data_3KMU
# 
_entry.id   3KMU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3KMU         pdb_00003kmu 10.2210/pdb3kmu/pdb 
RCSB  RCSB056188   ?            ?                   
WWPDB D_1000056188 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3KMW 
_pdbx_database_related.details        'Cytoskeletal protein complex 2' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KMU 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fukuda, K.' 1 
'Qin, J.'    2 
# 
_citation.id                        primary 
_citation.title                     
'The pseudoactive site of ILK is essential for its binding to alpha-Parvin and localization to focal adhesions.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            36 
_citation.page_first                819 
_citation.page_last                 830 
_citation.year                      2009 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20005845 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2009.11.028 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fukuda, K.' 1 ? 
primary 'Gupta, S.'  2 ? 
primary 'Chen, K.'   3 ? 
primary 'Wu, C.'     4 ? 
primary 'Qin, J.'    5 ? 
# 
_cell.entry_id           3KMU 
_cell.length_a           44.380 
_cell.length_b           117.715 
_cell.length_c           47.344 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.68 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KMU 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Integrin-linked kinase' 31675.428 1   ? 'C346S, C422S' 'C-terminal pseudokinase domain: UNP residues 183-452'      
? 
2 polymer man Alpha-parvin             14983.758 1   ? ?              'C-terminal calponin homology domain: UNP residues 248-372' 
? 
3 water   nat water                    18.015    298 ? ?              ?                                                           
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 ILK                                                                                                                 
2 'Calponin-like integrin-linked kinase-binding protein, CH-ILKBP, Matrix-remodeling-associated protein 2, Actopaxin' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;(MSE)NKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGAC
QSPPAPHPTLITHW(MSE)PYGSLYNVLHEGTNFVVDQSQAVKFALD(MSE)ARG(MSE)AFLHTLEPLIPRHALNSRSV
(MSE)IDED(MSE)TARIS(MSE)ADVKFSFQSPGR(MSE)YAPAWVAPEALQKKPEDTNRRSAD(MSE)WSFAVLLWEL
VTREVPFADLSN(MSE)EIG(MSE)KVALEGLRPTIPPGISPHVSKL(MSE)KIC(MSE)NEDPAKRPKFD(MSE)IVPI
LEK(MSE)QDK
;
;MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPP
APHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVK
FSFQSPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHV
SKLMKICMNEDPAKRPKFDMIVPILEKMQDK
;
A ? 
2 'polypeptide(L)' no yes 
;GSH(MSE)DAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLL(MSE)GLLEGYFVPLHSFFL
TPDSFEQKVLNVSFAFEL(MSE)QDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
;
;GSHMDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQK
VLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   ASN n 
1 3   LYS n 
1 4   HIS n 
1 5   SER n 
1 6   GLY n 
1 7   ILE n 
1 8   ASP n 
1 9   PHE n 
1 10  LYS n 
1 11  GLN n 
1 12  LEU n 
1 13  ASN n 
1 14  PHE n 
1 15  LEU n 
1 16  THR n 
1 17  LYS n 
1 18  LEU n 
1 19  ASN n 
1 20  GLU n 
1 21  ASN n 
1 22  HIS n 
1 23  SER n 
1 24  GLY n 
1 25  GLU n 
1 26  LEU n 
1 27  TRP n 
1 28  LYS n 
1 29  GLY n 
1 30  ARG n 
1 31  TRP n 
1 32  GLN n 
1 33  GLY n 
1 34  ASN n 
1 35  ASP n 
1 36  ILE n 
1 37  VAL n 
1 38  VAL n 
1 39  LYS n 
1 40  VAL n 
1 41  LEU n 
1 42  LYS n 
1 43  VAL n 
1 44  ARG n 
1 45  ASP n 
1 46  TRP n 
1 47  SER n 
1 48  THR n 
1 49  ARG n 
1 50  LYS n 
1 51  SER n 
1 52  ARG n 
1 53  ASP n 
1 54  PHE n 
1 55  ASN n 
1 56  GLU n 
1 57  GLU n 
1 58  CYS n 
1 59  PRO n 
1 60  ARG n 
1 61  LEU n 
1 62  ARG n 
1 63  ILE n 
1 64  PHE n 
1 65  SER n 
1 66  HIS n 
1 67  PRO n 
1 68  ASN n 
1 69  VAL n 
1 70  LEU n 
1 71  PRO n 
1 72  VAL n 
1 73  LEU n 
1 74  GLY n 
1 75  ALA n 
1 76  CYS n 
1 77  GLN n 
1 78  SER n 
1 79  PRO n 
1 80  PRO n 
1 81  ALA n 
1 82  PRO n 
1 83  HIS n 
1 84  PRO n 
1 85  THR n 
1 86  LEU n 
1 87  ILE n 
1 88  THR n 
1 89  HIS n 
1 90  TRP n 
1 91  MSE n 
1 92  PRO n 
1 93  TYR n 
1 94  GLY n 
1 95  SER n 
1 96  LEU n 
1 97  TYR n 
1 98  ASN n 
1 99  VAL n 
1 100 LEU n 
1 101 HIS n 
1 102 GLU n 
1 103 GLY n 
1 104 THR n 
1 105 ASN n 
1 106 PHE n 
1 107 VAL n 
1 108 VAL n 
1 109 ASP n 
1 110 GLN n 
1 111 SER n 
1 112 GLN n 
1 113 ALA n 
1 114 VAL n 
1 115 LYS n 
1 116 PHE n 
1 117 ALA n 
1 118 LEU n 
1 119 ASP n 
1 120 MSE n 
1 121 ALA n 
1 122 ARG n 
1 123 GLY n 
1 124 MSE n 
1 125 ALA n 
1 126 PHE n 
1 127 LEU n 
1 128 HIS n 
1 129 THR n 
1 130 LEU n 
1 131 GLU n 
1 132 PRO n 
1 133 LEU n 
1 134 ILE n 
1 135 PRO n 
1 136 ARG n 
1 137 HIS n 
1 138 ALA n 
1 139 LEU n 
1 140 ASN n 
1 141 SER n 
1 142 ARG n 
1 143 SER n 
1 144 VAL n 
1 145 MSE n 
1 146 ILE n 
1 147 ASP n 
1 148 GLU n 
1 149 ASP n 
1 150 MSE n 
1 151 THR n 
1 152 ALA n 
1 153 ARG n 
1 154 ILE n 
1 155 SER n 
1 156 MSE n 
1 157 ALA n 
1 158 ASP n 
1 159 VAL n 
1 160 LYS n 
1 161 PHE n 
1 162 SER n 
1 163 PHE n 
1 164 GLN n 
1 165 SER n 
1 166 PRO n 
1 167 GLY n 
1 168 ARG n 
1 169 MSE n 
1 170 TYR n 
1 171 ALA n 
1 172 PRO n 
1 173 ALA n 
1 174 TRP n 
1 175 VAL n 
1 176 ALA n 
1 177 PRO n 
1 178 GLU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 LYS n 
1 183 LYS n 
1 184 PRO n 
1 185 GLU n 
1 186 ASP n 
1 187 THR n 
1 188 ASN n 
1 189 ARG n 
1 190 ARG n 
1 191 SER n 
1 192 ALA n 
1 193 ASP n 
1 194 MSE n 
1 195 TRP n 
1 196 SER n 
1 197 PHE n 
1 198 ALA n 
1 199 VAL n 
1 200 LEU n 
1 201 LEU n 
1 202 TRP n 
1 203 GLU n 
1 204 LEU n 
1 205 VAL n 
1 206 THR n 
1 207 ARG n 
1 208 GLU n 
1 209 VAL n 
1 210 PRO n 
1 211 PHE n 
1 212 ALA n 
1 213 ASP n 
1 214 LEU n 
1 215 SER n 
1 216 ASN n 
1 217 MSE n 
1 218 GLU n 
1 219 ILE n 
1 220 GLY n 
1 221 MSE n 
1 222 LYS n 
1 223 VAL n 
1 224 ALA n 
1 225 LEU n 
1 226 GLU n 
1 227 GLY n 
1 228 LEU n 
1 229 ARG n 
1 230 PRO n 
1 231 THR n 
1 232 ILE n 
1 233 PRO n 
1 234 PRO n 
1 235 GLY n 
1 236 ILE n 
1 237 SER n 
1 238 PRO n 
1 239 HIS n 
1 240 VAL n 
1 241 SER n 
1 242 LYS n 
1 243 LEU n 
1 244 MSE n 
1 245 LYS n 
1 246 ILE n 
1 247 CYS n 
1 248 MSE n 
1 249 ASN n 
1 250 GLU n 
1 251 ASP n 
1 252 PRO n 
1 253 ALA n 
1 254 LYS n 
1 255 ARG n 
1 256 PRO n 
1 257 LYS n 
1 258 PHE n 
1 259 ASP n 
1 260 MSE n 
1 261 ILE n 
1 262 VAL n 
1 263 PRO n 
1 264 ILE n 
1 265 LEU n 
1 266 GLU n 
1 267 LYS n 
1 268 MSE n 
1 269 GLN n 
1 270 ASP n 
1 271 LYS n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MSE n 
2 5   ASP n 
2 6   ALA n 
2 7   PHE n 
2 8   ASP n 
2 9   THR n 
2 10  LEU n 
2 11  PHE n 
2 12  ASP n 
2 13  HIS n 
2 14  ALA n 
2 15  PRO n 
2 16  ASP n 
2 17  LYS n 
2 18  LEU n 
2 19  ASN n 
2 20  VAL n 
2 21  VAL n 
2 22  LYS n 
2 23  LYS n 
2 24  THR n 
2 25  LEU n 
2 26  ILE n 
2 27  THR n 
2 28  PHE n 
2 29  VAL n 
2 30  ASN n 
2 31  LYS n 
2 32  HIS n 
2 33  LEU n 
2 34  ASN n 
2 35  LYS n 
2 36  LEU n 
2 37  ASN n 
2 38  LEU n 
2 39  GLU n 
2 40  VAL n 
2 41  THR n 
2 42  GLU n 
2 43  LEU n 
2 44  GLU n 
2 45  THR n 
2 46  GLN n 
2 47  PHE n 
2 48  ALA n 
2 49  ASP n 
2 50  GLY n 
2 51  VAL n 
2 52  TYR n 
2 53  LEU n 
2 54  VAL n 
2 55  LEU n 
2 56  LEU n 
2 57  MSE n 
2 58  GLY n 
2 59  LEU n 
2 60  LEU n 
2 61  GLU n 
2 62  GLY n 
2 63  TYR n 
2 64  PHE n 
2 65  VAL n 
2 66  PRO n 
2 67  LEU n 
2 68  HIS n 
2 69  SER n 
2 70  PHE n 
2 71  PHE n 
2 72  LEU n 
2 73  THR n 
2 74  PRO n 
2 75  ASP n 
2 76  SER n 
2 77  PHE n 
2 78  GLU n 
2 79  GLN n 
2 80  LYS n 
2 81  VAL n 
2 82  LEU n 
2 83  ASN n 
2 84  VAL n 
2 85  SER n 
2 86  PHE n 
2 87  ALA n 
2 88  PHE n 
2 89  GLU n 
2 90  LEU n 
2 91  MSE n 
2 92  GLN n 
2 93  ASP n 
2 94  GLY n 
2 95  GLY n 
2 96  LEU n 
2 97  GLU n 
2 98  LYS n 
2 99  PRO n 
2 100 LYS n 
2 101 PRO n 
2 102 ARG n 
2 103 PRO n 
2 104 GLU n 
2 105 ASP n 
2 106 ILE n 
2 107 VAL n 
2 108 ASN n 
2 109 CYS n 
2 110 ASP n 
2 111 LEU n 
2 112 LYS n 
2 113 SER n 
2 114 THR n 
2 115 LEU n 
2 116 ARG n 
2 117 VAL n 
2 118 LEU n 
2 119 TYR n 
2 120 ASN n 
2 121 LEU n 
2 122 PHE n 
2 123 THR n 
2 124 LYS n 
2 125 TYR n 
2 126 ARG n 
2 127 ASN n 
2 128 VAL n 
2 129 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'ILK, ILK1, ILK2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(DE3)pLysS' ? ? ? ? ? ? ? Plasmid ? ? ? pST39 ? ? 
2 1 sample ? ? ? human ? 'PARVA, MXRA2'    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(DE3)pLysS' ? ? ? ? ? ? ? Plasmid ? ? ? pST39 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ILK_HUMAN   Q13418 1 
;NKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPA
PHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKF
SFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVC
KLMKICMNEDPAKRPKFDMIVPILEKMQDK
;
183 ? 
2 UNP PARVA_HUMAN Q9NVD7 2 
;DAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNV
SFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
;
248 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KMU A 2 ? 271 ? Q13418 183 ? 452 ? 183 452 
2 2 3KMU B 5 ? 129 ? Q9NVD7 248 ? 372 ? 248 372 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KMU MSE A 1   ? UNP Q13418 ?   ?   'expression tag'      -1  1 
1 3KMU SER A 165 ? UNP Q13418 CYS 346 'engineered mutation' 346 2 
1 3KMU SER A 241 ? UNP Q13418 CYS 422 'engineered mutation' 422 3 
2 3KMU GLY B 1   ? UNP Q9NVD7 ?   ?   'expression tag'      -4  4 
2 3KMU SER B 2   ? UNP Q9NVD7 ?   ?   'expression tag'      -3  5 
2 3KMU HIS B 3   ? UNP Q9NVD7 ?   ?   'expression tag'      -2  6 
2 3KMU MSE B 4   ? UNP Q9NVD7 ?   ?   'expression tag'      -1  7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3KMU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.density_percent_sol   52.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.05 M Bis-Tris, 12% PEG 5000 MME, 5% 1-Propyl alcohol, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2008-07-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111) DOUBLE-CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97880 1.0 
2 0.97900 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.97880, 0.97900' 
# 
_reflns.entry_id                     3KMU 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             58.82 
_reflns.d_resolution_high            1.750 
_reflns.number_obs                   94370 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05800 
_reflns.pdbx_netI_over_sigmaI        28.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.800 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.78 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.44000 
_reflns_shell.meanI_over_sigI_obs    2.300 
_reflns_shell.pdbx_redundancy        3.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3KMU 
_refine.ls_number_reflns_obs                     41751 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             58.82 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2243 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               28.78 
_refine.aniso_B[1][1]                            0.77000 
_refine.aniso_B[2][2]                            -0.32000 
_refine.aniso_B[3][3]                            -0.48000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.06000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'THE FRIEDEL PAIRS WERE USED IN PHASING' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.129 
_refine.pdbx_overall_ESU_R_Free                  0.124 
_refine.overall_SU_ML                            0.084 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.642 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3147 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             298 
_refine_hist.number_atoms_total               3445 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        58.82 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.022  ? 3230 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.484  1.968  ? 4382 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.536  5.000  ? 389  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.393 24.041 ? 146  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.759 15.000 ? 568  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.087 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.103  0.200  ? 484  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 2442 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.213  0.200  ? 1582 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.307  0.200  ? 2237 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.172  0.200  ? 272  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.163  0.200  ? 44   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.206  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.094  1.500  ? 2009 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.727  2.000  ? 3201 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.809  3.000  ? 1366 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.853  4.500  ? 1181 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.85 
_refine_ls_shell.number_reflns_R_work             3096 
_refine_ls_shell.R_factor_R_work                  0.2520 
_refine_ls_shell.percent_reflns_obs               99.97 
_refine_ls_shell.R_factor_R_free                  0.2870 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             177 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3KMU 
_struct.title                     'Crystal structure of the ILK/alpha-parvin core complex (apo)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KMU 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;CELL ADHESION, ANK repeat, ATP-binding, Cell junction, Cell membrane, Integrin-binding protein, Membrane, Nucleotide-binding, Phosphoprotein, pseudokinase, Actin-binding, Alternative splicing
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'The heterodimeric complex observed in the asymmetric unit is relevant to the biological assembly unit in vivo.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? LEU A 12  ? ASP A 189 LEU A 193 5 ? 5  
HELX_P HELX_P2  2  SER A 47  ? CYS A 58  ? SER A 228 CYS A 239 1 ? 12 
HELX_P HELX_P3  3  PRO A 59  ? ARG A 62  ? PRO A 240 ARG A 243 5 ? 4  
HELX_P HELX_P4  4  SER A 95  ? GLU A 102 ? SER A 276 GLU A 283 1 ? 8  
HELX_P HELX_P5  5  ASP A 109 ? HIS A 128 ? ASP A 290 HIS A 309 1 ? 20 
HELX_P HELX_P6  6  ALA A 157 ? VAL A 159 ? ALA A 338 VAL A 340 5 ? 3  
HELX_P HELX_P7  7  ALA A 171 ? VAL A 175 ? ALA A 352 VAL A 356 5 ? 5  
HELX_P HELX_P8  8  ALA A 176 ? LYS A 182 ? ALA A 357 LYS A 363 1 ? 7  
HELX_P HELX_P9  9  LYS A 183 ? THR A 187 ? LYS A 364 THR A 368 5 ? 5  
HELX_P HELX_P10 10 ASN A 188 ? ARG A 207 ? ASN A 369 ARG A 388 1 ? 20 
HELX_P HELX_P11 11 SER A 215 ? GLU A 226 ? SER A 396 GLU A 407 1 ? 12 
HELX_P HELX_P12 12 SER A 237 ? MSE A 248 ? SER A 418 MSE A 429 1 ? 12 
HELX_P HELX_P13 13 ASP A 251 ? ARG A 255 ? ASP A 432 ARG A 436 5 ? 5  
HELX_P HELX_P14 14 LYS A 257 ? GLN A 269 ? LYS A 438 GLN A 450 1 ? 13 
HELX_P HELX_P15 15 ALA B 6   ? HIS B 13  ? ALA B 249 HIS B 256 1 ? 8  
HELX_P HELX_P16 16 ALA B 14  ? ASN B 34  ? ALA B 257 ASN B 277 1 ? 21 
HELX_P HELX_P17 17 LYS B 35  ? ASN B 37  ? LYS B 278 ASN B 280 5 ? 3  
HELX_P HELX_P18 18 GLY B 50  ? GLY B 62  ? GLY B 293 GLY B 305 1 ? 13 
HELX_P HELX_P19 19 PRO B 66  ? PHE B 70  ? PRO B 309 PHE B 313 5 ? 5  
HELX_P HELX_P20 20 SER B 76  ? GLY B 94  ? SER B 319 GLY B 337 1 ? 19 
HELX_P HELX_P21 21 ARG B 102 ? ASN B 108 ? ARG B 345 ASN B 351 1 ? 7  
HELX_P HELX_P22 22 ASP B 110 ? ARG B 126 ? ASP B 353 ARG B 369 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A TRP 90  C ? ? ? 1_555 A MSE 91  N ? ? A TRP 271 A MSE 272 1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale2  covale both ? A MSE 91  C ? ? ? 1_555 A PRO 92  N ? ? A MSE 272 A PRO 273 1_555 ? ? ? ? ? ? ? 1.341 ? ? 
covale3  covale both ? A ASP 119 C ? ? ? 1_555 A MSE 120 N ? ? A ASP 300 A MSE 301 1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale4  covale both ? A MSE 120 C ? ? ? 1_555 A ALA 121 N ? ? A MSE 301 A ALA 302 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale5  covale both ? A GLY 123 C ? ? ? 1_555 A MSE 124 N ? ? A GLY 304 A MSE 305 1_555 ? ? ? ? ? ? ? 1.339 ? ? 
covale6  covale both ? A MSE 124 C ? ? ? 1_555 A ALA 125 N ? ? A MSE 305 A ALA 306 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale7  covale both ? A VAL 144 C ? ? ? 1_555 A MSE 145 N ? ? A VAL 325 A MSE 326 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale8  covale both ? A MSE 145 C ? ? ? 1_555 A ILE 146 N ? ? A MSE 326 A ILE 327 1_555 ? ? ? ? ? ? ? 1.338 ? ? 
covale9  covale both ? A ASP 149 C ? ? ? 1_555 A MSE 150 N ? ? A ASP 330 A MSE 331 1_555 ? ? ? ? ? ? ? 1.339 ? ? 
covale10 covale both ? A MSE 150 C ? ? ? 1_555 A THR 151 N ? ? A MSE 331 A THR 332 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale11 covale both ? A SER 155 C ? ? ? 1_555 A MSE 156 N ? ? A SER 336 A MSE 337 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale12 covale both ? A MSE 156 C ? ? ? 1_555 A ALA 157 N ? ? A MSE 337 A ALA 338 1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale13 covale both ? A ARG 168 C ? ? ? 1_555 A MSE 169 N ? ? A ARG 349 A MSE 350 1_555 ? ? ? ? ? ? ? 1.338 ? ? 
covale14 covale both ? A MSE 169 C ? ? ? 1_555 A TYR 170 N ? ? A MSE 350 A TYR 351 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale15 covale both ? A ASP 193 C ? ? ? 1_555 A MSE 194 N ? ? A ASP 374 A MSE 375 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale16 covale both ? A MSE 194 C ? ? ? 1_555 A TRP 195 N ? ? A MSE 375 A TRP 376 1_555 ? ? ? ? ? ? ? 1.339 ? ? 
covale17 covale both ? A ASN 216 C ? ? ? 1_555 A MSE 217 N ? ? A ASN 397 A MSE 398 1_555 ? ? ? ? ? ? ? 1.339 ? ? 
covale18 covale both ? A MSE 217 C ? ? ? 1_555 A GLU 218 N ? ? A MSE 398 A GLU 399 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale19 covale both ? A GLY 220 C ? ? ? 1_555 A MSE 221 N ? ? A GLY 401 A MSE 402 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale20 covale both ? A MSE 221 C ? ? ? 1_555 A LYS 222 N ? ? A MSE 402 A LYS 403 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale21 covale both ? A LEU 243 C ? ? ? 1_555 A MSE 244 N ? ? A LEU 424 A MSE 425 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale22 covale both ? A MSE 244 C ? ? ? 1_555 A LYS 245 N ? ? A MSE 425 A LYS 426 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale23 covale both ? A CYS 247 C ? ? ? 1_555 A MSE 248 N ? ? A CYS 428 A MSE 429 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale24 covale both ? A MSE 248 C ? ? ? 1_555 A ASN 249 N ? ? A MSE 429 A ASN 430 1_555 ? ? ? ? ? ? ? 1.322 ? ? 
covale25 covale both ? A ASP 259 C ? ? ? 1_555 A MSE 260 N ? ? A ASP 440 A MSE 441 1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale26 covale both ? A MSE 260 C ? ? ? 1_555 A ILE 261 N ? ? A MSE 441 A ILE 442 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale27 covale both ? A LYS 267 C ? ? ? 1_555 A MSE 268 N ? ? A LYS 448 A MSE 449 1_555 ? ? ? ? ? ? ? 1.339 ? ? 
covale28 covale both ? A MSE 268 C ? ? ? 1_555 A GLN 269 N ? ? A MSE 449 A GLN 450 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale29 covale both ? B LEU 56  C ? ? ? 1_555 B MSE 57  N ? ? B LEU 299 B MSE 300 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale30 covale both ? B MSE 57  C ? ? ? 1_555 B GLY 58  N ? ? B MSE 300 B GLY 301 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale31 covale both ? B LEU 90  C ? ? ? 1_555 B MSE 91  N ? ? B LEU 333 B MSE 334 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale32 covale both ? B MSE 91  C ? ? ? 1_555 B GLN 92  N ? ? B MSE 334 B GLN 335 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 78  A . ? SER 259 A PRO 79  A ? PRO 260 A 1 0.81  
2 PRO 79  A . ? PRO 260 A PRO 80  A ? PRO 261 A 1 1.98  
3 GLU 131 A . ? GLU 312 A PRO 132 A ? PRO 313 A 1 -2.56 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 13  ? ASN A 21  ? ASN A 194 ASN A 202 
A 2 GLY A 24  ? TRP A 31  ? GLY A 205 TRP A 212 
A 3 ASN A 34  ? LEU A 41  ? ASN A 215 LEU A 222 
A 4 THR A 85  ? HIS A 89  ? THR A 266 HIS A 270 
A 5 GLY A 74  ? CYS A 76  ? GLY A 255 CYS A 257 
B 1 VAL A 69  ? LEU A 70  ? VAL A 250 LEU A 251 
B 2 ALA A 152 ? SER A 155 ? ALA A 333 SER A 336 
B 3 VAL A 144 ? ILE A 146 ? VAL A 325 ILE A 327 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 16  ? N THR A 197 O LYS A 28  ? O LYS A 209 
A 2 3 N GLU A 25  ? N GLU A 206 O VAL A 40  ? O VAL A 221 
A 3 4 N LYS A 39  ? N LYS A 220 O LEU A 86  ? O LEU A 267 
A 4 5 O THR A 85  ? O THR A 266 N CYS A 76  ? N CYS A 257 
B 1 2 N LEU A 70  ? N LEU A 251 O ILE A 154 ? O ILE A 335 
B 2 3 O ARG A 153 ? O ARG A 334 N MSE A 145 ? N MSE A 326 
# 
_database_PDB_matrix.entry_id          3KMU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KMU 
_atom_sites.fract_transf_matrix[1][1]   0.022533 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004658 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008495 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021569 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 4   ? 20.117 37.271  -12.700 1.00 48.30 ? 185 HIS A N   1 
ATOM   2    C  CA  . HIS A 1 4   ? 20.974 37.336  -11.471 1.00 47.63 ? 185 HIS A CA  1 
ATOM   3    C  C   . HIS A 1 4   ? 22.150 36.340  -11.553 1.00 46.45 ? 185 HIS A C   1 
ATOM   4    O  O   . HIS A 1 4   ? 21.940 35.130  -11.731 1.00 46.99 ? 185 HIS A O   1 
ATOM   5    C  CB  . HIS A 1 4   ? 20.142 37.051  -10.203 1.00 48.59 ? 185 HIS A CB  1 
ATOM   6    C  CG  . HIS A 1 4   ? 18.744 37.612  -10.224 1.00 50.44 ? 185 HIS A CG  1 
ATOM   7    N  ND1 . HIS A 1 4   ? 18.425 38.855  -9.712  1.00 51.52 ? 185 HIS A ND1 1 
ATOM   8    C  CD2 . HIS A 1 4   ? 17.578 37.081  -10.670 1.00 51.21 ? 185 HIS A CD2 1 
ATOM   9    C  CE1 . HIS A 1 4   ? 17.128 39.069  -9.851  1.00 51.66 ? 185 HIS A CE1 1 
ATOM   10   N  NE2 . HIS A 1 4   ? 16.590 38.007  -10.427 1.00 52.44 ? 185 HIS A NE2 1 
ATOM   11   N  N   . SER A 1 5   ? 23.378 36.845  -11.418 1.00 43.95 ? 186 SER A N   1 
ATOM   12   C  CA  . SER A 1 5   ? 24.588 36.011  -11.480 1.00 41.31 ? 186 SER A CA  1 
ATOM   13   C  C   . SER A 1 5   ? 25.116 35.583  -10.094 1.00 38.86 ? 186 SER A C   1 
ATOM   14   O  O   . SER A 1 5   ? 26.249 35.103  -9.967  1.00 37.95 ? 186 SER A O   1 
ATOM   15   C  CB  . SER A 1 5   ? 25.689 36.743  -12.251 1.00 42.11 ? 186 SER A CB  1 
ATOM   16   O  OG  . SER A 1 5   ? 25.942 38.012  -11.669 1.00 43.50 ? 186 SER A OG  1 
ATOM   17   N  N   . GLY A 1 6   ? 24.302 35.770  -9.062  1.00 36.09 ? 187 GLY A N   1 
ATOM   18   C  CA  . GLY A 1 6   ? 24.661 35.324  -7.719  1.00 32.96 ? 187 GLY A CA  1 
ATOM   19   C  C   . GLY A 1 6   ? 25.523 36.340  -7.011  1.00 31.15 ? 187 GLY A C   1 
ATOM   20   O  O   . GLY A 1 6   ? 25.669 37.479  -7.464  1.00 31.42 ? 187 GLY A O   1 
ATOM   21   N  N   . ILE A 1 7   ? 26.079 35.944  -5.877  1.00 28.86 ? 188 ILE A N   1 
ATOM   22   C  CA  . ILE A 1 7   ? 26.947 36.802  -5.100  1.00 27.00 ? 188 ILE A CA  1 
ATOM   23   C  C   . ILE A 1 7   ? 28.387 36.540  -5.559  1.00 26.94 ? 188 ILE A C   1 
ATOM   24   O  O   . ILE A 1 7   ? 28.743 35.408  -5.874  1.00 25.44 ? 188 ILE A O   1 
ATOM   25   C  CB  . ILE A 1 7   ? 26.768 36.542  -3.570  1.00 27.01 ? 188 ILE A CB  1 
ATOM   26   C  CG1 . ILE A 1 7   ? 25.443 37.154  -3.092  1.00 24.82 ? 188 ILE A CG1 1 
ATOM   27   C  CG2 . ILE A 1 7   ? 27.946 37.132  -2.768  1.00 25.26 ? 188 ILE A CG2 1 
ATOM   28   C  CD1 . ILE A 1 7   ? 25.123 36.849  -1.656  1.00 28.35 ? 188 ILE A CD1 1 
ATOM   29   N  N   . ASP A 1 8   ? 29.207 37.590  -5.605  1.00 26.68 ? 189 ASP A N   1 
ATOM   30   C  CA  . ASP A 1 8   ? 30.610 37.427  -5.983  1.00 27.28 ? 189 ASP A CA  1 
ATOM   31   C  C   . ASP A 1 8   ? 31.380 36.909  -4.793  1.00 27.17 ? 189 ASP A C   1 
ATOM   32   O  O   . ASP A 1 8   ? 31.437 37.577  -3.759  1.00 27.75 ? 189 ASP A O   1 
ATOM   33   C  CB  . ASP A 1 8   ? 31.212 38.767  -6.417  1.00 28.07 ? 189 ASP A CB  1 
ATOM   34   C  CG  . ASP A 1 8   ? 32.564 38.612  -7.078  1.00 30.20 ? 189 ASP A CG  1 
ATOM   35   O  OD1 . ASP A 1 8   ? 33.376 37.737  -6.692  1.00 30.65 ? 189 ASP A OD1 1 
ATOM   36   O  OD2 . ASP A 1 8   ? 32.817 39.403  -8.013  1.00 39.52 ? 189 ASP A OD2 1 
ATOM   37   N  N   . PHE A 1 9   ? 31.967 35.729  -4.946  1.00 27.16 ? 190 PHE A N   1 
ATOM   38   C  CA  . PHE A 1 9   ? 32.758 35.075  -3.908  1.00 28.73 ? 190 PHE A CA  1 
ATOM   39   C  C   . PHE A 1 9   ? 33.928 35.922  -3.377  1.00 29.26 ? 190 PHE A C   1 
ATOM   40   O  O   . PHE A 1 9   ? 34.291 35.849  -2.189  1.00 27.46 ? 190 PHE A O   1 
ATOM   41   C  CB  . PHE A 1 9   ? 33.272 33.742  -4.448  1.00 28.32 ? 190 PHE A CB  1 
ATOM   42   C  CG  . PHE A 1 9   ? 33.988 32.910  -3.438  1.00 30.76 ? 190 PHE A CG  1 
ATOM   43   C  CD1 . PHE A 1 9   ? 35.378 33.026  -3.272  1.00 31.75 ? 190 PHE A CD1 1 
ATOM   44   C  CD2 . PHE A 1 9   ? 33.299 31.962  -2.686  1.00 30.32 ? 190 PHE A CD2 1 
ATOM   45   C  CE1 . PHE A 1 9   ? 36.050 32.234  -2.340  1.00 33.21 ? 190 PHE A CE1 1 
ATOM   46   C  CE2 . PHE A 1 9   ? 33.956 31.164  -1.766  1.00 32.91 ? 190 PHE A CE2 1 
ATOM   47   C  CZ  . PHE A 1 9   ? 35.345 31.308  -1.586  1.00 31.65 ? 190 PHE A CZ  1 
ATOM   48   N  N   . LYS A 1 10  ? 34.505 36.724  -4.271  1.00 31.14 ? 191 LYS A N   1 
ATOM   49   C  CA  . LYS A 1 10  ? 35.620 37.622  -3.901  1.00 32.54 ? 191 LYS A CA  1 
ATOM   50   C  C   . LYS A 1 10  ? 35.179 38.741  -2.961  1.00 32.48 ? 191 LYS A C   1 
ATOM   51   O  O   . LYS A 1 10  ? 36.002 39.260  -2.196  1.00 33.44 ? 191 LYS A O   1 
ATOM   52   C  CB  . LYS A 1 10  ? 36.259 38.229  -5.150  1.00 33.09 ? 191 LYS A CB  1 
ATOM   53   C  CG  . LYS A 1 10  ? 36.751 37.219  -6.159  1.00 36.13 ? 191 LYS A CG  1 
ATOM   54   C  CD  . LYS A 1 10  ? 36.996 37.938  -7.482  1.00 42.29 ? 191 LYS A CD  1 
ATOM   55   C  CE  . LYS A 1 10  ? 37.414 36.959  -8.574  1.00 44.02 ? 191 LYS A CE  1 
ATOM   56   N  NZ  . LYS A 1 10  ? 37.887 37.689  -9.790  1.00 47.18 ? 191 LYS A NZ  1 
ATOM   57   N  N   . GLN A 1 11  ? 33.898 39.109  -3.020  1.00 31.65 ? 192 GLN A N   1 
ATOM   58   C  CA  . GLN A 1 11  ? 33.347 40.131  -2.129  1.00 32.00 ? 192 GLN A CA  1 
ATOM   59   C  C   . GLN A 1 11  ? 33.137 39.635  -0.692  1.00 31.13 ? 192 GLN A C   1 
ATOM   60   O  O   . GLN A 1 11  ? 32.834 40.446  0.191   1.00 31.92 ? 192 GLN A O   1 
ATOM   61   C  CB  . GLN A 1 11  ? 32.042 40.701  -2.669  1.00 32.48 ? 192 GLN A CB  1 
ATOM   62   C  CG  . GLN A 1 11  ? 32.161 41.474  -3.957  1.00 35.40 ? 192 GLN A CG  1 
ATOM   63   C  CD  . GLN A 1 11  ? 30.862 42.132  -4.360  1.00 39.11 ? 192 GLN A CD  1 
ATOM   64   O  OE1 . GLN A 1 11  ? 30.872 43.100  -5.115  1.00 42.60 ? 192 GLN A OE1 1 
ATOM   65   N  NE2 . GLN A 1 11  ? 29.732 41.617  -3.865  1.00 38.74 ? 192 GLN A NE2 1 
ATOM   66   N  N   . LEU A 1 12  ? 33.316 38.330  -0.447  1.00 29.30 ? 193 LEU A N   1 
ATOM   67   C  CA  . LEU A 1 12  ? 33.129 37.779  0.889   1.00 28.54 ? 193 LEU A CA  1 
ATOM   68   C  C   . LEU A 1 12  ? 34.354 37.955  1.760   1.00 28.87 ? 193 LEU A C   1 
ATOM   69   O  O   . LEU A 1 12  ? 35.477 37.539  1.403   1.00 27.54 ? 193 LEU A O   1 
ATOM   70   C  CB  . LEU A 1 12  ? 32.774 36.290  0.868   1.00 28.57 ? 193 LEU A CB  1 
ATOM   71   C  CG  . LEU A 1 12  ? 31.573 35.817  0.056   1.00 26.49 ? 193 LEU A CG  1 
ATOM   72   C  CD1 . LEU A 1 12  ? 31.553 34.285  0.063   1.00 25.37 ? 193 LEU A CD1 1 
ATOM   73   C  CD2 . LEU A 1 12  ? 30.252 36.410  0.586   1.00 24.52 ? 193 LEU A CD2 1 
ATOM   74   N  N   . ASN A 1 13  ? 34.103 38.532  2.926   1.00 27.85 ? 194 ASN A N   1 
ATOM   75   C  CA  . ASN A 1 13  ? 35.116 38.670  3.952   1.00 28.34 ? 194 ASN A CA  1 
ATOM   76   C  C   . ASN A 1 13  ? 34.947 37.507  4.935   1.00 27.88 ? 194 ASN A C   1 
ATOM   77   O  O   . ASN A 1 13  ? 34.021 37.519  5.760   1.00 27.36 ? 194 ASN A O   1 
ATOM   78   C  CB  . ASN A 1 13  ? 34.915 40.036  4.598   1.00 28.13 ? 194 ASN A CB  1 
ATOM   79   C  CG  . ASN A 1 13  ? 35.895 40.329  5.708   1.00 30.79 ? 194 ASN A CG  1 
ATOM   80   O  OD1 . ASN A 1 13  ? 35.705 41.304  6.435   1.00 34.68 ? 194 ASN A OD1 1 
ATOM   81   N  ND2 . ASN A 1 13  ? 36.922 39.490  5.870   1.00 30.28 ? 194 ASN A ND2 1 
ATOM   82   N  N   . PHE A 1 14  ? 35.807 36.489  4.817   1.00 27.35 ? 195 PHE A N   1 
ATOM   83   C  CA  . PHE A 1 14  ? 35.784 35.323  5.713   1.00 28.20 ? 195 PHE A CA  1 
ATOM   84   C  C   . PHE A 1 14  ? 36.481 35.668  7.033   1.00 29.31 ? 195 PHE A C   1 
ATOM   85   O  O   . PHE A 1 14  ? 37.685 36.003  7.047   1.00 30.30 ? 195 PHE A O   1 
ATOM   86   C  CB  . PHE A 1 14  ? 36.473 34.122  5.079   1.00 28.07 ? 195 PHE A CB  1 
ATOM   87   C  CG  . PHE A 1 14  ? 35.688 33.450  3.973   1.00 28.35 ? 195 PHE A CG  1 
ATOM   88   C  CD1 . PHE A 1 14  ? 35.714 33.951  2.662   1.00 27.24 ? 195 PHE A CD1 1 
ATOM   89   C  CD2 . PHE A 1 14  ? 34.954 32.289  4.235   1.00 26.55 ? 195 PHE A CD2 1 
ATOM   90   C  CE1 . PHE A 1 14  ? 35.018 33.297  1.640   1.00 28.51 ? 195 PHE A CE1 1 
ATOM   91   C  CE2 . PHE A 1 14  ? 34.251 31.642  3.222   1.00 25.79 ? 195 PHE A CE2 1 
ATOM   92   C  CZ  . PHE A 1 14  ? 34.292 32.148  1.918   1.00 27.06 ? 195 PHE A CZ  1 
ATOM   93   N  N   . LEU A 1 15  ? 35.748 35.602  8.130   1.00 29.47 ? 196 LEU A N   1 
ATOM   94   C  CA  . LEU A 1 15  ? 36.268 36.090  9.398   1.00 30.23 ? 196 LEU A CA  1 
ATOM   95   C  C   . LEU A 1 15  ? 36.801 34.989  10.256  1.00 30.71 ? 196 LEU A C   1 
ATOM   96   O  O   . LEU A 1 15  ? 37.923 35.066  10.747  1.00 30.90 ? 196 LEU A O   1 
ATOM   97   C  CB  . LEU A 1 15  ? 35.229 36.881  10.178  1.00 30.20 ? 196 LEU A CB  1 
ATOM   98   C  CG  . LEU A 1 15  ? 35.047 38.377  9.936   1.00 31.63 ? 196 LEU A CG  1 
ATOM   99   C  CD1 . LEU A 1 15  ? 34.864 38.709  8.481   1.00 35.81 ? 196 LEU A CD1 1 
ATOM   100  C  CD2 . LEU A 1 15  ? 33.861 38.855  10.733  1.00 32.76 ? 196 LEU A CD2 1 
ATOM   101  N  N   . THR A 1 16  ? 35.993 33.957  10.462  1.00 30.08 ? 197 THR A N   1 
ATOM   102  C  CA  . THR A 1 16  ? 36.385 32.864  11.316  1.00 29.40 ? 197 THR A CA  1 
ATOM   103  C  C   . THR A 1 16  ? 35.631 31.578  10.964  1.00 27.51 ? 197 THR A C   1 
ATOM   104  O  O   . THR A 1 16  ? 34.436 31.619  10.641  1.00 26.73 ? 197 THR A O   1 
ATOM   105  C  CB  . THR A 1 16  ? 36.273 33.274  12.821  1.00 29.88 ? 197 THR A CB  1 
ATOM   106  O  OG1 . THR A 1 16  ? 36.739 32.216  13.665  1.00 34.13 ? 197 THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 16  ? 34.874 33.668  13.218  1.00 31.13 ? 197 THR A CG2 1 
ATOM   108  N  N   . LYS A 1 17  ? 36.329 30.451  11.002  1.00 25.02 ? 198 LYS A N   1 
ATOM   109  C  CA  . LYS A 1 17  ? 35.719 29.171  10.683  1.00 23.51 ? 198 LYS A CA  1 
ATOM   110  C  C   . LYS A 1 17  ? 34.950 28.604  11.868  1.00 23.42 ? 198 LYS A C   1 
ATOM   111  O  O   . LYS A 1 17  ? 35.460 28.489  12.981  1.00 22.44 ? 198 LYS A O   1 
ATOM   112  C  CB  . LYS A 1 17  ? 36.754 28.169  10.169  1.00 23.59 ? 198 LYS A CB  1 
ATOM   113  C  CG  . LYS A 1 17  ? 36.159 26.899  9.611   1.00 23.12 ? 198 LYS A CG  1 
ATOM   114  C  CD  . LYS A 1 17  ? 37.227 26.003  9.007   1.00 21.72 ? 198 LYS A CD  1 
ATOM   115  C  CE  . LYS A 1 17  ? 36.675 25.033  7.989   1.00 19.94 ? 198 LYS A CE  1 
ATOM   116  N  NZ  . LYS A 1 17  ? 37.693 24.199  7.312   1.00 16.25 ? 198 LYS A NZ  1 
ATOM   117  N  N   . LEU A 1 18  ? 33.715 28.178  11.607  1.00 20.84 ? 199 LEU A N   1 
ATOM   118  C  CA  . LEU A 1 18  ? 32.810 27.805  12.683  1.00 21.01 ? 199 LEU A CA  1 
ATOM   119  C  C   . LEU A 1 18  ? 32.652 26.313  12.804  1.00 21.82 ? 199 LEU A C   1 
ATOM   120  O  O   . LEU A 1 18  ? 32.538 25.781  13.925  1.00 22.80 ? 199 LEU A O   1 
ATOM   121  C  CB  . LEU A 1 18  ? 31.427 28.446  12.442  1.00 19.18 ? 199 LEU A CB  1 
ATOM   122  C  CG  . LEU A 1 18  ? 31.256 29.959  12.465  1.00 19.57 ? 199 LEU A CG  1 
ATOM   123  C  CD1 . LEU A 1 18  ? 29.770 30.283  12.085  1.00 19.00 ? 199 LEU A CD1 1 
ATOM   124  C  CD2 . LEU A 1 18  ? 31.592 30.574  13.819  1.00 21.80 ? 199 LEU A CD2 1 
ATOM   125  N  N   . ASN A 1 19  ? 32.602 25.616  11.665  1.00 22.37 ? 200 ASN A N   1 
ATOM   126  C  CA  . ASN A 1 19  ? 32.530 24.166  11.664  1.00 23.27 ? 200 ASN A CA  1 
ATOM   127  C  C   . ASN A 1 19  ? 32.947 23.540  10.339  1.00 22.65 ? 200 ASN A C   1 
ATOM   128  O  O   . ASN A 1 19  ? 33.051 24.238  9.318   1.00 21.27 ? 200 ASN A O   1 
ATOM   129  C  CB  . ASN A 1 19  ? 31.152 23.667  12.186  1.00 25.02 ? 200 ASN A CB  1 
ATOM   130  C  CG  . ASN A 1 19  ? 30.226 23.204  11.084  1.00 29.91 ? 200 ASN A CG  1 
ATOM   131  O  OD1 . ASN A 1 19  ? 30.084 23.864  10.068  1.00 36.75 ? 200 ASN A OD1 1 
ATOM   132  N  ND2 . ASN A 1 19  ? 29.593 22.041  11.281  1.00 37.41 ? 200 ASN A ND2 1 
ATOM   133  N  N   . GLU A 1 20  ? 33.242 22.241  10.378  1.00 22.57 ? 201 GLU A N   1 
ATOM   134  C  CA  . GLU A 1 20  ? 33.465 21.436  9.175   1.00 23.11 ? 201 GLU A CA  1 
ATOM   135  C  C   . GLU A 1 20  ? 32.986 20.011  9.407   1.00 25.20 ? 201 GLU A C   1 
ATOM   136  O  O   . GLU A 1 20  ? 33.190 19.427  10.487  1.00 24.71 ? 201 GLU A O   1 
ATOM   137  C  CB  . GLU A 1 20  ? 34.945 21.424  8.739   1.00 23.57 ? 201 GLU A CB  1 
ATOM   138  C  CG  . GLU A 1 20  ? 35.915 21.228  9.883   1.00 22.67 ? 201 GLU A CG  1 
ATOM   139  C  CD  . GLU A 1 20  ? 37.388 21.220  9.470   1.00 22.94 ? 201 GLU A CD  1 
ATOM   140  O  OE1 . GLU A 1 20  ? 37.756 21.894  8.505   1.00 26.49 ? 201 GLU A OE1 1 
ATOM   141  O  OE2 . GLU A 1 20  ? 38.186 20.555  10.154  1.00 20.28 ? 201 GLU A OE2 1 
ATOM   142  N  N   . ASN A 1 21  ? 32.345 19.452  8.389   1.00 25.73 ? 202 ASN A N   1 
ATOM   143  C  CA  . ASN A 1 21  ? 31.849 18.082  8.470   1.00 28.28 ? 202 ASN A CA  1 
ATOM   144  C  C   . ASN A 1 21  ? 31.605 17.489  7.093   1.00 28.72 ? 202 ASN A C   1 
ATOM   145  O  O   . ASN A 1 21  ? 32.139 18.000  6.099   1.00 29.11 ? 202 ASN A O   1 
ATOM   146  C  CB  . ASN A 1 21  ? 30.589 18.029  9.324   1.00 28.25 ? 202 ASN A CB  1 
ATOM   147  C  CG  . ASN A 1 21  ? 29.421 18.757  8.706   1.00 29.79 ? 202 ASN A CG  1 
ATOM   148  O  OD1 . ASN A 1 21  ? 29.422 19.121  7.513   1.00 30.00 ? 202 ASN A OD1 1 
ATOM   149  N  ND2 . ASN A 1 21  ? 28.389 18.941  9.502   1.00 32.04 ? 202 ASN A ND2 1 
ATOM   150  N  N   . HIS A 1 22  ? 30.808 16.413  7.044   1.00 29.78 ? 203 HIS A N   1 
ATOM   151  C  CA  . HIS A 1 22  ? 30.521 15.665  5.808   1.00 29.83 ? 203 HIS A CA  1 
ATOM   152  C  C   . HIS A 1 22  ? 30.044 16.568  4.640   1.00 29.90 ? 203 HIS A C   1 
ATOM   153  O  O   . HIS A 1 22  ? 30.447 16.390  3.480   1.00 31.51 ? 203 HIS A O   1 
ATOM   154  C  CB  . HIS A 1 22  ? 29.481 14.550  6.095   1.00 30.44 ? 203 HIS A CB  1 
ATOM   155  C  CG  . HIS A 1 22  ? 28.179 15.067  6.623   1.00 29.65 ? 203 HIS A CG  1 
ATOM   156  N  ND1 . HIS A 1 22  ? 27.950 15.271  7.967   1.00 33.05 ? 203 HIS A ND1 1 
ATOM   157  C  CD2 . HIS A 1 22  ? 27.064 15.485  5.987   1.00 29.80 ? 203 HIS A CD2 1 
ATOM   158  C  CE1 . HIS A 1 22  ? 26.743 15.779  8.138   1.00 31.33 ? 203 HIS A CE1 1 
ATOM   159  N  NE2 . HIS A 1 22  ? 26.191 15.936  6.950   1.00 31.76 ? 203 HIS A NE2 1 
ATOM   160  N  N   . SER A 1 23  ? 29.199 17.544  4.949   1.00 29.25 ? 204 SER A N   1 
ATOM   161  C  CA  . SER A 1 23  ? 28.560 18.338  3.904   1.00 28.01 ? 204 SER A CA  1 
ATOM   162  C  C   . SER A 1 23  ? 29.404 19.532  3.443   1.00 26.48 ? 204 SER A C   1 
ATOM   163  O  O   . SER A 1 23  ? 29.083 20.150  2.439   1.00 25.62 ? 204 SER A O   1 
ATOM   164  C  CB  . SER A 1 23  ? 27.206 18.850  4.381   1.00 28.87 ? 204 SER A CB  1 
ATOM   165  O  OG  . SER A 1 23  ? 27.374 19.920  5.301   1.00 30.73 ? 204 SER A OG  1 
ATOM   166  N  N   . GLY A 1 24  ? 30.422 19.905  4.228   1.00 24.21 ? 205 GLY A N   1 
ATOM   167  C  CA  . GLY A 1 24  ? 31.287 21.038  3.863   1.00 21.08 ? 205 GLY A CA  1 
ATOM   168  C  C   . GLY A 1 24  ? 31.720 21.810  5.101   1.00 20.67 ? 205 GLY A C   1 
ATOM   169  O  O   . GLY A 1 24  ? 32.043 21.207  6.143   1.00 19.51 ? 205 GLY A O   1 
ATOM   170  N  N   . GLU A 1 25  ? 31.690 23.138  5.013   1.00 19.04 ? 206 GLU A N   1 
ATOM   171  C  CA  . GLU A 1 25  ? 32.166 23.952  6.123   1.00 19.49 ? 206 GLU A CA  1 
ATOM   172  C  C   . GLU A 1 25  ? 31.321 25.208  6.318   1.00 19.13 ? 206 GLU A C   1 
ATOM   173  O  O   . GLU A 1 25  ? 30.656 25.669  5.380   1.00 18.86 ? 206 GLU A O   1 
ATOM   174  C  CB  . GLU A 1 25  ? 33.652 24.287  5.990   1.00 20.45 ? 206 GLU A CB  1 
ATOM   175  C  CG  . GLU A 1 25  ? 34.090 24.652  4.670   1.00 24.08 ? 206 GLU A CG  1 
ATOM   176  C  CD  . GLU A 1 25  ? 35.608 24.869  4.559   1.00 26.86 ? 206 GLU A CD  1 
ATOM   177  O  OE1 . GLU A 1 25  ? 36.441 23.956  4.807   1.00 24.88 ? 206 GLU A OE1 1 
ATOM   178  O  OE2 . GLU A 1 25  ? 35.951 25.983  4.171   1.00 27.96 ? 206 GLU A OE2 1 
ATOM   179  N  N   . LEU A 1 26  ? 31.344 25.747  7.532   1.00 18.44 ? 207 LEU A N   1 
ATOM   180  C  CA  . LEU A 1 26  ? 30.611 26.953  7.826   1.00 17.94 ? 207 LEU A CA  1 
ATOM   181  C  C   . LEU A 1 26  ? 31.567 27.978  8.411   1.00 18.24 ? 207 LEU A C   1 
ATOM   182  O  O   . LEU A 1 26  ? 32.361 27.664  9.312   1.00 18.09 ? 207 LEU A O   1 
ATOM   183  C  CB  . LEU A 1 26  ? 29.482 26.666  8.816   1.00 18.80 ? 207 LEU A CB  1 
ATOM   184  C  CG  . LEU A 1 26  ? 28.426 27.767  8.998   1.00 21.18 ? 207 LEU A CG  1 
ATOM   185  C  CD1 . LEU A 1 26  ? 27.523 27.885  7.753   1.00 21.67 ? 207 LEU A CD1 1 
ATOM   186  C  CD2 . LEU A 1 26  ? 27.554 27.384  10.186  1.00 22.96 ? 207 LEU A CD2 1 
ATOM   187  N  N   . TRP A 1 27  ? 31.493 29.182  7.872   1.00 17.97 ? 208 TRP A N   1 
ATOM   188  C  CA  . TRP A 1 27  ? 32.290 30.325  8.323   1.00 18.96 ? 208 TRP A CA  1 
ATOM   189  C  C   . TRP A 1 27  ? 31.427 31.482  8.778   1.00 20.12 ? 208 TRP A C   1 
ATOM   190  O  O   . TRP A 1 27  ? 30.311 31.719  8.248   1.00 21.52 ? 208 TRP A O   1 
ATOM   191  C  CB  . TRP A 1 27  ? 33.171 30.837  7.178   1.00 19.03 ? 208 TRP A CB  1 
ATOM   192  C  CG  . TRP A 1 27  ? 34.178 29.889  6.677   1.00 18.99 ? 208 TRP A CG  1 
ATOM   193  C  CD1 . TRP A 1 27  ? 33.986 28.750  5.942   1.00 19.94 ? 208 TRP A CD1 1 
ATOM   194  C  CD2 . TRP A 1 27  ? 35.580 30.027  6.850   1.00 19.37 ? 208 TRP A CD2 1 
ATOM   195  N  NE1 . TRP A 1 27  ? 35.190 28.153  5.663   1.00 19.43 ? 208 TRP A NE1 1 
ATOM   196  C  CE2 . TRP A 1 27  ? 36.192 28.918  6.210   1.00 20.85 ? 208 TRP A CE2 1 
ATOM   197  C  CE3 . TRP A 1 27  ? 36.376 30.964  7.506   1.00 20.04 ? 208 TRP A CE3 1 
ATOM   198  C  CZ2 . TRP A 1 27  ? 37.583 28.733  6.208   1.00 21.06 ? 208 TRP A CZ2 1 
ATOM   199  C  CZ3 . TRP A 1 27  ? 37.754 30.786  7.495   1.00 20.78 ? 208 TRP A CZ3 1 
ATOM   200  C  CH2 . TRP A 1 27  ? 38.337 29.676  6.860   1.00 18.72 ? 208 TRP A CH2 1 
ATOM   201  N  N   . LYS A 1 28  ? 31.935 32.248  9.740   1.00 19.27 ? 209 LYS A N   1 
ATOM   202  C  CA  . LYS A 1 28  ? 31.356 33.533  10.022  1.00 20.31 ? 209 LYS A CA  1 
ATOM   203  C  C   . LYS A 1 28  ? 32.101 34.528  9.147   1.00 20.41 ? 209 LYS A C   1 
ATOM   204  O  O   . LYS A 1 28  ? 33.335 34.400  8.935   1.00 21.37 ? 209 LYS A O   1 
ATOM   205  C  CB  . LYS A 1 28  ? 31.463 33.878  11.520  1.00 20.15 ? 209 LYS A CB  1 
ATOM   206  C  CG  . LYS A 1 28  ? 30.765 35.178  11.973  1.00 19.87 ? 209 LYS A CG  1 
ATOM   207  C  CD  . LYS A 1 28  ? 30.895 35.319  13.522  1.00 22.06 ? 209 LYS A CD  1 
ATOM   208  C  CE  . LYS A 1 28  ? 30.280 36.627  14.107  1.00 23.68 ? 209 LYS A CE  1 
ATOM   209  N  NZ  . LYS A 1 28  ? 30.845 37.886  13.579  1.00 28.34 ? 209 LYS A NZ  1 
ATOM   210  N  N   . GLY A 1 29  ? 31.374 35.505  8.636   1.00 19.30 ? 210 GLY A N   1 
ATOM   211  C  CA  . GLY A 1 29  ? 31.930 36.443  7.691   1.00 20.70 ? 210 GLY A CA  1 
ATOM   212  C  C   . GLY A 1 29  ? 31.173 37.759  7.562   1.00 21.12 ? 210 GLY A C   1 
ATOM   213  O  O   . GLY A 1 29  ? 30.267 38.087  8.358   1.00 21.04 ? 210 GLY A O   1 
ATOM   214  N  N   . ARG A 1 30  ? 31.557 38.527  6.552   1.00 21.10 ? 211 ARG A N   1 
ATOM   215  C  CA  . ARG A 1 30  ? 30.936 39.808  6.282   1.00 22.74 ? 211 ARG A CA  1 
ATOM   216  C  C   . ARG A 1 30  ? 30.803 39.995  4.777   1.00 22.72 ? 211 ARG A C   1 
ATOM   217  O  O   . ARG A 1 30  ? 31.674 39.531  4.013   1.00 22.79 ? 211 ARG A O   1 
ATOM   218  C  CB  . ARG A 1 30  ? 31.770 40.947  6.883   1.00 23.97 ? 211 ARG A CB  1 
ATOM   219  C  CG  . ARG A 1 30  ? 31.798 40.984  8.378   1.00 25.70 ? 211 ARG A CG  1 
ATOM   220  C  CD  . ARG A 1 30  ? 32.284 42.332  8.862   1.00 32.93 ? 211 ARG A CD  1 
ATOM   221  N  NE  . ARG A 1 30  ? 31.413 43.375  8.339   1.00 34.96 ? 211 ARG A NE  1 
ATOM   222  C  CZ  . ARG A 1 30  ? 30.371 43.893  8.982   1.00 37.21 ? 211 ARG A CZ  1 
ATOM   223  N  NH1 . ARG A 1 30  ? 30.059 43.477  10.201  1.00 39.04 ? 211 ARG A NH1 1 
ATOM   224  N  NH2 . ARG A 1 30  ? 29.643 44.839  8.404   1.00 35.65 ? 211 ARG A NH2 1 
ATOM   225  N  N   . TRP A 1 31  ? 29.717 40.659  4.371   1.00 24.05 ? 212 TRP A N   1 
ATOM   226  C  CA  . TRP A 1 31  ? 29.420 40.927  2.963   1.00 25.25 ? 212 TRP A CA  1 
ATOM   227  C  C   . TRP A 1 31  ? 28.460 42.082  2.818   1.00 25.89 ? 212 TRP A C   1 
ATOM   228  O  O   . TRP A 1 31  ? 27.356 42.050  3.364   1.00 26.25 ? 212 TRP A O   1 
ATOM   229  C  CB  . TRP A 1 31  ? 28.859 39.683  2.252   1.00 25.03 ? 212 TRP A CB  1 
ATOM   230  C  CG  . TRP A 1 31  ? 28.333 39.953  0.828   1.00 25.20 ? 212 TRP A CG  1 
ATOM   231  C  CD1 . TRP A 1 31  ? 29.087 40.116  -0.296  1.00 25.40 ? 212 TRP A CD1 1 
ATOM   232  C  CD2 . TRP A 1 31  ? 26.964 40.108  0.416   1.00 25.44 ? 212 TRP A CD2 1 
ATOM   233  N  NE1 . TRP A 1 31  ? 28.282 40.339  -1.384  1.00 24.65 ? 212 TRP A NE1 1 
ATOM   234  C  CE2 . TRP A 1 31  ? 26.976 40.359  -0.980  1.00 25.33 ? 212 TRP A CE2 1 
ATOM   235  C  CE3 . TRP A 1 31  ? 25.732 40.061  1.085   1.00 24.85 ? 212 TRP A CE3 1 
ATOM   236  C  CZ2 . TRP A 1 31  ? 25.805 40.552  -1.721  1.00 26.17 ? 212 TRP A CZ2 1 
ATOM   237  C  CZ3 . TRP A 1 31  ? 24.543 40.270  0.334   1.00 26.89 ? 212 TRP A CZ3 1 
ATOM   238  C  CH2 . TRP A 1 31  ? 24.599 40.501  -1.049  1.00 25.24 ? 212 TRP A CH2 1 
ATOM   239  N  N   . GLN A 1 32  ? 28.874 43.116  2.073   1.00 26.90 ? 213 GLN A N   1 
ATOM   240  C  CA  . GLN A 1 32  ? 27.999 44.267  1.780   1.00 26.90 ? 213 GLN A CA  1 
ATOM   241  C  C   . GLN A 1 32  ? 27.267 44.836  3.013   1.00 26.31 ? 213 GLN A C   1 
ATOM   242  O  O   . GLN A 1 32  ? 26.061 45.144  2.979   1.00 27.07 ? 213 GLN A O   1 
ATOM   243  C  CB  . GLN A 1 32  ? 27.064 43.953  0.598   1.00 27.51 ? 213 GLN A CB  1 
ATOM   244  C  CG  . GLN A 1 32  ? 27.878 43.941  -0.712  1.00 30.51 ? 213 GLN A CG  1 
ATOM   245  C  CD  . GLN A 1 32  ? 27.071 43.772  -1.973  1.00 33.94 ? 213 GLN A CD  1 
ATOM   246  O  OE1 . GLN A 1 32  ? 27.604 43.320  -3.000  1.00 36.17 ? 213 GLN A OE1 1 
ATOM   247  N  NE2 . GLN A 1 32  ? 25.803 44.132  -1.929  1.00 31.88 ? 213 GLN A NE2 1 
ATOM   248  N  N   . GLY A 1 33  ? 28.015 44.979  4.100   1.00 25.32 ? 214 GLY A N   1 
ATOM   249  C  CA  . GLY A 1 33  ? 27.491 45.548  5.331   1.00 25.72 ? 214 GLY A CA  1 
ATOM   250  C  C   . GLY A 1 33  ? 26.636 44.604  6.161   1.00 25.58 ? 214 GLY A C   1 
ATOM   251  O  O   . GLY A 1 33  ? 25.950 45.035  7.105   1.00 25.92 ? 214 GLY A O   1 
ATOM   252  N  N   . ASN A 1 34  ? 26.712 43.319  5.830   1.00 23.99 ? 215 ASN A N   1 
ATOM   253  C  CA  . ASN A 1 34  ? 26.004 42.270  6.565   1.00 23.85 ? 215 ASN A CA  1 
ATOM   254  C  C   . ASN A 1 34  ? 26.931 41.343  7.350   1.00 22.51 ? 215 ASN A C   1 
ATOM   255  O  O   . ASN A 1 34  ? 27.942 40.913  6.829   1.00 22.69 ? 215 ASN A O   1 
ATOM   256  C  CB  . ASN A 1 34  ? 25.225 41.415  5.563   1.00 23.27 ? 215 ASN A CB  1 
ATOM   257  C  CG  . ASN A 1 34  ? 24.185 42.204  4.812   1.00 25.14 ? 215 ASN A CG  1 
ATOM   258  O  OD1 . ASN A 1 34  ? 23.257 42.734  5.403   1.00 28.92 ? 215 ASN A OD1 1 
ATOM   259  N  ND2 . ASN A 1 34  ? 24.302 42.235  3.500   1.00 24.89 ? 215 ASN A ND2 1 
ATOM   260  N  N   . ASP A 1 35  ? 26.574 41.022  8.598   1.00 21.37 ? 216 ASP A N   1 
ATOM   261  C  CA  . ASP A 1 35  ? 27.206 39.904  9.285   1.00 20.74 ? 216 ASP A CA  1 
ATOM   262  C  C   . ASP A 1 35  ? 26.522 38.629  8.778   1.00 18.68 ? 216 ASP A C   1 
