 ? -2.601  25.397 72.904  1.00 107.67 ? 285 GLN D CD  1 
ATOM   1888 O  OE1 . GLN D 1 23 ? -1.816  26.319 73.132  1.00 97.34  ? 285 GLN D OE1 1 
ATOM   1889 N  NE2 . GLN D 1 23 ? -3.893  25.598 72.672  1.00 90.19  ? 285 GLN D NE2 1 
ATOM   1890 N  N   . GLU D 1 24 ? -0.144  21.796 72.846  1.00 41.20  ? 286 GLU D N   1 
ATOM   1891 C  CA  . GLU D 1 24 ? 1.302   21.882 73.017  1.00 59.41  ? 286 GLU D CA  1 
ATOM   1892 C  C   . GLU D 1 24 ? 1.972   20.559 72.653  1.00 44.75  ? 286 GLU D C   1 
ATOM   1893 O  O   . GLU D 1 24 ? 3.096   20.534 72.148  1.00 35.88  ? 286 GLU D O   1 
ATOM   1894 C  CB  . GLU D 1 24 ? 1.642   22.287 74.456  1.00 33.09  ? 286 GLU D CB  1 
ATOM   1895 C  CG  . GLU D 1 24 ? 3.109   22.619 74.689  1.00 65.00  ? 286 GLU D CG  1 
ATOM   1896 C  CD  . GLU D 1 24 ? 3.365   23.207 76.067  1.00 104.53 ? 286 GLU D CD  1 
ATOM   1897 O  OE1 . GLU D 1 24 ? 2.386   23.569 76.753  1.00 89.57  ? 286 GLU D OE1 1 
ATOM   1898 O  OE2 . GLU D 1 24 ? 4.546   23.309 76.464  1.00 92.68  ? 286 GLU D OE2 1 
ATOM   1899 N  N   . ALA D 1 25 ? 1.266   19.461 72.905  1.00 36.13  ? 287 ALA D N   1 
ATOM   1900 C  CA  . ALA D 1 25 ? 1.771   18.133 72.581  1.00 41.22  ? 287 ALA D CA  1 
ATOM   1901 C  C   . ALA D 1 25 ? 1.770   17.902 71.076  1.00 43.12  ? 287 ALA D C   1 
ATOM   1902 O  O   . ALA D 1 25 ? 2.791   17.535 70.497  1.00 44.22  ? 287 ALA D O   1 
ATOM   1903 C  CB  . ALA D 1 25 ? 0.947   17.064 73.282  1.00 17.16  ? 287 ALA D CB  1 
ATOM   1904 N  N   . GLU D 1 26 ? 0.618   18.113 70.449  1.00 41.87  ? 288 GLU D N   1 
ATOM   1905 C  CA  . GLU D 1 26 ? 0.484   17.942 69.007  1.00 31.06  ? 288 GLU D CA  1 
ATOM   1906 C  C   . GLU D 1 26 ? 1.520   18.791 68.279  1.00 42.17  ? 288 GLU D C   1 
ATOM   1907 O  O   . GLU D 1 26 ? 2.149   18.345 67.317  1.00 42.43  ? 288 GLU D O   1 
ATOM   1908 C  CB  . GLU D 1 26 ? -0.925  18.326 68.560  1.00 54.76  ? 288 GLU D CB  1 
ATOM   1909 C  CG  . GLU D 1 26 ? -1.212  18.040 67.100  1.00 101.48 ? 288 GLU D CG  1 
ATOM   1910 C  CD  . GLU D 1 26 ? -2.673  18.229 66.749  1.00 108.87 ? 288 GLU D CD  1 
ATOM   1911 O  OE1 . GLU D 1 26 ? -3.484  18.458 67.672  1.00 90.07  ? 288 GLU D OE1 1 
ATOM   1912 O  OE2 . GLU D 1 26 ? -3.010  18.147 65.550  1.00 98.64  ? 288 GLU D OE2 1 
ATOM   1913 N  N   . GLU D 1 27 ? 1.697   20.016 68.757  1.00 54.61  ? 289 GLU D N   1 
ATOM   1914 C  CA  . GLU D 1 27 ? 2.687   20.923 68.199  1.00 38.68  ? 289 GLU D CA  1 
ATOM   1915 C  C   . GLU D 1 27 ? 4.084   20.341 68.350  1.00 39.87  ? 289 GLU D C   1 
ATOM   1916 O  O   . GLU D 1 27 ? 4.913   20.460 67.449  1.00 56.49  ? 289 GLU D O   1 
ATOM   1917 C  CB  . GLU D 1 27 ? 2.608   22.281 68.896  1.00 29.01  ? 289 GLU D CB  1 
ATOM   1918 C  CG  . GLU D 1 27 ? 3.641   23.288 68.434  1.00 49.36  ? 289 GLU D CG  1 
ATOM   1919 C  CD  . GLU D 1 27 ? 3.618   24.555 69.268  1.00 97.12  ? 289 GLU D CD  1 
ATOM   1920 O  OE1 . GLU D 1 27 ? 2.802   24.632 70.210  1.00 77.04  ? 289 GLU D OE1 1 
ATOM   1921 O  OE2 . GLU D 1 27 ? 4.417   25.471 68.984  1.00 110.16 ? 289 GLU D OE2 1 
ATOM   1922 N  N   . TRP D 1 28 ? 4.335   19.708 69.492  1.00 48.35  ? 290 TRP D N   1 
ATOM   1923 C  CA  . TRP D 1 28 ? 5.653   19.167 69.807  1.00 31.79  ? 290 TRP D CA  1 
ATOM   1924 C  C   . TRP D 1 28 ? 6.018   17.978 68.920  1.00 41.44  ? 290 TRP D C   1 
ATOM   1925 O  O   . TRP D 1 28 ? 7.129   17.901 68.398  1.00 29.71  ? 290 TRP D O   1 
ATOM   1926 C  CB  . TRP D 1 28 ? 5.723   18.772 71.283  1.00 21.49  ? 290 TRP D CB  1 
ATOM   1927 C  CG  . TRP D 1 28 ? 7.085   18.350 71.733  1.00 33.04  ? 290 TRP D CG  1 
ATOM   1928 C  CD1 . TRP D 1 28 ? 8.056   19.149 72.258  1.00 24.89  ? 290 TRP D CD1 1 
ATOM   1929 C  CD2 . TRP D 1 28 ? 7.628   17.025 71.702  1.00 31.72  ? 290 TRP D CD2 1 
ATOM   1930 N  NE1 . TRP D 1 28 ? 9.172   18.406 72.555  1.00 35.99  ? 290 TRP D NE1 1 
ATOM   1931 C  CE2 . TRP D 1 28 ? 8.934   17.097 72.223  1.00 43.31  ? 290 TRP D CE2 1 
ATOM   1932 C  CE3 . TRP D 1 28 ? 7.137   15.784 71.284  1.00 32.43  ? 290 TRP D CE3 1 
ATOM   1933 C  CZ2 . TRP D 1 28 ? 9.756   15.979 72.338  1.00 39.14  ? 290 TRP D CZ2 1 
ATOM   1934 C  CZ3 . TRP D 1 28 ? 7.953   14.675 71.398  1.00 32.29  ? 290 TRP D CZ3 1 
ATOM   1935 C  CH2 . TRP D 1 28 ? 9.248   14.779 71.920  1.00 32.93  ? 290 TRP D CH2 1 
ATOM   1936 N  N   . TYR D 1 29 ? 5.081   17.051 68.751  1.00 25.27  ? 291 TYR D N   1 
ATOM   1937 C  CA  . TYR D 1 29 ? 5.323   15.871 67.924  1.00 21.97  ? 291 TYR D CA  1 
ATOM   1938 C  C   . TYR D 1 29 ? 5.530   16.225 66.451  1.00 33.77  ? 291 TYR D C   1 
ATOM   1939 O  O   . TYR D 1 29 ? 6.396   15.659 65.783  1.00 38.45  ? 291 TYR D O   1 
ATOM   1940 C  CB  . TYR D 1 29 ? 4.181   14.865 68.073  1.00 26.20  ? 291 TYR D CB  1 
ATOM   1941 C  CG  . TYR D 1 29 ? 4.206   14.110 69.379  1.00 30.62  ? 291 TYR D CG  1 
ATOM   1942 C  CD1 . TYR D 1 29 ? 4.893   12.910 69.496  1.00 36.08  ? 291 TYR D CD1 1 
ATOM   1943 C  CD2 . TYR D 1 29 ? 3.543   14.599 70.496  1.00 48.03  ? 291 TYR D CD2 1 
ATOM   1944 C  CE1 . TYR D 1 29 ? 4.917   12.214 70.693  1.00 43.65  ? 291 TYR D CE1 1 
ATOM   1945 C  CE2 . TYR D 1 29 ? 3.560   13.912 71.695  1.00 41.56  ? 291 TYR D CE2 1 
ATOM   1946 C  CZ  . TYR D 1 29 ? 4.247   12.722 71.788  1.00 30.82  ? 291 TYR D CZ  1 
ATOM   1947 O  OH  . TYR D 1 29 ? 4.262   12.044 72.983  1.00 32.49  ? 291 TYR D OH  1 
ATOM   1948 N  N   . LYS D 1 30 ? 4.726   17.157 65.950  1.00 45.42  ? 292 LYS D N   1 
ATOM   1949 C  CA  . LYS D 1 30 ? 4.824   17.586 64.559  1.00 40.29  ? 292 LYS D CA  1 
ATOM   1950 C  C   . LYS D 1 30 ? 6.187   18.199 64.261  1.00 30.22  ? 292 LYS D C   1 
ATOM   1951 O  O   . LYS D 1 30 ? 6.738   18.012 63.177  1.00 27.84  ? 292 LYS D O   1 
ATOM   1952 C  CB  . LYS D 1 30 ? 3.717   18.587 64.220  1.00 41.16  ? 292 LYS D CB  1 
ATOM   1953 C  CG  . LYS D 1 30 ? 2.326   17.981 64.142  1.00 73.97  ? 292 LYS D CG  1 
ATOM   1954 C  CD  . LYS D 1 30 ? 1.312   18.995 63.634  1.00 79.37  ? 292 LYS D CD  1 
ATOM   1955 C  CE  . LYS D 1 30 ? 1.741   19.574 62.295  1.00 89.82  ? 292 LYS D CE  1 
ATOM   1956 N  NZ  . LYS D 1 30 ? 0.773   20.582 61.782  1.00 90.59  ? 292 LYS D NZ  1 
ATOM   1957 N  N   . SER D 1 31 ? 6.725   18.937 65.224  1.00 14.13  ? 293 SER D N   1 
ATOM   1958 C  CA  . SER D 1 31 ? 8.040   19.544 65.057  1.00 45.08  ? 293 SER D CA  1 
ATOM   1959 C  C   . SER D 1 31 ? 9.154   18.497 65.066  1.00 48.56  ? 293 SER D C   1 
ATOM   1960 O  O   . SER D 1 31 ? 10.097  18.583 64.280  1.00 33.07  ? 293 SER D O   1 
ATOM   1961 C  CB  . SER D 1 31 ? 8.286   20.606 66.130  1.00 15.20  ? 293 SER D CB  1 
ATOM   1962 O  OG  . SER D 1 31 ? 7.933   20.124 67.413  1.00 50.10  ? 293 SER D OG  1 
ATOM   1963 N  N   . LYS D 1 32 ? 9.045   17.518 65.960  1.00 39.15  ? 294 LYS D N   1 
ATOM   1964 C  CA  . LYS D 1 32 ? 10.010  16.424 66.017  1.00 32.54  ? 294 LYS D CA  1 
ATOM   1965 C  C   . LYS D 1 32 ? 9.953   15.604 64.734  1.00 34.92  ? 294 LYS D C   1 
ATOM   1966 O  O   . LYS D 1 32 ? 10.984  15.200 64.194  1.00 22.89  ? 294 LYS D O   1 
ATOM   1967 C  CB  . LYS D 1 32 ? 9.752   15.531 67.233  1.00 25.71  ? 294 LYS D CB  1 
ATOM   1968 C  CG  . LYS D 1 32 ? 9.888   16.259 68.554  1.00 34.94  ? 294 LYS D CG  1 
ATOM   1969 C  CD  . LYS D 1 32 ? 11.100  17.171 68.541  1.00 27.52  ? 294 LYS D CD  1 
