data_3KSA
# 
_entry.id   3KSA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KSA         
NDB   NA0375       
RCSB  RCSB056384   
WWPDB D_1000056384 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3KSB 'DNA cleavage complex of type IIA topoisomerases (re-sealed form)'               unspecified 
PDB 3K9F 'Levofloxacin-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'  unspecified 
PDB 3FOE 'Clinafloxacin-DNA cleavage complex of type IV topoisomerase from S. pneumoniae' unspecified 
PDB 3FOF 'Moxifloxacin-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'  unspecified 
PDB 2NOV 'ParC55 domain of type IV topoisomerase from S. pneumoniae'                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KSA 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Laponogov, I.'   1 
'Pan, X.-S.'      2 
'Veselkov, D.A.'  3 
'McAuley, K.E.'   4 
'Fisher, L.M.'    5 
'Sanderson, M.R.' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases'         'Plos One'           5  e11338 
e11338 2010 ? US 1932-6203 ? ? 20596531 10.1371/journal.pone.0011338 
1       'Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases' Nat.Struct.Mol.Biol. 16 667    669 
2009 ? US 1545-9993 ? ? 19448616 10.1038/nsmb.1604            
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Laponogov, I.'   1  
primary 'Pan, X.-S.'      2  
primary 'Veselkov, D.A.'  3  
primary 'McAuley, K.E.'   4  
primary 'Fisher, L.M.'    5  
primary 'Sanderson, M.R.' 6  
1       'Laponogov, I.'   7  
1       'Sohi, M.K.'      8  
1       'Veselkov, D.A.'  9  
1       'Pan, X.-S.'      10 
1       'Sawhney, R.'     11 
1       'Thompson, A.W.'  12 
1       'McAuley, K.E.'   13 
1       'Fisher, L.M.'    14 
1       'Sanderson, M.R.' 15 
# 
_cell.entry_id           3KSA 
_cell.length_a           116.911 
_cell.length_b           116.911 
_cell.length_c           183.759 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KSA 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA topoisomerase 4 subunit A'                                      56455.434 2 5.99.1.- ? 'residues 1-488'   ? 
2 polymer     man 'DNA topoisomerase 4 subunit B'                                      30415.703 2 5.99.1.- ? 'residues 404-647' ? 
3 polymer     syn "5'-D(*AP*CP*CP*AP*AP*GP*GP*T*CP*AP*TP*GP*AP*AP*T)-3'"               4602.024  1 ?        ? ?                  
E-site 
4 polymer     syn "5'-D(P*AP*GP*TP*CP*AP*TP*TP*CP*AP*TP*GP*AP*CP*CP*TP*TP*GP*GP*T)-3'" 5810.770  1 ?        ? ?                  
E-site 
5 polymer     syn "5'-D(*CP*TP*GP*TP*TP*TP*TP*A*CP*GP*TP*GP*CP*AP*T)-3'"               4565.968  1 ?        ? ?                  
E-site 
6 polymer     syn "5'-D(P*GP*AP*CP*TP*AP*TP*GP*CP*AP*CP*GP*TP*AP*AP*AP*AP*CP*AP*G)-3'" 5846.827  1 ?        ? ?                  
E-site 
7 non-polymer syn 'MAGNESIUM ION'                                                      24.305    2 ?        ? ?                  ? 
8 water       nat water                                                                18.015    7 ?        ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ParC55, Topoisomerase IV subunit A' 
2 'ParE30, Topoisomerase IV subunit B' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
A,B ? 
2 'polypeptide(L)'        no no 
;MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
;
;MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
;
C,D ? 
3 polydeoxyribonucleotide no no '(DA)(DC)(DC)(DA)(DA)(DG)(DG)(DT)(DC)(DA)(DT)(DG)(DA)(DA)(DT)' ACCAAGGTCATGAAT E   ? 
4 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DG)(DA)(DC)(DC)(DT)(DT)(DG)(DG)(DT)' AGTCATTCATGACCTTGGT 
F   ? 
5 polydeoxyribonucleotide no no '(DC)(DT)(DG)(DT)(DT)(DT)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DA)(DT)' CTGTTTTACGTGCAT G   ? 
6 polydeoxyribonucleotide no no '(DG)(DA)(DC)(DT)(DA)(DT)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DA)(DA)(DA)(DC)(DA)(DG)' GACTATGCACGTAAAACAG 
H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   GLN n 
1 6   ASN n 
1 7   MET n 
1 8   SER n 
1 9   LEU n 
1 10  GLU n 
1 11  ASP n 
1 12  ILE n 
1 13  MET n 
1 14  GLY n 
1 15  GLU n 
1 16  ARG n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  TYR n 
1 21  SER n 
1 22  LYS n 
1 23  TYR n 
1 24  ILE n 
1 25  ILE n 
1 26  GLN n 
1 27  ASP n 
1 28  ARG n 
1 29  ALA n 
1 30  LEU n 
1 31  PRO n 
1 32  ASP n 
1 33  ILE n 
1 34  ARG n 
1 35  ASP n 
1 36  GLY n 
1 37  LEU n 
1 38  LYS n 
1 39  PRO n 
1 40  VAL n 
1 41  GLN n 
1 42  ARG n 
1 43  ARG n 
1 44  ILE n 
1 45  LEU n 
1 46  TYR n 
1 47  SER n 
1 48  MET n 
1 49  ASN n 
1 50  LYS n 
1 51  ASP n 
1 52  SER n 
1 53  ASN n 
1 54  THR n 
1 55  PHE n 
1 56  ASP n 
1 57  LYS n 
1 58  SER n 
1 59  TYR n 
1 60  ARG n 
1 61  LYS n 
1 62  SER n 
1 63  ALA n 
1 64  LYS n 
1 65  SER n 
1 66  VAL n 
1 67  GLY n 
1 68  ASN n 
1 69  ILE n 
1 70  MET n 
1 71  GLY n 
1 72  ASN n 
1 73  PHE n 
1 74  HIS n 
1 75  PRO n 
1 76  HIS n 
1 77  GLY n 
1 78  ASP n 
1 79  SER n 
1 80  SER n 
1 81  ILE n 
1 82  TYR n 
1 83  ASP n 
1 84  ALA n 
1 85  MET n 
1 86  VAL n 
1 87  ARG n 
1 88  MET n 
1 89  SER n 
1 90  GLN n 
1 91  ASN n 
1 92  TRP n 
1 93  LYS n 
1 94  ASN n 
1 95  ARG n 
1 96  GLU n 
1 97  ILE n 
1 98  LEU n 
1 99  VAL n 
1 100 GLU n 
1 101 MET n 
1 102 HIS n 
1 103 GLY n 
1 104 ASN n 
1 105 ASN n 
1 106 GLY n 
1 107 SER n 
1 108 MET n 
1 109 ASP n 
1 110 GLY n 
1 111 ASP n 
1 112 PRO n 
1 113 PRO n 
1 114 ALA n 
1 115 ALA n 
1 116 MET n 
1 117 ARG n 
1 118 TYR n 
1 119 THR n 
1 120 GLU n 
1 121 ALA n 
1 122 ARG n 
1 123 LEU n 
1 124 SER n 
1 125 GLU n 
1 126 ILE n 
1 127 ALA n 
1 128 GLY n 
1 129 TYR n 
1 130 LEU n 
1 131 LEU n 
1 132 GLN n 
1 133 ASP n 
1 134 ILE n 
1 135 GLU n 
1 136 LYS n 
1 137 LYS n 
1 138 THR n 
1 139 VAL n 
1 140 PRO n 
1 141 PHE n 
1 142 ALA n 
1 143 TRP n 
1 144 ASN n 
1 145 PHE n 
1 146 ASP n 
1 147 ASP n 
1 148 THR n 
1 149 GLU n 
1 150 LYS n 
1 151 GLU n 
1 152 PRO n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 PRO n 
1 157 ALA n 
1 158 ALA n 
1 159 PHE n 
1 160 PRO n 
1 161 ASN n 
1 162 LEU n 
1 163 LEU n 
1 164 VAL n 
1 165 ASN n 
1 166 GLY n 
1 167 SER n 
1 168 THR n 
1 169 GLY n 
1 170 ILE n 
1 171 SER n 
1 172 ALA n 
1 173 GLY n 
1 174 TYR n 
1 175 ALA n 
1 176 THR n 
1 177 ASP n 
1 178 ILE n 
1 179 PRO n 
1 180 PRO n 
1 181 HIS n 
1 182 ASN n 
1 183 LEU n 
1 184 ALA n 
1 185 GLU n 
1 186 VAL n 
1 187 ILE n 
1 188 ASP n 
1 189 ALA n 
1 190 ALA n 
1 191 VAL n 
1 192 TYR n 
1 193 MET n 
1 194 ILE n 
1 195 ASP n 
1 196 HIS n 
1 197 PRO n 
1 198 THR n 
1 199 ALA n 
1 200 LYS n 
1 201 ILE n 
1 202 ASP n 
1 203 LYS n 
1 204 LEU n 
1 205 MET n 
1 206 GLU n 
1 207 PHE n 
1 208 LEU n 
1 209 PRO n 
1 210 GLY n 
1 211 PRO n 
1 212 ASP n 
1 213 PHE n 
1 214 PRO n 
1 215 THR n 
1 216 GLY n 
1 217 ALA n 
1 218 ILE n 
1 219 ILE n 
1 220 GLN n 
1 221 GLY n 
1 222 ARG n 
1 223 ASP n 
1 224 GLU n 
1 225 ILE n 
1 226 LYS n 
1 227 LYS n 
1 228 ALA n 
1 229 TYR n 
1 230 GLU n 
1 231 THR n 
1 232 GLY n 
1 233 LYS n 
1 234 GLY n 
1 235 ARG n 
1 236 VAL n 
1 237 VAL n 
1 238 VAL n 
1 239 ARG n 
1 240 SER n 
1 241 LYS n 
1 242 THR n 
1 243 GLU n 
1 244 ILE n 
1 245 GLU n 
1 246 LYS n 
1 247 LEU n 
1 248 LYS n 
1 249 GLY n 
1 250 GLY n 
1 251 LYS n 
1 252 GLU n 
1 253 GLN n 
1 254 ILE n 
1 255 VAL n 
1 256 ILE n 
1 257 THR n 
1 258 GLU n 
1 259 ILE n 
1 260 PRO n 
1 261 TYR n 
1 262 GLU n 
1 263 ILE n 
1 264 ASN n 
1 265 LYS n 
1 266 ALA n 
1 267 ASN n 
1 268 LEU n 
1 269 VAL n 
1 270 LYS n 
1 271 LYS n 
1 272 ILE n 
1 273 ASP n 
1 274 ASP n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASN n 
1 279 ASN n 
1 280 LYS n 
1 281 VAL n 
1 282 ALA n 
1 283 GLY n 
1 284 ILE n 
1 285 ALA n 
1 286 GLU n 
1 287 VAL n 
1 288 ARG n 
1 289 ASP n 
1 290 GLU n 