ATOM   263  O  O   . ASP A 1 35  ? 25.309 38.517  8.857   1.00 18.18 ? 216 ASP A O   1 
ATOM   264  C  CB  . ASP A 1 35  ? 27.022 39.996  10.803  1.00 21.68 ? 216 ASP A CB  1 
ATOM   265  C  CG  . ASP A 1 35  ? 27.762 41.180  11.406  1.00 26.09 ? 216 ASP A CG  1 
ATOM   266  O  OD1 . ASP A 1 35  ? 28.947 41.362  11.069  1.00 27.88 ? 216 ASP A OD1 1 
ATOM   267  O  OD2 . ASP A 1 35  ? 27.157 41.901  12.216  1.00 31.28 ? 216 ASP A OD2 1 
ATOM   268  N  N   . ILE A 1 36  ? 27.318 37.706  8.261   1.00 18.33 ? 217 ILE A N   1 
ATOM   269  C  CA  . ILE A 1 36  ? 26.826 36.536  7.561   1.00 17.57 ? 217 ILE A CA  1 
ATOM   270  C  C   . ILE A 1 36  ? 27.459 35.225  8.034   1.00 17.44 ? 217 ILE A C   1 
ATOM   271  O  O   . ILE A 1 36  ? 28.515 35.181  8.692   1.00 14.65 ? 217 ILE A O   1 
ATOM   272  C  CB  . ILE A 1 36  ? 27.000 36.658  6.012   1.00 17.94 ? 217 ILE A CB  1 
ATOM   273  C  CG1 . ILE A 1 36  ? 28.484 36.836  5.635   1.00 18.90 ? 217 ILE A CG1 1 
ATOM   274  C  CG2 . ILE A 1 36  ? 26.081 37.757  5.446   1.00 16.44 ? 217 ILE A CG2 1 
ATOM   275  C  CD1 . ILE A 1 36  ? 28.837 36.416  4.236   1.00 21.26 ? 217 ILE A CD1 1 
ATOM   276  N  N   . VAL A 1 37  ? 26.804 34.130  7.694   1.00 15.65 ? 218 VAL A N   1 
ATOM   277  C  CA  . VAL A 1 37  ? 27.473 32.850  7.721   1.00 15.69 ? 218 VAL A CA  1 
ATOM   278  C  C   . VAL A 1 37  ? 27.573 32.369  6.291   1.00 16.64 ? 218 VAL A C   1 
ATOM   279  O  O   . VAL A 1 37  ? 26.650 32.565  5.481   1.00 16.07 ? 218 VAL A O   1 
ATOM   280  C  CB  . VAL A 1 37  ? 26.817 31.822  8.618   1.00 16.26 ? 218 VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 37  ? 26.965 32.227  10.067  1.00 16.23 ? 218 VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 37  ? 25.328 31.629  8.300   1.00 15.84 ? 218 VAL A CG2 1 
ATOM   283  N  N   . VAL A 1 38  ? 28.705 31.775  5.981   1.00 16.67 ? 219 VAL A N   1 
ATOM   284  C  CA  . VAL A 1 38  ? 29.006 31.243  4.652   1.00 16.61 ? 219 VAL A CA  1 
ATOM   285  C  C   . VAL A 1 38  ? 29.031 29.736  4.737   1.00 16.88 ? 219 VAL A C   1 
ATOM   286  O  O   . VAL A 1 38  ? 29.858 29.139  5.454   1.00 17.87 ? 219 VAL A O   1 
ATOM   287  C  CB  . VAL A 1 38  ? 30.394 31.702  4.095   1.00 17.17 ? 219 VAL A CB  1 
ATOM   288  C  CG1 . VAL A 1 38  ? 30.555 31.234  2.639   1.00 16.93 ? 219 VAL A CG1 1 
ATOM   289  C  CG2 . VAL A 1 38  ? 30.600 33.237  4.198   1.00 16.81 ? 219 VAL A CG2 1 
ATOM   290  N  N   . LYS A 1 39  ? 28.149 29.088  3.983   1.00 16.27 ? 220 LYS A N   1 
ATOM   291  C  CA  . LYS A 1 39  ? 28.091 27.660  3.949   1.00 16.70 ? 220 LYS A CA  1 
ATOM   292  C  C   . LYS A 1 39  ? 28.701 27.174  2.634   1.00 17.10 ? 220 LYS A C   1 
ATOM   293  O  O   . LYS A 1 39  ? 28.205 27.444  1.541   1.00 15.83 ? 220 LYS A O   1 
ATOM   294  C  CB  . LYS A 1 39  ? 26.628 27.210  4.133   1.00 18.46 ? 220 LYS A CB  1 
ATOM   295  C  CG  . LYS A 1 39  ? 26.416 25.737  4.117   1.00 22.53 ? 220 LYS A CG  1 
ATOM   296  C  CD  . LYS A 1 39  ? 24.920 25.455  4.378   1.00 27.51 ? 220 LYS A CD  1 
ATOM   297  C  CE  . LYS A 1 39  ? 24.649 23.959  4.254   1.00 33.73 ? 220 LYS A CE  1 
ATOM   298  N  NZ  . LYS A 1 39  ? 23.197 23.628  4.373   1.00 34.24 ? 220 LYS A NZ  1 
ATOM   299  N  N   . VAL A 1 40  ? 29.835 26.503  2.751   1.00 16.05 ? 221 VAL A N   1 
ATOM   300  C  CA  . VAL A 1 40  ? 30.598 26.032  1.592   1.00 17.58 ? 221 VAL A CA  1 
ATOM   301  C  C   . VAL A 1 40  ? 30.303 24.550  1.430   1.00 18.44 ? 221 VAL A C   1 
ATOM   302  O  O   . VAL A 1 40  ? 30.581 23.747  2.337   1.00 18.71 ? 221 VAL A O   1 
ATOM   303  C  CB  . VAL A 1 40  ? 32.137 26.232  1.808   1.00 17.67 ? 221 VAL A CB  1 
ATOM   304  C  CG1 . VAL A 1 40  ? 32.890 25.707  0.588   1.00 19.20 ? 221 VAL A CG1 1 
ATOM   305  C  CG2 . VAL A 1 40  ? 32.438 27.693  2.088   1.00 18.09 ? 221 VAL A CG2 1 
ATOM   306  N  N   . LEU A 1 41  ? 29.720 24.171  0.291   1.00 17.86 ? 222 LEU A N   1 
ATOM   307  C  CA  . LEU A 1 41  ? 29.254 22.800  0.122   1.00 19.23 ? 222 LEU A CA  1 
ATOM   308  C  C   . LEU A 1 41  ? 30.318 21.900  -0.495  1.00 21.47 ? 222 LEU A C   1 
ATOM   309  O  O   . LEU A 1 41  ? 30.852 22.227  -1.546  1.00 22.72 ? 222 LEU A O   1 
ATOM   310  C  CB  . LEU A 1 41  ? 27.956 22.754  -0.717  1.00 18.30 ? 222 LEU A CB  1 
ATOM   311  C  CG  . LEU A 1 41  ? 26.765 23.472  -0.102  1.00 19.95 ? 222 LEU A CG  1 
ATOM   312  C  CD1 . LEU A 1 41  ? 25.634 23.639  -1.149  1.00 22.48 ? 222 LEU A CD1 1 
ATOM   313  C  CD2 . LEU A 1 41  ? 26.263 22.690  1.141   1.00 22.73 ? 222 LEU A CD2 1 
ATOM   314  N  N   . LYS A 1 42  ? 30.612 20.772  0.161   1.00 22.87 ? 223 LYS A N   1 
ATOM   315  C  CA  . LYS A 1 42  ? 31.558 19.804  -0.392  1.00 25.18 ? 223 LYS A CA  1 
ATOM   316  C  C   . LYS A 1 42  ? 30.768 18.751  -1.148  1.00 23.72 ? 223 LYS A C   1 
ATOM   317  O  O   . LYS A 1 42  ? 29.802 18.163  -0.629  1.00 24.97 ? 223 LYS A O   1 
ATOM   318  C  CB  . LYS A 1 42  ? 32.456 19.183  0.705   1.00 27.53 ? 223 LYS A CB  1 
ATOM   319  C  CG  . LYS A 1 42  ? 33.804 19.949  0.940   1.00 31.12 ? 223 LYS A CG  1 
ATOM   320  C  CD  . LYS A 1 42  ? 33.760 21.486  0.693   1.00 35.74 ? 223 LYS A CD  1 
ATOM   321  C  CE  . LYS A 1 42  ? 34.947 22.191  1.361   1.00 36.30 ? 223 LYS A CE  1 
ATOM   322  N  NZ  . LYS A 1 42  ? 35.525 23.332  0.518   1.00 41.43 ? 223 LYS A NZ  1 
ATOM   323  N  N   . VAL A 1 43  ? 31.121 18.609  -2.415  1.00 23.19 ? 224 VAL A N   1 
ATOM   324  C  CA  . VAL A 1 43  ? 30.418 17.717  -3.331  1.00 22.57 ? 224 VAL A CA  1 
ATOM   325  C  C   . VAL A 1 43  ? 31.412 16.902  -4.157  1.00 23.57 ? 224 VAL A C   1 
ATOM   326  O  O   . VAL A 1 43  ? 32.284 17.459  -4.839  1.00 25.44 ? 224 VAL A O   1 
ATOM   327  C  CB  . VAL A 1 43  ? 29.489 18.506  -4.305  1.00 21.39 ? 224 VAL A CB  1 
ATOM   328  C  CG1 . VAL A 1 43  ? 28.654 17.530  -5.176  1.00 21.89 ? 224 VAL A CG1 1 
ATOM   329  C  CG2 . VAL A 1 43  ? 28.580 19.461  -3.553  1.00 21.03 ? 224 VAL A CG2 1 
ATOM   330  N  N   . ARG A 1 44  ? 31.265 15.589  -4.101  1.00 24.38 ? 225 ARG A N   1 
ATOM   331  C  CA  . ARG A 1 44  ? 32.070 14.673  -4.899  1.00 25.55 ? 225 ARG A CA  1 
ATOM   332  C  C   . ARG A 1 44  ? 31.536 14.701  -6.338  1.00 24.52 ? 225 ARG A C   1 
ATOM   333  O  O   . ARG A 1 44  ? 30.331 14.763  -6.550  1.00 24.73 ? 225 ARG A O   1 
ATOM   334  C  CB  . ARG A 1 44  ? 31.921 13.266  -4.318  1.00 25.68 ? 225 ARG A CB  1 
ATOM   335  C  CG  . ARG A 1 44  ? 32.887 12.224  -4.869  1.00 28.19 ? 225 ARG A CG  1 
ATOM   336  C  CD  . ARG A 1 44  ? 33.015 10.989  -3.920  1.00 27.34 ? 225 ARG A CD  1 
ATOM   337  N  NE  . ARG A 1 44  ? 31.759 10.258  -3.771  1.00 32.63 ? 225 ARG A NE  1 
ATOM   338  C  CZ  . ARG A 1 44  ? 31.307 9.353   -4.640  1.00 33.88 ? 225 ARG A CZ  1 
ATOM   339  N  NH1 . ARG A 1 44  ? 32.005 9.067   -5.740  1.00 35.02 ? 225 ARG A NH1 1 
ATOM   340  N  NH2 . ARG A 1 44  ? 30.140 8.749   -4.426  1.00 36.07 ? 225 ARG A NH2 1 
ATOM   341  N  N   . ASP A 1 45  ? 32.427 14.651  -7.311  1.00 24.04 ? 226 ASP A N   1 
ATOM   342  C  CA  . ASP A 1 45  ? 32.020 14.531  -8.727  1.00 24.01 ? 226 ASP A CA  1 
ATOM   343  C  C   . ASP A 1 45  ? 31.135 15.718  -9.111  1.00 22.10 ? 226 ASP A C   1 
ATOM   344  O  O   . ASP A 1 45  ? 30.054 15.543  -9.655  1.00 21.99 ? 226 ASP A O   1 
ATOM   345  C  CB  . ASP A 1 45  ? 31.261 13.223  -8.990  1.00 24.44 ? 226 ASP A CB  1 
ATOM   346  C  CG  . ASP A 1 45  ? 32.150 11.982  -8.956  1.00 29.14 ? 226 ASP A CG  1 
ATOM   347  O  OD1 . ASP A 1 45  ? 33.383 12.089  -9.133  1.00 33.59 ? 226 ASP A OD1 1 
ATOM   348  O  OD2 . ASP A 1 45  ? 31.586 10.888  -8.779  1.00 31.22 ? 226 ASP A OD2 1 
ATOM   349  N  N   . TRP A 1 46  ? 31.597 16.924  -8.802  1.00 21.32 ? 227 TRP A N   1 
ATOM   350  C  CA  . TRP A 1 46  ? 30.902 18.152  -9.221  1.00 20.15 ? 227 TRP A CA  1 
ATOM   351  C  C   . TRP A 1 46  ? 30.871 18.196  -10.749 1.00 20.55 ? 227 TRP A C   1 
ATOM   352  O  O   . TRP A 1 46  ? 31.809 17.741  -11.416 1.00 20.82 ? 227 TRP A O   1 
ATOM   353  C  CB  . TRP A 1 46  ? 31.640 19.352  -8.707  1.00 19.67 ? 227 TRP A CB  1 
ATOM   354  C  CG  . TRP A 1 46  ? 30.950 20.681  -8.844  1.00 19.39 ? 227 TRP A CG  1 
ATOM   355  C  CD1 . TRP A 1 46  ? 31.452 21.780  -9.455  1.00 20.25 ? 227 TRP A CD1 1 
ATOM   356  C  CD2 . TRP A 1 46  ? 29.680 21.063  -8.304  1.00 16.77 ? 227 TRP A CD2 1 
ATOM   357  N  NE1 . TRP A 1 46  ? 30.582 22.844  -9.336  1.00 18.08 ? 227 TRP A NE1 1 
ATOM   358  C  CE2 . TRP A 1 46  ? 29.476 22.422  -8.647  1.00 18.64 ? 227 TRP A CE2 1 
ATOM   359  C  CE3 . TRP A 1 46  ? 28.669 20.381  -7.583  1.00 19.23 ? 227 TRP A CE3 1 
ATOM   360  C  CZ2 . TRP A 1 46  ? 28.318 23.132  -8.281  1.00 18.27 ? 227 TRP A CZ2 1 
ATOM   361  C  CZ3 . TRP A 1 46  ? 27.528 21.104  -7.196  1.00 18.05 ? 227 TRP A CZ3 1 
ATOM   362  C  CH2 . TRP A 1 46  ? 27.355 22.445  -7.568  1.00 18.22 ? 227 TRP A CH2 1 
ATOM   363  N  N   . SER A 1 47  ? 29.777 18.694  -11.309 1.00 18.13 ? 228 SER A N   1 
ATOM   364  C  CA  . SER A 1 47  ? 29.680 18.702  -12.762 1.00 16.51 ? 228 SER A CA  1 
ATOM   365  C  C   . SER A 1 47  ? 28.895 19.906  -13.197 1.00 15.83 ? 228 SER A C   1 
ATOM   366  O  O   . SER A 1 47  ? 28.288 20.594  -12.391 1.00 14.12 ? 228 SER A O   1 
ATOM   367  C  CB  . SER A 1 47  ? 28.904 17.494  -13.224 1.00 16.16 ? 228 SER A CB  1 
ATOM   368  O  OG  . SER A 1 47  ? 27.586 17.599  -12.739 1.00 17.03 ? 228 SER A OG  1 
ATOM   369  N  N   . THR A 1 48  ? 28.879 20.139  -14.505 1.00 14.81 ? 229 THR A N   1 
ATOM   370  C  CA  . THR A 1 48  ? 28.107 21.260  -15.031 1.00 15.53 ? 229 THR A CA  1 
ATOM   371  C  C   . THR A 1 48  ? 26.610 21.125  -14.726 1.00 14.02 ? 229 THR A C   1 
ATOM   372  O  O   . THR A 1 48  ? 25.953 22.124  -14.384 1.00 13.48 ? 229 THR A O   1 
ATOM   373  C  CB  . THR A 1 48  ? 28.374 21.407  -16.530 1.00 16.78 ? 229 THR A CB  1 
ATOM   374  O  OG1 . THR A 1 48  ? 29.780 21.647  -16.682 1.00 20.27 ? 229 THR A OG1 1 
ATOM   375  C  CG2 . THR A 1 48  ? 27.622 22.586  -17.067 1.00 16.90 ? 229 THR A CG2 1 
ATOM   376  N  N   . ARG A 1 49  ? 26.081 19.907  -14.834 1.00 13.47 ? 230 ARG A N   1 
ATOM   377  C  CA  . ARG A 1 49  ? 24.671 19.616  -14.568 1.00 13.02 ? 230 ARG A CA  1 
ATOM   378  C  C   . ARG A 1 49  ? 24.331 19.965  -13.110 1.00 13.37 ? 230 ARG A C   1 
ATOM   379  O  O   . ARG A 1 49  ? 23.311 20.593  -12.819 1.00 13.26 ? 230 ARG A O   1 
ATOM   380  C  CB  . ARG A 1 49  ? 24.397 18.135  -14.813 1.00 12.91 ? 230 ARG A CB  1 
ATOM   381  C  CG  . ARG A 1 49  ? 22.954 17.716  -14.580 1.00 14.66 ? 230 ARG A CG  1 
ATOM   382  C  CD  . ARG A 1 49  ? 22.762 16.247  -14.938 1.00 13.90 ? 230 ARG A CD  1 
ATOM   383  N  NE  . ARG A 1 49  ? 21.349 15.902  -14.990 1.00 19.17 ? 230 ARG A NE  1 
ATOM   384  C  CZ  . ARG A 1 49  ? 20.850 14.798  -15.552 1.00 22.30 ? 230 ARG A CZ  1 
ATOM   385  N  NH1 . ARG A 1 49  ? 21.665 13.916  -16.107 1.00 23.16 ? 230 ARG A NH1 1 
ATOM   386  N  NH2 . ARG A 1 49  ? 19.532 14.589  -15.566 1.00 23.11 ? 230 ARG A NH2 1 
ATOM   387  N  N   . LYS A 1 50  ? 25.195 19.541  -12.192 1.00 13.09 ? 231 LYS A N   1 
ATOM   388  C  CA  . LYS A 1 50  ? 24.978 19.864  -10.753 1.00 13.22 ? 231 LYS A CA  1 
ATOM   389  C  C   . LYS A 1 50  ? 25.067 21.344  -10.482 1.00 12.20 ? 231 LYS A C   1 
ATOM   390  O  O   . LYS A 1 50  ? 24.331 21.866  -9.633  1.00 12.60 ? 231 LYS A O   1 
ATOM   391  C  CB  . LYS A 1 50  ? 25.977 19.074  -9.851  1.00 12.56 ? 231 LYS A CB  1 
ATOM   392  C  CG  . LYS A 1 50  ? 25.699 17.573  -9.896  1.00 12.94 ? 231 LYS A CG  1 
ATOM   393  C  CD  . LYS A 1 50  ? 26.779 16.785  -9.059  1.00 15.04 ? 231 LYS A CD  1 
ATOM   394  C  CE  . LYS A 1 50  ? 26.500 15.301  -9.092  1.00 18.27 ? 231 LYS A CE  1 
ATOM   395  N  NZ  . LYS A 1 50  ? 27.569 14.556  -8.303  1.00 22.15 ? 231 LYS A NZ  1 
ATOM   396  N  N   . SER A 1 51  ? 26.016 22.035  -11.125 1.00 12.07 ? 232 SER A N   1 
ATOM   397  C  CA  . SER A 1 51  ? 26.178 23.474  -10.929 1.00 12.22 ? 232 SER A CA  1 
ATOM   398  C  C   . SER A 1 51  ? 24.908 24.188  -11.447 1.00 12.40 ? 232 SER A C   1 
ATOM   399  O  O   . SER A 1 51  ? 24.380 25.094  -10.786 1.00 11.59 ? 232 SER A O   1 
ATOM   400  C  CB  . SER A 1 51  ? 27.412 23.962  -11.677 1.00 11.40 ? 232 SER A CB  1 
ATOM   401  O  OG  . SER A 1 51  ? 27.638 25.341  -11.441 1.00 14.36 ? 232 SER A OG  1 
ATOM   402  N  N   . ARG A 1 52  ? 24.436 23.759  -12.627 1.00 11.68 ? 233 ARG A N   1 
ATOM   403  C  CA  . ARG A 1 52  ? 23.205 24.264  -13.195 1.00 11.96 ? 233 ARG A CA  1 
ATOM   404  C  C   . ARG A 1 52  ? 22.058 24.066  -12.196 1.00 11.27 ? 233 ARG A C   1 
ATOM   405  O  O   . ARG A 1 52  ? 21.353 25.018  -11.890 1.00 11.76 ? 233 ARG A O   1 
ATOM   406  C  CB  . ARG A 1 52  ? 22.894 23.575  -14.536 1.00 12.85 ? 233 ARG A CB  1 
ATOM   407  C  CG  . ARG A 1 52  ? 21.694 24.225  -15.312 1.00 12.99 ? 233 ARG A CG  1 
ATOM   408  C  CD  . ARG A 1 52  ? 20.300 23.793  -14.829 1.00 12.90 ? 233 ARG A CD  1 
ATOM   409  N  NE  . ARG A 1 52  ? 20.188 22.359  -14.648 1.00 13.42 ? 233 ARG A NE  1 
ATOM   410  C  CZ  . ARG A 1 52  ? 19.955 21.473  -15.619 1.00 14.75 ? 233 ARG A CZ  1 
ATOM   411  N  NH1 . ARG A 1 52  ? 19.804 21.883  -16.878 1.00 12.95 ? 233 ARG A NH1 1 
ATOM   412  N  NH2 . ARG A 1 52  ? 19.910 20.170  -15.330 1.00 14.77 ? 233 ARG A NH2 1 
ATOM   413  N  N   . ASP A 1 53  ? 21.935 22.866  -11.641 1.00 12.09 ? 234 ASP A N   1 
ATOM   414  C  CA  . ASP A 1 53  ? 20.833 22.543  -10.685 1.00 12.20 ? 234 ASP A CA  1 
ATOM   415  C  C   . ASP A 1 53  ? 20.962 23.427  -9.441  1.00 12.92 ? 234 ASP A C   1 
ATOM   416  O  O   . ASP A 1 53  ? 19.964 23.990  -8.954  1.00 12.38 ? 234 ASP A O   1 
ATOM   417  C  CB  . ASP A 1 53  ? 20.856 21.056  -10.315 1.00 13.28 ? 234 ASP A CB  1 
ATOM   418  C  CG  . ASP A 1 53  ? 20.503 20.144  -11.495 1.00 15.68 ? 234 ASP A CG  1 
ATOM   419  O  OD1 . ASP A 1 53  ? 19.853 20.628  -12.454 1.00 15.17 ? 234 ASP A OD1 1 
ATOM   420  O  OD2 . ASP A 1 53  ? 20.851 18.933  -11.428 1.00 17.35 ? 234 ASP A OD2 1 
ATOM   421  N  N   . PHE A 1 54  ? 22.190 23.617  -8.959  1.00 12.38 ? 235 PHE A N   1 
ATOM   422  C  CA  . PHE A 1 54  ? 22.388 24.481  -7.759  1.00 12.32 ? 235 PHE A CA  1 
ATOM   423  C  C   . PHE A 1 54  ? 21.857 25.887  -8.070  1.00 12.88 ? 235 PHE A C   1 
ATOM   424  O  O   . PHE A 1 54  ? 21.132 26.499  -7.276  1.00 12.20 ? 235 PHE A O   1 
ATOM   425  C  CB  . PHE A 1 54  ? 23.875 24.491  -7.413  1.00 12.24 ? 235 PHE A CB  1 
ATOM   426  C  CG  . PHE A 1 54  ? 24.241 25.344  -6.215  1.00 12.68 ? 235 PHE A CG  1 
ATOM   427  C  CD1 . PHE A 1 54  ? 23.721 25.058  -4.941  1.00 14.52 ? 235 PHE A CD1 1 
ATOM   428  C  CD2 . PHE A 1 54  ? 25.159 26.403  -6.357  1.00 10.67 ? 235 PHE A CD2 1 
ATOM   429  C  CE1 . PHE A 1 54  ? 24.106 25.855  -3.800  1.00 12.69 ? 235 PHE A CE1 1 
ATOM   430  C  CE2 . PHE A 1 54  ? 25.560 27.180  -5.250  1.00 13.95 ? 235 PHE A CE2 1 
ATOM   431  C  CZ  . PHE A 1 54  ? 25.022 26.911  -3.967  1.00 13.80 ? 235 PHE A CZ  1 
ATOM   432  N  N   . ASN A 1 55  ? 22.219 26.405  -9.252  1.00 12.59 ? 236 ASN A N   1 
ATOM   433  C  CA  . ASN A 1 55  ? 21.852 27.759  -9.590  1.00 13.14 ? 236 ASN A CA  1 
ATOM   434  C  C   . ASN A 1 55  ? 20.329 27.922  -9.798  1.00 12.72 ? 236 ASN A C   1 
ATOM   435  O  O   . ASN A 1 55  ? 19.817 29.030  -9.635  1.00 12.64 ? 236 ASN A O   1 
ATOM   436  C  CB  . ASN A 1 55  ? 22.613 28.225  -10.836 1.00 13.23 ? 236 ASN A CB  1 
ATOM   437  C  CG  . ASN A 1 55  ? 24.140 28.301  -10.606 1.00 14.18 ? 236 ASN A CG  1 
ATOM   438  O  OD1 . ASN A 1 55  ? 24.637 28.205  -9.456  1.00 14.29 ? 236 ASN A OD1 1 
ATOM   439  N  ND2 . ASN A 1 55  ? 24.907 28.440  -11.722 1.00 15.35 ? 236 ASN A ND2 1 
ATOM   440  N  N   . GLU A 1 56  ? 19.649 26.856  -10.190 1.00 13.08 ? 237 GLU A N   1 
ATOM   441  C  CA  . GLU A 1 56  ? 18.152 26.878  -10.318 1.00 13.81 ? 237 GLU A CA  1 
ATOM   442  C  C   . GLU A 1 56  ? 17.423 26.666  -8.982  1.00 14.32 ? 237 GLU A C   1 
ATOM   443  O  O   . GLU A 1 56  ? 16.303 27.144  -8.805  1.00 15.28 ? 237 GLU A O   1 
ATOM   444  C  CB  . GLU A 1 56  ? 17.683 25.820  -11.310 1.00 14.69 ? 237 GLU A CB  1 
ATOM   445  C  CG  . GLU A 1 56  ? 18.157 26.044  -12.726 1.00 15.74 ? 237 GLU A CG  1 
ATOM   446  C  CD  . GLU A 1 56  ? 17.710 27.388  -13.312 1.00 21.88 ? 237 GLU A CD  1 
ATOM   447  O  OE1 . GLU A 1 56  ? 16.505 27.760  -13.194 1.00 23.86 ? 237 GLU A OE1 1 
ATOM   448  O  OE2 . GLU A 1 56  ? 18.561 28.075  -13.884 1.00 19.67 ? 237 GLU A OE2 1 
ATOM   449  N  N   . GLU A 1 57  ? 18.080 25.962  -8.060  1.00 14.02 ? 238 GLU A N   1 
ATOM   450  C  CA  . GLU A 1 57  ? 17.492 25.614  -6.761  1.00 15.46 ? 238 GLU A CA  1 
ATOM   451  C  C   . GLU A 1 57  ? 17.629 26.758  -5.771  1.00 14.89 ? 238 GLU A C   1 
ATOM   452  O  O   . GLU A 1 57  ? 16.726 26.995  -4.977  1.00 14.76 ? 238 GLU A O   1 
ATOM   453  C  CB  . GLU A 1 57  ? 18.124 24.331  -6.208  1.00 15.26 ? 238 GLU A CB  1 
ATOM   454  C  CG  . GLU A 1 57  ? 17.662 23.040  -6.972  1.00 15.73 ? 238 GLU A CG  1 
ATOM   455  C  CD  . GLU A 1 57  ? 18.465 21.782  -6.692  1.00 17.61 ? 238 GLU A CD  1 
ATOM   456  O  OE1 . GLU A 1 57  ? 18.888 21.529  -5.541  1.00 18.05 ? 238 GLU A OE1 1 
ATOM   457  O  OE2 . GLU A 1 57  ? 18.660 21.005  -7.663  1.00 19.22 ? 238 GLU A OE2 1 
ATOM   458  N  N   . CYS A 1 58  ? 18.778 27.436  -5.778  1.00 14.44 ? 239 CYS A N   1 
ATOM   459  C  CA  . CYS A 1 58  ? 19.021 28.560  -4.816  1.00 15.78 ? 239 CYS A CA  1 
ATOM   460  C  C   . CYS A 1 58  ? 18.000 29.733  -4.847  1.00 16.17 ? 239 CYS A C   1 
ATOM   461  O  O   . CYS A 1 58  ? 17.614 30.236  -3.768  1.00 15.52 ? 239 CYS A O   1 
ATOM   462  C  CB  . CYS A 1 58  ? 20.420 29.132  -5.019  1.00 14.56 ? 239 CYS A CB  1 
ATOM   463  S  SG  . CYS A 1 58  ? 21.707 28.109  -4.423  1.00 17.87 ? 239 CYS A SG  1 
ATOM   464  N  N   . PRO A 1 59  ? 17.603 30.223  -6.047  1.00 15.97 ? 240 PRO A N   1 
ATOM   465  C  CA  . PRO A 1 59  ? 16.674 31.371  -6.049  1.00 16.58 ? 240 PRO A CA  1 
ATOM   466  C  C   . PRO A 1 59  ? 15.445 31.155  -5.202  1.00 15.31 ? 240 PRO A C   1 
ATOM   467  O  O   . PRO A 1 59  ? 14.929 32.120  -4.633  1.00 16.95 ? 240 PRO A O   1 
ATOM   468  C  CB  . PRO A 1 59  ? 16.283 31.529  -7.540  1.00 15.96 ? 240 PRO A CB  1 
ATOM   469  C  CG  . PRO A 1 59  ? 17.445 31.055  -8.249  1.00 17.85 ? 240 PRO A CG  1 
ATOM   470  C  CD  . PRO A 1 59  ? 17.993 29.873  -7.435  1.00 17.04 ? 240 PRO A CD  1 
ATOM   471  N  N   . ARG A 1 60  ? 14.989 29.910  -5.093  1.00 15.37 ? 241 ARG A N   1 
ATOM   472  C  CA  . ARG A 1 60  ? 13.757 29.607  -4.339  1.00 14.95 ? 241 ARG A CA  1 
ATOM   473  C  C   . ARG A 1 60  ? 13.888 29.849  -2.828  1.00 13.66 ? 241 ARG A C   1 
ATOM   474  O  O   . ARG A 1 60  ? 12.879 30.037  -2.102  1.00 12.98 ? 241 ARG A O   1 
ATOM   475  C  CB  . ARG A 1 60  ? 13.321 28.151  -4.552  1.00 14.50 ? 241 ARG A CB  1 
ATOM   476  C  CG  . ARG A 1 60  ? 13.045 27.794  -6.034  1.00 18.64 ? 241 ARG A CG  1 
ATOM   477  C  CD  . ARG A 1 60  ? 11.857 26.837  -6.179  1.00 17.61 ? 241 ARG A CD  1 
ATOM   478  N  NE  . ARG A 1 60  ? 10.600 27.444  -5.670  1.00 21.34 ? 241 ARG A NE  1 
ATOM   479  C  CZ  . ARG A 1 60  ? 9.584  26.714  -5.205  1.00 20.19 ? 241 ARG A CZ  1 
ATOM   480  N  NH1 . ARG A 1 60  ? 9.676  25.383  -5.186  1.00 18.59 ? 241 ARG A NH1 1 
ATOM   481  N  NH2 . ARG A 1 60  ? 8.505  27.305  -4.721  1.00 20.07 ? 241 ARG A NH2 1 
ATOM   482  N  N   . LEU A 1 61  ? 15.126 29.778  -2.357  1.00 12.66 ? 242 LEU A N   1 
ATOM   483  C  CA  . LEU A 1 61  ? 15.431 29.954  -0.932  1.00 12.56 ? 242 LEU A CA  1 
ATOM   484  C  C   . LEU A 1 61  ? 15.521 31.425  -0.493  1.00 11.84 ? 242 LEU A C   1 
ATOM   485  O  O   . LEU A 1 61  ? 15.673 31.716  0.700   1.00 11.14 ? 242 LEU A O   1 
ATOM   486  C  CB  . LEU A 1 61  ? 16.789 29.300  -0.631  1.00 12.10 ? 242 LEU A CB  1 
ATOM   487  C  CG  . LEU A 1 61  ? 16.920 27.860  -1.144  1.00 15.20 ? 242 LEU A CG  1 
ATOM   488  C  CD1 . LEU A 1 61  ? 18.334 27.282  -0.835  1.00 12.90 ? 242 LEU A CD1 1 
ATOM   489  C  CD2 . LEU A 1 61  ? 15.830 26.959  -0.604  1.00 15.76 ? 242 LEU A CD2 1 
ATOM   490  N  N   . ARG A 1 62  ? 15.409 32.345  -1.441  1.00 11.39 ? 243 ARG A N   1 
ATOM   491  C  CA  . ARG A 1 62  ? 15.600 33.762  -1.139  1.00 14.02 ? 243 ARG A CA  1 
ATOM   492  C  C   . ARG A 1 62  ? 14.220 34.324  -0.780  1.00 14.50 ? 243 ARG A C   1 
ATOM   493  O  O   . ARG A 1 62  ? 13.610 35.073  -1.551  1.00 14.48 ? 243 ARG A O   1 
ATOM   494  C  CB  . ARG A 1 62  ? 16.247 34.452  -2.351  1.00 13.35 ? 243 ARG A CB  1 
ATOM   495  C  CG  . ARG A 1 62  ? 17.606 33.829  -2.744  1.00 16.35 ? 243 ARG A CG  1 
ATOM   496  C  CD  . ARG A 1 62  ? 18.291 34.616  -3.857  1.00 17.62 ? 243 ARG A CD  1 
ATOM   497  N  NE  . ARG A 1 62  ? 18.585 35.987  -3.424  1.00 21.37 ? 243 ARG A NE  1 
ATOM   498  C  CZ  . ARG A 1 62  ? 17.854 37.045  -3.752  1.00 25.90 ? 243 ARG A CZ  1 
ATOM   499  N  NH1 . ARG A 1 62  ? 16.784 36.929  -4.557  1.00 26.02 ? 243 ARG A NH1 1 
ATOM   500  N  NH2 . ARG A 1 62  ? 18.208 38.236  -3.293  1.00 28.89 ? 243 ARG A NH2 1 
ATOM   501  N  N   . ILE A 1 63  ? 13.719 33.931  0.390   1.00 14.82 ? 244 ILE A N   1 
ATOM   502  C  CA  . ILE A 1 63  ? 12.366 34.292  0.813   1.00 15.41 ? 244 ILE A CA  1 
ATOM   503  C  C   . ILE A 1 63  ? 12.411 35.418  1.850   1.00 15.11 ? 244 ILE A C   1 
ATOM   504  O  O   . ILE A 1 63  ? 12.840 35.227  3.000   1.00 15.10 ? 244 ILE A O   1 
ATOM   505  C  CB  . ILE A 1 63  ? 11.620 33.046  1.375   1.00 16.31 ? 244 ILE A CB  1 
ATOM   506  C  CG1 . ILE A 1 63  ? 11.506 31.990  0.269   1.00 16.43 ? 244 ILE A CG1 1 
ATOM   507  C  CG2 . ILE A 1 63  ? 10.234 33.426  1.943   1.00 16.13 ? 244 ILE A CG2 1 
ATOM   508  C  CD1 . ILE A 1 63  ? 11.049 30.650  0.749   1.00 19.47 ? 244 ILE A CD1 1 
ATOM   509  N  N   . PHE A 1 64  ? 11.962 36.593  1.419   1.00 16.75 ? 245 PHE A N   1 
ATOM   510  C  CA  . PHE A 1 64  ? 12.117 37.804  2.220   1.00 17.23 ? 245 PHE A CA  1 
ATOM   511  C  C   . PHE A 1 64  ? 10.806 38.303  2.791   1.00 19.17 ? 245 PHE A C   1 
ATOM   512  O  O   . PHE A 1 64  ? 10.771 39.374  3.409   1.00 19.92 ? 245 PHE A O   1 
ATOM   513  C  CB  . PHE A 1 64  ? 12.803 38.915  1.408   1.00 17.52 ? 245 PHE A CB  1 
ATOM   514  C  CG  . PHE A 1 64  ? 14.242 38.637  1.108   1.00 17.77 ? 245 PHE A CG  1 
ATOM   515  C  CD1 . PHE A 1 64  ? 14.611 38.022  -0.073  1.00 21.85 ? 245 PHE A CD1 1 
ATOM   516  C  CD2 . PHE A 1 64  ? 15.235 38.969  2.030   1.00 22.01 ? 245 PHE A CD2 1 
ATOM   517  C  CE1 . PHE A 1 64  ? 15.973 37.741  -0.350  1.00 23.68 ? 245 PHE A CE1 1 
ATOM   518  C  CE2 . PHE A 1 64  ? 16.590 38.684  1.763   1.00 21.88 ? 245 PHE A CE2 1 
ATOM   519  C  CZ  . PHE A 1 64  ? 16.947 38.063  0.569   1.00 20.95 ? 245 PHE A CZ  1 
ATOM   520  N  N   . SER A 1 65  ? 9.758  37.511  2.646   1.00 18.30 ? 246 SER A N   1 
ATOM   521  C  CA  . SER A 1 65  ? 8.409  37.993  2.968   1.00 19.89 ? 246 SER A CA  1 
ATOM   522  C  C   . SER A 1 65  ? 7.740  37.422  4.199   1.00 18.61 ? 246 SER A C   1 
ATOM   523  O  O   . SER A 1 65  ? 6.531  37.617  4.375   1.00 20.25 ? 246 SER A O   1 
ATOM   524  C  CB  . SER A 1 65  ? 7.481  37.784  1.771   1.00 20.98 ? 246 SER A CB  1 
ATOM   525  O  OG  . SER A 1 65  ? 7.428  36.409  1.432   1.00 24.55 ? 246 SER A OG  1 
ATOM   526  N  N   . HIS A 1 66  ? 8.477  36.710  5.056   1.00 17.28 ? 247 HIS A N   1 
ATOM   527  C  CA  . HIS A 1 66  ? 7.833  36.221  6.270   1.00 14.06 ? 247 HIS A CA  1 
ATOM   528  C  C   . HIS A 1 66  ? 8.796  36.277  7.461   1.00 14.62 ? 247 HIS A C   1 
ATOM   529  O  O   . HIS A 1 66  ? 9.936  35.854  7.350   1.00 14.56 ? 247 HIS A O   1 
ATOM   530  C  CB  . HIS A 1 66  ? 7.255  34.799  6.091   1.00 14.30 ? 247 HIS A CB  1 
ATOM   531  C  CG  . HIS A 1 66  ? 6.382  34.398  7.221   1.00 12.55 ? 247 HIS A CG  1 
ATOM   532  N  ND1 . HIS A 1 66  ? 5.000  34.341  7.135   1.00 16.35 ? 247 HIS A ND1 1 
ATOM   533  C  CD2 . HIS A 1 66  ? 6.691  34.084  8.493   1.00 11.17 ? 247 HIS A CD2 1 
ATOM   534  C  CE1 . HIS A 1 66  ? 4.504  33.982  8.304   1.00 10.99 ? 247 HIS A CE1 1 
ATOM   535  N  NE2 . HIS A 1 66  ? 5.512  33.826  9.147   1.00 16.56 ? 247 HIS A NE2 1 
ATOM   536  N  N   . PRO A 1 67  ? 8.346  36.823  8.593   1.00 14.18 ? 248 PRO A N   1 
ATOM   537  C  CA  . PRO A 1 67  ? 9.273  37.014  9.707   1.00 13.73 ? 248 PRO A CA  1 
ATOM   538  C  C   . PRO A 1 67  ? 9.803  35.701  10.286  1.00 12.44 ? 248 PRO A C   1 
ATOM   539  O  O   . PRO A 1 67  ? 10.844 35.706  10.960  1.00 13.19 ? 248 PRO A O   1 
ATOM   540  C  CB  . PRO A 1 67  ? 8.413  37.728  10.757  1.00 15.33 ? 248 PRO A CB  1 
ATOM   541  C  CG  . PRO A 1 67  ? 7.025  37.363  10.451  1.00 15.42 ? 248 PRO A CG  1 
ATOM   542  C  CD  . PRO A 1 67  ? 6.984  37.288  8.927   1.00 15.11 ? 248 PRO A CD  1 
ATOM   543  N  N   . ASN A 1 68  ? 9.098  34.600  10.059  1.00 10.59 ? 249 ASN A N   1 
ATOM   544  C  CA  . ASN A 1 68  ? 9.575  33.318  10.616  1.00 10.26 ? 249 ASN A CA  1 
ATOM   545  C  C   . ASN A 1 68  ? 10.265 32.433  9.594   1.00 9.98  ? 249 ASN A C   1 
ATOM   546  O  O   . ASN A 1 68  ? 10.310 31.196  9.758   1.00 8.54  ? 249 ASN A O   1 
ATOM   547  C  CB  . ASN A 1 68  ? 8.411  32.581  11.288  1.00 11.46 ? 249 ASN A CB  1 
ATOM   548  C  CG  . ASN A 1 68  ? 7.793  33.412  12.393  1.00 13.94 ? 249 ASN A CG  1 
ATOM   549  O  OD1 . ASN A 1 68  ? 6.620  33.817  12.304  1.00 12.86 ? 249 ASN A OD1 1 
ATOM   550  N  ND2 . ASN A 1 68  ? 8.609  33.773  13.389  1.00 13.67 ? 249 ASN A ND2 1 
ATOM   551  N  N   . VAL A 1 69  ? 10.687 33.067  8.517   1.00 8.28  ? 250 VAL A N   1 
ATOM   552  C  CA  . VAL A 1 69  ? 11.497 32.392  7.476   1.00 10.89 ? 250 VAL A CA  1 
ATOM   553  C  C   . VAL A 1 69  ? 12.811 33.192  7.319   1.00 9.80  ? 250 VAL A C   1 
ATOM   554  O  O   . VAL A 1 69  ? 12.799 34.420  7.125   1.00 12.07 ? 250 VAL A O   1 
ATOM   555  C  CB  . VAL A 1 69  ? 10.751 32.254  6.117   1.00 7.95  ? 250 VAL A CB  1 
ATOM   556  C  CG1 . VAL A 1 69  ? 11.704 31.593  5.074   1.00 11.32 ? 250 VAL A CG1 1 
ATOM   557  C  CG2 . VAL A 1 69  ? 9.471  31.348  6.295   1.00 12.22 ? 250 VAL A CG2 1 
ATOM   558  N  N   . LEU A 1 70  ? 13.934 32.499  7.445   1.00 10.21 ? 251 LEU A N   1 
ATOM   559  C  CA  . LEU A 1 70  ? 15.269 33.131  7.317   1.00 10.59 ? 251 LEU A CA  1 
ATOM   560  C  C   . LEU A 1 70  ? 15.775 32.832  5.886   1.00 9.73  ? 251 LEU A C   1 
ATOM   561  O  O   . LEU A 1 70  ? 16.129 31.710  5.594   1.00 9.22  ? 251 LEU A O   1 
ATOM   562  C  CB  . LEU A 1 70  ? 16.234 32.578  8.381   1.00 11.20 ? 251 LEU A CB  1 
ATOM   563  C  CG  . LEU A 1 70  ? 17.624 33.212  8.374   1.00 12.69 ? 251 LEU A CG  1 
ATOM   564  C  CD1 . LEU A 1 70  ? 17.596 34.652  8.830   1.00 15.27 ? 251 LEU A CD1 1 
ATOM   565  C  CD2 . LEU A 1 70  ? 18.560 32.334  9.216   1.00 13.66 ? 251 LEU A CD2 1 
ATOM   566  N  N   . PRO A 1 71  ? 15.798 33.844  4.991   1.00 11.38 ? 252 PRO A N   1 
ATOM   567  C  CA  . PRO A 1 71  ? 16.208 33.636  3.597   1.00 11.99 ? 252 PRO A CA  1 
ATOM   568  C  C   . PRO A 1 71  ? 17.691 33.348  3.476   1.00 11.77 ? 252 PRO A C   1 
ATOM   569  O  O   . PRO A 1 71  ? 18.498 33.801  4.301   1.00 11.19 ? 252 PRO A O   1 
ATOM   570  C  CB  . PRO A 1 71  ? 15.960 35.005  2.935   1.00 12.15 ? 252 PRO A CB  1 
ATOM   571  C  CG  . PRO A 1 71  ? 16.181 35.994  4.048   1.00 11.83 ? 252 PRO A CG  1 
ATOM   572  C  CD  . PRO A 1 71  ? 15.514 35.258  5.268   1.00 12.37 ? 252 PRO A CD  1 
ATOM   573  N  N   . VAL A 1 72  ? 18.028 32.594  2.455   1.00 11.37 ? 253 VAL A N   1 
ATOM   574  C  CA  . VAL A 1 72  ? 19.369 32.648  1.884   1.00 12.62 ? 253 VAL A CA  1 
ATOM   575  C  C   . VAL A 1 72  ? 19.484 34.028  1.232   1.00 14.09 ? 253 VAL A C   1 
ATOM   576  O  O   . VAL A 1 72  ? 18.613 34.446  0.451   1.00 13.44 ? 253 VAL A O   1 
ATOM   577  C  CB  . VAL A 1 72  ? 19.531 31.517  0.827   1.00 12.58 ? 253 VAL A CB  1 
ATOM   578  C  CG1 . VAL A 1 72  ? 20.773 31.760  -0.077  1.00 14.08 ? 253 VAL A CG1 1 
ATOM   579  C  CG2 . VAL A 1 72  ? 19.598 30.157  1.510   1.00 15.29 ? 253 VAL A CG2 1 
ATOM   580  N  N   . LEU A 1 73  ? 20.521 34.778  1.595   1.00 14.81 ? 254 LEU A N   1 
ATOM   581  C  CA  . LEU A 1 73  ? 20.750 36.074  0.975   1.00 16.51 ? 254 LEU A CA  1 
ATOM   582  C  C   . LEU A 1 73  ? 21.152 35.946  -0.481  1.00 17.39 ? 254 LEU A C   1 
ATOM   583  O  O   . LEU A 1 73  ? 20.759 36.750  -1.330  1.00 18.18 ? 254 LEU A O   1 
ATOM   584  C  CB  . LEU A 1 73  ? 21.822 36.858  1.740   1.00 16.96 ? 254 LEU A CB  1 
ATOM   585  C  CG  . LEU A 1 73  ? 21.457 37.223  3.150   1.00 18.33 ? 254 LEU A CG  1 
ATOM   586  C  CD1 . LEU A 1 73  ? 22.595 38.026  3.733   1.00 20.59 ? 254 LEU A CD1 1 
ATOM   587  C  CD2 . LEU A 1 73  ? 20.126 38.044  3.148   1.00 22.70 ? 254 LEU A CD2 1 
ATOM   588  N  N   . GLY A 1 74  ? 21.950 34.932  -0.779  1.00 15.99 ? 255 GLY A N   1 
ATOM   589  C  CA  . GLY A 1 74  ? 22.360 34.689  -2.124  1.00 16.90 ? 255 GLY A CA  1 
ATOM   590  C  C   . GLY A 1 74  ? 23.335 33.527  -2.123  1.00 16.53 ? 255 GLY A C   1 
ATOM   591  O  O   . GLY A 1 74  ? 23.674 32.984  -1.059  1.00 16.32 ? 255 GLY A O   1 
ATOM   592  N  N   . ALA A 1 75  ? 23.759 33.127  -3.317  1.00 16.71 ? 256 ALA A N   1 
ATOM   593  C  CA  . ALA A 1 75  ? 24.668 32.028  -3.419  1.00 15.59 ? 256 ALA A CA  1 
ATOM   594  C  C   . ALA A 1 75  ? 25.774 32.390  -4.401  1.00 16.42 ? 256 ALA A C   1 
ATOM   595  O  O   . ALA A 1 75  ? 25.593 33.258  -5.310  1.00 17.20 ? 256 ALA A O   1 
ATOM   596  C  CB  . ALA A 1 75  ? 23.917 30.758  -3.861  1.00 16.56 ? 256 ALA A CB  1 
ATOM   597  N  N   . CYS A 1 76  ? 26.924 31.771  -4.192  1.00 17.24 ? 257 CYS A N   1 
ATOM   598  C  CA  . CYS A 1 76  ? 28.052 31.896  -5.127  1.00 17.53 ? 257 CYS A CA  1 
ATOM   599  C  C   . CYS A 1 76  ? 28.073 30.713  -6.071  1.00 17.58 ? 257 CYS A C   1 
ATOM   600  O  O   . CYS A 1 76  ? 28.191 29.537  -5.649  1.00 18.58 ? 257 CYS A O   1 
ATOM   601  C  CB  . CYS A 1 76  ? 29.370 31.963  -4.352  1.00 18.50 ? 257 CYS A CB  1 
ATOM   602  S  SG  . CYS A 1 76  ? 29.438 33.341  -3.251  1.00 24.09 ? 257 CYS A SG  1 
ATOM   603  N  N   . GLN A 1 77  ? 27.954 31.014  -7.356  1.00 17.49 ? 258 GLN A N   1 
ATOM   604  C  CA  . GLN A 1 77  ? 27.923 29.968  -8.350  1.00 17.72 ? 258 GLN A CA  1 
ATOM   605  C  C   . GLN A 1 77  ? 29.351 29.446  -8.546  1.00 18.88 ? 258 GLN A C   1 
ATOM   606  O  O   . GLN A 1 77  ? 30.331 30.208  -8.432  1.00 18.78 ? 258 GLN A O   1 
ATOM   607  C  CB  . GLN A 1 77  ? 27.324 30.488  -9.655  1.00 18.61 ? 258 GLN A CB  1 
ATOM   608  C  CG  . GLN A 1 77  ? 25.948 31.119  -9.426  1.00 19.91 ? 258 GLN A CG  1 
ATOM   609  C  CD  . GLN A 1 77  ? 25.258 31.614  -10.658 1.00 24.13 ? 258 GLN A CD  1 
ATOM   610  O  OE1 . GLN A 1 77  ? 24.090 32.032  -10.571 1.00 28.87 ? 258 GLN A OE1 1 
ATOM   611  N  NE2 . GLN A 1 77  ? 25.931 31.577  -11.814 1.00 21.71 ? 258 GLN A NE2 1 
ATOM   612  N  N   . SER A 1 78  ? 29.434 28.156  -8.836  1.00 18.46 ? 259 SER A N   1 
ATOM   613  C  CA  . SER A 1 78  ? 30.707 27.440  -8.956  1.00 19.76 ? 259 SER A CA  1 
ATOM   614  C  C   . SER A 1 78  ? 30.674 26.570  -10.212 1.00 19.25 ? 259 SER A C   1 
ATOM   615  O  O   . SER A 1 78  ? 29.986 25.559  -10.235 1.00 18.12 ? 259 SER A O   1 
ATOM   616  C  CB  . SER A 1 78  ? 30.883 26.582  -7.692  1.00 19.84 ? 259 SER A CB  1 
ATOM   617  O  OG  . SER A 1 78  ? 32.119 25.900  -7.676  1.00 21.64 ? 259 SER A OG  1 
ATOM   618  N  N   . PRO A 1 79  ? 31.378 26.985  -11.290 1.00 20.60 ? 260 PRO A N   1 
ATOM   619  C  CA  . PRO A 1 79  ? 32.202 28.191  -11.395 1.00 21.22 ? 260 PRO A CA  1 
ATOM   620  C  C   . PRO A 1 79  ? 31.376 29.462  -11.434 1.00 22.50 ? 260 PRO A C   1 
ATOM   621  O  O   . PRO A 1 79  ? 30.139 29.404  -11.689 1.00 21.99 ? 260 PRO A O   1 
ATOM   622  C  CB  . PRO A 1 79  ? 32.958 27.983  -12.737 1.00 21.64 ? 260 PRO A CB  1 
ATOM   623  C  CG  . PRO A 1 79  ? 31.927 27.226  -13.606 1.00 21.84 ? 260 PRO A CG  1 
ATOM   624  C  CD  . PRO A 1 79  ? 31.327 26.235  -12.567 1.00 20.95 ? 260 PRO A CD  1 
ATOM   625  N  N   . PRO A 1 80  ? 32.024 30.625  -11.255 1.00 23.50 ? 261 PRO A N   1 
ATOM   626  C  CA  . PRO A 1 80  ? 33.463 30.823  -11.062 1.00 24.79 ? 261 PRO A CA  1 
ATOM   627  C  C   . PRO A 1 80  ? 33.991 30.652  -9.642  1.00 24.89 ? 261 PRO A C   1 
ATOM   628  O  O   . PRO A 1 80  ? 35.214 30.691  -9.463  1.00 25.39 ? 261 PRO A O   1 
ATOM   629  C  CB  . PRO A 1 80  ? 33.660 32.264  -11.507 1.00 24.37 ? 261 PRO A CB  1 
ATOM   630  C  CG  . PRO A 1 80  ? 32.441 32.924  -11.073 1.00 25.29 ? 261 PRO A CG  1 
ATOM   631  C  CD  . PRO A 1 80  ? 31.334 31.917  -11.365 1.00 22.95 ? 261 PRO A CD  1 
ATOM   632  N  N   . ALA A 1 81  ? 33.119 30.469  -8.639  1.00 23.67 ? 262 ALA A N   1 
ATOM   633  C  CA  . ALA A 1 81  ? 33.587 30.289  -7.251  1.00 23.55 ? 262 ALA A CA  1 
ATOM   634  C  C   . ALA A 1 81  ? 34.264 28.942  -7.074  1.00 23.77 ? 262 ALA A C   1 
ATOM   635  O  O   . ALA A 1 81  ? 33.965 27.993  -7.797  1.00 23.45 ? 262 ALA A O   1 
ATOM   636  C  CB  . ALA A 1 81  ? 32.432 30.454  -6.233  1.00 23.10 ? 262 ALA A CB  1 
ATOM   637  N  N   . PRO A 1 82  ? 35.197 28.833  -6.099  1.00 24.62 ? 263 PRO A N   1 
ATOM   638  C  CA  . PRO A 1 82  ? 35.856 27.542  -5.934  1.00 24.28 ? 263 PRO A CA  1 
ATOM   639  C  C   . PRO A 1 82  ? 34.919 26.366  -5.582  1.00 22.77 ? 263 PRO A C   1 
ATOM   640  O  O   . PRO A 1 82  ? 35.152 25.224  -6.012  1.00 22.58 ? 263 PRO A O   1 
ATOM   641  C  CB  . PRO A 1 82  ? 36.875 27.806  -4.808  1.00 24.93 ? 263 PRO A CB  1 
ATOM   642  C  CG  . PRO A 1 82  ? 36.426 29.022  -4.145  1.00 26.34 ? 263 PRO A CG  1 
ATOM   643  C  CD  . PRO A 1 82  ? 35.708 29.844  -5.152  1.00 25.09 ? 263 PRO A CD  1 
ATOM   644  N  N   . HIS A 1 83  ? 33.843 26.649  -4.837  1.00 21.60 ? 264 HIS A N   1 
ATOM   645  C  CA  . HIS A 1 83  ? 32.886 25.630  -4.425  1.00 21.02 ? 264 HIS A CA  1 
ATOM   646  C  C   . HIS A 1 83  ? 31.485 26.261  -4.379  1.00 18.56 ? 264 HIS A C   1 
ATOM   647  O  O   . HIS A 1 83  ? 31.351 27.475  -4.162  1.00 18.12 ? 264 HIS A O   1 
ATOM   648  C  CB  . HIS A 1 83  ? 33.186 25.110  -3.019  1.00 22.38 ? 264 HIS A CB  1 
ATOM   649  C  CG  . HIS A 1 83  ? 34.635 24.812  -2.772  1.00 27.65 ? 264 HIS A CG  1 
ATOM   650  N  ND1 . HIS A 1 83  ? 35.148 23.538  -2.841  1.00 32.11 ? 264 HIS A ND1 1 
ATOM   651  C  CD2 . HIS A 1 83  ? 35.674 25.622  -2.455  1.00 30.74 ? 264 HIS A CD2 1 
ATOM   652  C  CE1 . HIS A 1 83  ? 36.445 23.573  -2.582  1.00 32.15 ? 264 HIS A CE1 1 
ATOM   653  N  NE2 . HIS A 1 83  ? 36.790 24.827  -2.355  1.00 32.74 ? 264 HIS A NE2 1 
ATOM   654  N  N   . PRO A 1 84  ? 30.436 25.442  -4.578  1.00 18.34 ? 265 PRO A N   1 
ATOM   655  C  CA  . PRO A 1 84  ? 29.079 26.022  -4.427  1.00 16.96 ? 265 PRO A CA  1 
ATOM   656  C  C   . PRO A 1 84  ? 28.880 26.476  -2.983  1.00 17.35 ? 265 PRO A C   1 
ATOM   657  O  O   . PRO A 1 84  ? 29.127 25.696  -2.030  1.00 17.07 ? 265 PRO A O   1 
ATOM   658  C  CB  . PRO A 1 84  ? 28.152 24.859  -4.741  1.00 16.49 ? 265 PRO A CB  1 
ATOM   659  C  CG  . PRO A 1 84  ? 29.011 23.602  -4.648  1.00 18.53 ? 265 PRO A CG  1 
ATOM   660  C  CD  . PRO A 1 84  ? 30.413 24.009  -4.905  1.00 17.68 ? 265 PRO A CD  1 
ATOM   661  N  N   . THR A 1 85  ? 28.457 27.718  -2.832  1.00 15.77 ? 266 THR A N   1 
ATOM   662  C  CA  . THR A 1 85  ? 28.442 28.397  -1.549  1.00 17.85 ? 266 THR A CA  1 
ATOM   663  C  C   . THR A 1 85  ? 27.140 29.155  -1.345  1.00 18.40 ? 266 THR A C   1 
ATOM   664  O  O   . THR A 1 85  ? 26.659 29.802  -2.284  1.00 18.22 ? 266 THR A O   1 
ATOM   665  C  CB  . THR A 1 85  ? 29.640 29.401  -1.500  1.00 17.42 ? 266 THR A CB  1 
ATOM   666  O  OG1 . THR A 1 85  ? 30.847 28.675  -1.742  1.00 20.32 ? 266 THR A OG1 1 
ATOM   667  C  CG2 . THR A 1 85  ? 29.736 30.064  -0.157  1.00 20.02 ? 266 THR A CG2 1 
ATOM   668  N  N   . LEU A 1 86  ? 26.587 29.043  -0.133  1.00 17.53 ? 267 LEU A N   1 
ATOM   669  C  CA  . LEU A 1 86  ? 25.379 29.775  0.278   1.00 18.25 ? 267 LEU A CA  1 
ATOM   670  C  C   . LEU A 1 86  ? 25.734 30.807  1.329   1.00 17.78 ? 267 LEU A C   1 
ATOM   671  O  O   . LEU A 1 86  ? 26.543 30.502  2.227   1.00 17.21 ? 267 LEU A O   1 
ATOM   672  C  CB  . LEU A 1 86  ? 24.383 28.807  0.951   1.00 18.64 ? 267 LEU A CB  1 
ATOM   673  C  CG  . LEU A 1 86  ? 23.739 27.702  0.163   1.00 22.33 ? 267 LEU A CG  1 
ATOM   674  C  CD1 . LEU A 1 86  ? 22.753 26.960  1.051   1.00 23.50 ? 267 LEU A CD1 1 
ATOM   675  C  CD2 . LEU A 1 86  ? 22.962 28.313  -1.033  1.00 24.55 ? 267 LEU A CD2 1 
ATOM   676  N  N   . ILE A 1 87  ? 25.079 31.968  1.279   1.00 15.37 ? 268 ILE A N   1 
ATOM   677  C  CA  . ILE A 1 87  ? 25.215 33.026  2.299   1.00 17.46 ? 268 ILE A CA  1 
ATOM   678  C  C   . ILE A 1 87  ? 23.885 33.271  3.037   1.00 17.49 ? 268 ILE A C   1 
ATOM   679  O  O   . ILE A 1 87  ? 22.843 33.451  2.385   1.00 15.03 ? 268 ILE A O   1 
ATOM   680  C  CB  . ILE A 1 87  ? 25.580 34.368  1.589   1.00 18.18 ? 268 ILE A CB  1 
ATOM   681  C  CG1 . ILE A 1 87  ? 26.788 34.171  0.688   1.00 21.58 ? 268 ILE A CG1 1 
ATOM   682  C  CG2 . ILE A 1 87  ? 25.776 35.495  2.586   1.00 20.64 ? 268 ILE A CG2 1 
ATOM   683  C  CD1 . ILE A 1 87  ? 27.959 33.690  1.441   1.00 25.35 ? 268 ILE A CD1 1 
ATOM   684  N  N   . THR A 1 88  ? 23.915 33.321  4.378   1.00 16.67 ? 269 THR A N   1 
ATOM   685  C  CA  . THR A 1 88  ? 22.748 33.784  5.160   1.00 17.29 ? 269 THR A CA  1 
ATOM   686  C  C   . THR A 1 88  ? 23.173 34.729  6.261   1.00 18.12 ? 269 THR A C   1 
ATOM   687  O  O   . THR A 1 88  ? 24.382 34.858  6.540   1.00 17.50 ? 269 THR A O   1 
ATOM   688  C  CB  . THR A 1 88  ? 21.963 32.592  5.770   1.00 18.68 ? 269 THR A CB  1 
ATOM   689  O  OG1 . THR A 1 88  ? 21.880 31.587  4.774   1.00 23.14 ? 269 THR A OG1 1 
ATOM   690  C  CG2 . THR A 1 88  ? 20.560 33.012  6.114   1.00 16.81 ? 269 THR A CG2 1 
ATOM   691  N  N   . HIS A 1 89  ? 22.205 35.436  6.843   1.00 18.21 ? 270 HIS A N   1 
ATOM   692  C  CA  . HIS A 1 89  ? 22.485 36.287  7.990   1.00 19.57 ? 270 HIS A CA  1 
ATOM   693  C  C   . HIS A 1 89  ? 23.034 35.482  9.165   1.00 19.63 ? 270 HIS A C   1 
ATOM   694  O  O   . HIS A 1 89  ? 22.668 34.320  9.377   1.00 19.39 ? 270 HIS A O   1 
ATOM   695  C  CB  . HIS A 1 89  ? 21.247 37.111  8.364   1.00 19.72 ? 270 HIS A CB  1 
ATOM   696  C  CG  . HIS A 1 89  ? 21.136 38.380  7.581   1.00 23.92 ? 270 HIS A CG  1 
ATOM   697  N  ND1 . HIS A 1 89  ? 20.015 38.720  6.855   1.00 29.57 ? 270 HIS A ND1 1 
ATOM   698  C  CD2 . HIS A 1 89  ? 22.022 39.388  7.397   1.00 28.03 ? 270 HIS A CD2 1 
ATOM   699  C  CE1 . HIS A 1 89  ? 20.205 39.892  6.277   1.00 28.46 ? 270 HIS A CE1 1 
ATOM   700  N  NE2 . HIS A 1 89  ? 21.417 40.320  6.587   1.00 29.90 ? 270 HIS A NE2 1 
ATOM   701  N  N   . TRP A 1 90  ? 23.970 36.096  9.883   1.00 19.77 ? 271 TRP A N   1 
ATOM   702  C  CA  . TRP A 1 90  ? 24.488 35.503  11.099  1.00 21.74 ? 271 TRP A CA  1 
ATOM   703  C  C   . TRP A 1 90  ? 23.421 35.574  12.188  1.00 21.73 ? 271 TRP A C   1 
ATOM   704  O  O   . TRP A 1 90  ? 22.780 36.604  12.400  1.00 20.46 ? 271 TRP A O   1 
ATOM   705  C  CB  . TRP A 1 90  ? 25.746 36.261  11.512  1.00 23.09 ? 271 TRP A CB  1 
ATOM   706  C  CG  . TRP A 1 90  ? 26.197 36.030  12.917  1.00 25.13 ? 271 TRP A CG  1 
ATOM   707  C  CD1 . TRP A 1 90  ? 26.037 36.877  13.980  1.00 29.41 ? 271 TRP A CD1 1 
ATOM   708  C  CD2 . TRP A 1 90  ? 26.915 34.903  13.407  1.00 27.05 ? 271 TRP A CD2 1 
ATOM   709  N  NE1 . TRP A 1 90  ? 26.621 36.335  15.110  1.00 31.66 ? 271 TRP A NE1 1 
ATOM   710  C  CE2 . TRP A 1 90  ? 27.165 35.125  14.785  1.00 29.27 ? 271 TRP A CE2 1 
ATOM   711  C  CE3 . TRP A 1 90  ? 27.381 33.734  12.827  1.00 29.19 ? 271 TRP A CE3 1 
ATOM   712  C  CZ2 . TRP A 1 90  ? 27.866 34.206  15.588  1.00 28.46 ? 271 TRP A CZ2 1 
ATOM   713  C  CZ3 . TRP A 1 90  ? 28.090 32.809  13.642  1.00 29.09 ? 271 TRP A CZ3 1 
ATOM   714  C  CH2 . TRP A 1 90  ? 28.309 33.056  14.999  1.00 28.30 ? 271 TRP A CH2 1 
HETATM 715  N  N   . MSE A 1 91  ? 23.222 34.458  12.872  1.00 23.10 ? 272 MSE A N   1 
HETATM 716  C  CA  . MSE A 1 91  ? 22.216 34.372  13.926  1.00 24.59 ? 272 MSE A CA  1 
HETATM 717  C  C   . MSE A 1 91  ? 22.975 34.092  15.223  1.00 25.51 ? 272 MSE A C   1 
HETATM 718  O  O   . MSE A 1 91  ? 23.542 33.018  15.395  1.00 23.32 ? 272 MSE A O   1 
HETATM 719  C  CB  . MSE A 1 91  ? 21.172 33.280  13.618  1.00 24.98 ? 272 MSE A CB  1 
HETATM 720  C  CG  . MSE A 1 91  ? 20.293 33.622  12.397  1.00 25.96 ? 272 MSE A CG  1 
HETATM 721  SE SE  . MSE A 1 91  ? 18.866 34.956  12.662  0.75 33.22 ? 272 MSE A SE  1 
HETATM 722  C  CE  . MSE A 1 91  ? 17.405 33.699  12.951  1.00 35.94 ? 272 MSE A CE  1 
ATOM   723  N  N   . PRO A 1 92  ? 22.972 35.073  16.138  1.00 27.90 ? 273 PRO A N   1 
ATOM   724  C  CA  . PRO A 1 92  ? 23.869 35.019  17.306  1.00 28.42 ? 273 PRO A CA  1 
ATOM   725  C  C   . PRO A 1 92  ? 23.577 33.812  18.260  1.00 27.15 ? 273 PRO A C   1 
ATOM   726  O  O   . PRO A 1 92  ? 24.525 33.140  18.749  1.00 27.29 ? 273 PRO A O   1 
ATOM   727  C  CB  . PRO A 1 92  ? 23.641 36.383  17.979  1.00 28.88 ? 273 PRO A CB  1 
ATOM   728  C  CG  . PRO A 1 92  ? 22.229 36.779  17.585  1.00 29.43 ? 273 PRO A CG  1 
ATOM   729  C  CD  . PRO A 1 92  ? 22.081 36.254  16.159  1.00 28.17 ? 273 PRO A CD  1 
ATOM   730  N  N   . TYR A 1 93  ? 22.298 33.498  18.456  1.00 25.69 ? 274 TYR A N   1 
ATOM   731  C  CA  . TYR A 1 93  ? 21.899 32.388  19.329  1.00 23.67 ? 274 TYR A CA  1 
ATOM   732  C  C   . TYR A 1 93  ? 22.035 31.032  18.625  1.00 21.29 ? 274 TYR A C   1 
ATOM   733  O  O   . TYR A 1 93  ? 21.937 29.977  19.264  1.00 20.45 ? 274 TYR A O   1 
ATOM   734  C  CB  . TYR A 1 93  ? 20.468 32.579  19.855  1.00 25.78 ? 274 TYR A CB  1 
ATOM   735  C  CG  . TYR A 1 93  ? 20.305 33.711  20.846  1.00 28.17 ? 274 TYR A CG  1 
ATOM   736  C  CD1 . TYR A 1 93  ? 20.799 33.601  22.156  1.00 30.92 ? 274 TYR A CD1 1 
ATOM   737  C  CD2 . TYR A 1 93  ? 19.644 34.875  20.487  1.00 29.45 ? 274 TYR A CD2 1 
ATOM   738  C  CE1 . TYR A 1 93  ? 20.650 34.649  23.057  1.00 32.89 ? 274 TYR A CE1 1 
ATOM   739  C  CE2 . TYR A 1 93  ? 19.482 35.920  21.381  1.00 32.86 ? 274 TYR A CE2 1 
ATOM   740  C  CZ  . TYR A 1 93  ? 19.989 35.805  22.654  1.00 32.30 ? 274 TYR A CZ  1 
ATOM   741  O  OH  . TYR A 1 93  ? 19.825 36.862  23.525  1.00 34.51 ? 274 TYR A OH  1 
ATOM   742  N  N   . GLY A 1 94  ? 22.257 31.044  17.309  1.00 18.62 ? 275 GLY A N   1 
ATOM   743  C  CA  . GLY A 1 94  ? 22.452 29.796  16.589  1.00 16.61 ? 275 GLY A CA  1 
ATOM   744  C  C   . GLY A 1 94  ? 21.116 29.093  16.359  1.00 15.61 ? 275 GLY A C   1 
ATOM   745  O  O   . GLY A 1 94  ? 20.056 29.769  16.277  1.00 15.11 ? 275 GLY A O   1 
ATOM   746  N  N   . SER A 1 95  ? 21.152 27.767  16.250  1.00 14.08 ? 276 SER A N   1 
ATOM   747  C  CA  . SER A 1 95  ? 19.925 26.963  15.949  1.00 13.21 ? 276 SER A CA  1 
ATOM   748  C  C   . SER A 1 95  ? 19.068 26.752  17.178  1.00 13.35 ? 276 SER A C   1 
ATOM   749  O  O   . SER A 1 95  ? 19.547 26.950  18.322  1.00 12.41 ? 276 SER A O   1 
ATOM   750  C  CB  . SER A 1 95  ? 20.293 25.590  15.390  1.00 13.51 ? 276 SER A CB  1 
ATOM   751  O  OG  . SER A 1 95  ? 21.027 24.834  16.345  1.00 13.98 ? 276 SER A OG  1 
ATOM   752  N  N   . LEU A 1 96  ? 17.824 26.362  16.965  1.00 11.57 ? 277 LEU A N   1 
ATOM   753  C  CA  . LEU A 1 96  ? 16.979 25.937  18.095  1.00 12.04 ? 277 LEU A CA  1 
ATOM   754  C  C   . LEU A 1 96  ? 17.694 24.818  18.854  1.00 12.95 ? 277 LEU A C   1 
ATOM   755  O  O   . LEU A 1 96  ? 17.665 24.764  20.093  1.00 13.09 ? 277 LEU A O   1 
ATOM   756  C  CB  . LEU A 1 96  ? 15.629 25.406  17.605  1.00 12.93 ? 277 LEU A CB  1 
ATOM   757  C  CG  . LEU A 1 96  ? 14.678 24.890  18.705  1.00 13.72 ? 277 LEU A CG  1 
ATOM   758  C  CD1 . LEU A 1 96  ? 14.248 25.994  19.684  1.00 15.31 ? 277 LEU A CD1 1 
ATOM   759  C  CD2 . LEU A 1 96  ? 13.459 24.310  18.036  1.00 14.86 ? 277 LEU A CD2 1 
ATOM   760  N  N   . TYR A 1 97  ? 18.290 23.882  18.115  1.00 12.20 ? 278 TYR A N   1 
ATOM   761  C  CA  . TYR A 1 97  ? 19.019 22.803  18.760  1.00 13.64 ? 278 TYR A CA  1 
ATOM   762  C  C   . TYR A 1 97  ? 20.090 23.364  19.723  1.00 13.72 ? 278 TYR A C   1 
ATOM   763  O  O   . TYR A 1 97  ? 20.182 22.871  20.837  1.00 13.37 ? 278 TYR A O   1 
ATOM   764  C  CB  . TYR A 1 97  ? 19.626 21.869  17.693  1.00 13.53 ? 278 TYR A CB  1 