ATOM   1970 C  CE  . LYS D 1 32 ? 10.985  18.264 69.587  1.00 27.92  ? 294 LYS D CE  1 
ATOM   1971 N  NZ  . LYS D 1 32 ? 11.920  19.389 69.306  1.00 41.25  ? 294 LYS D NZ  1 
ATOM   1972 N  N   . PHE D 1 33 ? 8.739   15.366 64.248  1.00 28.53  ? 295 PHE D N   1 
ATOM   1973 C  CA  . PHE D 1 33 ? 8.548   14.660 62.989  1.00 24.09  ? 295 PHE D CA  1 
ATOM   1974 C  C   . PHE D 1 33 ? 9.159   15.460 61.847  1.00 27.33  ? 295 PHE D C   1 
ATOM   1975 O  O   . PHE D 1 33 ? 9.718   14.897 60.906  1.00 24.15  ? 295 PHE D O   1 
ATOM   1976 C  CB  . PHE D 1 33 ? 7.061   14.415 62.728  1.00 35.20  ? 295 PHE D CB  1 
ATOM   1977 C  CG  . PHE D 1 33 ? 6.782   13.696 61.439  1.00 60.36  ? 295 PHE D CG  1 
ATOM   1978 C  CD1 . PHE D 1 33 ? 7.063   12.347 61.309  1.00 62.01  ? 295 PHE D CD1 1 
ATOM   1979 C  CD2 . PHE D 1 33 ? 6.234   14.367 60.360  1.00 59.07  ? 295 PHE D CD2 1 
ATOM   1980 C  CE1 . PHE D 1 33 ? 6.807   11.685 60.126  1.00 64.29  ? 295 PHE D CE1 1 
ATOM   1981 C  CE2 . PHE D 1 33 ? 5.977   13.707 59.176  1.00 44.01  ? 295 PHE D CE2 1 
ATOM   1982 C  CZ  . PHE D 1 33 ? 6.263   12.366 59.060  1.00 58.85  ? 295 PHE D CZ  1 
ATOM   1983 N  N   . ALA D 1 34 ? 9.049   16.781 61.941  1.00 44.42  ? 296 ALA D N   1 
ATOM   1984 C  CA  . ALA D 1 34 ? 9.651   17.668 60.959  1.00 23.52  ? 296 ALA D CA  1 
ATOM   1985 C  C   . ALA D 1 34 ? 11.165  17.534 60.987  1.00 24.79  ? 296 ALA D C   1 
ATOM   1986 O  O   . ALA D 1 34 ? 11.789  17.314 59.950  1.00 38.18  ? 296 ALA D O   1 
ATOM   1987 C  CB  . ALA D 1 34 ? 9.237   19.106 61.219  1.00 29.84  ? 296 ALA D CB  1 
ATOM   1988 N  N   . ASP D 1 35 ? 11.746  17.664 62.178  1.00 20.64  ? 297 ASP D N   1 
ATOM   1989 C  CA  . ASP D 1 35 ? 13.186  17.511 62.358  1.00 35.19  ? 297 ASP D CA  1 
ATOM   1990 C  C   . ASP D 1 35 ? 13.684  16.239 61.691  1.00 30.82  ? 297 ASP D C   1 
ATOM   1991 O  O   . ASP D 1 35 ? 14.548  16.286 60.820  1.00 23.68  ? 297 ASP D O   1 
ATOM   1992 C  CB  . ASP D 1 35 ? 13.546  17.472 63.843  1.00 42.27  ? 297 ASP D CB  1 
ATOM   1993 C  CG  . ASP D 1 35 ? 13.570  18.847 64.475  1.00 57.18  ? 297 ASP D CG  1 
ATOM   1994 O  OD1 . ASP D 1 35 ? 13.251  19.833 63.778  1.00 60.12  ? 297 ASP D OD1 1 
ATOM   1995 O  OD2 . ASP D 1 35 ? 13.915  18.941 65.673  1.00 48.84  ? 297 ASP D OD2 1 
ATOM   1996 N  N   . LEU D 1 36 ? 13.121  15.106 62.099  1.00 32.71  ? 298 LEU D N   1 
ATOM   1997 C  CA  . LEU D 1 36 ? 13.521  13.808 61.567  1.00 27.51  ? 298 LEU D CA  1 
ATOM   1998 C  C   . LEU D 1 36 ? 13.339  13.722 60.055  1.00 25.53  ? 298 LEU D C   1 
ATOM   1999 O  O   . LEU D 1 36 ? 14.216  13.232 59.347  1.00 23.07  ? 298 LEU D O   1 
ATOM   2000 C  CB  . LEU D 1 36 ? 12.743  12.686 62.255  1.00 30.42  ? 298 LEU D CB  1 
ATOM   2001 C  CG  . LEU D 1 36 ? 12.906  12.596 63.773  1.00 38.19  ? 298 LEU D CG  1 
ATOM   2002 C  CD1 . LEU D 1 36 ? 12.094  11.440 64.352  1.00 16.58  ? 298 LEU D CD1 1 
ATOM   2003 C  CD2 . LEU D 1 36 ? 14.375  12.463 64.142  1.00 15.28  ? 298 LEU D CD2 1 
ATOM   2004 N  N   . SER D 1 37 ? 12.197  14.194 59.566  1.00 27.72  ? 299 SER D N   1 
ATOM   2005 C  CA  . SER D 1 37 ? 11.920  14.194 58.133  1.00 24.21  ? 299 SER D CA  1 
ATOM   2006 C  C   . SER D 1 37 ? 13.010  14.912 57.345  1.00 29.11  ? 299 SER D C   1 
ATOM   2007 O  O   . SER D 1 37 ? 13.435  14.446 56.289  1.00 30.39  ? 299 SER D O   1 
ATOM   2008 C  CB  . SER D 1 37 ? 10.562  14.838 57.850  1.00 32.50  ? 299 SER D CB  1 
ATOM   2009 O  OG  . SER D 1 37 ? 9.503   13.958 58.184  1.00 44.27  ? 299 SER D OG  1 
ATOM   2010 N  N   . GLU D 1 38 ? 13.453  16.052 57.864  1.00 23.57  ? 300 GLU D N   1 
ATOM   2011 C  CA  . GLU D 1 38 ? 14.495  16.835 57.213  1.00 33.06  ? 300 GLU D CA  1 
ATOM   2012 C  C   . GLU D 1 38 ? 15.829  16.092 57.216  1.00 40.75  ? 300 GLU D C   1 
ATOM   2013 O  O   . GLU D 1 38 ? 16.522  16.044 56.200  1.00 40.33  ? 300 GLU D O   1 
ATOM   2014 C  CB  . GLU D 1 38 ? 14.635  18.200 57.890  1.00 45.59  ? 300 GLU D CB  1 
ATOM   2015 C  CG  . GLU D 1 38 ? 13.444  19.118 57.678  1.00 61.22  ? 300 GLU D CG  1 
ATOM   2016 C  CD  . GLU D 1 38 ? 13.434  20.298 58.630  1.00 83.35  ? 300 GLU D CD  1 
ATOM   2017 O  OE1 . GLU D 1 38 ? 14.440  20.499 59.344  1.00 79.53  ? 300 GLU D OE1 1 
ATOM   2018 O  OE2 . GLU D 1 38 ? 12.417  21.022 58.666  1.00 83.00  ? 300 GLU D OE2 1 
ATOM   2019 N  N   . ALA D 1 39 ? 16.178  15.509 58.359  1.00 41.70  ? 301 ALA D N   1 
ATOM   2020 C  CA  . ALA D 1 39 ? 17.422  14.760 58.489  1.00 35.98  ? 301 ALA D CA  1 
ATOM   2021 C  C   . ALA D 1 39 ? 17.461  13.599 57.502  1.00 39.47  ? 301 ALA D C   1 
ATOM   2022 O  O   . ALA D 1 39 ? 18.496  13.319 56.895  1.00 35.49  ? 301 ALA D O   1 
ATOM   2023 C  CB  . ALA D 1 39 ? 17.592  14.257 59.915  1.00 23.03  ? 301 ALA D CB  1 
ATOM   2024 N  N   . ALA D 1 40 ? 16.325  12.927 57.345  1.00 16.25  ? 302 ALA D N   1 
ATOM   2025 C  CA  . ALA D 1 40 ? 16.221  11.809 56.416  1.00 24.69  ? 302 ALA D CA  1 
ATOM   2026 C  C   . ALA D 1 40 ? 16.389  12.259 54.965  1.00 35.01  ? 302 ALA D C   1 
ATOM   2027 O  O   . ALA D 1 40 ? 17.182  11.683 54.220  1.00 24.87  ? 302 ALA D O   1 
ATOM   2028 C  CB  . ALA D 1 40 ? 14.896  11.086 56.600  1.00 26.41  ? 302 ALA D CB  1 
ATOM   2029 N  N   . ASN D 1 41 ? 15.636  13.282 54.568  1.00 30.47  ? 303 ASN D N   1 
ATOM   2030 C  CA  . ASN D 1 41 ? 15.722  13.814 53.211  1.00 26.07  ? 303 ASN D CA  1 
ATOM   2031 C  C   . ASN D 1 41 ? 17.155  14.184 52.860  1.00 37.47  ? 303 ASN D C   1 
ATOM   2032 O  O   . ASN D 1 41 ? 17.626  13.913 51.757  1.00 38.82  ? 303 ASN D O   1 
ATOM   2033 C  CB  . ASN D 1 41 ? 14.819  15.037 53.053  1.00 34.17  ? 303 ASN D CB  1 
ATOM   2034 C  CG  . ASN D 1 41 ? 13.349  14.696 53.165  1.00 38.50  ? 303 ASN D CG  1 
ATOM   2035 O  OD1 . ASN D 1 41 ? 12.924  13.598 52.804  1.00 36.00  ? 303 ASN D OD1 1 
ATOM   2036 N  ND2 . ASN D 1 41 ? 12.559  15.642 53.658  1.00 30.17  ? 303 ASN D ND2 1 
ATOM   2037 N  N   . ARG D 1 42 ? 17.843  14.807 53.809  1.00 23.61  ? 304 ARG D N   1 
ATOM   2038 C  CA  . ARG D 1 42 ? 19.244  15.170 53.634  1.00 29.13  ? 304 ARG D CA  1 
ATOM   2039 C  C   . ARG D 1 42 ? 20.107  13.932 53.414  1.00 35.65  ? 304 ARG D C   1 
ATOM   2040 O  O   . ARG D 1 42 ? 21.061  13.957 52.635  1.00 40.40  ? 304 ARG D O   1 
ATOM   2041 C  CB  . ARG D 1 42 ? 19.741  15.955 54.849  1.00 56.14  ? 304 ARG D CB  1 
ATOM   2042 C  CG  . ARG D 1 42 ? 19.362  17.428 54.833  1.00 74.90  ? 304 ARG D CG  1 
ATOM   2043 C  CD  . ARG D 1 42 ? 19.022  17.932 56.228  1.00 82.05  ? 304 ARG D CD  1 
ATOM   2044 N  NE  . ARG D 1 42 ? 19.997  17.509 57.228  1.00 79.93  ? 304 ARG D NE  1 
ATOM   2045 C  CZ  . ARG D 1 42 ? 19.786  17.558 58.539  1.00 76.24  ? 304 ARG D CZ  1 
ATOM   2046 N  NH1 . ARG D 1 42 ? 18.630  18.007 59.010  1.00 64.62  ? 304 ARG D NH1 1 
ATOM   2047 N  NH2 . ARG D 1 42 ? 20.728  17.152 59.380  1.00 69.46  ? 304 ARG D NH2 1 
ATOM   2048 N  N   . ASN D 1 43 ? 19.772  12.851 54.109  1.00 44.17  ? 305 ASN D N   1 
ATOM   2049 C  CA  . ASN D 1 43 ? 20.465  11.586 53.918  1.00 31.84  ? 305 ASN D CA  1 
ATOM   2050 C  C   . ASN D 1 43 ? 20.143  10.981 52.553  1.00 38.05  ? 305 ASN D C   1 
ATOM   2051 O  O   . ASN D 1 43 ? 21.027  10.454 51.879  1.00 33.66  ? 305 ASN D O   1 
ATOM   2052 C  CB  . ASN D 1 43 ? 20.120  10.609 55.042  1.00 35.44  ? 305 ASN D CB  1 