1 291 SER n 
1 292 ASP n 
1 293 ARG n 
1 294 ASP n 
1 295 GLY n 
1 296 LEU n 
1 297 ARG n 
1 298 ILE n 
1 299 ALA n 
1 300 ILE n 
1 301 GLU n 
1 302 LEU n 
1 303 LYS n 
1 304 LYS n 
1 305 ASP n 
1 306 ALA n 
1 307 ASN n 
1 308 THR n 
1 309 GLU n 
1 310 LEU n 
1 311 VAL n 
1 312 LEU n 
1 313 ASN n 
1 314 TYR n 
1 315 LEU n 
1 316 PHE n 
1 317 LYS n 
1 318 TYR n 
1 319 THR n 
1 320 ASP n 
1 321 LEU n 
1 322 GLN n 
1 323 ILE n 
1 324 ASN n 
1 325 TYR n 
1 326 ASN n 
1 327 PHE n 
1 328 ASN n 
1 329 MET n 
1 330 VAL n 
1 331 ALA n 
1 332 ILE n 
1 333 ASP n 
1 334 ASN n 
1 335 PHE n 
1 336 THR n 
1 337 PRO n 
1 338 ARG n 
1 339 GLN n 
1 340 VAL n 
1 341 GLY n 
1 342 ILE n 
1 343 VAL n 
1 344 PRO n 
1 345 ILE n 
1 346 LEU n 
1 347 SER n 
1 348 SER n 
1 349 TYR n 
1 350 ILE n 
1 351 ALA n 
1 352 HIS n 
1 353 ARG n 
1 354 ARG n 
1 355 GLU n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ALA n 
1 360 ARG n 
1 361 SER n 
1 362 ARG n 
1 363 PHE n 
1 364 ASP n 
1 365 LYS n 
1 366 GLU n 
1 367 LYS n 
1 368 ALA n 
1 369 GLU n 
1 370 LYS n 
1 371 ARG n 
1 372 LEU n 
1 373 HIS n 
1 374 ILE n 
1 375 VAL n 
1 376 GLU n 
1 377 GLY n 
1 378 LEU n 
1 379 ILE n 
1 380 ARG n 
1 381 VAL n 
1 382 ILE n 
1 383 SER n 
1 384 ILE n 
1 385 LEU n 
1 386 ASP n 
1 387 GLU n 
1 388 VAL n 
1 389 ILE n 
1 390 ALA n 
1 391 LEU n 
1 392 ILE n 
1 393 ARG n 
1 394 ALA n 
1 395 SER n 
1 396 GLU n 
1 397 ASN n 
1 398 LYS n 
1 399 ALA n 
1 400 ASP n 
1 401 ALA n 
1 402 LYS n 
1 403 GLU n 
1 404 ASN n 
1 405 LEU n 
1 406 LYS n 
1 407 VAL n 
1 408 SER n 
1 409 TYR n 
1 410 ASP n 
1 411 PHE n 
1 412 THR n 
1 413 GLU n 
1 414 GLU n 
1 415 GLN n 
1 416 ALA n 
1 417 GLU n 
1 418 ALA n 
1 419 ILE n 
1 420 VAL n 
1 421 THR n 
1 422 LEU n 
1 423 GLN n 
1 424 LEU n 
1 425 TYR n 
1 426 ARG n 
1 427 LEU n 
1 428 THR n 
1 429 ASN n 
1 430 THR n 
1 431 ASP n 
1 432 VAL n 
1 433 VAL n 
1 434 VAL n 
1 435 LEU n 
1 436 GLN n 
1 437 GLU n 
1 438 GLU n 
1 439 GLU n 
1 440 ALA n 
1 441 GLU n 
1 442 LEU n 
1 443 ARG n 
1 444 GLU n 
1 445 LYS n 
1 446 ILE n 
1 447 ALA n 
1 448 MET n 
1 449 LEU n 
1 450 ALA n 
1 451 ALA n 
1 452 ILE n 
1 453 ILE n 
1 454 GLY n 
1 455 ASP n 
1 456 GLU n 
1 457 ARG n 
1 458 THR n 
1 459 MET n 
1 460 TYR n 
1 461 ASN n 
1 462 LEU n 
1 463 MET n 
1 464 LYS n 
1 465 LYS n 
1 466 GLU n 
1 467 LEU n 
1 468 ARG n 
1 469 GLU n 
1 470 VAL n 
1 471 LYS n 
1 472 LYS n 
1 473 LYS n 
1 474 PHE n 
1 475 ALA n 
1 476 THR n 
1 477 PRO n 
1 478 ARG n 
1 479 LEU n 
1 480 SER n 
1 481 SER n 
1 482 LEU n 
1 483 GLU n 
1 484 ASP n 
1 485 THR n 
1 486 ALA n 
1 487 LYS n 
1 488 ALA n 
1 489 LEU n 
1 490 GLU n 
1 491 HIS n 
1 492 HIS n 
1 493 HIS n 
1 494 HIS n 
1 495 HIS n 
1 496 HIS n 
2 1   MET n 
2 2   GLY n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  HIS n 
2 12  HIS n 
2 13  SER n 
2 14  SER n 
2 15  GLY n 
2 16  HIS n 
2 17  ILE n 
2 18  ASP n 
2 19  ASP n 
2 20  ASP n 
2 21  ASP n 
2 22  LYS n 
2 23  HIS n 
2 24  MET n 
2 25  LYS n 
2 26  ASN n 
2 27  LYS n 
2 28  LYS n 
2 29  ASP n 
2 30  LYS n 
2 31  GLY n 
2 32  LEU n 
2 33  LEU n 
2 34  SER n 
2 35  GLY n 
2 36  LYS n 
2 37  LEU n 
2 38  THR n 
2 39  PRO n 
2 40  ALA n 
2 41  GLN n 
2 42  SER n 
2 43  LYS n 
2 44  ASN n 
2 45  PRO n 
2 46  ALA n 
2 47  LYS n 
2 48  ASN n 
2 49  GLU n 
2 50  LEU n 
2 51  TYR n 
2 52  LEU n 
2 53  VAL n 
2 54  GLU n 
2 55  GLY n 
2 56  ASP n 
2 57  SER n 
2 58  ALA n 
2 59  GLY n 
2 60  GLY n 
2 61  SER n 
2 62  ALA n 
2 63  LYS n 
2 64  GLN n 
2 65  GLY n 
2 66  ARG n 
2 67  ASP n 
2 68  ARG n 
2 69  LYS n 
2 70  PHE n 
2 71  GLN n 
2 72  ALA n 
2 73  ILE n 
2 74  LEU n 
2 75  PRO n 
2 76  LEU n 
2 77  ARG n 
2 78  GLY n 
2 79  LYS n 
2 80  VAL n 
2 81  ILE n 
2 82  ASN n 
2 83  THR n 
2 84  ALA n 
2 85  LYS n 
2 86  ALA n 
2 87  LYS n 
2 88  MET n 
2 89  ALA n 
2 90  ASP n 
2 91  ILE n 
2 92  LEU n 
2 93  LYS n 
2 94  ASN n 
2 95  GLU n 
2 96  GLU n 
2 97  ILE n 
2 98  ASN n 
2 99  THR n 
2 100 MET n 
2 101 ILE n 
2 102 TYR n 
2 103 THR n 
2 104 ILE n 
2 105 GLY n 
2 106 ALA n 
2 107 GLY n 
2 108 VAL n 
2 109 GLY n 
2 110 ALA n 
2 111 ASP n 
2 112 PHE n 
2 113 SER n 
2 114 ILE n 
2 115 GLU n 
2 116 ASP n 
2 117 ALA n 
2 118 ASN n 
2 119 TYR n 
2 120 ASP n 
2 121 LYS n 
2 122 ILE n 
2 123 ILE n 
2 124 ILE n 
2 125 MET n 
2 126 THR n 
2 127 ASP n 
2 128 ALA n 
2 129 ASP n 
2 130 THR n 
2 131 ASP n 
2 132 GLY n 
2 133 ALA n 
2 134 HIS n 
2 135 ILE n 
2 136 GLN n 
2 137 THR n 
2 138 LEU n 
2 139 LEU n 
2 140 LEU n 
2 141 THR n 
2 142 PHE n 
2 143 PHE n 
2 144 TYR n 
2 145 ARG n 
2 146 TYR n 
2 147 MET n 
2 148 ARG n 
2 149 PRO n 
2 150 LEU n 
2 151 VAL n 
2 152 GLU n 
2 153 ALA n 
2 154 GLY n 
2 155 HIS n 
2 156 VAL n 
2 157 TYR n 
2 158 ILE n 
2 159 ALA n 
2 160 LEU n 
2 161 PRO n 
2 162 PRO n 
2 163 LEU n 
2 164 TYR n 
2 165 LYS n 
2 166 MET n 
2 167 SER n 
2 168 LYS n 
2 169 GLY n 
2 170 LYS n 
2 171 GLY n 
2 172 LYS n 
2 173 LYS n 
2 174 GLU n 
2 175 GLU n 
2 176 VAL n 
2 177 ALA n 
2 178 TYR n 
2 179 ALA n 
2 180 TRP n 
2 181 THR n 
2 182 ASP n 
2 183 GLY n 
2 184 GLU n 
2 185 LEU n 
2 186 GLU n 
2 187 GLU n 
2 188 LEU n 
2 189 ARG n 
2 190 LYS n 
2 191 GLN n 
2 192 PHE n 
2 193 GLY n 
2 194 LYS n 
2 195 GLY n 
2 196 ALA n 
2 197 THR n 
2 198 LEU n 
2 199 GLN n 
2 200 ARG n 
2 201 TYR n 
2 202 LYS n 
2 203 GLY n 
2 204 LEU n 
2 205 GLY n 
2 206 GLU n 
2 207 MET n 
2 208 ASN n 
2 209 ALA n 
2 210 ASP n 
2 211 GLN n 
2 212 LEU n 
2 213 TRP n 
2 214 GLU n 
2 215 THR n 
2 216 THR n 
2 217 MET n 
2 218 ASN n 
2 219 PRO n 
2 220 GLU n 
2 221 THR n 
2 222 ARG n 
2 223 THR n 
2 224 LEU n 
2 225 ILE n 
2 226 ARG n 
2 227 VAL n 
2 228 THR n 
2 229 ILE n 
2 230 GLU n 
2 231 ASP n 
2 232 LEU n 
2 233 ALA n 
2 234 ARG n 
2 235 ALA n 
2 236 GLU n 
2 237 ARG n 
2 238 ARG n 
2 239 VAL n 
2 240 ASN n 
2 241 VAL n 
2 242 LEU n 
2 243 MET n 
2 244 GLY n 
2 245 ASP n 
2 246 LYS n 
2 247 VAL n 
2 248 GLU n 
2 249 PRO n 
2 250 ARG n 
2 251 ARG n 
2 252 LYS n 
2 253 TRP n 
2 254 ILE n 
2 255 GLU n 
2 256 ASP n 
2 257 ASN n 
2 258 VAL n 
2 259 LYS n 
2 260 PHE n 
2 261 THR n 
2 262 LEU n 
2 263 GLU n 
2 264 GLU n 
2 265 ALA n 
2 266 THR n 
2 267 VAL n 
2 268 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DC  n 
3 4   DA  n 
3 5   DA  n 
3 6   DG  n 
3 7   DG  n 
3 8   DT  n 
3 9   DC  n 
3 10  DA  n 
3 11  DT  n 
3 12  DG  n 
3 13  DA  n 
3 14  DA  n 
3 15  DT  n 
4 1   DA  n 
4 2   DG  n 
4 3   DT  n 
4 4   DC  n 
4 5   DA  n 
4 6   DT  n 
4 7   DT  n 
4 8   DC  n 
4 9   DA  n 
4 10  DT  n 
4 11  DG  n 
4 12  DA  n 
4 13  DC  n 
4 14  DC  n 
4 15  DT  n 
4 16  DT  n 
4 17  DG  n 
4 18  DG  n 
4 19  DT  n 
5 1   DC  n 
5 2   DT  n 
5 3   DG  n 
5 4   DT  n 
5 5   DT  n 
5 6   DT  n 
5 7   DT  n 
5 8   DA  n 
5 9   DC  n 
5 10  DG  n 
5 11  DT  n 
5 12  DG  n 
5 13  DC  n 
5 14  DA  n 
5 15  DT  n 
6 1   DG  n 
6 2   DA  n 
6 3   DC  n 
6 4   DT  n 
6 5   DA  n 
6 6   DT  n 
6 7   DG  n 
6 8   DC  n 
6 9   DA  n 
6 10  DC  n 
6 11  DG  n 
6 12  DT  n 
6 13  DA  n 
6 14  DA  n 
6 15  DA  n 
6 16  DA  n 
6 17  DC  n 
6 18  DA  n 
6 19  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? parC ? 7785 ? ? ? ? 'Streptococcus pneumoniae' 1313 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? Plasmid ? ? ? pET29A ? ? 
2 1 sample ? ? ? ? ? parE ? 7785 ? ? ? ? 'Streptococcus pneumoniae' 1313 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? Plasmid ? ? ? pET19B ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PARC_STRPN P72525 1 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKA
;
1   ? 
2 UNP PARE_STRPN Q59961 2 
;KNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTI
GAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDGE
LEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLEE
ATVF
;
404 ? 