ATOM   765  C  CG  . TYR A 1 97  ? 20.399 20.685  18.267  1.00 15.01 ? 278 TYR A CG  1 
ATOM   766  C  CD1 . TYR A 1 97  ? 21.670 20.874  18.848  1.00 18.31 ? 278 TYR A CD1 1 
ATOM   767  C  CD2 . TYR A 1 97  ? 19.873 19.425  18.200  1.00 14.13 ? 278 TYR A CD2 1 
ATOM   768  C  CE1 . TYR A 1 97  ? 22.392 19.798  19.374  1.00 17.49 ? 278 TYR A CE1 1 
ATOM   769  C  CE2 . TYR A 1 97  ? 20.590 18.307  18.736  1.00 16.88 ? 278 TYR A CE2 1 
ATOM   770  C  CZ  . TYR A 1 97  ? 21.831 18.529  19.313  1.00 15.65 ? 278 TYR A CZ  1 
ATOM   771  O  OH  . TYR A 1 97  ? 22.520 17.437  19.837  1.00 18.69 ? 278 TYR A OH  1 
ATOM   772  N  N   . ASN A 1 98  ? 20.911 24.328  19.298  1.00 13.23 ? 279 ASN A N   1 
ATOM   773  C  CA  . ASN A 1 98  ? 21.953 24.937  20.162  1.00 15.46 ? 279 ASN A CA  1 
ATOM   774  C  C   . ASN A 1 98  ? 21.318 25.537  21.420  1.00 15.69 ? 279 ASN A C   1 
ATOM   775  O  O   . ASN A 1 98  ? 21.812 25.379  22.547  1.00 16.10 ? 279 ASN A O   1 
ATOM   776  C  CB  . ASN A 1 98  ? 22.677 26.102  19.469  1.00 15.25 ? 279 ASN A CB  1 
ATOM   777  C  CG  . ASN A 1 98  ? 23.486 25.696  18.224  1.00 19.56 ? 279 ASN A CG  1 
ATOM   778  O  OD1 . ASN A 1 98  ? 23.645 26.521  17.295  1.00 23.89 ? 279 ASN A OD1 1 
ATOM   779  N  ND2 . ASN A 1 98  ? 24.041 24.503  18.219  1.00 21.17 ? 279 ASN A ND2 1 
ATOM   780  N  N   . VAL A 1 99  ? 20.225 26.268  21.200  1.00 15.50 ? 280 VAL A N   1 
ATOM   781  C  CA  . VAL A 1 99  ? 19.543 27.010  22.258  1.00 14.75 ? 280 VAL A CA  1 
ATOM   782  C  C   . VAL A 1 99  ? 18.941 26.024  23.273  1.00 14.49 ? 280 VAL A C   1 
ATOM   783  O  O   . VAL A 1 99  ? 19.053 26.262  24.473  1.00 15.69 ? 280 VAL A O   1 
ATOM   784  C  CB  . VAL A 1 99  ? 18.475 28.021  21.675  1.00 13.69 ? 280 VAL A CB  1 
ATOM   785  C  CG1 . VAL A 1 99  ? 17.561 28.594  22.793  1.00 15.53 ? 280 VAL A CG1 1 
ATOM   786  C  CG2 . VAL A 1 99  ? 19.160 29.216  20.992  1.00 14.29 ? 280 VAL A CG2 1 
ATOM   787  N  N   . LEU A 1 100 ? 18.275 24.944  22.823  1.00 12.83 ? 281 LEU A N   1 
ATOM   788  C  CA  . LEU A 1 100 ? 17.663 23.987  23.759  1.00 13.76 ? 281 LEU A CA  1 
ATOM   789  C  C   . LEU A 1 100 ? 18.672 23.080  24.475  1.00 15.63 ? 281 LEU A C   1 
ATOM   790  O  O   . LEU A 1 100 ? 18.512 22.760  25.660  1.00 15.75 ? 281 LEU A O   1 
ATOM   791  C  CB  . LEU A 1 100 ? 16.619 23.086  23.073  1.00 14.99 ? 281 LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 100 ? 15.405 23.792  22.474  1.00 12.81 ? 281 LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 100 ? 14.511 22.772  21.787  1.00 12.70 ? 281 LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 100 ? 14.564 24.654  23.502  1.00 15.13 ? 281 LEU A CD2 1 
ATOM   795  N  N   . HIS A 1 101 ? 19.714 22.696  23.752  1.00 14.86 ? 282 HIS A N   1 
ATOM   796  C  CA  . HIS A 1 101 ? 20.551 21.576  24.187  1.00 17.22 ? 282 HIS A CA  1 
ATOM   797  C  C   . HIS A 1 101 ? 21.978 21.969  24.500  1.00 18.91 ? 282 HIS A C   1 
ATOM   798  O  O   . HIS A 1 101 ? 22.683 21.210  25.169  1.00 19.26 ? 282 HIS A O   1 
ATOM   799  C  CB  . HIS A 1 101 ? 20.524 20.455  23.129  1.00 15.60 ? 282 HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 101 ? 19.134 19.946  22.846  1.00 15.39 ? 282 HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 101 ? 18.578 19.942  21.581  1.00 18.06 ? 282 HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 101 ? 18.167 19.501  23.679  1.00 11.72 ? 282 HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 101 ? 17.337 19.484  21.648  1.00 14.45 ? 282 HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 101 ? 17.072 19.186  22.910  1.00 18.58 ? 282 HIS A NE2 1 
ATOM   805  N  N   . GLU A 1 102 ? 22.393 23.140  24.064  1.00 20.78 ? 283 GLU A N   1 
ATOM   806  C  CA  . GLU A 1 102 ? 23.802 23.515  24.196  1.00 25.13 ? 283 GLU A CA  1 
ATOM   807  C  C   . GLU A 1 102 ? 23.954 24.911  24.781  1.00 26.52 ? 283 GLU A C   1 
ATOM   808  O  O   . GLU A 1 102 ? 24.953 25.613  24.535  1.00 27.85 ? 283 GLU A O   1 
ATOM   809  C  CB  . GLU A 1 102 ? 24.510 23.353  22.844  1.00 24.31 ? 283 GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 102 ? 24.664 21.879  22.451  1.00 27.21 ? 283 GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 102 ? 25.266 21.659  21.062  1.00 28.65 ? 283 GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 102 ? 25.656 20.503  20.770  1.00 33.44 ? 283 GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 102 ? 25.296 22.606  20.257  1.00 31.60 ? 283 GLU A OE2 1 
ATOM   814  N  N   . GLY A 1 103 ? 22.969 25.288  25.589  1.00 27.15 ? 284 GLY A N   1 
ATOM   815  C  CA  . GLY A 1 103 ? 22.838 26.645  26.068  1.00 30.84 ? 284 GLY A CA  1 
ATOM   816  C  C   . GLY A 1 103 ? 23.369 26.712  27.480  1.00 33.58 ? 284 GLY A C   1 
ATOM   817  O  O   . GLY A 1 103 ? 22.720 26.241  28.429  1.00 34.47 ? 284 GLY A O   1 
ATOM   818  N  N   . THR A 1 104 ? 24.543 27.304  27.623  1.00 34.84 ? 285 THR A N   1 
ATOM   819  C  CA  . THR A 1 104 ? 25.233 27.310  28.914  1.00 36.78 ? 285 THR A CA  1 
ATOM   820  C  C   . THR A 1 104 ? 24.950 28.559  29.759  1.00 36.92 ? 285 THR A C   1 
ATOM   821  O  O   . THR A 1 104 ? 25.361 28.628  30.923  1.00 38.37 ? 285 THR A O   1 
ATOM   822  C  CB  . THR A 1 104 ? 26.766 27.133  28.719  1.00 36.77 ? 285 THR A CB  1 
ATOM   823  O  OG1 . THR A 1 104 ? 27.284 28.288  28.066  1.00 40.12 ? 285 THR A OG1 1 
ATOM   824  C  CG2 . THR A 1 104 ? 27.075 25.880  27.879  1.00 37.07 ? 285 THR A CG2 1 
ATOM   825  N  N   . ASN A 1 105 ? 24.266 29.549  29.188  1.00 36.68 ? 286 ASN A N   1 
ATOM   826  C  CA  . ASN A 1 105 ? 24.027 30.810  29.903  1.00 36.82 ? 286 ASN A CA  1 
ATOM   827  C  C   . ASN A 1 105 ? 22.699 30.878  30.629  1.00 35.31 ? 286 ASN A C   1 
ATOM   828  O  O   . ASN A 1 105 ? 22.635 31.402  31.732  1.00 36.02 ? 286 ASN A O   1 
ATOM   829  C  CB  . ASN A 1 105 ? 24.105 32.026  28.973  1.00 37.91 ? 286 ASN A CB  1 
ATOM   830  C  CG  . ASN A 1 105 ? 25.455 32.180  28.313  1.00 41.57 ? 286 ASN A CG  1 
ATOM   831  O  OD1 . ASN A 1 105 ? 25.538 32.641  27.171  1.00 47.41 ? 286 ASN A OD1 1 
ATOM   832  N  ND2 . ASN A 1 105 ? 26.524 31.807  29.020  1.00 44.85 ? 286 ASN A ND2 1 
ATOM   833  N  N   . PHE A 1 106 ? 21.638 30.421  29.967  1.00 33.23 ? 287 PHE A N   1 
ATOM   834  C  CA  . PHE A 1 106 ? 20.280 30.485  30.508  1.00 31.20 ? 287 PHE A CA  1 
ATOM   835  C  C   . PHE A 1 106 ? 19.508 29.317  29.922  1.00 27.44 ? 287 PHE A C   1 
ATOM   836  O  O   . PHE A 1 106 ? 19.934 28.711  28.934  1.00 26.42 ? 287 PHE A O   1 
ATOM   837  C  CB  . PHE A 1 106 ? 19.575 31.845  30.231  1.00 33.12 ? 287 PHE A CB  1 
ATOM   838  C  CG  . PHE A 1 106 ? 19.414 32.188  28.755  1.00 34.65 ? 287 PHE A CG  1 
ATOM   839  C  CD1 . PHE A 1 106 ? 18.227 31.871  28.080  1.00 37.58 ? 287 PHE A CD1 1 
ATOM   840  C  CD2 . PHE A 1 106 ? 20.436 32.836  28.051  1.00 38.30 ? 287 PHE A CD2 1 
ATOM   841  C  CE1 . PHE A 1 106 ? 18.061 32.177  26.738  1.00 38.74 ? 287 PHE A CE1 1 
ATOM   842  C  CE2 . PHE A 1 106 ? 20.289 33.149  26.683  1.00 37.59 ? 287 PHE A CE2 1 
ATOM   843  C  CZ  . PHE A 1 106 ? 19.096 32.821  26.025  1.00 38.51 ? 287 PHE A CZ  1 
ATOM   844  N  N   . VAL A 1 107 ? 18.422 28.942  30.581  1.00 22.97 ? 288 VAL A N   1 
ATOM   845  C  CA  . VAL A 1 107 ? 17.568 27.909  30.050  1.00 19.24 ? 288 VAL A CA  1 
ATOM   846  C  C   . VAL A 1 107 ? 16.303 28.621  29.624  1.00 18.52 ? 288 VAL A C   1 
ATOM   847  O  O   . VAL A 1 107 ? 15.705 29.370  30.396  1.00 16.21 ? 288 VAL A O   1 
ATOM   848  C  CB  . VAL A 1 107 ? 17.273 26.808  31.136  1.00 19.79 ? 288 VAL A CB  1 
ATOM   849  C  CG1 . VAL A 1 107 ? 16.217 25.808  30.654  1.00 16.57 ? 288 VAL A CG1 1 
ATOM   850  C  CG2 . VAL A 1 107 ? 18.573 26.082  31.556  1.00 17.70 ? 288 VAL A CG2 1 
ATOM   851  N  N   . VAL A 1 108 ? 15.889 28.434  28.375  1.00 16.62 ? 289 VAL A N   1 
ATOM   852  C  CA  . VAL A 1 108 ? 14.705 29.171  27.959  1.00 16.98 ? 289 VAL A CA  1 
ATOM   853  C  C   . VAL A 1 108 ? 13.466 28.681  28.687  1.00 16.03 ? 289 VAL A C   1 
ATOM   854  O  O   . VAL A 1 108 ? 13.349 27.496  28.968  1.00 15.13 ? 289 VAL A O   1 
ATOM   855  C  CB  . VAL A 1 108 ? 14.483 29.146  26.464  1.00 18.12 ? 289 VAL A CB  1 
ATOM   856  C  CG1 . VAL A 1 108 ? 15.658 29.803  25.766  1.00 19.26 ? 289 VAL A CG1 1 
ATOM   857  C  CG2 . VAL A 1 108 ? 14.258 27.724  25.982  1.00 19.78 ? 289 VAL A CG2 1 
ATOM   858  N  N   . ASP A 1 109 ? 12.564 29.601  29.022  1.00 15.86 ? 290 ASP A N   1 
ATOM   859  C  CA  . ASP A 1 109 ? 11.412 29.202  29.809  1.00 15.99 ? 290 ASP A CA  1 
ATOM   860  C  C   . ASP A 1 109 ? 10.303 28.660  28.921  1.00 15.17 ? 290 ASP A C   1 
ATOM   861  O  O   . ASP A 1 109 ? 10.446 28.661  27.691  1.00 14.61 ? 290 ASP A O   1 
ATOM   862  C  CB  . ASP A 1 109 ? 10.947 30.290  30.790  1.00 17.13 ? 290 ASP A CB  1 
ATOM   863  C  CG  . ASP A 1 109 ? 10.342 31.516  30.124  1.00 21.84 ? 290 ASP A CG  1 
ATOM   864  O  OD1 . ASP A 1 109 ? 9.952  31.485  28.933  1.00 21.23 ? 290 ASP A OD1 1 
ATOM   865  O  OD2 . ASP A 1 109 ? 10.270 32.568  30.826  1.00 24.37 ? 290 ASP A OD2 1 
ATOM   866  N  N   . GLN A 1 110 ? 9.248  28.156  29.531  1.00 14.29 ? 291 GLN A N   1 
ATOM   867  C  CA  . GLN A 1 110 ? 8.245  27.445  28.758  1.00 15.27 ? 291 GLN A CA  1 
ATOM   868  C  C   . GLN A 1 110 ? 7.394  28.428  27.955  1.00 14.40 ? 291 GLN A C   1 
ATOM   869  O  O   . GLN A 1 110 ? 6.883  28.061  26.901  1.00 15.84 ? 291 GLN A O   1 
ATOM   870  C  CB  . GLN A 1 110 ? 7.452  26.450  29.604  1.00 16.00 ? 291 GLN A CB  1 
ATOM   871  C  CG  . GLN A 1 110 ? 6.884  25.199  28.826  1.00 18.21 ? 291 GLN A CG  1 
ATOM   872  C  CD  . GLN A 1 110 ? 7.968  24.354  28.098  1.00 18.94 ? 291 GLN A CD  1 
ATOM   873  O  OE1 . GLN A 1 110 ? 9.149  24.405  28.436  1.00 17.37 ? 291 GLN A OE1 1 
ATOM   874  N  NE2 . GLN A 1 110 ? 7.536  23.561  27.110  1.00 17.99 ? 291 GLN A NE2 1 
ATOM   875  N  N   . SER A 1 111 ? 7.317  29.676  28.411  1.00 15.17 ? 292 SER A N   1 
ATOM   876  C  CA  . SER A 1 111 ? 6.611  30.722  27.664  1.00 16.31 ? 292 SER A CA  1 
ATOM   877  C  C   . SER A 1 111 ? 7.372  30.981  26.366  1.00 15.73 ? 292 SER A C   1 
ATOM   878  O  O   . SER A 1 111 ? 6.764  31.108  25.286  1.00 14.73 ? 292 SER A O   1 
ATOM   879  C  CB  . SER A 1 111 ? 6.535  32.006  28.506  1.00 17.65 ? 292 SER A CB  1 
ATOM   880  O  OG  . SER A 1 111 ? 5.894  33.019  27.776  1.00 24.75 ? 292 SER A OG  1 
ATOM   881  N  N   . GLN A 1 112 ? 8.701  31.078  26.481  1.00 12.39 ? 293 GLN A N   1 
ATOM   882  C  CA  . GLN A 1 112 ? 9.519  31.198  25.291  1.00 13.10 ? 293 GLN A CA  1 
ATOM   883  C  C   . GLN A 1 112 ? 9.408  29.974  24.370  1.00 11.70 ? 293 GLN A C   1 
ATOM   884  O  O   . GLN A 1 112 ? 9.425  30.139  23.134  1.00 11.71 ? 293 GLN A O   1 
ATOM   885  C  CB  . GLN A 1 112 ? 10.965 31.456  25.678  1.00 13.15 ? 293 GLN A CB  1 
ATOM   886  C  CG  . GLN A 1 112 ? 11.832 31.750  24.455  1.00 17.76 ? 293 GLN A CG  1 
ATOM   887  C  CD  . GLN A 1 112 ? 11.404 33.005  23.697  1.00 22.23 ? 293 GLN A CD  1 
ATOM   888  O  OE1 . GLN A 1 112 ? 10.835 32.949  22.569  1.00 20.05 ? 293 GLN A OE1 1 
ATOM   889  N  NE2 . GLN A 1 112 ? 11.661 34.145  24.307  1.00 23.72 ? 293 GLN A NE2 1 
ATOM   890  N  N   . ALA A 1 113 ? 9.328  28.777  24.955  1.00 10.79 ? 294 ALA A N   1 
ATOM   891  C  CA  . ALA A 1 113 ? 9.155  27.535  24.177  1.00 10.82 ? 294 ALA A CA  1 
ATOM   892  C  C   . ALA A 1 113 ? 7.843  27.569  23.368  1.00 11.83 ? 294 ALA A C   1 
ATOM   893  O  O   . ALA A 1 113 ? 7.841  27.235  22.190  1.00 10.70 ? 294 ALA A O   1 
ATOM   894  C  CB  . ALA A 1 113 ? 9.207  26.313  25.064  1.00 10.34 ? 294 ALA A CB  1 
ATOM   895  N  N   . VAL A 1 114 ? 6.759  27.996  24.000  1.00 11.91 ? 295 VAL A N   1 
ATOM   896  C  CA  . VAL A 1 114 ? 5.470  28.156  23.276  1.00 12.71 ? 295 VAL A CA  1 
ATOM   897  C  C   . VAL A 1 114 ? 5.597  29.160  22.136  1.00 13.64 ? 295 VAL A C   1 
ATOM   898  O  O   . VAL A 1 114 ? 5.073  28.944  21.044  1.00 12.19 ? 295 VAL A O   1 
ATOM   899  C  CB  . VAL A 1 114 ? 4.291  28.518  24.248  1.00 13.88 ? 295 VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 114 ? 3.023  28.923  23.415  1.00 17.70 ? 295 VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 114 ? 4.009  27.332  25.165  1.00 15.80 ? 295 VAL A CG2 1 
ATOM   902  N  N   . LYS A 1 115 ? 6.282  30.275  22.390  1.00 12.76 ? 296 LYS A N   1 
ATOM   903  C  CA  . LYS A 1 115 ? 6.511  31.275  21.359  1.00 13.37 ? 296 LYS A CA  1 
ATOM   904  C  C   . LYS A 1 115 ? 7.346  30.677  20.212  1.00 13.34 ? 296 LYS A C   1 
ATOM   905  O  O   . LYS A 1 115 ? 7.058  30.959  19.057  1.00 12.09 ? 296 LYS A O   1 
ATOM   906  C  CB  . LYS A 1 115 ? 7.194  32.526  21.935  1.00 14.54 ? 296 LYS A CB  1 
ATOM   907  C  CG  . LYS A 1 115 ? 7.458  33.632  20.898  1.00 20.43 ? 296 LYS A CG  1 
ATOM   908  C  CD  . LYS A 1 115 ? 6.134  34.084  20.260  1.00 29.69 ? 296 LYS A CD  1 
ATOM   909  C  CE  . LYS A 1 115 ? 6.212  35.504  19.683  1.00 33.87 ? 296 LYS A CE  1 
ATOM   910  N  NZ  . LYS A 1 115 ? 7.118  35.567  18.500  1.00 34.79 ? 296 LYS A NZ  1 
ATOM   911  N  N   . PHE A 1 116 ? 8.395  29.897  20.517  1.00 10.96 ? 297 PHE A N   1 
ATOM   912  C  CA  . PHE A 1 116 ? 9.130  29.191  19.425  1.00 10.70 ? 297 PHE A CA  1 
ATOM   913  C  C   . PHE A 1 116 ? 8.202  28.299  18.583  1.00 9.59  ? 297 PHE A C   1 
ATOM   914  O  O   . PHE A 1 116 ? 8.320  28.300  17.355  1.00 8.15  ? 297 PHE A O   1 
ATOM   915  C  CB  . PHE A 1 116 ? 10.256 28.281  19.942  1.00 9.94  ? 297 PHE A CB  1 
ATOM   916  C  CG  . PHE A 1 116 ? 11.452 28.999  20.574  1.00 10.43 ? 297 PHE A CG  1 
ATOM   917  C  CD1 . PHE A 1 116 ? 11.790 30.304  20.268  1.00 8.79  ? 297 PHE A CD1 1 
ATOM   918  C  CD2 . PHE A 1 116 ? 12.294 28.256  21.407  1.00 12.20 ? 297 PHE A CD2 1 
ATOM   919  C  CE1 . PHE A 1 116 ? 12.965 30.899  20.820  1.00 12.58 ? 297 PHE A CE1 1 
ATOM   920  C  CE2 . PHE A 1 116 ? 13.455 28.816  21.972  1.00 9.98  ? 297 PHE A CE2 1 
ATOM   921  C  CZ  . PHE A 1 116 ? 13.779 30.152  21.708  1.00 9.77  ? 297 PHE A CZ  1 
ATOM   922  N  N   . ALA A 1 117 ? 7.366  27.511  19.258  1.00 10.36 ? 298 ALA A N   1 
ATOM   923  C  CA  . ALA A 1 117 ? 6.418  26.630  18.584  1.00 10.34 ? 298 ALA A CA  1 
ATOM   924  C  C   . ALA A 1 117 ? 5.484  27.416  17.630  1.00 11.30 ? 298 ALA A C   1 
ATOM   925  O  O   . ALA A 1 117 ? 5.299  27.022  16.473  1.00 12.45 ? 298 ALA A O   1 
ATOM   926  C  CB  . ALA A 1 117 ? 5.589  25.845  19.625  1.00 9.85  ? 298 ALA A CB  1 
ATOM   927  N  N   . LEU A 1 118 ? 4.945  28.539  18.117  1.00 10.56 ? 299 LEU A N   1 
ATOM   928  C  CA  . LEU A 1 118 ? 4.066  29.413  17.312  1.00 10.72 ? 299 LEU A CA  1 
ATOM   929  C  C   . LEU A 1 118 ? 4.795  30.028  16.129  1.00 10.85 ? 299 LEU A C   1 
ATOM   930  O  O   . LEU A 1 118 ? 4.275  30.052  14.997  1.00 10.08 ? 299 LEU A O   1 
ATOM   931  C  CB  . LEU A 1 118 ? 3.477  30.509  18.221  1.00 10.32 ? 299 LEU A CB  1 
ATOM   932  C  CG  . LEU A 1 118 ? 2.662  31.566  17.483  1.00 11.40 ? 299 LEU A CG  1 
ATOM   933  C  CD1 . LEU A 1 118 ? 1.500  30.864  16.661  1.00 11.48 ? 299 LEU A CD1 1 
ATOM   934  C  CD2 . LEU A 1 118 ? 2.109  32.551  18.520  1.00 13.99 ? 299 LEU A CD2 1 
ATOM   935  N  N   . ASP A 1 119 ? 6.009  30.516  16.375  1.00 9.82  ? 300 ASP A N   1 
ATOM   936  C  CA  . ASP A 1 119 ? 6.892  31.066  15.313  1.00 10.84 ? 300 ASP A CA  1 
ATOM   937  C  C   . ASP A 1 119 ? 7.098  29.996  14.227  1.00 10.42 ? 300 ASP A C   1 
ATOM   938  O  O   . ASP A 1 119 ? 6.957  30.290  13.026  1.00 9.54  ? 300 ASP A O   1 
ATOM   939  C  CB  . ASP A 1 119 ? 8.257  31.462  15.915  1.00 10.24 ? 300 ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 119 ? 8.240  32.820  16.650  1.00 16.23 ? 300 ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 119 ? 7.220  33.511  16.631  1.00 17.54 ? 300 ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 119 ? 9.262  33.179  17.288  1.00 18.26 ? 300 ASP A OD2 1 
HETATM 943  N  N   . MSE A 1 120 ? 7.510  28.779  14.614  1.00 9.43  ? 301 MSE A N   1 
HETATM 944  C  CA  . MSE A 1 120 ? 7.737  27.716  13.642  1.00 10.48 ? 301 MSE A CA  1 
HETATM 945  C  C   . MSE A 1 120 ? 6.498  27.334  12.876  1.00 9.97  ? 301 MSE A C   1 
HETATM 946  O  O   . MSE A 1 120 ? 6.564  27.140  11.659  1.00 10.30 ? 301 MSE A O   1 
HETATM 947  C  CB  . MSE A 1 120 ? 8.426  26.468  14.294  1.00 8.91  ? 301 MSE A CB  1 
HETATM 948  C  CG  . MSE A 1 120 ? 9.743  26.921  14.899  1.00 10.12 ? 301 MSE A CG  1 
HETATM 949  SE SE  . MSE A 1 120 ? 10.607 25.337  15.492  0.84 18.08 ? 301 MSE A SE  1 
HETATM 950  C  CE  . MSE A 1 120 ? 9.528  24.892  17.061  1.00 13.40 ? 301 MSE A CE  1 
ATOM   951  N  N   . ALA A 1 121 ? 5.369  27.260  13.569  1.00 8.50  ? 302 ALA A N   1 
ATOM   952  C  CA  . ALA A 1 121 ? 4.096  26.904  12.922  1.00 9.66  ? 302 ALA A CA  1 
ATOM   953  C  C   . ALA A 1 121 ? 3.673  27.962  11.888  1.00 9.87  ? 302 ALA A C   1 
ATOM   954  O  O   . ALA A 1 121 ? 3.204  27.616  10.800  1.00 10.21 ? 302 ALA A O   1 
ATOM   955  C  CB  . ALA A 1 121 ? 3.036  26.693  13.993  1.00 8.42  ? 302 ALA A CB  1 
ATOM   956  N  N   . ARG A 1 122 ? 3.879  29.244  12.218  1.00 10.29 ? 303 ARG A N   1 
ATOM   957  C  CA  . ARG A 1 122 ? 3.571  30.349  11.307  1.00 9.81  ? 303 ARG A CA  1 
ATOM   958  C  C   . ARG A 1 122 ? 4.475  30.277  10.091  1.00 9.19  ? 303 ARG A C   1 
ATOM   959  O  O   . ARG A 1 122 ? 4.000  30.453  8.959   1.00 9.26  ? 303 ARG A O   1 
ATOM   960  C  CB  . ARG A 1 122 ? 3.779  31.710  12.010  1.00 10.40 ? 303 ARG A CB  1 
ATOM   961  C  CG  . ARG A 1 122 ? 2.639  32.109  12.886  1.00 11.68 ? 303 ARG A CG  1 
ATOM   962  C  CD  . ARG A 1 122 ? 2.880  33.508  13.516  1.00 13.60 ? 303 ARG A CD  1 
ATOM   963  N  NE  . ARG A 1 122 ? 1.688  33.906  14.281  1.00 19.34 ? 303 ARG A NE  1 
ATOM   964  C  CZ  . ARG A 1 122 ? 1.727  34.678  15.360  1.00 23.67 ? 303 ARG A CZ  1 
ATOM   965  N  NH1 . ARG A 1 122 ? 2.915  35.093  15.816  1.00 20.57 ? 303 ARG A NH1 1 
ATOM   966  N  NH2 . ARG A 1 122 ? 0.584  35.036  15.976  1.00 20.70 ? 303 ARG A NH2 1 
ATOM   967  N  N   . GLY A 1 123 ? 5.774  30.053  10.313  1.00 8.26  ? 304 GLY A N   1 
ATOM   968  C  CA  . GLY A 1 123 ? 6.742  29.938  9.203   1.00 9.53  ? 304 GLY A CA  1 
ATOM   969  C  C   . GLY A 1 123 ? 6.404  28.740  8.309   1.00 10.33 ? 304 GLY A C   1 
ATOM   970  O  O   . GLY A 1 123 ? 6.394  28.847  7.053   1.00 9.77  ? 304 GLY A O   1 
HETATM 971  N  N   . MSE A 1 124 ? 6.054  27.609  8.935   1.00 9.66  ? 305 MSE A N   1 
HETATM 972  C  CA  . MSE A 1 124 ? 5.751  26.432  8.141   1.00 10.43 ? 305 MSE A CA  1 
HETATM 973  C  C   . MSE A 1 124 ? 4.425  26.616  7.385   1.00 10.90 ? 305 MSE A C   1 
HETATM 974  O  O   . MSE A 1 124 ? 4.315  26.156  6.229   1.00 10.22 ? 305 MSE A O   1 
HETATM 975  C  CB  . MSE A 1 124 ? 5.695  25.172  9.006   1.00 9.83  ? 305 MSE A CB  1 
HETATM 976  C  CG  . MSE A 1 124 ? 7.053  24.765  9.590   1.00 10.97 ? 305 MSE A CG  1 
HETATM 977  SE SE  . MSE A 1 124 ? 8.354  24.491  8.156   0.85 16.89 ? 305 MSE A SE  1 
HETATM 978  C  CE  . MSE A 1 124 ? 7.397  23.073  7.179   1.00 16.09 ? 305 MSE A CE  1 
ATOM   979  N  N   . ALA A 1 125 ? 3.433  27.231  8.035   1.00 10.57 ? 306 ALA A N   1 
ATOM   980  C  CA  . ALA A 1 125 ? 2.140  27.493  7.332   1.00 11.32 ? 306 ALA A CA  1 
ATOM   981  C  C   . ALA A 1 125 ? 2.419  28.290  6.049   1.00 11.21 ? 306 ALA A C   1 
ATOM   982  O  O   . ALA A 1 125 ? 1.844  28.012  4.971   1.00 11.08 ? 306 ALA A O   1 
ATOM   983  C  CB  . ALA A 1 125 ? 1.133  28.256  8.218   1.00 10.30 ? 306 ALA A CB  1 
ATOM   984  N  N   . PHE A 1 126 ? 3.297  29.277  6.168   1.00 9.52  ? 307 PHE A N   1 
ATOM   985  C  CA  . PHE A 1 126 ? 3.626  30.103  5.036   1.00 10.71 ? 307 PHE A CA  1 
ATOM   986  C  C   . PHE A 1 126 ? 4.297  29.289  3.950   1.00 10.21 ? 307 PHE A C   1 
ATOM   987  O  O   . PHE A 1 126 ? 3.937  29.376  2.760   1.00 10.27 ? 307 PHE A O   1 
ATOM   988  C  CB  . PHE A 1 126 ? 4.535  31.282  5.468   1.00 10.77 ? 307 PHE A CB  1 
ATOM   989  C  CG  . PHE A 1 126 ? 5.036  32.078  4.272   1.00 13.49 ? 307 PHE A CG  1 
ATOM   990  C  CD1 . PHE A 1 126 ? 4.181  32.952  3.640   1.00 15.71 ? 307 PHE A CD1 1 
ATOM   991  C  CD2 . PHE A 1 126 ? 6.292  31.858  3.738   1.00 14.86 ? 307 PHE A CD2 1 
ATOM   992  C  CE1 . PHE A 1 126 ? 4.598  33.653  2.521   1.00 19.53 ? 307 PHE A CE1 1 
ATOM   993  C  CE2 . PHE A 1 126 ? 6.721  32.502  2.605   1.00 19.39 ? 307 PHE A CE2 1 
ATOM   994  C  CZ  . PHE A 1 126 ? 5.871  33.396  1.976   1.00 16.36 ? 307 PHE A CZ  1 
ATOM   995  N  N   . LEU A 1 127 ? 5.359  28.554  4.324   1.00 9.37  ? 308 LEU A N   1 
ATOM   996  C  CA  . LEU A 1 127 ? 6.077  27.735  3.334   1.00 9.41  ? 308 LEU A CA  1 
ATOM   997  C  C   . LEU A 1 127 ? 5.153  26.719  2.669   1.00 9.81  ? 308 LEU A C   1 
ATOM   998  O  O   . LEU A 1 127 ? 5.311  26.414  1.488   1.00 10.65 ? 308 LEU A O   1 
ATOM   999  C  CB  . LEU A 1 127 ? 7.220  27.008  4.017   1.00 9.03  ? 308 LEU A CB  1 
ATOM   1000 C  CG  . LEU A 1 127 ? 8.319  27.990  4.452   1.00 8.53  ? 308 LEU A CG  1 
ATOM   1001 C  CD1 . LEU A 1 127 ? 9.418  27.214  5.273   1.00 11.74 ? 308 LEU A CD1 1 
ATOM   1002 C  CD2 . LEU A 1 127 ? 8.911  28.670  3.223   1.00 12.06 ? 308 LEU A CD2 1 
ATOM   1003 N  N   . HIS A 1 128 ? 4.164  26.234  3.416   1.00 10.44 ? 309 HIS A N   1 
ATOM   1004 C  CA  . HIS A 1 128 ? 3.211  25.287  2.834   1.00 11.79 ? 309 HIS A CA  1 
ATOM   1005 C  C   . HIS A 1 128 ? 2.253  25.901  1.826   1.00 12.68 ? 309 HIS A C   1 
ATOM   1006 O  O   . HIS A 1 128 ? 1.558  25.161  1.092   1.00 15.11 ? 309 HIS A O   1 
ATOM   1007 C  CB  . HIS A 1 128 ? 2.454  24.538  3.907   1.00 11.57 ? 309 HIS A CB  1 
ATOM   1008 C  CG  . HIS A 1 128 ? 3.248  23.407  4.475   1.00 9.58  ? 309 HIS A CG  1 
ATOM   1009 N  ND1 . HIS A 1 128 ? 2.717  22.513  5.364   1.00 11.15 ? 309 HIS A ND1 1 
ATOM   1010 C  CD2 . HIS A 1 128 ? 4.534  23.033  4.274   1.00 10.91 ? 309 HIS A CD2 1 
ATOM   1011 C  CE1 . HIS A 1 128 ? 3.632  21.618  5.683   1.00 11.77 ? 309 HIS A CE1 1 
ATOM   1012 N  NE2 . HIS A 1 128 ? 4.750  21.915  5.033   1.00 12.71 ? 309 HIS A NE2 1 
ATOM   1013 N  N   . THR A 1 129 ? 2.282  27.215  1.735   1.00 12.36 ? 310 THR A N   1 
ATOM   1014 C  CA  . THR A 1 129 ? 1.456  27.917  0.710   1.00 13.98 ? 310 THR A CA  1 
ATOM   1015 C  C   . THR A 1 129 ? 2.152  28.007  -0.627  1.00 14.69 ? 310 THR A C   1 
ATOM   1016 O  O   . THR A 1 129 ? 1.542  28.401  -1.654  1.00 14.28 ? 310 THR A O   1 
ATOM   1017 C  CB  . THR A 1 129 ? 1.021  29.319  1.137   1.00 11.99 ? 310 THR A CB  1 
ATOM   1018 O  OG1 . THR A 1 129 ? 2.131  30.262  1.095   1.00 13.36 ? 310 THR A OG1 1 
ATOM   1019 C  CG2 . THR A 1 129 ? 0.335  29.292  2.512   1.00 13.88 ? 310 THR A CG2 1 
ATOM   1020 N  N   . LEU A 1 130 ? 3.449  27.718  -0.646  1.00 14.74 ? 311 LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 130 ? 4.215  27.865  -1.889  1.00 16.35 ? 311 LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 130 ? 3.889  26.734  -2.865  1.00 18.15 ? 311 LEU A C   1 
ATOM   1023 O  O   . LEU A 1 130 ? 3.656  25.594  -2.452  1.00 17.61 ? 311 LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 130 ? 5.719  27.854  -1.581  1.00 16.66 ? 311 LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 130 ? 6.171  28.959  -0.625  1.00 17.11 ? 311 LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 130 ? 7.684  28.939  -0.465  1.00 17.44 ? 311 LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 130 ? 5.724  30.358  -1.079  1.00 19.40 ? 311 LEU A CD2 1 
ATOM   1028 N  N   . GLU A 1 131 ? 3.904  27.068  -4.156  1.00 22.11 ? 312 GLU A N   1 
ATOM   1029 C  CA  . GLU A 1 131 ? 3.627  26.103  -5.228  1.00 24.05 ? 312 GLU A CA  1 
ATOM   1030 C  C   . GLU A 1 131 ? 4.669  26.196  -6.342  1.00 23.98 ? 312 GLU A C   1 
ATOM   1031 O  O   . GLU A 1 131 ? 4.807  27.237  -6.979  1.00 25.80 ? 312 GLU A O   1 
ATOM   1032 C  CB  . GLU A 1 131 ? 2.208  26.303  -5.800  1.00 26.13 ? 312 GLU A CB  1 
ATOM   1033 C  CG  . GLU A 1 131 ? 1.916  25.461  -7.058  1.00 30.45 ? 312 GLU A CG  1 
ATOM   1034 C  CD  . GLU A 1 131 ? 1.898  23.940  -6.805  1.00 37.59 ? 312 GLU A CD  1 
ATOM   1035 O  OE1 . GLU A 1 131 ? 1.735  23.507  -5.639  1.00 39.13 ? 312 GLU A OE1 1 
ATOM   1036 O  OE2 . GLU A 1 131 ? 2.035  23.161  -7.783  1.00 41.87 ? 312 GLU A OE2 1 
ATOM   1037 N  N   . PRO A 1 132 ? 5.436  25.122  -6.547  1.00 23.46 ? 313 PRO A N   1 
ATOM   1038 C  CA  . PRO A 1 132 ? 5.350  23.917  -5.727  1.00 21.93 ? 313 PRO A CA  1 
ATOM   1039 C  C   . PRO A 1 132 ? 6.066  24.141  -4.377  1.00 19.47 ? 313 PRO A C   1 
ATOM   1040 O  O   . PRO A 1 132 ? 6.659  25.209  -4.172  1.00 18.89 ? 313 PRO A O   1 
ATOM   1041 C  CB  . PRO A 1 132 ? 6.122  22.886  -6.552  1.00 23.38 ? 313 PRO A CB  1 
ATOM   1042 C  CG  . PRO A 1 132 ? 7.121  23.687  -7.259  1.00 24.17 ? 313 PRO A CG  1 
ATOM   1043 C  CD  . PRO A 1 132 ? 6.492  25.011  -7.577  1.00 24.81 ? 313 PRO A CD  1 
ATOM   1044 N  N   . LEU A 1 133 ? 5.980  23.164  -3.488  1.00 18.03 ? 314 LEU A N   1 
ATOM   1045 C  CA  . LEU A 1 133 ? 6.641  23.248  -2.176  1.00 17.83 ? 314 LEU A CA  1 
ATOM   1046 C  C   . LEU A 1 133 ? 8.127  23.346  -2.437  1.00 17.41 ? 314 LEU A C   1 
ATOM   1047 O  O   . LEU A 1 133 ? 8.585  22.796  -3.447  1.00 16.37 ? 314 LEU A O   1 
ATOM   1048 C  CB  . LEU A 1 133 ? 6.359  21.989  -1.359  1.00 17.44 ? 314 LEU A CB  1 
ATOM   1049 C  CG  . LEU A 1 133 ? 4.968  21.842  -0.761  1.00 18.91 ? 314 LEU A CG  1 
ATOM   1050 C  CD1 . LEU A 1 133 ? 4.884  20.485  -0.083  1.00 21.59 ? 314 LEU A CD1 1 
ATOM   1051 C  CD2 . LEU A 1 133 ? 4.668  23.003  0.266   1.00 16.48 ? 314 LEU A CD2 1 
ATOM   1052 N  N   . ILE A 1 134 ? 8.892  23.990  -1.550  1.00 16.56 ? 315 ILE A N   1 
ATOM   1053 C  CA  . ILE A 1 134 ? 10.366 23.952  -1.683  1.00 17.78 ? 315 ILE A CA  1 
ATOM   1054 C  C   . ILE A 1 134 ? 10.799 22.491  -1.432  1.00 17.23 ? 315 ILE A C   1 
ATOM   1055 O  O   . ILE A 1 134 ? 10.481 21.943  -0.367  1.00 17.07 ? 315 ILE A O   1 
ATOM   1056 C  CB  . ILE A 1 134 ? 11.062 24.961  -0.714  1.00 18.36 ? 315 ILE A CB  1 
ATOM   1057 C  CG1 . ILE A 1 134 ? 10.914 26.428  -1.202  1.00 22.35 ? 315 ILE A CG1 1 
ATOM   1058 C  CG2 . ILE A 1 134 ? 12.602 24.734  -0.671  1.00 17.75 ? 315 ILE A CG2 1 
ATOM   1059 C  CD1 . ILE A 1 134 ? 9.579  26.792  -1.762  1.00 32.25 ? 315 ILE A CD1 1 
ATOM   1060 N  N   . PRO A 1 135 ? 11.486 21.846  -2.409  1.00 17.46 ? 316 PRO A N   1 
ATOM   1061 C  CA  . PRO A 1 135 ? 11.818 20.425  -2.290  1.00 17.97 ? 316 PRO A CA  1 
ATOM   1062 C  C   . PRO A 1 135 ? 12.955 20.205  -1.283  1.00 17.19 ? 316 PRO A C   1 
ATOM   1063 O  O   . PRO A 1 135 ? 13.743 21.117  -1.057  1.00 16.82 ? 316 PRO A O   1 
ATOM   1064 C  CB  . PRO A 1 135 ? 12.298 20.037  -3.685  1.00 18.73 ? 316 PRO A CB  1 
ATOM   1065 C  CG  . PRO A 1 135 ? 12.698 21.286  -4.362  1.00 19.47 ? 316 PRO A CG  1 
ATOM   1066 C  CD  . PRO A 1 135 ? 11.925 22.422  -3.697  1.00 18.29 ? 316 PRO A CD  1 
ATOM   1067 N  N   . ARG A 1 136 ? 12.958 19.033  -0.647  1.00 17.58 ? 317 ARG A N   1 
ATOM   1068 C  CA  . ARG A 1 136 ? 14.041 18.587  0.248   1.00 18.64 ? 317 ARG A CA  1 
ATOM   1069 C  C   . ARG A 1 136 ? 14.254 19.442  1.474   1.00 20.31 ? 317 ARG A C   1 
ATOM   1070 O  O   . ARG A 1 136 ? 15.394 19.522  2.001   1.00 21.47 ? 317 ARG A O   1 
ATOM   1071 C  CB  . ARG A 1 136 ? 15.360 18.422  -0.493  1.00 18.18 ? 317 ARG A CB  1 
ATOM   1072 C  CG  . ARG A 1 136 ? 15.240 17.462  -1.679  1.00 22.62 ? 317 ARG A CG  1 
ATOM   1073 C  CD  . ARG A 1 136 ? 16.514 17.533  -2.513  1.00 25.29 ? 317 ARG A CD  1 
ATOM   1074 N  NE  . ARG A 1 136 ? 16.560 18.799  -3.221  1.00 29.37 ? 317 ARG A NE  1 
ATOM   1075 C  CZ  . ARG A 1 136 ? 16.049 18.996  -4.442  1.00 28.84 ? 317 ARG A CZ  1 
ATOM   1076 N  NH1 . ARG A 1 136 ? 15.467 18.005  -5.096  1.00 28.58 ? 317 ARG A NH1 1 
ATOM   1077 N  NH2 . ARG A 1 136 ? 16.127 20.181  -4.996  1.00 29.18 ? 317 ARG A NH2 1 
ATOM   1078 N  N   . HIS A 1 137 ? 13.178 20.085  1.915   1.00 20.09 ? 318 HIS A N   1 
ATOM   1079 C  CA  . HIS A 1 137 ? 13.232 20.844  3.139   1.00 21.78 ? 318 HIS A CA  1 
ATOM   1080 C  C   . HIS A 1 137 ? 12.803 19.948  4.332   1.00 21.08 ? 318 HIS A C   1 
ATOM   1081 O  O   . HIS A 1 137 ? 11.701 19.465  4.316   1.00 23.46 ? 318 HIS A O   1 
ATOM   1082 C  CB  . HIS A 1 137 ? 12.332 22.069  3.034   1.00 23.91 ? 318 HIS A CB  1 
ATOM   1083 C  CG  . HIS A 1 137 ? 12.209 22.792  4.320   1.00 28.16 ? 318 HIS A CG  1 
ATOM   1084 N  ND1 . HIS A 1 137 ? 10.995 23.069  4.908   1.00 34.83 ? 318 HIS A ND1 1 
ATOM   1085 C  CD2 . HIS A 1 137 ? 13.159 23.201  5.191   1.00 30.91 ? 318 HIS A CD2 1 
ATOM   1086 C  CE1 . HIS A 1 137 ? 11.202 23.657  6.075   1.00 34.56 ? 318 HIS A CE1 1 
ATOM   1087 N  NE2 . HIS A 1 137 ? 12.506 23.747  6.269   1.00 34.32 ? 318 HIS A NE2 1 
ATOM   1088 N  N   . ALA A 1 138 ? 13.710 19.680  5.275   1.00 20.04 ? 319 ALA A N   1 
ATOM   1089 C  CA  . ALA A 1 138 ? 13.431 18.862  6.478   1.00 19.54 ? 319 ALA A CA  1 
ATOM   1090 C  C   . ALA A 1 138 ? 13.357 19.808  7.665   1.00 18.04 ? 319 ALA A C   1 
ATOM   1091 O  O   . ALA A 1 138 ? 14.295 20.603  7.903   1.00 20.35 ? 319 ALA A O   1 
ATOM   1092 C  CB  . ALA A 1 138 ? 14.536 17.833  6.727   1.00 19.65 ? 319 ALA A CB  1 
ATOM   1093 N  N   . LEU A 1 139 ? 12.281 19.682  8.428   1.00 15.82 ? 320 LEU A N   1 
ATOM   1094 C  CA  . LEU A 1 139 ? 12.124 20.497  9.639   1.00 13.37 ? 320 LEU A CA  1 
ATOM   1095 C  C   . LEU A 1 139 ? 12.734 19.718  10.804  1.00 13.08 ? 320 LEU A C   1 
ATOM   1096 O  O   . LEU A 1 139 ? 12.339 18.611  11.027  1.00 12.43 ? 320 LEU A O   1 
ATOM   1097 C  CB  . LEU A 1 139 ? 10.641 20.716  9.889   1.00 12.49 ? 320 LEU A CB  1 
ATOM   1098 C  CG  . LEU A 1 139 ? 10.246 21.500  11.151  1.00 11.41 ? 320 LEU A CG  1 
ATOM   1099 C  CD1 . LEU A 1 139 ? 10.972 22.885  11.193  1.00 12.18 ? 320 LEU A CD1 1 
ATOM   1100 C  CD2 . LEU A 1 139 ? 8.719  21.641  11.269  1.00 13.44 ? 320 LEU A CD2 1 
ATOM   1101 N  N   . ASN A 1 140 ? 13.645 20.341  11.552  1.00 12.54 ? 321 ASN A N   1 
ATOM   1102 C  CA  . ASN A 1 140 ? 14.176 19.748  12.783  1.00 12.43 ? 321 ASN A CA  1 
ATOM   1103 C  C   . ASN A 1 140 ? 14.810 20.865  13.568  1.00 12.18 ? 321 ASN A C   1 
ATOM   1104 O  O   . ASN A 1 140 ? 14.890 21.980  13.077  1.00 12.67 ? 321 ASN A O   1 
ATOM   1105 C  CB  . ASN A 1 140 ? 15.192 18.622  12.470  1.00 11.68 ? 321 ASN A CB  1 
ATOM   1106 C  CG  . ASN A 1 140 ? 16.284 19.062  11.527  1.00 13.63 ? 321 ASN A CG  1 
ATOM   1107 O  OD1 . ASN A 1 140 ? 16.948 20.089  11.735  1.00 14.49 ? 321 ASN A OD1 1 
ATOM   1108 N  ND2 . ASN A 1 140 ? 16.512 18.272  10.488  1.00 18.13 ? 321 ASN A ND2 1 
ATOM   1109 N  N   . SER A 1 141 ? 15.280 20.605  14.792  1.00 11.60 ? 322 SER A N   1 
ATOM   1110 C  CA  . SER A 1 141 ? 15.762 21.725  15.580  1.00 11.49 ? 322 SER A CA  1 
ATOM   1111 C  C   . SER A 1 141 ? 17.115 22.324  15.072  1.00 10.95 ? 322 SER A C   1 
ATOM   1112 O  O   . SER A 1 141 ? 17.484 23.446  15.392  1.00 11.79 ? 322 SER A O   1 
ATOM   1113 C  CB  . SER A 1 141 ? 15.767 21.304  17.065  1.00 12.36 ? 322 SER A CB  1 
ATOM   1114 O  OG  . SER A 1 141 ? 16.631 20.196  17.233  1.00 13.94 ? 322 SER A OG  1 
ATOM   1115 N  N   . ARG A 1 142 ? 17.846 21.593  14.245  1.00 11.62 ? 323 ARG A N   1 
ATOM   1116 C  CA  . ARG A 1 142 ? 19.032 22.142  13.598  1.00 13.48 ? 323 ARG A CA  1 
ATOM   1117 C  C   . ARG A 1 142 ? 18.732 23.044  12.399  1.00 13.85 ? 323 ARG A C   1 
ATOM   1118 O  O   . ARG A 1 142 ? 19.607 23.830  11.940  1.00 14.79 ? 323 ARG A O   1 
ATOM   1119 C  CB  . ARG A 1 142 ? 19.933 20.978  13.175  1.00 14.63 ? 323 ARG A CB  1 
ATOM   1120 C  CG  . ARG A 1 142 ? 20.675 20.414  14.407  1.00 18.32 ? 323 ARG A CG  1 
ATOM   1121 C  CD  . ARG A 1 142 ? 21.804 19.537  13.943  1.00 23.33 ? 323 ARG A CD  1 
ATOM   1122 N  NE  . ARG A 1 142 ? 22.456 18.740  14.995  1.00 25.03 ? 323 ARG A NE  1 
ATOM   1123 C  CZ  . ARG A 1 142 ? 23.412 19.209  15.793  1.00 27.26 ? 323 ARG A CZ  1 
ATOM   1124 N  NH1 . ARG A 1 142 ? 23.784 20.481  15.727  1.00 28.59 ? 323 ARG A NH1 1 
ATOM   1125 N  NH2 . ARG A 1 142 ? 24.002 18.405  16.662  1.00 26.17 ? 323 ARG A NH2 1 
ATOM   1126 N  N   . SER A 1 143 ? 17.517 22.934  11.863  1.00 12.28 ? 324 SER A N   1 
ATOM   1127 C  CA  . SER A 1 143 ? 17.154 23.730  10.683  1.00 12.96 ? 324 SER A CA  1 
ATOM   1128 C  C   . SER A 1 143 ? 16.190 24.899  11.011  1.00 12.24 ? 324 SER A C   1 
ATOM   1129 O  O   . SER A 1 143 ? 15.472 25.384  10.155  1.00 13.42 ? 324 SER A O   1 
ATOM   1130 C  CB  . SER A 1 143 ? 16.622 22.874  9.553   1.00 14.34 ? 324 SER A CB  1 
ATOM   1131 O  OG  . SER A 1 143 ? 15.352 22.365  9.878   1.00 15.66 ? 324 SER A OG  1 
ATOM   1132 N  N   . VAL A 1 144 ? 16.204 25.335  12.262  1.00 10.70 ? 325 VAL A N   1 
ATOM   1133 C  CA  . VAL A 1 144 ? 15.469 26.523  12.689  1.00 10.46 ? 325 VAL A CA  1 
ATOM   1134 C  C   . VAL A 1 144 ? 16.512 27.362  13.412  1.00 11.05 ? 325 VAL A C   1 
ATOM   1135 O  O   . VAL A 1 144 ? 17.258 26.815  14.214  1.00 13.31 ? 325 VAL A O   1 
ATOM   1136 C  CB  . VAL A 1 144 ? 14.319 26.142  13.662  1.00 10.16 ? 325 VAL A CB  1 
ATOM   1137 C  CG1 . VAL A 1 144 ? 13.594 27.417  14.266  1.00 11.19 ? 325 VAL A CG1 1 
ATOM   1138 C  CG2 . VAL A 1 144 ? 13.292 25.177  12.983  1.00 9.69  ? 325 VAL A CG2 1 
HETATM 1139 N  N   . MSE A 1 145 ? 16.606 28.649  13.105  1.00 11.51 ? 326 MSE A N   1 
HETATM 1140 C  CA  . MSE A 1 145 ? 17.587 29.568  13.759  1.00 12.05 ? 326 MSE A CA  1 
HETATM 1141 C  C   . MSE A 1 145 ? 16.829 30.466  14.740  1.00 12.46 ? 326 MSE A C   1 
HETATM 1142 O  O   . MSE A 1 145 ? 15.642 30.760  14.542  1.00 12.14 ? 326 MSE A O   1 
HETATM 1143 C  CB  . MSE A 1 145 ? 18.242 30.451  12.695  1.00 11.44 ? 326 MSE A CB  1 
HETATM 1144 C  CG  . MSE A 1 145 ? 19.010 29.693  11.652  1.00 13.61 ? 326 MSE A CG  1 
HETATM 1145 SE SE  . MSE A 1 145 ? 20.538 28.762  12.515  0.82 24.38 ? 326 MSE A SE  1 
HETATM 1146 C  CE  . MSE A 1 145 ? 20.092 27.033  11.762  1.00 20.33 ? 326 MSE A CE  1 
ATOM   1147 N  N   . ILE A 1 146 ? 17.540 30.953  15.764  1.00 12.42 ? 327 ILE A N   1 
ATOM   1148 C  CA  . ILE A 1 146 ? 16.951 31.827  16.784  1.00 13.61 ? 327 ILE A CA  1 
ATOM   1149 C  C   . ILE A 1 146 ? 17.584 33.236  16.657  1.00 15.32 ? 327 ILE A C   1 
ATOM   1150 O  O   . ILE A 1 146 ? 18.815 33.369  16.750  1.00 14.00 ? 327 ILE A O   1 
ATOM   1151 C  CB  . ILE A 1 146 ? 17.182 31.212  18.199  1.00 11.79 ? 327 ILE A CB  1 
ATOM   1152 C  CG1 . ILE A 1 146 ? 16.626 29.779  18.274  1.00 13.80 ? 327 ILE A CG1 1 
ATOM   1153 C  CG2 . ILE A 1 146 ? 16.519 32.099  19.267  1.00 14.93 ? 327 ILE A CG2 1 
ATOM   1154 C  CD1 . ILE A 1 146 ? 15.068 29.560  17.920  1.00 11.24 ? 327 ILE A CD1 1 
ATOM   1155 N  N   . ASP A 1 147 ? 16.772 34.246  16.360  1.00 17.57 ? 328 ASP A N   1 
ATOM   1156 C  CA  . ASP A 1 147 ? 17.257 35.617  16.131  1.00 21.23 ? 328 ASP A CA  1 
ATOM   1157 C  C   . ASP A 1 147 ? 17.546 36.344  17.461  1.00 22.80 ? 328 ASP A C   1 
ATOM   1158 O  O   . ASP A 1 147 ? 17.258 35.814  18.527  1.00 21.55 ? 328 ASP A O   1 
ATOM   1159 C  CB  . ASP A 1 147 ? 16.233 36.396  15.271  1.00 22.21 ? 328 ASP A CB  1 
ATOM   1160 C  CG  . ASP A 1 147 ? 16.893 37.364  14.261  1.00 26.38 ? 328 ASP A CG  1 
ATOM   1161 O  OD1 . ASP A 1 147 ? 17.957 37.963  14.573  1.00 31.12 ? 328 ASP A OD1 1 
ATOM   1162 O  OD2 . ASP A 1 147 ? 16.325 37.574  13.149  1.00 29.36 ? 328 ASP A OD2 1 
ATOM   1163 N  N   . GLU A 1 148 ? 18.082 37.568  17.371  1.00 26.41 ? 329 GLU A N   1 
ATOM   1164 C  CA  . GLU A 1 148 ? 18.433 38.402  18.553  1.00 29.28 ? 329 GLU A CA  1 
ATOM   1165 C  C   . GLU A 1 148 ? 17.271 38.609  19.538  1.00 27.87 ? 329 GLU A C   1 
ATOM   1166 O  O   . GLU A 1 148 ? 17.488 38.654  20.764  1.00 29.54 ? 329 GLU A O   1 
ATOM   1167 C  CB  . GLU A 1 148 ? 19.020 39.766  18.114  1.00 29.43 ? 329 GLU A CB  1 
ATOM   1168 C  CG  . GLU A 1 148 ? 17.987 40.759  17.493  1.00 33.57 ? 329 GLU A CG  1 
ATOM   1169 C  CD  . GLU A 1 148 ? 18.588 41.759  16.477  1.00 35.01 ? 329 GLU A CD  1 
ATOM   1170 O  OE1 . GLU A 1 148 ? 17.856 42.115  15.504  1.00 42.11 ? 329 GLU A OE1 1 
ATOM   1171 O  OE2 . GLU A 1 148 ? 19.778 42.170  16.636  1.00 41.62 ? 329 GLU A OE2 1 
ATOM   1172 N  N   . ASP A 1 149 ? 16.048 38.724  19.024  1.00 26.94 ? 330 ASP A N   1 
ATOM   1173 C  CA  . ASP A 1 149 ? 14.898 38.941  19.899  1.00 26.43 ? 330 ASP A CA  1 
ATOM   1174 C  C   . ASP A 1 149 ? 14.131 37.651  20.208  1.00 24.79 ? 330 ASP A C   1 
ATOM   1175 O  O   . ASP A 1 149 ? 12.967 37.696  20.641  1.00 24.19 ? 330 ASP A O   1 
ATOM   1176 C  CB  . ASP A 1 149 ? 13.977 40.024  19.312  1.00 28.06 ? 330 ASP A CB  1 
ATOM   1177 C  CG  . ASP A 1 149 ? 13.442 39.658  17.945  1.00 30.61 ? 330 ASP A CG  1 
ATOM   1178 O  OD1 . ASP A 1 149 ? 13.701 38.520  17.481  1.00 32.57 ? 330 ASP A OD1 1 
ATOM   1179 O  OD2 . ASP A 1 149 ? 12.749 40.511  17.329  1.00 36.47 ? 330 ASP A OD2 1 
HETATM 1180 N  N   . MSE A 1 150 ? 14.828 36.523  20.022  1.00 22.71 ? 331 MSE A N   1 
HETATM 1181 C  CA  . MSE A 1 150 ? 14.370 35.156  20.336  1.00 21.75 ? 331 MSE A CA  1 
HETATM 1182 C  C   . MSE A 1 150 ? 13.292 34.689  19.356  1.00 19.89 ? 331 MSE A C   1 
HETATM 1183 O  O   . MSE A 1 150 ? 12.584 33.751  19.658  1.00 21.07 ? 331 MSE A O   1 
HETATM 1184 C  CB  . MSE A 1 150 ? 13.843 35.012  21.779  1.00 22.41 ? 331 MSE A CB  1 
HETATM 1185 C  CG  . MSE A 1 150 ? 14.772 35.576  22.855  1.00 26.85 ? 331 MSE A CG  1 
HETATM 1186 SE SE  . MSE A 1 150 ? 16.370 34.524  22.828  0.69 39.84 ? 331 MSE A SE  1 
HETATM 1187 C  CE  . MSE A 1 150 ? 15.646 32.973  23.497  1.00 22.58 ? 331 MSE A CE  1 
ATOM   1188 N  N   . THR A 1 151 ? 13.131 35.372  18.234  1.00 17.16 ? 332 THR A N   1 
ATOM   1189 C  CA  . THR A 1 151 ? 12.202 34.877  17.183  1.00 16.63 ? 332 THR A CA  1 
ATOM   1190 C  C   . THR A 1 151 ? 12.798 33.658  16.498  1.00 14.29 ? 332 THR A C   1 
ATOM   1191 O  O   . THR A 1 151 ? 13.952 33.703  16.055  1.00 15.43 ? 332 THR A O   1 
ATOM   1192 C  CB  . THR A 1 151 ? 12.006 35.960  16.119  1.00 17.54 ? 332 THR A CB  1 
ATOM   1193 O  OG1 . THR A 1 151 ? 11.494 37.149  16.755  1.00 20.72 ? 332 THR A OG1 1 
ATOM   1194 C  CG2 . THR A 1 151 ? 10.975 35.522  15.072  1.00 16.86 ? 332 THR A CG2 1 
ATOM   1195 N  N   . ALA A 1 152 ? 11.999 32.599  16.359  1.00 12.42 ? 333 ALA A N   1 
ATOM   1196 C  CA  . ALA A 1 152 ? 12.452 31.403  15.638  1.00 12.39 ? 333 ALA A CA  1 
ATOM   1197 C  C   . ALA A 1 152 ? 12.201 31.576  14.152  1.00 12.25 ? 333 ALA A C   1 
ATOM   1198 O  O   . ALA A 1 152 ? 11.142 32.107  13.745  1.00 10.80 ? 333 ALA A O   1 
ATOM   1199 C  CB  . ALA A 1 152 ? 11.693 30.196  16.116  1.00 13.58 ? 333 ALA A CB  1 
ATOM   1200 N  N   . ARG A 1 153 ? 13.155 31.129  13.336  1.00 10.58 ? 334 ARG A N   1 
ATOM   1201 C  CA  . ARG A 1 153 ? 13.011 31.326  11.879  1.00 11.88 ? 334 ARG A CA  1 
ATOM   1202 C  C   . ARG A 1 153 ? 13.425 30.076  11.143  1.00 12.05 ? 334 ARG A C   1 
ATOM   1203 O  O   . ARG A 1 153 ? 14.484 29.514  11.429  1.00 11.78 ? 334 ARG A O   1 
ATOM   1204 C  CB  . ARG A 1 153 ? 13.861 32.542  11.428  1.00 9.70  ? 334 ARG A CB  1 
ATOM   1205 C  CG  . ARG A 1 153 ? 13.474 33.850  12.179  1.00 13.17 ? 334 ARG A CG  1 
ATOM   1206 C  CD  . ARG A 1 153 ? 14.268 35.014  11.718  1.00 14.98 ? 334 ARG A CD  1 
ATOM   1207 N  NE  . ARG A 1 153 ? 13.853 35.418  10.381  1.00 15.41 ? 334 ARG A NE  1 
ATOM   1208 C  CZ  . ARG A 1 153 ? 14.384 36.437  9.700   1.00 20.73 ? 334 ARG A CZ  1 
ATOM   1209 N  NH1 . ARG A 1 153 ? 15.379 37.185  10.231  1.00 17.83 ? 334 ARG A NH1 1 
ATOM   1210 N  NH2 . ARG A 1 153 ? 13.928 36.704  8.482   1.00 18.99 ? 334 ARG A NH2 1 
ATOM   1211 N  N   . ILE A 1 154 ? 12.583 29.636  10.204  1.00 11.18 ? 335 ILE A N   1 
ATOM   1212 C  CA  . ILE A 1 154 ? 12.900 28.419  9.445   1.00 11.53 ? 335 ILE A CA  1 
ATOM   1213 C  C   . ILE A 1 154 ? 14.081 28.741  8.538   1.00 11.56 ? 335 ILE A C   1 
ATOM   1214 O  O   . ILE A 1 154 ? 14.064 29.705  7.810   1.00 10.75 ? 335 ILE A O   1 
ATOM   1215 C  CB  . ILE A 1 154 ? 11.675 27.868  8.597   1.00 12.57 ? 335 ILE A CB  1 
ATOM   1216 C  CG1 . ILE A 1 154 ? 10.351 27.758  9.460   1.00 11.58 ? 335 ILE A CG1 1 
ATOM   1217 C  CG2 . ILE A 1 154 ? 12.128 26.538  7.927   1.00 12.28 ? 335 ILE A CG2 1 
ATOM   1218 C  CD1 . ILE A 1 154 ? 10.529 26.986  10.790  1.00 13.51 ? 335 ILE A CD1 1 
ATOM   1219 N  N   . SER A 1 155 ? 15.135 27.929  8.600   1.00 11.35 ? 336 SER A N   1 
ATOM   1220 C  CA  . SER A 1 155 ? 16.376 28.256  7.877   1.00 12.47 ? 336 SER A CA  1 
ATOM   1221 C  C   . SER A 1 155 ? 16.420 27.717  6.443   1.00 11.41 ? 336 SER A C   1 
ATOM   1222 O  O   . SER A 1 155 ? 16.590 26.520  6.196   1.00 11.89 ? 336 SER A O   1 
ATOM   1223 C  CB  . SER A 1 155 ? 17.581 27.738  8.661   1.00 14.86 ? 336 SER A CB  1 
ATOM   1224 O  OG  . SER A 1 155 ? 18.774 28.041  7.962   1.00 16.32 ? 336 SER A OG  1 
HETATM 1225 N  N   . MSE A 1 156 ? 16.281 28.614  5.480   1.00 11.79 ? 337 MSE A N   1 
HETATM 1226 C  CA  . MSE A 1 156 ? 16.277 28.175  4.069   1.00 11.91 ? 337 MSE A CA  1 
HETATM 1227 C  C   . MSE A 1 156 ? 17.654 27.657  3.648   1.00 12.21 ? 337 MSE A C   1 
HETATM 1228 O  O   . MSE A 1 156 ? 17.755 26.840  2.720   1.00 10.82 ? 337 MSE A O   1 
HETATM 1229 C  CB  . MSE A 1 156 ? 15.788 29.283  3.105   1.00 12.92 ? 337 MSE A CB  1 
HETATM 1230 C  CG  . MSE A 1 156 ? 14.513 29.945  3.444   1.00 12.78 ? 337 MSE A CG  1 
HETATM 1231 SE SE  . MSE A 1 156 ? 13.140 28.601  3.216   0.82 26.00 ? 337 MSE A SE  1 
HETATM 1232 C  CE  . MSE A 1 156 ? 12.963 28.066  4.658   1.00 5.98  ? 337 MSE A CE  1 
ATOM   1233 N  N   . ALA A 1 157 ? 18.714 28.080  4.354   1.00 12.28 ? 338 ALA A N   1 
ATOM   1234 C  CA  . ALA A 1 157 ? 20.069 27.582  4.000   1.00 14.36 ? 338 ALA A CA  1 
ATOM   1235 C  C   . ALA A 1 157 ? 20.267 26.087  4.377   1.00 15.28 ? 338 ALA A C   1 
ATOM   1236 O  O   . ALA A 1 157 ? 21.226 25.440  3.908   1.00 17.14 ? 338 ALA A O   1 
ATOM   1237 C  CB  . ALA A 1 157 ? 21.145 28.445  4.629   1.00 13.60 ? 338 ALA A CB  1 
ATOM   1238 N  N   . ASP A 1 158 ? 19.363 25.552  5.199   1.00 15.10 ? 339 ASP A N   1 
ATOM   1239 C  CA  . ASP A 1 158 ? 19.394 24.140  5.566   1.00 16.97 ? 339 ASP A CA  1 
ATOM   1240 C  C   . ASP A 1 158 ? 18.587 23.176  4.696   1.00 17.50 ? 339 ASP A C   1 
ATOM   1241 O  O   . ASP A 1 158 ? 18.438 21.979  5.021   1.00 18.28 ? 339 ASP A O   1 
ATOM   1242 C  CB  . ASP A 1 158 ? 19.075 24.011  7.060   1.00 16.52 ? 339 ASP A CB  1 
ATOM   1243 C  CG  . ASP A 1 158 ? 20.246 24.524  7.912   1.00 21.87 ? 339 ASP A CG  1 
ATOM   1244 O  OD1 . ASP A 1 158 ? 21.340 23.953  7.780   1.00 26.11 ? 339 ASP A OD1 1 
ATOM   1245 O  OD2 . ASP A 1 158 ? 20.124 25.531  8.626   1.00 24.26 ? 339 ASP A OD2 1 
ATOM   1246 N  N   . VAL A 1 159 ? 18.118 23.650  3.542   1.00 17.30 ? 340 VAL A N   1 
ATOM   1247 C  CA  . VAL A 1 159 ? 17.454 22.761  2.634   1.00 18.48 ? 340 VAL A CA  1 
ATOM   1248 C  C   . VAL A 1 159 ? 18.542 21.950  1.914   1.00 19.78 ? 340 VAL A C   1 
ATOM   1249 O  O   . VAL A 1 159 ? 19.573 22.490  1.620   1.00 21.43 ? 340 VAL A O   1 
ATOM   1250 C  CB  . VAL A 1 159 ? 16.640 23.553  1.625   1.00 17.92 ? 340 VAL A CB  1 
ATOM   1251 C  CG1 . VAL A 1 159 ? 15.860 22.629  0.722   1.00 21.26 ? 340 VAL A CG1 1 
ATOM   1252 C  CG2 . VAL A 1 159 ? 15.630 24.418  2.330   1.00 18.26 ? 340 VAL A CG2 1 
ATOM   1253 N  N   . LYS A 1 160 ? 18.317 20.678  1.625   1.00 19.02 ? 341 LYS A N   1 
ATOM   1254 C  CA  . LYS A 1 160 ? 19.331 19.912  0.909   1.00 19.68 ? 341 LYS A CA  1 
ATOM   1255 C  C   . LYS A 1 160 ? 19.148 20.135  -0.572  1.00 19.32 ? 341 LYS A C   1 
ATOM   1256 O  O   . LYS A 1 160 ? 18.019 20.227  -1.058  1.00 18.80 ? 341 LYS A O   1 
ATOM   1257 C  CB  . LYS A 1 160 ? 19.223 18.409  1.191   1.00 20.23 ? 341 LYS A CB  1 
ATOM   1258 C  CG  . LYS A 1 160 ? 19.748 17.992  2.530   1.00 24.12 ? 341 LYS A CG  1 
ATOM   1259 C  CD  . LYS A 1 160 ? 19.401 16.539  2.844   1.00 30.39 ? 341 LYS A CD  1 
ATOM   1260 C  CE  . LYS A 1 160 ? 20.200 15.545  2.046   1.00 29.88 ? 341 LYS A CE  1 
ATOM   1261 N  NZ  . LYS A 1 160 ? 20.282 14.211  2.780   1.00 25.22 ? 341 LYS A NZ  1 
ATOM   1262 N  N   . PHE A 1 161 ? 20.261 20.126  -1.297  1.00 18.77 ? 342 PHE A N   1 