ATOM   2053 C  CG  . ASN D 1 43 ? 20.960  9.345  54.998  1.00 64.96  ? 305 ASN D CG  1 
ATOM   2054 O  OD1 . ASN D 1 43 ? 21.765  9.092  55.894  1.00 53.03  ? 305 ASN D OD1 1 
ATOM   2055 N  ND2 . ASN D 1 43 ? 20.781  8.547  53.951  1.00 39.26  ? 305 ASN D ND2 1 
ATOM   2056 N  N   . ASN D 1 44 ? 18.876  11.058 52.154  1.00 38.15  ? 306 ASN D N   1 
ATOM   2057 C  CA  . ASN D 1 44 ? 18.461  10.602 50.832  1.00 36.94  ? 306 ASN D CA  1 
ATOM   2058 C  C   . ASN D 1 44 ? 19.205  11.366 49.747  1.00 39.99  ? 306 ASN D C   1 
ATOM   2059 O  O   . ASN D 1 44 ? 19.781  10.771 48.838  1.00 44.69  ? 306 ASN D O   1 
ATOM   2060 C  CB  . ASN D 1 44 ? 16.952  10.774 50.648  1.00 49.01  ? 306 ASN D CB  1 
ATOM   2061 C  CG  . ASN D 1 44 ? 16.147  10.017 51.686  1.00 53.63  ? 306 ASN D CG  1 
ATOM   2062 O  OD1 . ASN D 1 44 ? 16.705  9.379  52.577  1.00 66.96  ? 306 ASN D OD1 1 
ATOM   2063 N  ND2 . ASN D 1 44 ? 14.825  10.085 51.575  1.00 49.89  ? 306 ASN D ND2 1 
ATOM   2064 N  N   . ASP D 1 45 ? 19.195  12.690 49.856  1.00 44.05  ? 307 ASP D N   1 
ATOM   2065 C  CA  . ASP D 1 45 ? 19.918  13.540 48.921  1.00 37.86  ? 307 ASP D CA  1 
ATOM   2066 C  C   . ASP D 1 45 ? 21.382  13.124 48.877  1.00 37.85  ? 307 ASP D C   1 
ATOM   2067 O  O   . ASP D 1 45 ? 21.993  13.069 47.810  1.00 64.83  ? 307 ASP D O   1 
ATOM   2068 C  CB  . ASP D 1 45 ? 19.801  15.010 49.326  1.00 43.29  ? 307 ASP D CB  1 
ATOM   2069 C  CG  . ASP D 1 45 ? 18.370  15.514 49.300  1.00 72.84  ? 307 ASP D CG  1 
ATOM   2070 O  OD1 . ASP D 1 45 ? 17.461  14.748 48.909  1.00 44.87  ? 307 ASP D OD1 1 
ATOM   2071 O  OD2 . ASP D 1 45 ? 18.160  16.687 49.674  1.00 72.10  ? 307 ASP D OD2 1 
ATOM   2072 N  N   . ALA D 1 46 ? 21.932  12.822 50.048  1.00 48.06  ? 308 ALA D N   1 
ATOM   2073 C  CA  . ALA D 1 46 ? 23.319  12.398 50.165  1.00 35.75  ? 308 ALA D CA  1 
ATOM   2074 C  C   . ALA D 1 46 ? 23.546  11.060 49.476  1.00 46.76  ? 308 ALA D C   1 
ATOM   2075 O  O   . ALA D 1 46 ? 24.583  10.846 48.848  1.00 34.87  ? 308 ALA D O   1 
ATOM   2076 C  CB  . ALA D 1 46 ? 23.723  12.319 51.628  1.00 14.37  ? 308 ALA D CB  1 
ATOM   2077 N  N   . LEU D 1 47 ? 22.575  10.161 49.600  1.00 25.45  ? 309 LEU D N   1 
ATOM   2078 C  CA  . LEU D 1 47 ? 22.655  8.853  48.960  1.00 35.48  ? 309 LEU D CA  1 
ATOM   2079 C  C   . LEU D 1 47 ? 22.511  8.997  47.449  1.00 46.51  ? 309 LEU D C   1 
ATOM   2080 O  O   . LEU D 1 47 ? 23.349  8.527  46.680  1.00 43.15  ? 309 LEU D O   1 
ATOM   2081 C  CB  . LEU D 1 47 ? 21.565  7.927  49.500  1.00 31.10  ? 309 LEU D CB  1 
ATOM   2082 C  CG  . LEU D 1 47 ? 21.541  6.514  48.915  1.00 36.21  ? 309 LEU D CG  1 
ATOM   2083 C  CD1 . LEU D 1 47 ? 22.836  5.792  49.244  1.00 40.48  ? 309 LEU D CD1 1 
ATOM   2084 C  CD2 . LEU D 1 47 ? 20.341  5.739  49.430  1.00 13.15  ? 309 LEU D CD2 1 
ATOM   2085 N  N   . ARG D 1 48 ? 21.440  9.667  47.036  1.00 50.30  ? 310 ARG D N   1 
ATOM   2086 C  CA  . ARG D 1 48 ? 21.166  9.910  45.626  1.00 43.58  ? 310 ARG D CA  1 
ATOM   2087 C  C   . ARG D 1 48 ? 22.377  10.517 44.927  1.00 46.43  ? 310 ARG D C   1 
ATOM   2088 O  O   . ARG D 1 48 ? 22.641  10.229 43.760  1.00 59.21  ? 310 ARG D O   1 
ATOM   2089 C  CB  . ARG D 1 48 ? 19.956  10.836 45.477  1.00 38.69  ? 310 ARG D CB  1 
ATOM   2090 C  CG  . ARG D 1 48 ? 19.541  11.097 44.040  1.00 60.41  ? 310 ARG D CG  1 
ATOM   2091 C  CD  . ARG D 1 48 ? 18.514  12.216 43.963  1.00 69.79  ? 310 ARG D CD  1 
ATOM   2092 N  NE  . ARG D 1 48 ? 19.021  13.453 44.549  1.00 78.10  ? 310 ARG D NE  1 
ATOM   2093 C  CZ  . ARG D 1 48 ? 19.755  14.344 43.891  1.00 95.56  ? 310 ARG D CZ  1 
ATOM   2094 N  NH1 . ARG D 1 48 ? 20.068  14.138 42.619  1.00 97.47  ? 310 ARG D NH1 1 
ATOM   2095 N  NH2 . ARG D 1 48 ? 20.176  15.442 44.504  1.00 78.66  ? 310 ARG D NH2 1 
ATOM   2096 N  N   . GLN D 1 49 ? 23.111  11.358 45.649  1.00 30.00  ? 311 GLN D N   1 
ATOM   2097 C  CA  . GLN D 1 49 ? 24.291  12.014 45.099  1.00 51.94  ? 311 GLN D CA  1 
ATOM   2098 C  C   . GLN D 1 49 ? 25.458  11.042 44.936  1.00 40.74  ? 311 GLN D C   1 
ATOM   2099 O  O   . GLN D 1 49 ? 26.081  10.983 43.876  1.00 61.70  ? 311 GLN D O   1 
ATOM   2100 C  CB  . GLN D 1 49 ? 24.707  13.194 45.979  1.00 50.34  ? 311 GLN D CB  1 
ATOM   2101 C  CG  . GLN D 1 49 ? 25.919  13.955 45.466  1.00 67.02  ? 311 GLN D CG  1 
ATOM   2102 C  CD  . GLN D 1 49 ? 26.376  15.036 46.427  1.00 96.66  ? 311 GLN D CD  1 
ATOM   2103 O  OE1 . GLN D 1 49 ? 25.818  15.194 47.513  1.00 93.98  ? 311 GLN D OE1 1 
ATOM   2104 N  NE2 . GLN D 1 49 ? 27.398  15.785 46.031  1.00 99.76  ? 311 GLN D NE2 1 
ATOM   2105 N  N   . ALA D 1 50 ? 25.748  10.283 45.989  1.00 48.63  ? 312 ALA D N   1 
ATOM   2106 C  CA  . ALA D 1 50 ? 26.852  9.330  45.963  1.00 42.94  ? 312 ALA D CA  1 
ATOM   2107 C  C   . ALA D 1 50 ? 26.643  8.282  44.875  1.00 55.83  ? 312 ALA D C   1 
ATOM   2108 O  O   . ALA D 1 50 ? 27.603  7.711  44.358  1.00 41.38  ? 312 ALA D O   1 
ATOM   2109 C  CB  . ALA D 1 50 ? 27.018  8.668  47.323  1.00 31.14  ? 312 ALA D CB  1 
ATOM   2110 N  N   . LYS D 1 51 ? 25.382  8.033  44.535  1.00 32.75  ? 313 LYS D N   1 
ATOM   2111 C  CA  . LYS D 1 51 ? 25.041  7.131  43.439  1.00 32.92  ? 313 LYS D CA  1 
ATOM   2112 C  C   . LYS D 1 51 ? 25.383  7.762  42.093  1.00 48.03  ? 313 LYS D C   1 
ATOM   2113 O  O   . LYS D 1 51 ? 26.017  7.135  41.242  1.00 37.10  ? 313 LYS D O   1 
ATOM   2114 C  CB  . LYS D 1 51 ? 23.552  6.774  43.476  1.00 42.69  ? 313 LYS D CB  1 
ATOM   2115 C  CG  . LYS D 1 51 ? 23.186  5.675  44.460  1.00 31.45  ? 313 LYS D CG  1 
ATOM   2116 C  CD  . LYS D 1 51 ? 23.715  4.325  44.009  1.00 84.21  ? 313 LYS D CD  1 
ATOM   2117 C  CE  . LYS D 1 51 ? 23.203  3.210  44.904  1.00 80.42  ? 313 LYS D CE  1 
ATOM   2118 N  NZ  . LYS D 1 51 ? 23.646  1.874  44.424  1.00 80.56  ? 313 LYS D NZ  1 
ATOM   2119 N  N   . GLN D 1 52 ? 24.951  9.004  41.904  1.00 55.44  ? 314 GLN D N   1 
ATOM   2120 C  CA  . GLN D 1 52 ? 25.217  9.726  40.666  1.00 49.60  ? 314 GLN D CA  1 
ATOM   2121 C  C   . GLN D 1 52 ? 26.713  9.868  40.441  1.00 45.57  ? 314 GLN D C   1 
ATOM   2122 O  O   . GLN D 1 52 ? 27.179  9.900  39.303  1.00 61.61  ? 314 GLN D O   1 
ATOM   2123 C  CB  . GLN D 1 52 ? 24.557  11.107 40.689  1.00 36.64  ? 314 GLN D CB  1 
ATOM   2124 C  CG  . GLN D 1 52 ? 23.037  11.076 40.615  1.00 79.85  ? 314 GLN D CG  1 
ATOM   2125 C  CD  . GLN D 1 52 ? 22.433  12.467 40.546  1.00 106.19 ? 314 GLN D CD  1 
ATOM   2126 O  OE1 . GLN D 1 52 ? 23.119  13.466 40.770  1.00 103.60 ? 314 GLN D OE1 1 
ATOM   2127 N  NE2 . GLN D 1 52 ? 21.143  12.539 40.236  1.00 81.59  ? 314 GLN D NE2 1 
ATOM   2128 N  N   . GLU D 1 53 ? 27.458  9.955  41.536  1.00 44.28  ? 315 GLU D N   1 
ATOM   2129 C  CA  . GLU D 1 53 ? 28.902  10.109 41.466  1.00 36.53  ? 315 GLU D CA  1 
ATOM   2130 C  C   . GLU D 1 53 ? 29.583  8.749  41.337  1.00 56.65  ? 315 GLU D C   1 
ATOM   2131 O  O   . GLU D 1 53 ? 30.796  8.668  41.178  1.00 72.34  ? 315 GLU D O   1 
ATOM   2132 C  CB  . GLU D 1 53 ? 29.422  10.858 42.695  1.00 48.08  ? 315 GLU D CB  1 
ATOM   2133 C  CG  . GLU D 1 53 ? 30.822  11.433 42.525  1.00 107.04 ? 315 GLU D CG  1 
ATOM   2134 C  CD  . GLU D 1 53 ? 31.151  12.484 43.569  1.00 126.79 ? 315 GLU D CD  1 