3 PDB 3KSA       3KSA   3 ACCAAGGTCATGAAT 1   ? 
4 PDB 3KSA       3KSA   4 AGTCATTCATGACCTTGGT 1   ? 
5 PDB 3KSA       3KSA   5 CTGTTTTACGTGCAT 1   ? 
6 PDB 3KSA       3KSA   6 GACTATGCACGTAAAACAG 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KSA A 1  ? 488 ? P72525 1   ? 488 ? 1   488 
2 1 3KSA B 1  ? 488 ? P72525 1   ? 488 ? 1   488 
3 2 3KSA C 25 ? 268 ? Q59961 404 ? 647 ? 404 647 
4 2 3KSA D 25 ? 268 ? Q59961 404 ? 647 ? 404 647 
5 3 3KSA E 1  ? 15  ? 3KSA   1   ? 15  ? 1   15  
6 4 3KSA F 1  ? 19  ? 3KSA   1   ? 19  ? 1   19  
7 5 3KSA G 1  ? 15  ? 3KSA   1   ? 15  ? 1   15  
8 6 3KSA H 1  ? 19  ? 3KSA   1   ? 19  ? 1   19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KSA LEU A 489 ? UNP P72525 ? ? 'EXPRESSION TAG'        489 1  
1 3KSA GLU A 490 ? UNP P72525 ? ? 'EXPRESSION TAG'        490 2  
1 3KSA HIS A 491 ? UNP P72525 ? ? 'EXPRESSION TAG'        491 3  
1 3KSA HIS A 492 ? UNP P72525 ? ? 'EXPRESSION TAG'        492 4  
1 3KSA HIS A 493 ? UNP P72525 ? ? 'EXPRESSION TAG'        493 5  
1 3KSA HIS A 494 ? UNP P72525 ? ? 'EXPRESSION TAG'        494 6  
1 3KSA HIS A 495 ? UNP P72525 ? ? 'EXPRESSION TAG'        495 7  
1 3KSA HIS A 496 ? UNP P72525 ? ? 'EXPRESSION TAG'        496 8  
2 3KSA LEU B 489 ? UNP P72525 ? ? 'EXPRESSION TAG'        489 9  
2 3KSA GLU B 490 ? UNP P72525 ? ? 'EXPRESSION TAG'        490 10 
2 3KSA HIS B 491 ? UNP P72525 ? ? 'EXPRESSION TAG'        491 11 
2 3KSA HIS B 492 ? UNP P72525 ? ? 'EXPRESSION TAG'        492 12 
2 3KSA HIS B 493 ? UNP P72525 ? ? 'EXPRESSION TAG'        493 13 
2 3KSA HIS B 494 ? UNP P72525 ? ? 'EXPRESSION TAG'        494 14 
2 3KSA HIS B 495 ? UNP P72525 ? ? 'EXPRESSION TAG'        495 15 
2 3KSA HIS B 496 ? UNP P72525 ? ? 'EXPRESSION TAG'        496 16 
3 3KSA MET C 1   ? UNP Q59961 ? ? 'INITIATING METHIONINE' 380 17 
3 3KSA GLY C 2   ? UNP Q59961 ? ? 'EXPRESSION TAG'        381 18 
3 3KSA HIS C 3   ? UNP Q59961 ? ? 'EXPRESSION TAG'        382 19 
3 3KSA HIS C 4   ? UNP Q59961 ? ? 'EXPRESSION TAG'        383 20 
3 3KSA HIS C 5   ? UNP Q59961 ? ? 'EXPRESSION TAG'        384 21 
3 3KSA HIS C 6   ? UNP Q59961 ? ? 'EXPRESSION TAG'        385 22 
3 3KSA HIS C 7   ? UNP Q59961 ? ? 'EXPRESSION TAG'        386 23 
3 3KSA HIS C 8   ? UNP Q59961 ? ? 'EXPRESSION TAG'        387 24 
3 3KSA HIS C 9   ? UNP Q59961 ? ? 'EXPRESSION TAG'        388 25 
3 3KSA HIS C 10  ? UNP Q59961 ? ? 'EXPRESSION TAG'        389 26 
3 3KSA HIS C 11  ? UNP Q59961 ? ? 'EXPRESSION TAG'        390 27 
3 3KSA HIS C 12  ? UNP Q59961 ? ? 'EXPRESSION TAG'        391 28 
3 3KSA SER C 13  ? UNP Q59961 ? ? 'EXPRESSION TAG'        392 29 
3 3KSA SER C 14  ? UNP Q59961 ? ? 'EXPRESSION TAG'        393 30 
3 3KSA GLY C 15  ? UNP Q59961 ? ? 'EXPRESSION TAG'        394 31 
3 3KSA HIS C 16  ? UNP Q59961 ? ? 'EXPRESSION TAG'        395 32 
3 3KSA ILE C 17  ? UNP Q59961 ? ? 'EXPRESSION TAG'        396 33 
3 3KSA ASP C 18  ? UNP Q59961 ? ? 'EXPRESSION TAG'        397 34 
3 3KSA ASP C 19  ? UNP Q59961 ? ? 'EXPRESSION TAG'        398 35 
3 3KSA ASP C 20  ? UNP Q59961 ? ? 'EXPRESSION TAG'        399 36 
3 3KSA ASP C 21  ? UNP Q59961 ? ? 'EXPRESSION TAG'        400 37 
3 3KSA LYS C 22  ? UNP Q59961 ? ? 'EXPRESSION TAG'        401 38 
3 3KSA HIS C 23  ? UNP Q59961 ? ? 'EXPRESSION TAG'        402 39 
3 3KSA MET C 24  ? UNP Q59961 ? ? 'EXPRESSION TAG'        403 40 
4 3KSA MET D 1   ? UNP Q59961 ? ? 'INITIATING METHIONINE' 380 41 
4 3KSA GLY D 2   ? UNP Q59961 ? ? 'EXPRESSION TAG'        381 42 
4 3KSA HIS D 3   ? UNP Q59961 ? ? 'EXPRESSION TAG'        382 43 
4 3KSA HIS D 4   ? UNP Q59961 ? ? 'EXPRESSION TAG'        383 44 
4 3KSA HIS D 5   ? UNP Q59961 ? ? 'EXPRESSION TAG'        384 45 
4 3KSA HIS D 6   ? UNP Q59961 ? ? 'EXPRESSION TAG'        385 46 
4 3KSA HIS D 7   ? UNP Q59961 ? ? 'EXPRESSION TAG'        386 47 
4 3KSA HIS D 8   ? UNP Q59961 ? ? 'EXPRESSION TAG'        387 48 
4 3KSA HIS D 9   ? UNP Q59961 ? ? 'EXPRESSION TAG'        388 49 
4 3KSA HIS D 10  ? UNP Q59961 ? ? 'EXPRESSION TAG'        389 50 
4 3KSA HIS D 11  ? UNP Q59961 ? ? 'EXPRESSION TAG'        390 51 
4 3KSA HIS D 12  ? UNP Q59961 ? ? 'EXPRESSION TAG'        391 52 
4 3KSA SER D 13  ? UNP Q59961 ? ? 'EXPRESSION TAG'        392 53 
4 3KSA SER D 14  ? UNP Q59961 ? ? 'EXPRESSION TAG'        393 54 
4 3KSA GLY D 15  ? UNP Q59961 ? ? 'EXPRESSION TAG'        394 55 
4 3KSA HIS D 16  ? UNP Q59961 ? ? 'EXPRESSION TAG'        395 56 
4 3KSA ILE D 17  ? UNP Q59961 ? ? 'EXPRESSION TAG'        396 57 
4 3KSA ASP D 18  ? UNP Q59961 ? ? 'EXPRESSION TAG'        397 58 
4 3KSA ASP D 19  ? UNP Q59961 ? ? 'EXPRESSION TAG'        398 59 
4 3KSA ASP D 20  ? UNP Q59961 ? ? 'EXPRESSION TAG'        399 60 
4 3KSA ASP D 21  ? UNP Q59961 ? ? 'EXPRESSION TAG'        400 61 
4 3KSA LYS D 22  ? UNP Q59961 ? ? 'EXPRESSION TAG'        401 62 
4 3KSA HIS D 23  ? UNP Q59961 ? ? 'EXPRESSION TAG'        402 63 
4 3KSA MET D 24  ? UNP Q59961 ? ? 'EXPRESSION TAG'        403 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3KSA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.73 
_exptl_crystal.density_percent_sol   66.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'4-5% isopropanol, optimised mixture of salts, 50mM Na cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-08-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
# 
_reflns.entry_id                     3KSA 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.3 
_reflns.number_obs                   41533 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              0.08 
_reflns.pdbx_netI_over_sigmaI        15.725 
_reflns.B_iso_Wilson_estimate        116.060 
_reflns.pdbx_redundancy              5.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.3 
_reflns_shell.d_res_low              3.42 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.461 
_reflns_shell.pdbx_Rsym_value        0.461 
_reflns_shell.meanI_over_sigI_obs    3.512 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4232 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3KSA 
_refine.ls_number_reflns_obs                     41250 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.403 
_refine.ls_d_res_high                            3.300 
_refine.ls_percent_reflns_obs                    97.77 
_refine.ls_R_factor_obs                          0.1805 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1762 
_refine.ls_R_factor_R_free                       0.2181 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.09 
_refine.ls_number_reflns_R_free                  4164 
_refine.ls_number_reflns_R_work                  37086 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               136.591 
_refine.aniso_B[1][1]                            1.332 
_refine.aniso_B[2][2]                            1.332 
_refine.aniso_B[3][3]                            -49.123 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.279 
_refine.solvent_model_param_bsol                 115.475 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3K9F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic+TLS 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.12 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                400.19 
_refine.B_iso_min                                64.69 
_refine.pdbx_overall_phase_error                 22.090 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10079 
_refine_hist.pdbx_number_atoms_nucleic_acid   730 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               10818 
_refine_hist.d_res_high                       3.300 
_refine_hist.d_res_low                        29.403 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           11602 0.027  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          15224 1.295  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     1812  0.082  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1845  0.006  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 6429  20.231 ? ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
'X-RAY DIFFRACTION' 1 1 POSITIONAL A 3426 0.017 ? 1 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1 2 POSITIONAL B 3426 0.017 ? 2 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 POSITIONAL C 1589 0.017 ? 3 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 POSITIONAL D 1589 0.017 ? 4 ? ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.3000  3.3375  1268 0.2966 100.00 0.3576 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 3.3375  3.3767  1248 0.2589 100.00 0.3095 . . 108 . . . . 'X-RAY DIFFRACTION' 
. 3.3767  3.4178  1313 0.2633 99.00  0.3319 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 3.4178  3.4610  1248 0.2608 99.00  0.3515 . . 127 . . . . 'X-RAY DIFFRACTION' 
. 3.4610  3.5065  1286 0.2354 99.00  0.3219 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 3.5065  3.5545  1241 0.2194 99.00  0.2726 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.5545  3.6051  1238 0.2206 100.00 0.2348 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.6051  3.6589  1284 0.2126 99.00  0.2735 . . 124 . . . . 'X-RAY DIFFRACTION' 
. 3.6589  3.7159  1247 0.1984 99.00  0.2384 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 3.7159  3.7767  1265 0.1754 100.00 0.2302 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 3.7767  3.8417  1225 0.1803 100.00 0.2377 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 3.8417  3.9114  1289 0.1647 99.00  0.2005 . . 161 . . . . 'X-RAY DIFFRACTION' 
. 3.9114  3.9865  1216 0.1612 99.00  0.1994 . . 114 . . . . 'X-RAY DIFFRACTION' 
. 3.9865  4.0676  1263 0.1614 99.00  0.2330 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 4.0676  4.1558  1275 0.1553 100.00 0.2202 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 4.1558  4.2522  1244 0.1571 100.00 0.2090 . . 158 . . . . 'X-RAY DIFFRACTION' 
. 4.2522  4.3583  1261 0.1329 100.00 0.1937 . . 154 . . . . 'X-RAY DIFFRACTION' 
. 4.3583  4.4757  1262 0.1220 100.00 0.1741 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 4.4757  4.6069  1226 0.1170 100.00 0.1503 . . 166 . . . . 'X-RAY DIFFRACTION' 
. 4.6069  4.7550  1266 0.1197 100.00 0.1706 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 4.7550  4.9242  1263 0.1239 100.00 0.1648 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 4.9242  5.1204  1275 0.1407 100.00 0.1797 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 5.1204  5.3521  1282 0.1437 100.00 0.2172 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 5.3521  5.6324  1242 0.1563 100.00 0.2234 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 5.6324  5.9825  1248 0.1730 100.00 0.2090 . . 158 . . . . 'X-RAY DIFFRACTION' 
. 5.9825  6.4400  1299 0.1760 100.00 0.2271 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 6.4400  7.0798  1251 0.1713 100.00 0.2336 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 7.0798  8.0856  1271 0.1702 100.00 0.2027 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 8.0856  10.1176 1153 0.1678 92.00  0.1685 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 10.1176 29.4043 637  0.2486 50.00  0.2285 . . 73  . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 C 
2 2 D 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 3   A 246 'chain A and (resseq 3:246 or resseq 253:285 or resseq 287:483 )'                     ? ? ? ? ? ? ? ? 
1 1 2 ? A 253 A 285 'chain A and (resseq 3:246 or resseq 253:285 or resseq 287:483 )'                     ? ? ? ? ? ? ? ? 
1 1 3 ? A 287 A 483 'chain A and (resseq 3:246 or resseq 253:285 or resseq 287:483 )'                     ? ? ? ? ? ? ? ? 
1 2 1 ? B 3   B 246 'chain B and (resseq 3:246 or resseq 253:285 or resseq 287:483 )'                     ? ? ? ? ? ? ? ? 
1 2 2 ? B 253 B 285 'chain B and (resseq 3:246 or resseq 253:285 or resseq 287:483 )'                     ? ? ? ? ? ? ? ? 
1 2 3 ? B 287 B 483 'chain B and (resseq 3:246 or resseq 253:285 or resseq 287:483 )'                     ? ? ? ? ? ? ? ? 