ATOM   1263 C  CA  . PHE A 1 161 ? 20.188 20.242  -2.765  1.00 19.19 ? 342 PHE A CA  1 
ATOM   1264 C  C   . PHE A 1 161 ? 20.081 18.889  -3.421  1.00 20.75 ? 342 PHE A C   1 
ATOM   1265 O  O   . PHE A 1 161 ? 20.384 17.883  -2.786  1.00 21.03 ? 342 PHE A O   1 
ATOM   1266 C  CB  . PHE A 1 161 ? 21.381 21.028  -3.265  1.00 17.97 ? 342 PHE A CB  1 
ATOM   1267 C  CG  . PHE A 1 161 ? 21.329 22.431  -2.826  1.00 17.33 ? 342 PHE A CG  1 
ATOM   1268 C  CD1 . PHE A 1 161 ? 20.590 23.371  -3.569  1.00 18.90 ? 342 PHE A CD1 1 
ATOM   1269 C  CD2 . PHE A 1 161 ? 21.912 22.818  -1.632  1.00 17.17 ? 342 PHE A CD2 1 
ATOM   1270 C  CE1 . PHE A 1 161 ? 20.507 24.691  -3.129  1.00 15.41 ? 342 PHE A CE1 1 
ATOM   1271 C  CE2 . PHE A 1 161 ? 21.836 24.129  -1.186  1.00 18.64 ? 342 PHE A CE2 1 
ATOM   1272 C  CZ  . PHE A 1 161 ? 21.099 25.062  -1.928  1.00 16.81 ? 342 PHE A CZ  1 
ATOM   1273 N  N   . SER A 1 162 ? 19.642 18.869  -4.675  1.00 21.73 ? 343 SER A N   1 
ATOM   1274 C  CA  . SER A 1 162 ? 19.452 17.620  -5.399  1.00 23.45 ? 343 SER A CA  1 
ATOM   1275 C  C   . SER A 1 162 ? 20.734 16.781  -5.458  1.00 24.60 ? 343 SER A C   1 
ATOM   1276 O  O   . SER A 1 162 ? 20.663 15.566  -5.494  1.00 26.04 ? 343 SER A O   1 
ATOM   1277 C  CB  . SER A 1 162 ? 18.929 17.879  -6.808  1.00 23.78 ? 343 SER A CB  1 
ATOM   1278 O  OG  . SER A 1 162 ? 19.806 18.740  -7.508  1.00 23.25 ? 343 SER A OG  1 
ATOM   1279 N  N   . PHE A 1 163 ? 21.899 17.424  -5.446  1.00 24.96 ? 344 PHE A N   1 
ATOM   1280 C  CA  . PHE A 1 163 ? 23.158 16.684  -5.609  1.00 25.88 ? 344 PHE A CA  1 
ATOM   1281 C  C   . PHE A 1 163 ? 23.766 16.282  -4.288  1.00 27.23 ? 344 PHE A C   1 
ATOM   1282 O  O   . PHE A 1 163 ? 24.831 15.665  -4.274  1.00 27.48 ? 344 PHE A O   1 
ATOM   1283 C  CB  . PHE A 1 163 ? 24.174 17.532  -6.381  1.00 23.92 ? 344 PHE A CB  1 
ATOM   1284 C  CG  . PHE A 1 163 ? 24.316 18.918  -5.835  1.00 22.98 ? 344 PHE A CG  1 
ATOM   1285 C  CD1 . PHE A 1 163 ? 25.041 19.158  -4.669  1.00 21.59 ? 344 PHE A CD1 1 
ATOM   1286 C  CD2 . PHE A 1 163 ? 23.660 19.972  -6.437  1.00 19.56 ? 344 PHE A CD2 1 
ATOM   1287 C  CE1 . PHE A 1 163 ? 25.143 20.438  -4.132  1.00 20.23 ? 344 PHE A CE1 1 
ATOM   1288 C  CE2 . PHE A 1 163 ? 23.762 21.244  -5.916  1.00 17.43 ? 344 PHE A CE2 1 
ATOM   1289 C  CZ  . PHE A 1 163 ? 24.509 21.478  -4.756  1.00 21.76 ? 344 PHE A CZ  1 
ATOM   1290 N  N   . GLN A 1 164 ? 23.157 16.686  -3.175  1.00 29.05 ? 345 GLN A N   1 
ATOM   1291 C  CA  . GLN A 1 164 ? 23.724 16.320  -1.874  1.00 31.95 ? 345 GLN A CA  1 
ATOM   1292 C  C   . GLN A 1 164 ? 23.061 15.154  -1.141  1.00 33.66 ? 345 GLN A C   1 
ATOM   1293 O  O   . GLN A 1 164 ? 21.940 15.254  -0.621  1.00 34.68 ? 345 GLN A O   1 
ATOM   1294 C  CB  . GLN A 1 164 ? 24.009 17.518  -0.956  1.00 31.63 ? 345 GLN A CB  1 
ATOM   1295 C  CG  . GLN A 1 164 ? 22.921 18.450  -0.708  1.00 34.23 ? 345 GLN A CG  1 
ATOM   1296 C  CD  . GLN A 1 164 ? 23.314 19.527  0.274   1.00 34.67 ? 345 GLN A CD  1 
ATOM   1297 O  OE1 . GLN A 1 164 ? 24.471 19.628  0.716   1.00 37.52 ? 345 GLN A OE1 1 
ATOM   1298 N  NE2 . GLN A 1 164 ? 22.378 20.357  0.592   1.00 31.41 ? 345 GLN A NE2 1 
ATOM   1299 N  N   . SER A 1 165 ? 23.772 14.024  -1.184  1.00 35.26 ? 346 SER A N   1 
ATOM   1300 C  CA  . SER A 1 165 ? 23.541 12.852  -0.337  1.00 35.70 ? 346 SER A CA  1 
ATOM   1301 C  C   . SER A 1 165 ? 22.080 12.419  -0.194  1.00 35.33 ? 346 SER A C   1 
ATOM   1302 O  O   . SER A 1 165 ? 21.549 12.481  0.906   1.00 34.41 ? 346 SER A O   1 
ATOM   1303 C  CB  . SER A 1 165 ? 24.153 13.102  1.060   1.00 36.46 ? 346 SER A CB  1 
ATOM   1304 O  OG  . SER A 1 165 ? 23.295 13.829  1.961   1.00 35.99 ? 346 SER A OG  1 
ATOM   1305 N  N   . PRO A 1 166 ? 21.446 11.924  -1.281  1.00 35.02 ? 347 PRO A N   1 
ATOM   1306 C  CA  . PRO A 1 166 ? 20.003 11.658  -1.149  1.00 35.09 ? 347 PRO A CA  1 
ATOM   1307 C  C   . PRO A 1 166 ? 19.734 10.335  -0.394  1.00 34.71 ? 347 PRO A C   1 
ATOM   1308 O  O   . PRO A 1 166 ? 18.632 10.105  0.145   1.00 35.88 ? 347 PRO A O   1 
ATOM   1309 C  CB  . PRO A 1 166 ? 19.518 11.600  -2.603  1.00 35.35 ? 347 PRO A CB  1 
ATOM   1310 C  CG  . PRO A 1 166 ? 20.724 11.200  -3.397  1.00 35.54 ? 347 PRO A CG  1 
ATOM   1311 C  CD  . PRO A 1 166 ? 21.971 11.524  -2.603  1.00 35.65 ? 347 PRO A CD  1 
ATOM   1312 N  N   . GLY A 1 167 ? 20.753 9.488   -0.340  1.00 33.41 ? 348 GLY A N   1 
ATOM   1313 C  CA  . GLY A 1 167 ? 20.668 8.232   0.410   1.00 31.27 ? 348 GLY A CA  1 
ATOM   1314 C  C   . GLY A 1 167 ? 21.195 8.281   1.831   1.00 30.18 ? 348 GLY A C   1 
ATOM   1315 O  O   . GLY A 1 167 ? 21.299 7.246   2.477   1.00 29.35 ? 348 GLY A O   1 
ATOM   1316 N  N   . ARG A 1 168 ? 21.522 9.472   2.337   1.00 28.73 ? 349 ARG A N   1 
ATOM   1317 C  CA  . ARG A 1 168 ? 22.072 9.616   3.695   1.00 27.87 ? 349 ARG A CA  1 
ATOM   1318 C  C   . ARG A 1 168 ? 21.247 10.640  4.508   1.00 27.58 ? 349 ARG A C   1 
ATOM   1319 O  O   . ARG A 1 168 ? 21.292 11.839  4.192   1.00 27.84 ? 349 ARG A O   1 
ATOM   1320 C  CB  . ARG A 1 168 ? 23.547 10.051  3.653   1.00 27.71 ? 349 ARG A CB  1 
ATOM   1321 C  CG  . ARG A 1 168 ? 24.495 9.052   2.961   1.00 28.79 ? 349 ARG A CG  1 
ATOM   1322 C  CD  . ARG A 1 168 ? 25.960 9.454   3.014   1.00 30.76 ? 349 ARG A CD  1 
ATOM   1323 N  NE  . ARG A 1 168 ? 26.355 10.319  1.896   1.00 36.75 ? 349 ARG A NE  1 
ATOM   1324 C  CZ  . ARG A 1 168 ? 26.916 11.517  2.043   1.00 38.03 ? 349 ARG A CZ  1 
ATOM   1325 N  NH1 . ARG A 1 168 ? 27.192 11.989  3.258   1.00 36.70 ? 349 ARG A NH1 1 
ATOM   1326 N  NH2 . ARG A 1 168 ? 27.229 12.237  0.967   1.00 38.37 ? 349 ARG A NH2 1 
HETATM 1327 N  N   . MSE A 1 169 ? 20.501 10.166  5.513   1.00 25.22 ? 350 MSE A N   1 
HETATM 1328 C  CA  . MSE A 1 169 ? 19.721 11.022  6.434   1.00 24.72 ? 350 MSE A CA  1 
HETATM 1329 C  C   . MSE A 1 169 ? 20.403 11.136  7.786   1.00 22.22 ? 350 MSE A C   1 
HETATM 1330 O  O   . MSE A 1 169 ? 20.584 10.119  8.487   1.00 21.09 ? 350 MSE A O   1 
HETATM 1331 C  CB  . MSE A 1 169 ? 18.337 10.440  6.683   1.00 24.38 ? 350 MSE A CB  1 
HETATM 1332 C  CG  . MSE A 1 169 ? 17.249 10.865  5.765   1.00 28.43 ? 350 MSE A CG  1 
HETATM 1333 SE SE  . MSE A 1 169 ? 15.627 10.248  6.655   0.76 29.03 ? 350 MSE A SE  1 
HETATM 1334 C  CE  . MSE A 1 169 ? 14.383 10.334  5.211   1.00 29.04 ? 350 MSE A CE  1 
ATOM   1335 N  N   . TYR A 1 170 ? 20.700 12.372  8.189   1.00 19.91 ? 351 TYR A N   1 
ATOM   1336 C  CA  . TYR A 1 170 ? 21.487 12.619  9.375   1.00 19.24 ? 351 TYR A CA  1 
ATOM   1337 C  C   . TYR A 1 170 ? 20.655 13.082  10.570  1.00 18.97 ? 351 TYR A C   1 
ATOM   1338 O  O   . TYR A 1 170 ? 21.174 13.265  11.693  1.00 19.07 ? 351 TYR A O   1 
ATOM   1339 C  CB  . TYR A 1 170 ? 22.544 13.640  9.049   1.00 20.66 ? 351 TYR A CB  1 
ATOM   1340 C  CG  . TYR A 1 170 ? 23.725 13.093  8.249   1.00 21.08 ? 351 TYR A CG  1 
ATOM   1341 C  CD1 . TYR A 1 170 ? 24.830 12.536  8.908   1.00 23.48 ? 351 TYR A CD1 1 
ATOM   1342 C  CD2 . TYR A 1 170 ? 23.746 13.164  6.862   1.00 23.83 ? 351 TYR A CD2 1 
ATOM   1343 C  CE1 . TYR A 1 170 ? 25.954 12.063  8.195   1.00 20.37 ? 351 TYR A CE1 1 
ATOM   1344 C  CE2 . TYR A 1 170 ? 24.858 12.675  6.132   1.00 21.67 ? 351 TYR A CE2 1 
ATOM   1345 C  CZ  . TYR A 1 170 ? 25.942 12.129  6.819   1.00 22.81 ? 351 TYR A CZ  1 
ATOM   1346 O  OH  . TYR A 1 170 ? 27.044 11.670  6.121   1.00 24.38 ? 351 TYR A OH  1 
ATOM   1347 N  N   . ALA A 1 171 ? 19.371 13.298  10.329  1.00 16.91 ? 352 ALA A N   1 
ATOM   1348 C  CA  . ALA A 1 171 ? 18.489 13.697  11.431  1.00 16.15 ? 352 ALA A CA  1 
ATOM   1349 C  C   . ALA A 1 171 ? 17.189 12.921  11.379  1.00 15.26 ? 352 ALA A C   1 
ATOM   1350 O  O   . ALA A 1 171 ? 16.089 13.511  11.350  1.00 14.71 ? 352 ALA A O   1 
ATOM   1351 C  CB  . ALA A 1 171 ? 18.240 15.218  11.325  1.00 16.86 ? 352 ALA A CB  1 
ATOM   1352 N  N   . PRO A 1 172 ? 17.276 11.567  11.394  1.00 14.07 ? 353 PRO A N   1 
ATOM   1353 C  CA  . PRO A 1 172 ? 16.070 10.779  11.220  1.00 13.77 ? 353 PRO A CA  1 
ATOM   1354 C  C   . PRO A 1 172 ? 15.028 10.901  12.324  1.00 13.48 ? 353 PRO A C   1 
ATOM   1355 O  O   . PRO A 1 172 ? 13.873 10.597  12.072  1.00 14.68 ? 353 PRO A O   1 
ATOM   1356 C  CB  . PRO A 1 172 ? 16.598 9.323   11.167  1.00 13.87 ? 353 PRO A CB  1 
ATOM   1357 C  CG  . PRO A 1 172 ? 17.932 9.369   11.868  1.00 14.08 ? 353 PRO A CG  1 
ATOM   1358 C  CD  . PRO A 1 172 ? 18.492 10.724  11.506  1.00 14.02 ? 353 PRO A CD  1 
ATOM   1359 N  N   . ALA A 1 173 ? 15.443 11.312  13.533  1.00 14.19 ? 354 ALA A N   1 
ATOM   1360 C  CA  . ALA A 1 173 ? 14.527 11.327  14.705  1.00 13.62 ? 354 ALA A CA  1 
ATOM   1361 C  C   . ALA A 1 173 ? 13.311 12.221  14.464  1.00 14.07 ? 354 ALA A C   1 
ATOM   1362 O  O   . ALA A 1 173 ? 12.263 12.025  15.051  1.00 14.07 ? 354 ALA A O   1 
ATOM   1363 C  CB  . ALA A 1 173 ? 15.260 11.739  15.973  1.00 13.04 ? 354 ALA A CB  1 
ATOM   1364 N  N   . TRP A 1 174 ? 13.464 13.191  13.565  1.00 13.22 ? 355 TRP A N   1 
ATOM   1365 C  CA  . TRP A 1 174 ? 12.408 14.146  13.270  1.00 13.48 ? 355 TRP A CA  1 
ATOM   1366 C  C   . TRP A 1 174 ? 11.571 13.782  12.055  1.00 14.16 ? 355 TRP A C   1 
ATOM   1367 O  O   . TRP A 1 174 ? 10.611 14.456  11.746  1.00 14.82 ? 355 TRP A O   1 
ATOM   1368 C  CB  . TRP A 1 174 ? 13.014 15.559  13.070  1.00 13.38 ? 355 TRP A CB  1 
ATOM   1369 C  CG  . TRP A 1 174 ? 13.555 16.176  14.332  1.00 13.61 ? 355 TRP A CG  1 
ATOM   1370 C  CD1 . TRP A 1 174 ? 12.893 17.020  15.183  1.00 14.83 ? 355 TRP A CD1 1 
ATOM   1371 C  CD2 . TRP A 1 174 ? 14.857 15.964  14.908  1.00 13.07 ? 355 TRP A CD2 1 
ATOM   1372 N  NE1 . TRP A 1 174 ? 13.723 17.386  16.223  1.00 13.82 ? 355 TRP A NE1 1 
ATOM   1373 C  CE2 . TRP A 1 174 ? 14.921 16.733  16.089  1.00 14.29 ? 355 TRP A CE2 1 
ATOM   1374 C  CE3 . TRP A 1 174 ? 15.986 15.234  14.512  1.00 12.72 ? 355 TRP A CE3 1 
ATOM   1375 C  CZ2 . TRP A 1 174 ? 16.066 16.762  16.907  1.00 14.78 ? 355 TRP A CZ2 1 
ATOM   1376 C  CZ3 . TRP A 1 174 ? 17.128 15.252  15.347  1.00 16.49 ? 355 TRP A CZ3 1 
ATOM   1377 C  CH2 . TRP A 1 174 ? 17.137 15.993  16.526  1.00 16.92 ? 355 TRP A CH2 1 
ATOM   1378 N  N   . VAL A 1 175 ? 11.925 12.713  11.372  1.00 14.19 ? 356 VAL A N   1 
ATOM   1379 C  CA  . VAL A 1 175 ? 11.287 12.425  10.088  1.00 14.59 ? 356 VAL A CA  1 
ATOM   1380 C  C   . VAL A 1 175 ? 10.102 11.488  10.291  1.00 14.13 ? 356 VAL A C   1 
ATOM   1381 O  O   . VAL A 1 175 ? 10.220 10.499  11.051  1.00 15.70 ? 356 VAL A O   1 
ATOM   1382 C  CB  . VAL A 1 175 ? 12.345 11.796  9.138   1.00 13.50 ? 356 VAL A CB  1 
ATOM   1383 C  CG1 . VAL A 1 175 ? 11.672 11.267  7.872   1.00 15.17 ? 356 VAL A CG1 1 
ATOM   1384 C  CG2 . VAL A 1 175 ? 13.494 12.795  8.817   1.00 15.86 ? 356 VAL A CG2 1 
ATOM   1385 N  N   . ALA A 1 176 ? 8.987  11.740  9.588   1.00 15.02 ? 357 ALA A N   1 
ATOM   1386 C  CA  . ALA A 1 176 ? 7.788  10.917  9.662   1.00 16.38 ? 357 ALA A CA  1 
ATOM   1387 C  C   . ALA A 1 176 ? 8.111  9.446   9.283   1.00 16.92 ? 357 ALA A C   1 
ATOM   1388 O  O   . ALA A 1 176 ? 8.984  9.213   8.428   1.00 17.03 ? 357 ALA A O   1 
ATOM   1389 C  CB  . ALA A 1 176 ? 6.662  11.498  8.733   1.00 16.14 ? 357 ALA A CB  1 
ATOM   1390 N  N   . PRO A 1 177 ? 7.438  8.461   9.918   1.00 18.55 ? 358 PRO A N   1 
ATOM   1391 C  CA  . PRO A 1 177 ? 7.748  7.056   9.630   1.00 19.26 ? 358 PRO A CA  1 
ATOM   1392 C  C   . PRO A 1 177 ? 7.614  6.729   8.139   1.00 19.65 ? 358 PRO A C   1 
ATOM   1393 O  O   . PRO A 1 177 ? 8.460  6.024   7.579   1.00 20.29 ? 358 PRO A O   1 
ATOM   1394 C  CB  . PRO A 1 177 ? 6.698  6.299   10.473  1.00 19.56 ? 358 PRO A CB  1 
ATOM   1395 C  CG  . PRO A 1 177 ? 6.470  7.217   11.647  1.00 20.66 ? 358 PRO A CG  1 
ATOM   1396 C  CD  . PRO A 1 177 ? 6.380  8.565   10.955  1.00 19.26 ? 358 PRO A CD  1 
ATOM   1397 N  N   . GLU A 1 178 ? 6.589  7.268   7.501   1.00 19.33 ? 359 GLU A N   1 
ATOM   1398 C  CA  . GLU A 1 178 ? 6.390  7.063   6.054   1.00 19.96 ? 359 GLU A CA  1 
ATOM   1399 C  C   . GLU A 1 178 ? 7.522  7.657   5.203   1.00 20.12 ? 359 GLU A C   1 
ATOM   1400 O  O   . GLU A 1 178 ? 7.866  7.105   4.142   1.00 20.55 ? 359 GLU A O   1 
ATOM   1401 C  CB  . GLU A 1 178 ? 4.993  7.516   5.607   1.00 20.05 ? 359 GLU A CB  1 
ATOM   1402 C  CG  . GLU A 1 178 ? 4.735  9.072   5.554   1.00 21.20 ? 359 GLU A CG  1 
ATOM   1403 C  CD  . GLU A 1 178 ? 4.370  9.749   6.880   1.00 19.41 ? 359 GLU A CD  1 
ATOM   1404 O  OE1 . GLU A 1 178 ? 4.255  9.086   7.952   1.00 21.04 ? 359 GLU A OE1 1 
ATOM   1405 O  OE2 . GLU A 1 178 ? 4.199  10.996  6.839   1.00 18.89 ? 359 GLU A OE2 1 
ATOM   1406 N  N   . ALA A 1 179 ? 8.120  8.763   5.673   1.00 18.85 ? 360 ALA A N   1 
ATOM   1407 C  CA  . ALA A 1 179 ? 9.185  9.442   4.957   1.00 18.76 ? 360 ALA A CA  1 
ATOM   1408 C  C   . ALA A 1 179 ? 10.535 8.725   5.123   1.00 18.74 ? 360 ALA A C   1 
ATOM   1409 O  O   . ALA A 1 179 ? 11.462 8.963   4.360   1.00 18.78 ? 360 ALA A O   1 
ATOM   1410 C  CB  . ALA A 1 179 ? 9.257  10.947  5.371   1.00 18.70 ? 360 ALA A CB  1 
ATOM   1411 N  N   . LEU A 1 180 ? 10.627 7.826   6.111   1.00 18.33 ? 361 LEU A N   1 
ATOM   1412 C  CA  . LEU A 1 180 ? 11.789 6.970   6.259   1.00 19.36 ? 361 LEU A CA  1 
ATOM   1413 C  C   . LEU A 1 180 ? 11.857 5.872   5.185   1.00 21.08 ? 361 LEU A C   1 
ATOM   1414 O  O   . LEU A 1 180 ? 12.938 5.340   4.916   1.00 20.70 ? 361 LEU A O   1 
ATOM   1415 C  CB  . LEU A 1 180 ? 11.811 6.335   7.656   1.00 18.29 ? 361 LEU A CB  1 
ATOM   1416 C  CG  . LEU A 1 180 ? 11.994 7.283   8.865   1.00 17.89 ? 361 LEU A CG  1 
ATOM   1417 C  CD1 . LEU A 1 180 ? 11.941 6.471   10.143  1.00 15.91 ? 361 LEU A CD1 1 
ATOM   1418 C  CD2 . LEU A 1 180 ? 13.316 8.006   8.804   1.00 20.61 ? 361 LEU A CD2 1 
ATOM   1419 N  N   . GLN A 1 181 ? 10.712 5.579   4.580   1.00 21.90 ? 362 GLN A N   1 
ATOM   1420 C  CA  . GLN A 1 181 ? 10.527 4.355   3.761   1.00 25.39 ? 362 GLN A CA  1 
ATOM   1421 C  C   . GLN A 1 181 ? 10.039 4.615   2.350   1.00 26.78 ? 362 GLN A C   1 
ATOM   1422 O  O   . GLN A 1 181 ? 10.267 3.790   1.472   1.00 27.95 ? 362 GLN A O   1 
ATOM   1423 C  CB  . GLN A 1 181 ? 9.492  3.437   4.411   1.00 24.99 ? 362 GLN A CB  1 
ATOM   1424 C  CG  . GLN A 1 181 ? 9.713  3.220   5.900   1.00 29.65 ? 362 GLN A CG  1 
ATOM   1425 C  CD  . GLN A 1 181 ? 8.590  2.451   6.524   1.00 33.38 ? 362 GLN A CD  1 
ATOM   1426 O  OE1 . GLN A 1 181 ? 8.413  1.266   6.230   1.00 35.67 ? 362 GLN A OE1 1 
ATOM   1427 N  NE2 . GLN A 1 181 ? 7.805  3.114   7.383   1.00 31.75 ? 362 GLN A NE2 1 
ATOM   1428 N  N   . LYS A 1 182 ? 9.326  5.723   2.136   1.00 27.02 ? 363 LYS A N   1 
ATOM   1429 C  CA  . LYS A 1 182 ? 8.759  6.037   0.808   1.00 28.58 ? 363 LYS A CA  1 
ATOM   1430 C  C   . LYS A 1 182 ? 9.427  7.230   0.151   1.00 27.98 ? 363 LYS A C   1 
ATOM   1431 O  O   . LYS A 1 182 ? 9.797  8.183   0.823   1.00 27.05 ? 363 LYS A O   1 
ATOM   1432 C  CB  . LYS A 1 182 ? 7.247  6.305   0.892   1.00 27.90 ? 363 LYS A CB  1 
ATOM   1433 C  CG  . LYS A 1 182 ? 6.420  5.181   1.475   1.00 30.67 ? 363 LYS A CG  1 
ATOM   1434 C  CD  . LYS A 1 182 ? 4.926  5.388   1.218   1.00 31.45 ? 363 LYS A CD  1 
ATOM   1435 C  CE  . LYS A 1 182 ? 4.166  4.076   1.477   1.00 38.06 ? 363 LYS A CE  1 
ATOM   1436 N  NZ  . LYS A 1 182 ? 2.669  4.142   1.294   1.00 40.14 ? 363 LYS A NZ  1 
ATOM   1437 N  N   . LYS A 1 183 ? 9.566  7.175   -1.179  1.00 28.21 ? 364 LYS A N   1 
ATOM   1438 C  CA  . LYS A 1 183 ? 10.011 8.322   -1.981  1.00 28.72 ? 364 LYS A CA  1 
ATOM   1439 C  C   . LYS A 1 183 ? 9.138  9.548   -1.659  1.00 27.82 ? 364 LYS A C   1 
ATOM   1440 O  O   . LYS A 1 183 ? 7.939  9.402   -1.469  1.00 26.20 ? 364 LYS A O   1 
ATOM   1441 C  CB  . LYS A 1 183 ? 9.864  7.998   -3.486  1.00 29.93 ? 364 LYS A CB  1 
ATOM   1442 C  CG  . LYS A 1 183 ? 10.817 6.918   -4.039  1.00 32.35 ? 364 LYS A CG  1 
ATOM   1443 C  CD  . LYS A 1 183 ? 12.206 7.506   -4.291  1.00 36.29 ? 364 LYS A CD  1 
ATOM   1444 C  CE  . LYS A 1 183 ? 13.163 6.475   -4.909  1.00 36.74 ? 364 LYS A CE  1 
ATOM   1445 N  NZ  . LYS A 1 183 ? 14.578 6.622   -4.369  1.00 39.09 ? 364 LYS A NZ  1 
ATOM   1446 N  N   . PRO A 1 184 ? 9.738  10.753  -1.614  1.00 28.17 ? 365 PRO A N   1 
ATOM   1447 C  CA  . PRO A 1 184 ? 9.001  12.011  -1.393  1.00 29.32 ? 365 PRO A CA  1 
ATOM   1448 C  C   . PRO A 1 184 ? 7.747  12.149  -2.272  1.00 29.37 ? 365 PRO A C   1 
ATOM   1449 O  O   . PRO A 1 184 ? 6.684  12.564  -1.795  1.00 28.47 ? 365 PRO A O   1 
ATOM   1450 C  CB  . PRO A 1 184 ? 10.024 13.079  -1.785  1.00 29.23 ? 365 PRO A CB  1 
ATOM   1451 C  CG  . PRO A 1 184 ? 11.345 12.437  -1.538  1.00 30.14 ? 365 PRO A CG  1 
ATOM   1452 C  CD  . PRO A 1 184 ? 11.187 10.978  -1.767  1.00 28.63 ? 365 PRO A CD  1 
ATOM   1453 N  N   . GLU A 1 185 ? 7.874  11.764  -3.540  1.00 30.34 ? 366 GLU A N   1 
ATOM   1454 C  CA  . GLU A 1 185 ? 6.762  11.829  -4.491  1.00 31.37 ? 366 GLU A CA  1 
ATOM   1455 C  C   . GLU A 1 185 ? 5.595  10.935  -4.111  1.00 30.70 ? 366 GLU A C   1 
ATOM   1456 O  O   . GLU A 1 185 ? 4.488  11.141  -4.573  1.00 30.89 ? 366 GLU A O   1 
ATOM   1457 C  CB  . GLU A 1 185 ? 7.232  11.466  -5.906  1.00 32.41 ? 366 GLU A CB  1 
ATOM   1458 C  CG  . GLU A 1 185 ? 8.558  12.057  -6.290  1.00 36.23 ? 366 GLU A CG  1 
ATOM   1459 C  CD  . GLU A 1 185 ? 9.707  11.139  -5.923  1.00 40.29 ? 366 GLU A CD  1 
ATOM   1460 O  OE1 . GLU A 1 185 ? 10.417 11.435  -4.943  1.00 42.21 ? 366 GLU A OE1 1 
ATOM   1461 O  OE2 . GLU A 1 185 ? 9.887  10.114  -6.615  1.00 44.16 ? 366 GLU A OE2 1 
ATOM   1462 N  N   . ASP A 1 186 ? 5.846  9.936   -3.270  1.00 29.94 ? 367 ASP A N   1 
ATOM   1463 C  CA  . ASP A 1 186 ? 4.814  8.985   -2.838  1.00 29.01 ? 367 ASP A CA  1 
ATOM   1464 C  C   . ASP A 1 186 ? 4.264  9.247   -1.428  1.00 28.21 ? 367 ASP A C   1 
ATOM   1465 O  O   . ASP A 1 186 ? 3.556  8.422   -0.850  1.00 27.68 ? 367 ASP A O   1 
ATOM   1466 C  CB  . ASP A 1 186 ? 5.381  7.573   -2.935  1.00 29.50 ? 367 ASP A CB  1 
ATOM   1467 C  CG  . ASP A 1 186 ? 5.655  7.181   -4.375  1.00 31.91 ? 367 ASP A CG  1 
ATOM   1468 O  OD1 . ASP A 1 186 ? 4.836  7.567   -5.241  1.00 33.16 ? 367 ASP A OD1 1 
ATOM   1469 O  OD2 . ASP A 1 186 ? 6.699  6.542   -4.636  1.00 34.88 ? 367 ASP A OD2 1 
ATOM   1470 N  N   . THR A 1 187 ? 4.596  10.418  -0.899  1.00 27.67 ? 368 THR A N   1 
ATOM   1471 C  CA  . THR A 1 187 ? 4.173  10.850  0.434   1.00 26.78 ? 368 THR A CA  1 
ATOM   1472 C  C   . THR A 1 187 ? 3.542  12.225  0.333   1.00 26.04 ? 368 THR A C   1 
ATOM   1473 O  O   . THR A 1 187 ? 3.885  13.026  -0.559  1.00 26.61 ? 368 THR A O   1 
ATOM   1474 C  CB  . THR A 1 187 ? 5.380  11.017  1.392   1.00 27.68 ? 368 THR A CB  1 
ATOM   1475 O  OG1 . THR A 1 187 ? 6.096  12.202  1.009   1.00 27.70 ? 368 THR A OG1 1 
ATOM   1476 C  CG2 . THR A 1 187 ? 6.335  9.830   1.317   1.00 26.88 ? 368 THR A CG2 1 
ATOM   1477 N  N   . ASN A 1 188 ? 2.640  12.497  1.264   1.00 24.19 ? 369 ASN A N   1 
ATOM   1478 C  CA  . ASN A 1 188 ? 2.082  13.819  1.427   1.00 22.77 ? 369 ASN A CA  1 
ATOM   1479 C  C   . ASN A 1 188 ? 3.110  14.586  2.249   1.00 21.31 ? 369 ASN A C   1 
ATOM   1480 O  O   . ASN A 1 188 ? 3.268  14.340  3.442   1.00 19.59 ? 369 ASN A O   1 
ATOM   1481 C  CB  . ASN A 1 188 ? 0.752  13.760  2.141   1.00 23.31 ? 369 ASN A CB  1 
ATOM   1482 C  CG  . ASN A 1 188 ? 0.096  15.127  2.246   1.00 24.98 ? 369 ASN A CG  1 
ATOM   1483 O  OD1 . ASN A 1 188 ? 0.685  16.078  2.772   1.00 22.75 ? 369 ASN A OD1 1 
ATOM   1484 N  ND2 . ASN A 1 188 ? -1.111 15.247  1.691   1.00 28.65 ? 369 ASN A ND2 1 
ATOM   1485 N  N   . ARG A 1 189 ? 3.806  15.486  1.585   1.00 19.88 ? 370 ARG A N   1 
ATOM   1486 C  CA  . ARG A 1 189 ? 4.950  16.165  2.196   1.00 20.04 ? 370 ARG A CA  1 
ATOM   1487 C  C   . ARG A 1 189 ? 4.505  17.092  3.329   1.00 19.41 ? 370 ARG A C   1 
ATOM   1488 O  O   . ARG A 1 189 ? 5.213  17.230  4.355   1.00 17.36 ? 370 ARG A O   1 
ATOM   1489 C  CB  . ARG A 1 189 ? 5.778  16.882  1.141   1.00 21.05 ? 370 ARG A CB  1 
ATOM   1490 C  CG  . ARG A 1 189 ? 6.598  15.852  0.304   1.00 26.51 ? 370 ARG A CG  1 
ATOM   1491 C  CD  . ARG A 1 189 ? 7.500  16.477  -0.721  1.00 32.62 ? 370 ARG A CD  1 
ATOM   1492 N  NE  . ARG A 1 189 ? 6.768  17.051  -1.856  1.00 36.09 ? 370 ARG A NE  1 
ATOM   1493 C  CZ  . ARG A 1 189 ? 7.219  18.077  -2.579  1.00 38.20 ? 370 ARG A CZ  1 
ATOM   1494 N  NH1 . ARG A 1 189 ? 6.492  18.560  -3.586  1.00 38.83 ? 370 ARG A NH1 1 
ATOM   1495 N  NH2 . ARG A 1 189 ? 8.399  18.633  -2.282  1.00 38.94 ? 370 ARG A NH2 1 
ATOM   1496 N  N   . ARG A 1 190 ? 3.330  17.693  3.179   1.00 18.46 ? 371 ARG A N   1 
ATOM   1497 C  CA  . ARG A 1 190 ? 2.880  18.644  4.207   1.00 18.14 ? 371 ARG A CA  1 
ATOM   1498 C  C   . ARG A 1 190 ? 2.587  17.912  5.498   1.00 17.69 ? 371 ARG A C   1 
ATOM   1499 O  O   . ARG A 1 190 ? 2.922  18.379  6.591   1.00 17.04 ? 371 ARG A O   1 
ATOM   1500 C  CB  . ARG A 1 190 ? 1.672  19.450  3.739   1.00 18.39 ? 371 ARG A CB  1 
ATOM   1501 C  CG  . ARG A 1 190 ? 2.016  20.484  2.622   1.00 18.42 ? 371 ARG A CG  1 
ATOM   1502 C  CD  . ARG A 1 190 ? 0.751  21.260  2.206   1.00 19.61 ? 371 ARG A CD  1 
ATOM   1503 N  NE  . ARG A 1 190 ? 1.008  22.291  1.192   1.00 20.55 ? 371 ARG A NE  1 
ATOM   1504 C  CZ  . ARG A 1 190 ? 1.105  22.045  -0.109  1.00 23.51 ? 371 ARG A CZ  1 
ATOM   1505 N  NH1 . ARG A 1 190 ? 0.985  20.794  -0.548  1.00 23.23 ? 371 ARG A NH1 1 
ATOM   1506 N  NH2 . ARG A 1 190 ? 1.353  23.034  -0.967  1.00 21.03 ? 371 ARG A NH2 1 
ATOM   1507 N  N   . SER A 1 191 ? 1.973  16.743  5.369   1.00 16.83 ? 372 SER A N   1 
ATOM   1508 C  CA  . SER A 1 191 ? 1.716  15.887  6.512   1.00 17.59 ? 372 SER A CA  1 
ATOM   1509 C  C   . SER A 1 191 ? 2.990  15.326  7.161   1.00 16.28 ? 372 SER A C   1 
ATOM   1510 O  O   . SER A 1 191 ? 3.068  15.227  8.395   1.00 15.34 ? 372 SER A O   1 
ATOM   1511 C  CB  . SER A 1 191 ? 0.705  14.795  6.127   1.00 18.96 ? 372 SER A CB  1 
ATOM   1512 O  OG  . SER A 1 191 ? 0.309  14.105  7.325   1.00 25.91 ? 372 SER A OG  1 
ATOM   1513 N  N   . ALA A 1 192 ? 3.981  14.961  6.358   1.00 15.91 ? 373 ALA A N   1 
ATOM   1514 C  CA  . ALA A 1 192 ? 5.283  14.541  6.887   1.00 15.11 ? 373 ALA A CA  1 
ATOM   1515 C  C   . ALA A 1 192 ? 5.896  15.672  7.719   1.00 14.81 ? 373 ALA A C   1 
ATOM   1516 O  O   . ALA A 1 192 ? 6.502  15.416  8.774   1.00 14.53 ? 373 ALA A O   1 
ATOM   1517 C  CB  . ALA A 1 192 ? 6.241  14.157  5.763   1.00 14.87 ? 373 ALA A CB  1 
ATOM   1518 N  N   . ASP A 1 193 ? 5.779  16.919  7.255   1.00 13.81 ? 374 ASP A N   1 
ATOM   1519 C  CA  . ASP A 1 193 ? 6.343  18.041  8.046   1.00 12.85 ? 374 ASP A CA  1 
ATOM   1520 C  C   . ASP A 1 193 ? 5.638  18.201  9.387   1.00 11.42 ? 374 ASP A C   1 
ATOM   1521 O  O   . ASP A 1 193 ? 6.249  18.623  10.362  1.00 11.21 ? 374 ASP A O   1 
ATOM   1522 C  CB  . ASP A 1 193 ? 6.310  19.401  7.304   1.00 12.90 ? 374 ASP A CB  1 
ATOM   1523 C  CG  . ASP A 1 193 ? 7.198  19.406  6.073   1.00 17.02 ? 374 ASP A CG  1 
ATOM   1524 O  OD1 . ASP A 1 193 ? 8.194  18.629  6.078   1.00 17.41 ? 374 ASP A OD1 1 
ATOM   1525 O  OD2 . ASP A 1 193 ? 6.916  20.167  5.098   1.00 17.12 ? 374 ASP A OD2 1 
HETATM 1526 N  N   . MSE A 1 194 ? 4.343  17.912  9.443   1.00 12.77 ? 375 MSE A N   1 
HETATM 1527 C  CA  . MSE A 1 194 ? 3.626  18.008  10.718  1.00 12.35 ? 375 MSE A CA  1 
HETATM 1528 C  C   . MSE A 1 194 ? 4.129  16.989  11.776  1.00 13.56 ? 375 MSE A C   1 
HETATM 1529 O  O   . MSE A 1 194 ? 4.180  17.303  12.983  1.00 11.31 ? 375 MSE A O   1 
HETATM 1530 C  CB  . MSE A 1 194 ? 2.099  17.911  10.488  1.00 13.27 ? 375 MSE A CB  1 
HETATM 1531 C  CG  . MSE A 1 194 ? 1.252  18.058  11.719  1.00 12.10 ? 375 MSE A CG  1 
HETATM 1532 SE SE  . MSE A 1 194 ? 1.678  19.788  12.851  0.85 19.04 ? 375 MSE A SE  1 
HETATM 1533 C  CE  . MSE A 1 194 ? 0.802  20.994  11.689  1.00 19.25 ? 375 MSE A CE  1 
ATOM   1534 N  N   . TRP A 1 195 ? 4.476  15.770  11.343  1.00 13.26 ? 376 TRP A N   1 
ATOM   1535 C  CA  . TRP A 1 195 ? 5.231  14.846  12.224  1.00 13.72 ? 376 TRP A CA  1 
ATOM   1536 C  C   . TRP A 1 195 ? 6.482  15.503  12.811  1.00 12.40 ? 376 TRP A C   1 
ATOM   1537 O  O   . TRP A 1 195 ? 6.743  15.374  14.000  1.00 13.19 ? 376 TRP A O   1 
ATOM   1538 C  CB  . TRP A 1 195 ? 5.665  13.571  11.486  1.00 15.18 ? 376 TRP A CB  1 
ATOM   1539 C  CG  . TRP A 1 195 ? 6.285  12.580  12.384  1.00 13.88 ? 376 TRP A CG  1 
ATOM   1540 C  CD1 . TRP A 1 195 ? 7.587  12.552  12.841  1.00 16.36 ? 376 TRP A CD1 1 
ATOM   1541 C  CD2 . TRP A 1 195 ? 5.616  11.488  13.011  1.00 16.41 ? 376 TRP A CD2 1 
ATOM   1542 N  NE1 . TRP A 1 195 ? 7.757  11.465  13.684  1.00 16.06 ? 376 TRP A NE1 1 
ATOM   1543 C  CE2 . TRP A 1 195 ? 6.569  10.806  13.804  1.00 15.10 ? 376 TRP A CE2 1 
ATOM   1544 C  CE3 . TRP A 1 195 ? 4.304  11.005  12.963  1.00 18.95 ? 376 TRP A CE3 1 
ATOM   1545 C  CZ2 . TRP A 1 195 ? 6.253  9.645   14.526  1.00 17.99 ? 376 TRP A CZ2 1 
ATOM   1546 C  CZ3 . TRP A 1 195 ? 3.985  9.845   13.673  1.00 18.79 ? 376 TRP A CZ3 1 
ATOM   1547 C  CH2 . TRP A 1 195 ? 4.955  9.191   14.466  1.00 18.37 ? 376 TRP A CH2 1 
ATOM   1548 N  N   . SER A 1 196 ? 7.287  16.165  11.976  1.00 11.69 ? 377 SER A N   1 
ATOM   1549 C  CA  . SER A 1 196 ? 8.529  16.775  12.436  1.00 11.49 ? 377 SER A CA  1 
ATOM   1550 C  C   . SER A 1 196 ? 8.224  17.829  13.497  1.00 11.99 ? 377 SER A C   1 
ATOM   1551 O  O   . SER A 1 196 ? 8.934  17.955  14.480  1.00 11.60 ? 377 SER A O   1 
ATOM   1552 C  CB  . SER A 1 196 ? 9.296  17.378  11.263  1.00 11.96 ? 377 SER A CB  1 
ATOM   1553 O  OG  . SER A 1 196 ? 9.461  16.407  10.175  1.00 12.07 ? 377 SER A OG  1 
ATOM   1554 N  N   . PHE A 1 197 ? 7.148  18.566  13.272  1.00 12.25 ? 378 PHE A N   1 
ATOM   1555 C  CA  . PHE A 1 197 ? 6.735  19.591  14.246  1.00 12.55 ? 378 PHE A CA  1 
ATOM   1556 C  C   . PHE A 1 197 ? 6.314  18.912  15.562  1.00 12.07 ? 378 PHE A C   1 
ATOM   1557 O  O   . PHE A 1 197 ? 6.681  19.379  16.649  1.00 11.53 ? 378 PHE A O   1 
ATOM   1558 C  CB  . PHE A 1 197 ? 5.582  20.426  13.677  1.00 12.35 ? 378 PHE A CB  1 
ATOM   1559 C  CG  . PHE A 1 197 ? 5.198  21.590  14.577  1.00 11.57 ? 378 PHE A CG  1 
ATOM   1560 C  CD1 . PHE A 1 197 ? 5.969  22.724  14.600  1.00 11.29 ? 378 PHE A CD1 1 
ATOM   1561 C  CD2 . PHE A 1 197 ? 4.102  21.501  15.445  1.00 13.50 ? 378 PHE A CD2 1 
ATOM   1562 C  CE1 . PHE A 1 197 ? 5.618  23.818  15.424  1.00 12.17 ? 378 PHE A CE1 1 
ATOM   1563 C  CE2 . PHE A 1 197 ? 3.752  22.580  16.294  1.00 13.99 ? 378 PHE A CE2 1 
ATOM   1564 C  CZ  . PHE A 1 197 ? 4.504  23.736  16.276  1.00 11.53 ? 378 PHE A CZ  1 
ATOM   1565 N  N   . ALA A 1 198 ? 5.604  17.775  15.481  1.00 11.70 ? 379 ALA A N   1 
ATOM   1566 C  CA  . ALA A 1 198 ? 5.235  17.008  16.700  1.00 12.28 ? 379 ALA A CA  1 
ATOM   1567 C  C   . ALA A 1 198 ? 6.475  16.596  17.516  1.00 12.94 ? 379 ALA A C   1 
ATOM   1568 O  O   . ALA A 1 198 ? 6.458  16.645  18.747  1.00 13.22 ? 379 ALA A O   1 
ATOM   1569 C  CB  . ALA A 1 198 ? 4.394  15.800  16.355  1.00 12.29 ? 379 ALA A CB  1 
ATOM   1570 N  N   . VAL A 1 199 ? 7.542  16.188  16.841  1.00 11.78 ? 380 VAL A N   1 
ATOM   1571 C  CA  . VAL A 1 199 ? 8.791  15.806  17.512  1.00 11.82 ? 380 VAL A CA  1 
ATOM   1572 C  C   . VAL A 1 199 ? 9.436  17.047  18.142  1.00 11.94 ? 380 VAL A C   1 
ATOM   1573 O  O   . VAL A 1 199 ? 10.018 16.967  19.226  1.00 11.72 ? 380 VAL A O   1 
ATOM   1574 C  CB  . VAL A 1 199 ? 9.786  15.082  16.543  1.00 11.32 ? 380 VAL A CB  1 
ATOM   1575 C  CG1 . VAL A 1 199 ? 11.194 14.850  17.196  1.00 11.02 ? 380 VAL A CG1 1 
ATOM   1576 C  CG2 . VAL A 1 199 ? 9.185  13.741  16.073  1.00 10.49 ? 380 VAL A CG2 1 
ATOM   1577 N  N   . LEU A 1 200 ? 9.357  18.181  17.444  1.00 10.58 ? 381 LEU A N   1 
ATOM   1578 C  CA  . LEU A 1 200 ? 9.828  19.445  18.008  1.00 10.38 ? 381 LEU A CA  1 
ATOM   1579 C  C   . LEU A 1 200 ? 9.048  19.824  19.255  1.00 10.54 ? 381 LEU A C   1 
ATOM   1580 O  O   . LEU A 1 200 ? 9.638  20.345  20.200  1.00 11.39 ? 381 LEU A O   1 
ATOM   1581 C  CB  . LEU A 1 200 ? 9.678  20.586  16.992  1.00 9.67  ? 381 LEU A CB  1 
ATOM   1582 C  CG  . LEU A 1 200 ? 10.806 20.562  15.928  1.00 9.64  ? 381 LEU A CG  1 
ATOM   1583 C  CD1 . LEU A 1 200 ? 10.356 21.428  14.691  1.00 13.68 ? 381 LEU A CD1 1 
ATOM   1584 C  CD2 . LEU A 1 200 ? 12.125 21.027  16.425  1.00 11.07 ? 381 LEU A CD2 1 
ATOM   1585 N  N   . LEU A 1 201 ? 7.736  19.605  19.231  1.00 10.50 ? 382 LEU A N   1 
ATOM   1586 C  CA  . LEU A 1 201 ? 6.931  19.810  20.464  1.00 12.00 ? 382 LEU A CA  1 
ATOM   1587 C  C   . LEU A 1 201 ? 7.472  18.960  21.617  1.00 12.64 ? 382 LEU A C   1 
ATOM   1588 O  O   . LEU A 1 201 ? 7.679  19.453  22.760  1.00 13.56 ? 382 LEU A O   1 
ATOM   1589 C  CB  . LEU A 1 201 ? 5.444  19.521  20.227  1.00 12.62 ? 382 LEU A CB  1 
ATOM   1590 C  CG  . LEU A 1 201 ? 4.611  20.485  19.365  1.00 14.86 ? 382 LEU A CG  1 
ATOM   1591 C  CD1 . LEU A 1 201 ? 3.196  19.925  19.246  1.00 14.00 ? 382 LEU A CD1 1 
ATOM   1592 C  CD2 . LEU A 1 201 ? 4.568  21.923  19.943  1.00 16.22 ? 382 LEU A CD2 1 
ATOM   1593 N  N   . TRP A 1 202 ? 7.768  17.708  21.304  1.00 12.45 ? 383 TRP A N   1 
ATOM   1594 C  CA  . TRP A 1 202 ? 8.345  16.774  22.278  1.00 13.77 ? 383 TRP A CA  1 
ATOM   1595 C  C   . TRP A 1 202 ? 9.673  17.319  22.834  1.00 13.27 ? 383 TRP A C   1 
ATOM   1596 O  O   . TRP A 1 202 ? 9.915  17.287  24.055  1.00 14.11 ? 383 TRP A O   1 
ATOM   1597 C  CB  . TRP A 1 202 ? 8.482  15.359  21.624  1.00 13.11 ? 383 TRP A CB  1 
ATOM   1598 C  CG  . TRP A 1 202 ? 8.999  14.267  22.613  1.00 14.37 ? 383 TRP A CG  1 
ATOM   1599 C  CD1 . TRP A 1 202 ? 8.249  13.377  23.307  1.00 17.56 ? 383 TRP A CD1 1 
ATOM   1600 C  CD2 . TRP A 1 202 ? 10.369 13.975  22.919  1.00 15.81 ? 383 TRP A CD2 1 
ATOM   1601 N  NE1 . TRP A 1 202 ? 9.074  12.549  24.061  1.00 15.86 ? 383 TRP A NE1 1 
ATOM   1602 C  CE2 . TRP A 1 202 ? 10.375 12.914  23.847  1.00 16.59 ? 383 TRP A CE2 1 
ATOM   1603 C  CE3 . TRP A 1 202 ? 11.605 14.542  22.530  1.00 13.52 ? 383 TRP A CE3 1 
ATOM   1604 C  CZ2 . TRP A 1 202 ? 11.569 12.375  24.366  1.00 17.48 ? 383 TRP A CZ2 1 
ATOM   1605 C  CZ3 . TRP A 1 202 ? 12.768 14.018  23.055  1.00 16.77 ? 383 TRP A CZ3 1 
ATOM   1606 C  CH2 . TRP A 1 202 ? 12.743 12.931  23.960  1.00 16.34 ? 383 TRP A CH2 1 
ATOM   1607 N  N   . GLU A 1 203 ? 10.533 17.804  21.951  1.00 12.80 ? 384 GLU A N   1 
ATOM   1608 C  CA  . GLU A 1 203 ? 11.831 18.315  22.313  1.00 13.78 ? 384 GLU A CA  1 
ATOM   1609 C  C   . GLU A 1 203 ? 11.686 19.585  23.194  1.00 13.85 ? 384 GLU A C   1 
ATOM   1610 O  O   . GLU A 1 203 ? 12.446 19.776  24.146  1.00 13.44 ? 384 GLU A O   1 
ATOM   1611 C  CB  . GLU A 1 203 ? 12.568 18.625  21.008  1.00 15.37 ? 384 GLU A CB  1 
ATOM   1612 C  CG  . GLU A 1 203 ? 14.028 18.800  21.056  1.00 15.40 ? 384 GLU A CG  1 
ATOM   1613 C  CD  . GLU A 1 203 ? 14.600 18.991  19.619  1.00 14.30 ? 384 GLU A CD  1 
ATOM   1614 O  OE1 . GLU A 1 203 ? 13.816 18.903  18.636  1.00 15.68 ? 384 GLU A OE1 1 
ATOM   1615 O  OE2 . GLU A 1 203 ? 15.824 19.222  19.493  1.00 14.73 ? 384 GLU A OE2 1 
ATOM   1616 N  N   . LEU A 1 204 ? 10.684 20.426  22.907  1.00 12.05 ? 385 LEU A N   1 
ATOM   1617 C  CA  . LEU A 1 204 ? 10.434 21.631  23.713  1.00 11.95 ? 385 LEU A CA  1 
ATOM   1618 C  C   . LEU A 1 204 ? 9.864  21.270  25.090  1.00 12.32 ? 385 LEU A C   1 
ATOM   1619 O  O   . LEU A 1 204 ? 10.078 21.998  26.060  1.00 13.38 ? 385 LEU A O   1 
ATOM   1620 C  CB  . LEU A 1 204 ? 9.457  22.562  23.010  1.00 9.12  ? 385 LEU A CB  1 
ATOM   1621 C  CG  . LEU A 1 204 ? 10.061 23.281  21.790  1.00 12.52 ? 385 LEU A CG  1 
ATOM   1622 C  CD1 . LEU A 1 204 ? 8.951  23.911  20.903  1.00 13.14 ? 385 LEU A CD1 1 
ATOM   1623 C  CD2 . LEU A 1 204 ? 11.060 24.350  22.236  1.00 14.42 ? 385 LEU A CD2 1 
ATOM   1624 N  N   . VAL A 1 205 ? 9.145  20.162  25.141  1.00 13.28 ? 386 VAL A N   1 
ATOM   1625 C  CA  . VAL A 1 205 ? 8.525  19.730  26.404  1.00 14.81 ? 386 VAL A CA  1 
ATOM   1626 C  C   . VAL A 1 205 ? 9.561  19.027  27.267  1.00 16.32 ? 386 VAL A C   1 
ATOM   1627 O  O   . VAL A 1 205 ? 9.644  19.290  28.478  1.00 16.92 ? 386 VAL A O   1 
ATOM   1628 C  CB  . VAL A 1 205 ? 7.297  18.828  26.149  1.00 15.05 ? 386 VAL A CB  1 
ATOM   1629 C  CG1 . VAL A 1 205 ? 6.838  18.156  27.438  1.00 17.17 ? 386 VAL A CG1 1 
ATOM   1630 C  CG2 . VAL A 1 205 ? 6.140  19.651  25.526  1.00 14.79 ? 386 VAL A CG2 1 
ATOM   1631 N  N   . THR A 1 206 ? 10.370 18.148  26.676  1.00 14.79 ? 387 THR A N   1 
ATOM   1632 C  CA  . THR A 1 206 ? 11.377 17.396  27.461  1.00 14.72 ? 387 THR A CA  1 
ATOM   1633 C  C   . THR A 1 206 ? 12.749 18.029  27.658  1.00 14.47 ? 387 THR A C   1 
ATOM   1634 O  O   . THR A 1 206 ? 13.503 17.642  28.580  1.00 15.18 ? 387 THR A O   1 
ATOM   1635 C  CB  . THR A 1 206 ? 11.632 15.985  26.862  1.00 14.15 ? 387 THR A CB  1 
ATOM   1636 O  OG1 . THR A 1 206 ? 12.244 16.125  25.579  1.00 14.72 ? 387 THR A OG1 1 
ATOM   1637 C  CG2 . THR A 1 206 ? 10.313 15.173  26.748  1.00 15.28 ? 387 THR A CG2 1 
ATOM   1638 N  N   . ARG A 1 207 ? 13.113 18.951  26.761  1.00 13.15 ? 388 ARG A N   1 
ATOM   1639 C  CA  . ARG A 1 207 ? 14.444 19.512  26.708  1.00 13.71 ? 388 ARG A CA  1 
ATOM   1640 C  C   . ARG A 1 207 ? 15.488 18.380  26.611  1.00 14.51 ? 388 ARG A C   1 
ATOM   1641 O  O   . ARG A 1 207 ? 16.484 18.372  27.315  1.00 13.54 ? 388 ARG A O   1 
ATOM   1642 C  CB  . ARG A 1 207 ? 14.698 20.457  27.909  1.00 13.23 ? 388 ARG A CB  1 
ATOM   1643 C  CG  . ARG A 1 207 ? 13.656 21.580  28.045  1.00 14.05 ? 388 ARG A CG  1 
ATOM   1644 C  CD  . ARG A 1 207 ? 13.385 22.327  26.693  1.00 14.07 ? 388 ARG A CD  1 
ATOM   1645 N  NE  . ARG A 1 207 ? 12.389 23.372  26.943  1.00 13.84 ? 388 ARG A NE  1 
ATOM   1646 C  CZ  . ARG A 1 207 ? 12.653 24.557  27.511  1.00 12.86 ? 388 ARG A CZ  1 
ATOM   1647 N  NH1 . ARG A 1 207 ? 13.922 24.958  27.757  1.00 12.18 ? 388 ARG A NH1 1 
ATOM   1648 N  NH2 . ARG A 1 207 ? 11.652 25.393  27.759  1.00 12.51 ? 388 ARG A NH2 1 
ATOM   1649 N  N   . GLU A 1 208 ? 15.173 17.398  25.778  1.00 14.46 ? 389 GLU A N   1 
ATOM   1650 C  CA  . GLU A 1 208 ? 16.056 16.271  25.489  1.00 15.57 ? 389 GLU A CA  1 
ATOM   1651 C  C   . GLU A 1 208 ? 16.127 16.129  23.986  1.00 15.68 ? 389 GLU A C   1 
ATOM   1652 O  O   . GLU A 1 208 ? 15.115 16.367  23.294  1.00 14.48 ? 389 GLU A O   1 
ATOM   1653 C  CB  . GLU A 1 208 ? 15.463 14.989  26.056  1.00 15.62 ? 389 GLU A CB  1 
ATOM   1654 C  CG  . GLU A 1 208 ? 15.602 14.917  27.608  1.00 15.49 ? 389 GLU A CG  1 
ATOM   1655 C  CD  . GLU A 1 208 ? 14.902 13.714  28.229  1.00 19.91 ? 389 GLU A CD  1 
ATOM   1656 O  OE1 . GLU A 1 208 ? 14.277 12.884  27.502  1.00 25.36 ? 389 GLU A OE1 1 
ATOM   1657 O  OE2 . GLU A 1 208 ? 14.940 13.616  29.482  1.00 22.55 ? 389 GLU A OE2 1 
ATOM   1658 N  N   . VAL A 1 209 ? 17.286 15.672  23.491  1.00 15.68 ? 390 VAL A N   1 
ATOM   1659 C  CA  . VAL A 1 209 ? 17.374 15.288  22.068  1.00 17.05 ? 390 VAL A CA  1 
ATOM   1660 C  C   . VAL A 1 209 ? 16.576 13.990  21.888  1.00 16.98 ? 390 VAL A C   1 
ATOM   1661 O  O   . VAL A 1 209 ? 16.859 12.973  22.575  1.00 19.27 ? 390 VAL A O   1 
ATOM   1662 C  CB  . VAL A 1 209 ? 18.860 15.162  21.615  1.00 17.29 ? 390 VAL A CB  1 
ATOM   1663 C  CG1 . VAL A 1 209 ? 18.985 14.639  20.180  1.00 16.55 ? 390 VAL A CG1 1 
ATOM   1664 C  CG2 . VAL A 1 209 ? 19.568 16.501  21.742  1.00 17.44 ? 390 VAL A CG2 1 
ATOM   1665 N  N   . PRO A 1 210 ? 15.637 13.949  20.919  1.00 17.54 ? 391 PRO A N   1 
ATOM   1666 C  CA  . PRO A 1 210 ? 14.905 12.677  20.720  1.00 17.62 ? 391 PRO A CA  1 
ATOM   1667 C  C   . PRO A 1 210 ? 15.823 11.509  20.322  1.00 18.79 ? 391 PRO A C   1 
ATOM   1668 O  O   . PRO A 1 210 ? 16.608 11.640  19.394  1.00 18.43 ? 391 PRO A O   1 
ATOM   1669 C  CB  . PRO A 1 210 ? 13.903 12.993  19.593  1.00 17.78 ? 391 PRO A CB  1 
ATOM   1670 C  CG  . PRO A 1 210 ? 14.441 14.135  18.905  1.00 18.62 ? 391 PRO A CG  1 
ATOM   1671 C  CD  . PRO A 1 210 ? 15.216 14.975  19.942  1.00 16.63 ? 391 PRO A CD  1 
ATOM   1672 N  N   . PHE A 1 211 ? 15.717 10.399  21.060  1.00 18.94 ? 392 PHE A N   1 
ATOM   1673 C  CA  . PHE A 1 211 ? 16.526 9.180   20.834  1.00 19.71 ? 392 PHE A CA  1 
ATOM   1674 C  C   . PHE A 1 211 ? 18.032 9.411   20.900  1.00 21.20 ? 392 PHE A C   1 
ATOM   1675 O  O   . PHE A 1 211 ? 18.793 8.811   20.128  1.00 21.55 ? 392 PHE A O   1 
ATOM   1676 C  CB  . PHE A 1 211 ? 16.161 8.543   19.480  1.00 19.79 ? 392 PHE A CB  1 
ATOM   1677 C  CG  . PHE A 1 211 ? 14.693 8.360   19.262  1.00 19.20 ? 392 PHE A CG  1 
ATOM   1678 C  CD1 . PHE A 1 211 ? 13.911 7.622   20.155  1.00 20.40 ? 392 PHE A CD1 1 
ATOM   1679 C  CD2 . PHE A 1 211 ? 14.071 8.916   18.138  1.00 20.78 ? 392 PHE A CD2 1 
ATOM   1680 C  CE1 . PHE A 1 211 ? 12.527 7.462   19.938  1.00 20.85 ? 392 PHE A CE1 1 
ATOM   1681 C  CE2 . PHE A 1 211 ? 12.697 8.756   17.891  1.00 17.26 ? 392 PHE A CE2 1 
ATOM   1682 C  CZ  . PHE A 1 211 ? 11.906 8.031   18.806  1.00 19.85 ? 392 PHE A CZ  1 
ATOM   1683 N  N   . ALA A 1 212 ? 18.468 10.265  21.817  1.00 21.79 ? 393 ALA A N   1 
ATOM   1684 C  CA  . ALA A 1 212 ? 19.859 10.722  21.887  1.00 23.35 ? 393 ALA A CA  1 
ATOM   1685 C  C   . ALA A 1 212 ? 20.851 9.549   22.134  1.00 24.08 ? 393 ALA A C   1 
ATOM   1686 O  O   . ALA A 1 212 ? 22.052 9.652   21.834  1.00 24.88 ? 393 ALA A O   1 
ATOM   1687 C  CB  . ALA A 1 212 ? 19.998 11.732  22.992  1.00 23.78 ? 393 ALA A CB  1 
ATOM   1688 N  N   . ASP A 1 213 ? 20.321 8.475   22.698  1.00 25.02 ? 394 ASP A N   1 
ATOM   1689 C  CA  . ASP A 1 213 ? 21.117 7.288   23.084  1.00 26.70 ? 394 ASP A CA  1 
ATOM   1690 C  C   . ASP A 1 213 ? 21.282 6.326   21.893  1.00 26.96 ? 394 ASP A C   1 
ATOM   1691 O  O   . ASP A 1 213 ? 21.965 5.285   22.008  1.00 27.05 ? 394 ASP A O   1 
ATOM   1692 C  CB  . ASP A 1 213 ? 20.425 6.575   24.242  1.00 27.85 ? 394 ASP A CB  1 
ATOM   1693 C  CG  . ASP A 1 213 ? 18.962 6.269   23.935  1.00 31.51 ? 394 ASP A CG  1 
ATOM   1694 O  OD1 . ASP A 1 213 ? 18.254 7.193   23.460  1.00 37.95 ? 394 ASP A OD1 1 
ATOM   1695 O  OD2 . ASP A 1 213 ? 18.510 5.127   24.165  1.00 36.80 ? 394 ASP A OD2 1 
ATOM   1696 N  N   . LEU A 1 214 ? 20.652 6.663   20.758  1.00 24.96 ? 395 LEU A N   1 
ATOM   1697 C  CA  . LEU A 1 214 ? 20.754 5.855   19.534  1.00 24.08 ? 395 LEU A CA  1 
ATOM   1698 C  C   . LEU A 1 214 ? 21.465 6.557   18.411  1.00 23.76 ? 395 LEU A C   1 
ATOM   1699 O  O   . LEU A 1 214 ? 21.361 7.778   18.283  1.00 24.13 ? 395 LEU A O   1 
ATOM   1700 C  CB  . LEU A 1 214 ? 19.379 5.446   19.040  1.00 23.01 ? 395 LEU A CB  1 
ATOM   1701 C  CG  . LEU A 1 214 ? 18.533 4.695   20.030  1.00 24.18 ? 395 LEU A CG  1 
ATOM   1702 C  CD1 . LEU A 1 214 ? 17.213 4.329   19.403  1.00 23.52 ? 395 LEU A CD1 1 
ATOM   1703 C  CD2 . LEU A 1 214 ? 19.286 3.440   20.503  1.00 26.11 ? 395 LEU A CD2 1 
ATOM   1704 N  N   . SER A 1 215 ? 22.170 5.778   17.585  1.00 22.63 ? 396 SER A N   1 
ATOM   1705 C  CA  . SER A 1 215 ? 22.832 6.283   16.383  1.00 20.90 ? 396 SER A CA  1 
ATOM   1706 C  C   . SER A 1 215 ? 21.718 6.509   15.365  1.00 19.71 ? 396 SER A C   1 
ATOM   1707 O  O   . SER A 1 215 ? 20.625 5.957   15.495  1.00 18.38 ? 396 SER A O   1 
ATOM   1708 C  CB  . SER A 1 215 ? 23.783 5.222   15.791  1.00 20.77 ? 396 SER A CB  1 
ATOM   1709 O  OG  . SER A 1 215 ? 23.010 4.097   15.420  1.00 22.00 ? 396 SER A OG  1 
ATOM   1710 N  N   . ASN A 1 216 ? 22.006 7.341   14.373  1.00 19.66 ? 397 ASN A N   1 
ATOM   1711 C  CA  . ASN A 1 216 ? 21.035 7.624   13.302  1.00 19.84 ? 397 ASN A CA  1 
ATOM   1712 C  C   . ASN A 1 216 ? 20.465 6.365   12.603  1.00 20.66 ? 397 ASN A C   1 
ATOM   1713 O  O   . ASN A 1 216 ? 19.240 6.233   12.406  1.00 18.93 ? 397 ASN A O   1 
ATOM   1714 C  CB  . ASN A 1 216 ? 21.665 8.614   12.318  1.00 20.17 ? 397 ASN A CB  1 
ATOM   1715 C  CG  . ASN A 1 216 ? 21.693 10.051  12.865  1.00 18.38 ? 397 ASN A CG  1 
ATOM   1716 O  OD1 . ASN A 1 216 ? 20.835 10.423  13.690  1.00 19.10 ? 397 ASN A OD1 1 
ATOM   1717 N  ND2 . ASN A 1 216 ? 22.608 10.865  12.375  1.00 17.52 ? 397 ASN A ND2 1 
HETATM 1718 N  N   . MSE A 1 217 ? 21.356 5.429   12.252  1.00 20.70 ? 398 MSE A N   1 
HETATM 1719 C  CA  . MSE A 1 217 ? 20.931 4.174   11.616  1.00 19.92 ? 398 MSE A CA  1 
HETATM 1720 C  C   . MSE A 1 217 ? 19.965 3.439   12.513  1.00 20.50 ? 398 MSE A C   1 
HETATM 1721 O  O   . MSE A 1 217 ? 18.906 2.996   12.066  1.00 20.04 ? 398 MSE A O   1 
HETATM 1722 C  CB  . MSE A 1 217 ? 22.113 3.256   11.231  1.00 20.26 ? 398 MSE A CB  1 
HETATM 1723 C  CG  . MSE A 1 217 ? 21.553 1.941   10.677  1.00 20.38 ? 398 MSE A CG  1 
HETATM 1724 SE SE  . MSE A 1 217 ? 20.822 2.442   8.994   0.87 25.49 ? 398 MSE A SE  1 
HETATM 1725 C  CE  . MSE A 1 217 ? 19.381 1.784   8.775   1.00 9.24  ? 398 MSE A CE  1 
ATOM   1726 N  N   . GLU A 1 218 ? 20.321 3.308   13.792  1.00 19.77 ? 399 GLU A N   1 
ATOM   1727 C  CA  . GLU A 1 218 ? 19.396 2.707   14.752  1.00 20.44 ? 399 GLU A CA  1 
ATOM   1728 C  C   . GLU A 1 218 ? 18.043 3.396   14.753  1.00 19.71 ? 399 GLU A C   1 
ATOM   1729 O  O   . GLU A 1 218 ? 17.002 2.757   14.670  1.00 19.48 ? 399 GLU A O   1 
ATOM   1730 C  CB  . GLU A 1 218 ? 20.009 2.783   16.145  1.00 20.83 ? 399 GLU A CB  1 
ATOM   1731 C  CG  . GLU A 1 218 ? 21.013 1.674   16.379  1.00 24.21 ? 399 GLU A CG  1 
ATOM   1732 C  CD  . GLU A 1 218 ? 21.786 1.872   17.662  1.00 27.29 ? 399 GLU A CD  1 
ATOM   1733 O  OE1 . GLU A 1 218 ? 21.423 1.191   18.635  1.00 29.95 ? 399 GLU A OE1 1 
ATOM   1734 O  OE2 . GLU A 1 218 ? 22.731 2.703   17.698  1.00 30.11 ? 399 GLU A OE2 1 
ATOM   1735 N  N   . ILE A 1 219 ? 18.071 4.728   14.795  1.00 19.98 ? 400 ILE A N   1 
ATOM   1736 C  CA  . ILE A 1 219 ? 16.792 5.474   14.857  1.00 19.16 ? 400 ILE A CA  1 
ATOM   1737 C  C   . ILE A 1 219 ? 15.896 5.166   13.661  1.00 19.10 ? 400 ILE A C   1 
ATOM   1738 O  O   . ILE A 1 219 ? 14.736 4.802   13.815  1.00 18.91 ? 400 ILE A O   1 
ATOM   1739 C  CB  . ILE A 1 219 ? 17.031 7.001   14.982  1.00 18.37 ? 400 ILE A CB  1 
ATOM   1740 C  CG1 . ILE A 1 219 ? 17.642 7.320   16.368  1.00 19.38 ? 400 ILE A CG1 1 
ATOM   1741 C  CG2 . ILE A 1 219 ? 15.696 7.750   14.807  1.00 17.66 ? 400 ILE A CG2 1 
ATOM   1742 C  CD1 . ILE A 1 219 ? 18.355 8.689   16.467  1.00 18.86 ? 400 ILE A CD1 1 
ATOM   1743 N  N   . GLY A 1 220 ? 16.419 5.359   12.455  1.00 19.66 ? 401 GLY A N   1 
ATOM   1744 C  CA  . GLY A 1 220 ? 15.563 5.188   11.278  1.00 19.82 ? 401 GLY A CA  1 
ATOM   1745 C  C   . GLY A 1 220 ? 15.041 3.763   11.132  1.00 20.10 ? 401 GLY A C   1 
ATOM   1746 O  O   . GLY A 1 220 ? 13.884 3.548   10.777  1.00 20.11 ? 401 GLY A O   1 
HETATM 1747 N  N   . MSE A 1 221 ? 15.889 2.782   11.425  1.00 21.54 ? 402 MSE A N   1 
HETATM 1748 C  CA  . MSE A 1 221 ? 15.450 1.377   11.303  1.00 23.36 ? 402 MSE A CA  1 
HETATM 1749 C  C   . MSE A 1 221 ? 14.360 1.043   12.297  1.00 23.35 ? 402 MSE A C   1 
HETATM 1750 O  O   . MSE A 1 221 ? 13.346 0.449   11.939  1.00 23.27 ? 402 MSE A O   1 
HETATM 1751 C  CB  . MSE A 1 221 ? 16.592 0.378   11.500  1.00 24.03 ? 402 MSE A CB  1 
HETATM 1752 C  CG  . MSE A 1 221 ? 17.609 0.333   10.403  1.00 25.13 ? 402 MSE A CG  1 
HETATM 1753 SE SE  . MSE A 1 221 ? 16.985 0.216   8.535   1.00 33.68 ? 402 MSE A SE  1 
HETATM 1754 C  CE  . MSE A 1 221 ? 15.245 -0.380  8.565   1.00 27.08 ? 402 MSE A CE  1 
ATOM   1755 N  N   . LYS A 1 222 ? 14.574 1.448   13.547  1.00 23.62 ? 403 LYS A N   1 
ATOM   1756 C  CA  . LYS A 1 222 ? 13.598 1.181   14.589  1.00 23.93 ? 403 LYS A CA  1 
ATOM   1757 C  C   . LYS A 1 222 ? 12.277 1.926   14.422  1.00 23.09 ? 403 LYS A C   1 
ATOM   1758 O  O   . LYS A 1 222 ? 11.220 1.351   14.611  1.00 22.81 ? 403 LYS A O   1 
ATOM   1759 C  CB  . LYS A 1 222 ? 14.200 1.408   15.977  1.00 23.57 ? 403 LYS A CB  1 
ATOM   1760 C  CG  . LYS A 1 222 ? 15.330 0.422   16.321  1.00 25.50 ? 403 LYS A CG  1 
ATOM   1761 C  CD  . LYS A 1 222 ? 15.957 0.782   17.677  1.00 26.42 ? 403 LYS A CD  1 
ATOM   1762 C  CE  . LYS A 1 222 ? 17.278 0.049   17.930  1.00 31.51 ? 403 LYS A CE  1 
ATOM   1763 N  NZ  . LYS A 1 222 ? 17.145 -1.419  17.745  1.00 34.98 ? 403 LYS A NZ  1 
ATOM   1764 N  N   . VAL A 1 223 ? 12.325 3.211   14.051  1.00 22.65 ? 404 VAL A N   1 