ATOM   2135 O  OE1 . GLU D 1 53 ? 30.323  12.701 44.479  1.00 118.01 ? 315 GLU D OE1 1 
ATOM   2136 O  OE2 . GLU D 1 53 ? 32.236  13.095 43.479  1.00 113.95 ? 315 GLU D OE2 1 
ATOM   2137 N  N   . SER D 1 54 ? 28.794  7.681  41.398  1.00 50.98  ? 316 SER D N   1 
ATOM   2138 C  CA  . SER D 1 54 ? 29.331  6.334  41.245  1.00 48.97  ? 316 SER D CA  1 
ATOM   2139 C  C   . SER D 1 54 ? 29.262  5.898  39.787  1.00 57.09  ? 316 SER D C   1 
ATOM   2140 O  O   . SER D 1 54 ? 30.266  5.496  39.199  1.00 37.84  ? 316 SER D O   1 
ATOM   2141 C  CB  . SER D 1 54 ? 28.568  5.346  42.129  1.00 31.51  ? 316 SER D CB  1 
ATOM   2142 O  OG  . SER D 1 54 ? 29.168  4.063  42.093  1.00 59.70  ? 316 SER D OG  1 
ATOM   2143 N  N   . THR D 1 55 ? 28.069  5.974  39.210  1.00 49.26  ? 317 THR D N   1 
ATOM   2144 C  CA  . THR D 1 55 ? 27.892  5.672  37.797  1.00 66.47  ? 317 THR D CA  1 
ATOM   2145 C  C   . THR D 1 55 ? 28.741  6.627  36.960  1.00 72.05  ? 317 THR D C   1 
ATOM   2146 O  O   . THR D 1 55 ? 29.254  6.260  35.901  1.00 62.29  ? 317 THR D O   1 
ATOM   2147 C  CB  . THR D 1 55 ? 26.413  5.775  37.379  1.00 45.21  ? 317 THR D CB  1 
ATOM   2148 O  OG1 . THR D 1 55 ? 25.902  7.065  37.734  1.00 46.58  ? 317 THR D OG1 1 
ATOM   2149 C  CG2 . THR D 1 55 ? 25.584  4.708  38.078  1.00 54.97  ? 317 THR D CG2 1 
ATOM   2150 N  N   . GLU D 1 56 ? 28.889  7.854  37.449  1.00 57.70  ? 318 GLU D N   1 
ATOM   2151 C  CA  . GLU D 1 56 ? 29.746  8.843  36.809  1.00 59.52  ? 318 GLU D CA  1 
ATOM   2152 C  C   . GLU D 1 56 ? 31.175  8.322  36.700  1.00 67.13  ? 318 GLU D C   1 
ATOM   2153 O  O   . GLU D 1 56 ? 31.767  8.327  35.620  1.00 56.22  ? 318 GLU D O   1 
ATOM   2154 C  CB  . GLU D 1 56 ? 29.719  10.150 37.602  1.00 67.92  ? 318 GLU D CB  1 
ATOM   2155 C  CG  . GLU D 1 56 ? 30.806  11.143 37.226  1.00 78.16  ? 318 GLU D CG  1 
ATOM   2156 C  CD  . GLU D 1 56 ? 30.789  12.382 38.105  1.00 101.17 ? 318 GLU D CD  1 
ATOM   2157 O  OE1 . GLU D 1 56 ? 29.717  12.704 38.660  1.00 90.27  ? 318 GLU D OE1 1 
ATOM   2158 O  OE2 . GLU D 1 56 ? 31.844  13.036 38.241  1.00 111.50 ? 318 GLU D OE2 1 
ATOM   2159 N  N   . TYR D 1 57 ? 31.724  7.874  37.824  1.00 63.72  ? 319 TYR D N   1 
ATOM   2160 C  CA  . TYR D 1 57 ? 33.064  7.299  37.853  1.00 47.55  ? 319 TYR D CA  1 
ATOM   2161 C  C   . TYR D 1 57 ? 33.152  6.014  37.030  1.00 51.92  ? 319 TYR D C   1 
ATOM   2162 O  O   . TYR D 1 57 ? 34.212  5.670  36.513  1.00 42.38  ? 319 TYR D O   1 
ATOM   2163 C  CB  . TYR D 1 57 ? 33.484  7.012  39.294  1.00 52.52  ? 319 TYR D CB  1 
ATOM   2164 C  CG  . TYR D 1 57 ? 34.180  8.160  39.985  1.00 63.85  ? 319 TYR D CG  1 
ATOM   2165 C  CD1 . TYR D 1 57 ? 33.457  9.178  40.590  1.00 82.63  ? 319 TYR D CD1 1 
ATOM   2166 C  CD2 . TYR D 1 57 ? 35.565  8.218  40.043  1.00 54.73  ? 319 TYR D CD2 1 
ATOM   2167 C  CE1 . TYR D 1 57 ? 34.093  10.226 41.229  1.00 77.07  ? 319 TYR D CE1 1 
ATOM   2168 C  CE2 . TYR D 1 57 ? 36.209  9.260  40.678  1.00 61.22  ? 319 TYR D CE2 1 
ATOM   2169 C  CZ  . TYR D 1 57 ? 35.470  10.261 41.270  1.00 70.91  ? 319 TYR D CZ  1 
ATOM   2170 O  OH  . TYR D 1 57 ? 36.109  11.301 41.904  1.00 83.10  ? 319 TYR D OH  1 
ATOM   2171 N  N   . ARG D 1 58 ? 32.034  5.306  36.915  1.00 70.82  ? 320 ARG D N   1 
ATOM   2172 C  CA  . ARG D 1 58 ? 32.016  4.017  36.233  1.00 61.08  ? 320 ARG D CA  1 
ATOM   2173 C  C   . ARG D 1 58 ? 32.154  4.163  34.720  1.00 59.42  ? 320 ARG D C   1 
ATOM   2174 O  O   . ARG D 1 58 ? 32.908  3.427  34.085  1.00 60.58  ? 320 ARG D O   1 
ATOM   2175 C  CB  . ARG D 1 58 ? 30.748  3.235  36.586  1.00 53.36  ? 320 ARG D CB  1 
ATOM   2176 C  CG  . ARG D 1 58 ? 30.827  1.753  36.245  1.00 61.65  ? 320 ARG D CG  1 
ATOM   2177 C  CD  . ARG D 1 58 ? 29.625  0.995  36.789  1.00 83.75  ? 320 ARG D CD  1 
ATOM   2178 N  NE  . ARG D 1 58 ? 28.390  1.357  36.102  1.00 74.16  ? 320 ARG D NE  1 
ATOM   2179 C  CZ  . ARG D 1 58 ? 27.858  0.659  35.104  1.00 87.14  ? 320 ARG D CZ  1 
ATOM   2180 N  NH1 . ARG D 1 58 ? 28.449  -0.449 34.678  1.00 81.23  ? 320 ARG D NH1 1 
ATOM   2181 N  NH2 . ARG D 1 58 ? 26.732  1.065  34.536  1.00 85.91  ? 320 ARG D NH2 1 
ATOM   2182 N  N   . ARG D 1 59 ? 31.418  5.107  34.144  1.00 52.45  ? 321 ARG D N   1 
ATOM   2183 C  CA  . ARG D 1 59 ? 31.499  5.359  32.712  1.00 59.44  ? 321 ARG D CA  1 
ATOM   2184 C  C   . ARG D 1 59 ? 32.902  5.821  32.340  1.00 52.02  ? 321 ARG D C   1 
ATOM   2185 O  O   . ARG D 1 59 ? 33.383  5.555  31.239  1.00 47.35  ? 321 ARG D O   1 
ATOM   2186 C  CB  . ARG D 1 59 ? 30.466  6.405  32.290  1.00 64.62  ? 321 ARG D CB  1 
ATOM   2187 C  CG  . ARG D 1 59 ? 29.041  6.052  32.675  1.00 57.12  ? 321 ARG D CG  1 
ATOM   2188 C  CD  . ARG D 1 59 ? 28.045  7.021  32.063  1.00 78.67  ? 321 ARG D CD  1 
ATOM   2189 N  NE  . ARG D 1 59 ? 26.676  6.710  32.462  1.00 110.80 ? 321 ARG D NE  1 
ATOM   2190 C  CZ  . ARG D 1 59 ? 25.936  5.758  31.905  1.00 123.56 ? 321 ARG D CZ  1 
ATOM   2191 N  NH1 . ARG D 1 59 ? 26.433  5.018  30.924  1.00 114.77 ? 321 ARG D NH1 1 
ATOM   2192 N  NH2 . ARG D 1 59 ? 24.698  5.544  32.331  1.00 110.34 ? 321 ARG D NH2 1 
ATOM   2193 N  N   . GLN D 1 60 ? 33.554  6.512  33.270  1.00 42.56  ? 322 GLN D N   1 
ATOM   2194 C  CA  . GLN D 1 60 ? 34.914  6.992  33.061  1.00 47.93  ? 322 GLN D CA  1 
ATOM   2195 C  C   . GLN D 1 60 ? 35.892  5.831  32.906  1.00 40.29  ? 322 GLN D C   1 
ATOM   2196 O  O   . GLN D 1 60 ? 36.656  5.780  31.947  1.00 60.17  ? 322 GLN D O   1 
ATOM   2197 C  CB  . GLN D 1 60 ? 35.348  7.890  34.220  1.00 72.92  ? 322 GLN D CB  1 
ATOM   2198 C  CG  . GLN D 1 60 ? 36.729  8.503  34.050  1.00 64.66  ? 322 GLN D CG  1 
ATOM   2199 C  CD  . GLN D 1 60 ? 37.216  9.199  35.306  1.00 78.38  ? 322 GLN D CD  1 
ATOM   2200 O  OE1 . GLN D 1 60 ? 36.693  8.971  36.398  1.00 61.46  ? 322 GLN D OE1 1 
ATOM   2201 N  NE2 . GLN D 1 60 ? 38.224  10.050 35.158  1.00 75.68  ? 322 GLN D NE2 1 
ATOM   2202 N  N   . VAL D 1 61 ? 35.866  4.900  33.852  1.00 51.33  ? 323 VAL D N   1 
ATOM   2203 C  CA  . VAL D 1 61 ? 36.751  3.740  33.793  1.00 57.24  ? 323 VAL D CA  1 
ATOM   2204 C  C   . VAL D 1 61 ? 36.442  2.861  32.580  1.00 56.87  ? 323 VAL D C   1 
ATOM   2205 O  O   . VAL D 1 61 ? 37.344  2.287  31.972  1.00 44.60  ? 323 VAL D O   1 
ATOM   2206 C  CB  . VAL D 1 61 ? 36.698  2.906  35.095  1.00 45.91  ? 323 VAL D CB  1 
ATOM   2207 C  CG1 . VAL D 1 61 ? 35.278  2.775  35.597  1.00 50.50  ? 323 VAL D CG1 1 
ATOM   2208 C  CG2 . VAL D 1 61 ? 37.329  1.535  34.882  1.00 63.90  ? 323 VAL D CG2 1 
ATOM   2209 N  N   . GLN D 1 62 ? 35.164  2.768  32.227  1.00 74.83  ? 324 GLN D N   1 
ATOM   2210 C  CA  . GLN D 1 62 ? 34.754  2.051  31.026  1.00 52.75  ? 324 GLN D CA  1 
ATOM   2211 C  C   . GLN D 1 62 ? 35.429  2.652  29.799  1.00 48.47  ? 324 GLN D C   1 
ATOM   2212 O  O   . GLN D 1 62 ? 35.843  1.936  28.891  1.00 58.98  ? 324 GLN D O   1 
ATOM   2213 C  CB  . GLN D 1 62 ? 33.234  2.111  30.857  1.00 28.16  ? 324 GLN D CB  1 
ATOM   2214 C  CG  . GLN D 1 62 ? 32.465  1.114  31.702  1.00 37.12  ? 324 GLN D CG  1 
ATOM   2215 C  CD  . GLN D 1 62 ? 30.977  1.134  31.402  1.00 53.79  ? 324 GLN D CD  1 
ATOM   2216 O  OE1 . GLN D 1 62 ? 30.458  2.103  30.850  1.00 59.52  ? 324 GLN D OE1 1 
ATOM   2217 N  NE2 . GLN D 1 62 ? 30.283  0.061  31.765  1.00 55.49  ? 324 GLN D NE2 1 