2 1 1 ? C 415 C 487 'chain C and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 1 2 ? C 490 C 494 'chain C and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 1 3 ? C 496 C 547 'chain C and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 1 4 ? C 553 C 640 'chain C and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 2 1 ? D 415 D 487 'chain D and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 2 2 ? D 490 D 494 'chain D and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 2 3 ? D 496 D 547 'chain D and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
2 2 4 ? D 553 D 640 'chain D and (resseq 415:487 or resseq 490:494 or resseq 496:547 or resseq 553:640 )' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3KSA 
_struct.title                     
'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (cleaved form)' 
_struct.pdbx_descriptor           
'DNA topoisomerase 4 subunit A (E.C.5.99.1.-), DNA topoisomerase 4 subunit B (E.C.5.99.1.-)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KSA 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA 
_struct_keywords.text            
;Topoisomerase, protein-DNA cleavage complex, Streptococcus pneumoniae, DNA-binding, nucleotide-binding, quinolone, Cleaved form, ISOMERASE-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 9   ? ARG A 28  ? LEU A 9   ARG A 28  1 ? 20 
HELX_P HELX_P2  2  LYS A 38  ? ASP A 51  ? LYS A 38  ASP A 51  1 ? 14 
HELX_P HELX_P3  3  SER A 62  ? PHE A 73  ? SER A 62  PHE A 73  1 ? 12 
HELX_P HELX_P4  4  GLY A 77  ? MET A 88  ? GLY A 77  MET A 88  1 ? 12 
HELX_P HELX_P5  5  SER A 124 ? GLN A 132 ? SER A 124 GLN A 132 1 ? 9  
HELX_P HELX_P6  6  PRO A 160 ? ASN A 165 ? PRO A 160 ASN A 165 1 ? 6  
HELX_P HELX_P7  7  ASN A 182 ? HIS A 196 ? ASN A 182 HIS A 196 1 ? 15 
HELX_P HELX_P8  8  LYS A 200 ? LEU A 208 ? LYS A 200 LEU A 208 1 ? 9  
HELX_P HELX_P9  9  GLY A 221 ? GLY A 232 ? GLY A 221 GLY A 232 1 ? 12 
HELX_P HELX_P10 10 ASN A 264 ? ASN A 278 ? ASN A 264 ASN A 278 1 ? 15 
HELX_P HELX_P11 11 ASN A 307 ? THR A 319 ? ASN A 307 THR A 319 1 ? 13 
HELX_P HELX_P12 12 GLY A 341 ? ALA A 394 ? GLY A 341 ALA A 394 1 ? 54 
HELX_P HELX_P13 13 ASN A 397 ? TYR A 409 ? ASN A 397 TYR A 409 1 ? 13 
HELX_P HELX_P14 14 THR A 412 ? LEU A 422 ? THR A 412 LEU A 422 1 ? 11 
HELX_P HELX_P15 15 LEU A 424 ? ASN A 429 ? LEU A 424 ASN A 429 5 ? 6  
HELX_P HELX_P16 16 ASP A 431 ? GLY A 454 ? ASP A 431 GLY A 454 1 ? 24 
HELX_P HELX_P17 17 GLU A 456 ? ALA A 475 ? GLU A 456 ALA A 475 1 ? 20 
HELX_P HELX_P18 18 LEU B 9   ? ARG B 28  ? LEU B 9   ARG B 28  1 ? 20 
HELX_P HELX_P19 19 LYS B 38  ? ASP B 51  ? LYS B 38  ASP B 51  1 ? 14 
HELX_P HELX_P20 20 SER B 62  ? PHE B 73  ? SER B 62  PHE B 73  1 ? 12 
HELX_P HELX_P21 21 GLY B 77  ? MET B 88  ? GLY B 77  MET B 88  1 ? 12 
HELX_P HELX_P22 22 SER B 124 ? GLN B 132 ? SER B 124 GLN B 132 1 ? 9  
HELX_P HELX_P23 23 PRO B 160 ? GLY B 166 ? PRO B 160 GLY B 166 1 ? 7  
HELX_P HELX_P24 24 ASN B 182 ? HIS B 196 ? ASN B 182 HIS B 196 1 ? 15 
HELX_P HELX_P25 25 LYS B 200 ? LEU B 208 ? LYS B 200 LEU B 208 1 ? 9  
HELX_P HELX_P26 26 GLY B 221 ? GLY B 232 ? GLY B 221 GLY B 232 1 ? 12 
HELX_P HELX_P27 27 ASN B 264 ? ASN B 278 ? ASN B 264 ASN B 278 1 ? 15 
HELX_P HELX_P28 28 ASN B 307 ? THR B 319 ? ASN B 307 THR B 319 1 ? 13 
HELX_P HELX_P29 29 GLY B 341 ? ALA B 394 ? GLY B 341 ALA B 394 1 ? 54 
HELX_P HELX_P30 30 ASN B 397 ? TYR B 409 ? ASN B 397 TYR B 409 1 ? 13 
HELX_P HELX_P31 31 THR B 412 ? LEU B 422 ? THR B 412 LEU B 422 1 ? 11 
HELX_P HELX_P32 32 LEU B 424 ? ASN B 429 ? LEU B 424 ASN B 429 5 ? 6  
HELX_P HELX_P33 33 ASP B 431 ? GLY B 454 ? ASP B 431 GLY B 454 1 ? 24 
HELX_P HELX_P34 34 GLU B 456 ? ALA B 475 ? GLU B 456 ALA B 475 1 ? 20 
HELX_P HELX_P35 35 GLY C 55  ? GLY C 65  ? GLY C 434 GLY C 444 1 ? 11 
HELX_P HELX_P36 36 MET C 88  ? LYS C 93  ? MET C 467 LYS C 472 1 ? 6  
HELX_P HELX_P37 37 ASN C 94  ? GLY C 105 ? ASN C 473 GLY C 484 1 ? 12 
HELX_P HELX_P38 38 ASP C 129 ? TYR C 146 ? ASP C 508 TYR C 525 1 ? 18 
HELX_P HELX_P39 39 MET C 147 ? GLY C 154 ? MET C 526 GLY C 533 1 ? 8  
HELX_P HELX_P40 40 THR C 181 ? GLY C 193 ? THR C 560 GLY C 572 1 ? 13 
HELX_P HELX_P41 41 GLY C 203 ? MET C 207 ? GLY C 582 MET C 586 5 ? 5  
HELX_P HELX_P42 42 ASN C 208 ? MET C 217 ? ASN C 587 MET C 596 1 ? 10 
HELX_P HELX_P43 43 LEU C 232 ? MET C 243 ? LEU C 611 MET C 622 1 ? 12 
HELX_P HELX_P44 44 VAL C 247 ? VAL C 258 ? VAL C 626 VAL C 637 1 ? 12 
HELX_P HELX_P45 45 GLY D 55  ? GLY D 65  ? GLY D 434 GLY D 444 1 ? 11 
HELX_P HELX_P46 46 MET D 88  ? LYS D 93  ? MET D 467 LYS D 472 1 ? 6  
HELX_P HELX_P47 47 ASN D 94  ? GLY D 105 ? ASN D 473 GLY D 484 1 ? 12 
HELX_P HELX_P48 48 ASP D 129 ? TYR D 146 ? ASP D 508 TYR D 525 1 ? 18 
HELX_P HELX_P49 49 MET D 147 ? GLY D 154 ? MET D 526 GLY D 533 1 ? 8  
HELX_P HELX_P50 50 ASP D 182 ? GLY D 193 ? ASP D 561 GLY D 572 1 ? 12 
HELX_P HELX_P51 51 GLY D 203 ? MET D 207 ? GLY D 582 MET D 586 5 ? 5  
HELX_P HELX_P52 52 ASN D 208 ? MET D 217 ? ASN D 587 MET D 596 1 ? 10 
HELX_P HELX_P53 53 LEU D 232 ? MET D 243 ? LEU D 611 MET D 622 1 ? 12 
HELX_P HELX_P54 54 VAL D 247 ? VAL D 258 ? VAL D 626 VAL D 637 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A TYR 118 OH    ? ? ? 1_555 F DA 1  P  ? ? A TYR 118 F DA 1   1_555 ? ? ? ? ? ? ?               1.602 ? 
covale2  covale ? ? B TYR 118 OH    ? ? ? 1_555 H DG 1  P  ? ? B TYR 118 H DG 1   1_555 ? ? ? ? ? ? ?               1.603 ? 
metalc1  metalc ? ? D GLU 54  OE1   ? ? ? 1_555 J MG .  MG ? ? D GLU 433 D MG 742 1_555 ? ? ? ? ? ? ?               2.589 ? 
metalc2  metalc ? ? C GLU 54  OE1   ? ? ? 1_555 I MG .  MG ? ? C GLU 433 C MG 742 1_555 ? ? ? ? ? ? ?               2.832 ? 
metalc3  metalc ? ? C ASP 127 OD2   ? ? ? 1_555 I MG .  MG ? ? C ASP 506 C MG 742 1_555 ? ? ? ? ? ? ?               2.916 ? 
metalc4  metalc ? ? D ASP 127 OD2   ? ? ? 1_555 J MG .  MG ? ? D ASP 506 D MG 742 1_555 ? ? ? ? ? ? ?               2.955 ? 
metalc5  metalc ? ? G DT  15  "O3'" ? ? ? 1_555 J MG .  MG ? ? G DT  15  D MG 742 1_555 ? ? ? ? ? ? ?               2.962 ? 
hydrog1  hydrog ? ? E DC  9   N4    ? ? ? 1_555 F DT 10 O4 ? ? E DC  9   F DT 10  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog2  hydrog ? ? E DC  9   N3    ? ? ? 1_555 F DG 11 N1 ? ? E DC  9   F DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? E DC  9   N4    ? ? ? 1_555 F DG 11 O6 ? ? E DC  9   F DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? E DC  9   O2    ? ? ? 1_555 F DG 11 N2 ? ? E DC  9   F DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? E DA  10  N1    ? ? ? 1_555 F DT 10 N3 ? ? E DA  10  F DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? E DA  10  N6    ? ? ? 1_555 F DT 10 O4 ? ? E DA  10  F DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? E DT  11  N3    ? ? ? 1_555 F DA 9  N1 ? ? E DT  11  F DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? E DT  11  O4    ? ? ? 1_555 F DA 9  N6 ? ? E DT  11  F DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? E DG  12  N1    ? ? ? 1_555 F DC 8  N3 ? ? E DG  12  F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? E DG  12  N2    ? ? ? 1_555 F DC 8  O2 ? ? E DG  12  F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? E DG  12  O6    ? ? ? 1_555 F DC 8  N4 ? ? E DG  12  F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? E DA  13  N1    ? ? ? 1_555 F DT 7  N3 ? ? E DA  13  F DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? E DA  13  N6    ? ? ? 1_555 F DT 7  O4 ? ? E DA  13  F DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? E DA  14  N1    ? ? ? 1_555 F DT 6  N3 ? ? E DA  14  F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? E DA  14  N6    ? ? ? 1_555 F DT 6  O4 ? ? E DA  14  F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? E DT  15  N3    ? ? ? 1_555 F DA 5  N1 ? ? E DT  15  F DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? E DT  15  O4    ? ? ? 1_555 F DA 5  N6 ? ? E DT  15  F DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? F DA  1   N1    ? ? ? 1_555 H DT 4  N3 ? ? F DA  1   H DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? F DA  1   N6    ? ? ? 1_555 H DT 4  O4 ? ? F DA  1   H DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? F DG  2   N1    ? ? ? 1_555 H DC 3  N3 ? ? F DG  2   H DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? F DG  2   N2    ? ? ? 1_555 H DC 3  O2 ? ? F DG  2   H DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? F DG  2   O6    ? ? ? 1_555 H DC 3  N4 ? ? F DG  2   H DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? F DT  3   N3    ? ? ? 1_555 H DA 2  N1 ? ? F DT  3   H DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? F DT  3   O4    ? ? ? 1_555 H DA 2  N6 ? ? F DT  3   H DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? F DT  3   N3    ? ? ? 1_555 H DC 3  N3 ? ? F DT  3   H DC 3   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog26 hydrog ? ? F DT  3   O4    ? ? ? 1_555 H DC 3  N4 ? ? F DT  3   H DC 3   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog27 hydrog ? ? F DC  4   N3    ? ? ? 1_555 H DG 1  N1 ? ? F DC  4   H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? F DC  4   N4    ? ? ? 1_555 H DG 1  O6 ? ? F DC  4   H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? F DC  4   O2    ? ? ? 1_555 H DG 1  N2 ? ? F DC  4   H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? G DC  9   N3    ? ? ? 1_555 H DG 11 N1 ? ? G DC  9   H DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? G DC  9   N4    ? ? ? 1_555 H DG 11 O6 ? ? G DC  9   H DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? G DC  9   O2    ? ? ? 1_555 H DG 11 N2 ? ? G DC  9   H DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? G DG  10  N1    ? ? ? 1_555 H DA 9  N1 ? ? G DG  10  H DA 9   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog34 hydrog ? ? G DG  10  O6    ? ? ? 1_555 H DA 9  N6 ? ? G DG  10  H DA 9   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog35 hydrog ? ? G DG  10  N1    ? ? ? 1_555 H DC 10 N3 ? ? G DG  10  H DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? G DG  10  N2    ? ? ? 1_555 H DC 10 O2 ? ? G DG  10  H DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ? ? G DG  10  O6    ? ? ? 1_555 H DC 10 N4 ? ? G DG  10  H DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ? ? G DT  11  N3    ? ? ? 1_555 H DA 9  N1 ? ? G DT  11  H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ? ? G DT  11  O4    ? ? ? 1_555 H DA 9  N6 ? ? G DT  11  H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? G DG  12  N1    ? ? ? 1_555 H DC 8  N3 ? ? G DG  12  H DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41 hydrog ? ? G DG  12  N2    ? ? ? 1_555 H DC 8  O2 ? ? G DG  12  H DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ? ? G DG  12  O6    ? ? ? 1_555 H DC 8  N4 ? ? G DG  12  H DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43 hydrog ? ? G DC  13  N3    ? ? ? 1_555 H DG 7  N1 ? ? G DC  13  H DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44 hydrog ? ? G DC  13  N4    ? ? ? 1_555 H DG 7  O6 ? ? G DC  13  H DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45 hydrog ? ? G DC  13  O2    ? ? ? 1_555 H DG 7  N2 ? ? G DC  13  H DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ? ? G DA  14  N1    ? ? ? 1_555 H DT 6  N3 ? ? G DA  14  H DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ? ? G DA  14  N6    ? ? ? 1_555 H DT 6  O4 ? ? G DA  14  H DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48 hydrog ? ? G DT  15  N3    ? ? ? 1_555 H DA 5  N1 ? ? G DT  15  H DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ? ? G DT  15  O4    ? ? ? 1_555 H DA 5  N6 ? ? G DT  15  H DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 168 A . ? THR 168 A GLY 169 A ? GLY 169 A 1 -6.22 
2 THR 168 B . ? THR 168 B GLY 169 B ? GLY 169 B 1 -5.91 
3 ALA 117 C . ? ALA 496 C ASN 118 C ? ASN 497 C 1 2.34  
4 ALA 117 D . ? ALA 496 D ASN 118 D ? ASN 497 D 1 1.77  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
H ? 6 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
N ? 2 ? 