ATOM   1765 C  CA  . VAL A 1 223 ? 11.076 3.933   13.786  1.00 23.17 ? 404 VAL A CA  1 
ATOM   1766 C  C   . VAL A 1 223 ? 10.322 3.357   12.574  1.00 24.21 ? 404 VAL A C   1 
ATOM   1767 O  O   . VAL A 1 223 ? 9.091  3.212   12.608  1.00 24.00 ? 404 VAL A O   1 
ATOM   1768 C  CB  . VAL A 1 223 ? 11.346 5.446   13.573  1.00 22.92 ? 404 VAL A CB  1 
ATOM   1769 C  CG1 . VAL A 1 223 ? 10.072 6.196   13.207  1.00 23.11 ? 404 VAL A CG1 1 
ATOM   1770 C  CG2 . VAL A 1 223 ? 12.067 6.060   14.820  1.00 21.39 ? 404 VAL A CG2 1 
ATOM   1771 N  N   . ALA A 1 224 ? 11.055 3.058   11.492  1.00 25.15 ? 405 ALA A N   1 
ATOM   1772 C  CA  . ALA A 1 224 ? 10.427 2.518   10.258  1.00 25.62 ? 405 ALA A CA  1 
ATOM   1773 C  C   . ALA A 1 224 ? 9.903  1.091   10.433  1.00 26.76 ? 405 ALA A C   1 
ATOM   1774 O  O   . ALA A 1 224 ? 8.793  0.773   10.020  1.00 26.34 ? 405 ALA A O   1 
ATOM   1775 C  CB  . ALA A 1 224 ? 11.420 2.567   9.080   1.00 26.08 ? 405 ALA A CB  1 
ATOM   1776 N  N   . LEU A 1 225 ? 10.723 0.240   11.040  1.00 27.93 ? 406 LEU A N   1 
ATOM   1777 C  CA  . LEU A 1 225 ? 10.454 -1.198  11.028  1.00 29.39 ? 406 LEU A CA  1 
ATOM   1778 C  C   . LEU A 1 225 ? 9.970  -1.776  12.345  1.00 30.00 ? 406 LEU A C   1 
ATOM   1779 O  O   . LEU A 1 225 ? 9.381  -2.864  12.341  1.00 31.20 ? 406 LEU A O   1 
ATOM   1780 C  CB  . LEU A 1 225 ? 11.690 -1.972  10.559  1.00 28.71 ? 406 LEU A CB  1 
ATOM   1781 C  CG  . LEU A 1 225 ? 12.213 -1.641  9.161   1.00 29.69 ? 406 LEU A CG  1 
ATOM   1782 C  CD1 . LEU A 1 225 ? 13.360 -2.600  8.805   1.00 30.42 ? 406 LEU A CD1 1 
ATOM   1783 C  CD2 . LEU A 1 225 ? 11.100 -1.643  8.115   1.00 27.44 ? 406 LEU A CD2 1 
ATOM   1784 N  N   . GLU A 1 226 ? 10.234 -1.089  13.457  1.00 29.86 ? 407 GLU A N   1 
ATOM   1785 C  CA  . GLU A 1 226 ? 9.896  -1.611  14.790  1.00 30.14 ? 407 GLU A CA  1 
ATOM   1786 C  C   . GLU A 1 226 ? 8.890  -0.769  15.583  1.00 30.45 ? 407 GLU A C   1 
ATOM   1787 O  O   . GLU A 1 226 ? 8.598  -1.084  16.750  1.00 31.00 ? 407 GLU A O   1 
ATOM   1788 C  CB  . GLU A 1 226 ? 11.148 -1.760  15.639  1.00 29.83 ? 407 GLU A CB  1 
ATOM   1789 C  CG  . GLU A 1 226 ? 11.827 -3.074  15.494  1.00 34.54 ? 407 GLU A CG  1 
ATOM   1790 C  CD  . GLU A 1 226 ? 13.194 -3.057  16.114  1.00 40.87 ? 407 GLU A CD  1 
ATOM   1791 O  OE1 . GLU A 1 226 ? 13.329 -2.668  17.308  1.00 43.71 ? 407 GLU A OE1 1 
ATOM   1792 O  OE2 . GLU A 1 226 ? 14.147 -3.417  15.394  1.00 44.91 ? 407 GLU A OE2 1 
ATOM   1793 N  N   . GLY A 1 227 ? 8.379  0.298   14.969  1.00 29.27 ? 408 GLY A N   1 
ATOM   1794 C  CA  . GLY A 1 227 ? 7.492  1.238   15.648  1.00 28.39 ? 408 GLY A CA  1 
ATOM   1795 C  C   . GLY A 1 227 ? 8.085  2.000   16.825  1.00 27.00 ? 408 GLY A C   1 
ATOM   1796 O  O   . GLY A 1 227 ? 7.371  2.268   17.790  1.00 28.33 ? 408 GLY A O   1 
ATOM   1797 N  N   . LEU A 1 228 ? 9.366  2.363   16.782  1.00 25.91 ? 409 LEU A N   1 
ATOM   1798 C  CA  . LEU A 1 228 ? 9.934  3.177   17.851  1.00 25.48 ? 409 LEU A CA  1 
ATOM   1799 C  C   . LEU A 1 228 ? 9.350  4.569   17.782  1.00 26.20 ? 409 LEU A C   1 
ATOM   1800 O  O   . LEU A 1 228 ? 9.289  5.129   16.705  1.00 25.68 ? 409 LEU A O   1 
ATOM   1801 C  CB  . LEU A 1 228 ? 11.456 3.243   17.755  1.00 25.11 ? 409 LEU A CB  1 
ATOM   1802 C  CG  . LEU A 1 228 ? 12.145 4.181   18.726  1.00 24.77 ? 409 LEU A CG  1 
ATOM   1803 C  CD1 . LEU A 1 228 ? 11.947 3.677   20.168  1.00 28.02 ? 409 LEU A CD1 1 
ATOM   1804 C  CD2 . LEU A 1 228 ? 13.628 4.300   18.378  1.00 23.49 ? 409 LEU A CD2 1 
ATOM   1805 N  N   . ARG A 1 229 ? 8.895  5.105   18.926  1.00 26.74 ? 410 ARG A N   1 
ATOM   1806 C  CA  . ARG A 1 229 ? 8.264  6.445   19.001  1.00 27.41 ? 410 ARG A CA  1 
ATOM   1807 C  C   . ARG A 1 229 ? 8.697  7.170   20.269  1.00 29.07 ? 410 ARG A C   1 
ATOM   1808 O  O   . ARG A 1 229 ? 9.038  6.517   21.257  1.00 28.38 ? 410 ARG A O   1 
ATOM   1809 C  CB  . ARG A 1 229 ? 6.734  6.353   19.027  1.00 27.24 ? 410 ARG A CB  1 
ATOM   1810 C  CG  . ARG A 1 229 ? 6.128  5.589   17.884  1.00 25.76 ? 410 ARG A CG  1 
ATOM   1811 C  CD  . ARG A 1 229 ? 6.258  6.361   16.528  1.00 23.41 ? 410 ARG A CD  1 
ATOM   1812 N  NE  . ARG A 1 229 ? 5.613  5.678   15.407  1.00 23.27 ? 410 ARG A NE  1 
ATOM   1813 C  CZ  . ARG A 1 229 ? 6.228  4.833   14.567  1.00 20.96 ? 410 ARG A CZ  1 
ATOM   1814 N  NH1 . ARG A 1 229 ? 7.511  4.510   14.734  1.00 24.57 ? 410 ARG A NH1 1 
ATOM   1815 N  NH2 . ARG A 1 229 ? 5.555  4.299   13.573  1.00 19.42 ? 410 ARG A NH2 1 
ATOM   1816 N  N   . PRO A 1 230 ? 8.692  8.524   20.248  1.00 29.63 ? 411 PRO A N   1 
ATOM   1817 C  CA  . PRO A 1 230 ? 9.017  9.220   21.499  1.00 31.36 ? 411 PRO A CA  1 
ATOM   1818 C  C   . PRO A 1 230 ? 8.014  8.923   22.602  1.00 32.75 ? 411 PRO A C   1 
ATOM   1819 O  O   . PRO A 1 230 ? 6.800  8.763   22.340  1.00 32.44 ? 411 PRO A O   1 
ATOM   1820 C  CB  . PRO A 1 230 ? 8.967  10.707  21.110  1.00 30.91 ? 411 PRO A CB  1 
ATOM   1821 C  CG  . PRO A 1 230 ? 9.215  10.708  19.613  1.00 30.41 ? 411 PRO A CG  1 
ATOM   1822 C  CD  . PRO A 1 230 ? 8.454  9.473   19.146  1.00 29.74 ? 411 PRO A CD  1 
ATOM   1823 N  N   . THR A 1 231 ? 8.536  8.814   23.820  1.00 34.48 ? 412 THR A N   1 
ATOM   1824 C  CA  . THR A 1 231 ? 7.669  8.555   24.965  1.00 37.45 ? 412 THR A CA  1 
ATOM   1825 C  C   . THR A 1 231 ? 6.986  9.857   25.341  1.00 37.93 ? 412 THR A C   1 
ATOM   1826 O  O   . THR A 1 231 ? 7.667  10.814  25.699  1.00 38.58 ? 412 THR A O   1 
ATOM   1827 C  CB  . THR A 1 231 ? 8.449  7.983   26.164  1.00 37.52 ? 412 THR A CB  1 
ATOM   1828 O  OG1 . THR A 1 231 ? 9.216  6.843   25.735  1.00 40.34 ? 412 THR A OG1 1 
ATOM   1829 C  CG2 . THR A 1 231 ? 7.473  7.533   27.265  1.00 38.68 ? 412 THR A CG2 1 
ATOM   1830 N  N   . ILE A 1 232 ? 5.659  9.886   25.209  1.00 39.49 ? 413 ILE A N   1 
ATOM   1831 C  CA  . ILE A 1 232 ? 4.825  10.999  25.685  1.00 40.80 ? 413 ILE A CA  1 
ATOM   1832 C  C   . ILE A 1 232 ? 5.202  11.344  27.141  1.00 40.88 ? 413 ILE A C   1 
ATOM   1833 O  O   . ILE A 1 232 ? 5.172  10.481  28.025  1.00 40.83 ? 413 ILE A O   1 
ATOM   1834 C  CB  . ILE A 1 232 ? 3.297  10.695  25.521  1.00 41.35 ? 413 ILE A CB  1 
ATOM   1835 C  CG1 . ILE A 1 232 ? 2.483  11.987  25.354  1.00 41.78 ? 413 ILE A CG1 1 
ATOM   1836 C  CG2 . ILE A 1 232 ? 2.755  9.804   26.657  1.00 42.09 ? 413 ILE A CG2 1 
ATOM   1837 C  CD1 . ILE A 1 232 ? 1.983  12.191  23.926  1.00 42.72 ? 413 ILE A CD1 1 
ATOM   1838 N  N   . PRO A 1 233 ? 5.614  12.599  27.376  1.00 40.93 ? 414 PRO A N   1 
ATOM   1839 C  CA  . PRO A 1 233 ? 6.215  12.947  28.654  1.00 41.33 ? 414 PRO A CA  1 
ATOM   1840 C  C   . PRO A 1 233 ? 5.228  12.906  29.829  1.00 42.12 ? 414 PRO A C   1 
ATOM   1841 O  O   . PRO A 1 233 ? 4.047  13.234  29.656  1.00 42.07 ? 414 PRO A O   1 
ATOM   1842 C  CB  . PRO A 1 233 ? 6.748  14.366  28.412  1.00 40.98 ? 414 PRO A CB  1 
ATOM   1843 C  CG  . PRO A 1 233 ? 6.767  14.520  26.904  1.00 40.40 ? 414 PRO A CG  1 
ATOM   1844 C  CD  . PRO A 1 233 ? 5.584  13.755  26.460  1.00 40.37 ? 414 PRO A CD  1 
ATOM   1845 N  N   . PRO A 1 234 ? 5.715  12.480  31.012  1.00 43.07 ? 415 PRO A N   1 
ATOM   1846 C  CA  . PRO A 1 234 ? 4.894  12.478  32.218  1.00 43.58 ? 415 PRO A CA  1 
ATOM   1847 C  C   . PRO A 1 234 ? 4.579  13.909  32.669  1.00 43.68 ? 415 PRO A C   1 
ATOM   1848 O  O   . PRO A 1 234 ? 5.429  14.808  32.534  1.00 44.47 ? 415 PRO A O   1 
ATOM   1849 C  CB  . PRO A 1 234 ? 5.793  11.774  33.249  1.00 43.85 ? 415 PRO A CB  1 
ATOM   1850 C  CG  . PRO A 1 234 ? 7.182  11.991  32.770  1.00 43.59 ? 415 PRO A CG  1 
ATOM   1851 C  CD  . PRO A 1 234 ? 7.083  11.982  31.274  1.00 43.20 ? 415 PRO A CD  1 
ATOM   1852 N  N   . GLY A 1 235 ? 3.362  14.123  33.161  1.00 43.69 ? 416 GLY A N   1 
ATOM   1853 C  CA  . GLY A 1 235 ? 3.034  15.347  33.901  1.00 43.34 ? 416 GLY A CA  1 
ATOM   1854 C  C   . GLY A 1 235 ? 2.943  16.640  33.121  1.00 42.98 ? 416 GLY A C   1 
ATOM   1855 O  O   . GLY A 1 235 ? 3.351  17.697  33.606  1.00 43.71 ? 416 GLY A O   1 
ATOM   1856 N  N   . ILE A 1 236 ? 2.407  16.574  31.910  1.00 42.19 ? 417 ILE A N   1 
ATOM   1857 C  CA  . ILE A 1 236 ? 2.178  17.784  31.134  1.00 41.06 ? 417 ILE A CA  1 
ATOM   1858 C  C   . ILE A 1 236 ? 0.673  17.998  31.034  1.00 40.43 ? 417 ILE A C   1 
ATOM   1859 O  O   . ILE A 1 236 ? -0.096 17.067  31.298  1.00 40.32 ? 417 ILE A O   1 
ATOM   1860 C  CB  . ILE A 1 236 ? 2.882  17.727  29.749  1.00 41.03 ? 417 ILE A CB  1 
ATOM   1861 C  CG1 . ILE A 1 236 ? 2.214  16.716  28.819  1.00 41.60 ? 417 ILE A CG1 1 
ATOM   1862 C  CG2 . ILE A 1 236 ? 4.346  17.383  29.935  1.00 40.69 ? 417 ILE A CG2 1 
ATOM   1863 C  CD1 . ILE A 1 236 ? 2.742  16.744  27.361  1.00 40.79 ? 417 ILE A CD1 1 
ATOM   1864 N  N   . SER A 1 237 ? 0.249  19.213  30.688  1.00 39.06 ? 418 SER A N   1 
ATOM   1865 C  CA  . SER A 1 237 ? -1.178 19.516  30.614  1.00 38.42 ? 418 SER A CA  1 
ATOM   1866 C  C   . SER A 1 237 ? -1.854 18.630  29.588  1.00 37.62 ? 418 SER A C   1 
ATOM   1867 O  O   . SER A 1 237 ? -1.229 18.276  28.588  1.00 36.62 ? 418 SER A O   1 
ATOM   1868 C  CB  . SER A 1 237 ? -1.428 20.991  30.282  1.00 38.41 ? 418 SER A CB  1 
ATOM   1869 O  OG  . SER A 1 237 ? -1.326 21.241  28.894  1.00 39.46 ? 418 SER A OG  1 
ATOM   1870 N  N   . PRO A 1 238 ? -3.118 18.230  29.859  1.00 36.92 ? 419 PRO A N   1 
ATOM   1871 C  CA  . PRO A 1 238 ? -4.001 17.542  28.906  1.00 36.67 ? 419 PRO A CA  1 
ATOM   1872 C  C   . PRO A 1 238 ? -3.979 18.195  27.512  1.00 35.88 ? 419 PRO A C   1 
ATOM   1873 O  O   . PRO A 1 238 ? -4.018 17.490  26.490  1.00 35.60 ? 419 PRO A O   1 
ATOM   1874 C  CB  . PRO A 1 238 ? -5.403 17.711  29.535  1.00 37.07 ? 419 PRO A CB  1 
ATOM   1875 C  CG  . PRO A 1 238 ? -5.207 18.526  30.814  1.00 37.29 ? 419 PRO A CG  1 
ATOM   1876 C  CD  . PRO A 1 238 ? -3.767 18.364  31.178  1.00 37.54 ? 419 PRO A CD  1 
ATOM   1877 N  N   . HIS A 1 239 ? -3.890 19.523  27.493  1.00 34.54 ? 420 HIS A N   1 
ATOM   1878 C  CA  . HIS A 1 239 ? -3.961 20.295  26.260  1.00 33.91 ? 420 HIS A CA  1 
ATOM   1879 C  C   . HIS A 1 239 ? -2.689 20.181  25.407  1.00 31.72 ? 420 HIS A C   1 
ATOM   1880 O  O   . HIS A 1 239 ? -2.770 20.107  24.178  1.00 31.27 ? 420 HIS A O   1 
ATOM   1881 C  CB  . HIS A 1 239 ? -4.273 21.754  26.562  1.00 34.37 ? 420 HIS A CB  1 
ATOM   1882 C  CG  . HIS A 1 239 ? -4.599 22.557  25.341  1.00 37.97 ? 420 HIS A CG  1 
ATOM   1883 N  ND1 . HIS A 1 239 ? -5.767 22.381  24.621  1.00 40.44 ? 420 HIS A ND1 1 
ATOM   1884 C  CD2 . HIS A 1 239 ? -3.906 23.530  24.703  1.00 38.57 ? 420 HIS A CD2 1 
ATOM   1885 C  CE1 . HIS A 1 239 ? -5.776 23.215  23.595  1.00 41.78 ? 420 HIS A CE1 1 
ATOM   1886 N  NE2 . HIS A 1 239 ? -4.657 23.922  23.621  1.00 40.44 ? 420 HIS A NE2 1 
ATOM   1887 N  N   . VAL A 1 240 ? -1.524 20.185  26.052  1.00 30.04 ? 421 VAL A N   1 
ATOM   1888 C  CA  . VAL A 1 240 ? -0.260 19.981  25.330  1.00 28.29 ? 421 VAL A CA  1 
ATOM   1889 C  C   . VAL A 1 240 ? -0.194 18.517  24.886  1.00 28.06 ? 421 VAL A C   1 
ATOM   1890 O  O   . VAL A 1 240 ? 0.276  18.199  23.785  1.00 26.79 ? 421 VAL A O   1 
ATOM   1891 C  CB  . VAL A 1 240 ? 0.972  20.337  26.197  1.00 28.03 ? 421 VAL A CB  1 
ATOM   1892 C  CG1 . VAL A 1 240 ? 2.260  20.010  25.455  1.00 26.57 ? 421 VAL A CG1 1 
ATOM   1893 C  CG2 . VAL A 1 240 ? 0.951  21.799  26.553  1.00 27.93 ? 421 VAL A CG2 1 
ATOM   1894 N  N   . SER A 1 241 ? -0.706 17.631  25.740  1.00 27.66 ? 422 SER A N   1 
ATOM   1895 C  CA  . SER A 1 241 ? -0.727 16.210  25.434  1.00 27.98 ? 422 SER A CA  1 
ATOM   1896 C  C   . SER A 1 241 ? -1.549 15.908  24.169  1.00 27.59 ? 422 SER A C   1 
ATOM   1897 O  O   . SER A 1 241 ? -1.074 15.206  23.266  1.00 27.75 ? 422 SER A O   1 
ATOM   1898 C  CB  . SER A 1 241 ? -1.303 15.429  26.617  1.00 28.07 ? 422 SER A CB  1 
ATOM   1899 O  OG  . SER A 1 241 ? -0.941 14.078  26.471  1.00 31.67 ? 422 SER A OG  1 
ATOM   1900 N  N   . LYS A 1 242 ? -2.782 16.418  24.135  1.00 27.09 ? 423 LYS A N   1 
ATOM   1901 C  CA  . LYS A 1 242 ? -3.706 16.247  23.009  1.00 27.63 ? 423 LYS A CA  1 
ATOM   1902 C  C   . LYS A 1 242 ? -3.092 16.808  21.722  1.00 25.37 ? 423 LYS A C   1 
ATOM   1903 O  O   . LYS A 1 242 ? -3.122 16.137  20.695  1.00 25.24 ? 423 LYS A O   1 
ATOM   1904 C  CB  . LYS A 1 242 ? -5.031 16.954  23.309  1.00 27.54 ? 423 LYS A CB  1 
ATOM   1905 C  CG  . LYS A 1 242 ? -6.063 16.919  22.194  1.00 30.78 ? 423 LYS A CG  1 
ATOM   1906 C  CD  . LYS A 1 242 ? -7.344 17.607  22.615  1.00 31.80 ? 423 LYS A CD  1 
ATOM   1907 C  CE  . LYS A 1 242 ? -8.483 17.326  21.640  1.00 36.77 ? 423 LYS A CE  1 
ATOM   1908 N  NZ  . LYS A 1 242 ? -9.776 17.218  22.359  1.00 40.77 ? 423 LYS A NZ  1 
ATOM   1909 N  N   . LEU A 1 243 ? -2.532 18.018  21.791  1.00 23.16 ? 424 LEU A N   1 
ATOM   1910 C  CA  . LEU A 1 243 ? -1.886 18.637  20.630  1.00 22.46 ? 424 LEU A CA  1 
ATOM   1911 C  C   . LEU A 1 243 ? -0.751 17.764  20.090  1.00 22.16 ? 424 LEU A C   1 
ATOM   1912 O  O   . LEU A 1 243 ? -0.643 17.574  18.879  1.00 21.24 ? 424 LEU A O   1 
ATOM   1913 C  CB  . LEU A 1 243 ? -1.355 20.053  20.954  1.00 22.59 ? 424 LEU A CB  1 
ATOM   1914 C  CG  . LEU A 1 243 ? -0.681 20.803  19.778  1.00 22.37 ? 424 LEU A CG  1 
ATOM   1915 C  CD1 . LEU A 1 243 ? -1.716 21.084  18.664  1.00 19.80 ? 424 LEU A CD1 1 
ATOM   1916 C  CD2 . LEU A 1 243 ? -0.007 22.097  20.174  1.00 22.87 ? 424 LEU A CD2 1 
HETATM 1917 N  N   . MSE A 1 244 ? 0.097  17.244  20.972  1.00 21.36 ? 425 MSE A N   1 
HETATM 1918 C  CA  . MSE A 1 244 ? 1.204  16.399  20.520  1.00 23.84 ? 425 MSE A CA  1 
HETATM 1919 C  C   . MSE A 1 244 ? 0.730  15.109  19.821  1.00 23.21 ? 425 MSE A C   1 
HETATM 1920 O  O   . MSE A 1 244 ? 1.247  14.712  18.767  1.00 21.47 ? 425 MSE A O   1 
HETATM 1921 C  CB  . MSE A 1 244 ? 2.126  16.088  21.686  1.00 22.91 ? 425 MSE A CB  1 
HETATM 1922 C  CG  . MSE A 1 244 ? 3.496  15.627  21.269  1.00 26.18 ? 425 MSE A CG  1 
HETATM 1923 SE SE  . MSE A 1 244 ? 4.658  15.479  22.835  0.59 31.55 ? 425 MSE A SE  1 
HETATM 1924 C  CE  . MSE A 1 244 ? 4.004  16.987  23.726  1.00 14.90 ? 425 MSE A CE  1 
ATOM   1925 N  N   . LYS A 1 245 ? -0.286 14.487  20.409  1.00 23.75 ? 426 LYS A N   1 
ATOM   1926 C  CA  . LYS A 1 245 ? -0.878 13.244  19.914  1.00 26.08 ? 426 LYS A CA  1 
ATOM   1927 C  C   . LYS A 1 245 ? -1.511 13.415  18.520  1.00 25.36 ? 426 LYS A C   1 
ATOM   1928 O  O   . LYS A 1 245 ? -1.263 12.614  17.623  1.00 26.03 ? 426 LYS A O   1 
ATOM   1929 C  CB  . LYS A 1 245 ? -1.904 12.733  20.921  1.00 26.16 ? 426 LYS A CB  1 
ATOM   1930 C  CG  . LYS A 1 245 ? -1.283 11.981  22.127  1.00 28.89 ? 426 LYS A CG  1 
ATOM   1931 C  CD  . LYS A 1 245 ? -2.349 11.401  23.118  1.00 29.03 ? 426 LYS A CD  1 
ATOM   1932 C  CE  . LYS A 1 245 ? -3.538 12.376  23.358  1.00 33.82 ? 426 LYS A CE  1 
ATOM   1933 N  NZ  . LYS A 1 245 ? -3.853 12.674  24.809  1.00 37.11 ? 426 LYS A NZ  1 
ATOM   1934 N  N   . ILE A 1 246 ? -2.297 14.481  18.359  1.00 25.55 ? 427 ILE A N   1 
ATOM   1935 C  CA  . ILE A 1 246 ? -2.913 14.880  17.089  1.00 26.05 ? 427 ILE A CA  1 
ATOM   1936 C  C   . ILE A 1 246 ? -1.846 15.131  15.999  1.00 24.60 ? 427 ILE A C   1 
ATOM   1937 O  O   . ILE A 1 246 ? -2.000 14.690  14.850  1.00 24.51 ? 427 ILE A O   1 
ATOM   1938 C  CB  . ILE A 1 246 ? -3.763 16.173  17.333  1.00 26.57 ? 427 ILE A CB  1 
ATOM   1939 C  CG1 . ILE A 1 246 ? -5.170 15.844  17.853  1.00 29.47 ? 427 ILE A CG1 1 
ATOM   1940 C  CG2 . ILE A 1 246 ? -3.875 17.032  16.145  1.00 29.03 ? 427 ILE A CG2 1 
ATOM   1941 C  CD1 . ILE A 1 246 ? -5.213 15.130  19.177  1.00 36.77 ? 427 ILE A CD1 1 
ATOM   1942 N  N   . CYS A 1 247 ? -0.786 15.860  16.354  1.00 22.35 ? 428 CYS A N   1 
ATOM   1943 C  CA  . CYS A 1 247 ? 0.291  16.176  15.395  1.00 21.03 ? 428 CYS A CA  1 
ATOM   1944 C  C   . CYS A 1 247 ? 1.105  14.929  14.980  1.00 21.61 ? 428 CYS A C   1 
ATOM   1945 O  O   . CYS A 1 247 ? 1.580  14.840  13.864  1.00 19.98 ? 428 CYS A O   1 
ATOM   1946 C  CB  . CYS A 1 247 ? 1.200  17.302  15.935  1.00 20.73 ? 428 CYS A CB  1 
ATOM   1947 S  SG  . CYS A 1 247 ? 0.272  18.877  16.124  1.00 19.47 ? 428 CYS A SG  1 
HETATM 1948 N  N   . MSE A 1 248 ? 1.236  13.962  15.884  1.00 23.06 ? 429 MSE A N   1 
HETATM 1949 C  CA  . MSE A 1 248 ? 1.983  12.711  15.599  1.00 26.07 ? 429 MSE A CA  1 
HETATM 1950 C  C   . MSE A 1 248 ? 1.066  11.521  15.304  1.00 25.64 ? 429 MSE A C   1 
HETATM 1951 O  O   . MSE A 1 248 ? 1.406  10.377  15.595  1.00 26.23 ? 429 MSE A O   1 
HETATM 1952 C  CB  . MSE A 1 248 ? 2.908  12.382  16.761  1.00 26.23 ? 429 MSE A CB  1 
HETATM 1953 C  CG  . MSE A 1 248 ? 4.355  12.171  16.342  1.00 28.50 ? 429 MSE A CG  1 
HETATM 1954 SE SE  . MSE A 1 248 ? 5.478  11.693  17.873  0.59 30.88 ? 429 MSE A SE  1 
HETATM 1955 C  CE  . MSE A 1 248 ? 4.221  12.386  19.244  1.00 26.19 ? 429 MSE A CE  1 
ATOM   1956 N  N   . ASN A 1 249 ? -0.092 11.797  14.728  1.00 26.59 ? 430 ASN A N   1 
ATOM   1957 C  CA  . ASN A 1 249 ? -1.005 10.762  14.296  1.00 27.52 ? 430 ASN A CA  1 
ATOM   1958 C  C   . ASN A 1 249 ? -0.278 9.814   13.360  1.00 26.99 ? 430 ASN A C   1 
ATOM   1959 O  O   . ASN A 1 249 ? 0.474  10.255  12.497  1.00 26.12 ? 430 ASN A O   1 
ATOM   1960 C  CB  . ASN A 1 249 ? -2.200 11.378  13.588  1.00 27.67 ? 430 ASN A CB  1 
ATOM   1961 C  CG  . ASN A 1 249 ? -3.408 10.441  13.536  1.00 32.02 ? 430 ASN A CG  1 
ATOM   1962 O  OD1 . ASN A 1 249 ? -3.314 9.289   13.085  1.00 35.25 ? 430 ASN A OD1 1 
ATOM   1963 N  ND2 . ASN A 1 249 ? -4.552 10.941  13.977  1.00 35.48 ? 430 ASN A ND2 1 
ATOM   1964 N  N   . GLU A 1 250 ? -0.464 8.510   13.551  1.00 27.16 ? 431 GLU A N   1 
ATOM   1965 C  CA  . GLU A 1 250 ? 0.210  7.515   12.713  1.00 27.32 ? 431 GLU A CA  1 
ATOM   1966 C  C   . GLU A 1 250 ? -0.281 7.639   11.271  1.00 27.31 ? 431 GLU A C   1 
ATOM   1967 O  O   . GLU A 1 250 ? 0.511  7.449   10.324  1.00 27.61 ? 431 GLU A O   1 
ATOM   1968 C  CB  . GLU A 1 250 ? -0.001 6.075   13.232  1.00 28.01 ? 431 GLU A CB  1 
ATOM   1969 C  CG  . GLU A 1 250 ? 0.662  5.772   14.568  1.00 30.83 ? 431 GLU A CG  1 
ATOM   1970 C  CD  . GLU A 1 250 ? 2.182  5.754   14.500  1.00 33.19 ? 431 GLU A CD  1 
ATOM   1971 O  OE1 . GLU A 1 250 ? 2.750  5.392   13.444  1.00 33.10 ? 431 GLU A OE1 1 
ATOM   1972 O  OE2 . GLU A 1 250 ? 2.810  6.104   15.523  1.00 36.84 ? 431 GLU A OE2 1 
ATOM   1973 N  N   . ASP A 1 251 ? -1.569 7.974   11.127  1.00 26.29 ? 432 ASP A N   1 
ATOM   1974 C  CA  . ASP A 1 251 ? -2.193 8.266   9.837   1.00 26.60 ? 432 ASP A CA  1 
ATOM   1975 C  C   . ASP A 1 251 ? -1.879 9.691   9.361   1.00 25.34 ? 432 ASP A C   1 
ATOM   1976 O  O   . ASP A 1 251 ? -2.466 10.656  9.869   1.00 25.10 ? 432 ASP A O   1 
ATOM   1977 C  CB  . ASP A 1 251 ? -3.724 8.098   9.921   1.00 25.81 ? 432 ASP A CB  1 
ATOM   1978 C  CG  . ASP A 1 251 ? -4.417 8.244   8.563   1.00 29.28 ? 432 ASP A CG  1 
ATOM   1979 O  OD1 . ASP A 1 251 ? -3.717 8.355   7.543   1.00 30.44 ? 432 ASP A OD1 1 
ATOM   1980 O  OD2 . ASP A 1 251 ? -5.668 8.284   8.511   1.00 30.75 ? 432 ASP A OD2 1 
ATOM   1981 N  N   . PRO A 1 252 ? -1.010 9.820   8.338   1.00 25.53 ? 433 PRO A N   1 
ATOM   1982 C  CA  . PRO A 1 252 ? -0.598 11.145  7.863   1.00 24.54 ? 433 PRO A CA  1 
ATOM   1983 C  C   . PRO A 1 252 ? -1.823 11.998  7.553   1.00 24.74 ? 433 PRO A C   1 
ATOM   1984 O  O   . PRO A 1 252 ? -1.858 13.245  7.786   1.00 24.02 ? 433 PRO A O   1 
ATOM   1985 C  CB  . PRO A 1 252 ? 0.150  10.819  6.559   1.00 25.16 ? 433 PRO A CB  1 
ATOM   1986 C  CG  . PRO A 1 252 ? 0.714  9.441   6.782   1.00 24.60 ? 433 PRO A CG  1 
ATOM   1987 C  CD  . PRO A 1 252 ? -0.408 8.741   7.528   1.00 25.31 ? 433 PRO A CD  1 
ATOM   1988 N  N   . ALA A 1 253 ? -2.846 11.349  7.017   1.00 24.39 ? 434 ALA A N   1 
ATOM   1989 C  CA  . ALA A 1 253 ? -4.014 12.098  6.550   1.00 25.15 ? 434 ALA A CA  1 
ATOM   1990 C  C   . ALA A 1 253 ? -4.848 12.722  7.676   1.00 25.18 ? 434 ALA A C   1 
ATOM   1991 O  O   . ALA A 1 253 ? -5.671 13.609  7.431   1.00 26.26 ? 434 ALA A O   1 
ATOM   1992 C  CB  . ALA A 1 253 ? -4.867 11.222  5.610   1.00 25.53 ? 434 ALA A CB  1 
ATOM   1993 N  N   . LYS A 1 254 ? -4.629 12.296  8.914   1.00 25.13 ? 435 LYS A N   1 
ATOM   1994 C  CA  . LYS A 1 254 ? -5.414 12.840  10.028  1.00 25.15 ? 435 LYS A CA  1 
ATOM   1995 C  C   . LYS A 1 254 ? -4.631 13.927  10.791  1.00 23.66 ? 435 LYS A C   1 
ATOM   1996 O  O   . LYS A 1 254 ? -5.127 14.501  11.757  1.00 24.14 ? 435 LYS A O   1 
ATOM   1997 C  CB  . LYS A 1 254 ? -5.844 11.732  10.996  1.00 26.31 ? 435 LYS A CB  1 
ATOM   1998 C  CG  . LYS A 1 254 ? -6.924 10.736  10.455  1.00 29.65 ? 435 LYS A CG  1 
ATOM   1999 C  CD  . LYS A 1 254 ? -8.137 11.394  9.739   1.00 31.96 ? 435 LYS A CD  1 
ATOM   2000 C  CE  . LYS A 1 254 ? -9.194 10.344  9.197   1.00 32.81 ? 435 LYS A CE  1 
ATOM   2001 N  NZ  . LYS A 1 254 ? -9.107 9.967   7.715   1.00 32.14 ? 435 LYS A NZ  1 
ATOM   2002 N  N   . ARG A 1 255 ? -3.413 14.204  10.347  1.00 21.61 ? 436 ARG A N   1 
ATOM   2003 C  CA  . ARG A 1 255 ? -2.571 15.186  11.059  1.00 18.52 ? 436 ARG A CA  1 
ATOM   2004 C  C   . ARG A 1 255 ? -3.120 16.567  10.666  1.00 17.73 ? 436 ARG A C   1 
ATOM   2005 O  O   . ARG A 1 255 ? -3.487 16.759  9.504   1.00 18.89 ? 436 ARG A O   1 
ATOM   2006 C  CB  . ARG A 1 255 ? -1.102 15.045  10.644  1.00 18.59 ? 436 ARG A CB  1 
ATOM   2007 C  CG  . ARG A 1 255 ? -0.408 13.746  11.129  1.00 17.71 ? 436 ARG A CG  1 
ATOM   2008 C  CD  . ARG A 1 255 ? 1.051  13.605  10.731  1.00 17.71 ? 436 ARG A CD  1 
ATOM   2009 N  NE  . ARG A 1 255 ? 1.445  12.183  10.775  1.00 17.69 ? 436 ARG A NE  1 
ATOM   2010 C  CZ  . ARG A 1 255 ? 2.296  11.595  9.939   1.00 17.99 ? 436 ARG A CZ  1 
ATOM   2011 N  NH1 . ARG A 1 255 ? 2.955  12.302  9.019   1.00 16.30 ? 436 ARG A NH1 1 
ATOM   2012 N  NH2 . ARG A 1 255 ? 2.542  10.287  10.071  1.00 18.57 ? 436 ARG A NH2 1 
ATOM   2013 N  N   . PRO A 1 256 ? -3.148 17.534  11.606  1.00 17.22 ? 437 PRO A N   1 
ATOM   2014 C  CA  . PRO A 1 256 ? -3.620 18.861  11.246  1.00 16.97 ? 437 PRO A CA  1 
ATOM   2015 C  C   . PRO A 1 256 ? -2.673 19.550  10.259  1.00 15.58 ? 437 PRO A C   1 
ATOM   2016 O  O   . PRO A 1 256 ? -1.486 19.172  10.125  1.00 16.26 ? 437 PRO A O   1 
ATOM   2017 C  CB  . PRO A 1 256 ? -3.620 19.632  12.595  1.00 17.20 ? 437 PRO A CB  1 
ATOM   2018 C  CG  . PRO A 1 256 ? -2.615 18.918  13.440  1.00 19.60 ? 437 PRO A CG  1 
ATOM   2019 C  CD  . PRO A 1 256 ? -2.703 17.459  13.013  1.00 16.06 ? 437 PRO A CD  1 
ATOM   2020 N  N   . LYS A 1 257 ? -3.173 20.597  9.623   1.00 14.88 ? 438 LYS A N   1 
ATOM   2021 C  CA  . LYS A 1 257 ? -2.318 21.475  8.823   1.00 15.19 ? 438 LYS A CA  1 
ATOM   2022 C  C   . LYS A 1 257 ? -1.697 22.504  9.762   1.00 12.30 ? 438 LYS A C   1 
ATOM   2023 O  O   . LYS A 1 257 ? -2.232 22.779  10.872  1.00 12.43 ? 438 LYS A O   1 
ATOM   2024 C  CB  . LYS A 1 257 ? -3.138 22.204  7.767   1.00 14.28 ? 438 LYS A CB  1 
ATOM   2025 C  CG  . LYS A 1 257 ? -3.596 21.312  6.573   1.00 17.40 ? 438 LYS A CG  1 
ATOM   2026 C  CD  . LYS A 1 257 ? -4.209 22.194  5.473   1.00 19.84 ? 438 LYS A CD  1 
ATOM   2027 C  CE  . LYS A 1 257 ? -3.090 22.989  4.767   1.00 27.30 ? 438 LYS A CE  1 
ATOM   2028 N  NZ  . LYS A 1 257 ? -3.531 23.478  3.432   1.00 28.92 ? 438 LYS A NZ  1 
ATOM   2029 N  N   . PHE A 1 258 ? -0.572 23.068  9.359   1.00 12.17 ? 439 PHE A N   1 
ATOM   2030 C  CA  . PHE A 1 258 ? 0.038  24.165  10.192  1.00 10.93 ? 439 PHE A CA  1 
ATOM   2031 C  C   . PHE A 1 258 ? -0.905 25.361  10.403  1.00 12.21 ? 439 PHE A C   1 
ATOM   2032 O  O   . PHE A 1 258 ? -0.919 25.935  11.481  1.00 12.47 ? 439 PHE A O   1 
ATOM   2033 C  CB  . PHE A 1 258 ? 1.361  24.628  9.601   1.00 11.44 ? 439 PHE A CB  1 
ATOM   2034 C  CG  . PHE A 1 258 ? 2.500  23.654  9.864   1.00 11.22 ? 439 PHE A CG  1 
ATOM   2035 C  CD1 . PHE A 1 258 ? 3.151  23.668  11.096  1.00 10.94 ? 439 PHE A CD1 1 
ATOM   2036 C  CD2 . PHE A 1 258 ? 2.886  22.720  8.905   1.00 10.91 ? 439 PHE A CD2 1 
ATOM   2037 C  CE1 . PHE A 1 258 ? 4.201  22.747  11.359  1.00 9.55  ? 439 PHE A CE1 1 
ATOM   2038 C  CE2 . PHE A 1 258 ? 3.940  21.806  9.151   1.00 11.03 ? 439 PHE A CE2 1 
ATOM   2039 C  CZ  . PHE A 1 258 ? 4.576  21.811  10.391  1.00 11.85 ? 439 PHE A CZ  1 
ATOM   2040 N  N   . ASP A 1 259 ? -1.712 25.706  9.396   1.00 12.15 ? 440 ASP A N   1 
ATOM   2041 C  CA  . ASP A 1 259 ? -2.626 26.845  9.559   1.00 13.36 ? 440 ASP A CA  1 
ATOM   2042 C  C   . ASP A 1 259 ? -3.751 26.550  10.571  1.00 13.56 ? 440 ASP A C   1 
ATOM   2043 O  O   . ASP A 1 259 ? -4.373 27.493  11.085  1.00 14.46 ? 440 ASP A O   1 
ATOM   2044 C  CB  . ASP A 1 259 ? -3.123 27.390  8.192   1.00 14.21 ? 440 ASP A CB  1 
ATOM   2045 C  CG  . ASP A 1 259 ? -3.905 26.369  7.360   1.00 15.72 ? 440 ASP A CG  1 
ATOM   2046 O  OD1 . ASP A 1 259 ? -4.290 25.282  7.839   1.00 15.66 ? 440 ASP A OD1 1 
ATOM   2047 O  OD2 . ASP A 1 259 ? -4.142 26.697  6.156   1.00 18.54 ? 440 ASP A OD2 1 
HETATM 2048 N  N   . MSE A 1 260 ? -3.931 25.269  10.908  1.00 13.19 ? 441 MSE A N   1 
HETATM 2049 C  CA  . MSE A 1 260 ? -4.862 24.884  11.987  1.00 15.76 ? 441 MSE A CA  1 
HETATM 2050 C  C   . MSE A 1 260 ? -4.207 24.998  13.367  1.00 15.93 ? 441 MSE A C   1 
HETATM 2051 O  O   . MSE A 1 260 ? -4.867 25.375  14.354  1.00 16.52 ? 441 MSE A O   1 
HETATM 2052 C  CB  . MSE A 1 260 ? -5.432 23.473  11.753  1.00 16.67 ? 441 MSE A CB  1 
HETATM 2053 C  CG  . MSE A 1 260 ? -6.592 23.082  12.678  1.00 20.27 ? 441 MSE A CG  1 
HETATM 2054 SE SE  . MSE A 1 260 ? -8.176 24.282  12.482  0.83 27.72 ? 441 MSE A SE  1 
HETATM 2055 C  CE  . MSE A 1 260 ? -7.969 25.401  14.091  1.00 24.49 ? 441 MSE A CE  1 
ATOM   2056 N  N   . ILE A 1 261 ? -2.936 24.647  13.472  1.00 14.72 ? 442 ILE A N   1 
ATOM   2057 C  CA  . ILE A 1 261 ? -2.344 24.674  14.808  1.00 15.01 ? 442 ILE A CA  1 
ATOM   2058 C  C   . ILE A 1 261 ? -1.873 26.064  15.223  1.00 13.66 ? 442 ILE A C   1 
ATOM   2059 O  O   . ILE A 1 261 ? -1.724 26.322  16.392  1.00 12.36 ? 442 ILE A O   1 
ATOM   2060 C  CB  . ILE A 1 261 ? -1.258 23.588  15.051  1.00 17.05 ? 442 ILE A CB  1 
ATOM   2061 C  CG1 . ILE A 1 261 ? -0.034 23.901  14.246  1.00 17.51 ? 442 ILE A CG1 1 
ATOM   2062 C  CG2 . ILE A 1 261 ? -1.801 22.178  14.737  1.00 18.13 ? 442 ILE A CG2 1 
ATOM   2063 C  CD1 . ILE A 1 261 ? 1.169  23.136  14.743  1.00 24.92 ? 442 ILE A CD1 1 
ATOM   2064 N  N   . VAL A 1 262 ? -1.695 26.968  14.275  1.00 12.81 ? 443 VAL A N   1 
ATOM   2065 C  CA  . VAL A 1 262 ? -1.374 28.387  14.596  1.00 14.06 ? 443 VAL A CA  1 
ATOM   2066 C  C   . VAL A 1 262 ? -2.347 29.029  15.633  1.00 14.28 ? 443 VAL A C   1 
ATOM   2067 O  O   . VAL A 1 262 ? -1.902 29.550  16.681  1.00 12.86 ? 443 VAL A O   1 
ATOM   2068 C  CB  . VAL A 1 262 ? -1.189 29.240  13.317  1.00 13.50 ? 443 VAL A CB  1 
ATOM   2069 C  CG1 . VAL A 1 262 ? -1.154 30.718  13.674  1.00 14.95 ? 443 VAL A CG1 1 
ATOM   2070 C  CG2 . VAL A 1 262 ? 0.192  28.880  12.577  1.00 12.23 ? 443 VAL A CG2 1 
ATOM   2071 N  N   . PRO A 1 263 ? -3.682 29.063  15.333  1.00 15.85 ? 444 PRO A N   1 
ATOM   2072 C  CA  . PRO A 1 263 ? -4.624 29.573  16.345  1.00 16.53 ? 444 PRO A CA  1 
ATOM   2073 C  C   . PRO A 1 263 ? -4.624 28.821  17.680  1.00 16.73 ? 444 PRO A C   1 
ATOM   2074 O  O   . PRO A 1 263 ? -4.780 29.452  18.713  1.00 17.68 ? 444 PRO A O   1 
ATOM   2075 C  CB  . PRO A 1 263 ? -6.000 29.452  15.668  1.00 17.60 ? 444 PRO A CB  1 
ATOM   2076 C  CG  . PRO A 1 263 ? -5.781 28.550  14.521  1.00 16.92 ? 444 PRO A CG  1 
ATOM   2077 C  CD  . PRO A 1 263 ? -4.391 28.741  14.071  1.00 17.26 ? 444 PRO A CD  1 
ATOM   2078 N  N   . ILE A 1 264 ? -4.402 27.517  17.676  1.00 16.06 ? 445 ILE A N   1 
ATOM   2079 C  CA  . ILE A 1 264 ? -4.277 26.719  18.917  1.00 17.42 ? 445 ILE A CA  1 
ATOM   2080 C  C   . ILE A 1 264 ? -3.075 27.222  19.741  1.00 16.62 ? 445 ILE A C   1 
ATOM   2081 O  O   . ILE A 1 264 ? -3.144 27.445  20.968  1.00 16.95 ? 445 ILE A O   1 
ATOM   2082 C  CB  . ILE A 1 264 ? -4.143 25.218  18.572  1.00 17.59 ? 445 ILE A CB  1 
ATOM   2083 C  CG1 . ILE A 1 264 ? -5.438 24.714  17.881  1.00 17.66 ? 445 ILE A CG1 1 
ATOM   2084 C  CG2 . ILE A 1 264 ? -3.824 24.387  19.833  1.00 18.28 ? 445 ILE A CG2 1 
ATOM   2085 C  CD1 . ILE A 1 264 ? -5.368 23.263  17.342  1.00 20.82 ? 445 ILE A CD1 1 
ATOM   2086 N  N   . LEU A 1 265 ? -1.971 27.459  19.054  1.00 16.62 ? 446 LEU A N   1 
ATOM   2087 C  CA  . LEU A 1 265 ? -0.766 27.951  19.748  1.00 16.42 ? 446 LEU A CA  1 
ATOM   2088 C  C   . LEU A 1 265 ? -0.875 29.402  20.164  1.00 17.66 ? 446 LEU A C   1 
ATOM   2089 O  O   . LEU A 1 265 ? -0.286 29.806  21.174  1.00 18.32 ? 446 LEU A O   1 
ATOM   2090 C  CB  . LEU A 1 265 ? 0.458  27.736  18.854  1.00 15.98 ? 446 LEU A CB  1 
ATOM   2091 C  CG  . LEU A 1 265 ? 0.900  26.260  18.732  1.00 14.82 ? 446 LEU A CG  1 
ATOM   2092 C  CD1 . LEU A 1 265 ? 1.799  26.147  17.487  1.00 14.49 ? 446 LEU A CD1 1 
ATOM   2093 C  CD2 . LEU A 1 265 ? 1.664  25.700  19.978  1.00 15.66 ? 446 LEU A CD2 1 
ATOM   2094 N  N   . GLU A 1 266 ? -1.598 30.220  19.387  1.00 17.60 ? 447 GLU A N   1 
ATOM   2095 C  CA  . GLU A 1 266 ? -1.785 31.624  19.762  1.00 19.31 ? 447 GLU A CA  1 
ATOM   2096 C  C   . GLU A 1 266 ? -2.522 31.685  21.109  1.00 21.02 ? 447 GLU A C   1 
ATOM   2097 O  O   . GLU A 1 266 ? -2.152 32.479  21.983  1.00 21.61 ? 447 GLU A O   1 
ATOM   2098 C  CB  . GLU A 1 266 ? -2.588 32.366  18.695  1.00 18.33 ? 447 GLU A CB  1 
ATOM   2099 C  CG  . GLU A 1 266 ? -1.758 32.755  17.500  1.00 19.79 ? 447 GLU A CG  1 
ATOM   2100 C  CD  . GLU A 1 266 ? -2.577 33.295  16.329  1.00 22.36 ? 447 GLU A CD  1 
ATOM   2101 O  OE1 . GLU A 1 266 ? -3.810 33.010  16.238  1.00 24.11 ? 447 GLU A OE1 1 
ATOM   2102 O  OE2 . GLU A 1 266 ? -1.964 33.964  15.469  1.00 24.89 ? 447 GLU A OE2 1 
ATOM   2103 N  N   . LYS A 1 267 ? -3.512 30.815  21.288  1.00 21.61 ? 448 LYS A N   1 
ATOM   2104 C  CA  . LYS A 1 267 ? -4.287 30.809  22.535  1.00 24.86 ? 448 LYS A CA  1 
ATOM   2105 C  C   . LYS A 1 267 ? -3.445 30.321  23.720  1.00 26.27 ? 448 LYS A C   1 
ATOM   2106 O  O   . LYS A 1 267 ? -3.749 30.648  24.863  1.00 26.61 ? 448 LYS A O   1 
ATOM   2107 C  CB  . LYS A 1 267 ? -5.556 29.975  22.393  1.00 25.11 ? 448 LYS A CB  1 
ATOM   2108 C  CG  . LYS A 1 267 ? -6.537 30.591  21.431  1.00 28.19 ? 448 LYS A CG  1 
ATOM   2109 C  CD  . LYS A 1 267 ? -7.634 29.610  21.055  1.00 34.44 ? 448 LYS A CD  1 
ATOM   2110 C  CE  . LYS A 1 267 ? -8.500 30.189  19.943  1.00 36.54 ? 448 LYS A CE  1 
ATOM   2111 N  NZ  . LYS A 1 267 ? -7.822 30.199  18.604  1.00 40.66 ? 448 LYS A NZ  1 
HETATM 2112 N  N   . MSE A 1 268 ? -2.384 29.554  23.439  1.00 27.34 ? 449 MSE A N   1 
HETATM 2113 C  CA  . MSE A 1 268 ? -1.473 29.079  24.477  1.00 29.60 ? 449 MSE A CA  1 
HETATM 2114 C  C   . MSE A 1 268 ? -0.473 30.108  24.972  1.00 30.85 ? 449 MSE A C   1 
HETATM 2115 O  O   . MSE A 1 268 ? 0.105  29.939  26.043  1.00 30.53 ? 449 MSE A O   1 
HETATM 2116 C  CB  . MSE A 1 268 ? -0.736 27.845  24.006  1.00 28.68 ? 449 MSE A CB  1 
HETATM 2117 C  CG  . MSE A 1 268 ? -1.663 26.675  23.953  1.00 30.15 ? 449 MSE A CG  1 
HETATM 2118 SE SE  . MSE A 1 268 ? -0.979 25.187  22.967  0.65 31.95 ? 449 MSE A SE  1 
HETATM 2119 C  CE  . MSE A 1 268 ? 0.684  25.035  23.909  1.00 29.78 ? 449 MSE A CE  1 
ATOM   2120 N  N   . GLN A 1 269 ? -0.247 31.144  24.181  1.00 33.55 ? 450 GLN A N   1 
ATOM   2121 C  CA  . GLN A 1 269 ? 0.650  32.239  24.552  1.00 36.83 ? 450 GLN A CA  1 
ATOM   2122 C  C   . GLN A 1 269 ? 0.234  32.980  25.828  1.00 39.43 ? 450 GLN A C   1 
ATOM   2123 O  O   . GLN A 1 269 ? -0.954 33.013  26.180  1.00 39.71 ? 450 GLN A O   1 
ATOM   2124 C  CB  . GLN A 1 269 ? 0.687  33.266  23.449  1.00 36.81 ? 450 GLN A CB  1 
ATOM   2125 C  CG  . GLN A 1 269 ? 1.573  32.983  22.280  1.00 37.32 ? 450 GLN A CG  1 
ATOM   2126 C  CD  . GLN A 1 269 ? 1.764  34.255  21.484  1.00 40.35 ? 450 GLN A CD  1 
ATOM   2127 O  OE1 . GLN A 1 269 ? 2.828  34.882  21.543  1.00 42.68 ? 450 GLN A OE1 1 
ATOM   2128 N  NE2 . GLN A 1 269 ? 0.705  34.691  20.784  1.00 41.88 ? 450 GLN A NE2 1 
ATOM   2129 N  N   . ASP A 1 270 ? 1.231  33.605  26.467  1.00 41.99 ? 451 ASP A N   1 
ATOM   2130 C  CA  . ASP A 1 270 ? 1.093  34.441  27.687  1.00 44.61 ? 451 ASP A CA  1 
ATOM   2131 C  C   . ASP A 1 270 ? 1.871  33.791  28.857  1.00 45.09 ? 451 ASP A C   1 
ATOM   2132 O  O   . ASP A 1 270 ? 1.316  33.067  29.693  1.00 45.21 ? 451 ASP A O   1 
ATOM   2133 C  CB  . ASP A 1 270 ? -0.383 34.734  28.046  1.00 45.26 ? 451 ASP A CB  1 
ATOM   2134 C  CG  . ASP A 1 270 ? -0.550 35.952  28.954  1.00 48.68 ? 451 ASP A CG  1 
ATOM   2135 O  OD1 . ASP A 1 270 ? -0.061 35.926  30.113  1.00 52.42 ? 451 ASP A OD1 1 
ATOM   2136 O  OD2 . ASP A 1 270 ? -1.208 36.931  28.522  1.00 51.88 ? 451 ASP A OD2 1 
ATOM   2137 N  N   . ALA B 2 6   ? 49.753 -6.460  -1.326  1.00 71.17 ? 249 ALA B N   1 
ATOM   2138 C  CA  . ALA B 2 6   ? 49.988 -6.373  0.148   1.00 71.22 ? 249 ALA B CA  1 
ATOM   2139 C  C   . ALA B 2 6   ? 48.914 -7.123  0.937   1.00 71.33 ? 249 ALA B C   1 
ATOM   2140 O  O   . ALA B 2 6   ? 49.213 -7.769  1.942   1.00 71.46 ? 249 ALA B O   1 
ATOM   2141 C  CB  . ALA B 2 6   ? 50.066 -4.918  0.599   1.00 71.20 ? 249 ALA B CB  1 
ATOM   2142 N  N   . PHE B 2 7   ? 47.666 -7.024  0.487   1.00 71.26 ? 250 PHE B N   1 
ATOM   2143 C  CA  . PHE B 2 7   ? 46.580 -7.814  1.059   1.00 71.15 ? 250 PHE B CA  1 
ATOM   2144 C  C   . PHE B 2 7   ? 46.596 -9.235  0.478   1.00 71.42 ? 250 PHE B C   1 
ATOM   2145 O  O   . PHE B 2 7   ? 46.130 -10.177 1.122   1.00 71.43 ? 250 PHE B O   1 
ATOM   2146 C  CB  . PHE B 2 7   ? 45.221 -7.129  0.838   1.00 70.73 ? 250 PHE B CB  1 
ATOM   2147 C  CG  . PHE B 2 7   ? 44.059 -7.855  1.471   1.00 70.11 ? 250 PHE B CG  1 
ATOM   2148 C  CD1 . PHE B 2 7   ? 43.857 -7.811  2.847   1.00 69.69 ? 250 PHE B CD1 1 
ATOM   2149 C  CD2 . PHE B 2 7   ? 43.168 -8.583  0.687   1.00 69.73 ? 250 PHE B CD2 1 
ATOM   2150 C  CE1 . PHE B 2 7   ? 42.791 -8.487  3.435   1.00 69.17 ? 250 PHE B CE1 1 
ATOM   2151 C  CE2 . PHE B 2 7   ? 42.101 -9.260  1.266   1.00 69.04 ? 250 PHE B CE2 1 
ATOM   2152 C  CZ  . PHE B 2 7   ? 41.913 -9.213  2.642   1.00 69.10 ? 250 PHE B CZ  1 
ATOM   2153 N  N   . ASP B 2 8   ? 47.148 -9.381  -0.727  1.00 71.86 ? 251 ASP B N   1 
ATOM   2154 C  CA  . ASP B 2 8   ? 47.287 -10.687 -1.384  1.00 72.48 ? 251 ASP B CA  1 
ATOM   2155 C  C   . ASP B 2 8   ? 48.184 -11.656 -0.601  1.00 72.69 ? 251 ASP B C   1 
ATOM   2156 O  O   . ASP B 2 8   ? 47.877 -12.845 -0.477  1.00 72.54 ? 251 ASP B O   1 
ATOM   2157 C  CB  . ASP B 2 8   ? 47.835 -10.515 -2.803  1.00 72.64 ? 251 ASP B CB  1 
ATOM   2158 C  CG  . ASP B 2 8   ? 46.890 -9.747  -3.716  1.00 73.31 ? 251 ASP B CG  1 
ATOM   2159 O  OD1 . ASP B 2 8   ? 45.748 -9.443  -3.303  1.00 73.57 ? 251 ASP B OD1 1 
ATOM   2160 O  OD2 . ASP B 2 8   ? 47.297 -9.454  -4.862  1.00 74.43 ? 251 ASP B OD2 1 
ATOM   2161 N  N   . THR B 2 9   ? 49.289 -11.129 -0.081  1.00 72.93 ? 252 THR B N   1 
ATOM   2162 C  CA  . THR B 2 9   ? 50.250 -11.908 0.694   1.00 73.13 ? 252 THR B CA  1 
ATOM   2163 C  C   . THR B 2 9   ? 49.658 -12.379 2.024   1.00 73.23 ? 252 THR B C   1 
ATOM   2164 O  O   . THR B 2 9   ? 49.931 -13.496 2.468   1.00 73.32 ? 252 THR B O   1 
ATOM   2165 C  CB  . THR B 2 9   ? 51.535 -11.092 0.957   1.00 73.19 ? 252 THR B CB  1 
ATOM   2166 O  OG1 . THR B 2 9   ? 51.962 -10.473 -0.264  1.00 73.13 ? 252 THR B OG1 1 
ATOM   2167 C  CG2 . THR B 2 9   ? 52.655 -11.986 1.503   1.00 73.14 ? 252 THR B CG2 1 
ATOM   2168 N  N   . LEU B 2 10  ? 48.848 -11.522 2.647   1.00 73.35 ? 253 LEU B N   1 
ATOM   2169 C  CA  . LEU B 2 10  ? 48.188 -11.844 3.913   1.00 73.46 ? 253 LEU B CA  1 
ATOM   2170 C  C   . LEU B 2 10  ? 47.016 -12.804 3.692   1.00 73.45 ? 253 LEU B C   1 
ATOM   2171 O  O   . LEU B 2 10  ? 46.501 -13.387 4.646   1.00 73.68 ? 253 LEU B O   1 
ATOM   2172 C  CB  . LEU B 2 10  ? 47.711 -10.570 4.631   1.00 73.52 ? 253 LEU B CB  1 
ATOM   2173 C  CG  . LEU B 2 10  ? 48.583 -9.299  4.579   1.00 73.89 ? 253 LEU B CG  1 
ATOM   2174 C  CD1 . LEU B 2 10  ? 47.822 -8.080  5.119   1.00 74.30 ? 253 LEU B CD1 1 
ATOM   2175 C  CD2 . LEU B 2 10  ? 49.944 -9.458  5.279   1.00 74.21 ? 253 LEU B CD2 1 
ATOM   2176 N  N   . PHE B 2 11  ? 46.608 -12.966 2.433   1.00 73.30 ? 254 PHE B N   1 
ATOM   2177 C  CA  . PHE B 2 11  ? 45.540 -13.897 2.069   1.00 73.10 ? 254 PHE B CA  1 
ATOM   2178 C  C   . PHE B 2 11  ? 46.079 -15.249 1.595   1.00 73.00 ? 254 PHE B C   1 
ATOM   2179 O  O   . PHE B 2 11  ? 45.579 -16.298 2.000   1.00 72.81 ? 254 PHE B O   1 
ATOM   2180 C  CB  . PHE B 2 11  ? 44.622 -13.290 0.999   1.00 73.08 ? 254 PHE B CB  1 
ATOM   2181 C  CG  . PHE B 2 11  ? 43.336 -14.056 0.792   1.00 73.05 ? 254 PHE B CG  1 
ATOM   2182 C  CD1 . PHE B 2 11  ? 42.241 -13.845 1.630   1.00 72.63 ? 254 PHE B CD1 1 
ATOM   2183 C  CD2 . PHE B 2 11  ? 43.218 -14.983 -0.242  1.00 73.16 ? 254 PHE B CD2 1 
ATOM   2184 C  CE1 . PHE B 2 11  ? 41.051 -14.547 1.443   1.00 72.66 ? 254 PHE B CE1 1 
ATOM   2185 C  CE2 . PHE B 2 11  ? 42.031 -15.690 -0.439  1.00 72.89 ? 254 PHE B CE2 1 
ATOM   2186 C  CZ  . PHE B 2 11  ? 40.945 -15.470 0.406   1.00 72.78 ? 254 PHE B CZ  1 
ATOM   2187 N  N   . ASP B 2 12  ? 47.096 -15.215 0.738   1.00 72.94 ? 255 ASP B N   1 
ATOM   2188 C  CA  . ASP B 2 12  ? 47.618 -16.434 0.112   1.00 73.08 ? 255 ASP B CA  1 
ATOM   2189 C  C   . ASP B 2 12  ? 48.740 -17.121 0.898   1.00 73.08 ? 255 ASP B C   1 
ATOM   2190 O  O   . ASP B 2 12  ? 48.908 -18.339 0.795   1.00 73.17 ? 255 ASP B O   1 
ATOM   2191 C  CB  . ASP B 2 12  ? 48.080 -16.152 -1.324  1.00 72.88 ? 255 ASP B CB  1 
ATOM   2192 C  CG  . ASP B 2 12  ? 46.989 -15.531 -2.184  1.00 73.22 ? 255 ASP B CG  1 
ATOM   2193 O  OD1 . ASP B 2 12  ? 45.795 -15.854 -1.974  1.00 72.67 ? 255 ASP B OD1 1 
ATOM   2194 O  OD2 . ASP B 2 12  ? 47.334 -14.715 -3.071  1.00 73.07 ? 255 ASP B OD2 1 
ATOM   2195 N  N   . HIS B 2 13  ? 49.493 -16.347 1.684   1.00 73.14 ? 256 HIS B N   1 
ATOM   2196 C  CA  . HIS B 2 13  ? 50.717 -16.847 2.329   1.00 73.25 ? 256 HIS B CA  1 
ATOM   2197 C  C   . HIS B 2 13  ? 50.823 -16.576 3.847   1.00 73.48 ? 256 HIS B C   1 
ATOM   2198 O  O   . HIS B 2 13  ? 51.931 -16.562 4.412   1.00 73.57 ? 256 HIS B O   1 
ATOM   2199 C  CB  . HIS B 2 13  ? 51.960 -16.328 1.580   1.00 73.01 ? 256 HIS B CB  1 
ATOM   2200 C  CG  . HIS B 2 13  ? 51.908 -16.561 0.100   1.00 72.97 ? 256 HIS B CG  1 
ATOM   2201 N  ND1 . HIS B 2 13  ? 51.985 -17.819 -0.459  1.00 72.64 ? 256 HIS B ND1 1 
ATOM   2202 C  CD2 . HIS B 2 13  ? 51.765 -15.699 -0.934  1.00 72.59 ? 256 HIS B CD2 1 
ATOM   2203 C  CE1 . HIS B 2 13  ? 51.893 -17.722 -1.773  1.00 72.32 ? 256 HIS B CE1 1 
ATOM   2204 N  NE2 . HIS B 2 13  ? 51.761 -16.447 -2.087  1.00 72.52 ? 256 HIS B NE2 1 
ATOM   2205 N  N   . ALA B 2 14  ? 49.678 -16.381 4.502   1.00 73.40 ? 257 ALA B N   1 
ATOM   2206 C  CA  . ALA B 2 14  ? 49.648 -16.152 5.947   1.00 73.41 ? 257 ALA B CA  1 
ATOM   2207 C  C   . ALA B 2 14  ? 48.327 -16.588 6.587   1.00 73.48 ? 257 ALA B C   1 
ATOM   2208 O  O   . ALA B 2 14  ? 47.554 -15.738 7.047   1.00 73.37 ? 257 ALA B O   1 
ATOM   2209 C  CB  . ALA B 2 14  ? 49.947 -14.684 6.261   1.00 73.42 ? 257 ALA B CB  1 
ATOM   2210 N  N   . PRO B 2 15  ? 48.068 -17.918 6.631   1.00 73.53 ? 258 PRO B N   1 
ATOM   2211 C  CA  . PRO B 2 15  ? 46.861 -18.448 7.285   1.00 73.45 ? 258 PRO B CA  1 
ATOM   2212 C  C   . PRO B 2 15  ? 46.853 -18.127 8.777   1.00 73.47 ? 258 PRO B C   1 
ATOM   2213 O  O   . PRO B 2 15  ? 45.787 -17.929 9.359   1.00 73.13 ? 258 PRO B O   1 
ATOM   2214 C  CB  . PRO B 2 15  ? 46.971 -19.967 7.077   1.00 73.42 ? 258 PRO B CB  1 
ATOM   2215 C  CG  . PRO B 2 15  ? 47.983 -20.160 6.010   1.00 73.36 ? 258 PRO B CG  1 
ATOM   2216 C  CD  . PRO B 2 15  ? 48.912 -18.996 6.076   1.00 73.48 ? 258 PRO B CD  1 
ATOM   2217 N  N   . ASP B 2 16  ? 48.049 -18.088 9.370   1.00 73.68 ? 259 ASP B N   1 
ATOM   2218 C  CA  . ASP B 2 16  ? 48.261 -17.668 10.762  1.00 73.86 ? 259 ASP B CA  1 
ATOM   2219 C  C   . ASP B 2 16  ? 47.752 -16.243 11.030  1.00 73.89 ? 259 ASP B C   1 
ATOM   2220 O  O   . ASP B 2 16  ? 47.245 -15.946 12.121  1.00 74.07 ? 259 ASP B O   1 
ATOM   2221 C  CB  . ASP B 2 16  ? 49.748 -17.787 11.147  1.00 73.81 ? 259 ASP B CB  1 
ATOM   2222 C  CG  . ASP B 2 16  ? 50.677 -17.121 10.140  0.50 73.43 ? 259 ASP B CG  1 
ATOM   2223 O  OD1 . ASP B 2 16  ? 50.728 -17.570 8.976   0.50 72.99 ? 259 ASP B OD1 1 
ATOM   2224 O  OD2 . ASP B 2 16  ? 51.371 -16.155 10.517  0.50 73.20 ? 259 ASP B OD2 1 
ATOM   2225 N  N   . LYS B 2 17  ? 47.893 -15.374 10.030  1.00 73.76 ? 260 LYS B N   1 
ATOM   2226 C  CA  . LYS B 2 17  ? 47.370 -14.012 10.098  1.00 73.52 ? 260 LYS B CA  1 
ATOM   2227 C  C   . LYS B 2 17  ? 45.891 -13.988 9.712   1.00 73.19 ? 260 LYS B C   1 
ATOM   2228 O  O   . LYS B 2 17  ? 45.066 -13.468 10.467  1.00 73.20 ? 260 LYS B O   1 
ATOM   2229 C  CB  . LYS B 2 17  ? 48.172 -13.071 9.190   1.00 73.74 ? 260 LYS B CB  1 
ATOM   2230 C  CG  . LYS B 2 17  ? 49.696 -13.218 9.280   1.00 74.10 ? 260 LYS B CG  1 
ATOM   2231 C  CD  . LYS B 2 17  ? 50.246 -12.812 10.632  1.00 74.46 ? 260 LYS B CD  1 
ATOM   2232 C  CE  . LYS B 2 17  ? 51.654 -12.270 10.486  1.00 75.00 ? 260 LYS B CE  1 
ATOM   2233 N  NZ  . LYS B 2 17  ? 52.175 -11.743 11.778  1.00 75.48 ? 260 LYS B NZ  1 
ATOM   2234 N  N   . LEU B 2 18  ? 45.578 -14.578 8.552   1.00 72.69 ? 261 LEU B N   1 
ATOM   2235 C  CA  . LEU B 2 18  ? 44.229 -14.608 7.957   1.00 72.27 ? 261 LEU B CA  1 
ATOM   2236 C  C   . LEU B 2 18  ? 43.115 -15.008 8.936   1.00 72.07 ? 261 LEU B C   1 
ATOM   2237 O  O   . LEU B 2 18  ? 41.961 -14.606 8.773   1.00 71.98 ? 261 LEU B O   1 
ATOM   2238 C  CB  . LEU B 2 18  ? 44.212 -15.554 6.745   1.00 72.16 ? 261 LEU B CB  1 
ATOM   2239 C  CG  . LEU B 2 18  ? 43.326 -15.290 5.515   1.00 72.06 ? 261 LEU B CG  1 
ATOM   2240 C  CD1 . LEU B 2 18  ? 43.703 -16.230 4.392   1.00 71.06 ? 261 LEU B CD1 1 
ATOM   2241 C  CD2 . LEU B 2 18  ? 41.829 -15.405 5.790   1.00 72.38 ? 261 LEU B CD2 1 
ATOM   2242 N  N   . ASN B 2 19  ? 43.466 -15.794 9.947   1.00 71.61 ? 262 ASN B N   1 
ATOM   2243 C  CA  . ASN B 2 19  ? 42.485 -16.300 10.897  1.00 71.38 ? 262 ASN B CA  1 
ATOM   2244 C  C   . ASN B 2 19  ? 42.282 -15.403 12.110  1.00 71.11 ? 262 ASN B C   1 
ATOM   2245 O  O   . ASN B 2 19  ? 41.173 -15.332 12.648  1.00 71.19 ? 262 ASN B O   1 
ATOM   2246 C  CB  . ASN B 2 19  ? 42.831 -17.729 11.312  1.00 71.49 ? 262 ASN B CB  1 
ATOM   2247 C  CG  . ASN B 2 19  ? 42.938 -18.655 10.123  1.00 71.71 ? 262 ASN B CG  1 
ATOM   2248 O  OD1 . ASN B 2 19  ? 42.200 -18.511 9.144   1.00 71.15 ? 262 ASN B OD1 1 
ATOM   2249 N  ND2 . ASN B 2 19  ? 43.876 -19.601 10.186  1.00 72.18 ? 262 ASN B ND2 1 
ATOM   2250 N  N   . VAL B 2 20  ? 43.344 -14.720 12.538  1.00 70.55 ? 263 VAL B N   1 
ATOM   2251 C  CA  . VAL B 2 20  ? 43.197 -13.635 13.513  1.00 70.04 ? 263 VAL B CA  1 
ATOM   2252 C  C   . VAL B 2 20  ? 42.436 -12.488 12.827  1.00 69.66 ? 263 VAL B C   1 
ATOM   2253 O  O   . VAL B 2 20  ? 41.614 -11.817 13.454  1.00 69.54 ? 263 VAL B O   1 
ATOM   2254 C  CB  . VAL B 2 20  ? 44.562 -13.151 14.078  1.00 70.07 ? 263 VAL B CB  1 
ATOM   2255 C  CG1 . VAL B 2 20  ? 44.359 -12.051 15.127  1.00 69.78 ? 263 VAL B CG1 1 
ATOM   2256 C  CG2 . VAL B 2 20  ? 45.348 -14.326 14.680  1.00 69.87 ? 263 VAL B CG2 1 
ATOM   2257 N  N   . VAL B 2 21  ? 42.716 -12.306 11.532  1.00 69.17 ? 264 VAL B N   1 
ATOM   2258 C  CA  . VAL B 2 21  ? 42.036 -11.342 10.661  1.00 68.52 ? 264 VAL B CA  1 
ATOM   2259 C  C   . VAL B 2 21  ? 40.522 -11.584 10.617  1.00 68.07 ? 264 VAL B C   1 
ATOM   2260 O  O   . VAL B 2 21  ? 39.748 -10.708 11.007  1.00 68.08 ? 264 VAL B O   1 
ATOM   2261 C  CB  . VAL B 2 21  ? 42.670 -11.323 9.225   1.00 68.56 ? 264 VAL B CB  1 
ATOM   2262 C  CG1 . VAL B 2 21  ? 41.655 -10.921 8.148   1.00 68.80 ? 264 VAL B CG1 1 
ATOM   2263 C  CG2 . VAL B 2 21  ? 43.894 -10.407 9.192   1.00 67.94 ? 264 VAL B CG2 1 
ATOM   2264 N  N   . LYS B 2 22  ? 40.109 -12.773 10.178  1.00 67.24 ? 265 LYS B N   1 
ATOM   2265 C  CA  . LYS B 2 22  ? 38.686 -13.088 10.060  1.00 66.64 ? 265 LYS B CA  1 
ATOM   2266 C  C   . LYS B 2 22  ? 37.978 -13.053 11.411  1.00 66.08 ? 265 LYS B C   1 