ATOM   2218 N  N   . SER D 1 63 ? 35.535  3.977  29.781  1.00 57.64  ? 325 SER D N   1 
ATOM   2219 C  CA  . SER D 1 63 ? 36.128  4.686  28.655  1.00 56.36  ? 325 SER D CA  1 
ATOM   2220 C  C   . SER D 1 63 ? 37.646  4.612  28.702  1.00 45.66  ? 325 SER D C   1 
ATOM   2221 O  O   . SER D 1 63 ? 38.300  4.459  27.669  1.00 58.93  ? 325 SER D O   1 
ATOM   2222 C  CB  . SER D 1 63 ? 35.677  6.147  28.651  1.00 61.69  ? 325 SER D CB  1 
ATOM   2223 O  OG  . SER D 1 63 ? 36.236  6.852  27.556  1.00 81.14  ? 325 SER D OG  1 
ATOM   2224 N  N   . LEU D 1 64 ? 38.204  4.732  29.903  1.00 38.28  ? 326 LEU D N   1 
ATOM   2225 C  CA  . LEU D 1 64 ? 39.651  4.678  30.075  1.00 60.71  ? 326 LEU D CA  1 
ATOM   2226 C  C   . LEU D 1 64 ? 40.212  3.292  29.751  1.00 53.35  ? 326 LEU D C   1 
ATOM   2227 O  O   . LEU D 1 64 ? 41.255  3.172  29.108  1.00 44.38  ? 326 LEU D O   1 
ATOM   2228 C  CB  . LEU D 1 64 ? 40.042  5.100  31.493  1.00 57.03  ? 326 LEU D CB  1 
ATOM   2229 C  CG  . LEU D 1 64 ? 41.535  5.301  31.759  1.00 66.35  ? 326 LEU D CG  1 
ATOM   2230 C  CD1 . LEU D 1 64 ? 42.141  6.225  30.716  1.00 68.20  ? 326 LEU D CD1 1 
ATOM   2231 C  CD2 . LEU D 1 64 ? 41.766  5.846  33.160  1.00 51.70  ? 326 LEU D CD2 1 
ATOM   2232 N  N   . THR D 1 65 ? 39.518  2.248  30.191  1.00 53.21  ? 327 THR D N   1 
ATOM   2233 C  CA  . THR D 1 65 ? 39.947  0.883  29.913  1.00 51.58  ? 327 THR D CA  1 
ATOM   2234 C  C   . THR D 1 65 ? 39.860  0.601  28.416  1.00 58.88  ? 327 THR D C   1 
ATOM   2235 O  O   . THR D 1 65 ? 40.590  -0.237 27.885  1.00 47.17  ? 327 THR D O   1 
ATOM   2236 C  CB  . THR D 1 65 ? 39.107  -0.148 30.689  1.00 54.68  ? 327 THR D CB  1 
ATOM   2237 O  OG1 . THR D 1 65 ? 39.656  -1.456 30.495  1.00 92.40  ? 327 THR D OG1 1 
ATOM   2238 C  CG2 . THR D 1 65 ? 37.673  -0.138 30.206  1.00 59.25  ? 327 THR D CG2 1 
ATOM   2239 N  N   . CYS D 1 66 ? 38.964  1.314  27.743  1.00 55.14  ? 328 CYS D N   1 
ATOM   2240 C  CA  . CYS D 1 66 ? 38.813  1.195  26.300  1.00 45.38  ? 328 CYS D CA  1 
ATOM   2241 C  C   . CYS D 1 66 ? 39.939  1.944  25.598  1.00 49.32  ? 328 CYS D C   1 
ATOM   2242 O  O   . CYS D 1 66 ? 40.457  1.489  24.579  1.00 45.39  ? 328 CYS D O   1 
ATOM   2243 C  CB  . CYS D 1 66 ? 37.452  1.738  25.854  1.00 44.48  ? 328 CYS D CB  1 
ATOM   2244 S  SG  . CYS D 1 66 ? 37.164  1.694  24.064  1.00 79.00  ? 328 CYS D SG  1 
ATOM   2245 N  N   . GLU D 1 67 ? 40.312  3.093  26.154  1.00 53.67  ? 329 GLU D N   1 
ATOM   2246 C  CA  . GLU D 1 67 ? 41.406  3.889  25.615  1.00 48.27  ? 329 GLU D CA  1 
ATOM   2247 C  C   . GLU D 1 67 ? 42.732  3.160  25.793  1.00 42.88  ? 329 GLU D C   1 
ATOM   2248 O  O   . GLU D 1 67 ? 43.618  3.249  24.950  1.00 72.36  ? 329 GLU D O   1 
ATOM   2249 C  CB  . GLU D 1 67 ? 41.469  5.253  26.304  1.00 62.39  ? 329 GLU D CB  1 
ATOM   2250 C  CG  . GLU D 1 67 ? 42.427  6.232  25.643  1.00 89.91  ? 329 GLU D CG  1 
ATOM   2251 C  CD  . GLU D 1 67 ? 42.956  7.282  26.603  1.00 104.49 ? 329 GLU D CD  1 
ATOM   2252 O  OE1 . GLU D 1 67 ? 42.982  8.473  26.230  1.00 108.02 ? 329 GLU D OE1 1 
ATOM   2253 O  OE2 . GLU D 1 67 ? 43.349  6.917  27.731  1.00 107.44 ? 329 GLU D OE2 1 
ATOM   2254 N  N   . VAL D 1 68 ? 42.861  2.442  26.903  1.00 46.00  ? 330 VAL D N   1 
ATOM   2255 C  CA  . VAL D 1 68 ? 44.072  1.684  27.190  1.00 56.14  ? 330 VAL D CA  1 
ATOM   2256 C  C   . VAL D 1 68 ? 44.209  0.490  26.252  1.00 64.23  ? 330 VAL D C   1 
ATOM   2257 O  O   . VAL D 1 68 ? 45.310  0.155  25.812  1.00 61.82  ? 330 VAL D O   1 
ATOM   2258 C  CB  . VAL D 1 68 ? 44.084  1.181  28.647  1.00 52.24  ? 330 VAL D CB  1 
ATOM   2259 C  CG1 . VAL D 1 68 ? 45.157  0.120  28.834  1.00 57.41  ? 330 VAL D CG1 1 
ATOM   2260 C  CG2 . VAL D 1 68 ? 44.288  2.338  29.609  1.00 60.11  ? 330 VAL D CG2 1 
ATOM   2261 N  N   . ASP D 1 69 ? 43.082  -0.149 25.953  1.00 72.96  ? 331 ASP D N   1 
ATOM   2262 C  CA  . ASP D 1 69 ? 43.067  -1.311 25.072  1.00 60.44  ? 331 ASP D CA  1 
ATOM   2263 C  C   . ASP D 1 69 ? 43.449  -0.931 23.644  1.00 60.71  ? 331 ASP D C   1 
ATOM   2264 O  O   . ASP D 1 69 ? 44.470  -1.382 23.124  1.00 70.09  ? 331 ASP D O   1 
ATOM   2265 C  CB  . ASP D 1 69 ? 41.692  -1.987 25.094  1.00 46.45  ? 331 ASP D CB  1 
ATOM   2266 C  CG  . ASP D 1 69 ? 41.447  -2.768 26.373  1.00 80.37  ? 331 ASP D CG  1 
ATOM   2267 O  OD1 . ASP D 1 69 ? 42.404  -2.934 27.157  1.00 83.58  ? 331 ASP D OD1 1 
ATOM   2268 O  OD2 . ASP D 1 69 ? 40.301  -3.217 26.594  1.00 74.40  ? 331 ASP D OD2 1 
ATOM   2269 N  N   . ALA D 1 70 ? 42.625  -0.095 23.020  1.00 60.85  ? 332 ALA D N   1 
ATOM   2270 C  CA  . ALA D 1 70 ? 42.848  0.318  21.640  1.00 76.46  ? 332 ALA D CA  1 
ATOM   2271 C  C   . ALA D 1 70 ? 44.238  0.918  21.464  1.00 68.18  ? 332 ALA D C   1 
ATOM   2272 O  O   . ALA D 1 70 ? 44.838  0.816  20.393  1.00 78.90  ? 332 ALA D O   1 
ATOM   2273 C  CB  . ALA D 1 70 ? 41.777  1.306  21.200  1.00 65.57  ? 332 ALA D CB  1 
ATOM   2274 N  N   . LEU D 1 71 ? 44.747  1.539  22.523  1.00 43.62  ? 333 LEU D N   1 
ATOM   2275 C  CA  . LEU D 1 71 ? 46.082  2.123  22.499  1.00 60.97  ? 333 LEU D CA  1 
ATOM   2276 C  C   . LEU D 1 71 ? 47.155  1.034  22.562  1.00 83.78  ? 333 LEU D C   1 
ATOM   2277 O  O   . LEU D 1 71 ? 47.469  0.519  23.637  1.00 85.30  ? 333 LEU D O   1 
ATOM   2278 C  CB  . LEU D 1 71 ? 46.250  3.111  23.656  1.00 62.48  ? 333 LEU D CB  1 
ATOM   2279 C  CG  . LEU D 1 71 ? 47.585  3.847  23.775  1.00 94.00  ? 333 LEU D CG  1 
ATOM   2280 C  CD1 . LEU D 1 71 ? 47.942  4.535  22.467  1.00 102.71 ? 333 LEU D CD1 1 
ATOM   2281 C  CD2 . LEU D 1 71 ? 47.541  4.848  24.920  1.00 88.02  ? 333 LEU D CD2 1 
ATOM   2282 N  N   . LYS D 1 72 ? 47.709  0.689  21.403  1.00 95.86  ? 334 LYS D N   1 
ATOM   2283 C  CA  . LYS D 1 72 ? 48.715  -0.365 21.306  1.00 95.08  ? 334 LYS D CA  1 
ATOM   2284 C  C   . LYS D 1 72 ? 48.146  -1.708 21.750  1.00 82.11  ? 334 LYS D C   1 
ATOM   2285 O  O   . LYS D 1 72 ? 48.880  -2.684 21.901  1.00 81.02  ? 334 LYS D O   1 
ATOM   2286 C  CB  . LYS D 1 72 ? 49.944  -0.011 22.145  1.00 20.00  ? 334 LYS D CB  1 
ATOM   2287 C  CG  . LYS D 1 72 ? 50.728  1.184  21.626  1.00 20.00  ? 334 LYS D CG  1 
ATOM   2288 C  CD  . LYS D 1 72 ? 51.918  1.495  22.517  1.00 20.00  ? 334 LYS D CD  1 
ATOM   2289 C  CE  . LYS D 1 72 ? 52.714  2.675  21.986  1.00 20.00  ? 334 LYS D CE  1 
ATOM   2290 N  NZ  . LYS D 1 72 ? 53.871  3.005  22.864  1.00 20.00  ? 334 LYS D NZ  1 
HETATM 2291 O  O22 . P33 E 2 .  ? -6.206  6.060  77.152  1.00 58.99  ? 1   P33 A O22 1 
HETATM 2292 C  C21 . P33 E 2 .  ? -5.185  6.475  78.067  1.00 61.44  ? 1   P33 A C21 1 
HETATM 2293 C  C20 . P33 E 2 .  ? -4.930  7.972  77.917  1.00 66.90  ? 1   P33 A C20 1 
HETATM 2294 O  O19 . P33 E 2 .  ? -4.096  8.420  78.984  1.00 75.99  ? 1   P33 A O19 1 
HETATM 2295 C  C18 . P33 E 2 .  ? -3.066  9.287  78.516  1.00 89.67  ? 1   P33 A C18 1 
HETATM 2296 C  C17 . P33 E 2 .  ? -1.756  8.516  78.591  1.00 71.86  ? 1   P33 A C17 1 
HETATM 2297 O  O16 . P33 E 2 .  ? -2.033  7.168  78.222  1.00 65.78  ? 1   P33 A O16 1 
HETATM 2298 C  C15 . P33 E 2 .  ? -0.857  6.373  78.109  1.00 71.15  ? 1   P33 A C15 1 
HETATM 2299 C  C14 . P33 E 2 .  ? -1.273  4.931  77.846  1.00 29.87  ? 1   P33 A C14 1 
HETATM 2300 O  O13 . P33 E 2 .  ? -0.314  4.343  76.975  1.00 54.17  ? 1   P33 A O13 1 