O ? 3 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 4   ? SER A 8   ? ILE A 4   SER A 8   
A 2 LEU C 224 ? THR C 228 ? LEU C 603 THR C 607 
A 3 VAL C 156 ? ALA C 159 ? VAL C 535 ALA C 538 
A 4 LYS C 121 ? ILE C 124 ? LYS C 500 ILE C 503 
A 5 GLU C 49  ? VAL C 53  ? GLU C 428 VAL C 432 
A 6 GLN C 71  ? PRO C 75  ? GLN C 450 PRO C 454 
B 1 ARG A 60  ? LYS A 61  ? ARG A 60  LYS A 61  
B 2 GLU A 120 ? LEU A 123 ? GLU A 120 LEU A 123 
B 3 VAL A 99  ? HIS A 102 ? VAL A 99  HIS A 102 
C 1 PHE A 141 ? TRP A 143 ? PHE A 141 TRP A 143 
C 2 LYS A 150 ? PRO A 152 ? LYS A 150 PRO A 152 
D 1 SER A 167 ? ILE A 170 ? SER A 167 ILE A 170 
D 2 ALA A 175 ? ILE A 178 ? ALA A 175 ILE A 178 
E 1 GLN A 322 ? ASN A 328 ? GLN A 322 ASN A 328 
E 2 LYS A 233 ? ARG A 239 ? LYS A 233 ARG A 239 
E 3 ILE A 218 ? GLN A 220 ? ILE A 218 GLN A 220 
E 4 SER A 481 ? LEU A 482 ? SER A 481 LEU A 482 
F 1 THR A 242 ? ILE A 244 ? THR A 242 ILE A 244 
F 2 ILE A 254 ? ILE A 256 ? ILE A 254 ILE A 256 
F 3 ILE A 298 ? ILE A 300 ? ILE A 298 ILE A 300 
F 4 ARG A 288 ? ASP A 289 ? ARG A 288 ASP A 289 
G 1 VAL A 330 ? ASP A 333 ? VAL A 330 ASP A 333 
G 2 THR A 336 ? GLN A 339 ? THR A 336 GLN A 339 
H 1 ILE B 4   ? SER B 8   ? ILE B 4   SER B 8   
H 2 LEU D 224 ? THR D 228 ? LEU D 603 THR D 607 
H 3 VAL D 156 ? ALA D 159 ? VAL D 535 ALA D 538 
H 4 LYS D 121 ? ILE D 124 ? LYS D 500 ILE D 503 
H 5 GLU D 49  ? VAL D 53  ? GLU D 428 VAL D 432 
H 6 GLN D 71  ? PRO D 75  ? GLN D 450 PRO D 454 
I 1 ARG B 60  ? LYS B 61  ? ARG B 60  LYS B 61  
I 2 GLU B 120 ? LEU B 123 ? GLU B 120 LEU B 123 
I 3 VAL B 99  ? HIS B 102 ? VAL B 99  HIS B 102 
J 1 PHE B 141 ? TRP B 143 ? PHE B 141 TRP B 143 
J 2 LYS B 150 ? PRO B 152 ? LYS B 150 PRO B 152 
K 1 SER B 167 ? ILE B 170 ? SER B 167 ILE B 170 
K 2 ALA B 175 ? ILE B 178 ? ALA B 175 ILE B 178 
L 1 GLN B 322 ? ASN B 328 ? GLN B 322 ASN B 328 
L 2 LYS B 233 ? ARG B 239 ? LYS B 233 ARG B 239 
L 3 ILE B 218 ? GLN B 220 ? ILE B 218 GLN B 220 
L 4 SER B 481 ? LEU B 482 ? SER B 481 LEU B 482 
M 1 THR B 242 ? ILE B 244 ? THR B 242 ILE B 244 
M 2 ILE B 254 ? ILE B 256 ? ILE B 254 ILE B 256 
M 3 ILE B 298 ? ILE B 300 ? ILE B 298 ILE B 300 
M 4 ARG B 288 ? ASP B 289 ? ARG B 288 ASP B 289 
N 1 VAL B 330 ? ASP B 333 ? VAL B 330 ASP B 333 
N 2 THR B 336 ? GLN B 339 ? THR B 336 GLN B 339 
O 1 VAL C 176 ? ALA C 179 ? VAL C 555 ALA C 558 
O 2 TYR C 164 ? SER C 167 ? TYR C 543 SER C 546 
O 3 THR C 197 ? ARG C 200 ? THR C 576 ARG C 579 
P 1 VAL D 176 ? ALA D 179 ? VAL D 555 ALA D 558 
P 2 TYR D 164 ? SER D 167 ? TYR D 543 SER D 546 
P 3 THR D 197 ? ARG D 200 ? THR D 576 ARG D 579 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 5   ? N GLN A 5   O LEU C 224 ? O LEU C 603 
A 2 3 O ILE C 225 ? O ILE C 604 N ILE C 158 ? N ILE C 537 
A 3 4 O TYR C 157 ? O TYR C 536 N ILE C 122 ? N ILE C 501 
A 4 5 O ILE C 123 ? O ILE C 502 N LEU C 50  ? N LEU C 429 
A 5 6 N GLU C 49  ? N GLU C 428 O ALA C 72  ? O ALA C 451 
B 1 2 N ARG A 60  ? N ARG A 60  O ALA A 121 ? O ALA A 121 
B 2 3 O GLU A 120 ? O GLU A 120 N HIS A 102 ? N HIS A 102 
C 1 2 N ALA A 142 ? N ALA A 142 O GLU A 151 ? O GLU A 151 
D 1 2 N GLY A 169 ? N GLY A 169 O THR A 176 ? O THR A 176 
E 1 2 O PHE A 327 ? O PHE A 327 N GLY A 234 ? N GLY A 234 
E 2 3 O ARG A 239 ? O ARG A 239 N ILE A 218 ? N ILE A 218 
E 3 4 N ILE A 219 ? N ILE A 219 O SER A 481 ? O SER A 481 
F 1 2 N GLU A 243 ? N GLU A 243 O VAL A 255 ? O VAL A 255 
F 2 3 N ILE A 254 ? N ILE A 254 O ILE A 300 ? O ILE A 300 
F 3 4 O ALA A 299 ? O ALA A 299 N ARG A 288 ? N ARG A 288 
G 1 2 N ALA A 331 ? N ALA A 331 O ARG A 338 ? O ARG A 338 
H 1 2 N GLN B 5   ? N GLN B 5   O LEU D 224 ? O LEU D 603 
H 2 3 O ILE D 225 ? O ILE D 604 N ILE D 158 ? N ILE D 537 
H 3 4 O TYR D 157 ? O TYR D 536 N ILE D 122 ? N ILE D 501 
H 4 5 O ILE D 123 ? O ILE D 502 N LEU D 50  ? N LEU D 429 
H 5 6 N GLU D 49  ? N GLU D 428 O ALA D 72  ? O ALA D 451 
I 1 2 N ARG B 60  ? N ARG B 60  O ALA B 121 ? O ALA B 121 
I 2 3 O GLU B 120 ? O GLU B 120 N HIS B 102 ? N HIS B 102 
J 1 2 N ALA B 142 ? N ALA B 142 O GLU B 151 ? O GLU B 151 
K 1 2 N GLY B 169 ? N GLY B 169 O THR B 176 ? O THR B 176 
L 1 2 O PHE B 327 ? O PHE B 327 N GLY B 234 ? N GLY B 234 
L 2 3 O ARG B 239 ? O ARG B 239 N ILE B 218 ? N ILE B 218 
L 3 4 N ILE B 219 ? N ILE B 219 O SER B 481 ? O SER B 481 
M 1 2 N GLU B 243 ? N GLU B 243 O VAL B 255 ? O VAL B 255 
M 2 3 N ILE B 254 ? N ILE B 254 O ILE B 300 ? O ILE B 300 
M 3 4 O ALA B 299 ? O ALA B 299 N ARG B 288 ? N ARG B 288 
N 1 2 N ALA B 331 ? N ALA B 331 O ARG B 338 ? O ARG B 338 
O 1 2 O ALA C 179 ? O ALA C 558 N TYR C 164 ? N TYR C 543 
O 2 3 N LYS C 165 ? N LYS C 544 O GLN C 199 ? O GLN C 578 
P 1 2 O ALA D 179 ? O ALA D 558 N TYR D 164 ? N TYR D 543 
P 2 3 N LYS D 165 ? N LYS D 544 O GLN D 199 ? O GLN D 578 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG C 742' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG D 742' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 GLU C 54  ? GLU C 433 . ? 1_555 ? 
2 AC1 5 ASP C 127 ? ASP C 506 . ? 1_555 ? 
3 AC1 5 ASP C 129 ? ASP C 508 . ? 1_555 ? 
4 AC1 5 DT  E 15  ? DT  E 15  . ? 1_555 ? 
5 AC1 5 DG  H 1   ? DG  H 1   . ? 1_555 ? 
6 AC2 4 GLU D 54  ? GLU D 433 . ? 1_555 ? 
7 AC2 4 ASP D 127 ? ASP D 506 . ? 1_555 ? 
8 AC2 4 DA  F 1   ? DA  F 1   . ? 1_555 ? 
9 AC2 4 DT  G 15  ? DT  G 15  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KSA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KSA 
_atom_sites.fract_transf_matrix[1][1]   0.008554 
_atom_sites.fract_transf_matrix[1][2]   0.004938 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009877 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005442 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A 1 3   ? 7.326   68.456 -30.745 1.00 151.83 ? 3   ASN A N     1 
ATOM   2     C  CA    . ASN A 1 3   ? 7.560   67.142 -30.141 1.00 152.57 ? 3   ASN A CA    1 
ATOM   3     C  C     . ASN A 1 3   ? 7.111   66.025 -31.064 1.00 160.80 ? 3   ASN A C     1 
ATOM   4     O  O     . ASN A 1 3   ? 6.045   66.090 -31.680 1.00 149.84 ? 3   ASN A O     1 
ATOM   5     C  CB    . ASN A 1 3   ? 6.931   66.965 -28.744 1.00 124.91 ? 3   ASN A CB    1 
ATOM   6     N  N     . ILE A 1 4   ? 7.971   65.026 -31.196 1.00 170.59 ? 4   ILE A N     1 
ATOM   7     C  CA    . ILE A 1 4   ? 7.707   63.900 -32.067 1.00 153.89 ? 4   ILE A CA    1 
ATOM   8     C  C     . ILE A 1 4   ? 8.595   62.719 -31.655 1.00 154.88 ? 4   ILE A C     1 
ATOM   9     O  O     . ILE A 1 4   ? 9.809   62.871 -31.489 1.00 159.28 ? 4   ILE A O     1 
ATOM   10    C  CB    . ILE A 1 4   ? 7.939   64.287 -33.534 1.00 135.43 ? 4   ILE A CB    1 
ATOM   11    C  CG1   . ILE A 1 4   ? 8.091   63.050 -34.402 1.00 140.96 ? 4   ILE A CG1   1 
ATOM   12    C  CG2   . ILE A 1 4   ? 9.161   65.157 -33.662 1.00 140.52 ? 4   ILE A CG2   1 
ATOM   13    C  CD1   . ILE A 1 4   ? 6.932   62.823 -35.302 1.00 150.21 ? 4   ILE A CD1   1 
ATOM   14    N  N     . GLN A 1 5   ? 7.994   61.544 -31.495 1.00 148.04 ? 5   GLN A N     1 
ATOM   15    C  CA    . GLN A 1 5   ? 8.768   60.326 -31.273 1.00 134.54 ? 5   GLN A CA    1 
ATOM   16    C  C     . GLN A 1 5   ? 8.729   59.497 -32.545 1.00 144.56 ? 5   GLN A C     1 
ATOM   17    O  O     . GLN A 1 5   ? 7.680   59.276 -33.155 1.00 142.20 ? 5   GLN A O     1 
ATOM   18    C  CB    . GLN A 1 5   ? 8.323   59.501 -30.048 1.00 95.27  ? 5   GLN A CB    1 
ATOM   19    N  N     . ASN A 1 6   ? 9.901   59.031 -32.927 1.00 143.30 ? 6   ASN A N     1 
ATOM   20    C  CA    . ASN A 1 6   ? 10.090  58.427 -34.215 1.00 141.73 ? 6   ASN A CA    1 
ATOM   21    C  C     . ASN A 1 6   ? 10.143  56.931 -33.955 1.00 138.03 ? 6   ASN A C     1 
ATOM   22    O  O     . ASN A 1 6   ? 10.953  56.462 -33.166 1.00 153.98 ? 6   ASN A O     1 
ATOM   23    C  CB    . ASN A 1 6   ? 11.405  58.971 -34.799 1.00 138.01 ? 6   ASN A CB    1 
ATOM   24    C  CG    . ASN A 1 6   ? 11.339  59.218 -36.301 1.00 133.29 ? 6   ASN A CG    1 
ATOM   25    O  OD1   . ASN A 1 6   ? 10.519  58.626 -37.013 1.00 131.68 ? 6   ASN A OD1   1 
ATOM   26    N  ND2   . ASN A 1 6   ? 12.221  60.090 -36.793 1.00 121.89 ? 6   ASN A ND2   1 
ATOM   27    N  N     . MET A 1 7   ? 9.247   56.179 -34.574 1.00 122.35 ? 7   MET A N     1 
ATOM   28    C  CA    . MET A 1 7   ? 9.220   54.744 -34.347 1.00 125.72 ? 7   MET A CA    1 
ATOM   29    C  C     . MET A 1 7   ? 9.161   53.986 -35.657 1.00 137.98 ? 7   MET A C     1 
ATOM   30    O  O     . MET A 1 7   ? 8.641   54.500 -36.654 1.00 148.07 ? 7   MET A O     1 
ATOM   31    C  CB    . MET A 1 7   ? 8.018   54.371 -33.497 1.00 130.86 ? 7   MET A CB    1 
ATOM   32    C  CG    . MET A 1 7   ? 8.070   54.922 -32.108 1.00 135.05 ? 7   MET A CG    1 
ATOM   33    S  SD    . MET A 1 7   ? 7.038   53.904 -31.081 1.00 152.73 ? 7   MET A SD    1 
ATOM   34    C  CE    . MET A 1 7   ? 7.039   54.825 -29.539 1.00 327.97 ? 7   MET A CE    1 
ATOM   35    N  N     . SER A 1 8   ? 9.674   52.758 -35.667 1.00 136.59 ? 8   SER A N     1 
ATOM   36    C  CA    . SER A 1 8   ? 9.649   52.001 -36.907 1.00 144.28 ? 8   SER A CA    1 
ATOM   37    C  C     . SER A 1 8   ? 8.260   51.421 -37.171 1.00 137.60 ? 8   SER A C     1 
ATOM   38    O  O     . SER A 1 8   ? 7.313   51.656 -36.431 1.00 148.43 ? 8   SER A O     1 
ATOM   39    C  CB    . SER A 1 8   ? 10.662  50.855 -36.841 1.00 152.03 ? 8   SER A CB    1 