ATOM   2267 O  O   . LYS B 2 22  ? 36.866 -12.544 11.513  1.00 65.93 ? 265 LYS B O   1 
ATOM   2268 C  CB  . LYS B 2 22  ? 38.463 -14.419 9.346   1.00 66.70 ? 265 LYS B CB  1 
ATOM   2269 C  CG  . LYS B 2 22  ? 38.805 -14.360 7.861   1.00 67.44 ? 265 LYS B CG  1 
ATOM   2270 C  CD  . LYS B 2 22  ? 37.792 -15.120 7.003   1.00 68.69 ? 265 LYS B CD  1 
ATOM   2271 C  CE  . LYS B 2 22  ? 38.224 -16.558 6.715   1.00 69.13 ? 265 LYS B CE  1 
ATOM   2272 N  NZ  . LYS B 2 22  ? 37.368 -17.164 5.653   1.00 68.37 ? 265 LYS B NZ  1 
ATOM   2273 N  N   . LYS B 2 23  ? 38.638 -13.565 12.448  1.00 65.29 ? 266 LYS B N   1 
ATOM   2274 C  CA  . LYS B 2 23  ? 38.125 -13.458 13.814  1.00 64.72 ? 266 LYS B CA  1 
ATOM   2275 C  C   . LYS B 2 23  ? 37.821 -11.985 14.138  1.00 63.81 ? 266 LYS B C   1 
ATOM   2276 O  O   . LYS B 2 23  ? 36.727 -11.653 14.611  1.00 63.79 ? 266 LYS B O   1 
ATOM   2277 C  CB  . LYS B 2 23  ? 39.125 -14.069 14.815  1.00 64.73 ? 266 LYS B CB  1 
ATOM   2278 C  CG  . LYS B 2 23  ? 38.595 -14.266 16.237  1.00 65.52 ? 266 LYS B CG  1 
ATOM   2279 C  CD  . LYS B 2 23  ? 39.152 -13.214 17.192  1.00 66.90 ? 266 LYS B CD  1 
ATOM   2280 C  CE  . LYS B 2 23  ? 38.436 -13.226 18.536  1.00 67.60 ? 266 LYS B CE  1 
ATOM   2281 N  NZ  . LYS B 2 23  ? 37.032 -12.727 18.427  1.00 67.85 ? 266 LYS B NZ  1 
ATOM   2282 N  N   . THR B 2 24  ? 38.787 -11.120 13.833  1.00 62.76 ? 267 THR B N   1 
ATOM   2283 C  CA  . THR B 2 24  ? 38.712 -9.693  14.127  1.00 61.93 ? 267 THR B CA  1 
ATOM   2284 C  C   . THR B 2 24  ? 37.710 -8.954  13.227  1.00 60.94 ? 267 THR B C   1 
ATOM   2285 O  O   . THR B 2 24  ? 36.996 -8.065  13.701  1.00 60.68 ? 267 THR B O   1 
ATOM   2286 C  CB  . THR B 2 24  ? 40.108 -9.037  14.047  1.00 61.98 ? 267 THR B CB  1 
ATOM   2287 O  OG1 . THR B 2 24  ? 40.995 -9.689  14.968  1.00 62.48 ? 267 THR B OG1 1 
ATOM   2288 C  CG2 . THR B 2 24  ? 40.040 -7.544  14.384  1.00 62.70 ? 267 THR B CG2 1 
ATOM   2289 N  N   . LEU B 2 25  ? 37.661 -9.327  11.946  1.00 59.66 ? 268 LEU B N   1 
ATOM   2290 C  CA  . LEU B 2 25  ? 36.667 -8.782  11.006  1.00 58.56 ? 268 LEU B CA  1 
ATOM   2291 C  C   . LEU B 2 25  ? 35.223 -9.113  11.384  1.00 57.70 ? 268 LEU B C   1 
ATOM   2292 O  O   . LEU B 2 25  ? 34.329 -8.289  11.170  1.00 57.34 ? 268 LEU B O   1 
ATOM   2293 C  CB  . LEU B 2 25  ? 36.941 -9.225  9.564   1.00 58.56 ? 268 LEU B CB  1 
ATOM   2294 C  CG  . LEU B 2 25  ? 37.922 -8.415  8.709   1.00 58.70 ? 268 LEU B CG  1 
ATOM   2295 C  CD1 . LEU B 2 25  ? 37.960 -8.955  7.282   1.00 57.92 ? 268 LEU B CD1 1 
ATOM   2296 C  CD2 . LEU B 2 25  ? 37.572 -6.916  8.703   1.00 58.90 ? 268 LEU B CD2 1 
ATOM   2297 N  N   . ILE B 2 26  ? 34.995 -10.312 11.928  1.00 56.18 ? 269 ILE B N   1 
ATOM   2298 C  CA  . ILE B 2 26  ? 33.666 -10.696 12.403  1.00 54.88 ? 269 ILE B CA  1 
ATOM   2299 C  C   . ILE B 2 26  ? 33.380 -9.938  13.709  1.00 53.80 ? 269 ILE B C   1 
ATOM   2300 O  O   . ILE B 2 26  ? 32.243 -9.522  13.963  1.00 53.46 ? 269 ILE B O   1 
ATOM   2301 C  CB  . ILE B 2 26  ? 33.486 -12.256 12.562  1.00 55.22 ? 269 ILE B CB  1 
ATOM   2302 C  CG1 . ILE B 2 26  ? 34.140 -13.017 11.410  1.00 54.85 ? 269 ILE B CG1 1 
ATOM   2303 C  CG2 . ILE B 2 26  ? 32.020 -12.632 12.564  1.00 54.87 ? 269 ILE B CG2 1 
ATOM   2304 C  CD1 . ILE B 2 26  ? 34.306 -14.534 11.634  1.00 55.21 ? 269 ILE B CD1 1 
ATOM   2305 N  N   . THR B 2 27  ? 34.423 -9.733  14.514  1.00 52.18 ? 270 THR B N   1 
ATOM   2306 C  CA  . THR B 2 27  ? 34.314 -8.908  15.723  1.00 51.03 ? 270 THR B CA  1 
ATOM   2307 C  C   . THR B 2 27  ? 33.858 -7.482  15.366  1.00 49.73 ? 270 THR B C   1 
ATOM   2308 O  O   . THR B 2 27  ? 32.908 -6.965  15.957  1.00 49.77 ? 270 THR B O   1 
ATOM   2309 C  CB  . THR B 2 27  ? 35.646 -8.898  16.543  1.00 51.03 ? 270 THR B CB  1 
ATOM   2310 O  OG1 . THR B 2 27  ? 35.710 -10.065 17.373  1.00 51.51 ? 270 THR B OG1 1 
ATOM   2311 C  CG2 . THR B 2 27  ? 35.751 -7.663  17.439  1.00 51.31 ? 270 THR B CG2 1 
ATOM   2312 N  N   . PHE B 2 28  ? 34.544 -6.891  14.387  1.00 48.24 ? 271 PHE B N   1 
ATOM   2313 C  CA  . PHE B 2 28  ? 34.336 -5.521  13.902  1.00 46.69 ? 271 PHE B CA  1 
ATOM   2314 C  C   . PHE B 2 28  ? 32.931 -5.280  13.354  1.00 45.51 ? 271 PHE B C   1 
ATOM   2315 O  O   . PHE B 2 28  ? 32.235 -4.370  13.793  1.00 44.89 ? 271 PHE B O   1 
ATOM   2316 C  CB  . PHE B 2 28  ? 35.398 -5.196  12.836  1.00 46.64 ? 271 PHE B CB  1 
ATOM   2317 C  CG  . PHE B 2 28  ? 35.122 -3.942  12.035  1.00 46.83 ? 271 PHE B CG  1 
ATOM   2318 C  CD1 . PHE B 2 28  ? 35.185 -2.679  12.631  1.00 47.89 ? 271 PHE B CD1 1 
ATOM   2319 C  CD2 . PHE B 2 28  ? 34.832 -4.024  10.678  1.00 46.51 ? 271 PHE B CD2 1 
ATOM   2320 C  CE1 . PHE B 2 28  ? 34.943 -1.516  11.883  1.00 47.14 ? 271 PHE B CE1 1 
ATOM   2321 C  CE2 . PHE B 2 28  ? 34.596 -2.874  9.916   1.00 46.80 ? 271 PHE B CE2 1 
ATOM   2322 C  CZ  . PHE B 2 28  ? 34.647 -1.618  10.518  1.00 46.80 ? 271 PHE B CZ  1 
ATOM   2323 N  N   . VAL B 2 29  ? 32.512 -6.113  12.409  1.00 44.28 ? 272 VAL B N   1 
ATOM   2324 C  CA  . VAL B 2 29  ? 31.182 -5.977  11.806  1.00 43.24 ? 272 VAL B CA  1 
ATOM   2325 C  C   . VAL B 2 29  ? 30.027 -6.251  12.782  1.00 42.58 ? 272 VAL B C   1 
ATOM   2326 O  O   . VAL B 2 29  ? 28.947 -5.643  12.670  1.00 42.26 ? 272 VAL B O   1 
ATOM   2327 C  CB  . VAL B 2 29  ? 31.032 -6.836  10.524  1.00 42.94 ? 272 VAL B CB  1 
ATOM   2328 C  CG1 . VAL B 2 29  ? 32.121 -6.495  9.525   1.00 42.82 ? 272 VAL B CG1 1 
ATOM   2329 C  CG2 . VAL B 2 29  ? 31.044 -8.338  10.856  1.00 44.61 ? 272 VAL B CG2 1 
ATOM   2330 N  N   . ASN B 2 30  ? 30.241 -7.158  13.735  1.00 40.97 ? 273 ASN B N   1 
ATOM   2331 C  CA  . ASN B 2 30  ? 29.196 -7.480  14.698  1.00 40.33 ? 273 ASN B CA  1 
ATOM   2332 C  C   . ASN B 2 30  ? 29.062 -6.388  15.764  1.00 39.32 ? 273 ASN B C   1 
ATOM   2333 O  O   . ASN B 2 30  ? 27.992 -6.202  16.334  1.00 38.64 ? 273 ASN B O   1 
ATOM   2334 C  CB  . ASN B 2 30  ? 29.426 -8.859  15.339  1.00 40.72 ? 273 ASN B CB  1 
ATOM   2335 C  CG  . ASN B 2 30  ? 28.884 -10.013 14.477  1.00 41.78 ? 273 ASN B CG  1 
ATOM   2336 O  OD1 . ASN B 2 30  ? 27.670 -10.265 14.437  1.00 41.43 ? 273 ASN B OD1 1 
ATOM   2337 N  ND2 . ASN B 2 30  ? 29.790 -10.727 13.799  1.00 40.17 ? 273 ASN B ND2 1 
ATOM   2338 N  N   . LYS B 2 31  ? 30.164 -5.681  16.009  1.00 38.63 ? 274 LYS B N   1 
ATOM   2339 C  CA  . LYS B 2 31  ? 30.201 -4.555  16.937  1.00 38.87 ? 274 LYS B CA  1 
ATOM   2340 C  C   . LYS B 2 31  ? 29.099 -3.586  16.524  1.00 37.94 ? 274 LYS B C   1 
ATOM   2341 O  O   . LYS B 2 31  ? 28.309 -3.129  17.354  1.00 38.32 ? 274 LYS B O   1 
ATOM   2342 C  CB  . LYS B 2 31  ? 31.577 -3.881  16.857  1.00 38.81 ? 274 LYS B CB  1 
ATOM   2343 C  CG  . LYS B 2 31  ? 31.845 -2.727  17.824  1.00 40.06 ? 274 LYS B CG  1 
ATOM   2344 C  CD  . LYS B 2 31  ? 33.250 -2.187  17.568  1.00 40.70 ? 274 LYS B CD  1 
ATOM   2345 C  CE  . LYS B 2 31  ? 33.650 -1.108  18.557  1.00 44.64 ? 274 LYS B CE  1 
ATOM   2346 N  NZ  . LYS B 2 31  ? 34.033 -1.703  19.878  1.00 46.23 ? 274 LYS B NZ  1 
ATOM   2347 N  N   . HIS B 2 32  ? 29.031 -3.330  15.221  1.00 36.95 ? 275 HIS B N   1 
ATOM   2348 C  CA  . HIS B 2 32  ? 28.079 -2.373  14.649  1.00 35.50 ? 275 HIS B CA  1 
ATOM   2349 C  C   . HIS B 2 32  ? 26.726 -3.005  14.267  1.00 35.07 ? 275 HIS B C   1 
ATOM   2350 O  O   . HIS B 2 32  ? 25.688 -2.513  14.682  1.00 34.61 ? 275 HIS B O   1 
ATOM   2351 C  CB  . HIS B 2 32  ? 28.750 -1.623  13.507  1.00 34.91 ? 275 HIS B CB  1 
ATOM   2352 C  CG  . HIS B 2 32  ? 30.055 -0.993  13.897  1.00 34.72 ? 275 HIS B CG  1 
ATOM   2353 N  ND1 . HIS B 2 32  ? 30.131 0.168   14.642  1.00 33.96 ? 275 HIS B ND1 1 
ATOM   2354 C  CD2 . HIS B 2 32  ? 31.336 -1.378  13.673  1.00 33.58 ? 275 HIS B CD2 1 
ATOM   2355 C  CE1 . HIS B 2 32  ? 31.400 0.478   14.845  1.00 34.47 ? 275 HIS B CE1 1 
ATOM   2356 N  NE2 . HIS B 2 32  ? 32.155 -0.438  14.258  1.00 34.43 ? 275 HIS B NE2 1 
ATOM   2357 N  N   . LEU B 2 33  ? 26.729 -4.123  13.545  1.00 35.02 ? 276 LEU B N   1 
ATOM   2358 C  CA  . LEU B 2 33  ? 25.475 -4.776  13.100  1.00 35.17 ? 276 LEU B CA  1 
ATOM   2359 C  C   . LEU B 2 33  ? 24.536 -5.364  14.179  1.00 35.90 ? 276 LEU B C   1 
ATOM   2360 O  O   . LEU B 2 33  ? 23.311 -5.456  13.969  1.00 35.29 ? 276 LEU B O   1 
ATOM   2361 C  CB  . LEU B 2 33  ? 25.760 -5.806  11.987  1.00 35.11 ? 276 LEU B CB  1 
ATOM   2362 C  CG  . LEU B 2 33  ? 26.192 -5.211  10.626  1.00 35.61 ? 276 LEU B CG  1 
ATOM   2363 C  CD1 . LEU B 2 33  ? 26.916 -6.226  9.723   1.00 34.82 ? 276 LEU B CD1 1 
ATOM   2364 C  CD2 . LEU B 2 33  ? 25.028 -4.537  9.877   1.00 32.24 ? 276 LEU B CD2 1 
ATOM   2365 N  N   . ASN B 2 34  ? 25.100 -5.786  15.319  1.00 37.14 ? 277 ASN B N   1 
ATOM   2366 C  CA  . ASN B 2 34  ? 24.283 -6.246  16.457  1.00 37.83 ? 277 ASN B CA  1 
ATOM   2367 C  C   . ASN B 2 34  ? 23.321 -5.179  16.989  1.00 37.45 ? 277 ASN B C   1 
ATOM   2368 O  O   . ASN B 2 34  ? 22.258 -5.509  17.520  1.00 37.69 ? 277 ASN B O   1 
ATOM   2369 C  CB  . ASN B 2 34  ? 25.158 -6.746  17.621  1.00 37.93 ? 277 ASN B CB  1 
ATOM   2370 C  CG  . ASN B 2 34  ? 25.904 -8.048  17.303  1.00 40.43 ? 277 ASN B CG  1 
ATOM   2371 O  OD1 . ASN B 2 34  ? 25.583 -8.770  16.345  1.00 40.55 ? 277 ASN B OD1 1 
ATOM   2372 N  ND2 . ASN B 2 34  ? 26.925 -8.340  18.112  1.00 39.49 ? 277 ASN B ND2 1 
ATOM   2373 N  N   . LYS B 2 35  ? 23.702 -3.906  16.844  1.00 37.26 ? 278 LYS B N   1 
ATOM   2374 C  CA  . LYS B 2 35  ? 22.835 -2.764  17.213  1.00 36.74 ? 278 LYS B CA  1 
ATOM   2375 C  C   . LYS B 2 35  ? 21.505 -2.790  16.468  1.00 36.15 ? 278 LYS B C   1 
ATOM   2376 O  O   . LYS B 2 35  ? 20.492 -2.266  16.954  1.00 36.54 ? 278 LYS B O   1 
ATOM   2377 C  CB  . LYS B 2 35  ? 23.543 -1.440  16.957  1.00 36.70 ? 278 LYS B CB  1 
ATOM   2378 C  CG  . LYS B 2 35  ? 24.747 -1.181  17.843  1.00 38.91 ? 278 LYS B CG  1 
ATOM   2379 C  CD  . LYS B 2 35  ? 25.561 0.004   17.339  1.00 40.44 ? 278 LYS B CD  1 
ATOM   2380 C  CE  . LYS B 2 35  ? 26.800 0.216   18.204  1.00 42.99 ? 278 LYS B CE  1 
ATOM   2381 N  NZ  . LYS B 2 35  ? 27.566 1.467   17.872  1.00 45.41 ? 278 LYS B NZ  1 
ATOM   2382 N  N   . LEU B 2 36  ? 21.506 -3.406  15.286  1.00 35.41 ? 279 LEU B N   1 
ATOM   2383 C  CA  . LEU B 2 36  ? 20.275 -3.611  14.514  1.00 34.90 ? 279 LEU B CA  1 
ATOM   2384 C  C   . LEU B 2 36  ? 19.678 -4.997  14.756  1.00 35.97 ? 279 LEU B C   1 
ATOM   2385 O  O   . LEU B 2 36  ? 18.664 -5.368  14.148  1.00 35.90 ? 279 LEU B O   1 
ATOM   2386 C  CB  . LEU B 2 36  ? 20.514 -3.336  13.009  1.00 34.26 ? 279 LEU B CB  1 
ATOM   2387 C  CG  . LEU B 2 36  ? 21.038 -1.943  12.606  1.00 32.44 ? 279 LEU B CG  1 
ATOM   2388 C  CD1 . LEU B 2 36  ? 21.183 -1.818  11.082  1.00 27.89 ? 279 LEU B CD1 1 
ATOM   2389 C  CD2 . LEU B 2 36  ? 20.123 -0.839  13.147  1.00 29.82 ? 279 LEU B CD2 1 
ATOM   2390 N  N   . ASN B 2 37  ? 20.285 -5.727  15.699  1.00 37.38 ? 280 ASN B N   1 
ATOM   2391 C  CA  . ASN B 2 37  ? 19.929 -7.119  16.000  1.00 38.91 ? 280 ASN B CA  1 
ATOM   2392 C  C   . ASN B 2 37  ? 20.159 -8.024  14.780  1.00 38.81 ? 280 ASN B C   1 
ATOM   2393 O  O   . ASN B 2 37  ? 19.275 -8.792  14.368  1.00 39.44 ? 280 ASN B O   1 
ATOM   2394 C  CB  . ASN B 2 37  ? 18.498 -7.230  16.539  1.00 39.57 ? 280 ASN B CB  1 
ATOM   2395 C  CG  . ASN B 2 37  ? 18.243 -6.304  17.745  1.00 42.53 ? 280 ASN B CG  1 
ATOM   2396 O  OD1 . ASN B 2 37  ? 17.148 -5.741  17.879  1.00 46.45 ? 280 ASN B OD1 1 
ATOM   2397 N  ND2 . ASN B 2 37  ? 19.250 -6.136  18.614  1.00 43.75 ? 280 ASN B ND2 1 
ATOM   2398 N  N   . LEU B 2 38  ? 21.350 -7.883  14.198  1.00 38.73 ? 281 LEU B N   1 
ATOM   2399 C  CA  . LEU B 2 38  ? 21.786 -8.691  13.060  1.00 38.73 ? 281 LEU B CA  1 
ATOM   2400 C  C   . LEU B 2 38  ? 23.139 -9.248  13.401  1.00 38.99 ? 281 LEU B C   1 
ATOM   2401 O  O   . LEU B 2 38  ? 24.018 -8.540  13.884  1.00 38.78 ? 281 LEU B O   1 
ATOM   2402 C  CB  . LEU B 2 38  ? 21.919 -7.844  11.793  1.00 38.81 ? 281 LEU B CB  1 
ATOM   2403 C  CG  . LEU B 2 38  ? 20.701 -7.209  11.130  1.00 39.10 ? 281 LEU B CG  1 
ATOM   2404 C  CD1 . LEU B 2 38  ? 21.166 -6.321  9.954   1.00 37.89 ? 281 LEU B CD1 1 
ATOM   2405 C  CD2 . LEU B 2 38  ? 19.688 -8.251  10.665  1.00 37.91 ? 281 LEU B CD2 1 
ATOM   2406 N  N   . GLU B 2 39  ? 23.316 -10.532 13.152  1.00 39.93 ? 282 GLU B N   1 
ATOM   2407 C  CA  . GLU B 2 39  ? 24.567 -11.166 13.472  1.00 40.89 ? 282 GLU B CA  1 
ATOM   2408 C  C   . GLU B 2 39  ? 25.229 -11.622 12.191  1.00 40.68 ? 282 GLU B C   1 
ATOM   2409 O  O   . GLU B 2 39  ? 24.561 -12.096 11.272  1.00 40.35 ? 282 GLU B O   1 
ATOM   2410 C  CB  . GLU B 2 39  ? 24.327 -12.354 14.398  1.00 41.47 ? 282 GLU B CB  1 
ATOM   2411 C  CG  . GLU B 2 39  ? 25.259 -12.363 15.590  1.00 44.30 ? 282 GLU B CG  1 
ATOM   2412 C  CD  . GLU B 2 39  ? 25.814 -13.741 15.883  1.00 48.00 ? 282 GLU B CD  1 
ATOM   2413 O  OE1 . GLU B 2 39  ? 27.040 -13.832 16.134  1.00 49.08 ? 282 GLU B OE1 1 
ATOM   2414 O  OE2 . GLU B 2 39  ? 25.030 -14.724 15.854  1.00 48.51 ? 282 GLU B OE2 1 
ATOM   2415 N  N   . VAL B 2 40  ? 26.545 -11.462 12.130  1.00 40.99 ? 283 VAL B N   1 
ATOM   2416 C  CA  . VAL B 2 40  ? 27.328 -12.045 11.042  1.00 40.92 ? 283 VAL B CA  1 
ATOM   2417 C  C   . VAL B 2 40  ? 28.144 -13.227 11.585  1.00 41.32 ? 283 VAL B C   1 
ATOM   2418 O  O   . VAL B 2 40  ? 28.908 -13.083 12.549  1.00 41.03 ? 283 VAL B O   1 
ATOM   2419 C  CB  . VAL B 2 40  ? 28.233 -10.999 10.341  1.00 40.96 ? 283 VAL B CB  1 
ATOM   2420 C  CG1 . VAL B 2 40  ? 29.144 -11.653 9.309   1.00 40.11 ? 283 VAL B CG1 1 
ATOM   2421 C  CG2 . VAL B 2 40  ? 27.376 -9.928  9.660   1.00 40.93 ? 283 VAL B CG2 1 
ATOM   2422 N  N   . THR B 2 41  ? 27.959 -14.389 10.971  1.00 41.68 ? 284 THR B N   1 
ATOM   2423 C  CA  . THR B 2 41  ? 28.729 -15.597 11.344  1.00 41.96 ? 284 THR B CA  1 
ATOM   2424 C  C   . THR B 2 41  ? 29.571 -16.101 10.180  1.00 42.11 ? 284 THR B C   1 
ATOM   2425 O  O   . THR B 2 41  ? 30.571 -16.801 10.382  1.00 42.25 ? 284 THR B O   1 
ATOM   2426 C  CB  . THR B 2 41  ? 27.821 -16.737 11.843  1.00 42.08 ? 284 THR B CB  1 
ATOM   2427 O  OG1 . THR B 2 41  ? 26.884 -17.090 10.818  1.00 41.92 ? 284 THR B OG1 1 
ATOM   2428 C  CG2 . THR B 2 41  ? 27.071 -16.327 13.116  1.00 41.78 ? 284 THR B CG2 1 
ATOM   2429 N  N   . GLU B 2 42  ? 29.172 -15.728 8.963   1.00 42.01 ? 285 GLU B N   1 
ATOM   2430 C  CA  . GLU B 2 42  ? 29.832 -16.207 7.750   1.00 41.73 ? 285 GLU B CA  1 
ATOM   2431 C  C   . GLU B 2 42  ? 30.231 -15.080 6.818   1.00 41.27 ? 285 GLU B C   1 
ATOM   2432 O  O   . GLU B 2 42  ? 29.420 -14.595 6.019   1.00 40.66 ? 285 GLU B O   1 
ATOM   2433 C  CB  . GLU B 2 42  ? 28.950 -17.214 7.010   1.00 41.92 ? 285 GLU B CB  1 
ATOM   2434 C  CG  . GLU B 2 42  ? 29.603 -17.746 5.743   1.00 43.38 ? 285 GLU B CG  1 
ATOM   2435 C  CD  . GLU B 2 42  ? 28.907 -18.973 5.173   1.00 46.08 ? 285 GLU B CD  1 
ATOM   2436 O  OE1 . GLU B 2 42  ? 27.692 -18.897 4.884   1.00 45.30 ? 285 GLU B OE1 1 
ATOM   2437 O  OE2 . GLU B 2 42  ? 29.596 -20.012 5.013   1.00 46.41 ? 285 GLU B OE2 1 
ATOM   2438 N  N   . LEU B 2 43  ? 31.496 -14.684 6.910   1.00 41.14 ? 286 LEU B N   1 
ATOM   2439 C  CA  . LEU B 2 43  ? 32.025 -13.626 6.067   1.00 40.82 ? 286 LEU B CA  1 
ATOM   2440 C  C   . LEU B 2 43  ? 31.913 -13.945 4.578   1.00 40.52 ? 286 LEU B C   1 
ATOM   2441 O  O   . LEU B 2 43  ? 31.750 -13.036 3.775   1.00 40.64 ? 286 LEU B O   1 
ATOM   2442 C  CB  . LEU B 2 43  ? 33.477 -13.280 6.441   1.00 41.03 ? 286 LEU B CB  1 
ATOM   2443 C  CG  . LEU B 2 43  ? 33.740 -12.612 7.802   1.00 41.76 ? 286 LEU B CG  1 
ATOM   2444 C  CD1 . LEU B 2 43  ? 35.229 -12.290 7.978   1.00 42.71 ? 286 LEU B CD1 1 
ATOM   2445 C  CD2 . LEU B 2 43  ? 32.879 -11.345 8.052   1.00 40.86 ? 286 LEU B CD2 1 
ATOM   2446 N  N   . GLU B 2 44  ? 31.978 -15.230 4.209   1.00 40.02 ? 287 GLU B N   1 
ATOM   2447 C  CA  . GLU B 2 44  ? 31.992 -15.628 2.786   1.00 39.30 ? 287 GLU B CA  1 
ATOM   2448 C  C   . GLU B 2 44  ? 30.714 -15.310 2.002   1.00 38.02 ? 287 GLU B C   1 
ATOM   2449 O  O   . GLU B 2 44  ? 30.760 -15.237 0.774   1.00 37.69 ? 287 GLU B O   1 
ATOM   2450 C  CB  . GLU B 2 44  ? 32.331 -17.119 2.598   1.00 40.12 ? 287 GLU B CB  1 
ATOM   2451 C  CG  . GLU B 2 44  ? 33.604 -17.556 3.281   1.00 43.39 ? 287 GLU B CG  1 
ATOM   2452 C  CD  . GLU B 2 44  ? 33.351 -18.093 4.675   1.00 47.83 ? 287 GLU B CD  1 
ATOM   2453 O  OE1 . GLU B 2 44  ? 32.899 -19.258 4.769   1.00 51.55 ? 287 GLU B OE1 1 
ATOM   2454 O  OE2 . GLU B 2 44  ? 33.601 -17.362 5.675   1.00 49.43 ? 287 GLU B OE2 1 
ATOM   2455 N  N   . THR B 2 45  ? 29.581 -15.143 2.687   1.00 35.86 ? 288 THR B N   1 
ATOM   2456 C  CA  . THR B 2 45  ? 28.320 -14.971 1.953   1.00 34.41 ? 288 THR B CA  1 
ATOM   2457 C  C   . THR B 2 45  ? 27.425 -13.836 2.436   1.00 33.34 ? 288 THR B C   1 
ATOM   2458 O  O   . THR B 2 45  ? 26.577 -13.367 1.684   1.00 32.80 ? 288 THR B O   1 
ATOM   2459 C  CB  . THR B 2 45  ? 27.449 -16.252 1.925   1.00 33.85 ? 288 THR B CB  1 
ATOM   2460 O  OG1 . THR B 2 45  ? 27.013 -16.576 3.251   1.00 33.91 ? 288 THR B OG1 1 
ATOM   2461 C  CG2 . THR B 2 45  ? 28.227 -17.426 1.337   1.00 34.95 ? 288 THR B CG2 1 
ATOM   2462 N  N   . GLN B 2 46  ? 27.603 -13.411 3.682   1.00 32.42 ? 289 GLN B N   1 
ATOM   2463 C  CA  . GLN B 2 46  ? 26.587 -12.574 4.326   1.00 31.57 ? 289 GLN B CA  1 
ATOM   2464 C  C   . GLN B 2 46  ? 26.624 -11.096 3.895   1.00 30.78 ? 289 GLN B C   1 
ATOM   2465 O  O   . GLN B 2 46  ? 25.747 -10.313 4.279   1.00 29.86 ? 289 GLN B O   1 
ATOM   2466 C  CB  . GLN B 2 46  ? 26.632 -12.741 5.840   1.00 31.55 ? 289 GLN B CB  1 
ATOM   2467 C  CG  . GLN B 2 46  ? 25.943 -14.027 6.313   1.00 34.10 ? 289 GLN B CG  1 
ATOM   2468 C  CD  . GLN B 2 46  ? 25.803 -14.088 7.815   1.00 35.46 ? 289 GLN B CD  1 
ATOM   2469 O  OE1 . GLN B 2 46  ? 26.780 -14.285 8.529   1.00 34.29 ? 289 GLN B OE1 1 
ATOM   2470 N  NE2 . GLN B 2 46  ? 24.571 -13.910 8.309   1.00 37.63 ? 289 GLN B NE2 1 
ATOM   2471 N  N   . PHE B 2 47  ? 27.627 -10.735 3.089   1.00 30.06 ? 290 PHE B N   1 
ATOM   2472 C  CA  . PHE B 2 47  ? 27.724 -9.385  2.526   1.00 29.18 ? 290 PHE B CA  1 
ATOM   2473 C  C   . PHE B 2 47  ? 27.472 -9.374  1.018   1.00 28.51 ? 290 PHE B C   1 
ATOM   2474 O  O   . PHE B 2 47  ? 27.499 -8.313  0.382   1.00 27.85 ? 290 PHE B O   1 
ATOM   2475 C  CB  . PHE B 2 47  ? 29.085 -8.757  2.874   1.00 29.48 ? 290 PHE B CB  1 
ATOM   2476 C  CG  . PHE B 2 47  ? 29.260 -8.472  4.344   1.00 30.52 ? 290 PHE B CG  1 
ATOM   2477 C  CD1 . PHE B 2 47  ? 28.765 -7.278  4.905   1.00 28.59 ? 290 PHE B CD1 1 
ATOM   2478 C  CD2 . PHE B 2 47  ? 29.908 -9.388  5.180   1.00 31.53 ? 290 PHE B CD2 1 
ATOM   2479 C  CE1 . PHE B 2 47  ? 28.914 -7.005  6.264   1.00 32.08 ? 290 PHE B CE1 1 
ATOM   2480 C  CE2 . PHE B 2 47  ? 30.074 -9.126  6.556   1.00 33.40 ? 290 PHE B CE2 1 
ATOM   2481 C  CZ  . PHE B 2 47  ? 29.575 -7.929  7.105   1.00 32.00 ? 290 PHE B CZ  1 
ATOM   2482 N  N   . ALA B 2 48  ? 27.219 -10.556 0.442   1.00 28.07 ? 291 ALA B N   1 
ATOM   2483 C  CA  . ALA B 2 48  ? 27.035 -10.691 -1.011  1.00 27.34 ? 291 ALA B CA  1 
ATOM   2484 C  C   . ALA B 2 48  ? 25.853 -9.911  -1.570  1.00 27.19 ? 291 ALA B C   1 
ATOM   2485 O  O   . ALA B 2 48  ? 25.924 -9.417  -2.696  1.00 27.47 ? 291 ALA B O   1 
ATOM   2486 C  CB  . ALA B 2 48  ? 26.926 -12.162 -1.424  1.00 28.11 ? 291 ALA B CB  1 
ATOM   2487 N  N   . ASP B 2 49  ? 24.769 -9.786  -0.801  1.00 25.95 ? 292 ASP B N   1 
ATOM   2488 C  CA  . ASP B 2 49  ? 23.570 -9.164  -1.359  1.00 25.17 ? 292 ASP B CA  1 
ATOM   2489 C  C   . ASP B 2 49  ? 23.538 -7.617  -1.213  1.00 24.28 ? 292 ASP B C   1 
ATOM   2490 O  O   . ASP B 2 49  ? 22.596 -6.981  -1.652  1.00 24.86 ? 292 ASP B O   1 
ATOM   2491 C  CB  . ASP B 2 49  ? 22.299 -9.829  -0.833  1.00 24.27 ? 292 ASP B CB  1 
ATOM   2492 C  CG  . ASP B 2 49  ? 21.951 -9.420  0.606   1.00 25.90 ? 292 ASP B CG  1 
ATOM   2493 O  OD1 . ASP B 2 49  ? 22.730 -8.686  1.299   1.00 27.52 ? 292 ASP B OD1 1 
ATOM   2494 O  OD2 . ASP B 2 49  ? 20.896 -9.892  1.065   1.00 27.76 ? 292 ASP B OD2 1 
ATOM   2495 N  N   . GLY B 2 50  ? 24.582 -7.039  -0.619  1.00 23.79 ? 293 GLY B N   1 
ATOM   2496 C  CA  . GLY B 2 50  ? 24.735 -5.581  -0.508  1.00 23.10 ? 293 GLY B CA  1 
ATOM   2497 C  C   . GLY B 2 50  ? 24.079 -4.925  0.709   1.00 23.64 ? 293 GLY B C   1 
ATOM   2498 O  O   . GLY B 2 50  ? 24.506 -3.823  1.108   1.00 23.18 ? 293 GLY B O   1 
ATOM   2499 N  N   . VAL B 2 51  ? 23.107 -5.612  1.317   1.00 23.58 ? 294 VAL B N   1 
ATOM   2500 C  CA  . VAL B 2 51  ? 22.271 -5.033  2.425   1.00 23.30 ? 294 VAL B CA  1 
ATOM   2501 C  C   . VAL B 2 51  ? 23.116 -4.657  3.631   1.00 23.73 ? 294 VAL B C   1 
ATOM   2502 O  O   . VAL B 2 51  ? 23.094 -3.523  4.054   1.00 22.74 ? 294 VAL B O   1 
ATOM   2503 C  CB  . VAL B 2 51  ? 21.081 -5.943  2.862   1.00 23.85 ? 294 VAL B CB  1 
ATOM   2504 C  CG1 . VAL B 2 51  ? 20.259 -5.299  4.015   1.00 23.37 ? 294 VAL B CG1 1 
ATOM   2505 C  CG2 . VAL B 2 51  ? 20.138 -6.228  1.717   1.00 22.59 ? 294 VAL B CG2 1 
ATOM   2506 N  N   . TYR B 2 52  ? 23.865 -5.611  4.190   1.00 23.48 ? 295 TYR B N   1 
ATOM   2507 C  CA  . TYR B 2 52  ? 24.685 -5.336  5.358   1.00 23.95 ? 295 TYR B CA  1 
ATOM   2508 C  C   . TYR B 2 52  ? 25.765 -4.308  5.076   1.00 22.98 ? 295 TYR B C   1 
ATOM   2509 O  O   . TYR B 2 52  ? 26.145 -3.584  5.984   1.00 23.64 ? 295 TYR B O   1 
ATOM   2510 C  CB  . TYR B 2 52  ? 25.311 -6.644  5.927   1.00 24.34 ? 295 TYR B CB  1 
ATOM   2511 C  CG  . TYR B 2 52  ? 24.325 -7.609  6.592   1.00 26.16 ? 295 TYR B CG  1 
ATOM   2512 C  CD1 . TYR B 2 52  ? 22.926 -7.466  6.443   1.00 25.44 ? 295 TYR B CD1 1 
ATOM   2513 C  CD2 . TYR B 2 52  ? 24.794 -8.691  7.353   1.00 26.30 ? 295 TYR B CD2 1 
ATOM   2514 C  CE1 . TYR B 2 52  ? 22.021 -8.368  7.040   1.00 27.39 ? 295 TYR B CE1 1 
ATOM   2515 C  CE2 . TYR B 2 52  ? 23.900 -9.600  7.952   1.00 29.03 ? 295 TYR B CE2 1 
ATOM   2516 C  CZ  . TYR B 2 52  ? 22.526 -9.439  7.795   1.00 27.90 ? 295 TYR B CZ  1 
ATOM   2517 O  OH  . TYR B 2 52  ? 21.650 -10.337 8.384   1.00 28.01 ? 295 TYR B OH  1 
ATOM   2518 N  N   . LEU B 2 53  ? 26.293 -4.245  3.843   1.00 22.14 ? 296 LEU B N   1 
ATOM   2519 C  CA  . LEU B 2 53  ? 27.305 -3.222  3.538   1.00 22.60 ? 296 LEU B CA  1 
ATOM   2520 C  C   . LEU B 2 53  ? 26.671 -1.816  3.665   1.00 22.12 ? 296 LEU B C   1 
ATOM   2521 O  O   . LEU B 2 53  ? 27.289 -0.880  4.205   1.00 22.97 ? 296 LEU B O   1 
ATOM   2522 C  CB  . LEU B 2 53  ? 27.889 -3.389  2.116   1.00 23.30 ? 296 LEU B CB  1 
ATOM   2523 C  CG  . LEU B 2 53  ? 28.951 -4.508  1.921   1.00 24.45 ? 296 LEU B CG  1 
ATOM   2524 C  CD1 . LEU B 2 53  ? 29.338 -4.537  0.471   1.00 24.33 ? 296 LEU B CD1 1 
ATOM   2525 C  CD2 . LEU B 2 53  ? 30.183 -4.260  2.773   1.00 25.80 ? 296 LEU B CD2 1 
ATOM   2526 N  N   . VAL B 2 54  ? 25.447 -1.696  3.152   1.00 22.23 ? 297 VAL B N   1 
ATOM   2527 C  CA  . VAL B 2 54  ? 24.707 -0.411  3.189   1.00 21.65 ? 297 VAL B CA  1 
ATOM   2528 C  C   . VAL B 2 54  ? 24.498 -0.019  4.647   1.00 21.69 ? 297 VAL B C   1 
ATOM   2529 O  O   . VAL B 2 54  ? 24.909 1.078   5.066   1.00 21.37 ? 297 VAL B O   1 
ATOM   2530 C  CB  . VAL B 2 54  ? 23.356 -0.486  2.436   1.00 21.35 ? 297 VAL B CB  1 
ATOM   2531 C  CG1 . VAL B 2 54  ? 22.509 0.780   2.642   1.00 20.87 ? 297 VAL B CG1 1 
ATOM   2532 C  CG2 . VAL B 2 54  ? 23.583 -0.667  0.916   1.00 19.52 ? 297 VAL B CG2 1 
ATOM   2533 N  N   . LEU B 2 55  ? 23.901 -0.924  5.409   1.00 21.10 ? 298 LEU B N   1 
ATOM   2534 C  CA  . LEU B 2 55  ? 23.630 -0.707  6.854   1.00 21.84 ? 298 LEU B CA  1 
ATOM   2535 C  C   . LEU B 2 55  ? 24.894 -0.433  7.633   1.00 23.11 ? 298 LEU B C   1 
ATOM   2536 O  O   . LEU B 2 55  ? 24.907 0.407   8.520   1.00 22.73 ? 298 LEU B O   1 
ATOM   2537 C  CB  . LEU B 2 55  ? 22.899 -1.903  7.444   1.00 20.82 ? 298 LEU B CB  1 
ATOM   2538 C  CG  . LEU B 2 55  ? 21.554 -2.306  6.822   1.00 20.33 ? 298 LEU B CG  1 
ATOM   2539 C  CD1 . LEU B 2 55  ? 20.979 -3.540  7.456   1.00 22.68 ? 298 LEU B CD1 1 
ATOM   2540 C  CD2 . LEU B 2 55  ? 20.497 -1.163  6.793   1.00 22.60 ? 298 LEU B CD2 1 
ATOM   2541 N  N   . LEU B 2 56  ? 25.968 -1.152  7.311   1.00 23.06 ? 299 LEU B N   1 
ATOM   2542 C  CA  . LEU B 2 56  ? 27.239 -0.908  7.971   1.00 23.21 ? 299 LEU B CA  1 
ATOM   2543 C  C   . LEU B 2 56  ? 27.768 0.487   7.744   1.00 22.64 ? 299 LEU B C   1 
ATOM   2544 O  O   . LEU B 2 56  ? 28.250 1.124   8.678   1.00 22.59 ? 299 LEU B O   1 
ATOM   2545 C  CB  . LEU B 2 56  ? 28.280 -1.903  7.470   1.00 24.14 ? 299 LEU B CB  1 
ATOM   2546 C  CG  . LEU B 2 56  ? 28.955 -2.792  8.503   1.00 27.67 ? 299 LEU B CG  1 
ATOM   2547 C  CD1 . LEU B 2 56  ? 30.026 -3.627  7.772   1.00 29.69 ? 299 LEU B CD1 1 
ATOM   2548 C  CD2 . LEU B 2 56  ? 29.566 -2.067  9.734   1.00 28.92 ? 299 LEU B CD2 1 
HETATM 2549 N  N   . MSE B 2 57  ? 27.702 0.959   6.496   1.00 21.69 ? 300 MSE B N   1 
HETATM 2550 C  CA  . MSE B 2 57  ? 28.212 2.277   6.156   1.00 22.86 ? 300 MSE B CA  1 
HETATM 2551 C  C   . MSE B 2 57  ? 27.476 3.388   6.959   1.00 22.11 ? 300 MSE B C   1 
HETATM 2552 O  O   . MSE B 2 57  ? 28.117 4.335   7.440   1.00 21.63 ? 300 MSE B O   1 
HETATM 2553 C  CB  . MSE B 2 57  ? 28.144 2.497   4.649   1.00 24.04 ? 300 MSE B CB  1 
HETATM 2554 C  CG  . MSE B 2 57  ? 29.293 1.746   3.884   1.00 24.52 ? 300 MSE B CG  1 
HETATM 2555 SE SE  . MSE B 2 57  ? 31.010 2.329   4.589   1.00 41.06 ? 300 MSE B SE  1 
HETATM 2556 C  CE  . MSE B 2 57  ? 30.802 4.289   4.594   1.00 34.14 ? 300 MSE B CE  1 
ATOM   2557 N  N   . GLY B 2 58  ? 26.175 3.213   7.144   1.00 21.67 ? 301 GLY B N   1 
ATOM   2558 C  CA  . GLY B 2 58  ? 25.394 4.181   7.945   1.00 22.88 ? 301 GLY B CA  1 
ATOM   2559 C  C   . GLY B 2 58  ? 25.821 4.096   9.401   1.00 23.60 ? 301 GLY B C   1 
ATOM   2560 O  O   . GLY B 2 58  ? 25.878 5.097   10.114  1.00 23.43 ? 301 GLY B O   1 
ATOM   2561 N  N   . LEU B 2 59  ? 26.119 2.886   9.865   1.00 23.54 ? 302 LEU B N   1 
ATOM   2562 C  CA  . LEU B 2 59  ? 26.574 2.737   11.259  1.00 24.05 ? 302 LEU B CA  1 
ATOM   2563 C  C   . LEU B 2 59  ? 27.954 3.336   11.504  1.00 24.51 ? 302 LEU B C   1 
ATOM   2564 O  O   . LEU B 2 59  ? 28.195 3.949   12.554  1.00 26.27 ? 302 LEU B O   1 
ATOM   2565 C  CB  . LEU B 2 59  ? 26.519 1.284   11.684  1.00 23.46 ? 302 LEU B CB  1 
ATOM   2566 C  CG  . LEU B 2 59  ? 25.115 0.716   11.821  1.00 24.24 ? 302 LEU B CG  1 
ATOM   2567 C  CD1 . LEU B 2 59  ? 25.177 -0.769  11.588  1.00 24.88 ? 302 LEU B CD1 1 
ATOM   2568 C  CD2 . LEU B 2 59  ? 24.506 1.032   13.169  1.00 24.87 ? 302 LEU B CD2 1 
ATOM   2569 N  N   . LEU B 2 60  ? 28.847 3.171   10.540  1.00 24.42 ? 303 LEU B N   1 
ATOM   2570 C  CA  . LEU B 2 60  ? 30.205 3.687   10.638  1.00 25.61 ? 303 LEU B CA  1 
ATOM   2571 C  C   . LEU B 2 60  ? 30.293 5.189   10.473  1.00 26.21 ? 303 LEU B C   1 
ATOM   2572 O  O   . LEU B 2 60  ? 31.133 5.830   11.102  1.00 26.37 ? 303 LEU B O   1 
ATOM   2573 C  CB  . LEU B 2 60  ? 31.095 2.998   9.605   1.00 25.68 ? 303 LEU B CB  1 
ATOM   2574 C  CG  . LEU B 2 60  ? 31.732 1.681   10.079  1.00 27.50 ? 303 LEU B CG  1 
ATOM   2575 C  CD1 . LEU B 2 60  ? 31.055 1.027   11.313  1.00 29.52 ? 303 LEU B CD1 1 
ATOM   2576 C  CD2 . LEU B 2 60  ? 31.864 0.720   8.910   1.00 27.41 ? 303 LEU B CD2 1 
ATOM   2577 N  N   . GLU B 2 61  ? 29.431 5.740   9.609   1.00 25.94 ? 304 GLU B N   1 
ATOM   2578 C  CA  . GLU B 2 61  ? 29.497 7.156   9.229   1.00 25.82 ? 304 GLU B CA  1 
ATOM   2579 C  C   . GLU B 2 61  ? 28.288 7.988   9.736   1.00 24.75 ? 304 GLU B C   1 
ATOM   2580 O  O   . GLU B 2 61  ? 28.128 9.142   9.353   1.00 26.69 ? 304 GLU B O   1 
ATOM   2581 C  CB  . GLU B 2 61  ? 29.680 7.302   7.706   1.00 26.00 ? 304 GLU B CB  1 
ATOM   2582 C  CG  . GLU B 2 61  ? 31.104 7.048   7.180   1.00 28.03 ? 304 GLU B CG  1 
ATOM   2583 C  CD  . GLU B 2 61  ? 32.022 8.284   7.233   1.00 31.64 ? 304 GLU B CD  1 
ATOM   2584 O  OE1 . GLU B 2 61  ? 31.560 9.405   7.530   1.00 34.56 ? 304 GLU B OE1 1 
ATOM   2585 O  OE2 . GLU B 2 61  ? 33.226 8.149   6.940   1.00 31.97 ? 304 GLU B OE2 1 
ATOM   2586 N  N   . GLY B 2 62  ? 27.469 7.400   10.596  1.00 23.45 ? 305 GLY B N   1 
ATOM   2587 C  CA  . GLY B 2 62  ? 26.453 8.120   11.398  1.00 22.19 ? 305 GLY B CA  1 
ATOM   2588 C  C   . GLY B 2 62  ? 25.255 8.673   10.641  1.00 21.65 ? 305 GLY B C   1 
ATOM   2589 O  O   . GLY B 2 62  ? 24.780 9.796   10.914  1.00 20.06 ? 305 GLY B O   1 
ATOM   2590 N  N   . TYR B 2 63  ? 24.738 7.898   9.703   1.00 19.85 ? 306 TYR B N   1 
ATOM   2591 C  CA  . TYR B 2 63  ? 23.480 8.269   9.052   1.00 19.76 ? 306 TYR B CA  1 
ATOM   2592 C  C   . TYR B 2 63  ? 22.561 7.087   8.915   1.00 18.89 ? 306 TYR B C   1 
ATOM   2593 O  O   . TYR B 2 63  ? 23.004 5.924   8.993   1.00 18.57 ? 306 TYR B O   1 
ATOM   2594 C  CB  . TYR B 2 63  ? 23.711 8.920   7.672   1.00 20.19 ? 306 TYR B CB  1 
ATOM   2595 C  CG  . TYR B 2 63  ? 24.648 8.147   6.761   1.00 19.91 ? 306 TYR B CG  1 
ATOM   2596 C  CD1 . TYR B 2 63  ? 24.204 7.021   6.062   1.00 21.11 ? 306 TYR B CD1 1 
ATOM   2597 C  CD2 . TYR B 2 63  ? 25.982 8.558   6.602   1.00 22.25 ? 306 TYR B CD2 1 
ATOM   2598 C  CE1 . TYR B 2 63  ? 25.091 6.299   5.237   1.00 19.14 ? 306 TYR B CE1 1 
ATOM   2599 C  CE2 . TYR B 2 63  ? 26.865 7.859   5.784   1.00 20.74 ? 306 TYR B CE2 1 
ATOM   2600 C  CZ  . TYR B 2 63  ? 26.400 6.725   5.114   1.00 21.74 ? 306 TYR B CZ  1 
ATOM   2601 O  OH  . TYR B 2 63  ? 27.242 6.034   4.286   1.00 22.72 ? 306 TYR B OH  1 
ATOM   2602 N  N   . PHE B 2 64  ? 21.279 7.371   8.751   1.00 18.01 ? 307 PHE B N   1 
ATOM   2603 C  CA  . PHE B 2 64  ? 20.301 6.419   8.296   1.00 16.52 ? 307 PHE B CA  1 
ATOM   2604 C  C   . PHE B 2 64  ? 20.239 6.433   6.766   1.00 18.02 ? 307 PHE B C   1 
ATOM   2605 O  O   . PHE B 2 64  ? 20.415 7.473   6.150   1.00 18.87 ? 307 PHE B O   1 
ATOM   2606 C  CB  . PHE B 2 64  ? 18.930 6.781   8.869   1.00 17.89 ? 307 PHE B CB  1 
ATOM   2607 C  CG  . PHE B 2 64  ? 17.789 5.913   8.388   1.00 15.83 ? 307 PHE B CG  1 
ATOM   2608 C  CD1 . PHE B 2 64  ? 17.739 4.549   8.646   1.00 17.03 ? 307 PHE B CD1 1 
ATOM   2609 C  CD2 . PHE B 2 64  ? 16.752 6.457   7.674   1.00 12.80 ? 307 PHE B CD2 1 
ATOM   2610 C  CE1 . PHE B 2 64  ? 16.644 3.791   8.215   1.00 15.23 ? 307 PHE B CE1 1 
ATOM   2611 C  CE2 . PHE B 2 64  ? 15.660 5.721   7.240   1.00 17.46 ? 307 PHE B CE2 1 
ATOM   2612 C  CZ  . PHE B 2 64  ? 15.629 4.336   7.502   1.00 19.85 ? 307 PHE B CZ  1 
ATOM   2613 N  N   . VAL B 2 65  ? 19.975 5.273   6.159   1.00 18.14 ? 308 VAL B N   1 
ATOM   2614 C  CA  . VAL B 2 65  ? 19.774 5.180   4.702   1.00 17.42 ? 308 VAL B CA  1 
ATOM   2615 C  C   . VAL B 2 65  ? 18.298 4.899   4.418   1.00 17.61 ? 308 VAL B C   1 
ATOM   2616 O  O   . VAL B 2 65  ? 17.743 3.813   4.757   1.00 18.12 ? 308 VAL B O   1 
ATOM   2617 C  CB  . VAL B 2 65  ? 20.651 4.095   4.030   1.00 16.46 ? 308 VAL B CB  1 
ATOM   2618 C  CG1 . VAL B 2 65  ? 20.349 4.042   2.506   1.00 18.90 ? 308 VAL B CG1 1 
ATOM   2619 C  CG2 . VAL B 2 65  ? 22.110 4.407   4.235   1.00 18.50 ? 308 VAL B CG2 1 
ATOM   2620 N  N   . PRO B 2 66  ? 17.604 5.901   3.832   1.00 19.33 ? 309 PRO B N   1 
ATOM   2621 C  CA  . PRO B 2 66  ? 16.166 5.711   3.633   1.00 19.66 ? 309 PRO B CA  1 
ATOM   2622 C  C   . PRO B 2 66  ? 15.933 4.453   2.835   1.00 20.88 ? 309 PRO B C   1 
ATOM   2623 O  O   . PRO B 2 66  ? 16.710 4.155   1.927   1.00 21.17 ? 309 PRO B O   1 
ATOM   2624 C  CB  . PRO B 2 66  ? 15.746 6.942   2.817   1.00 19.55 ? 309 PRO B CB  1 
ATOM   2625 C  CG  . PRO B 2 66  ? 16.760 7.962   3.141   1.00 19.79 ? 309 PRO B CG  1 
ATOM   2626 C  CD  . PRO B 2 66  ? 18.065 7.228   3.372   1.00 19.42 ? 309 PRO B CD  1 
ATOM   2627 N  N   . LEU B 2 67  ? 14.851 3.752   3.151   1.00 21.67 ? 310 LEU B N   1 
ATOM   2628 C  CA  . LEU B 2 67  ? 14.642 2.392   2.630   1.00 23.55 ? 310 LEU B CA  1 
ATOM   2629 C  C   . LEU B 2 67  ? 14.211 2.397   1.171   1.00 24.63 ? 310 LEU B C   1 
ATOM   2630 O  O   . LEU B 2 67  ? 14.356 1.374   0.485   1.00 26.10 ? 310 LEU B O   1 
ATOM   2631 C  CB  . LEU B 2 67  ? 13.657 1.609   3.479   1.00 23.50 ? 310 LEU B CB  1 
ATOM   2632 C  CG  . LEU B 2 67  ? 13.904 1.481   4.976   1.00 24.12 ? 310 LEU B CG  1 
ATOM   2633 C  CD1 . LEU B 2 67  ? 12.918 0.507   5.595   1.00 27.07 ? 310 LEU B CD1 1 
ATOM   2634 C  CD2 . LEU B 2 67  ? 15.357 1.093   5.325   1.00 25.91 ? 310 LEU B CD2 1 
ATOM   2635 N  N   . HIS B 2 68  ? 13.735 3.547   0.677   1.00 24.76 ? 311 HIS B N   1 
ATOM   2636 C  CA  . HIS B 2 68  ? 13.554 3.723   -0.766  1.00 25.04 ? 311 HIS B CA  1 
ATOM   2637 C  C   . HIS B 2 68  ? 14.863 3.912   -1.557  1.00 23.82 ? 311 HIS B C   1 
ATOM   2638 O  O   . HIS B 2 68  ? 14.834 3.940   -2.784  1.00 26.14 ? 311 HIS B O   1 
ATOM   2639 C  CB  . HIS B 2 68  ? 12.580 4.871   -1.062  1.00 25.20 ? 311 HIS B CB  1 
ATOM   2640 C  CG  . HIS B 2 68  ? 13.050 6.195   -0.538  1.00 26.74 ? 311 HIS B CG  1 
ATOM   2641 N  ND1 . HIS B 2 68  ? 13.989 6.966   -1.195  1.00 28.42 ? 311 HIS B ND1 1 
ATOM   2642 C  CD2 . HIS B 2 68  ? 12.727 6.872   0.589   1.00 28.42 ? 311 HIS B CD2 1 
ATOM   2643 C  CE1 . HIS B 2 68  ? 14.218 8.065   -0.495  1.00 25.57 ? 311 HIS B CE1 1 
ATOM   2644 N  NE2 . HIS B 2 68  ? 13.453 8.042   0.582   1.00 26.17 ? 311 HIS B NE2 1 
ATOM   2645 N  N   . SER B 2 69  ? 16.002 4.041   -0.892  1.00 23.03 ? 312 SER B N   1 
ATOM   2646 C  CA  . SER B 2 69  ? 17.269 4.321   -1.552  1.00 23.63 ? 312 SER B CA  1 
ATOM   2647 C  C   . SER B 2 69  ? 18.026 3.070   -2.016  1.00 24.29 ? 312 SER B C   1 
ATOM   2648 O  O   . SER B 2 69  ? 18.996 3.176   -2.769  1.00 24.72 ? 312 SER B O   1 
ATOM   2649 C  CB  . SER B 2 69  ? 18.191 5.119   -0.623  1.00 23.48 ? 312 SER B CB  1 
ATOM   2650 O  OG  . SER B 2 69  ? 17.703 6.444   -0.497  1.00 26.87 ? 312 SER B OG  1 
ATOM   2651 N  N   . PHE B 2 70  ? 17.647 1.909   -1.483  1.00 24.41 ? 313 PHE B N   1 
ATOM   2652 C  CA  . PHE B 2 70  ? 18.302 0.629   -1.828  1.00 24.16 ? 313 PHE B CA  1 
ATOM   2653 C  C   . PHE B 2 70  ? 17.269 -0.489  -1.689  1.00 24.83 ? 313 PHE B C   1 
ATOM   2654 O  O   . PHE B 2 70  ? 16.123 -0.232  -1.313  1.00 24.10 ? 313 PHE B O   1 
ATOM   2655 C  CB  . PHE B 2 70  ? 19.570 0.396   -1.008  1.00 23.89 ? 313 PHE B CB  1 
ATOM   2656 C  CG  . PHE B 2 70  ? 19.330 0.087   0.471   1.00 24.82 ? 313 PHE B CG  1 
ATOM   2657 C  CD1 . PHE B 2 70  ? 18.750 1.026   1.325   1.00 21.43 ? 313 PHE B CD1 1 
ATOM   2658 C  CD2 . PHE B 2 70  ? 19.761 -1.122  1.026   1.00 24.64 ? 313 PHE B CD2 1 
ATOM   2659 C  CE1 . PHE B 2 70  ? 18.562 0.751   2.672   1.00 20.54 ? 313 PHE B CE1 1 
ATOM   2660 C  CE2 . PHE B 2 70  ? 19.571 -1.397  2.384   1.00 22.77 ? 313 PHE B CE2 1 
ATOM   2661 C  CZ  . PHE B 2 70  ? 18.974 -0.467  3.204   1.00 23.61 ? 313 PHE B CZ  1 
ATOM   2662 N  N   . PHE B 2 71  ? 17.650 -1.726  -2.011  1.00 24.14 ? 314 PHE B N   1 
ATOM   2663 C  CA  . PHE B 2 71  ? 16.716 -2.832  -1.889  1.00 25.25 ? 314 PHE B CA  1 
ATOM   2664 C  C   . PHE B 2 71  ? 17.006 -3.598  -0.598  1.00 25.67 ? 314 PHE B C   1 
ATOM   2665 O  O   . PHE B 2 71  ? 17.984 -4.366  -0.532  1.00 26.14 ? 314 PHE B O   1 
ATOM   2666 C  CB  . PHE B 2 71  ? 16.853 -3.756  -3.114  1.00 25.68 ? 314 PHE B CB  1 
ATOM   2667 C  CG  . PHE B 2 71  ? 16.680 -3.036  -4.422  1.00 24.46 ? 314 PHE B CG  1 
ATOM   2668 C  CD1 . PHE B 2 71  ? 15.420 -2.868  -4.962  1.00 25.05 ? 314 PHE B CD1 1 
ATOM   2669 C  CD2 . PHE B 2 71  ? 17.787 -2.496  -5.089  1.00 24.34 ? 314 PHE B CD2 1 
ATOM   2670 C  CE1 . PHE B 2 71  ? 15.251 -2.186  -6.174  1.00 26.16 ? 314 PHE B CE1 1 
ATOM   2671 C  CE2 . PHE B 2 71  ? 17.625 -1.806  -6.300  1.00 25.73 ? 314 PHE B CE2 1 
ATOM   2672 C  CZ  . PHE B 2 71  ? 16.343 -1.664  -6.834  1.00 25.40 ? 314 PHE B CZ  1 
ATOM   2673 N  N   . LEU B 2 72  ? 16.191 -3.358  0.439   1.00 25.77 ? 315 LEU B N   1 
ATOM   2674 C  CA  . LEU B 2 72  ? 16.351 -4.044  1.739   1.00 26.01 ? 315 LEU B CA  1 
ATOM   2675 C  C   . LEU B 2 72  ? 16.201 -5.586  1.648   1.00 26.46 ? 315 LEU B C   1 
ATOM   2676 O  O   . LEU B 2 72  ? 16.794 -6.318  2.438   1.00 25.45 ? 315 LEU B O   1 
ATOM   2677 C  CB  . LEU B 2 72  ? 15.360 -3.512  2.775   1.00 26.05 ? 315 LEU B CB  1 
ATOM   2678 C  CG  . LEU B 2 72  ? 15.563 -3.915  4.237   1.00 25.41 ? 315 LEU B CG  1 
ATOM   2679 C  CD1 . LEU B 2 72  ? 16.952 -3.494  4.740   1.00 26.44 ? 315 LEU B CD1 1 
ATOM   2680 C  CD2 . LEU B 2 72  ? 14.471 -3.247  5.062   1.00 26.80 ? 315 LEU B CD2 1 
ATOM   2681 N  N   . THR B 2 73  ? 15.396 -6.047  0.699   1.00 26.65 ? 316 THR B N   1 
ATOM   2682 C  CA  . THR B 2 73  ? 15.277 -7.473  0.428   1.00 28.52 ? 316 THR B CA  1 
ATOM   2683 C  C   . THR B 2 73  ? 15.491 -7.700  -1.087  1.00 27.76 ? 316 THR B C   1 
ATOM   2684 O  O   . THR B 2 73  ? 14.542 -7.863  -1.826  1.00 27.34 ? 316 THR B O   1 
ATOM   2685 C  CB  . THR B 2 73  ? 13.910 -8.021  0.939   1.00 28.87 ? 316 THR B CB  1 
ATOM   2686 O  OG1 . THR B 2 73  ? 12.846 -7.372  0.247   1.00 32.32 ? 316 THR B OG1 1 
ATOM   2687 C  CG2 . THR B 2 73  ? 13.714 -7.717  2.439   1.00 29.97 ? 316 THR B CG2 1 
ATOM   2688 N  N   . PRO B 2 74  ? 16.745 -7.672  -1.546  1.00 28.14 ? 317 PRO B N   1 
ATOM   2689 C  CA  . PRO B 2 74  ? 16.977 -7.732  -3.007  1.00 28.57 ? 317 PRO B CA  1 
ATOM   2690 C  C   . PRO B 2 74  ? 16.411 -9.019  -3.631  1.00 29.86 ? 317 PRO B C   1 
ATOM   2691 O  O   . PRO B 2 74  ? 16.504 -10.102 -3.031  1.00 29.67 ? 317 PRO B O   1 
ATOM   2692 C  CB  . PRO B 2 74  ? 18.493 -7.629  -3.144  1.00 28.61 ? 317 PRO B CB  1 
ATOM   2693 C  CG  . PRO B 2 74  ? 19.054 -7.917  -1.812  1.00 28.76 ? 317 PRO B CG  1 
ATOM   2694 C  CD  . PRO B 2 74  ? 18.001 -7.630  -0.777  1.00 28.54 ? 317 PRO B CD  1 
ATOM   2695 N  N   . ASP B 2 75  ? 15.801 -8.888  -4.805  1.00 30.88 ? 318 ASP B N   1 
ATOM   2696 C  CA  . ASP B 2 75  ? 15.037 -9.971  -5.405  1.00 32.88 ? 318 ASP B CA  1 
ATOM   2697 C  C   . ASP B 2 75  ? 15.628 -10.466 -6.721  1.00 32.48 ? 318 ASP B C   1 
ATOM   2698 O  O   . ASP B 2 75  ? 14.988 -11.240 -7.444  1.00 33.65 ? 318 ASP B O   1 
ATOM   2699 C  CB  . ASP B 2 75  ? 13.590 -9.531  -5.636  1.00 33.55 ? 318 ASP B CB  1 
ATOM   2700 C  CG  . ASP B 2 75  ? 12.659 -10.709 -5.873  1.00 38.49 ? 318 ASP B CG  1 
ATOM   2701 O  OD1 . ASP B 2 75  ? 12.638 -11.637 -5.026  1.00 42.33 ? 318 ASP B OD1 1 
ATOM   2702 O  OD2 . ASP B 2 75  ? 11.946 -10.721 -6.908  1.00 42.99 ? 318 ASP B OD2 1 
ATOM   2703 N  N   . SER B 2 76  ? 16.845 -10.039 -7.026  1.00 32.62 ? 319 SER B N   1 
ATOM   2704 C  CA  . SER B 2 76  ? 17.496 -10.426 -8.269  1.00 33.29 ? 319 SER B CA  1 
ATOM   2705 C  C   . SER B 2 76  ? 18.971 -10.128 -8.156  1.00 33.05 ? 319 SER B C   1 
ATOM   2706 O  O   . SER B 2 76  ? 19.388 -9.343  -7.286  1.00 32.29 ? 319 SER B O   1 
ATOM   2707 C  CB  . SER B 2 76  ? 16.924 -9.628  -9.436  1.00 33.74 ? 319 SER B CB  1 
ATOM   2708 O  OG  . SER B 2 76  ? 17.418 -8.302  -9.383  1.00 34.94 ? 319 SER B OG  1 
ATOM   2709 N  N   . PHE B 2 77  ? 19.752 -10.732 -9.052  1.00 32.29 ? 320 PHE B N   1 
ATOM   2710 C  CA  . PHE B 2 77  ? 21.175 -10.445 -9.172  1.00 33.04 ? 320 PHE B CA  1 
ATOM   2711 C  C   . PHE B 2 77  ? 21.383 -8.938  -9.365  1.00 33.29 ? 320 PHE B C   1 
ATOM   2712 O  O   . PHE B 2 77  ? 22.333 -8.354  -8.803  1.00 33.37 ? 320 PHE B O   1 
ATOM   2713 C  CB  . PHE B 2 77  ? 21.800 -11.253 -10.340 1.00 32.48 ? 320 PHE B CB  1 
ATOM   2714 C  CG  . PHE B 2 77  ? 23.256 -10.943 -10.593 1.00 33.54 ? 320 PHE B CG  1 
ATOM   2715 C  CD1 . PHE B 2 77  ? 24.255 -11.568 -9.845  1.00 32.59 ? 320 PHE B CD1 1 
ATOM   2716 C  CD2 . PHE B 2 77  ? 23.620 -10.034 -11.590 1.00 33.77 ? 320 PHE B CD2 1 
ATOM   2717 C  CE1 . PHE B 2 77  ? 25.586 -11.276 -10.059 1.00 33.42 ? 320 PHE B CE1 1 
ATOM   2718 C  CE2 . PHE B 2 77  ? 24.954 -9.727  -11.831 1.00 33.92 ? 320 PHE B CE2 1 
ATOM   2719 C  CZ  . PHE B 2 77  ? 25.948 -10.343 -11.062 1.00 33.52 ? 320 PHE B CZ  1 
ATOM   2720 N  N   . GLU B 2 78  ? 20.477 -8.322  -10.125 1.00 33.40 ? 321 GLU B N   1 
ATOM   2721 C  CA  . GLU B 2 78  ? 20.611 -6.907  -10.507 1.00 34.84 ? 321 GLU B CA  1 
ATOM   2722 C  C   . GLU B 2 78  ? 20.488 -5.978  -9.297  1.00 33.78 ? 321 GLU B C   1 
ATOM   2723 O  O   . GLU B 2 78  ? 21.253 -5.028  -9.155  1.00 34.03 ? 321 GLU B O   1 
ATOM   2724 C  CB  . GLU B 2 78  ? 19.578 -6.508  -11.575 1.00 35.47 ? 321 GLU B CB  1 
ATOM   2725 C  CG  . GLU B 2 78  ? 19.972 -6.854  -13.008 1.00 38.91 ? 321 GLU B CG  1 
ATOM   2726 C  CD  . GLU B 2 78  ? 19.543 -8.261  -13.404 1.00 44.33 ? 321 GLU B CD  1 
ATOM   2727 O  OE1 . GLU B 2 78  ? 18.312 -8.547  -13.407 1.00 44.89 ? 321 GLU B OE1 1 
ATOM   2728 O  OE2 . GLU B 2 78  ? 20.448 -9.079  -13.722 1.00 48.41 ? 321 GLU B OE2 1 
ATOM   2729 N  N   . GLN B 2 79  ? 19.541 -6.297  -8.424  1.00 33.19 ? 322 GLN B N   1 
ATOM   2730 C  CA  . GLN B 2 79  ? 19.282 -5.497  -7.229  1.00 31.07 ? 322 GLN B CA  1 
ATOM   2731 C  C   . GLN B 2 79  ? 20.428 -5.618  -6.257  1.00 30.82 ? 322 GLN B C   1 
ATOM   2732 O  O   . GLN B 2 79  ? 20.827 -4.623  -5.671  1.00 29.95 ? 322 GLN B O   1 
ATOM   2733 C  CB  . GLN B 2 79  ? 17.960 -5.891  -6.591  1.00 31.73 ? 322 GLN B CB  1 
ATOM   2734 C  CG  . GLN B 2 79  ? 16.774 -5.473  -7.423  1.00 28.95 ? 322 GLN B CG  1 
ATOM   2735 C  CD  . GLN B 2 79  ? 15.453 -5.732  -6.784  1.00 29.53 ? 322 GLN B CD  1 
ATOM   2736 O  OE1 . GLN B 2 79  ? 15.362 -6.240  -5.661  1.00 32.21 ? 322 GLN B OE1 1 
ATOM   2737 N  NE2 . GLN B 2 79  ? 14.395 -5.383  -7.492  1.00 30.63 ? 322 GLN B NE2 1 
ATOM   2738 N  N   . LYS B 2 80  ? 20.971 -6.832  -6.101  1.00 29.27 ? 323 LYS B N   1 
ATOM   2739 C  CA  . LYS B 2 80  ? 22.167 -7.026  -5.285  1.00 29.10 ? 323 LYS B CA  1 
ATOM   2740 C  C   . LYS B 2 80  ? 23.382 -6.230  -5.776  1.00 28.76 ? 323 LYS B C   1 
ATOM   2741 O  O   . LYS B 2 80  ? 24.139 -5.665  -4.972  1.00 27.85 ? 323 LYS B O   1 
ATOM   2742 C  CB  . LYS B 2 80  ? 22.511 -8.519  -5.184  1.00 28.82 ? 323 LYS B CB  1 
ATOM   2743 C  CG  . LYS B 2 80  ? 21.423 -9.348  -4.568  1.00 28.35 ? 323 LYS B CG  1 
ATOM   2744 C  CD  . LYS B 2 80  ? 21.830 -10.831 -4.486  1.00 29.91 ? 323 LYS B CD  1 
ATOM   2745 C  CE  . LYS B 2 80  ? 20.718 -11.622 -3.831  1.00 31.47 ? 323 LYS B CE  1 
ATOM   2746 N  NZ  . LYS B 2 80  ? 21.026 -13.093 -3.693  1.00 32.56 ? 323 LYS B NZ  1 
ATOM   2747 N  N   . VAL B 2 81  ? 23.591 -6.210  -7.098  1.00 28.91 ? 324 VAL B N   1 
ATOM   2748 C  CA  . VAL B 2 81  ? 24.701 -5.462  -7.662  1.00 28.60 ? 324 VAL B CA  1 
ATOM   2749 C  C   . VAL B 2 81  ? 24.479 -3.969  -7.419  1.00 28.35 ? 324 VAL B C   1 
ATOM   2750 O  O   . VAL B 2 81  ? 25.412 -3.259  -7.020  1.00 29.21 ? 324 VAL B O   1 
ATOM   2751 C  CB  . VAL B 2 81  ? 24.922 -5.775  -9.177  1.00 29.38 ? 324 VAL B CB  1 
ATOM   2752 C  CG1 . VAL B 2 81  ? 25.880 -4.749  -9.801  1.00 28.93 ? 324 VAL B CG1 1 
ATOM   2753 C  CG2 . VAL B 2 81  ? 25.485 -7.216  -9.338  1.00 29.11 ? 324 VAL B CG2 1 
ATOM   2754 N  N   . LEU B 2 82  ? 23.243 -3.534  -7.611  1.00 27.63 ? 325 LEU B N   1 
ATOM   2755 C  CA  . LEU B 2 82  ? 22.833 -2.146  -7.360  1.00 27.87 ? 325 LEU B CA  1 
ATOM   2756 C  C   . LEU B 2 82  ? 23.041 -1.740  -5.898  1.00 27.15 ? 325 LEU B C   1 
ATOM   2757 O  O   . LEU B 2 82  ? 23.554 -0.657  -5.632  1.00 26.71 ? 325 LEU B O   1 
ATOM   2758 C  CB  . LEU B 2 82  ? 21.374 -1.938  -7.765  1.00 28.21 ? 325 LEU B CB  1 
ATOM   2759 C  CG  . LEU B 2 82  ? 21.079 -1.877  -9.273  1.00 30.18 ? 325 LEU B CG  1 
ATOM   2760 C  CD1 . LEU B 2 82  ? 19.631 -1.674  -9.535  1.00 29.18 ? 325 LEU B CD1 1 
ATOM   2761 C  CD2 . LEU B 2 82  ? 21.909 -0.775  -9.964  1.00 31.27 ? 325 LEU B CD2 1 
ATOM   2762 N  N   . ASN B 2 83  ? 22.691 -2.641  -4.970  1.00 26.41 ? 326 ASN B N   1 
ATOM   2763 C  CA  . ASN B 2 83  ? 22.965 -2.443  -3.542  1.00 26.31 ? 326 ASN B CA  1 
ATOM   2764 C  C   . ASN B 2 83  ? 24.444 -2.340  -3.267  1.00 26.21 ? 326 ASN B C   1 
ATOM   2765 O  O   . ASN B 2 83  ? 24.897 -1.467  -2.533  1.00 26.09 ? 326 ASN B O   1 
ATOM   2766 C  CB  . ASN B 2 83  ? 22.441 -3.627  -2.725  1.00 25.53 ? 326 ASN B CB  1 
ATOM   2767 C  CG  . ASN B 2 83  ? 20.988 -3.517  -2.373  1.00 27.57 ? 326 ASN B CG  1 