HETATM 2301 C  C12 . P33 E 2 .  ? -0.803  3.166  76.340  1.00 65.54  ? 1   P33 A C12 1 
HETATM 2302 C  C11 . P33 E 2 .  ? -0.395  3.220  74.874  1.00 60.14  ? 1   P33 A C11 1 
HETATM 2303 O  O10 . P33 E 2 .  ? 0.603   4.227  74.716  1.00 38.72  ? 1   P33 A O10 1 
HETATM 2304 C  C9  . P33 E 2 .  ? 1.030   4.347  73.362  1.00 22.21  ? 1   P33 A C9  1 
HETATM 2305 C  C8  . P33 E 2 .  ? 1.614   5.737  73.134  1.00 39.77  ? 1   P33 A C8  1 
HETATM 2306 O  O7  . P33 E 2 .  ? 0.556   6.686  73.005  1.00 33.38  ? 1   P33 A O7  1 
HETATM 2307 C  C6  . P33 E 2 .  ? 1.049   7.950  72.565  1.00 43.01  ? 1   P33 A C6  1 
HETATM 2308 C  C5  . P33 E 2 .  ? -0.102  8.904  72.272  1.00 42.59  ? 1   P33 A C5  1 
HETATM 2309 O  O4  . P33 E 2 .  ? -0.885  9.102  73.447  1.00 32.41  ? 1   P33 A O4  1 
HETATM 2310 C  C3  . P33 E 2 .  ? -1.493  10.392 73.468  1.00 44.40  ? 1   P33 A C3  1 
HETATM 2311 C  C2  . P33 E 2 .  ? -2.495  10.460 74.612  1.00 56.86  ? 1   P33 A C2  1 
HETATM 2312 O  O1  . P33 E 2 .  ? -1.964  9.760  75.742  1.00 50.30  ? 1   P33 A O1  1 
HETATM 2313 SM SM  . SM  F 3 .  ? -13.992 17.661 72.196  0.74 124.01 ? 3   SM  A SM  1 
HETATM 2314 O  O1  . P6G G 4 .  ? -0.878  14.525 79.521  1.00 71.26  ? 4   P6G B O1  1 
HETATM 2315 C  C2  . P6G G 4 .  ? 0.192   15.461 79.689  1.00 55.37  ? 4   P6G B C2  1 
HETATM 2316 C  C3  . P6G G 4 .  ? 0.270   16.348 78.453  1.00 28.55  ? 4   P6G B C3  1 
HETATM 2317 O  O4  . P6G G 4 .  ? 1.440   17.161 78.520  1.00 55.06  ? 4   P6G B O4  1 
HETATM 2318 C  C5  . P6G G 4 .  ? 1.636   17.892 77.311  1.00 53.49  ? 4   P6G B C5  1 
HETATM 2319 C  C6  . P6G G 4 .  ? 3.079   18.376 77.230  1.00 32.92  ? 4   P6G B C6  1 
HETATM 2320 O  O7  . P6G G 4 .  ? 3.459   18.452 75.857  1.00 34.64  ? 4   P6G B O7  1 
HETATM 2321 C  C8  . P6G G 4 .  ? 4.824   18.091 75.666  1.00 35.98  ? 4   P6G B C8  1 
HETATM 2322 C  C9  . P6G G 4 .  ? 4.884   16.989 74.616  1.00 46.30  ? 4   P6G B C9  1 
HETATM 2323 O  O10 . P6G G 4 .  ? 5.971   16.121 74.926  1.00 45.79  ? 4   P6G B O10 1 
HETATM 2324 C  C11 . P6G G 4 .  ? 5.608   14.750 74.781  1.00 53.37  ? 4   P6G B C11 1 
HETATM 2325 C  C12 . P6G G 4 .  ? 6.326   13.939 75.852  1.00 49.57  ? 4   P6G B C12 1 
HETATM 2326 O  O13 . P6G G 4 .  ? 5.455   12.910 76.313  1.00 34.15  ? 4   P6G B O13 1 
HETATM 2327 C  C14 . P6G G 4 .  ? 5.365   12.895 77.735  1.00 25.22  ? 4   P6G B C14 1 
HETATM 2328 C  C15 . P6G G 4 .  ? 3.929   12.571 78.130  1.00 27.25  ? 4   P6G B C15 1 
HETATM 2329 O  O16 . P6G G 4 .  ? 3.725   12.865 79.511  1.00 51.03  ? 4   P6G B O16 1 
HETATM 2330 C  C17 . P6G G 4 .  ? 2.357   12.699 79.876  1.00 55.03  ? 4   P6G B C17 1 
HETATM 2331 C  C18 . P6G G 4 .  ? 2.211   12.777 81.390  1.00 54.45  ? 4   P6G B C18 1 
HETATM 2332 O  O19 . P6G G 4 .  ? 0.847   12.523 81.742  1.00 70.30  ? 4   P6G B O19 1 
HETATM 2333 SM SM  . SM  H 3 .  ? 5.085   23.818 80.138  1.00 69.97  ? 1   SM  B SM  1 
HETATM 2334 CA CA  . CA  I 5 .  ? 31.412  10.482 61.545  1.00 102.27 ? 6   CA  B CA  1 
HETATM 2335 CA CA  . CA  J 5 .  ? 7.177   7.461  92.022  1.00 74.76  ? 7   CA  B CA  1 
HETATM 2336 O  O1  . PG4 K 6 .  ? 1.264   8.662  78.996  1.00 90.04  ? 2   PG4 C O1  1 
HETATM 2337 C  C1  . PG4 K 6 .  ? 1.809   8.403  80.292  1.00 61.43  ? 2   PG4 C C1  1 
HETATM 2338 C  C2  . PG4 K 6 .  ? 1.007   9.150  81.351  1.00 97.67  ? 2   PG4 C C2  1 
HETATM 2339 O  O2  . PG4 K 6 .  ? -0.355  8.727  81.336  1.00 77.70  ? 2   PG4 C O2  1 
HETATM 2340 C  C3  . PG4 K 6 .  ? -0.873  8.614  82.660  1.00 47.62  ? 2   PG4 C C3  1 
HETATM 2341 C  C4  . PG4 K 6 .  ? -2.350  8.985  82.668  1.00 62.49  ? 2   PG4 C C4  1 
HETATM 2342 O  O3  . PG4 K 6 .  ? -3.005  8.338  83.757  1.00 77.16  ? 2   PG4 C O3  1 
HETATM 2343 C  C5  . PG4 K 6 .  ? -4.032  9.157  84.310  1.00 58.37  ? 2   PG4 C C5  1 
HETATM 2344 C  C6  . PG4 K 6 .  ? -5.363  8.421  84.224  1.00 47.73  ? 2   PG4 C C6  1 
HETATM 2345 O  O4  . PG4 K 6 .  ? -5.768  8.403  82.856  1.00 48.35  ? 2   PG4 C O4  1 
HETATM 2346 C  C7  . PG4 K 6 .  ? -6.494  7.222  82.522  1.00 66.35  ? 2   PG4 C C7  1 
HETATM 2347 C  C8  . PG4 K 6 .  ? -6.770  7.194  81.023  1.00 45.15  ? 2   PG4 C C8  1 
HETATM 2348 O  O5  . PG4 K 6 .  ? -6.983  5.839  80.611  1.00 41.45  ? 2   PG4 C O5  1 
HETATM 2349 O  O1  . PG4 L 6 .  ? 0.277   10.818 95.671  1.00 100.01 ? 5   PG4 C O1  1 
HETATM 2350 C  C1  . PG4 L 6 .  ? -0.431  11.801 94.907  1.00 98.96  ? 5   PG4 C C1  1 
HETATM 2351 C  C2  . PG4 L 6 .  ? -1.545  11.119 94.124  1.00 88.58  ? 5   PG4 C C2  1 
HETATM 2352 O  O2  . PG4 L 6 .  ? -2.532  12.082 93.764  1.00 68.99  ? 5   PG4 C O2  1 
HETATM 2353 C  C3  . PG4 L 6 .  ? -3.643  11.478 93.105  1.00 69.37  ? 5   PG4 C C3  1 
HETATM 2354 C  C4  . PG4 L 6 .  ? -4.831  12.433 93.145  1.00 62.24  ? 5   PG4 C C4  1 
HETATM 2355 O  O3  . PG4 L 6 .  ? -5.858  11.963 92.274  1.00 57.60  ? 5   PG4 C O3  1 
HETATM 2356 C  C5  . PG4 L 6 .  ? -6.816  12.980 91.981  1.00 53.36  ? 5   PG4 C C5  1 
HETATM 2357 C  C6  . PG4 L 6 .  ? -7.471  12.677 90.638  1.00 75.74  ? 5   PG4 C C6  1 
HETATM 2358 O  O4  . PG4 L 6 .  ? -8.386  13.718 90.298  1.00 78.39  ? 5   PG4 C O4  1 
HETATM 2359 C  C7  . PG4 L 6 .  ? -9.016  13.472 89.044  1.00 55.37  ? 5   PG4 C C7  1 
HETATM 2360 C  C8  . PG4 L 6 .  ? -10.174 14.443 88.852  1.00 41.86  ? 5   PG4 C C8  1 
HETATM 2361 O  O5  . PG4 L 6 .  ? -10.891 14.082 87.666  1.00 51.70  ? 5   PG4 C O5  1 
HETATM 2362 CA CA  . CA  M 5 .  ? 8.333   9.817  67.797  1.00 75.26  ? 4   CA  C CA  1 
HETATM 2363 O  OH2 . 1PE N 7 .  ? -2.860  16.361 78.964  1.00 43.45  ? 3   1PE D OH2 1 
HETATM 2364 C  C12 . 1PE N 7 .  ? -3.893  15.478 79.414  1.00 58.78  ? 3   1PE D C12 1 
HETATM 2365 C  C22 . 1PE N 7 .  ? -4.773  16.193 80.434  1.00 71.99  ? 3   1PE D C22 1 
HETATM 2366 O  OH3 . 1PE N 7 .  ? -3.993  16.564 81.569  1.00 61.36  ? 3   1PE D OH3 1 
HETATM 2367 C  C13 . 1PE N 7 .  ? -3.981  17.431 83.809  1.00 34.79  ? 3   1PE D C13 1 
HETATM 2368 C  C23 . 1PE N 7 .  ? -4.729  17.374 82.483  1.00 39.86  ? 3   1PE D C23 1 
HETATM 2369 O  OH4 . 1PE N 7 .  ? -2.773  18.173 83.657  1.00 39.52  ? 3   1PE D OH4 1 
HETATM 2370 C  C14 . 1PE N 7 .  ? -0.715  18.752 84.795  1.00 34.81  ? 3   1PE D C14 1 
HETATM 2371 C  C24 . 1PE N 7 .  ? -1.773  17.684 84.548  1.00 50.82  ? 3   1PE D C24 1 
HETATM 2372 O  OH5 . 1PE N 7 .  ? -0.382  19.406 83.573  1.00 34.82  ? 3   1PE D OH5 1 
HETATM 2373 C  C15 . 1PE N 7 .  ? 0.225   21.707 83.260  1.00 67.90  ? 3   1PE D C15 1 
HETATM 2374 C  C25 . 1PE N 7 .  ? 0.675   20.343 83.771  1.00 35.17  ? 3   1PE D C25 1 
HETATM 2375 O  OH6 . 1PE N 7 .  ? 1.181   22.705 83.611  1.00 54.19  ? 3   1PE D OH6 1 
HETATM 2376 C  C16 . 1PE N 7 .  ? 1.619   24.872 82.652  1.00 54.75  ? 3   1PE D C16 1 
HETATM 2377 C  C26 . 1PE N 7 .  ? 0.647   24.018 83.455  1.00 46.40  ? 3   1PE D C26 1 
HETATM 2378 O  OH7 . 1PE N 7 .  ? 1.867   24.233 81.394  1.00 30.75  ? 3   1PE D OH7 1 
HETATM 2379 C  C1  . PGE O 8 .  ? 8.484   25.542 74.703  1.00 80.02  ? 6   PGE D C1  1 
HETATM 2380 O  O1  . PGE O 8 .  ? 7.889   26.704 75.289  1.00 66.22  ? 6   PGE D O1  1 
HETATM 2381 C  C2  . PGE O 8 .  ? 7.394   24.631 74.150  1.00 65.95  ? 6   PGE D C2  1 
HETATM 2382 O  O2  . PGE O 8 .  ? 7.941   23.329 73.954  1.00 67.94  ? 6   PGE D O2  1 