ATOM   40    O  OG    . SER A 1 8   ? 10.003  49.625 -36.572 1.00 155.85 ? 8   SER A OG    1 
ATOM   41    N  N     . LEU A 1 9   ? 8.162   50.622 -38.218 1.00 124.88 ? 9   LEU A N     1 
ATOM   42    C  CA    . LEU A 1 9   ? 6.901   50.055 -38.627 1.00 117.67 ? 9   LEU A CA    1 
ATOM   43    C  C     . LEU A 1 9   ? 6.845   48.679 -38.018 1.00 125.00 ? 9   LEU A C     1 
ATOM   44    O  O     . LEU A 1 9   ? 5.786   48.205 -37.608 1.00 131.38 ? 9   LEU A O     1 
ATOM   45    C  CB    . LEU A 1 9   ? 6.850   49.983 -40.154 1.00 119.73 ? 9   LEU A CB    1 
ATOM   46    C  CG    . LEU A 1 9   ? 5.495   49.697 -40.788 1.00 123.48 ? 9   LEU A CG    1 
ATOM   47    C  CD1   . LEU A 1 9   ? 5.355   48.224 -41.056 1.00 126.13 ? 9   LEU A CD1   1 
ATOM   48    C  CD2   . LEU A 1 9   ? 4.375   50.188 -39.885 1.00 125.16 ? 9   LEU A CD2   1 
ATOM   49    N  N     . GLU A 1 10  ? 8.005   48.028 -37.994 1.00 135.20 ? 10  GLU A N     1 
ATOM   50    C  CA    . GLU A 1 10  ? 8.120   46.670 -37.485 1.00 133.15 ? 10  GLU A CA    1 
ATOM   51    C  C     . GLU A 1 10  ? 7.757   46.671 -36.007 1.00 141.63 ? 10  GLU A C     1 
ATOM   52    O  O     . GLU A 1 10  ? 6.852   45.947 -35.567 1.00 130.11 ? 10  GLU A O     1 
ATOM   53    C  CB    . GLU A 1 10  ? 9.548   46.147 -37.680 1.00 112.21 ? 10  GLU A CB    1 
ATOM   54    N  N     . ASP A 1 11  ? 8.462   47.514 -35.253 1.00 142.60 ? 11  ASP A N     1 
ATOM   55    C  CA    . ASP A 1 11  ? 8.284   47.616 -33.807 1.00 133.07 ? 11  ASP A CA    1 
ATOM   56    C  C     . ASP A 1 11  ? 6.874   48.092 -33.403 1.00 126.43 ? 11  ASP A C     1 
ATOM   57    O  O     . ASP A 1 11  ? 6.217   47.489 -32.550 1.00 125.82 ? 11  ASP A O     1 
ATOM   58    C  CB    . ASP A 1 11  ? 9.399   48.482 -33.190 1.00 110.23 ? 11  ASP A CB    1 
ATOM   59    N  N     . ILE A 1 12  ? 6.407   49.167 -34.018 1.00 116.90 ? 12  ILE A N     1 
ATOM   60    C  CA    . ILE A 1 12  ? 5.049   49.637 -33.771 1.00 113.73 ? 12  ILE A CA    1 
ATOM   61    C  C     . ILE A 1 12  ? 3.999   48.560 -34.017 1.00 110.44 ? 12  ILE A C     1 
ATOM   62    O  O     . ILE A 1 12  ? 3.102   48.375 -33.203 1.00 103.67 ? 12  ILE A O     1 
ATOM   63    C  CB    . ILE A 1 12  ? 4.722   50.837 -34.649 1.00 106.12 ? 12  ILE A CB    1 
ATOM   64    C  CG1   . ILE A 1 12  ? 5.419   52.067 -34.079 1.00 105.23 ? 12  ILE A CG1   1 
ATOM   65    C  CG2   . ILE A 1 12  ? 3.207   51.009 -34.769 1.00 87.78  ? 12  ILE A CG2   1 
ATOM   66    C  CD1   . ILE A 1 12  ? 5.148   53.295 -34.862 1.00 118.09 ? 12  ILE A CD1   1 
ATOM   67    N  N     . MET A 1 13  ? 4.106   47.879 -35.156 1.00 115.01 ? 13  MET A N     1 
ATOM   68    C  CA    . MET A 1 13  ? 3.197   46.801 -35.519 1.00 109.71 ? 13  MET A CA    1 
ATOM   69    C  C     . MET A 1 13  ? 3.300   45.680 -34.500 1.00 115.46 ? 13  MET A C     1 
ATOM   70    O  O     . MET A 1 13  ? 2.293   45.041 -34.153 1.00 102.35 ? 13  MET A O     1 
ATOM   71    C  CB    . MET A 1 13  ? 3.525   46.281 -36.916 1.00 115.80 ? 13  MET A CB    1 
ATOM   72    C  CG    . MET A 1 13  ? 2.803   46.997 -38.050 1.00 117.34 ? 13  MET A CG    1 
ATOM   73    S  SD    . MET A 1 13  ? 1.236   46.207 -38.454 1.00 145.26 ? 13  MET A SD    1 
ATOM   74    C  CE    . MET A 1 13  ? 1.758   44.499 -38.574 1.00 205.62 ? 13  MET A CE    1 
ATOM   75    N  N     . GLY A 1 14  ? 4.529   45.448 -34.036 1.00 122.06 ? 14  GLY A N     1 
ATOM   76    C  CA    . GLY A 1 14  ? 4.809   44.507 -32.961 1.00 122.78 ? 14  GLY A CA    1 
ATOM   77    C  C     . GLY A 1 14  ? 4.020   44.773 -31.686 1.00 115.01 ? 14  GLY A C     1 
ATOM   78    O  O     . GLY A 1 14  ? 3.144   43.979 -31.346 1.00 111.03 ? 14  GLY A O     1 
ATOM   79    N  N     . GLU A 1 15  ? 4.284   45.892 -31.003 1.00 107.65 ? 15  GLU A N     1 
ATOM   80    C  CA    . GLU A 1 15  ? 3.533   46.220 -29.784 1.00 105.21 ? 15  GLU A CA    1 
ATOM   81    C  C     . GLU A 1 15  ? 2.040   46.184 -30.033 1.00 105.05 ? 15  GLU A C     1 
ATOM   82    O  O     . GLU A 1 15  ? 1.317   45.432 -29.385 1.00 106.54 ? 15  GLU A O     1 
ATOM   83    C  CB    . GLU A 1 15  ? 3.875   47.597 -29.213 1.00 89.05  ? 15  GLU A CB    1 
ATOM   84    N  N     . ARG A 1 16  ? 1.581   46.986 -30.985 1.00 99.45  ? 16  ARG A N     1 
ATOM   85    C  CA    . ARG A 1 16  ? 0.153   47.121 -31.203 1.00 104.89 ? 16  ARG A CA    1 
ATOM   86    C  C     . ARG A 1 16  ? -0.517  45.780 -31.437 1.00 112.71 ? 16  ARG A C     1 
ATOM   87    O  O     . ARG A 1 16  ? -1.642  45.578 -31.003 1.00 124.26 ? 16  ARG A O     1 
ATOM   88    C  CB    . ARG A 1 16  ? -0.184  48.105 -32.321 1.00 107.50 ? 16  ARG A CB    1 
ATOM   89    C  CG    . ARG A 1 16  ? 0.323   49.529 -32.108 1.00 112.99 ? 16  ARG A CG    1 
ATOM   90    C  CD    . ARG A 1 16  ? 0.383   49.861 -30.645 1.00 132.21 ? 16  ARG A CD    1 
ATOM   91    N  NE    . ARG A 1 16  ? -0.076  51.221 -30.385 1.00 146.19 ? 16  ARG A NE    1 
ATOM   92    C  CZ    . ARG A 1 16  ? 0.663   52.316 -30.545 1.00 146.94 ? 16  ARG A CZ    1 
ATOM   93    N  NH1   . ARG A 1 16  ? 1.920   52.225 -30.981 1.00 150.17 ? 16  ARG A NH1   1 
ATOM   94    N  NH2   . ARG A 1 16  ? 0.136   53.505 -30.266 1.00 133.93 ? 16  ARG A NH2   1 
ATOM   95    N  N     . PHE A 1 17  ? 0.139   44.858 -32.130 1.00 112.94 ? 17  PHE A N     1 
ATOM   96    C  CA    . PHE A 1 17  ? -0.500  43.557 -32.284 1.00 123.87 ? 17  PHE A CA    1 
ATOM   97    C  C     . PHE A 1 17  ? -0.530  42.792 -30.972 1.00 124.43 ? 17  PHE A C     1 
ATOM   98    O  O     . PHE A 1 17  ? -1.586  42.317 -30.552 1.00 115.84 ? 17  PHE A O     1 
ATOM   99    C  CB    . PHE A 1 17  ? 0.135   42.695 -33.362 1.00 129.28 ? 17  PHE A CB    1 
ATOM   100   C  CG    . PHE A 1 17  ? -0.784  41.630 -33.872 1.00 136.60 ? 17  PHE A CG    1 
ATOM   101   C  CD1   . PHE A 1 17  ? -0.527  40.286 -33.621 1.00 124.83 ? 17  PHE A CD1   1 
ATOM   102   C  CD2   . PHE A 1 17  ? -1.941  41.988 -34.584 1.00 145.89 ? 17  PHE A CD2   1 
ATOM   103   C  CE1   . PHE A 1 17  ? -1.389  39.316 -34.097 1.00 136.74 ? 17  PHE A CE1   1 
ATOM   104   C  CE2   . PHE A 1 17  ? -2.820  41.028 -35.070 1.00 145.78 ? 17  PHE A CE2   1 
ATOM   105   C  CZ    . PHE A 1 17  ? -2.546  39.689 -34.829 1.00 149.61 ? 17  PHE A CZ    1 
ATOM   106   N  N     . GLY A 1 18  ? 0.632   42.684 -30.330 1.00 117.24 ? 18  GLY A N     1 
ATOM   107   C  CA    . GLY A 1 18  ? 0.766   41.972 -29.066 1.00 114.36 ? 18  GLY A CA    1 
ATOM   108   C  C     . GLY A 1 18  ? -0.253  42.391 -28.015 1.00 112.24 ? 18  GLY A C     1 
ATOM   109   O  O     . GLY A 1 18  ? -0.819  41.549 -27.307 1.00 96.49  ? 18  GLY A O     1 
ATOM   110   N  N     . ARG A 1 19  ? -0.492  43.694 -27.908 1.00 104.64 ? 19  ARG A N     1 
ATOM   111   C  CA    . ARG A 1 19  ? -1.497  44.174 -26.983 1.00 102.84 ? 19  ARG A CA    1 
ATOM   112   C  C     . ARG A 1 19  ? -2.833  43.538 -27.290 1.00 113.39 ? 19  ARG A C     1 
ATOM   113   O  O     . ARG A 1 19  ? -3.406  42.826 -26.460 1.00 120.63 ? 19  ARG A O     1 
ATOM   114   C  CB    . ARG A 1 19  ? -1.610  45.686 -27.062 1.00 98.79  ? 19  ARG A CB    1 
ATOM   115   C  CG    . ARG A 1 19  ? -0.707  46.389 -26.049 1.00 119.21 ? 19  ARG A CG    1 
ATOM   116   C  CD    . ARG A 1 19  ? -0.631  47.872 -26.279 1.00 119.06 ? 19  ARG A CD    1 
ATOM   117   N  NE    . ARG A 1 19  ? -1.829  48.521 -25.781 1.00 136.74 ? 19  ARG A NE    1 
ATOM   118   C  CZ    . ARG A 1 19  ? -2.266  49.699 -26.208 1.00 165.66 ? 19  ARG A CZ    1 
ATOM   119   N  NH1   . ARG A 1 19  ? -1.598  50.357 -27.155 1.00 160.91 ? 19  ARG A NH1   1 
ATOM   120   N  NH2   . ARG A 1 19  ? -3.374  50.215 -25.686 1.00 184.56 ? 19  ARG A NH2   1 
ATOM   121   N  N     . TYR A 1 20  ? -3.316  43.775 -28.498 1.00 101.45 ? 20  TYR A N     1 
ATOM   122   C  CA    . TYR A 1 20  ? -4.619  43.267 -28.897 1.00 101.22 ? 20  TYR A CA    1 
ATOM   123   C  C     . TYR A 1 20  ? -4.701  41.753 -28.815 1.00 93.19  ? 20  TYR A C     1 
ATOM   124   O  O     . TYR A 1 20  ? -5.628  41.214 -28.228 1.00 100.62 ? 20  TYR A O     1 
ATOM   125   C  CB    . TYR A 1 20  ? -4.939  43.748 -30.297 1.00 96.07  ? 20  TYR A CB    1 
ATOM   126   C  CG    . TYR A 1 20  ? -6.293  43.388 -30.825 1.00 96.81  ? 20  TYR A CG    1 
ATOM   127   C  CD1   . TYR A 1 20  ? -7.396  44.168 -30.531 1.00 121.41 ? 20  TYR A CD1   1 
ATOM   128   C  CD2   . TYR A 1 20  ? -6.461  42.306 -31.677 1.00 90.61  ? 20  TYR A CD2   1 
ATOM   129   C  CE1   . TYR A 1 20  ? -8.644  43.862 -31.045 1.00 133.33 ? 20  TYR A CE1   1 
ATOM   130   C  CE2   . TYR A 1 20  ? -7.696  41.998 -32.197 1.00 111.91 ? 20  TYR A CE2   1 
ATOM   131   C  CZ    . TYR A 1 20  ? -8.787  42.774 -31.877 1.00 125.14 ? 20  TYR A CZ    1 
ATOM   132   O  OH    . TYR A 1 20  ? -10.021 42.457 -32.390 1.00 123.76 ? 20  TYR A OH    1 
ATOM   133   N  N     . SER A 1 21  ? -3.736  41.057 -29.394 1.00 91.12  ? 21  SER A N     1 
ATOM   134   C  CA    . SER A 1 21  ? -3.815  39.600 -29.438 1.00 113.35 ? 21  SER A CA    1 
ATOM   135   C  C     . SER A 1 21  ? -4.030  39.049 -28.035 1.00 113.33 ? 21  SER A C     1 
ATOM   136   O  O     . SER A 1 21  ? -4.856  38.157 -27.805 1.00 106.68 ? 21  SER A O     1 
ATOM   137   C  CB    . SER A 1 21  ? -2.529  39.065 -29.992 1.00 112.58 ? 21  SER A CB    1 