ATOM   2768 O  OD1 . ASN B 2 83  ? 20.313 -2.511  -2.653  1.00 25.62 ? 326 ASN B OD1 1 
ATOM   2769 N  ND2 . ASN B 2 83  ? 20.474 -4.580  -1.745  1.00 27.17 ? 326 ASN B ND2 1 
ATOM   2770 N  N   . VAL B 2 84  ? 25.230 -3.272  -3.817  1.00 25.41 ? 327 VAL B N   1 
ATOM   2771 C  CA  . VAL B 2 84  ? 26.648 -3.211  -3.590  1.00 25.89 ? 327 VAL B CA  1 
ATOM   2772 C  C   . VAL B 2 84  ? 27.243 -1.926  -4.177  1.00 25.81 ? 327 VAL B C   1 
ATOM   2773 O  O   . VAL B 2 84  ? 28.074 -1.298  -3.540  1.00 25.81 ? 327 VAL B O   1 
ATOM   2774 C  CB  . VAL B 2 84  ? 27.421 -4.491  -4.098  1.00 25.55 ? 327 VAL B CB  1 
ATOM   2775 C  CG1 . VAL B 2 84  ? 28.908 -4.284  -3.928  1.00 26.64 ? 327 VAL B CG1 1 
ATOM   2776 C  CG2 . VAL B 2 84  ? 27.017 -5.696  -3.298  1.00 25.90 ? 327 VAL B CG2 1 
ATOM   2777 N  N   . SER B 2 85  ? 26.809 -1.543  -5.377  1.00 27.14 ? 328 SER B N   1 
ATOM   2778 C  CA  . SER B 2 85  ? 27.354 -0.348  -6.049  1.00 28.07 ? 328 SER B CA  1 
ATOM   2779 C  C   . SER B 2 85  ? 27.095 0.921   -5.228  1.00 28.04 ? 328 SER B C   1 
ATOM   2780 O  O   . SER B 2 85  ? 27.984 1.762   -5.037  1.00 28.48 ? 328 SER B O   1 
ATOM   2781 C  CB  . SER B 2 85  ? 26.774 -0.204  -7.457  1.00 29.08 ? 328 SER B CB  1 
ATOM   2782 O  OG  . SER B 2 85  ? 27.259 -1.272  -8.265  1.00 30.30 ? 328 SER B OG  1 
ATOM   2783 N  N   . PHE B 2 86  ? 25.881 0.993   -4.701  1.00 27.82 ? 329 PHE B N   1 
ATOM   2784 C  CA  . PHE B 2 86  ? 25.468 2.083   -3.798  1.00 27.67 ? 329 PHE B CA  1 
ATOM   2785 C  C   . PHE B 2 86  ? 26.340 2.092   -2.535  1.00 27.26 ? 329 PHE B C   1 
ATOM   2786 O  O   . PHE B 2 86  ? 26.769 3.150   -2.076  1.00 26.24 ? 329 PHE B O   1 
ATOM   2787 C  CB  . PHE B 2 86  ? 23.986 1.919   -3.486  1.00 27.75 ? 329 PHE B CB  1 
ATOM   2788 C  CG  . PHE B 2 86  ? 23.459 2.899   -2.475  1.00 29.70 ? 329 PHE B CG  1 
ATOM   2789 C  CD1 . PHE B 2 86  ? 23.575 4.274   -2.689  1.00 28.79 ? 329 PHE B CD1 1 
ATOM   2790 C  CD2 . PHE B 2 86  ? 22.840 2.445   -1.318  1.00 28.80 ? 329 PHE B CD2 1 
ATOM   2791 C  CE1 . PHE B 2 86  ? 23.075 5.196   -1.748  1.00 32.00 ? 329 PHE B CE1 1 
ATOM   2792 C  CE2 . PHE B 2 86  ? 22.332 3.350   -0.384  1.00 30.15 ? 329 PHE B CE2 1 
ATOM   2793 C  CZ  . PHE B 2 86  ? 22.454 4.721   -0.596  1.00 27.60 ? 329 PHE B CZ  1 
ATOM   2794 N  N   . ALA B 2 87  ? 26.648 0.902   -2.012  1.00 27.48 ? 330 ALA B N   1 
ATOM   2795 C  CA  . ALA B 2 87  ? 27.527 0.776   -0.849  1.00 27.82 ? 330 ALA B CA  1 
ATOM   2796 C  C   . ALA B 2 87  ? 28.921 1.296   -1.145  1.00 28.34 ? 330 ALA B C   1 
ATOM   2797 O  O   . ALA B 2 87  ? 29.490 2.007   -0.334  1.00 27.09 ? 330 ALA B O   1 
ATOM   2798 C  CB  . ALA B 2 87  ? 27.574 -0.672  -0.339  1.00 28.45 ? 330 ALA B CB  1 
ATOM   2799 N  N   . PHE B 2 88  ? 29.456 0.977   -2.334  1.00 29.43 ? 331 PHE B N   1 
ATOM   2800 C  CA  . PHE B 2 88  ? 30.757 1.506   -2.731  1.00 31.13 ? 331 PHE B CA  1 
ATOM   2801 C  C   . PHE B 2 88  ? 30.728 3.029   -2.869  1.00 31.20 ? 331 PHE B C   1 
ATOM   2802 O  O   . PHE B 2 88  ? 31.699 3.700   -2.506  1.00 32.11 ? 331 PHE B O   1 
ATOM   2803 C  CB  . PHE B 2 88  ? 31.266 0.878   -4.036  1.00 31.44 ? 331 PHE B CB  1 
ATOM   2804 C  CG  . PHE B 2 88  ? 31.611 -0.610  -3.933  1.00 33.44 ? 331 PHE B CG  1 
ATOM   2805 C  CD1 . PHE B 2 88  ? 31.781 -1.238  -2.699  1.00 33.38 ? 331 PHE B CD1 1 
ATOM   2806 C  CD2 . PHE B 2 88  ? 31.803 -1.360  -5.088  1.00 34.98 ? 331 PHE B CD2 1 
ATOM   2807 C  CE1 . PHE B 2 88  ? 32.115 -2.607  -2.612  1.00 34.74 ? 331 PHE B CE1 1 
ATOM   2808 C  CE2 . PHE B 2 88  ? 32.138 -2.734  -5.017  1.00 35.84 ? 331 PHE B CE2 1 
ATOM   2809 C  CZ  . PHE B 2 88  ? 32.300 -3.350  -3.782  1.00 34.82 ? 331 PHE B CZ  1 
ATOM   2810 N  N   . GLU B 2 89  ? 29.622 3.560   -3.386  1.00 31.86 ? 332 GLU B N   1 
ATOM   2811 C  CA  . GLU B 2 89  ? 29.458 5.008   -3.500  1.00 32.05 ? 332 GLU B CA  1 
ATOM   2812 C  C   . GLU B 2 89  ? 29.518 5.636   -2.118  1.00 31.24 ? 332 GLU B C   1 
ATOM   2813 O  O   . GLU B 2 89  ? 30.218 6.629   -1.927  1.00 31.38 ? 332 GLU B O   1 
ATOM   2814 C  CB  . GLU B 2 89  ? 28.150 5.374   -4.194  1.00 32.25 ? 332 GLU B CB  1 
ATOM   2815 C  CG  . GLU B 2 89  ? 28.071 5.007   -5.697  1.00 36.91 ? 332 GLU B CG  1 
ATOM   2816 C  CD  . GLU B 2 89  ? 29.316 5.403   -6.509  1.00 42.77 ? 332 GLU B CD  1 
ATOM   2817 O  OE1 . GLU B 2 89  ? 29.863 6.533   -6.311  1.00 44.49 ? 332 GLU B OE1 1 
ATOM   2818 O  OE2 . GLU B 2 89  ? 29.742 4.574   -7.364  1.00 45.03 ? 332 GLU B OE2 1 
ATOM   2819 N  N   . LEU B 2 90  ? 28.805 5.037   -1.157  1.00 30.88 ? 333 LEU B N   1 
ATOM   2820 C  CA  . LEU B 2 90  ? 28.809 5.535   0.227   1.00 30.68 ? 333 LEU B CA  1 
ATOM   2821 C  C   . LEU B 2 90  ? 30.210 5.494   0.825   1.00 31.47 ? 333 LEU B C   1 
ATOM   2822 O  O   . LEU B 2 90  ? 30.613 6.401   1.527   1.00 30.54 ? 333 LEU B O   1 
ATOM   2823 C  CB  . LEU B 2 90  ? 27.846 4.763   1.118   1.00 30.50 ? 333 LEU B CB  1 
ATOM   2824 C  CG  . LEU B 2 90  ? 26.340 4.796   0.895   1.00 29.23 ? 333 LEU B CG  1 
ATOM   2825 C  CD1 . LEU B 2 90  ? 25.695 3.818   1.863   1.00 26.40 ? 333 LEU B CD1 1 
ATOM   2826 C  CD2 . LEU B 2 90  ? 25.731 6.186   1.070   1.00 28.80 ? 333 LEU B CD2 1 
HETATM 2827 N  N   . MSE B 2 91  ? 30.975 4.446   0.525   1.00 32.55 ? 334 MSE B N   1 
HETATM 2828 C  CA  . MSE B 2 91  ? 32.366 4.412   0.969   1.00 35.77 ? 334 MSE B CA  1 
HETATM 2829 C  C   . MSE B 2 91  ? 33.201 5.533   0.398   1.00 34.71 ? 334 MSE B C   1 
HETATM 2830 O  O   . MSE B 2 91  ? 34.035 6.087   1.099   1.00 35.58 ? 334 MSE B O   1 
HETATM 2831 C  CB  . MSE B 2 91  ? 33.011 3.089   0.599   1.00 34.82 ? 334 MSE B CB  1 
HETATM 2832 C  CG  . MSE B 2 91  ? 32.305 1.933   1.216   1.00 35.93 ? 334 MSE B CG  1 
HETATM 2833 SE SE  . MSE B 2 91  ? 33.132 0.350   0.481   1.00 43.70 ? 334 MSE B SE  1 
HETATM 2834 C  CE  . MSE B 2 91  ? 31.696 -0.899  0.789   1.00 34.93 ? 334 MSE B CE  1 
ATOM   2835 N  N   . GLN B 2 92  ? 32.990 5.851   -0.873  1.00 35.48 ? 335 GLN B N   1 
ATOM   2836 C  CA  . GLN B 2 92  ? 33.697 6.969   -1.508  1.00 36.20 ? 335 GLN B CA  1 
ATOM   2837 C  C   . GLN B 2 92  ? 33.268 8.319   -0.910  1.00 36.44 ? 335 GLN B C   1 
ATOM   2838 O  O   . GLN B 2 92  ? 34.116 9.175   -0.661  1.00 35.63 ? 335 GLN B O   1 
ATOM   2839 C  CB  . GLN B 2 92  ? 33.527 6.957   -3.028  1.00 36.35 ? 335 GLN B CB  1 
ATOM   2840 C  CG  . GLN B 2 92  ? 34.250 5.797   -3.725  1.00 37.19 ? 335 GLN B CG  1 
ATOM   2841 C  CD  . GLN B 2 92  ? 34.225 5.926   -5.231  1.00 37.09 ? 335 GLN B CD  1 
ATOM   2842 O  OE1 . GLN B 2 92  ? 35.067 6.605   -5.825  1.00 39.81 ? 335 GLN B OE1 1 
ATOM   2843 N  NE2 . GLN B 2 92  ? 33.268 5.276   -5.857  1.00 37.75 ? 335 GLN B NE2 1 
ATOM   2844 N  N   . ASP B 2 93  ? 31.963 8.487   -0.673  1.00 37.43 ? 336 ASP B N   1 
ATOM   2845 C  CA  . ASP B 2 93  ? 31.440 9.653   0.063   1.00 38.00 ? 336 ASP B CA  1 
ATOM   2846 C  C   . ASP B 2 93  ? 32.196 9.843   1.371   1.00 38.91 ? 336 ASP B C   1 
ATOM   2847 O  O   . ASP B 2 93  ? 32.450 10.969  1.783   1.00 39.65 ? 336 ASP B O   1 
ATOM   2848 C  CB  . ASP B 2 93  ? 29.949 9.486   0.364   1.00 37.77 ? 336 ASP B CB  1 
ATOM   2849 C  CG  . ASP B 2 93  ? 29.070 9.672   -0.863  1.00 36.34 ? 336 ASP B CG  1 
ATOM   2850 O  OD1 . ASP B 2 93  ? 29.565 10.054  -1.937  1.00 37.10 ? 336 ASP B OD1 1 
ATOM   2851 O  OD2 . ASP B 2 93  ? 27.867 9.433   -0.746  1.00 35.95 ? 336 ASP B OD2 1 
ATOM   2852 N  N   . GLY B 2 94  ? 32.586 8.733   2.000   1.00 39.87 ? 337 GLY B N   1 
ATOM   2853 C  CA  . GLY B 2 94  ? 33.301 8.752   3.282   1.00 40.17 ? 337 GLY B CA  1 
ATOM   2854 C  C   . GLY B 2 94  ? 34.811 8.968   3.233   1.00 40.74 ? 337 GLY B C   1 
ATOM   2855 O  O   . GLY B 2 94  ? 35.475 9.018   4.271   1.00 40.39 ? 337 GLY B O   1 
ATOM   2856 N  N   . GLY B 2 95  ? 35.361 9.110   2.036   1.00 41.41 ? 338 GLY B N   1 
ATOM   2857 C  CA  . GLY B 2 95  ? 36.768 9.431   1.900   1.00 42.58 ? 338 GLY B CA  1 
ATOM   2858 C  C   . GLY B 2 95  ? 37.611 8.258   1.430   1.00 43.53 ? 338 GLY B C   1 
ATOM   2859 O  O   . GLY B 2 95  ? 38.810 8.414   1.185   1.00 43.58 ? 338 GLY B O   1 
ATOM   2860 N  N   . LEU B 2 96  ? 36.997 7.083   1.303   1.00 44.32 ? 339 LEU B N   1 
ATOM   2861 C  CA  . LEU B 2 96  ? 37.708 5.923   0.754   1.00 45.44 ? 339 LEU B CA  1 
ATOM   2862 C  C   . LEU B 2 96  ? 37.838 6.049   -0.748  1.00 45.83 ? 339 LEU B C   1 
ATOM   2863 O  O   . LEU B 2 96  ? 36.893 6.456   -1.427  1.00 45.95 ? 339 LEU B O   1 
ATOM   2864 C  CB  . LEU B 2 96  ? 37.015 4.599   1.107   1.00 45.25 ? 339 LEU B CB  1 
ATOM   2865 C  CG  . LEU B 2 96  ? 37.429 3.932   2.419   1.00 45.75 ? 339 LEU B CG  1 
ATOM   2866 C  CD1 . LEU B 2 96  ? 36.630 2.665   2.663   1.00 46.09 ? 339 LEU B CD1 1 
ATOM   2867 C  CD2 . LEU B 2 96  ? 38.937 3.625   2.464   1.00 45.77 ? 339 LEU B CD2 1 
ATOM   2868 N  N   . GLU B 2 97  ? 39.013 5.709   -1.268  1.00 46.81 ? 340 GLU B N   1 
ATOM   2869 C  CA  . GLU B 2 97  ? 39.186 5.633   -2.718  1.00 47.93 ? 340 GLU B CA  1 
ATOM   2870 C  C   . GLU B 2 97  ? 38.284 4.526   -3.250  1.00 47.76 ? 340 GLU B C   1 
ATOM   2871 O  O   . GLU B 2 97  ? 37.874 3.637   -2.489  1.00 48.20 ? 340 GLU B O   1 
ATOM   2872 C  CB  . GLU B 2 97  ? 40.651 5.409   -3.110  1.00 47.96 ? 340 GLU B CB  1 
ATOM   2873 C  CG  . GLU B 2 97  ? 41.375 4.358   -2.287  1.00 48.69 ? 340 GLU B CG  1 
ATOM   2874 C  CD  . GLU B 2 97  ? 42.876 4.392   -2.497  1.00 49.87 ? 340 GLU B CD  1 
ATOM   2875 O  OE1 . GLU B 2 97  ? 43.334 4.113   -3.633  1.00 53.05 ? 340 GLU B OE1 1 
ATOM   2876 O  OE2 . GLU B 2 97  ? 43.600 4.697   -1.522  1.00 51.56 ? 340 GLU B OE2 1 
ATOM   2877 N  N   . LYS B 2 98  ? 37.947 4.606   -4.532  1.00 47.98 ? 341 LYS B N   1 
ATOM   2878 C  CA  . LYS B 2 98  ? 37.096 3.610   -5.162  1.00 48.43 ? 341 LYS B CA  1 
ATOM   2879 C  C   . LYS B 2 98  ? 37.636 2.203   -4.850  1.00 48.80 ? 341 LYS B C   1 
ATOM   2880 O  O   . LYS B 2 98  ? 38.847 1.955   -5.012  1.00 48.81 ? 341 LYS B O   1 
ATOM   2881 C  CB  . LYS B 2 98  ? 37.016 3.845   -6.673  1.00 48.47 ? 341 LYS B CB  1 
ATOM   2882 C  CG  . LYS B 2 98  ? 35.989 2.967   -7.368  1.00 48.79 ? 341 LYS B CG  1 
ATOM   2883 C  CD  . LYS B 2 98  ? 35.553 3.518   -8.701  1.00 49.80 ? 341 LYS B CD  1 
ATOM   2884 C  CE  . LYS B 2 98  ? 36.365 2.928   -9.820  1.00 51.18 ? 341 LYS B CE  1 
ATOM   2885 N  NZ  . LYS B 2 98  ? 35.523 2.758   -11.029 1.00 52.98 ? 341 LYS B NZ  1 
ATOM   2886 N  N   . PRO B 2 99  ? 36.754 1.304   -4.351  1.00 48.96 ? 342 PRO B N   1 
ATOM   2887 C  CA  . PRO B 2 99  ? 37.076 -0.105  -4.082  1.00 48.85 ? 342 PRO B CA  1 
ATOM   2888 C  C   . PRO B 2 99  ? 37.610 -0.814  -5.317  1.00 48.72 ? 342 PRO B C   1 
ATOM   2889 O  O   . PRO B 2 99  ? 37.070 -0.625  -6.414  1.00 48.81 ? 342 PRO B O   1 
ATOM   2890 C  CB  . PRO B 2 99  ? 35.719 -0.710  -3.696  1.00 48.89 ? 342 PRO B CB  1 
ATOM   2891 C  CG  . PRO B 2 99  ? 34.940 0.432   -3.160  1.00 48.82 ? 342 PRO B CG  1 
ATOM   2892 C  CD  . PRO B 2 99  ? 35.363 1.626   -3.967  1.00 49.20 ? 342 PRO B CD  1 
ATOM   2893 N  N   . LYS B 2 100 ? 38.657 -1.621  -5.130  1.00 48.78 ? 343 LYS B N   1 
ATOM   2894 C  CA  . LYS B 2 100 ? 39.256 -2.396  -6.231  1.00 48.34 ? 343 LYS B CA  1 
ATOM   2895 C  C   . LYS B 2 100 ? 38.293 -3.443  -6.820  1.00 47.82 ? 343 LYS B C   1 
ATOM   2896 O  O   . LYS B 2 100 ? 38.108 -3.476  -8.045  1.00 47.86 ? 343 LYS B O   1 
ATOM   2897 C  CB  . LYS B 2 100 ? 40.599 -3.010  -5.816  1.00 48.50 ? 343 LYS B CB  1 
ATOM   2898 C  CG  . LYS B 2 100 ? 41.767 -2.017  -5.883  1.00 49.65 ? 343 LYS B CG  1 
ATOM   2899 C  CD  . LYS B 2 100 ? 42.641 -2.088  -4.627  1.00 51.94 ? 343 LYS B CD  1 
ATOM   2900 C  CE  . LYS B 2 100 ? 41.973 -1.433  -3.392  1.00 52.36 ? 343 LYS B CE  1 
ATOM   2901 N  NZ  . LYS B 2 100 ? 42.570 -1.919  -2.099  1.00 51.25 ? 343 LYS B NZ  1 
ATOM   2902 N  N   . PRO B 2 101 ? 37.642 -4.270  -5.965  1.00 47.08 ? 344 PRO B N   1 
ATOM   2903 C  CA  . PRO B 2 101 ? 36.752 -5.277  -6.563  1.00 46.38 ? 344 PRO B CA  1 
ATOM   2904 C  C   . PRO B 2 101 ? 35.602 -4.632  -7.317  1.00 45.94 ? 344 PRO B C   1 
ATOM   2905 O  O   . PRO B 2 101 ? 35.138 -3.561  -6.913  1.00 46.80 ? 344 PRO B O   1 
ATOM   2906 C  CB  . PRO B 2 101 ? 36.190 -6.027  -5.349  1.00 46.17 ? 344 PRO B CB  1 
ATOM   2907 C  CG  . PRO B 2 101 ? 37.110 -5.729  -4.236  1.00 46.58 ? 344 PRO B CG  1 
ATOM   2908 C  CD  . PRO B 2 101 ? 37.640 -4.349  -4.494  1.00 46.85 ? 344 PRO B CD  1 
ATOM   2909 N  N   . ARG B 2 102 ? 35.144 -5.256  -8.400  1.00 44.85 ? 345 ARG B N   1 
ATOM   2910 C  CA  . ARG B 2 102 ? 33.859 -4.877  -8.991  1.00 44.19 ? 345 ARG B CA  1 
ATOM   2911 C  C   . ARG B 2 102 ? 32.763 -5.312  -8.028  1.00 43.00 ? 345 ARG B C   1 
ATOM   2912 O  O   . ARG B 2 102 ? 32.961 -6.272  -7.272  1.00 42.11 ? 345 ARG B O   1 
ATOM   2913 C  CB  . ARG B 2 102 ? 33.633 -5.574  -10.322 1.00 44.22 ? 345 ARG B CB  1 
ATOM   2914 C  CG  . ARG B 2 102 ? 34.047 -4.771  -11.563 1.00 45.70 ? 345 ARG B CG  1 
ATOM   2915 C  CD  . ARG B 2 102 ? 33.949 -5.640  -12.816 1.00 46.12 ? 345 ARG B CD  1 
ATOM   2916 N  NE  . ARG B 2 102 ? 34.586 -6.940  -12.580 1.00 49.99 ? 345 ARG B NE  1 
ATOM   2917 C  CZ  . ARG B 2 102 ? 33.974 -8.122  -12.629 1.00 50.43 ? 345 ARG B CZ  1 
ATOM   2918 N  NH1 . ARG B 2 102 ? 32.685 -8.213  -12.951 1.00 50.82 ? 345 ARG B NH1 1 
ATOM   2919 N  NH2 . ARG B 2 102 ? 34.670 -9.226  -12.373 1.00 51.58 ? 345 ARG B NH2 1 
ATOM   2920 N  N   . PRO B 2 103 ? 31.602 -4.618  -8.053  1.00 41.93 ? 346 PRO B N   1 
ATOM   2921 C  CA  . PRO B 2 103 ? 30.459 -4.999  -7.212  1.00 41.25 ? 346 PRO B CA  1 
ATOM   2922 C  C   . PRO B 2 103 ? 30.076 -6.481  -7.361  1.00 40.56 ? 346 PRO B C   1 
ATOM   2923 O  O   . PRO B 2 103 ? 29.803 -7.143  -6.354  1.00 40.02 ? 346 PRO B O   1 
ATOM   2924 C  CB  . PRO B 2 103 ? 29.334 -4.077  -7.702  1.00 40.75 ? 346 PRO B CB  1 
ATOM   2925 C  CG  . PRO B 2 103 ? 29.801 -3.545  -9.013  1.00 41.51 ? 346 PRO B CG  1 
ATOM   2926 C  CD  . PRO B 2 103 ? 31.282 -3.439  -8.875  1.00 42.11 ? 346 PRO B CD  1 
ATOM   2927 N  N   . GLU B 2 104 ? 30.122 -6.990  -8.599  1.00 40.05 ? 347 GLU B N   1 
ATOM   2928 C  CA  . GLU B 2 104 ? 29.823 -8.400  -8.942  1.00 39.18 ? 347 GLU B CA  1 
ATOM   2929 C  C   . GLU B 2 104 ? 30.703 -9.403  -8.207  1.00 38.46 ? 347 GLU B C   1 
ATOM   2930 O  O   . GLU B 2 104 ? 30.252 -10.500 -7.875  1.00 38.30 ? 347 GLU B O   1 
ATOM   2931 C  CB  . GLU B 2 104 ? 29.973 -8.631  -10.446 1.00 39.05 ? 347 GLU B CB  1 
ATOM   2932 C  CG  . GLU B 2 104 ? 29.002 -7.861  -11.320 1.00 40.21 ? 347 GLU B CG  1 
ATOM   2933 C  CD  . GLU B 2 104 ? 29.396 -6.401  -11.556 1.00 39.33 ? 347 GLU B CD  1 
ATOM   2934 O  OE1 . GLU B 2 104 ? 30.479 -5.965  -11.110 1.00 41.16 ? 347 GLU B OE1 1 
ATOM   2935 O  OE2 . GLU B 2 104 ? 28.605 -5.684  -12.196 1.00 41.03 ? 347 GLU B OE2 1 
ATOM   2936 N  N   . ASP B 2 105 ? 31.954 -9.023  -7.943  1.00 37.62 ? 348 ASP B N   1 
ATOM   2937 C  CA  . ASP B 2 105 ? 32.876 -9.890  -7.201  1.00 36.64 ? 348 ASP B CA  1 
ATOM   2938 C  C   . ASP B 2 105 ? 32.368 -10.110 -5.779  1.00 35.39 ? 348 ASP B C   1 
ATOM   2939 O  O   . ASP B 2 105 ? 32.579 -11.159 -5.186  1.00 34.08 ? 348 ASP B O   1 
ATOM   2940 C  CB  . ASP B 2 105 ? 34.295 -9.310  -7.186  1.00 37.53 ? 348 ASP B CB  1 
ATOM   2941 C  CG  . ASP B 2 105 ? 34.836 -9.027  -8.591  1.00 39.21 ? 348 ASP B CG  1 
ATOM   2942 O  OD1 . ASP B 2 105 ? 34.289 -9.563  -9.586  1.00 41.27 ? 348 ASP B OD1 1 
ATOM   2943 O  OD2 . ASP B 2 105 ? 35.806 -8.258  -8.693  1.00 40.34 ? 348 ASP B OD2 1 
ATOM   2944 N  N   . ILE B 2 106 ? 31.680 -9.104  -5.239  1.00 33.09 ? 349 ILE B N   1 
ATOM   2945 C  CA  . ILE B 2 106 ? 31.108 -9.217  -3.912  1.00 32.01 ? 349 ILE B CA  1 
ATOM   2946 C  C   . ILE B 2 106 ? 29.879 -10.134 -3.947  1.00 30.99 ? 349 ILE B C   1 
ATOM   2947 O  O   . ILE B 2 106 ? 29.721 -11.009 -3.092  1.00 30.43 ? 349 ILE B O   1 
ATOM   2948 C  CB  . ILE B 2 106 ? 30.718 -7.826  -3.373  1.00 31.17 ? 349 ILE B CB  1 
ATOM   2949 C  CG1 . ILE B 2 106 ? 31.974 -6.958  -3.233  1.00 31.49 ? 349 ILE B CG1 1 
ATOM   2950 C  CG2 . ILE B 2 106 ? 29.956 -7.956  -2.051  1.00 32.14 ? 349 ILE B CG2 1 
ATOM   2951 C  CD1 . ILE B 2 106 ? 32.897 -7.369  -2.104  1.00 32.44 ? 349 ILE B CD1 1 
ATOM   2952 N  N   . VAL B 2 107 ? 29.023 -9.908  -4.936  1.00 30.83 ? 350 VAL B N   1 
ATOM   2953 C  CA  . VAL B 2 107 ? 27.771 -10.649 -5.084  1.00 31.44 ? 350 VAL B CA  1 
ATOM   2954 C  C   . VAL B 2 107 ? 28.080 -12.134 -5.378  1.00 32.73 ? 350 VAL B C   1 
ATOM   2955 O  O   . VAL B 2 107 ? 27.394 -13.032 -4.894  1.00 32.03 ? 350 VAL B O   1 
ATOM   2956 C  CB  . VAL B 2 107 ? 26.875 -10.029 -6.192  1.00 30.95 ? 350 VAL B CB  1 
ATOM   2957 C  CG1 . VAL B 2 107 ? 25.553 -10.770 -6.333  1.00 31.07 ? 350 VAL B CG1 1 
ATOM   2958 C  CG2 . VAL B 2 107 ? 26.584 -8.517  -5.934  1.00 32.03 ? 350 VAL B CG2 1 
ATOM   2959 N  N   . ASN B 2 108 ? 29.132 -12.375 -6.155  1.00 34.13 ? 351 ASN B N   1 
ATOM   2960 C  CA  . ASN B 2 108 ? 29.615 -13.759 -6.416  1.00 35.13 ? 351 ASN B CA  1 
ATOM   2961 C  C   . ASN B 2 108 ? 30.388 -14.429 -5.259  1.00 36.03 ? 351 ASN B C   1 
ATOM   2962 O  O   . ASN B 2 108 ? 30.902 -15.542 -5.419  1.00 36.07 ? 351 ASN B O   1 
ATOM   2963 C  CB  . ASN B 2 108 ? 30.445 -13.788 -7.707  1.00 35.35 ? 351 ASN B CB  1 
ATOM   2964 C  CG  . ASN B 2 108 ? 29.630 -13.391 -8.956  1.00 36.18 ? 351 ASN B CG  1 
ATOM   2965 O  OD1 . ASN B 2 108 ? 28.442 -13.719 -9.086  1.00 38.91 ? 351 ASN B OD1 1 
ATOM   2966 N  ND2 . ASN B 2 108 ? 30.281 -12.690 -9.886  1.00 37.54 ? 351 ASN B ND2 1 
ATOM   2967 N  N   . CYS B 2 109 ? 30.474 -13.761 -4.104  1.00 36.05 ? 352 CYS B N   1 
ATOM   2968 C  CA  . CYS B 2 109 ? 31.108 -14.326 -2.892  1.00 36.77 ? 352 CYS B CA  1 
ATOM   2969 C  C   . CYS B 2 109 ? 32.626 -14.610 -3.023  1.00 37.80 ? 352 CYS B C   1 
ATOM   2970 O  O   . CYS B 2 109 ? 33.143 -15.576 -2.454  1.00 38.71 ? 352 CYS B O   1 
ATOM   2971 C  CB  . CYS B 2 109 ? 30.360 -15.580 -2.428  1.00 36.26 ? 352 CYS B CB  1 
ATOM   2972 S  SG  . CYS B 2 109 ? 28.560 -15.306 -2.289  1.00 34.82 ? 352 CYS B SG  1 
ATOM   2973 N  N   . ASP B 2 110 ? 33.320 -13.764 -3.775  1.00 38.81 ? 353 ASP B N   1 
ATOM   2974 C  CA  . ASP B 2 110 ? 34.788 -13.792 -3.852  1.00 39.54 ? 353 ASP B CA  1 
ATOM   2975 C  C   . ASP B 2 110 ? 35.357 -13.352 -2.498  1.00 39.89 ? 353 ASP B C   1 
ATOM   2976 O  O   . ASP B 2 110 ? 35.340 -12.163 -2.162  1.00 39.77 ? 353 ASP B O   1 
ATOM   2977 C  CB  . ASP B 2 110 ? 35.234 -12.889 -5.012  1.00 40.21 ? 353 ASP B CB  1 
ATOM   2978 C  CG  . ASP B 2 110 ? 36.746 -12.650 -5.070  1.00 42.63 ? 353 ASP B CG  1 
ATOM   2979 O  OD1 . ASP B 2 110 ? 37.487 -12.843 -4.075  1.00 42.74 ? 353 ASP B OD1 1 
ATOM   2980 O  OD2 . ASP B 2 110 ? 37.192 -12.213 -6.152  1.00 46.28 ? 353 ASP B OD2 1 
ATOM   2981 N  N   . LEU B 2 111 ? 35.843 -14.325 -1.727  1.00 39.70 ? 354 LEU B N   1 
ATOM   2982 C  CA  . LEU B 2 111 ? 36.276 -14.097 -0.349  1.00 40.29 ? 354 LEU B CA  1 
ATOM   2983 C  C   . LEU B 2 111 ? 37.390 -13.063 -0.191  1.00 40.54 ? 354 LEU B C   1 
ATOM   2984 O  O   . LEU B 2 111 ? 37.343 -12.245 0.739   1.00 40.47 ? 354 LEU B O   1 
ATOM   2985 C  CB  . LEU B 2 111 ? 36.694 -15.408 0.324   1.00 40.26 ? 354 LEU B CB  1 
ATOM   2986 C  CG  . LEU B 2 111 ? 37.126 -15.254 1.785   1.00 40.72 ? 354 LEU B CG  1 
ATOM   2987 C  CD1 . LEU B 2 111 ? 35.956 -14.803 2.670   1.00 40.18 ? 354 LEU B CD1 1 
ATOM   2988 C  CD2 . LEU B 2 111 ? 37.791 -16.513 2.307   1.00 41.02 ? 354 LEU B CD2 1 
ATOM   2989 N  N   . LYS B 2 112 ? 38.392 -13.101 -1.066  1.00 41.04 ? 355 LYS B N   1 
ATOM   2990 C  CA  . LYS B 2 112 ? 39.499 -12.135 -0.983  1.00 41.49 ? 355 LYS B CA  1 
ATOM   2991 C  C   . LYS B 2 112 ? 38.985 -10.695 -1.135  1.00 41.47 ? 355 LYS B C   1 
ATOM   2992 O  O   . LYS B 2 112 ? 39.358 -9.812  -0.343  1.00 41.08 ? 355 LYS B O   1 
ATOM   2993 C  CB  . LYS B 2 112 ? 40.598 -12.431 -2.012  1.00 41.50 ? 355 LYS B CB  1 
ATOM   2994 C  CG  . LYS B 2 112 ? 41.788 -11.465 -1.919  1.00 41.22 ? 355 LYS B CG  1 
ATOM   2995 C  CD  . LYS B 2 112 ? 42.751 -11.604 -3.089  1.00 42.42 ? 355 LYS B CD  1 
ATOM   2996 C  CE  . LYS B 2 112 ? 43.997 -12.398 -2.694  1.00 43.64 ? 355 LYS B CE  1 
ATOM   2997 N  NZ  . LYS B 2 112 ? 45.047 -12.316 -3.749  1.00 45.66 ? 355 LYS B NZ  1 
ATOM   2998 N  N   . SER B 2 113 ? 38.135 -10.497 -2.151  1.00 40.94 ? 356 SER B N   1 
ATOM   2999 C  CA  . SER B 2 113 ? 37.439 -9.238  -2.421  1.00 41.02 ? 356 SER B CA  1 
ATOM   3000 C  C   . SER B 2 113 ? 36.634 -8.739  -1.218  1.00 40.89 ? 356 SER B C   1 
ATOM   3001 O  O   . SER B 2 113 ? 36.865 -7.624  -0.711  1.00 41.82 ? 356 SER B O   1 
ATOM   3002 C  CB  . SER B 2 113 ? 36.496 -9.414  -3.610  1.00 40.75 ? 356 SER B CB  1 
ATOM   3003 O  OG  . SER B 2 113 ? 37.224 -9.653  -4.794  1.00 40.59 ? 356 SER B OG  1 
ATOM   3004 N  N   . THR B 2 114 ? 35.676 -9.560  -0.787  1.00 40.04 ? 357 THR B N   1 
ATOM   3005 C  CA  . THR B 2 114 ? 34.921 -9.312  0.427   1.00 39.08 ? 357 THR B CA  1 
ATOM   3006 C  C   . THR B 2 114 ? 35.832 -8.926  1.598   1.00 39.59 ? 357 THR B C   1 
ATOM   3007 O  O   . THR B 2 114 ? 35.593 -7.907  2.245   1.00 39.28 ? 357 THR B O   1 
ATOM   3008 C  CB  . THR B 2 114 ? 34.091 -10.547 0.815   1.00 39.00 ? 357 THR B CB  1 
ATOM   3009 O  OG1 . THR B 2 114 ? 33.327 -10.968 -0.322  1.00 36.91 ? 357 THR B OG1 1 
ATOM   3010 C  CG2 . THR B 2 114 ? 33.165 -10.225 1.976   1.00 38.41 ? 357 THR B CG2 1 
ATOM   3011 N  N   . LEU B 2 115 ? 36.875 -9.719  1.862   1.00 38.89 ? 358 LEU B N   1 
ATOM   3012 C  CA  . LEU B 2 115 ? 37.741 -9.450  3.018   1.00 39.55 ? 358 LEU B CA  1 
ATOM   3013 C  C   . LEU B 2 115 ? 38.580 -8.185  2.836   1.00 40.01 ? 358 LEU B C   1 
ATOM   3014 O  O   . LEU B 2 115 ? 38.938 -7.538  3.821   1.00 39.86 ? 358 LEU B O   1 
ATOM   3015 C  CB  . LEU B 2 115 ? 38.657 -10.652 3.364   1.00 39.65 ? 358 LEU B CB  1 
ATOM   3016 C  CG  . LEU B 2 115 ? 38.106 -12.007 3.862   1.00 40.36 ? 358 LEU B CG  1 
ATOM   3017 C  CD1 . LEU B 2 115 ? 39.227 -12.856 4.487   1.00 39.48 ? 358 LEU B CD1 1 
ATOM   3018 C  CD2 . LEU B 2 115 ? 36.911 -11.888 4.843   1.00 39.67 ? 358 LEU B CD2 1 
ATOM   3019 N  N   . ARG B 2 116 ? 38.893 -7.842  1.588   1.00 40.08 ? 359 ARG B N   1 
ATOM   3020 C  CA  . ARG B 2 116 ? 39.631 -6.619  1.280   1.00 41.56 ? 359 ARG B CA  1 
ATOM   3021 C  C   . ARG B 2 116 ? 38.784 -5.411  1.671   1.00 41.45 ? 359 ARG B C   1 
ATOM   3022 O  O   . ARG B 2 116 ? 39.217 -4.570  2.478   1.00 41.51 ? 359 ARG B O   1 
ATOM   3023 C  CB  . ARG B 2 116 ? 39.981 -6.545  -0.214  1.00 41.26 ? 359 ARG B CB  1 
ATOM   3024 C  CG  . ARG B 2 116 ? 40.779 -5.285  -0.608  1.00 42.43 ? 359 ARG B CG  1 
ATOM   3025 C  CD  . ARG B 2 116 ? 41.058 -5.215  -2.097  1.00 43.64 ? 359 ARG B CD  1 
ATOM   3026 N  NE  . ARG B 2 116 ? 41.705 -6.433  -2.595  1.00 48.89 ? 359 ARG B NE  1 
ATOM   3027 C  CZ  . ARG B 2 116 ? 43.017 -6.647  -2.616  1.00 50.62 ? 359 ARG B CZ  1 
ATOM   3028 N  NH1 . ARG B 2 116 ? 43.864 -5.726  -2.156  1.00 51.04 ? 359 ARG B NH1 1 
ATOM   3029 N  NH2 . ARG B 2 116 ? 43.484 -7.801  -3.090  1.00 52.49 ? 359 ARG B NH2 1 
ATOM   3030 N  N   . VAL B 2 117 ? 37.581 -5.356  1.089   1.00 41.16 ? 360 VAL B N   1 
ATOM   3031 C  CA  . VAL B 2 117 ? 36.561 -4.343  1.404   1.00 40.78 ? 360 VAL B CA  1 
ATOM   3032 C  C   . VAL B 2 117 ? 36.383 -4.161  2.908   1.00 41.27 ? 360 VAL B C   1 
ATOM   3033 O  O   . VAL B 2 117 ? 36.525 -3.042  3.416   1.00 41.35 ? 360 VAL B O   1 
ATOM   3034 C  CB  . VAL B 2 117 ? 35.195 -4.668  0.727   1.00 40.75 ? 360 VAL B CB  1 
ATOM   3035 C  CG1 . VAL B 2 117 ? 34.066 -3.819  1.326   1.00 39.83 ? 360 VAL B CG1 1 
ATOM   3036 C  CG2 . VAL B 2 117 ? 35.279 -4.437  -0.778  1.00 40.23 ? 360 VAL B CG2 1 
ATOM   3037 N  N   . LEU B 2 118 ? 36.104 -5.258  3.617   1.00 41.18 ? 361 LEU B N   1 
ATOM   3038 C  CA  . LEU B 2 118 ? 35.907 -5.214  5.066   1.00 41.39 ? 361 LEU B CA  1 
ATOM   3039 C  C   . LEU B 2 118 ? 37.166 -4.784  5.813   1.00 42.16 ? 361 LEU B C   1 
ATOM   3040 O  O   . LEU B 2 118 ? 37.078 -4.108  6.839   1.00 42.28 ? 361 LEU B O   1 
ATOM   3041 C  CB  . LEU B 2 118 ? 35.385 -6.556  5.605   1.00 40.75 ? 361 LEU B CB  1 
ATOM   3042 C  CG  . LEU B 2 118 ? 34.028 -7.068  5.098   1.00 40.27 ? 361 LEU B CG  1 
ATOM   3043 C  CD1 . LEU B 2 118 ? 33.699 -8.422  5.704   1.00 38.79 ? 361 LEU B CD1 1 
ATOM   3044 C  CD2 . LEU B 2 118 ? 32.880 -6.059  5.393   1.00 39.82 ? 361 LEU B CD2 1 
ATOM   3045 N  N   . TYR B 2 119 ? 38.325 -5.185  5.293   1.00 42.94 ? 362 TYR B N   1 
ATOM   3046 C  CA  . TYR B 2 119 ? 39.611 -4.842  5.884   1.00 44.30 ? 362 TYR B CA  1 
ATOM   3047 C  C   . TYR B 2 119 ? 39.902 -3.361  5.655   1.00 43.99 ? 362 TYR B C   1 
ATOM   3048 O  O   . TYR B 2 119 ? 40.415 -2.669  6.552   1.00 44.80 ? 362 TYR B O   1 
ATOM   3049 C  CB  . TYR B 2 119 ? 40.714 -5.731  5.286   1.00 45.13 ? 362 TYR B CB  1 
ATOM   3050 C  CG  . TYR B 2 119 ? 42.134 -5.360  5.651   1.00 46.96 ? 362 TYR B CG  1 
ATOM   3051 C  CD1 . TYR B 2 119 ? 42.962 -4.699  4.730   1.00 48.25 ? 362 TYR B CD1 1 
ATOM   3052 C  CD2 . TYR B 2 119 ? 42.662 -5.681  6.905   1.00 48.15 ? 362 TYR B CD2 1 
ATOM   3053 C  CE1 . TYR B 2 119 ? 44.276 -4.354  5.057   1.00 49.07 ? 362 TYR B CE1 1 
ATOM   3054 C  CE2 . TYR B 2 119 ? 43.980 -5.344  7.247   1.00 49.32 ? 362 TYR B CE2 1 
ATOM   3055 C  CZ  . TYR B 2 119 ? 44.780 -4.687  6.315   1.00 48.96 ? 362 TYR B CZ  1 
ATOM   3056 O  OH  . TYR B 2 119 ? 46.076 -4.348  6.645   1.00 49.53 ? 362 TYR B OH  1 
ATOM   3057 N  N   . ASN B 2 120 ? 39.570 -2.884  4.461   1.00 43.68 ? 363 ASN B N   1 
ATOM   3058 C  CA  . ASN B 2 120 ? 39.680 -1.455  4.134   1.00 44.20 ? 363 ASN B CA  1 
ATOM   3059 C  C   . ASN B 2 120 ? 38.710 -0.564  4.918   1.00 43.90 ? 363 ASN B C   1 
ATOM   3060 O  O   . ASN B 2 120 ? 39.013 0.610   5.200   1.00 44.22 ? 363 ASN B O   1 
ATOM   3061 C  CB  . ASN B 2 120 ? 39.561 -1.230  2.637   1.00 43.79 ? 363 ASN B CB  1 
ATOM   3062 C  CG  . ASN B 2 120 ? 40.875 -1.436  1.925   1.00 44.63 ? 363 ASN B CG  1 
ATOM   3063 O  OD1 . ASN B 2 120 ? 40.960 -1.285  0.705   1.00 44.87 ? 363 ASN B OD1 1 
ATOM   3064 N  ND2 . ASN B 2 120 ? 41.924 -1.766  2.690   1.00 43.79 ? 363 ASN B ND2 1 
ATOM   3065 N  N   . LEU B 2 121 ? 37.566 -1.137  5.285   1.00 43.43 ? 364 LEU B N   1 
ATOM   3066 C  CA  . LEU B 2 121 ? 36.702 -0.535  6.291   1.00 43.07 ? 364 LEU B CA  1 
ATOM   3067 C  C   . LEU B 2 121 ? 37.402 -0.549  7.652   1.00 43.94 ? 364 LEU B C   1 
ATOM   3068 O  O   . LEU B 2 121 ? 37.495 0.496   8.319   1.00 43.36 ? 364 LEU B O   1 
ATOM   3069 C  CB  . LEU B 2 121 ? 35.328 -1.231  6.342   1.00 42.33 ? 364 LEU B CB  1 
ATOM   3070 C  CG  . LEU B 2 121 ? 34.475 -1.111  5.064   1.00 40.74 ? 364 LEU B CG  1 
ATOM   3071 C  CD1 . LEU B 2 121 ? 33.078 -1.730  5.238   1.00 36.63 ? 364 LEU B CD1 1 
ATOM   3072 C  CD2 . LEU B 2 121 ? 34.378 0.349   4.562   1.00 38.74 ? 364 LEU B CD2 1 
ATOM   3073 N  N   . PHE B 2 122 ? 37.925 -1.720  8.040   1.00 44.75 ? 365 PHE B N   1 
ATOM   3074 C  CA  . PHE B 2 122 ? 38.538 -1.894  9.356   1.00 45.55 ? 365 PHE B CA  1 
ATOM   3075 C  C   . PHE B 2 122 ? 39.666 -0.905  9.620   1.00 45.62 ? 365 PHE B C   1 
ATOM   3076 O  O   . PHE B 2 122 ? 39.696 -0.308  10.685  1.00 45.84 ? 365 PHE B O   1 
ATOM   3077 C  CB  . PHE B 2 122 ? 39.019 -3.337  9.585   1.00 45.95 ? 365 PHE B CB  1 
ATOM   3078 C  CG  . PHE B 2 122 ? 39.718 -3.540  10.913  1.00 46.84 ? 365 PHE B CG  1 
ATOM   3079 C  CD1 . PHE B 2 122 ? 41.116 -3.457  11.006  1.00 47.57 ? 365 PHE B CD1 1 
ATOM   3080 C  CD2 . PHE B 2 122 ? 38.983 -3.791  12.070  1.00 46.99 ? 365 PHE B CD2 1 
ATOM   3081 C  CE1 . PHE B 2 122 ? 41.766 -3.627  12.234  1.00 48.38 ? 365 PHE B CE1 1 
ATOM   3082 C  CE2 . PHE B 2 122 ? 39.627 -3.968  13.308  1.00 47.64 ? 365 PHE B CE2 1 
ATOM   3083 C  CZ  . PHE B 2 122 ? 41.014 -3.887  13.388  1.00 47.43 ? 365 PHE B CZ  1 
ATOM   3084 N  N   . THR B 2 123 ? 40.572 -0.730  8.653   1.00 46.61 ? 366 THR B N   1 
ATOM   3085 C  CA  . THR B 2 123 ? 41.700 0.211   8.771   1.00 47.45 ? 366 THR B CA  1 
ATOM   3086 C  C   . THR B 2 123 ? 41.199 1.627   9.042   1.00 47.81 ? 366 THR B C   1 
ATOM   3087 O  O   . THR B 2 123 ? 41.816 2.381   9.813   1.00 47.63 ? 366 THR B O   1 
ATOM   3088 C  CB  . THR B 2 123 ? 42.567 0.277   7.479   1.00 47.64 ? 366 THR B CB  1 
ATOM   3089 O  OG1 . THR B 2 123 ? 42.862 -1.042  6.999   1.00 49.69 ? 366 THR B OG1 1 
ATOM   3090 C  CG2 . THR B 2 123 ? 43.890 1.036   7.737   1.00 48.04 ? 366 THR B CG2 1 
ATOM   3091 N  N   . LYS B 2 124 ? 40.090 1.978   8.385   1.00 47.98 ? 367 LYS B N   1 
ATOM   3092 C  CA  . LYS B 2 124 ? 39.473 3.293   8.515   1.00 47.71 ? 367 LYS B CA  1 
ATOM   3093 C  C   . LYS B 2 124 ? 38.702 3.421   9.821   1.00 47.92 ? 367 LYS B C   1 
ATOM   3094 O  O   . LYS B 2 124 ? 38.955 4.333   10.618  1.00 48.09 ? 367 LYS B O   1 
ATOM   3095 C  CB  . LYS B 2 124 ? 38.551 3.571   7.319   1.00 47.54 ? 367 LYS B CB  1 
ATOM   3096 C  CG  . LYS B 2 124 ? 38.185 5.047   7.150   1.00 45.14 ? 367 LYS B CG  1 
ATOM   3097 C  CD  . LYS B 2 124 ? 37.581 5.329   5.788   1.00 42.58 ? 367 LYS B CD  1 
ATOM   3098 C  CE  . LYS B 2 124 ? 36.926 6.689   5.743   1.00 40.71 ? 367 LYS B CE  1 
ATOM   3099 N  NZ  . LYS B 2 124 ? 37.903 7.805   5.710   1.00 38.15 ? 367 LYS B NZ  1 
ATOM   3100 N  N   . TYR B 2 125 ? 37.788 2.489   10.054  1.00 48.35 ? 368 TYR B N   1 
ATOM   3101 C  CA  . TYR B 2 125 ? 36.775 2.667   11.086  1.00 49.36 ? 368 TYR B CA  1 
ATOM   3102 C  C   . TYR B 2 125 ? 37.070 1.941   12.405  1.00 50.98 ? 368 TYR B C   1 
ATOM   3103 O  O   . TYR B 2 125 ? 36.193 1.809   13.258  1.00 51.02 ? 368 TYR B O   1 
ATOM   3104 C  CB  . TYR B 2 125 ? 35.370 2.357   10.523  1.00 47.76 ? 368 TYR B CB  1 
ATOM   3105 C  CG  . TYR B 2 125 ? 34.962 3.262   9.357   1.00 46.42 ? 368 TYR B CG  1 
ATOM   3106 C  CD1 . TYR B 2 125 ? 34.981 2.792   8.043   1.00 44.08 ? 368 TYR B CD1 1 
ATOM   3107 C  CD2 . TYR B 2 125 ? 34.580 4.599   9.572   1.00 45.55 ? 368 TYR B CD2 1 
ATOM   3108 C  CE1 . TYR B 2 125 ? 34.623 3.606   6.973   1.00 43.59 ? 368 TYR B CE1 1 
ATOM   3109 C  CE2 . TYR B 2 125 ? 34.215 5.433   8.498   1.00 44.37 ? 368 TYR B CE2 1 
ATOM   3110 C  CZ  . TYR B 2 125 ? 34.235 4.924   7.202   1.00 43.91 ? 368 TYR B CZ  1 
ATOM   3111 O  OH  . TYR B 2 125 ? 33.881 5.721   6.131   1.00 43.20 ? 368 TYR B OH  1 
ATOM   3112 N  N   . ARG B 2 126 ? 38.323 1.511   12.571  1.00 53.33 ? 369 ARG B N   1 
ATOM   3113 C  CA  . ARG B 2 126 ? 38.817 0.872   13.801  1.00 55.63 ? 369 ARG B CA  1 
ATOM   3114 C  C   . ARG B 2 126 ? 38.257 1.467   15.099  1.00 56.54 ? 369 ARG B C   1 
ATOM   3115 O  O   . ARG B 2 126 ? 37.497 0.810   15.824  1.00 56.67 ? 369 ARG B O   1 
ATOM   3116 C  CB  . ARG B 2 126 ? 40.351 0.941   13.851  1.00 55.47 ? 369 ARG B CB  1 
ATOM   3117 C  CG  . ARG B 2 126 ? 41.067 -0.187  13.131  1.00 56.62 ? 369 ARG B CG  1 
ATOM   3118 C  CD  . ARG B 2 126 ? 42.536 -0.346  13.572  1.00 57.23 ? 369 ARG B CD  1 
ATOM   3119 N  NE  . ARG B 2 126 ? 42.745 -0.038  14.992  1.00 61.50 ? 369 ARG B NE  1 
ATOM   3120 C  CZ  . ARG B 2 126 ? 42.288 -0.760  16.019  1.00 62.92 ? 369 ARG B CZ  1 
ATOM   3121 N  NH1 . ARG B 2 126 ? 41.572 -1.862  15.820  1.00 62.83 ? 369 ARG B NH1 1 
ATOM   3122 N  NH2 . ARG B 2 126 ? 42.542 -0.360  17.261  1.00 64.23 ? 369 ARG B NH2 1 
ATOM   3123 N  N   . ASN B 2 127 ? 38.634 2.715   15.370  1.00 57.80 ? 370 ASN B N   1 
ATOM   3124 C  CA  . ASN B 2 127 ? 38.326 3.375   16.643  1.00 59.22 ? 370 ASN B CA  1 
ATOM   3125 C  C   . ASN B 2 127 ? 36.867 3.838   16.814  1.00 59.79 ? 370 ASN B C   1 
ATOM   3126 O  O   . ASN B 2 127 ? 36.478 4.296   17.897  1.00 59.85 ? 370 ASN B O   1 
ATOM   3127 C  CB  . ASN B 2 127 ? 39.298 4.540   16.874  1.00 59.52 ? 370 ASN B CB  1 
ATOM   3128 C  CG  . ASN B 2 127 ? 40.760 4.108   16.815  1.00 59.96 ? 370 ASN B CG  1 
ATOM   3129 O  OD1 . ASN B 2 127 ? 41.069 2.933   16.609  1.00 59.86 ? 370 ASN B OD1 1 
ATOM   3130 N  ND2 . ASN B 2 127 ? 41.667 5.066   16.996  1.00 61.14 ? 370 ASN B ND2 1 
ATOM   3131 N  N   . VAL B 2 128 ? 36.070 3.709   15.751  1.00 60.41 ? 371 VAL B N   1 
ATOM   3132 C  CA  . VAL B 2 128 ? 34.646 4.056   15.789  1.00 61.08 ? 371 VAL B CA  1 
ATOM   3133 C  C   . VAL B 2 128 ? 33.887 3.116   16.736  1.00 61.72 ? 371 VAL B C   1 
ATOM   3134 O  O   . VAL B 2 128 ? 34.109 1.906   16.729  1.00 61.80 ? 371 VAL B O   1 
ATOM   3135 C  CB  . VAL B 2 128 ? 34.009 4.042   14.361  1.00 60.85 ? 371 VAL B CB  1 
ATOM   3136 C  CG1 . VAL B 2 128 ? 32.525 4.369   14.415  1.00 60.57 ? 371 VAL B CG1 1 
ATOM   3137 C  CG2 . VAL B 2 128 ? 34.736 5.005   13.428  1.00 60.27 ? 371 VAL B CG2 1 
ATOM   3138 N  N   . GLU B 2 129 ? 33.006 3.687   17.556  1.00 62.84 ? 372 GLU B N   1 
ATOM   3139 C  CA  . GLU B 2 129 ? 32.209 2.913   18.519  1.00 63.76 ? 372 GLU B CA  1 
ATOM   3140 C  C   . GLU B 2 129 ? 30.765 2.656   18.069  1.00 64.01 ? 372 GLU B C   1 
ATOM   3141 O  O   . GLU B 2 129 ? 30.103 1.746   18.583  1.00 64.27 ? 372 GLU B O   1 
ATOM   3142 C  CB  . GLU B 2 129 ? 32.224 3.582   19.903  1.00 63.96 ? 372 GLU B CB  1 
ATOM   3143 C  CG  . GLU B 2 129 ? 33.585 3.518   20.615  1.00 64.95 ? 372 GLU B CG  1 
ATOM   3144 C  CD  . GLU B 2 129 ? 34.155 2.105   20.691  1.00 65.89 ? 372 GLU B CD  1 
ATOM   3145 O  OE1 . GLU B 2 129 ? 33.397 1.171   21.046  1.00 65.88 ? 372 GLU B OE1 1 
ATOM   3146 O  OE2 . GLU B 2 129 ? 35.359 1.932   20.391  1.00 66.29 ? 372 GLU B OE2 1 
ATOM   3147 O  OXT . GLU B 2 129 ? 30.225 3.340   17.190  1.00 64.22 ? 372 GLU B OXT 1 
HETATM 3148 O  O   . HOH C 3 .   ? 7.737  25.095  0.793   1.00 15.00 ? 1   HOH A O   1 
HETATM 3149 O  O   . HOH C 3 .   ? 27.047 26.760  -9.319  1.00 15.57 ? 2   HOH A O   1 
HETATM 3150 O  O   . HOH C 3 .   ? 26.474 15.131  -12.855 1.00 17.84 ? 3   HOH A O   1 
HETATM 3151 O  O   . HOH C 3 .   ? 11.536 36.169  5.111   1.00 14.41 ? 4   HOH A O   1 
HETATM 3152 O  O   . HOH C 3 .   ? 19.560 17.617  -13.412 1.00 23.07 ? 5   HOH A O   1 
HETATM 3153 O  O   . HOH C 3 .   ? 24.292 31.608  12.144  1.00 24.84 ? 6   HOH A O   1 
HETATM 3154 O  O   . HOH C 3 .   ? 10.088 17.899  7.812   1.00 13.26 ? 7   HOH A O   1 
HETATM 3155 O  O   . HOH C 3 .   ? 0.183  22.231  6.463   1.00 14.71 ? 8   HOH A O   1 
HETATM 3156 O  O   . HOH C 3 .   ? 8.955  14.136  8.071   1.00 20.02 ? 9   HOH A O   1 
HETATM 3157 O  O   . HOH C 3 .   ? 16.519 24.084  27.047  1.00 22.72 ? 10  HOH A O   1 
HETATM 3158 O  O   . HOH C 3 .   ? -0.423 26.665  4.640   1.00 12.52 ? 11  HOH A O   1 
HETATM 3159 O  O   . HOH C 3 .   ? 27.297 17.800  -16.672 1.00 15.00 ? 12  HOH A O   1 
HETATM 3160 O  O   . HOH C 3 .   ? -0.861 25.036  6.755   1.00 14.51 ? 13  HOH A O   1 
HETATM 3161 O  O   . HOH C 3 .   ? 18.307 11.843  14.568  1.00 14.67 ? 14  HOH A O   1 
HETATM 3162 O  O   . HOH C 3 .   ? 12.478 16.131  9.530   1.00 16.67 ? 15  HOH A O   1 
HETATM 3163 O  O   . HOH C 3 .   ? 20.281 14.766  6.050   1.00 20.94 ? 16  HOH A O   1 
HETATM 3164 O  O   . HOH C 3 .   ? 21.820 17.874  -9.070  1.00 20.22 ? 17  HOH A O   1 
HETATM 3165 O  O   . HOH C 3 .   ? 20.669 10.387  18.277  1.00 21.91 ? 18  HOH A O   1 
HETATM 3166 O  O   . HOH C 3 .   ? 7.370  30.382  31.293  1.00 21.29 ? 19  HOH A O   1 
HETATM 3167 O  O   . HOH C 3 .   ? 9.200  8.079   16.216  1.00 20.32 ? 20  HOH A O   1 
HETATM 3168 O  O   . HOH C 3 .   ? 18.971 18.639  26.053  1.00 19.81 ? 21  HOH A O   1 
HETATM 3169 O  O   . HOH C 3 .   ? 13.657 28.816  32.357  1.00 20.10 ? 22  HOH A O   1 
HETATM 3170 O  O   . HOH C 3 .   ? 14.621 20.861  -7.277  1.00 21.41 ? 23  HOH A O   1 
HETATM 3171 O  O   . HOH C 3 .   ? 11.118 23.617  -6.933  1.00 20.72 ? 24  HOH A O   1 
HETATM 3172 O  O   . HOH C 3 .   ? -2.586 28.411  4.815   1.00 19.31 ? 25  HOH A O   1 
HETATM 3173 O  O   . HOH C 3 .   ? 15.250 15.659  9.852   1.00 16.67 ? 26  HOH A O   1 
HETATM 3174 O  O   . HOH C 3 .   ? 10.177 10.192  14.759  1.00 21.75 ? 27  HOH A O   1 
HETATM 3175 O  O   . HOH C 3 .   ? 26.496 15.133  -15.502 1.00 19.09 ? 28  HOH A O   1 
HETATM 3176 O  O   . HOH C 3 .   ? 18.622 12.047  17.374  1.00 18.17 ? 29  HOH A O   1 
HETATM 3177 O  O   . HOH C 3 .   ? 11.396 15.391  7.169   1.00 17.43 ? 30  HOH A O   1 
HETATM 3178 O  O   . HOH C 3 .   ? 14.762 24.901  -4.469  1.00 19.93 ? 31  HOH A O   1 
HETATM 3179 O  O   . HOH C 3 .   ? 8.525  20.395  -4.399  1.00 25.03 ? 32  HOH A O   1 
HETATM 3180 O  O   . HOH C 3 .   ? 30.273 38.651  11.059  1.00 21.77 ? 33  HOH A O   1 
HETATM 3181 O  O   . HOH C 3 .   ? 30.457 23.458  -19.336 1.00 22.20 ? 36  HOH A O   1 
HETATM 3182 O  O   . HOH C 3 .   ? 27.997 40.262  -5.087  1.00 29.79 ? 37  HOH A O   1 
HETATM 3183 O  O   . HOH C 3 .   ? 19.241 15.012  25.366  1.00 25.99 ? 38  HOH A O   1 
HETATM 3184 O  O   . HOH C 3 .   ? 1.720  10.346  3.027   1.00 23.76 ? 39  HOH A O   1 
HETATM 3185 O  O   . HOH C 3 .   ? 4.877  23.476  26.496  1.00 27.46 ? 41  HOH A O   1 
HETATM 3186 O  O   . HOH C 3 .   ? 1.861  31.936  8.444   1.00 26.10 ? 42  HOH A O   1 
HETATM 3187 O  O   . HOH C 3 .   ? 17.733 26.739  26.925  1.00 22.81 ? 43  HOH A O   1 
HETATM 3188 O  O   . HOH C 3 .   ? 23.588 29.437  -7.121  1.00 19.65 ? 44  HOH A O   1 
HETATM 3189 O  O   . HOH C 3 .   ? 22.186 23.876  12.432  1.00 23.04 ? 45  HOH A O   1 
HETATM 3190 O  O   . HOH C 3 .   ? 28.051 33.869  -8.004  1.00 24.36 ? 46  HOH A O   1 
HETATM 3191 O  O   . HOH C 3 .   ? 11.331 11.462  28.114  1.00 50.55 ? 47  HOH A O   1 
HETATM 3192 O  O   . HOH C 3 .   ? 11.569 9.217   12.836  1.00 21.95 ? 48  HOH A O   1 
HETATM 3193 O  O   . HOH C 3 .   ? 30.961 18.728  -16.033 1.00 25.62 ? 49  HOH A O   1 
HETATM 3194 O  O   . HOH C 3 .   ? -1.113 24.597  2.717   1.00 20.36 ? 50  HOH A O   1 
HETATM 3195 O  O   . HOH C 3 .   ? 22.157 31.838  10.224  1.00 23.46 ? 51  HOH A O   1 
HETATM 3196 O  O   . HOH C 3 .   ? 2.777  11.923  4.810   1.00 19.60 ? 53  HOH A O   1 
HETATM 3197 O  O   . HOH C 3 .   ? 14.809 24.557  6.841   1.00 36.74 ? 54  HOH A O   1 
HETATM 3198 O  O   . HOH C 3 .   ? 17.519 22.247  -12.489 1.00 22.65 ? 55  HOH A O   1 
HETATM 3199 O  O   . HOH C 3 .   ? 3.287  16.529  -1.305  1.00 31.21 ? 57  HOH A O   1 
HETATM 3200 O  O   . HOH C 3 .   ? 10.736 37.194  -1.062  1.00 23.10 ? 58  HOH A O   1 
HETATM 3201 O  O   . HOH C 3 .   ? 22.930 31.923  -7.744  1.00 33.84 ? 59  HOH A O   1 
HETATM 3202 O  O   . HOH C 3 .   ? 14.070 9.827   23.325  1.00 26.63 ? 60  HOH A O   1 
HETATM 3203 O  O   . HOH C 3 .   ? 18.779 30.712  5.789   1.00 17.28 ? 61  HOH A O   1 
HETATM 3204 O  O   . HOH C 3 .   ? 21.274 29.388  8.676   1.00 34.45 ? 62  HOH A O   1 
HETATM 3205 O  O   . HOH C 3 .   ? 12.043 38.056  11.619  1.00 24.70 ? 63  HOH A O   1 
HETATM 3206 O  O   . HOH C 3 .   ? 13.809 23.586  -6.771  1.00 23.00 ? 64  HOH A O   1 
HETATM 3207 O  O   . HOH C 3 .   ? 39.567 30.153  10.783  1.00 24.42 ? 66  HOH A O   1 
HETATM 3208 O  O   . HOH C 3 .   ? 15.324 34.677  -5.787  1.00 24.40 ? 67  HOH A O   1 
HETATM 3209 O  O   . HOH C 3 .   ? 17.377 16.708  -14.623 1.00 47.02 ? 69  HOH A O   1 
HETATM 3210 O  O   . HOH C 3 .   ? 22.217 14.969  18.630  1.00 21.95 ? 71  HOH A O   1 
HETATM 3211 O  O   . HOH C 3 .   ? -1.737 30.492  6.405   1.00 25.51 ? 74  HOH A O   1 
HETATM 3212 O  O   . HOH C 3 .   ? -0.387 33.918  12.518  1.00 33.49 ? 75  HOH A O   1 
HETATM 3213 O  O   . HOH C 3 .   ? 10.513 31.115  -3.168  1.00 30.99 ? 76  HOH A O   1 
HETATM 3214 O  O   . HOH C 3 .   ? 1.452  18.071  0.638   1.00 36.56 ? 77  HOH A O   1 
HETATM 3215 O  O   . HOH C 3 .   ? 13.189 32.253  28.448  1.00 23.08 ? 79  HOH A O   1 
HETATM 3216 O  O   . HOH C 3 .   ? -5.084 26.271  22.647  1.00 27.10 ? 80  HOH A O   1 
HETATM 3217 O  O   . HOH C 3 .   ? 4.356  32.388  25.066  1.00 26.29 ? 81  HOH A O   1 
HETATM 3218 O  O   . HOH C 3 .   ? -1.727 24.201  27.639  1.00 39.11 ? 82  HOH A O   1 
HETATM 3219 O  O   . HOH C 3 .   ? -2.504 15.970  7.175   1.00 25.76 ? 83  HOH A O   1 
HETATM 3220 O  O   . HOH C 3 .   ? 22.710 29.878  21.808  1.00 27.84 ? 84  HOH A O   1 
HETATM 3221 O  O   . HOH C 3 .   ? 12.933 14.290  5.270   1.00 25.64 ? 85  HOH A O   1 
HETATM 3222 O  O   . HOH C 3 .   ? 22.217 23.099  2.026   1.00 31.17 ? 87  HOH A O   1 
HETATM 3223 O  O   . HOH C 3 .   ? -5.821 17.867  8.035   1.00 39.37 ? 89  HOH A O   1 
HETATM 3224 O  O   . HOH C 3 .   ? 34.806 28.619  15.749  1.00 31.49 ? 90  HOH A O   1 
HETATM 3225 O  O   . HOH C 3 .   ? 39.052 25.675  4.200   1.00 22.35 ? 91  HOH A O   1 
HETATM 3226 O  O   . HOH C 3 .   ? 22.112 34.155  -5.598  1.00 31.45 ? 92  HOH A O   1 
HETATM 3227 O  O   . HOH C 3 .   ? 26.472 14.510  -5.680  1.00 32.20 ? 93  HOH A O   1 
HETATM 3228 O  O   . HOH C 3 .   ? 19.562 35.824  5.763   1.00 22.83 ? 94  HOH A O   1 
HETATM 3229 O  O   . HOH C 3 .   ? -4.709 13.828  14.498  1.00 47.13 ? 95  HOH A O   1 
HETATM 3230 O  O   . HOH C 3 .   ? 20.364 14.257  16.864  1.00 22.42 ? 96  HOH A O   1 
HETATM 3231 O  O   . HOH C 3 .   ? 4.315  29.991  -4.769  1.00 26.64 ? 97  HOH A O   1 
HETATM 3232 O  O   . HOH C 3 .   ? 37.195 19.021  12.002  1.00 26.37 ? 98  HOH A O   1 
HETATM 3233 O  O   . HOH C 3 .   ? -2.889 34.217  12.879  1.00 37.74 ? 99  HOH A O   1 
HETATM 3234 O  O   . HOH C 3 .   ? 23.548 45.616  7.126   1.00 30.09 ? 100 HOH A O   1 
HETATM 3235 O  O   . HOH C 3 .   ? 14.624 28.852  -9.663  1.00 35.41 ? 101 HOH A O   1 
HETATM 3236 O  O   . HOH C 3 .   ? 10.301 33.245  19.859  1.00 29.93 ? 102 HOH A O   1 
HETATM 3237 O  O   . HOH C 3 .   ? 19.989 32.756  -6.321  1.00 30.90 ? 103 HOH A O   1 
HETATM 3238 O  O   . HOH C 3 .   ? 22.880 23.372  15.121  1.00 21.38 ? 104 HOH A O   1 
HETATM 3239 O  O   . HOH C 3 .   ? 23.980 42.196  9.570   1.00 36.39 ? 106 HOH A O   1 
HETATM 3240 O  O   . HOH C 3 .   ? 12.828 31.483  33.585  1.00 29.73 ? 107 HOH A O   1 
HETATM 3241 O  O   . HOH C 3 .   ? 30.629 20.164  -18.809 1.00 28.09 ? 108 HOH A O   1 
HETATM 3242 O  O   . HOH C 3 .   ? 36.389 26.916  1.650   1.00 46.69 ? 109 HOH A O   1 
HETATM 3243 O  O   . HOH C 3 .   ? 16.719 19.438  4.147   1.00 34.00 ? 110 HOH A O   1 
HETATM 3244 O  O   . HOH C 3 .   ? 9.963  21.160  -7.100  1.00 40.28 ? 111 HOH A O   1 
HETATM 3245 O  O   . HOH C 3 .   ? 35.107 14.700  -6.771  1.00 34.14 ? 112 HOH A O   1 
HETATM 3246 O  O   . HOH C 3 .   ? 17.557 14.058  8.062   1.00 30.23 ? 113 HOH A O   1 
HETATM 3247 O  O   . HOH C 3 .   ? 5.141  4.371   7.808   1.00 37.39 ? 114 HOH A O   1 
HETATM 3248 O  O   . HOH C 3 .   ? 13.064 38.121  6.158   1.00 38.86 ? 116 HOH A O   1 
HETATM 3249 O  O   . HOH C 3 .   ? 29.090 22.379  7.933   1.00 39.12 ? 117 HOH A O   1 
HETATM 3250 O  O   . HOH C 3 .   ? 8.481  30.064  -4.241  1.00 39.10 ? 118 HOH A O   1 
HETATM 3251 O  O   . HOH C 3 .   ? 27.484 12.032  -9.231  1.00 37.51 ? 119 HOH A O   1 
HETATM 3252 O  O   . HOH C 3 .   ? 23.722 25.683  12.089  1.00 36.54 ? 120 HOH A O   1 
HETATM 3253 O  O   . HOH C 3 .   ? 24.614 8.699   14.565  1.00 27.55 ? 122 HOH A O   1 
HETATM 3254 O  O   . HOH C 3 .   ? 38.308 37.076  3.253   1.00 40.67 ? 124 HOH A O   1 
HETATM 3255 O  O   . HOH C 3 .   ? 14.592 32.495  30.446  1.00 39.06 ? 125 HOH A O   1 
HETATM 3256 O  O   . HOH C 3 .   ? 22.888 1.879   21.126  1.00 42.66 ? 126 HOH A O   1 
HETATM 3257 O  O   . HOH C 3 .   ? 31.262 43.206  0.638   1.00 29.29 ? 127 HOH A O   1 
HETATM 3258 O  O   . HOH C 3 .   ? 9.558  19.776  0.982   1.00 38.31 ? 128 HOH A O   1 
HETATM 3259 O  O   . HOH C 3 .   ? 17.066 20.610  7.385   1.00 41.24 ? 129 HOH A O   1 
HETATM 3260 O  O   . HOH C 3 .   ? 11.544 27.305  32.583  1.00 15.23 ? 130 HOH A O   1 
HETATM 3261 O  O   . HOH C 3 .   ? 22.981 27.344  8.576   1.00 34.18 ? 131 HOH A O   1 
HETATM 3262 O  O   . HOH C 3 .   ? 0.673  31.506  5.835   1.00 24.19 ? 132 HOH A O   1 
HETATM 3263 O  O   . HOH C 3 .   ? 21.910 36.763  -5.813  1.00 40.09 ? 133 HOH A O   1 
HETATM 3264 O  O   . HOH C 3 .   ? 4.025  21.211  -4.158  1.00 33.66 ? 135 HOH A O   1 
HETATM 3265 O  O   . HOH C 3 .   ? 8.192  5.183   -2.621  1.00 31.00 ? 136 HOH A O   1 
HETATM 3266 O  O   . HOH C 3 .   ? 21.689 21.003  4.722   1.00 32.21 ? 137 HOH A O   1 
HETATM 3267 O  O   . HOH C 3 .   ? 3.221  6.660   8.470   1.00 34.76 ? 139 HOH A O   1 
HETATM 3268 O  O   . HOH C 3 .   ? 33.595 28.225  -2.453  1.00 39.13 ? 142 HOH A O   1 
HETATM 3269 O  O   . HOH C 3 .   ? 15.528 22.920  -2.448  1.00 27.11 ? 143 HOH A O   1 