HETATM 2383 C  C3  . PGE O 8 .  ? 6.966   22.310 74.158  1.00 63.01  ? 6   PGE D C3  1 
HETATM 2384 C  C4  . PGE O 8 .  ? 7.470   21.395 75.265  1.00 54.45  ? 6   PGE D C4  1 
HETATM 2385 O  O4  . PGE O 8 .  ? 8.230   24.123 78.105  1.00 50.14  ? 6   PGE D O4  1 
HETATM 2386 C  C6  . PGE O 8 .  ? 8.474   22.782 78.545  1.00 60.65  ? 6   PGE D C6  1 
HETATM 2387 C  C5  . PGE O 8 .  ? 7.811   21.806 77.581  1.00 83.84  ? 6   PGE D C5  1 
HETATM 2388 O  O3  . PGE O 8 .  ? 8.098   22.217 76.247  1.00 92.98  ? 6   PGE D O3  1 
HETATM 2389 SM SM  . SM  P 3 .  ? 42.648  12.406 28.565  1.00 144.11 ? 2   SM  D SM  1 
HETATM 2390 CA CA  . CA  Q 5 .  ? 32.312  16.268 41.175  1.00 84.99  ? 5   CA  D CA  1 
HETATM 2391 CA CA  . CA  R 5 .  ? 10.347  22.100 70.248  1.00 80.91  ? 8   CA  D CA  1 
HETATM 2392 CA CA  . CA  S 5 .  ? 15.410  22.841 63.590  1.00 123.16 ? 9   CA  D CA  1 
HETATM 2393 O  O   . HOH T 9 .  ? -4.924  24.637 87.959  1.00 40.94  ? 10  HOH B O   1 
HETATM 2394 O  O   . HOH T 9 .  ? 5.070   8.635  78.639  1.00 39.85  ? 16  HOH B O   1 
HETATM 2395 O  O   . HOH U 9 .  ? -0.273  11.514 84.800  1.00 54.65  ? 12  HOH C O   1 
HETATM 2396 O  O   . HOH U 9 .  ? 8.494   1.673  85.910  1.00 45.06  ? 15  HOH C O   1 
HETATM 2397 O  O   . HOH V 9 .  ? 2.984   25.690 73.038  1.00 39.95  ? 11  HOH D O   1 
HETATM 2398 O  O   . HOH V 9 .  ? -0.961  22.674 67.700  1.00 46.80  ? 13  HOH D O   1 
HETATM 2399 O  O   . HOH V 9 .  ? 13.574  12.410 50.042  1.00 40.89  ? 14  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  263 ?   ?   ?   A . n 
A 1 2  ASP 2  264 264 ASP ASP A . n 
A 1 3  LEU 3  265 265 LEU LEU A . n 
A 1 4  THR 4  266 266 THR THR A . n 
A 1 5  ALA 5  267 267 ALA ALA A . n 
A 1 6  ALA 6  268 268 ALA ALA A . n 
A 1 7  LEU 7  269 269 LEU LEU A . n 
A 1 8  ARG 8  270 270 ARG ARG A . n 
A 1 9  ASP 9  271 271 ASP ASP A . n 
A 1 10 VAL 10 272 272 VAL VAL A . n 
A 1 11 ARG 11 273 273 ARG ARG A . n 
A 1 12 GLN 12 274 274 GLN GLN A . n 
A 1 13 GLN 13 275 275 GLN GLN A . n 
A 1 14 TYR 14 276 276 TYR TYR A . n 
A 1 15 GLU 15 277 277 GLU GLU A . n 
A 1 16 SER 16 278 278 SER SER A . n 
A 1 17 VAL 17 279 279 VAL VAL A . n 
A 1 18 ALA 18 280 280 ALA ALA A . n 
A 1 19 ALA 19 281 281 ALA ALA A . n 
A 1 20 LYS 20 282 282 LYS LYS A . n 
A 1 21 ASN 21 283 283 ASN ASN A . n 
A 1 22 LEU 22 284 284 LEU LEU A . n 
A 1 23 GLN 23 285 285 GLN GLN A . n 
A 1 24 GLU 24 286 286 GLU GLU A . n 
A 1 25 ALA 25 287 287 ALA ALA A . n 
A 1 26 GLU 26 288 288 GLU GLU A . n 
A 1 27 GLU 27 289 289 GLU GLU A . n 
A 1 28 TRP 28 290 290 TRP TRP A . n 
A 1 29 TYR 29 291 291 TYR TYR A . n 
A 1 30 LYS 30 292 292 LYS LYS A . n 
A 1 31 SER 31 293 293 SER SER A . n 
A 1 32 LYS 32 294 294 LYS LYS A . n 
A 1 33 PHE 33 295 295 PHE PHE A . n 
A 1 34 ALA 34 296 296 ALA ALA A . n 
A 1 35 ASP 35 297 297 ASP ASP A . n 
A 1 36 LEU 36 298 298 LEU LEU A . n 
A 1 37 SER 37 299 299 SER SER A . n 
A 1 38 GLU 38 300 300 GLU GLU A . n 
A 1 39 ALA 39 301 301 ALA ALA A . n 
A 1 40 ALA 40 302 302 ALA ALA A . n 
A 1 41 ASN 41 303 303 ASN ASN A . n 
A 1 42 ARG 42 304 304 ARG ARG A . n 
A 1 43 ASN 43 305 305 ASN ASN A . n 
A 1 44 ASN 44 306 306 ASN ASN A . n 
A 1 45 ASP 45 307 307 ASP ASP A . n 
A 1 46 ALA 46 308 308 ALA ALA A . n 
A 1 47 LEU 47 309 309 LEU LEU A . n 
A 1 48 ARG 48 310 310 ARG ARG A . n 
A 1 49 GLN 49 311 311 GLN GLN A . n 
A 1 50 ALA 50 312 312 ALA ALA A . n 
A 1 51 LYS 51 313 313 LYS LYS A . n 
A 1 52 GLN 52 314 314 GLN GLN A . n 
A 1 53 GLU 53 315 315 GLU GLU A . n 
A 1 54 SER 54 316 316 SER SER A . n 
A 1 55 THR 55 317 317 THR THR A . n 
A 1 56 GLU 56 318 318 GLU GLU A . n 
A 1 57 TYR 57 319 319 TYR TYR A . n 
A 1 58 ARG 58 320 320 ARG ARG A . n 
A 1 59 ARG 59 321 321 ARG ARG A . n 
A 1 60 GLN 60 322 322 GLN GLN A . n 
A 1 61 VAL 61 323 323 VAL VAL A . n 
A 1 62 GLN 62 324 324 GLN GLN A . n 
A 1 63 SER 63 325 325 SER SER A . n 
A 1 64 LEU 64 326 326 LEU LEU A . n 
A 1 65 THR 65 327 327 THR THR A . n 
A 1 66 CYS 66 328 328 CYS CYS A . n 
A 1 67 GLU 67 329 329 GLU GLU A . n 
A 1 68 VAL 68 330 330 VAL VAL A . n 
A 1 69 ASP 69 331 331 ASP ASP A . n 
A 1 70 ALA 70 332 332 ALA ALA A . n 
A 1 71 LEU 71 333 333 LEU LEU A . n 
A 1 72 LYS 72 334 334 LYS LYS A . n 
B 1 1  PRO 1  263 ?   ?   ?   B . n 
B 1 2  ASP 2  264 264 ASP ASP B . n 
B 1 3  LEU 3  265 265 LEU LEU B . n 
B 1 4  THR 4  266 266 THR THR B . n 
B 1 5  ALA 5  267 267 ALA ALA B . n 
B 1 6  ALA 6  268 268 ALA ALA B . n 
B 1 7  LEU 7  269 269 LEU LEU B . n 
B 1 8  ARG 8  270 270 ARG ARG B . n 
B 1 9  ASP 9  271 271 ASP ASP B . n 
B 1 10 VAL 10 272 272 VAL VAL B . n 
B 1 11 ARG 11 273 273 ARG ARG B . n 
B 1 12 GLN 12 274 274 GLN GLN B . n 
B 1 13 GLN 13 275 275 GLN GLN B . n 
B 1 14 TYR 14 276 276 TYR TYR B . n 
B 1 15 GLU 15 277 277 GLU GLU B . n 
B 1 16 SER 16 278 278 SER SER B . n 
B 1 17 VAL 17 279 279 VAL VAL B . n 
B 1 18 ALA 18 280 280 ALA ALA B . n 
B 1 19 ALA 19 281 281 ALA ALA B . n 
B 1 20 LYS 20 282 282 LYS LYS B . n 
B 1 21 ASN 21 283 283 ASN ASN B . n 
B 1 22 LEU 22 284 284 LEU LEU B . n 
B 1 23 GLN 23 285 285 GLN GLN B . n 
B 1 24 GLU 24 286 286 GLU GLU B . n 
B 1 25 ALA 25 287 287 ALA ALA B . n 
B 1 26 GLU 26 288 288 GLU GLU B . n 
B 1 27 GLU 27 289 289 GLU GLU B . n 
B 1 28 TRP 28 290 290 TRP TRP B . n 
B 1 29 TYR 29 291 291 TYR TYR B . n 
B 1 30 LYS 30 292 292 LYS LYS B . n 
B 1 31 SER 31 293 293 SER SER B . n 
B 1 32 LYS 32 294 294 LYS LYS B . n 
B 1 33 PHE 33 295 295 PHE PHE B . n 
B 1 34 ALA 34 296 296 ALA ALA B . n 
B 1 35 ASP 35 297 297 ASP ASP B . n 
B 1 36 LEU 36 298 298 LEU LEU B . n 
B 1 37 SER 37 299 299 SER SER B . n 
B 1 38 GLU 38 300 300 GLU GLU B . n 
B 1 39 ALA 39 301 301 ALA ALA B . n 
B 1 40 ALA 40 302 302 ALA ALA B . n 
B 1 41 ASN 41 303 303 ASN ASN B . n 
B 1 42 ARG 42 304 304 ARG ARG B . n 
B 1 43 ASN 43 305 305 ASN ASN B . n 
B 1 44 ASN 44 306 306 ASN ASN B . n 
B 1 45 ASP 45 307 307 ASP ASP B . n 
B 1 46 ALA 46 308 308 ALA ALA B . n 
B 1 47 LEU 47 309 309 LEU LEU B . n 
B 1 48 ARG 48 310 310 ARG ARG B . n 
B 1 49 GLN 49 311 311 GLN GLN B . n 
B 1 50 ALA 50 312 312 ALA ALA B . n 
B 1 51 LYS 51 313 313 LYS LYS B . n 
B 1 52 GLN 52 314 314 GLN GLN B . n 
B 1 53 GLU 53 315 315 GLU GLU B . n 
B 1 54 SER 54 316 316 SER SER B . n 
B 1 55 THR 55 317 317 THR THR B . n 
B 1 56 GLU 56 318 318 GLU GLU B . n 
B 1 57 TYR 57 319 319 TYR TYR B . n 
B 1 58 ARG 58 320 320 ARG ARG B . n 
B 1 59 ARG 59 321 321 ARG ARG B . n 
B 1 60 GLN 60 322 322 GLN GLN B . n 
B 1 61 VAL 61 323 323 VAL VAL B . n 
B 1 62 GLN 62 324 324 GLN GLN B . n 
B 1 63 SER 63 325 325 SER SER B . n 
B 1 64 LEU 64 326 326 LEU LEU B . n 
B 1 65 THR 65 327 327 THR THR B . n 
B 1 66 CYS 66 328 328 CYS CYS B . n 
B 1 67 GLU 67 329 329 GLU GLU B . n 
B 1 68 VAL 68 330 330 VAL VAL B . n 
B 1 69 ASP 69 331 331 ASP ASP B . n 
B 1 70 ALA 70 332 332 ALA ALA B . n 
B 1 71 LEU 71 333 333 LEU LEU B . n 
B 1 72 LYS 72 334 334 LYS LYS B . n 
C 1 1  PRO 1  263 263 PRO PRO C . n 
C 1 2  ASP 2  264 264 ASP ASP C . n 
C 1 3  LEU 3  265 265 LEU LEU C . n 
C 1 4  THR 4  266 266 THR THR C . n 
C 1 5  ALA 5  267 267 ALA ALA C . n 
C 1 6  ALA 6  268 268 ALA ALA C . n 
C 1 7  LEU 7  269 269 LEU LEU C . n 
C 1 8  ARG 8  270 270 ARG ARG C . n 
C 1 9  ASP 9  271 271 ASP ASP C . n 
C 1 10 VAL 10 272 272 VAL VAL C . n 
C 1 11 ARG 11 273 273 ARG ARG C . n 
C 1 12 GLN 12 274 274 GLN GLN C . n 