ATOM   138   O  OG    . SER A 1 21  ? -1.504  39.864 -29.446 1.00 136.27 ? 21  SER A OG    1 
ATOM   139   N  N     . LYS A 1 22  ? -3.266  39.603 -27.104 1.00 103.69 ? 22  LYS A N     1 
ATOM   140   C  CA    . LYS A 1 22  ? -3.351  39.233 -25.712 1.00 101.32 ? 22  LYS A CA    1 
ATOM   141   C  C     . LYS A 1 22  ? -4.744  39.536 -25.131 1.00 115.86 ? 22  LYS A C     1 
ATOM   142   O  O     . LYS A 1 22  ? -5.429  38.638 -24.647 1.00 119.24 ? 22  LYS A O     1 
ATOM   143   C  CB    . LYS A 1 22  ? -2.261  39.975 -24.967 1.00 107.30 ? 22  LYS A CB    1 
ATOM   144   C  CG    . LYS A 1 22  ? -1.722  39.261 -23.750 1.00 123.75 ? 22  LYS A CG    1 
ATOM   145   C  CD    . LYS A 1 22  ? -1.276  40.305 -22.734 1.00 137.59 ? 22  LYS A CD    1 
ATOM   146   C  CE    . LYS A 1 22  ? -0.649  39.695 -21.505 1.00 145.77 ? 22  LYS A CE    1 
ATOM   147   N  NZ    . LYS A 1 22  ? -0.424  40.758 -20.483 1.00 155.14 ? 22  LYS A NZ    1 
ATOM   148   N  N     . TYR A 1 23  ? -5.177  40.790 -25.199 1.00 105.74 ? 23  TYR A N     1 
ATOM   149   C  CA    . TYR A 1 23  ? -6.466  41.174 -24.617 1.00 98.03  ? 23  TYR A CA    1 
ATOM   150   C  C     . TYR A 1 23  ? -7.603  40.297 -25.110 1.00 107.04 ? 23  TYR A C     1 
ATOM   151   O  O     . TYR A 1 23  ? -8.495  39.956 -24.355 1.00 124.15 ? 23  TYR A O     1 
ATOM   152   C  CB    . TYR A 1 23  ? -6.798  42.613 -24.962 1.00 103.75 ? 23  TYR A CB    1 
ATOM   153   C  CG    . TYR A 1 23  ? -8.019  43.170 -24.283 1.00 102.10 ? 23  TYR A CG    1 
ATOM   154   C  CD1   . TYR A 1 23  ? -9.123  43.580 -25.015 1.00 125.77 ? 23  TYR A CD1   1 
ATOM   155   C  CD2   . TYR A 1 23  ? -8.045  43.338 -22.918 1.00 125.85 ? 23  TYR A CD2   1 
ATOM   156   C  CE1   . TYR A 1 23  ? -10.235 44.130 -24.394 1.00 134.91 ? 23  TYR A CE1   1 
ATOM   157   C  CE2   . TYR A 1 23  ? -9.138  43.879 -22.289 1.00 140.42 ? 23  TYR A CE2   1 
ATOM   158   C  CZ    . TYR A 1 23  ? -10.233 44.269 -23.024 1.00 149.93 ? 23  TYR A CZ    1 
ATOM   159   O  OH    . TYR A 1 23  ? -11.319 44.792 -22.362 1.00 165.65 ? 23  TYR A OH    1 
ATOM   160   N  N     . ILE A 1 24  ? -7.574  39.970 -26.396 1.00 113.99 ? 24  ILE A N     1 
ATOM   161   C  CA    . ILE A 1 24  ? -8.588  39.146 -27.035 1.00 110.18 ? 24  ILE A CA    1 
ATOM   162   C  C     . ILE A 1 24  ? -8.617  37.765 -26.423 1.00 102.43 ? 24  ILE A C     1 
ATOM   163   O  O     . ILE A 1 24  ? -9.673  37.253 -26.068 1.00 111.38 ? 24  ILE A O     1 
ATOM   164   C  CB    . ILE A 1 24  ? -8.249  38.961 -28.531 1.00 126.93 ? 24  ILE A CB    1 
ATOM   165   C  CG1   . ILE A 1 24  ? -8.691  40.181 -29.313 1.00 122.72 ? 24  ILE A CG1   1 
ATOM   166   C  CG2   . ILE A 1 24  ? -8.953  37.752 -29.087 1.00 146.88 ? 24  ILE A CG2   1 
ATOM   167   C  CD1   . ILE A 1 24  ? -10.024 40.721 -28.808 1.00 128.83 ? 24  ILE A CD1   1 
ATOM   168   N  N     . ILE A 1 25  ? -7.441  37.155 -26.331 1.00 91.59  ? 25  ILE A N     1 
ATOM   169   C  CA    . ILE A 1 25  ? -7.312  35.808 -25.807 1.00 103.67 ? 25  ILE A CA    1 
ATOM   170   C  C     . ILE A 1 25  ? -7.791  35.673 -24.365 1.00 110.09 ? 25  ILE A C     1 
ATOM   171   O  O     . ILE A 1 25  ? -8.671  34.865 -24.072 1.00 114.78 ? 25  ILE A O     1 
ATOM   172   C  CB    . ILE A 1 25  ? -5.876  35.378 -25.820 1.00 100.75 ? 25  ILE A CB    1 
ATOM   173   C  CG1   . ILE A 1 25  ? -5.361  35.340 -27.241 1.00 88.90  ? 25  ILE A CG1   1 
ATOM   174   C  CG2   . ILE A 1 25  ? -5.725  34.026 -25.145 1.00 103.06 ? 25  ILE A CG2   1 
ATOM   175   C  CD1   . ILE A 1 25  ? -3.972  34.793 -27.274 1.00 100.41 ? 25  ILE A CD1   1 
ATOM   176   N  N     . GLN A 1 26  ? -7.186  36.442 -23.463 1.00 108.58 ? 26  GLN A N     1 
ATOM   177   C  CA    . GLN A 1 26  ? -7.579  36.426 -22.062 1.00 123.83 ? 26  GLN A CA    1 
ATOM   178   C  C     . GLN A 1 26  ? -8.965  37.032 -21.876 1.00 126.57 ? 26  GLN A C     1 
ATOM   179   O  O     . GLN A 1 26  ? -9.923  36.343 -21.543 1.00 138.68 ? 26  GLN A O     1 
ATOM   180   C  CB    . GLN A 1 26  ? -6.564  37.200 -21.222 1.00 132.44 ? 26  GLN A CB    1 
ATOM   181   C  CG    . GLN A 1 26  ? -5.131  36.673 -21.337 1.00 133.57 ? 26  GLN A CG    1 
ATOM   182   C  CD    . GLN A 1 26  ? -4.108  37.538 -20.607 1.00 129.90 ? 26  GLN A CD    1 
ATOM   183   O  OE1   . GLN A 1 26  ? -4.260  38.756 -20.521 1.00 142.16 ? 26  GLN A OE1   1 
ATOM   184   N  NE2   . GLN A 1 26  ? -3.060  36.907 -20.081 1.00 107.15 ? 26  GLN A NE2   1 
ATOM   185   N  N     . ASP A 1 27  ? -9.051  38.330 -22.112 1.00 115.08 ? 27  ASP A N     1 
ATOM   186   C  CA    . ASP A 1 27  ? -10.237 39.116 -21.809 1.00 127.43 ? 27  ASP A CA    1 
ATOM   187   C  C     . ASP A 1 27  ? -11.502 38.996 -22.664 1.00 132.23 ? 27  ASP A C     1 
ATOM   188   O  O     . ASP A 1 27  ? -12.563 39.437 -22.224 1.00 149.46 ? 27  ASP A O     1 
ATOM   189   C  CB    . ASP A 1 27  ? -9.866  40.587 -21.660 1.00 163.38 ? 27  ASP A CB    1 
ATOM   190   C  CG    . ASP A 1 27  ? -9.609  40.964 -20.212 1.00 193.51 ? 27  ASP A CG    1 
ATOM   191   O  OD1   . ASP A 1 27  ? -8.938  40.163 -19.512 1.00 196.07 ? 27  ASP A OD1   1 
ATOM   192   O  OD2   . ASP A 1 27  ? -10.092 42.042 -19.778 1.00 203.09 ? 27  ASP A OD2   1 
ATOM   193   N  N     . ARG A 1 28  ? -11.417 38.545 -23.908 1.00 130.17 ? 28  ARG A N     1 
ATOM   194   C  CA    . ARG A 1 28  ? -12.661 38.452 -24.687 1.00 131.04 ? 28  ARG A CA    1 
ATOM   195   C  C     . ARG A 1 28  ? -13.209 37.049 -24.960 1.00 124.98 ? 28  ARG A C     1 
ATOM   196   O  O     . ARG A 1 28  ? -14.320 36.720 -24.545 1.00 118.43 ? 28  ARG A O     1 
ATOM   197   C  CB    . ARG A 1 28  ? -12.553 39.170 -26.044 1.00 116.30 ? 28  ARG A CB    1 
ATOM   198   C  CG    . ARG A 1 28  ? -13.475 40.369 -26.131 1.00 105.44 ? 28  ARG A CG    1 
ATOM   199   C  CD    . ARG A 1 28  ? -13.909 40.678 -27.535 1.00 127.03 ? 28  ARG A CD    1 
ATOM   200   N  NE    . ARG A 1 28  ? -12.907 41.402 -28.316 1.00 123.37 ? 28  ARG A NE    1 
ATOM   201   C  CZ    . ARG A 1 28  ? -12.668 42.712 -28.237 1.00 127.26 ? 28  ARG A CZ    1 
ATOM   202   N  NH1   . ARG A 1 28  ? -13.322 43.494 -27.376 1.00 114.26 ? 28  ARG A NH1   1 
ATOM   203   N  NH2   . ARG A 1 28  ? -11.742 43.242 -29.019 1.00 138.36 ? 28  ARG A NH2   1 
ATOM   204   N  N     . ALA A 1 29  ? -12.454 36.258 -25.713 1.00 99.22  ? 29  ALA A N     1 
ATOM   205   C  CA    . ALA A 1 29  ? -13.023 35.080 -26.362 1.00 105.06 ? 29  ALA A CA    1 
ATOM   206   C  C     . ALA A 1 29  ? -12.974 33.839 -25.520 1.00 116.17 ? 29  ALA A C     1 
ATOM   207   O  O     . ALA A 1 29  ? -13.960 33.115 -25.391 1.00 126.38 ? 29  ALA A O     1 
ATOM   208   C  CB    . ALA A 1 29  ? -12.311 34.804 -27.625 1.00 110.09 ? 29  ALA A CB    1 
ATOM   209   N  N     . LEU A 1 30  ? -11.803 33.576 -24.968 1.00 116.32 ? 30  LEU A N     1 
ATOM   210   C  CA    . LEU A 1 30  ? -11.562 32.294 -24.345 1.00 117.03 ? 30  LEU A CA    1 
ATOM   211   C  C     . LEU A 1 30  ? -12.015 32.248 -22.902 1.00 131.10 ? 30  LEU A C     1 
ATOM   212   O  O     . LEU A 1 30  ? -11.750 33.157 -22.114 1.00 137.19 ? 30  LEU A O     1 
ATOM   213   C  CB    . LEU A 1 30  ? -10.099 31.916 -24.466 1.00 119.89 ? 30  LEU A CB    1 
ATOM   214   C  CG    . LEU A 1 30  ? -9.674  32.118 -25.908 1.00 113.91 ? 30  LEU A CG    1 
ATOM   215   C  CD1   . LEU A 1 30  ? -8.289  31.552 -26.159 1.00 96.16  ? 30  LEU A CD1   1 
ATOM   216   C  CD2   . LEU A 1 30  ? -10.722 31.450 -26.771 1.00 130.51 ? 30  LEU A CD2   1 
ATOM   217   N  N     . PRO A 1 31  ? -12.706 31.165 -22.558 1.00 101.34 ? 31  PRO A N     1 
ATOM   218   C  CA    . PRO A 1 31  ? -13.260 30.864 -21.234 1.00 99.35  ? 31  PRO A CA    1 
ATOM   219   C  C     . PRO A 1 31  ? -12.170 30.531 -20.228 1.00 102.73 ? 31  PRO A C     1 
ATOM   220   O  O     . PRO A 1 31  ? -11.138 29.977 -20.600 1.00 106.07 ? 31  PRO A O     1 
ATOM   221   C  CB    . PRO A 1 31  ? -14.089 29.603 -21.484 1.00 109.28 ? 31  PRO A CB    1 
ATOM   222   C  CG    . PRO A 1 31  ? -13.487 28.976 -22.710 1.00 115.02 ? 31  PRO A CG    1 
ATOM   223   C  CD    . PRO A 1 31  ? -12.932 30.095 -23.543 1.00 101.04 ? 31  PRO A CD    1 
ATOM   224   N  N     . ASP A 1 32  ? -12.397 30.866 -18.965 1.00 111.62 ? 32  ASP A N     1 
ATOM   225   C  CA    . ASP A 1 32  ? -11.483 30.443 -17.923 1.00 119.60 ? 32  ASP A CA    1 
ATOM   226   C  C     . ASP A 1 32  ? -11.704 28.959 -17.720 1.00 123.30 ? 32  ASP A C     1 
ATOM   227   O  O     . ASP A 1 32  ? -12.842 28.487 -17.707 1.00 119.81 ? 32  ASP A O     1 
ATOM   228   C  CB    . ASP A 1 32  ? -11.716 31.209 -16.618 1.00 123.45 ? 32  ASP A CB    1 
ATOM   229   C  CG    . ASP A 1 32  ? -10.433 31.383 -15.802 1.00 134.37 ? 32  ASP A CG    1 
ATOM   230   O  OD1   . ASP A 1 32  ? -9.794  32.454 -15.935 1.00 134.41 ? 32  ASP A OD1   1 
ATOM   231   O  OD2   . ASP A 1 32  ? -10.054 30.456 -15.044 1.00 131.21 ? 32  ASP A OD2   1 
ATOM   232   N  N     . ILE A 1 33  ? -10.612 28.220 -17.571 1.00 123.41 ? 33  ILE A N     1 
ATOM   233   C  CA    . ILE A 1 33  ? -10.707 26.784 -17.378 1.00 113.59 ? 33  ILE A CA    1 
ATOM   234   C  C     . ILE A 1 33  ? -11.329 26.429 -16.027 1.00 116.28 ? 33  ILE A C     1 
ATOM   235   O  O     . ILE A 1 33  ? -11.665 25.270 -15.790 1.00 118.27 ? 33  ILE A O     1 
ATOM   236   C  CB    . ILE A 1 33  ? -9.333  26.122 -17.483 1.00 100.13 ? 33  ILE A CB    1 