HETATM 3270 O  O   . HOH C 3 .   ? 8.805  20.657  3.381   1.00 34.39 ? 144 HOH A O   1 
HETATM 3271 O  O   . HOH C 3 .   ? 36.427 35.802  -0.452  1.00 38.42 ? 145 HOH A O   1 
HETATM 3272 O  O   . HOH C 3 .   ? 20.934 31.394  -8.510  1.00 41.59 ? 146 HOH A O   1 
HETATM 3273 O  O   . HOH C 3 .   ? 17.917 18.478  14.792  1.00 24.67 ? 147 HOH A O   1 
HETATM 3274 O  O   . HOH C 3 .   ? 28.034 28.223  -12.285 1.00 31.90 ? 148 HOH A O   1 
HETATM 3275 O  O   . HOH C 3 .   ? 1.956  23.804  -3.344  1.00 40.07 ? 149 HOH A O   1 
HETATM 3276 O  O   . HOH C 3 .   ? 11.155 16.915  -1.387  1.00 39.14 ? 150 HOH A O   1 
HETATM 3277 O  O   . HOH C 3 .   ? 30.474 32.997  -8.099  1.00 31.74 ? 152 HOH A O   1 
HETATM 3278 O  O   . HOH C 3 .   ? 20.098 28.544  25.541  1.00 34.64 ? 153 HOH A O   1 
HETATM 3279 O  O   . HOH C 3 .   ? 24.972 30.915  14.345  1.00 41.48 ? 154 HOH A O   1 
HETATM 3280 O  O   . HOH C 3 .   ? 7.881  36.694  14.697  1.00 36.85 ? 155 HOH A O   1 
HETATM 3281 O  O   . HOH C 3 .   ? 15.700 21.297  5.530   1.00 32.99 ? 156 HOH A O   1 
HETATM 3282 O  O   . HOH C 3 .   ? 32.590 22.220  -17.922 1.00 38.36 ? 158 HOH A O   1 
HETATM 3283 O  O   . HOH C 3 .   ? 20.143 26.186  28.401  1.00 31.33 ? 159 HOH A O   1 
HETATM 3284 O  O   . HOH C 3 .   ? 33.290 21.236  13.200  1.00 34.62 ? 160 HOH A O   1 
HETATM 3285 O  O   . HOH C 3 .   ? 9.693  10.892  1.576   1.00 36.10 ? 161 HOH A O   1 
HETATM 3286 O  O   . HOH C 3 .   ? 17.210 11.849  24.833  1.00 37.96 ? 162 HOH A O   1 
HETATM 3287 O  O   . HOH C 3 .   ? -1.778 13.150  4.210   1.00 29.92 ? 163 HOH A O   1 
HETATM 3288 O  O   . HOH C 3 .   ? 22.995 39.068  11.299  1.00 32.33 ? 164 HOH A O   1 
HETATM 3289 O  O   . HOH C 3 .   ? 3.995  37.204  2.987   1.00 41.64 ? 165 HOH A O   1 
HETATM 3290 O  O   . HOH C 3 .   ? 0.050  19.677  7.142   1.00 35.33 ? 166 HOH A O   1 
HETATM 3291 O  O   . HOH C 3 .   ? 10.717 32.883  33.438  1.00 42.04 ? 167 HOH A O   1 
HETATM 3292 O  O   . HOH C 3 .   ? 31.190 22.422  -12.836 1.00 44.73 ? 168 HOH A O   1 
HETATM 3293 O  O   . HOH C 3 .   ? -8.289 27.467  17.733  1.00 43.98 ? 169 HOH A O   1 
HETATM 3294 O  O   . HOH C 3 .   ? 5.516  34.771  14.761  1.00 38.77 ? 171 HOH A O   1 
HETATM 3295 O  O   . HOH C 3 .   ? 13.924 38.134  13.582  1.00 33.02 ? 172 HOH A O   1 
HETATM 3296 O  O   . HOH C 3 .   ? -1.163 9.747   18.156  1.00 44.70 ? 173 HOH A O   1 
HETATM 3297 O  O   . HOH C 3 .   ? 14.101 25.402  -9.036  1.00 34.03 ? 174 HOH A O   1 
HETATM 3298 O  O   . HOH C 3 .   ? 2.569  8.329   17.055  1.00 32.51 ? 175 HOH A O   1 
HETATM 3299 O  O   . HOH C 3 .   ? 2.424  21.109  30.053  1.00 39.03 ? 176 HOH A O   1 
HETATM 3300 O  O   . HOH C 3 .   ? -1.990 7.785   16.041  1.00 34.78 ? 177 HOH A O   1 
HETATM 3301 O  O   . HOH C 3 .   ? 28.989 11.044  7.359   1.00 41.19 ? 178 HOH A O   1 
HETATM 3302 O  O   . HOH C 3 .   ? 10.934 6.461   23.076  1.00 37.75 ? 179 HOH A O   1 
HETATM 3303 O  O   . HOH C 3 .   ? -3.801 20.966  1.783   1.00 44.85 ? 180 HOH A O   1 
HETATM 3304 O  O   . HOH C 3 .   ? 23.878 17.055  8.597   1.00 46.05 ? 181 HOH A O   1 
HETATM 3305 O  O   . HOH C 3 .   ? 16.734 11.476  1.351   1.00 44.84 ? 453 HOH A O   1 
HETATM 3306 O  O   . HOH C 3 .   ? 10.384 1.510   0.851   1.00 38.88 ? 454 HOH A O   1 
HETATM 3307 O  O   . HOH C 3 .   ? 27.436 19.164  0.767   1.00 27.85 ? 455 HOH A O   1 
HETATM 3308 O  O   . HOH C 3 .   ? 26.005 20.941  17.978  1.00 38.82 ? 456 HOH A O   1 
HETATM 3309 O  O   . HOH C 3 .   ? 32.108 34.619  -7.635  1.00 39.82 ? 457 HOH A O   1 
HETATM 3310 O  O   . HOH C 3 .   ? 18.447 30.376  33.376  1.00 44.32 ? 458 HOH A O   1 
HETATM 3311 O  O   . HOH C 3 .   ? -6.043 7.631   13.281  1.00 44.87 ? 459 HOH A O   1 
HETATM 3312 O  O   . HOH C 3 .   ? 33.267 23.556  15.278  1.00 38.64 ? 460 HOH A O   1 
HETATM 3313 O  O   . HOH C 3 .   ? -0.699 17.787  8.047   1.00 32.00 ? 461 HOH A O   1 
HETATM 3314 O  O   . HOH C 3 .   ? -4.875 33.594  13.966  1.00 36.11 ? 462 HOH A O   1 
HETATM 3315 O  O   . HOH C 3 .   ? 13.493 33.980  26.567  1.00 35.37 ? 463 HOH A O   1 
HETATM 3316 O  O   . HOH C 3 .   ? 8.579  36.381  17.055  1.00 46.88 ? 464 HOH A O   1 
HETATM 3317 O  O   . HOH C 3 .   ? 2.530  30.376  27.385  1.00 34.17 ? 465 HOH A O   1 
HETATM 3318 O  O   . HOH C 3 .   ? 34.924 41.728  -6.727  1.00 45.57 ? 466 HOH A O   1 
HETATM 3319 O  O   . HOH C 3 .   ? 23.685 44.128  -0.492  1.00 42.41 ? 467 HOH A O   1 
HETATM 3320 O  O   . HOH C 3 .   ? 15.138 7.062   23.817  1.00 38.64 ? 468 HOH A O   1 
HETATM 3321 O  O   . HOH C 3 .   ? 34.094 17.058  -7.809  1.00 35.25 ? 469 HOH A O   1 
HETATM 3322 O  O   . HOH C 3 .   ? -9.050 12.249  6.088   1.00 47.31 ? 470 HOH A O   1 
HETATM 3323 O  O   . HOH C 3 .   ? 20.024 32.375  -3.665  1.00 39.44 ? 471 HOH A O   1 
HETATM 3324 O  O   . HOH C 3 .   ? 23.353 27.855  23.185  1.00 35.69 ? 472 HOH A O   1 
HETATM 3325 O  O   . HOH C 3 .   ? 8.160  3.108   21.155  1.00 33.87 ? 473 HOH A O   1 
HETATM 3326 O  O   . HOH C 3 .   ? 2.250  32.408  -0.517  1.00 34.44 ? 474 HOH A O   1 
HETATM 3327 O  O   . HOH C 3 .   ? 11.526 8.943   23.814  1.00 42.43 ? 475 HOH A O   1 
HETATM 3328 O  O   . HOH C 3 .   ? 33.316 24.506  -10.003 1.00 34.91 ? 476 HOH A O   1 
HETATM 3329 O  O   . HOH C 3 .   ? -6.048 32.616  18.002  1.00 34.06 ? 477 HOH A O   1 
HETATM 3330 O  O   . HOH C 3 .   ? 16.802 20.620  -9.572  1.00 31.00 ? 478 HOH A O   1 
HETATM 3331 O  O   . HOH C 3 .   ? 28.531 13.645  -11.687 1.00 29.28 ? 479 HOH A O   1 
HETATM 3332 O  O   . HOH C 3 .   ? 26.525 29.714  33.045  1.00 39.12 ? 480 HOH A O   1 
HETATM 3333 O  O   . HOH C 3 .   ? 24.499 18.624  23.900  1.00 42.91 ? 481 HOH A O   1 
HETATM 3334 O  O   . HOH C 3 .   ? 35.273 30.736  14.399  1.00 47.91 ? 482 HOH A O   1 
HETATM 3335 O  O   . HOH C 3 .   ? 26.608 14.988  -0.915  1.00 50.36 ? 483 HOH A O   1 
HETATM 3336 O  O   . HOH C 3 .   ? 24.947 3.027   19.006  1.00 43.17 ? 484 HOH A O   1 
HETATM 3337 O  O   . HOH C 3 .   ? 10.671 1.157   -1.852  1.00 47.50 ? 485 HOH A O   1 
HETATM 3338 O  O   . HOH C 3 .   ? -1.633 25.449  0.112   1.00 35.43 ? 486 HOH A O   1 
HETATM 3339 O  O   . HOH C 3 .   ? 7.078  0.010   12.580  1.00 48.33 ? 487 HOH A O   1 
HETATM 3340 O  O   . HOH C 3 .   ? 20.425 16.572  14.831  1.00 45.64 ? 488 HOH A O   1 
HETATM 3341 O  O   . HOH C 3 .   ? 19.623 39.435  22.439  1.00 51.34 ? 489 HOH A O   1 
HETATM 3342 O  O   . HOH C 3 .   ? 22.433 14.967  -9.414  1.00 40.89 ? 490 HOH A O   1 
HETATM 3343 O  O   . HOH C 3 .   ? 4.659  21.433  28.555  1.00 33.50 ? 491 HOH A O   1 
HETATM 3344 O  O   . HOH C 3 .   ? -5.641 34.084  20.302  1.00 46.34 ? 492 HOH A O   1 
HETATM 3345 O  O   . HOH C 3 .   ? 3.925  27.958  28.860  1.00 36.05 ? 493 HOH A O   1 
HETATM 3346 O  O   . HOH C 3 .   ? 21.881 29.789  24.342  1.00 43.44 ? 494 HOH A O   1 
HETATM 3347 O  O   . HOH C 3 .   ? 6.843  20.843  29.774  1.00 28.17 ? 495 HOH A O   1 
HETATM 3348 O  O   . HOH C 3 .   ? 10.124 3.161   -3.330  1.00 40.37 ? 496 HOH A O   1 
HETATM 3349 O  O   . HOH C 3 .   ? 23.880 14.606  -11.776 1.00 32.61 ? 497 HOH A O   1 
HETATM 3350 O  O   . HOH C 3 .   ? 7.228  23.031  31.399  1.00 30.51 ? 498 HOH A O   1 
HETATM 3351 O  O   . HOH C 3 .   ? 2.986  24.954  27.993  1.00 37.62 ? 499 HOH A O   1 
HETATM 3352 O  O   . HOH C 3 .   ? 17.356 13.513  2.834   1.00 46.66 ? 500 HOH A O   1 
HETATM 3353 O  O   . HOH C 3 .   ? 28.887 14.405  -2.755  1.00 43.72 ? 501 HOH A O   1 
HETATM 3354 O  O   . HOH C 3 .   ? 19.151 20.361  9.527   1.00 42.61 ? 502 HOH A O   1 
HETATM 3355 O  O   . HOH C 3 .   ? 16.768 5.293   -5.360  1.00 40.32 ? 503 HOH A O   1 
HETATM 3356 O  O   . HOH C 3 .   ? 16.991 34.417  -9.762  1.00 44.65 ? 504 HOH A O   1 
HETATM 3357 O  O   . HOH C 3 .   ? 28.726 34.286  -11.522 1.00 40.20 ? 505 HOH A O   1 
HETATM 3358 O  O   . HOH C 3 .   ? 37.049 22.409  -6.461  1.00 46.74 ? 506 HOH A O   1 
HETATM 3359 O  O   . HOH C 3 .   ? 12.011 33.694  -3.879  1.00 53.26 ? 507 HOH A O   1 
HETATM 3360 O  O   . HOH C 3 .   ? 7.868  34.465  25.941  1.00 43.09 ? 508 HOH A O   1 
HETATM 3361 O  O   . HOH C 3 .   ? 21.737 17.200  10.993  1.00 41.02 ? 509 HOH A O   1 
HETATM 3362 O  O   . HOH C 3 .   ? 4.844  14.969  -2.725  1.00 45.98 ? 510 HOH A O   1 
HETATM 3363 O  O   . HOH C 3 .   ? 9.667  14.819  4.124   1.00 40.89 ? 511 HOH A O   1 
HETATM 3364 O  O   . HOH C 3 .   ? 16.055 38.890  6.753   1.00 59.31 ? 512 HOH A O   1 
HETATM 3365 O  O   . HOH C 3 .   ? 30.918 23.754  -15.455 1.00 50.79 ? 513 HOH A O   1 
HETATM 3366 O  O   . HOH C 3 .   ? 18.629 24.213  -0.124  1.00 61.74 ? 514 HOH A O   1 
HETATM 3367 O  O   . HOH C 3 .   ? 23.169 13.467  -7.151  1.00 51.51 ? 515 HOH A O   1 
HETATM 3368 O  O   . HOH C 3 .   ? -0.275 25.488  -2.425  1.00 49.58 ? 516 HOH A O   1 
HETATM 3369 O  O   . HOH C 3 .   ? 7.956  12.953  2.604   1.00 35.18 ? 517 HOH A O   1 
HETATM 3370 O  O   . HOH C 3 .   ? 10.009 36.991  19.185  1.00 53.25 ? 518 HOH A O   1 
HETATM 3371 O  O   . HOH C 3 .   ? 39.267 38.030  6.376   1.00 57.90 ? 519 HOH A O   1 
HETATM 3372 O  O   . HOH C 3 .   ? 38.270 24.621  -6.477  1.00 55.61 ? 520 HOH A O   1 
HETATM 3373 O  O   . HOH C 3 .   ? 21.467 38.255  -3.625  1.00 60.43 ? 521 HOH A O   1 
HETATM 3374 O  O   . HOH C 3 .   ? 29.542 10.702  -7.146  1.00 39.93 ? 522 HOH A O   1 
HETATM 3375 O  O   . HOH C 3 .   ? 21.536 12.394  15.406  1.00 45.49 ? 523 HOH A O   1 
HETATM 3376 O  O   . HOH C 3 .   ? -0.413 36.380  18.701  1.00 61.38 ? 524 HOH A O   1 
HETATM 3377 O  O   . HOH C 3 .   ? 27.294 12.513  -2.231  1.00 51.77 ? 525 HOH A O   1 
HETATM 3378 O  O   . HOH C 3 .   ? 21.446 14.370  -2.994  1.00 51.75 ? 526 HOH A O   1 
HETATM 3379 O  O   . HOH C 3 .   ? 7.556  33.193  32.081  1.00 42.76 ? 527 HOH A O   1 
HETATM 3380 O  O   . HOH C 3 .   ? 17.313 14.742  -0.512  1.00 41.72 ? 528 HOH A O   1 
HETATM 3381 O  O   . HOH C 3 .   ? 0.952  32.997  1.773   1.00 46.84 ? 529 HOH A O   1 
HETATM 3382 O  O   . HOH C 3 .   ? 19.873 36.838  -6.945  1.00 38.20 ? 530 HOH A O   1 
HETATM 3383 O  O   . HOH C 3 .   ? 17.884 34.873  -7.339  1.00 38.47 ? 531 HOH A O   1 
HETATM 3384 O  O   . HOH C 3 .   ? 19.602 15.389  -1.807  1.00 41.05 ? 532 HOH A O   1 
HETATM 3385 O  O   . HOH C 3 .   ? 0.975  13.033  29.473  1.00 51.30 ? 533 HOH A O   1 
HETATM 3386 O  O   . HOH C 3 .   ? 15.054 11.336  25.811  1.00 36.41 ? 534 HOH A O   1 
HETATM 3387 O  O   . HOH C 3 .   ? -6.287 16.727  13.432  1.00 33.98 ? 535 HOH A O   1 
HETATM 3388 O  O   . HOH C 3 .   ? 18.929 12.804  26.984  1.00 41.16 ? 536 HOH A O   1 
HETATM 3389 O  O   . HOH C 3 .   ? 32.512 27.272  16.366  1.00 50.27 ? 537 HOH A O   1 
HETATM 3390 O  O   . HOH C 3 .   ? 5.764  40.577  3.475   1.00 51.52 ? 538 HOH A O   1 
HETATM 3391 O  O   . HOH C 3 .   ? 4.381  1.913   17.248  1.00 50.33 ? 539 HOH A O   1 
HETATM 3392 O  O   . HOH C 3 .   ? 15.082 11.678  31.274  1.00 43.90 ? 540 HOH A O   1 
HETATM 3393 O  O   . HOH C 3 .   ? 19.220 13.870  30.019  1.00 43.59 ? 541 HOH A O   1 
HETATM 3394 O  O   . HOH C 3 .   ? 30.193 36.636  -10.152 1.00 57.27 ? 542 HOH A O   1 
HETATM 3395 O  O   . HOH C 3 .   ? 29.022 33.592  -13.751 1.00 37.42 ? 543 HOH A O   1 
HETATM 3396 O  O   . HOH D 3 .   ? 13.674 0.555   -2.871  1.00 36.51 ? 34  HOH B O   1 
HETATM 3397 O  O   . HOH D 3 .   ? 29.649 7.370   3.882   1.00 28.24 ? 35  HOH B O   1 
HETATM 3398 O  O   . HOH D 3 .   ? 24.213 5.920   12.259  1.00 19.88 ? 40  HOH B O   1 
HETATM 3399 O  O   . HOH D 3 .   ? 26.460 -6.447  2.131   1.00 24.83 ? 52  HOH B O   1 
HETATM 3400 O  O   . HOH D 3 .   ? 20.325 -9.808  3.436   1.00 33.26 ? 56  HOH B O   1 
HETATM 3401 O  O   . HOH D 3 .   ? 25.970 11.729  12.278  1.00 33.15 ? 65  HOH B O   1 
HETATM 3402 O  O   . HOH D 3 .   ? 35.020 0.401   14.819  1.00 31.94 ? 68  HOH B O   1 
HETATM 3403 O  O   . HOH D 3 .   ? 29.888 -12.106 1.952   1.00 30.78 ? 70  HOH B O   1 
HETATM 3404 O  O   . HOH D 3 .   ? 14.176 -1.446  0.425   1.00 22.48 ? 72  HOH B O   1 
HETATM 3405 O  O   . HOH D 3 .   ? 30.753 -11.570 -0.603  1.00 31.81 ? 73  HOH B O   1 
HETATM 3406 O  O   . HOH D 3 .   ? 13.187 -5.792  -4.051  1.00 33.41 ? 78  HOH B O   1 
HETATM 3407 O  O   . HOH D 3 .   ? 13.855 -4.767  -1.505  1.00 26.11 ? 86  HOH B O   1 
HETATM 3408 O  O   . HOH D 3 .   ? 19.345 5.126   -4.440  1.00 30.06 ? 88  HOH B O   1 
HETATM 3409 O  O   . HOH D 3 .   ? 19.176 -10.294 7.694   1.00 32.44 ? 105 HOH B O   1 
HETATM 3410 O  O   . HOH D 3 .   ? 17.358 -11.390 -0.687  1.00 32.00 ? 115 HOH B O   1 
HETATM 3411 O  O   . HOH D 3 .   ? 24.329 -8.341  3.097   1.00 26.92 ? 121 HOH B O   1 
HETATM 3412 O  O   . HOH D 3 .   ? 35.071 -0.820  -7.440  1.00 42.18 ? 123 HOH B O   1 
HETATM 3413 O  O   . HOH D 3 .   ? 19.069 2.063   6.186   1.00 27.75 ? 134 HOH B O   1 
HETATM 3414 O  O   . HOH D 3 .   ? 19.848 -11.917 -0.501  1.00 37.69 ? 138 HOH B O   1 
HETATM 3415 O  O   . HOH D 3 .   ? 14.386 1.607   -4.809  1.00 49.03 ? 140 HOH B O   1 
HETATM 3416 O  O   . HOH D 3 .   ? 21.802 -14.842 -1.451  1.00 46.87 ? 141 HOH B O   1 
HETATM 3417 O  O   . HOH D 3 .   ? 26.575 5.628   13.970  1.00 32.78 ? 151 HOH B O   1 
HETATM 3418 O  O   . HOH D 3 .   ? 43.132 5.059   8.394   1.00 34.98 ? 157 HOH B O   1 
HETATM 3419 O  O   . HOH D 3 .   ? 38.153 -0.688  -0.413  1.00 35.35 ? 170 HOH B O   1 
HETATM 3420 O  O   . HOH D 3 .   ? 46.962 -17.415 3.832   1.00 49.47 ? 182 HOH B O   1 
HETATM 3421 O  O   . HOH D 3 .   ? 41.503 -18.960 7.027   1.00 46.84 ? 183 HOH B O   1 
HETATM 3422 O  O   . HOH D 3 .   ? 41.238 2.044   4.743   1.00 41.59 ? 185 HOH B O   1 
HETATM 3423 O  O   . HOH D 3 .   ? 17.331 -8.409  3.841   1.00 49.30 ? 187 HOH B O   1 
HETATM 3424 O  O   . HOH D 3 .   ? 23.542 1.582   -7.027  1.00 40.13 ? 189 HOH B O   1 
HETATM 3425 O  O   . HOH D 3 .   ? 24.249 -11.854 1.249   1.00 35.56 ? 194 HOH B O   1 
HETATM 3426 O  O   . HOH D 3 .   ? 44.653 2.355   10.728  1.00 44.28 ? 203 HOH B O   1 
HETATM 3427 O  O   . HOH D 3 .   ? 33.362 7.775   11.148  1.00 37.38 ? 205 HOH B O   1 
HETATM 3428 O  O   . HOH D 3 .   ? 36.186 7.912   11.100  1.00 39.32 ? 216 HOH B O   1 
HETATM 3429 O  O   . HOH D 3 .   ? 37.965 6.555   10.505  1.00 41.78 ? 227 HOH B O   1 
HETATM 3430 O  O   . HOH D 3 .   ? 24.299 -16.122 4.136   1.00 48.58 ? 229 HOH B O   1 
HETATM 3431 O  O   . HOH D 3 .   ? 31.099 9.653   12.456  1.00 55.40 ? 230 HOH B O   1 
HETATM 3432 O  O   . HOH D 3 .   ? 22.863 -12.914 6.148   1.00 45.40 ? 231 HOH B O   1 
HETATM 3433 O  O   . HOH D 3 .   ? 41.650 4.850   6.245   1.00 46.19 ? 232 HOH B O   1 
HETATM 3434 O  O   . HOH D 3 .   ? 29.968 10.001  4.484   1.00 44.94 ? 234 HOH B O   1 
HETATM 3435 O  O   . HOH D 3 .   ? 20.086 7.592   -3.664  1.00 38.94 ? 241 HOH B O   1 
HETATM 3436 O  O   . HOH D 3 .   ? 23.194 -11.245 4.344   1.00 41.94 ? 373 HOH B O   1 
HETATM 3437 O  O   . HOH D 3 .   ? 17.512 7.842   -2.475  1.00 38.04 ? 374 HOH B O   1 
HETATM 3438 O  O   . HOH D 3 .   ? 21.710 -12.109 -14.536 1.00 51.63 ? 375 HOH B O   1 
HETATM 3439 O  O   . HOH D 3 .   ? 47.728 -19.687 2.862   1.00 51.32 ? 376 HOH B O   1 
HETATM 3440 O  O   . HOH D 3 .   ? 39.135 1.542   -1.073  1.00 60.24 ? 377 HOH B O   1 
HETATM 3441 O  O   . HOH D 3 .   ? 28.676 11.597  -4.533  1.00 52.09 ? 378 HOH B O   1 
HETATM 3442 O  O   . HOH D 3 .   ? 32.102 11.695  5.520   1.00 51.08 ? 379 HOH B O   1 
HETATM 3443 O  O   . HOH D 3 .   ? 38.174 -13.010 -9.368  1.00 45.24 ? 380 HOH B O   1 
HETATM 3444 O  O   . HOH D 3 .   ? 13.982 10.639  1.187   1.00 40.07 ? 381 HOH B O   1 
HETATM 3445 O  O   . HOH D 3 .   ? 36.669 8.511   -3.461  1.00 45.44 ? 382 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   -1  ?   ?   ?   A . n 
A 1 2   ASN 2   183 ?   ?   ?   A . n 
A 1 3   LYS 3   184 ?   ?   ?   A . n 
A 1 4   HIS 4   185 185 HIS HIS A . n 
A 1 5   SER 5   186 186 SER SER A . n 
A 1 6   GLY 6   187 187 GLY GLY A . n 
A 1 7   ILE 7   188 188 ILE ILE A . n 
A 1 8   ASP 8   189 189 ASP ASP A . n 
A 1 9   PHE 9   190 190 PHE PHE A . n 
A 1 10  LYS 10  191 191 LYS LYS A . n 
A 1 11  GLN 11  192 192 GLN GLN A . n 
A 1 12  LEU 12  193 193 LEU LEU A . n 
A 1 13  ASN 13  194 194 ASN ASN A . n 
A 1 14  PHE 14  195 195 PHE PHE A . n 
A 1 15  LEU 15  196 196 LEU LEU A . n 
A 1 16  THR 16  197 197 THR THR A . n 
A 1 17  LYS 17  198 198 LYS LYS A . n 
A 1 18  LEU 18  199 199 LEU LEU A . n 
A 1 19  ASN 19  200 200 ASN ASN A . n 
A 1 20  GLU 20  201 201 GLU GLU A . n 
A 1 21  ASN 21  202 202 ASN ASN A . n 
A 1 22  HIS 22  203 203 HIS HIS A . n 
A 1 23  SER 23  204 204 SER SER A . n 
A 1 24  GLY 24  205 205 GLY GLY A . n 
A 1 25  GLU 25  206 206 GLU GLU A . n 
A 1 26  LEU 26  207 207 LEU LEU A . n 
A 1 27  TRP 27  208 208 TRP TRP A . n 
A 1 28  LYS 28  209 209 LYS LYS A . n 
A 1 29  GLY 29  210 210 GLY GLY A . n 
A 1 30  ARG 30  211 211 ARG ARG A . n 
A 1 31  TRP 31  212 212 TRP TRP A . n 
A 1 32  GLN 32  213 213 GLN GLN A . n 
A 1 33  GLY 33  214 214 GLY GLY A . n 
A 1 34  ASN 34  215 215 ASN ASN A . n 
A 1 35  ASP 35  216 216 ASP ASP A . n 
A 1 36  ILE 36  217 217 ILE ILE A . n 
A 1 37  VAL 37  218 218 VAL VAL A . n 
A 1 38  VAL 38  219 219 VAL VAL A . n 
A 1 39  LYS 39  220 220 LYS LYS A . n 
A 1 40  VAL 40  221 221 VAL VAL A . n 
A 1 41  LEU 41  222 222 LEU LEU A . n 
A 1 42  LYS 42  223 223 LYS LYS A . n 
A 1 43  VAL 43  224 224 VAL VAL A . n 
A 1 44  ARG 44  225 225 ARG ARG A . n 
A 1 45  ASP 45  226 226 ASP ASP A . n 
A 1 46  TRP 46  227 227 TRP TRP A . n 
A 1 47  SER 47  228 228 SER SER A . n 
A 1 48  THR 48  229 229 THR THR A . n 
A 1 49  ARG 49  230 230 ARG ARG A . n 
A 1 50  LYS 50  231 231 LYS LYS A . n 
A 1 51  SER 51  232 232 SER SER A . n 
A 1 52  ARG 52  233 233 ARG ARG A . n 
A 1 53  ASP 53  234 234 ASP ASP A . n 
A 1 54  PHE 54  235 235 PHE PHE A . n 
A 1 55  ASN 55  236 236 ASN ASN A . n 
A 1 56  GLU 56  237 237 GLU GLU A . n 
A 1 57  GLU 57  238 238 GLU GLU A . n 
A 1 58  CYS 58  239 239 CYS CYS A . n 
A 1 59  PRO 59  240 240 PRO PRO A . n 
A 1 60  ARG 60  241 241 ARG ARG A . n 
A 1 61  LEU 61  242 242 LEU LEU A . n 
A 1 62  ARG 62  243 243 ARG ARG A . n 
A 1 63  ILE 63  244 244 ILE ILE A . n 
A 1 64  PHE 64  245 245 PHE PHE A . n 
A 1 65  SER 65  246 246 SER SER A . n 
A 1 66  HIS 66  247 247 HIS HIS A . n 
A 1 67  PRO 67  248 248 PRO PRO A . n 
A 1 68  ASN 68  249 249 ASN ASN A . n 
A 1 69  VAL 69  250 250 VAL VAL A . n 
A 1 70  LEU 70  251 251 LEU LEU A . n 
A 1 71  PRO 71  252 252 PRO PRO A . n 
A 1 72  VAL 72  253 253 VAL VAL A . n 
A 1 73  LEU 73  254 254 LEU LEU A . n 
A 1 74  GLY 74  255 255 GLY GLY A . n 
A 1 75  ALA 75  256 256 ALA ALA A . n 
A 1 76  CYS 76  257 257 CYS CYS A . n 
A 1 77  GLN 77  258 258 GLN GLN A . n 
A 1 78  SER 78  259 259 SER SER A . n 
A 1 79  PRO 79  260 260 PRO PRO A . n 
A 1 80  PRO 80  261 261 PRO PRO A . n 
A 1 81  ALA 81  262 262 ALA ALA A . n 
A 1 82  PRO 82  263 263 PRO PRO A . n 
A 1 83  HIS 83  264 264 HIS HIS A . n 
A 1 84  PRO 84  265 265 PRO PRO A . n 
A 1 85  THR 85  266 266 THR THR A . n 
A 1 86  LEU 86  267 267 LEU LEU A . n 
A 1 87  ILE 87  268 268 ILE ILE A . n 
A 1 88  THR 88  269 269 THR THR A . n 
A 1 89  HIS 89  270 270 HIS HIS A . n 
A 1 90  TRP 90  271 271 TRP TRP A . n 
A 1 91  MSE 91  272 272 MSE MSE A . n 
A 1 92  PRO 92  273 273 PRO PRO A . n 
A 1 93  TYR 93  274 274 TYR TYR A . n 
A 1 94  GLY 94  275 275 GLY GLY A . n 
A 1 95  SER 95  276 276 SER SER A . n 
A 1 96  LEU 96  277 277 LEU LEU A . n 
A 1 97  TYR 97  278 278 TYR TYR A . n 
A 1 98  ASN 98  279 279 ASN ASN A . n 
A 1 99  VAL 99  280 280 VAL VAL A . n 
A 1 100 LEU 100 281 281 LEU LEU A . n 
A 1 101 HIS 101 282 282 HIS HIS A . n 
A 1 102 GLU 102 283 283 GLU GLU A . n 
A 1 103 GLY 103 284 284 GLY GLY A . n 
A 1 104 THR 104 285 285 THR THR A . n 
A 1 105 ASN 105 286 286 ASN ASN A . n 
A 1 106 PHE 106 287 287 PHE PHE A . n 
A 1 107 VAL 107 288 288 VAL VAL A . n 
A 1 108 VAL 108 289 289 VAL VAL A . n 
A 1 109 ASP 109 290 290 ASP ASP A . n 
A 1 110 GLN 110 291 291 GLN GLN A . n 
A 1 111 SER 111 292 292 SER SER A . n 
A 1 112 GLN 112 293 293 GLN GLN A . n 
A 1 113 ALA 113 294 294 ALA ALA A . n 
A 1 114 VAL 114 295 295 VAL VAL A . n 
A 1 115 LYS 115 296 296 LYS LYS A . n 
A 1 116 PHE 116 297 297 PHE PHE A . n 
A 1 117 ALA 117 298 298 ALA ALA A . n 
A 1 118 LEU 118 299 299 LEU LEU A . n 
A 1 119 ASP 119 300 300 ASP ASP A . n 
A 1 120 MSE 120 301 301 MSE MSE A . n 
A 1 121 ALA 121 302 302 ALA ALA A . n 
A 1 122 ARG 122 303 303 ARG ARG A . n 
A 1 123 GLY 123 304 304 GLY GLY A . n 
A 1 124 MSE 124 305 305 MSE MSE A . n 
A 1 125 ALA 125 306 306 ALA ALA A . n 
A 1 126 PHE 126 307 307 PHE PHE A . n 
A 1 127 LEU 127 308 308 LEU LEU A . n 
A 1 128 HIS 128 309 309 HIS HIS A . n 
A 1 129 THR 129 310 310 THR THR A . n 
A 1 130 LEU 130 311 311 LEU LEU A . n 
A 1 131 GLU 131 312 312 GLU GLU A . n 
A 1 132 PRO 132 313 313 PRO PRO A . n 
A 1 133 LEU 133 314 314 LEU LEU A . n 
A 1 134 ILE 134 315 315 ILE ILE A . n 
A 1 135 PRO 135 316 316 PRO PRO A . n 
A 1 136 ARG 136 317 317 ARG ARG A . n 
A 1 137 HIS 137 318 318 HIS HIS A . n 
A 1 138 ALA 138 319 319 ALA ALA A . n 
A 1 139 LEU 139 320 320 LEU LEU A . n 
A 1 140 ASN 140 321 321 ASN ASN A . n 
A 1 141 SER 141 322 322 SER SER A . n 
A 1 142 ARG 142 323 323 ARG ARG A . n 
A 1 143 SER 143 324 324 SER SER A . n 
A 1 144 VAL 144 325 325 VAL VAL A . n 
A 1 145 MSE 145 326 326 MSE MSE A . n 
A 1 146 ILE 146 327 327 ILE ILE A . n 
A 1 147 ASP 147 328 328 ASP ASP A . n 
A 1 148 GLU 148 329 329 GLU GLU A . n 
A 1 149 ASP 149 330 330 ASP ASP A . n 
A 1 150 MSE 150 331 331 MSE MSE A . n 
A 1 151 THR 151 332 332 THR THR A . n 
A 1 152 ALA 152 333 333 ALA ALA A . n 
A 1 153 ARG 153 334 334 ARG ARG A . n 
A 1 154 ILE 154 335 335 ILE ILE A . n 
A 1 155 SER 155 336 336 SER SER A . n 
A 1 156 MSE 156 337 337 MSE MSE A . n 
A 1 157 ALA 157 338 338 ALA ALA A . n 
A 1 158 ASP 158 339 339 ASP ASP A . n 
A 1 159 VAL 159 340 340 VAL VAL A . n 
A 1 160 LYS 160 341 341 LYS LYS A . n 
A 1 161 PHE 161 342 342 PHE PHE A . n 
A 1 162 SER 162 343 343 SER SER A . n 
A 1 163 PHE 163 344 344 PHE PHE A . n 
A 1 164 GLN 164 345 345 GLN GLN A . n 
A 1 165 SER 165 346 346 SER SER A . n 
A 1 166 PRO 166 347 347 PRO PRO A . n 
A 1 167 GLY 167 348 348 GLY GLY A . n 
A 1 168 ARG 168 349 349 ARG ARG A . n 
A 1 169 MSE 169 350 350 MSE MSE A . n 
A 1 170 TYR 170 351 351 TYR TYR A . n 
A 1 171 ALA 171 352 352 ALA ALA A . n 
A 1 172 PRO 172 353 353 PRO PRO A . n 
A 1 173 ALA 173 354 354 ALA ALA A . n 
A 1 174 TRP 174 355 355 TRP TRP A . n 
A 1 175 VAL 175 356 356 VAL VAL A . n 
A 1 176 ALA 176 357 357 ALA ALA A . n 
A 1 177 PRO 177 358 358 PRO PRO A . n 
A 1 178 GLU 178 359 359 GLU GLU A . n 
A 1 179 ALA 179 360 360 ALA ALA A . n 
A 1 180 LEU 180 361 361 LEU LEU A . n 
A 1 181 GLN 181 362 362 GLN GLN A . n 
A 1 182 LYS 182 363 363 LYS LYS A . n 
A 1 183 LYS 183 364 364 LYS LYS A . n 
A 1 184 PRO 184 365 365 PRO PRO A . n 
A 1 185 GLU 185 366 366 GLU GLU A . n 
A 1 186 ASP 186 367 367 ASP ASP A . n 
A 1 187 THR 187 368 368 THR THR A . n 
A 1 188 ASN 188 369 369 ASN ASN A . n 
A 1 189 ARG 189 370 370 ARG ARG A . n 
A 1 190 ARG 190 371 371 ARG ARG A . n 
A 1 191 SER 191 372 372 SER SER A . n 
A 1 192 ALA 192 373 373 ALA ALA A . n 
A 1 193 ASP 193 374 374 ASP ASP A . n 
A 1 194 MSE 194 375 375 MSE MSE A . n 
A 1 195 TRP 195 376 376 TRP TRP A . n 
A 1 196 SER 196 377 377 SER SER A . n 
A 1 197 PHE 197 378 378 PHE PHE A . n 
A 1 198 ALA 198 379 379 ALA ALA A . n 
A 1 199 VAL 199 380 380 VAL VAL A . n 
A 1 200 LEU 200 381 381 LEU LEU A . n 
A 1 201 LEU 201 382 382 LEU LEU A . n 
A 1 202 TRP 202 383 383 TRP TRP A . n 
A 1 203 GLU 203 384 384 GLU GLU A . n 
A 1 204 LEU 204 385 385 LEU LEU A . n 
A 1 205 VAL 205 386 386 VAL VAL A . n 
A 1 206 THR 206 387 387 THR THR A . n 
A 1 207 ARG 207 388 388 ARG ARG A . n 
A 1 208 GLU 208 389 389 GLU GLU A . n 
A 1 209 VAL 209 390 390 VAL VAL A . n 
A 1 210 PRO 210 391 391 PRO PRO A . n 
A 1 211 PHE 211 392 392 PHE PHE A . n 
A 1 212 ALA 212 393 393 ALA ALA A . n 
A 1 213 ASP 213 394 394 ASP ASP A . n 
A 1 214 LEU 214 395 395 LEU LEU A . n 
A 1 215 SER 215 396 396 SER SER A . n 
A 1 216 ASN 216 397 397 ASN ASN A . n 
A 1 217 MSE 217 398 398 MSE MSE A . n 
A 1 218 GLU 218 399 399 GLU GLU A . n 
A 1 219 ILE 219 400 400 ILE ILE A . n 
A 1 220 GLY 220 401 401 GLY GLY A . n 
A 1 221 MSE 221 402 402 MSE MSE A . n 
A 1 222 LYS 222 403 403 LYS LYS A . n 
A 1 223 VAL 223 404 404 VAL VAL A . n 
A 1 224 ALA 224 405 405 ALA ALA A . n 
A 1 225 LEU 225 406 406 LEU LEU A . n 
A 1 226 GLU 226 407 407 GLU GLU A . n 
A 1 227 GLY 227 408 408 GLY GLY A . n 
A 1 228 LEU 228 409 409 LEU LEU A . n 
A 1 229 ARG 229 410 410 ARG ARG A . n 
A 1 230 PRO 230 411 411 PRO PRO A . n 
A 1 231 THR 231 412 412 THR THR A . n 
A 1 232 ILE 232 413 413 ILE ILE A . n 
A 1 233 PRO 233 414 414 PRO PRO A . n 
A 1 234 PRO 234 415 415 PRO PRO A . n 
A 1 235 GLY 235 416 416 GLY GLY A . n 
A 1 236 ILE 236 417 417 ILE ILE A . n 
A 1 237 SER 237 418 418 SER SER A . n 
A 1 238 PRO 238 419 419 PRO PRO A . n 
A 1 239 HIS 239 420 420 HIS HIS A . n 
A 1 240 VAL 240 421 421 VAL VAL A . n 
A 1 241 SER 241 422 422 SER SER A . n 
A 1 242 LYS 242 423 423 LYS LYS A . n 
A 1 243 LEU 243 424 424 LEU LEU A . n 
A 1 244 MSE 244 425 425 MSE MSE A . n 
A 1 245 LYS 245 426 426 LYS LYS A . n 
A 1 246 ILE 246 427 427 ILE ILE A . n 
A 1 247 CYS 247 428 428 CYS CYS A . n 
A 1 248 MSE 248 429 429 MSE MSE A . n 
A 1 249 ASN 249 430 430 ASN ASN A . n 
A 1 250 GLU 250 431 431 GLU GLU A . n 
A 1 251 ASP 251 432 432 ASP ASP A . n 
A 1 252 PRO 252 433 433 PRO PRO A . n 
A 1 253 ALA 253 434 434 ALA ALA A . n 
A 1 254 LYS 254 435 435 LYS LYS A . n 
A 1 255 ARG 255 436 436 ARG ARG A . n 
A 1 256 PRO 256 437 437 PRO PRO A . n 
A 1 257 LYS 257 438 438 LYS LYS A . n 
A 1 258 PHE 258 439 439 PHE PHE A . n 
A 1 259 ASP 259 440 440 ASP ASP A . n 
A 1 260 MSE 260 441 441 MSE MSE A . n 
A 1 261 ILE 261 442 442 ILE ILE A . n 
A 1 262 VAL 262 443 443 VAL VAL A . n 
A 1 263 PRO 263 444 444 PRO PRO A . n 
A 1 264 ILE 264 445 445 ILE ILE A . n 
A 1 265 LEU 265 446 446 LEU LEU A . n 
A 1 266 GLU 266 447 447 GLU GLU A . n 
A 1 267 LYS 267 448 448 LYS LYS A . n 
A 1 268 MSE 268 449 449 MSE MSE A . n 
A 1 269 GLN 269 450 450 GLN GLN A . n 
A 1 270 ASP 270 451 451 ASP ASP A . n 
A 1 271 LYS 271 452 ?   ?   ?   A . n 
B 2 1   GLY 1   -4  ?   ?   ?   B . n 
B 2 2   SER 2   -3  ?   ?   ?   B . n 
B 2 3   HIS 3   -2  ?   ?   ?   B . n 
B 2 4   MSE 4   -1  ?   ?   ?   B . n 
B 2 5   ASP 5   248 ?   ?   ?   B . n 
B 2 6   ALA 6   249 249 ALA ALA B . n 
B 2 7   PHE 7   250 250 PHE PHE B . n 
B 2 8   ASP 8   251 251 ASP ASP B . n 
B 2 9   THR 9   252 252 THR THR B . n 
B 2 10  LEU 10  253 253 LEU LEU B . n 
B 2 11  PHE 11  254 254 PHE PHE B . n 
B 2 12  ASP 12  255 255 ASP ASP B . n 
B 2 13  HIS 13  256 256 HIS HIS B . n 
B 2 14  ALA 14  257 257 ALA ALA B . n 
B 2 15  PRO 15  258 258 PRO PRO B . n 
B 2 16  ASP 16  259 259 ASP ASP B . n 
B 2 17  LYS 17  260 260 LYS LYS B . n 
B 2 18  LEU 18  261 261 LEU LEU B . n 
B 2 19  ASN 19  262 262 ASN ASN B . n 
B 2 20  VAL 20  263 263 VAL VAL B . n 
B 2 21  VAL 21  264 264 VAL VAL B . n 
B 2 22  LYS 22  265 265 LYS LYS B . n 
B 2 23  LYS 23  266 266 LYS LYS B . n 
B 2 24  THR 24  267 267 THR THR B . n 
B 2 25  LEU 25  268 268 LEU LEU B . n 
B 2 26  ILE 26  269 269 ILE ILE B . n 
B 2 27  THR 27  270 270 THR THR B . n 
B 2 28  PHE 28  271 271 PHE PHE B . n 
B 2 29  VAL 29  272 272 VAL VAL B . n 
B 2 30  ASN 30  273 273 ASN ASN B . n 
B 2 31  LYS 31  274 274 LYS LYS B . n 
B 2 32  HIS 32  275 275 HIS HIS B . n 
B 2 33  LEU 33  276 276 LEU LEU B . n 
B 2 34  ASN 34  277 277 ASN ASN B . n 
B 2 35  LYS 35  278 278 LYS LYS B . n 
B 2 36  LEU 36  279 279 LEU LEU B . n 
B 2 37  ASN 37  280 280 ASN ASN B . n 
B 2 38  LEU 38  281 281 LEU LEU B . n 
B 2 39  GLU 39  282 282 GLU GLU B . n 
B 2 40  VAL 40  283 283 VAL VAL B . n 
B 2 41  THR 41  284 284 THR THR B . n 
B 2 42  GLU 42  285 285 GLU GLU B . n 
B 2 43  LEU 43  286 286 LEU LEU B . n 
B 2 44  GLU 44  287 287 GLU GLU B . n 
B 2 45  THR 45  288 288 THR THR B . n 
B 2 46  GLN 46  289 289 GLN GLN B . n 
B 2 47  PHE 47  290 290 PHE PHE B . n 
B 2 48  ALA 48  291 291 ALA ALA B . n 
B 2 49  ASP 49  292 292 ASP ASP B . n 
B 2 50  GLY 50  293 293 GLY GLY B . n 
B 2 51  VAL 51  294 294 VAL VAL B . n 
B 2 52  TYR 52  295 295 TYR TYR B . n 
B 2 53  LEU 53  296 296 LEU LEU B . n 
B 2 54  VAL 54  297 297 VAL VAL B . n 
B 2 55  LEU 55  298 298 LEU LEU B . n 
B 2 56  LEU 56  299 299 LEU LEU B . n 
B 2 57  MSE 57  300 300 MSE MSE B . n 
B 2 58  GLY 58  301 301 GLY GLY B . n 
B 2 59  LEU 59  302 302 LEU LEU B . n 
B 2 60  LEU 60  303 303 LEU LEU B . n 
B 2 61  GLU 61  304 304 GLU GLU B . n 
B 2 62  GLY 62  305 305 GLY GLY B . n 
B 2 63  TYR 63  306 306 TYR TYR B . n 
B 2 64  PHE 64  307 307 PHE PHE B . n 
B 2 65  VAL 65  308 308 VAL VAL B . n 
B 2 66  PRO 66  309 309 PRO PRO B . n 
B 2 67  LEU 67  310 310 LEU LEU B . n 
B 2 68  HIS 68  311 311 HIS HIS B . n 
B 2 69  SER 69  312 312 SER SER B . n 
B 2 70  PHE 70  313 313 PHE PHE B . n 
B 2 71  PHE 71  314 314 PHE PHE B . n 
B 2 72  LEU 72  315 315 LEU LEU B . n 
B 2 73  THR 73  316 316 THR THR B . n 
B 2 74  PRO 74  317 317 PRO PRO B . n 
B 2 75  ASP 75  318 318 ASP ASP B . n 
B 2 76  SER 76  319 319 SER SER B . n 
B 2 77  PHE 77  320 320 PHE PHE B . n 
B 2 78  GLU 78  321 321 GLU GLU B . n 
B 2 79  GLN 79  322 322 GLN GLN B . n 
B 2 80  LYS 80  323 323 LYS LYS B . n 
B 2 81  VAL 81  324 324 VAL VAL B . n 
B 2 82  LEU 82  325 325 LEU LEU B . n 
B 2 83  ASN 83  326 326 ASN ASN B . n 
B 2 84  VAL 84  327 327 VAL VAL B . n 
B 2 85  SER 85  328 328 SER SER B . n 
B 2 86  PHE 86  329 329 PHE PHE B . n 
B 2 87  ALA 87  330 330 ALA ALA B . n 
B 2 88  PHE 88  331 331 PHE PHE B . n 
B 2 89  GLU 89  332 332 GLU GLU B . n 
B 2 90  LEU 90  333 333 LEU LEU B . n 
B 2 91  MSE 91  334 334 MSE MSE B . n 
B 2 92  GLN 92  335 335 GLN GLN B . n 
B 2 93  ASP 93  336 336 ASP ASP B . n 
B 2 94  GLY 94  337 337 GLY GLY B . n 
B 2 95  GLY 95  338 338 GLY GLY B . n 
B 2 96  LEU 96  339 339 LEU LEU B . n 
B 2 97  GLU 97  340 340 GLU GLU B . n 
B 2 98  LYS 98  341 341 LYS LYS B . n 
B 2 99  PRO 99  342 342 PRO PRO B . n 
B 2 100 LYS 100 343 343 LYS LYS B . n 
B 2 101 PRO 101 344 344 PRO PRO B . n 
B 2 102 ARG 102 345 345 ARG ARG B . n 
B 2 103 PRO 103 346 346 PRO PRO B . n 
B 2 104 GLU 104 347 347 GLU GLU B . n 
B 2 105 ASP 105 348 348 ASP ASP B . n 
B 2 106 ILE 106 349 349 ILE ILE B . n 
B 2 107 VAL 107 350 350 VAL VAL B . n 
B 2 108 ASN 108 351 351 ASN ASN B . n 
B 2 109 CYS 109 352 352 CYS CYS B . n 
B 2 110 ASP 110 353 353 ASP ASP B . n 
B 2 111 LEU 111 354 354 LEU LEU B . n 
B 2 112 LYS 112 355 355 LYS LYS B . n 
B 2 113 SER 113 356 356 SER SER B . n 
B 2 114 THR 114 357 357 THR THR B . n 
B 2 115 LEU 115 358 358 LEU LEU B . n 
B 2 116 ARG 116 359 359 ARG ARG B . n 
B 2 117 VAL 117 360 360 VAL VAL B . n 
B 2 118 LEU 118 361 361 LEU LEU B . n 
B 2 119 TYR 119 362 362 TYR TYR B . n 
B 2 120 ASN 120 363 363 ASN ASN B . n 
B 2 121 LEU 121 364 364 LEU LEU B . n 
B 2 122 PHE 122 365 365 PHE PHE B . n 
B 2 123 THR 123 366 366 THR THR B . n 
B 2 124 LYS 124 367 367 LYS LYS B . n 
B 2 125 TYR 125 368 368 TYR TYR B . n 
B 2 126 ARG 126 369 369 ARG ARG B . n 
B 2 127 ASN 127 370 370 ASN ASN B . n 
B 2 128 VAL 128 371 371 VAL VAL B . n 
B 2 129 GLU 129 372 372 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   1   1   HOH HOH A . 
C 3 HOH 2   2   2   HOH HOH A . 
C 3 HOH 3   3   3   HOH HOH A . 
C 3 HOH 4   4   4   HOH HOH A . 
C 3 HOH 5   5   5   HOH HOH A . 
C 3 HOH 6   6   6   HOH HOH A . 
C 3 HOH 7   7   7   HOH HOH A . 
C 3 HOH 8   8   8   HOH HOH A . 
C 3 HOH 9   9   9   HOH HOH A . 
C 3 HOH 10  10  10  HOH HOH A . 
C 3 HOH 11  11  11  HOH HOH A . 
C 3 HOH 12  12  12  HOH HOH A . 
C 3 HOH 13  13  13  HOH HOH A . 
C 3 HOH 14  14  14  HOH HOH A . 
C 3 HOH 15  15  15  HOH HOH A . 
C 3 HOH 16  16  16  HOH HOH A . 
C 3 HOH 17  17  17  HOH HOH A . 
C 3 HOH 18  18  18  HOH HOH A . 
C 3 HOH 19  19  19  HOH HOH A . 
C 3 HOH 20  20  20  HOH HOH A . 
C 3 HOH 21  21  21  HOH HOH A . 
C 3 HOH 22  22  22  HOH HOH A . 
C 3 HOH 23  23  23  HOH HOH A . 
C 3 HOH 24  24  24  HOH HOH A . 
C 3 HOH 25  25  25  HOH HOH A . 
C 3 HOH 26  26  26  HOH HOH A . 
C 3 HOH 27  27  27  HOH HOH A . 
C 3 HOH 28  28  28  HOH HOH A . 
C 3 HOH 29  29  29  HOH HOH A . 
C 3 HOH 30  30  30  HOH HOH A . 
C 3 HOH 31  31  31  HOH HOH A . 
C 3 HOH 32  32  32  HOH HOH A . 
C 3 HOH 33  33  33  HOH HOH A . 
C 3 HOH 34  36  36  HOH HOH A . 
C 3 HOH 35  37  37  HOH HOH A . 
C 3 HOH 36  38  38  HOH HOH A . 
C 3 HOH 37  39  39  HOH HOH A . 
C 3 HOH 38  41  41  HOH HOH A . 
C 3 HOH 39  42  42  HOH HOH A . 
C 3 HOH 40  43  43  HOH HOH A . 
C 3 HOH 41  44  44  HOH HOH A . 
C 3 HOH 42  45  45  HOH HOH A . 
C 3 HOH 43  46  46  HOH HOH A . 
C 3 HOH 44  47  47  HOH HOH A . 
C 3 HOH 45  48  48  HOH HOH A . 
C 3 HOH 46  49  49  HOH HOH A . 
C 3 HOH 47  50  50  HOH HOH A . 
C 3 HOH 48  51  51  HOH HOH A . 
C 3 HOH 49  53  53  HOH HOH A . 
C 3 HOH 50  54  54  HOH HOH A . 
C 3 HOH 51  55  55  HOH HOH A . 
C 3 HOH 52  57  57  HOH HOH A . 
C 3 HOH 53  58  58  HOH HOH A . 
C 3 HOH 54  59  59  HOH HOH A . 
C 3 HOH 55  60  60  HOH HOH A . 
C 3 HOH 56  61  61  HOH HOH A . 
C 3 HOH 57  62  62  HOH HOH A . 
C 3 HOH 58  63  63  HOH HOH A . 
C 3 HOH 59  64  64  HOH HOH A . 
C 3 HOH 60  66  66  HOH HOH A . 
C 3 HOH 61  67  67  HOH HOH A . 
C 3 HOH 62  69  69  HOH HOH A . 
C 3 HOH 63  71  71  HOH HOH A . 
C 3 HOH 64  74  74  HOH HOH A . 
C 3 HOH 65  75  75  HOH HOH A . 
C 3 HOH 66  76  76  HOH HOH A . 
C 3 HOH 67  77  77  HOH HOH A . 
C 3 HOH 68  79  79  HOH HOH A . 
C 3 HOH 69  80  80  HOH HOH A . 
C 3 HOH 70  81  81  HOH HOH A . 
C 3 HOH 71  82  82  HOH HOH A . 
C 3 HOH 72  83  83  HOH HOH A . 
C 3 HOH 73  84  84  HOH HOH A . 
C 3 HOH 74  85  85  HOH HOH A . 
C 3 HOH 75  87  87  HOH HOH A . 
C 3 HOH 76  89  89  HOH HOH A . 
C 3 HOH 77  90  90  HOH HOH A . 
C 3 HOH 78  91  91  HOH HOH A . 
C 3 HOH 79  92  92  HOH HOH A . 
C 3 HOH 80  93  93  HOH HOH A . 
C 3 HOH 81  94  94  HOH HOH A . 
C 3 HOH 82  95  95  HOH HOH A . 
C 3 HOH 83  96  96  HOH HOH A . 
C 3 HOH 84  97  97  HOH HOH A . 
C 3 HOH 85  98  98  HOH HOH A . 
C 3 HOH 86  99  99  HOH HOH A . 
C 3 HOH 87  100 100 HOH HOH A . 
C 3 HOH 88  101 101 HOH HOH A . 
C 3 HOH 89  102 102 HOH HOH A . 
C 3 HOH 90  103 103 HOH HOH A . 
C 3 HOH 91  104 104 HOH HOH A . 
C 3 HOH 92  106 106 HOH HOH A . 
C 3 HOH 93  107 107 HOH HOH A . 
C 3 HOH 94  108 108 HOH HOH A . 
C 3 HOH 95  109 109 HOH HOH A . 
C 3 HOH 96  110 110 HOH HOH A . 
C 3 HOH 97  111 111 HOH HOH A . 
C 3 HOH 98  112 112 HOH HOH A . 
C 3 HOH 99  113 113 HOH HOH A . 
C 3 HOH 100 114 114 HOH HOH A . 
C 3 HOH 101 116 116 HOH HOH A . 
C 3 HOH 102 117 117 HOH HOH A . 
C 3 HOH 103 118 118 HOH HOH A . 
C 3 HOH 104 119 119 HOH HOH A . 
C 3 HOH 105 120 120 HOH HOH A . 
C 3 HOH 106 122 122 HOH HOH A . 
C 3 HOH 107 124 124 HOH HOH A . 
C 3 HOH 108 125 125 HOH HOH A . 
C 3 HOH 109 126 126 HOH HOH A . 
C 3 HOH 110 127 127 HOH HOH A . 
C 3 HOH 111 128 128 HOH HOH A . 
C 3 HOH 112 129 129 HOH HOH A . 
C 3 HOH 113 130 130 HOH HOH A . 
C 3 HOH 114 131 131 HOH HOH A . 
C 3 HOH 115 132 132 HOH HOH A . 
C 3 HOH 116 133 133 HOH HOH A . 
C 3 HOH 117 135 135 HOH HOH A . 
C 3 HOH 118 136 136 HOH HOH A . 
C 3 HOH 119 137 137 HOH HOH A . 
C 3 HOH 120 139 139 HOH HOH A . 
C 3 HOH 121 142 142 HOH HOH A . 
C 3 HOH 122 143 143 HOH HOH A . 
C 3 HOH 123 144 144 HOH HOH A . 
C 3 HOH 124 145 145 HOH HOH A . 
C 3 HOH 125 146 146 HOH HOH A . 
C 3 HOH 126 147 147 HOH HOH A . 
C 3 HOH 127 148 148 HOH HOH A . 
C 3 HOH 128 149 149 HOH HOH A . 
C 3 HOH 129 150 150 HOH HOH A . 
C 3 HOH 130 152 152 HOH HOH A . 
C 3 HOH 131 153 153 HOH HOH A . 
C 3 HOH 132 154 154 HOH HOH A . 
C 3 HOH 133 155 155 HOH HOH A . 
C 3 HOH 134 156 156 HOH HOH A . 
C 3 HOH 135 158 158 HOH HOH A . 
C 3 HOH 136 159 159 HOH HOH A . 
C 3 HOH 137 160 160 HOH HOH A . 
C 3 HOH 138 161 161 HOH HOH A . 
C 3 HOH 139 162 162 HOH HOH A . 
C 3 HOH 140 163 163 HOH HOH A . 
C 3 HOH 141 164 164 HOH HOH A . 
C 3 HOH 142 165 165 HOH HOH A . 
C 3 HOH 143 166 166 HOH HOH A . 
C 3 HOH 144 167 167 HOH HOH A . 
C 3 HOH 145 168 168 HOH HOH A . 
C 3 HOH 146 169 169 HOH HOH A . 
C 3 HOH 147 171 171 HOH HOH A . 
C 3 HOH 148 172 172 HOH HOH A . 
C 3 HOH 149 173 173 HOH HOH A . 
C 3 HOH 150 174 174 HOH HOH A . 
C 3 HOH 151 175 175 HOH HOH A . 
C 3 HOH 152 176 176 HOH HOH A . 
C 3 HOH 153 177 177 HOH HOH A . 
C 3 HOH 154 178 178 HOH HOH A . 
C 3 HOH 155 179 179 HOH HOH A . 
C 3 HOH 156 180 180 HOH HOH A . 
C 3 HOH 157 181 181 HOH HOH A . 
C 3 HOH 158 453 184 HOH HOH A . 
C 3 HOH 159 454 186 HOH HOH A . 
C 3 HOH 160 455 188 HOH HOH A . 
C 3 HOH 161 456 190 HOH HOH A . 
C 3 HOH 162 457 191 HOH HOH A . 
C 3 HOH 163 458 192 HOH HOH A . 
C 3 HOH 164 459 193 HOH HOH A . 
C 3 HOH 165 460 195 HOH HOH A . 
C 3 HOH 166 461 196 HOH HOH A . 
C 3 HOH 167 462 197 HOH HOH A . 
C 3 HOH 168 463 198 HOH HOH A . 
C 3 HOH 169 464 199 HOH HOH A . 
C 3 HOH 170 465 200 HOH HOH A . 
C 3 HOH 171 466 201 HOH HOH A . 
C 3 HOH 172 467 202 HOH HOH A . 
C 3 HOH 173 468 204 HOH HOH A . 
C 3 HOH 174 469 206 HOH HOH A . 
C 3 HOH 175 470 207 HOH HOH A . 
C 3 HOH 176 471 208 HOH HOH A . 
C 3 HOH 177 472 209 HOH HOH A . 
C 3 HOH 178 473 210 HOH HOH A . 
C 3 HOH 179 474 211 HOH HOH A . 
C 3 HOH 180 475 212 HOH HOH A . 
C 3 HOH 181 476 213 HOH HOH A . 
C 3 HOH 182 477 214 HOH HOH A . 
C 3 HOH 183 478 215 HOH HOH A . 
C 3 HOH 184 479 217 HOH HOH A . 
C 3 HOH 185 480 218 HOH HOH A . 
C 3 HOH 186 481 219 HOH HOH A . 
C 3 HOH 187 482 220 HOH HOH A . 
C 3 HOH 188 483 221 HOH HOH A . 
C 3 HOH 189 484 222 HOH HOH A . 
C 3 HOH 190 485 223 HOH HOH A . 
C 3 HOH 191 486 224 HOH HOH A . 
C 3 HOH 192 487 225 HOH HOH A . 
C 3 HOH 193 488 226 HOH HOH A . 
C 3 HOH 194 489 228 HOH HOH A . 
C 3 HOH 195 490 233 HOH HOH A . 
C 3 HOH 196 491 235 HOH HOH A . 
C 3 HOH 197 492 236 HOH HOH A . 
C 3 HOH 198 493 237 HOH HOH A . 
C 3 HOH 199 494 238 HOH HOH A . 
C 3 HOH 200 495 239 HOH HOH A . 
C 3 HOH 201 496 240 HOH HOH A . 
C 3 HOH 202 497 242 HOH HOH A . 
C 3 HOH 203 498 243 HOH HOH A . 
C 3 HOH 204 499 244 HOH HOH A . 
C 3 HOH 205 500 246 HOH HOH A . 
C 3 HOH 206 501 247 HOH HOH A . 
C 3 HOH 207 502 248 HOH HOH A . 
C 3 HOH 208 503 249 HOH HOH A . 
C 3 HOH 209 504 251 HOH HOH A . 
C 3 HOH 210 505 252 HOH HOH A . 
C 3 HOH 211 506 254 HOH HOH A . 
C 3 HOH 212 507 257 HOH HOH A . 
C 3 HOH 213 508 258 HOH HOH A . 
C 3 HOH 214 509 259 HOH HOH A . 
C 3 HOH 215 510 260 HOH HOH A . 
C 3 HOH 216 511 261 HOH HOH A . 
C 3 HOH 217 512 262 HOH HOH A . 
C 3 HOH 218 513 263 HOH HOH A . 
C 3 HOH 219 514 264 HOH HOH A . 
C 3 HOH 220 515 265 HOH HOH A . 
C 3 HOH 221 516 266 HOH HOH A . 
C 3 HOH 222 517 267 HOH HOH A . 
C 3 HOH 223 518 268 HOH HOH A . 
C 3 HOH 224 519 270 HOH HOH A . 
C 3 HOH 225 520 271 HOH HOH A . 
C 3 HOH 226 521 272 HOH HOH A . 
C 3 HOH 227 522 273 HOH HOH A . 
C 3 HOH 228 523 274 HOH HOH A . 
C 3 HOH 229 524 275 HOH HOH A . 
C 3 HOH 230 525 276 HOH HOH A . 
C 3 HOH 231 526 277 HOH HOH A . 
C 3 HOH 232 527 278 HOH HOH A . 
C 3 HOH 233 528 280 HOH HOH A . 
C 3 HOH 234 529 281 HOH HOH A . 
C 3 HOH 235 530 282 HOH HOH A . 
C 3 HOH 236 531 283 HOH HOH A . 
C 3 HOH 237 532 284 HOH HOH A . 
C 3 HOH 238 533 285 HOH HOH A . 
C 3 HOH 239 534 286 HOH HOH A . 
C 3 HOH 240 535 287 HOH HOH A . 
C 3 HOH 241 536 289 HOH HOH A . 
C 3 HOH 242 537 291 HOH HOH A . 
C 3 HOH 243 538 292 HOH HOH A . 
C 3 HOH 244 539 294 HOH HOH A . 
C 3 HOH 245 540 295 HOH HOH A . 
C 3 HOH 246 541 296 HOH HOH A . 
C 3 HOH 247 542 297 HOH HOH A . 
C 3 HOH 248 543 298 HOH HOH A . 
D 3 HOH 1   34  34  HOH HOH B . 
D 3 HOH 2   35  35  HOH HOH B . 
D 3 HOH 3   40  40  HOH HOH B . 
D 3 HOH 4   52  52  HOH HOH B . 
D 3 HOH 5   56  56  HOH HOH B . 
D 3 HOH 6   65  65  HOH HOH B . 
D 3 HOH 7   68  68  HOH HOH B . 
D 3 HOH 8   70  70  HOH HOH B . 
D 3 HOH 9   72  72  HOH HOH B . 
D 3 HOH 10  73  73  HOH HOH B . 
D 3 HOH 11  78  78  HOH HOH B . 
D 3 HOH 12  86  86  HOH HOH B . 
D 3 HOH 13  88  88  HOH HOH B . 
D 3 HOH 14  105 105 HOH HOH B . 
D 3 HOH 15  115 115 HOH HOH B . 
D 3 HOH 16  121 121 HOH HOH B . 
D 3 HOH 17  123 123 HOH HOH B . 
D 3 HOH 18  134 134 HOH HOH B . 
D 3 HOH 19  138 138 HOH HOH B . 
D 3 HOH 20  140 140 HOH HOH B . 
D 3 HOH 21  141 141 HOH HOH B . 
D 3 HOH 22  151 151 HOH HOH B . 
D 3 HOH 23  157 157 HOH HOH B . 
D 3 HOH 24  170 170 HOH HOH B . 
D 3 HOH 25  182 182 HOH HOH B . 
D 3 HOH 26  183 183 HOH HOH B . 
D 3 HOH 27  185 185 HOH HOH B . 
D 3 HOH 28  187 187 HOH HOH B . 
D 3 HOH 29  189 189 HOH HOH B . 
D 3 HOH 30  194 194 HOH HOH B . 
D 3 HOH 31  203 203 HOH HOH B . 
D 3 HOH 32  205 205 HOH HOH B . 
D 3 HOH 33  216 216 HOH HOH B . 
D 3 HOH 34  227 227 HOH HOH B . 
D 3 HOH 35  229 229 HOH HOH B . 
D 3 HOH 36  230 230 HOH HOH B . 
D 3 HOH 37  231 231 HOH HOH B . 
D 3 HOH 38  232 232 HOH HOH B . 
D 3 HOH 39  234 234 HOH HOH B . 
D 3 HOH 40  241 241 HOH HOH B . 
D 3 HOH 41  373 245 HOH HOH B . 
D 3 HOH 42  374 250 HOH HOH B . 
D 3 HOH 43  375 253 HOH HOH B . 
D 3 HOH 44  376 255 HOH HOH B . 
D 3 HOH 45  377 256 HOH HOH B . 
D 3 HOH 46  378 269 HOH HOH B . 
D 3 HOH 47  379 279 HOH HOH B . 
D 3 HOH 48  380 288 HOH HOH B . 
D 3 HOH 49  381 290 HOH HOH B . 
D 3 HOH 50  382 293 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 91  A MSE 272 ? MET SELENOMETHIONINE 
2  A MSE 120 A MSE 301 ? MET SELENOMETHIONINE 
3  A MSE 124 A MSE 305 ? MET SELENOMETHIONINE 
4  A MSE 145 A MSE 326 ? MET SELENOMETHIONINE 
5  A MSE 150 A MSE 331 ? MET SELENOMETHIONINE 
6  A MSE 156 A MSE 337 ? MET SELENOMETHIONINE 
7  A MSE 169 A MSE 350 ? MET SELENOMETHIONINE 
8  A MSE 194 A MSE 375 ? MET SELENOMETHIONINE 
9  A MSE 217 A MSE 398 ? MET SELENOMETHIONINE 
10 A MSE 221 A MSE 402 ? MET SELENOMETHIONINE 
11 A MSE 244 A MSE 425 ? MET SELENOMETHIONINE 
12 A MSE 248 A MSE 429 ? MET SELENOMETHIONINE 
13 A MSE 260 A MSE 441 ? MET SELENOMETHIONINE 
14 A MSE 268 A MSE 449 ? MET SELENOMETHIONINE 
15 B MSE 57  B MSE 300 ? MET SELENOMETHIONINE 
16 B MSE 91  B MSE 334 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1910  ? 
1 MORE         -11.2 ? 
1 'SSA (A^2)'  18630 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-29 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 3 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2         
2 3 'Structure model' struct_conn        
3 3 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_database_2.pdbx_DOI'                
2  3 'Structure model' '_database_2.pdbx_database_accession' 
3  3 'Structure model' '_struct_conn.pdbx_dist_value'        
4  3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5  3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'     
6  3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
7  3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
8  3 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
9  3 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
11 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'     
12 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
13 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
14 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
15 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
16 3 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
17 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
SOLVE    phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SE 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MSE 
_pdbx_validate_rmsd_bond.auth_seq_id_1             337 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MSE 
_pdbx_validate_rmsd_bond.auth_seq_id_2             337 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.548 
_pdbx_validate_rmsd_bond.bond_target_value         1.950 
_pdbx_validate_rmsd_bond.bond_deviation            -0.402 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.059 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ALA 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     257 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -153.38 
_pdbx_validate_torsion.psi             68.98 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MSE -1  ? A MSE 1   
2 1 Y 1 A ASN 183 ? A ASN 2   
3 1 Y 1 A LYS 184 ? A LYS 3   
4 1 Y 1 A LYS 452 ? A LYS 271 
5 1 Y 1 B GLY -4  ? B GLY 1   
6 1 Y 1 B SER -3  ? B SER 2   
7 1 Y 1 B HIS -2  ? B HIS 3   
8 1 Y 1 B MSE -1  ? B MSE 4   
9 1 Y 1 B ASP 248 ? B ASP 5   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#