C 1 13 GLN 13 275 275 GLN GLN C . n 
C 1 14 TYR 14 276 276 TYR TYR C . n 
C 1 15 GLU 15 277 277 GLU GLU C . n 
C 1 16 SER 16 278 278 SER SER C . n 
C 1 17 VAL 17 279 279 VAL VAL C . n 
C 1 18 ALA 18 280 280 ALA ALA C . n 
C 1 19 ALA 19 281 281 ALA ALA C . n 
C 1 20 LYS 20 282 282 LYS LYS C . n 
C 1 21 ASN 21 283 283 ASN ASN C . n 
C 1 22 LEU 22 284 284 LEU LEU C . n 
C 1 23 GLN 23 285 285 GLN GLN C . n 
C 1 24 GLU 24 286 286 GLU GLU C . n 
C 1 25 ALA 25 287 287 ALA ALA C . n 
C 1 26 GLU 26 288 288 GLU GLU C . n 
C 1 27 GLU 27 289 289 GLU GLU C . n 
C 1 28 TRP 28 290 290 TRP TRP C . n 
C 1 29 TYR 29 291 291 TYR TYR C . n 
C 1 30 LYS 30 292 292 LYS LYS C . n 
C 1 31 SER 31 293 293 SER SER C . n 
C 1 32 LYS 32 294 294 LYS LYS C . n 
C 1 33 PHE 33 295 295 PHE PHE C . n 
C 1 34 ALA 34 296 296 ALA ALA C . n 
C 1 35 ASP 35 297 297 ASP ASP C . n 
C 1 36 LEU 36 298 298 LEU LEU C . n 
C 1 37 SER 37 299 299 SER SER C . n 
C 1 38 GLU 38 300 300 GLU GLU C . n 
C 1 39 ALA 39 301 301 ALA ALA C . n 
C 1 40 ALA 40 302 302 ALA ALA C . n 
C 1 41 ASN 41 303 303 ASN ASN C . n 
C 1 42 ARG 42 304 304 ARG ARG C . n 
C 1 43 ASN 43 305 305 ASN ASN C . n 
C 1 44 ASN 44 306 306 ASN ASN C . n 
C 1 45 ASP 45 307 307 ASP ASP C . n 
C 1 46 ALA 46 308 308 ALA ALA C . n 
C 1 47 LEU 47 309 309 LEU LEU C . n 
C 1 48 ARG 48 310 310 ARG ARG C . n 
C 1 49 GLN 49 311 311 GLN GLN C . n 
C 1 50 ALA 50 312 312 ALA ALA C . n 
C 1 51 LYS 51 313 313 LYS LYS C . n 
C 1 52 GLN 52 314 314 GLN GLN C . n 
C 1 53 GLU 53 315 315 GLU GLU C . n 
C 1 54 SER 54 316 316 SER SER C . n 
C 1 55 THR 55 317 317 THR THR C . n 
C 1 56 GLU 56 318 318 GLU GLU C . n 
C 1 57 TYR 57 319 319 TYR TYR C . n 
C 1 58 ARG 58 320 320 ARG ARG C . n 
C 1 59 ARG 59 321 321 ARG ARG C . n 
C 1 60 GLN 60 322 322 GLN GLN C . n 
C 1 61 VAL 61 323 323 VAL VAL C . n 
C 1 62 GLN 62 324 324 GLN GLN C . n 
C 1 63 SER 63 325 325 SER SER C . n 
C 1 64 LEU 64 326 326 LEU LEU C . n 
C 1 65 THR 65 327 327 THR THR C . n 
C 1 66 CYS 66 328 328 CYS CYS C . n 
C 1 67 GLU 67 329 329 GLU GLU C . n 
C 1 68 VAL 68 330 330 VAL VAL C . n 
C 1 69 ASP 69 331 331 ASP ASP C . n 
C 1 70 ALA 70 332 332 ALA ALA C . n 
C 1 71 LEU 71 333 333 LEU LEU C . n 
C 1 72 LYS 72 334 ?   ?   ?   C . n 
D 1 1  PRO 1  263 ?   ?   ?   D . n 
D 1 2  ASP 2  264 ?   ?   ?   D . n 
D 1 3  LEU 3  265 265 LEU LEU D . n 
D 1 4  THR 4  266 266 THR THR D . n 
D 1 5  ALA 5  267 267 ALA ALA D . n 
D 1 6  ALA 6  268 268 ALA ALA D . n 
D 1 7  LEU 7  269 269 LEU LEU D . n 
D 1 8  ARG 8  270 270 ARG ARG D . n 
D 1 9  ASP 9  271 271 ASP ASP D . n 
D 1 10 VAL 10 272 272 VAL VAL D . n 
D 1 11 ARG 11 273 273 ARG ARG D . n 
D 1 12 GLN 12 274 274 GLN GLN D . n 
D 1 13 GLN 13 275 275 GLN GLN D . n 
D 1 14 TYR 14 276 276 TYR TYR D . n 
D 1 15 GLU 15 277 277 GLU GLU D . n 
D 1 16 SER 16 278 278 SER SER D . n 
D 1 17 VAL 17 279 279 VAL VAL D . n 
D 1 18 ALA 18 280 280 ALA ALA D . n 
D 1 19 ALA 19 281 281 ALA ALA D . n 
D 1 20 LYS 20 282 282 LYS LYS D . n 
D 1 21 ASN 21 283 283 ASN ASN D . n 
D 1 22 LEU 22 284 284 LEU LEU D . n 
D 1 23 GLN 23 285 285 GLN GLN D . n 
D 1 24 GLU 24 286 286 GLU GLU D . n 
D 1 25 ALA 25 287 287 ALA ALA D . n 
D 1 26 GLU 26 288 288 GLU GLU D . n 
D 1 27 GLU 27 289 289 GLU GLU D . n 
D 1 28 TRP 28 290 290 TRP TRP D . n 
D 1 29 TYR 29 291 291 TYR TYR D . n 
D 1 30 LYS 30 292 292 LYS LYS D . n 
D 1 31 SER 31 293 293 SER SER D . n 
D 1 32 LYS 32 294 294 LYS LYS D . n 
D 1 33 PHE 33 295 295 PHE PHE D . n 
D 1 34 ALA 34 296 296 ALA ALA D . n 
D 1 35 ASP 35 297 297 ASP ASP D . n 
D 1 36 LEU 36 298 298 LEU LEU D . n 
D 1 37 SER 37 299 299 SER SER D . n 
D 1 38 GLU 38 300 300 GLU GLU D . n 
D 1 39 ALA 39 301 301 ALA ALA D . n 
D 1 40 ALA 40 302 302 ALA ALA D . n 
D 1 41 ASN 41 303 303 ASN ASN D . n 
D 1 42 ARG 42 304 304 ARG ARG D . n 
D 1 43 ASN 43 305 305 ASN ASN D . n 
D 1 44 ASN 44 306 306 ASN ASN D . n 
D 1 45 ASP 45 307 307 ASP ASP D . n 
D 1 46 ALA 46 308 308 ALA ALA D . n 
D 1 47 LEU 47 309 309 LEU LEU D . n 
D 1 48 ARG 48 310 310 ARG ARG D . n 
D 1 49 GLN 49 311 311 GLN GLN D . n 
D 1 50 ALA 50 312 312 ALA ALA D . n 
D 1 51 LYS 51 313 313 LYS LYS D . n 
D 1 52 GLN 52 314 314 GLN GLN D . n 
D 1 53 GLU 53 315 315 GLU GLU D . n 
D 1 54 SER 54 316 316 SER SER D . n 
D 1 55 THR 55 317 317 THR THR D . n 
D 1 56 GLU 56 318 318 GLU GLU D . n 
D 1 57 TYR 57 319 319 TYR TYR D . n 
D 1 58 ARG 58 320 320 ARG ARG D . n 
D 1 59 ARG 59 321 321 ARG ARG D . n 
D 1 60 GLN 60 322 322 GLN GLN D . n 
D 1 61 VAL 61 323 323 VAL VAL D . n 
D 1 62 GLN 62 324 324 GLN GLN D . n 
D 1 63 SER 63 325 325 SER SER D . n 
D 1 64 LEU 64 326 326 LEU LEU D . n 
D 1 65 THR 65 327 327 THR THR D . n 
D 1 66 CYS 66 328 328 CYS CYS D . n 
D 1 67 GLU 67 329 329 GLU GLU D . n 
D 1 68 VAL 68 330 330 VAL VAL D . n 
D 1 69 ASP 69 331 331 ASP ASP D . n 
D 1 70 ALA 70 332 332 ALA ALA D . n 
D 1 71 LEU 71 333 333 LEU LEU D . n 
D 1 72 LYS 72 334 334 LYS LYS D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA dimeric    2 
3 author_and_software_defined_assembly PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V 
2 1 A,B,E,F,G,H,I,J,T                           
3 1 C,D,K,L,M,N,O,P,Q,R,S,U,V                   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9020  ? 
1 MORE         -75   ? 
1 'SSA (A^2)'  18530 ? 
2 'ABSA (A^2)' 1930  ? 
2 MORE         -15   ? 
2 'SSA (A^2)'  11800 ? 
3 'ABSA (A^2)' 1760  ? 
3 MORE         -14   ? 
3 'SSA (A^2)'  12060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .                 ? 1 
SHARP     phasing           .                 ? 2 
PHENIX    refinement        '(phenix.refine)' ? 3 
MOSFLM    'data reduction'  .                 ? 4 
SCALA     'data scaling'    .                 ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CE 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   LYS 
_pdbx_validate_close_contact.auth_seq_id_1    334 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CD2 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   LEU 
_pdbx_validate_close_contact.auth_seq_id_2    333 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PRO 263 ? A PRO 1  
2 1 Y 1 B PRO 263 ? B PRO 1  
3 1 Y 1 C LYS 334 ? C LYS 72 
4 1 Y 1 D PRO 263 ? D PRO 1  
5 1 Y 1 D ASP 264 ? D ASP 2  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL P33 
3 'SAMARIUM (III) ION'                    SM  
4 'HEXAETHYLENE GLYCOL'                   P6G 
5 'CALCIUM ION'                           CA  
6 'TETRAETHYLENE GLYCOL'                  PG4 
7 'PENTAETHYLENE GLYCOL'                  1PE 
8 'TRIETHYLENE GLYCOL'                    PGE 
9 water                                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 P33 1 1  1  P33 PM7 A . 
F 3 SM  1 3  3  SM  SM  A . 
G 4 P6G 1 4  4  P6G PM6 B . 
H 3 SM  1 1  1  SM  SM  B . 
I 5 CA  1 6  6  CA  CA  B . 
J 5 CA  1 7  7  CA  CA  B . 
K 6 PG4 1 2  2  PG4 PM4 C . 
L 6 PG4 1 5  5  PG4 PM4 C . 
M 5 CA  1 4  4  CA  CA  C . 
N 7 1PE 1 3  3  1PE PM5 D . 
O 8 PGE 1 6  6  PGE PM3 D . 
P 3 SM  1 2  2  SM  SM  D . 
Q 5 CA  1 5  5  CA  CA  D . 
R 5 CA  1 8  8  CA  CA  D . 
S 5 CA  1 9  9  CA  CA  D . 
T 9 HOH 1 10 10 HOH HOH B . 
T 9 HOH 2 16 16 HOH HOH B . 
U 9 HOH 1 12 12 HOH HOH C . 
U 9 HOH 2 15 15 HOH HOH C . 
V 9 HOH 1 11 11 HOH HOH D . 
V 9 HOH 2 13 13 HOH HOH D . 
V 9 HOH 3 14 14 HOH HOH D . 
#