ATOM   237   C  CG1   . ILE A 1 33  ? -9.485  24.700 -18.028 1.00 101.26 ? 33  ILE A CG1   1 
ATOM   238   C  CG2   . ILE A 1 33  ? -8.627  26.147 -16.129 1.00 89.82  ? 33  ILE A CG2   1 
ATOM   239   C  CD1   . ILE A 1 33  ? -8.237  23.857 -17.932 1.00 94.13  ? 33  ILE A CD1   1 
ATOM   240   N  N     . ARG A 1 34  ? -11.496 27.429 -15.157 1.00 120.96 ? 34  ARG A N     1 
ATOM   241   C  CA    . ARG A 1 34  ? -11.954 27.208 -13.777 1.00 115.30 ? 34  ARG A CA    1 
ATOM   242   C  C     . ARG A 1 34  ? -13.460 27.317 -13.590 1.00 106.90 ? 34  ARG A C     1 
ATOM   243   O  O     . ARG A 1 34  ? -14.050 26.501 -12.897 1.00 107.46 ? 34  ARG A O     1 
ATOM   244   C  CB    . ARG A 1 34  ? -11.263 28.156 -12.803 1.00 106.65 ? 34  ARG A CB    1 
ATOM   245   C  CG    . ARG A 1 34  ? -9.781  28.043 -12.817 1.00 111.34 ? 34  ARG A CG    1 
ATOM   246   C  CD    . ARG A 1 34  ? -9.136  29.005 -11.856 1.00 110.46 ? 34  ARG A CD    1 
ATOM   247   N  NE    . ARG A 1 34  ? -9.376  30.399 -12.188 1.00 111.09 ? 34  ARG A NE    1 
ATOM   248   C  CZ    . ARG A 1 34  ? -8.612  31.395 -11.754 1.00 124.52 ? 34  ARG A CZ    1 
ATOM   249   N  NH1   . ARG A 1 34  ? -7.552  31.125 -11.006 1.00 143.86 ? 34  ARG A NH1   1 
ATOM   250   N  NH2   . ARG A 1 34  ? -8.893  32.657 -12.061 1.00 109.96 ? 34  ARG A NH2   1 
ATOM   251   N  N     . ASP A 1 35  ? -14.069 28.338 -14.184 1.00 102.25 ? 35  ASP A N     1 
ATOM   252   C  CA    . ASP A 1 35  ? -15.510 28.529 -14.086 1.00 99.71  ? 35  ASP A CA    1 
ATOM   253   C  C     . ASP A 1 35  ? -16.119 28.437 -15.472 1.00 100.87 ? 35  ASP A C     1 
ATOM   254   O  O     . ASP A 1 35  ? -17.325 28.628 -15.652 1.00 91.61  ? 35  ASP A O     1 
ATOM   255   C  CB    . ASP A 1 35  ? -15.830 29.895 -13.480 1.00 113.69 ? 35  ASP A CB    1 
ATOM   256   C  CG    . ASP A 1 35  ? -15.440 31.045 -14.401 1.00 119.79 ? 35  ASP A CG    1 
ATOM   257   O  OD1   . ASP A 1 35  ? -14.733 30.789 -15.398 1.00 130.17 ? 35  ASP A OD1   1 
ATOM   258   O  OD2   . ASP A 1 35  ? -15.837 32.202 -14.133 1.00 104.27 ? 35  ASP A OD2   1 
ATOM   259   N  N     . GLY A 1 36  ? -15.260 28.164 -16.450 1.00 106.87 ? 36  GLY A N     1 
ATOM   260   C  CA    . GLY A 1 36  ? -15.675 27.995 -17.827 1.00 106.03 ? 36  GLY A CA    1 
ATOM   261   C  C     . GLY A 1 36  ? -16.444 29.162 -18.408 1.00 113.24 ? 36  GLY A C     1 
ATOM   262   O  O     . GLY A 1 36  ? -17.290 28.970 -19.280 1.00 133.34 ? 36  GLY A O     1 
ATOM   263   N  N     . LEU A 1 37  ? -16.146 30.373 -17.949 1.00 104.22 ? 37  LEU A N     1 
ATOM   264   C  CA    . LEU A 1 37  ? -16.828 31.566 -18.450 1.00 97.52  ? 37  LEU A CA    1 
ATOM   265   C  C     . LEU A 1 37  ? -15.933 32.552 -19.201 1.00 113.37 ? 37  LEU A C     1 
ATOM   266   O  O     . LEU A 1 37  ? -14.765 32.736 -18.858 1.00 128.68 ? 37  LEU A O     1 
ATOM   267   C  CB    . LEU A 1 37  ? -17.455 32.302 -17.288 1.00 94.25  ? 37  LEU A CB    1 
ATOM   268   C  CG    . LEU A 1 37  ? -18.640 31.561 -16.696 1.00 100.45 ? 37  LEU A CG    1 
ATOM   269   C  CD1   . LEU A 1 37  ? -19.215 32.316 -15.473 1.00 83.50  ? 37  LEU A CD1   1 
ATOM   270   C  CD2   . LEU A 1 37  ? -19.666 31.400 -17.800 1.00 103.35 ? 37  LEU A CD2   1 
ATOM   271   N  N     . LYS A 1 38  ? -16.486 33.192 -20.225 1.00 111.79 ? 38  LYS A N     1 
ATOM   272   C  CA    . LYS A 1 38  ? -15.856 34.380 -20.791 1.00 108.36 ? 38  LYS A CA    1 
ATOM   273   C  C     . LYS A 1 38  ? -16.279 35.570 -19.929 1.00 106.82 ? 38  LYS A C     1 
ATOM   274   O  O     . LYS A 1 38  ? -17.363 35.564 -19.336 1.00 102.81 ? 38  LYS A O     1 
ATOM   275   C  CB    . LYS A 1 38  ? -16.289 34.626 -22.234 1.00 101.92 ? 38  LYS A CB    1 
ATOM   276   C  CG    . LYS A 1 38  ? -16.084 33.496 -23.206 1.00 102.67 ? 38  LYS A CG    1 
ATOM   277   C  CD    . LYS A 1 38  ? -17.342 33.373 -24.072 1.00 114.76 ? 38  LYS A CD    1 
ATOM   278   C  CE    . LYS A 1 38  ? -17.070 33.080 -25.552 1.00 125.63 ? 38  LYS A CE    1 
ATOM   279   N  NZ    . LYS A 1 38  ? -18.325 33.288 -26.353 1.00 123.07 ? 38  LYS A NZ    1 
ATOM   280   N  N     . PRO A 1 39  ? -15.417 36.592 -19.852 1.00 101.58 ? 39  PRO A N     1 
ATOM   281   C  CA    . PRO A 1 39  ? -15.613 37.845 -19.118 1.00 98.17  ? 39  PRO A CA    1 
ATOM   282   C  C     . PRO A 1 39  ? -17.026 38.405 -19.187 1.00 108.66 ? 39  PRO A C     1 
ATOM   283   O  O     . PRO A 1 39  ? -17.605 38.646 -18.132 1.00 98.17  ? 39  PRO A O     1 
ATOM   284   C  CB    . PRO A 1 39  ? -14.603 38.767 -19.764 1.00 103.79 ? 39  PRO A CB    1 
ATOM   285   C  CG    . PRO A 1 39  ? -13.459 37.842 -20.005 1.00 107.05 ? 39  PRO A CG    1 
ATOM   286   C  CD    . PRO A 1 39  ? -14.023 36.466 -20.295 1.00 99.94  ? 39  PRO A CD    1 
ATOM   287   N  N     . VAL A 1 40  ? -17.573 38.611 -20.384 1.00 119.67 ? 40  VAL A N     1 
ATOM   288   C  CA    . VAL A 1 40  ? -18.918 39.163 -20.494 1.00 95.73  ? 40  VAL A CA    1 
ATOM   289   C  C     . VAL A 1 40  ? -19.852 38.289 -19.693 1.00 90.31  ? 40  VAL A C     1 
ATOM   290   O  O     . VAL A 1 40  ? -20.602 38.783 -18.860 1.00 97.43  ? 40  VAL A O     1 
ATOM   291   C  CB    . VAL A 1 40  ? -19.390 39.218 -21.947 1.00 99.06  ? 40  VAL A CB    1 
ATOM   292   C  CG1   . VAL A 1 40  ? -20.397 40.373 -22.148 1.00 87.78  ? 40  VAL A CG1   1 
ATOM   293   C  CG2   . VAL A 1 40  ? -18.174 39.393 -22.855 1.00 107.00 ? 40  VAL A CG2   1 
ATOM   294   N  N     . GLN A 1 41  ? -19.785 36.982 -19.912 1.00 98.82  ? 41  GLN A N     1 
ATOM   295   C  CA    . GLN A 1 41  ? -20.619 36.075 -19.126 1.00 100.94 ? 41  GLN A CA    1 
ATOM   296   C  C     . GLN A 1 41  ? -20.502 36.354 -17.646 1.00 92.13  ? 41  GLN A C     1 
ATOM   297   O  O     . GLN A 1 41  ? -21.511 36.653 -16.996 1.00 86.57  ? 41  GLN A O     1 
ATOM   298   C  CB    . GLN A 1 41  ? -20.251 34.631 -19.380 1.00 80.99  ? 41  GLN A CB    1 
ATOM   299   C  CG    . GLN A 1 41  ? -20.918 34.129 -20.593 1.00 85.84  ? 41  GLN A CG    1 
ATOM   300   C  CD    . GLN A 1 41  ? -20.048 33.230 -21.371 1.00 107.83 ? 41  GLN A CD    1 
ATOM   301   O  OE1   . GLN A 1 41  ? -18.867 33.055 -21.066 1.00 113.92 ? 41  GLN A OE1   1 
ATOM   302   N  NE2   . GLN A 1 41  ? -20.618 32.638 -22.398 1.00 128.16 ? 41  GLN A NE2   1 
ATOM   303   N  N     . ARG A 1 42  ? -19.269 36.299 -17.139 1.00 80.49  ? 42  ARG A N     1 
ATOM   304   C  CA    . ARG A 1 42  ? -18.996 36.509 -15.721 1.00 80.16  ? 42  ARG A CA    1 
ATOM   305   C  C     . ARG A 1 42  ? -19.580 37.823 -15.217 1.00 79.66  ? 42  ARG A C     1 
ATOM   306   O  O     . ARG A 1 42  ? -20.267 37.853 -14.203 1.00 77.41  ? 42  ARG A O     1 
ATOM   307   C  CB    . ARG A 1 42  ? -17.490 36.458 -15.450 1.00 87.02  ? 42  ARG A CB    1 
ATOM   308   C  CG    . ARG A 1 42  ? -17.113 36.139 -13.989 1.00 91.16  ? 42  ARG A CG    1 
ATOM   309   C  CD    . ARG A 1 42  ? -15.595 35.954 -13.761 1.00 95.42  ? 42  ARG A CD    1 
ATOM   310   N  NE    . ARG A 1 42  ? -15.030 34.908 -14.610 1.00 114.53 ? 42  ARG A NE    1 
ATOM   311   C  CZ    . ARG A 1 42  ? -14.315 35.149 -15.710 1.00 134.69 ? 42  ARG A CZ    1 
ATOM   312   N  NH1   . ARG A 1 42  ? -14.063 36.408 -16.073 1.00 143.13 ? 42  ARG A NH1   1 
ATOM   313   N  NH2   . ARG A 1 42  ? -13.842 34.140 -16.446 1.00 129.89 ? 42  ARG A NH2   1 
ATOM   314   N  N     . ARG A 1 43  ? -19.315 38.907 -15.934 1.00 77.30  ? 43  ARG A N     1 
ATOM   315   C  CA    . ARG A 1 43  ? -19.804 40.226 -15.541 1.00 85.05  ? 43  ARG A CA    1 
ATOM   316   C  C     . ARG A 1 43  ? -21.317 40.331 -15.521 1.00 90.90  ? 43  ARG A C     1 
ATOM   317   O  O     . ARG A 1 43  ? -21.887 40.976 -14.651 1.00 108.27 ? 43  ARG A O     1 
ATOM   318   C  CB    . ARG A 1 43  ? -19.233 41.304 -16.431 1.00 85.73  ? 43  ARG A CB    1 
ATOM   319   C  CG    . ARG A 1 43  ? -17.900 41.781 -15.963 1.00 89.66  ? 43  ARG A CG    1 
ATOM   320   C  CD    . ARG A 1 43  ? -17.227 42.491 -17.090 1.00 104.72 ? 43  ARG A CD    1 
ATOM   321   N  NE    . ARG A 1 43  ? -15.817 42.670 -16.808 1.00 108.26 ? 43  ARG A NE    1 
ATOM   322   C  CZ    . ARG A 1 43  ? -14.935 43.029 -17.717 1.00 105.35 ? 43  ARG A CZ    1 
ATOM   323   N  NH1   . ARG A 1 43  ? -15.328 43.246 -18.961 1.00 108.42 ? 43  ARG A NH1   1 
ATOM   324   N  NH2   . ARG A 1 43  ? -13.672 43.178 -17.372 1.00 111.41 ? 43  ARG A NH2   1 
ATOM   325   N  N     . ILE A 1 44  ? -21.966 39.719 -16.496 1.00 82.80  ? 44  ILE A N     1 
ATOM   326   C  CA    . ILE A 1 44  ? -23.409 39.625 -16.471 1.00 94.55  ? 44  ILE A CA    1 
ATOM   327   C  C     . ILE A 1 44  ? -23.835 38.928 -15.188 1.00 103.07 ? 44  ILE A C     1 
ATOM   328   O  O     . ILE A 1 44  ? -24.574 39.486 -14.376 1.00 97.47  ? 44  ILE A O     1 
ATOM   329   C  CB    . ILE A 1 44  ? -23.935 38.829 -17.671 1.00 82.35  ? 44  ILE A CB    1 
ATOM   330   C  CG1   . ILE A 1 44  ? -23.328 39.390 -18.957 1.00 88.03  ? 44  ILE A CG1   1 
ATOM   331   C  CG2   . ILE A 1 44  ? -25.455 38.876 -17.704 1.00 64.78  ? 44  ILE A CG2   1 
ATOM   332   C  CD1   . ILE A 1 44  ? -24.276 39.493 -20.133 1.00 95.99  ? 44  ILE A CD1   1 
ATOM   333   N  N     . LEU A 1 45  ? -23.339 37.714 -14.989 1.00 98.53  ? 45  LEU A N     1 
ATOM   334   C  CA    . LEU A 1 45  ? -23.708 36.938 -13.813 1.00 102.92 ? 45  LEU A CA    1 
ATOM   335   C  C     . LEU A 1 45  ? -23.520 37.702 -12.501 1.00 107.80 ? 45  LEU A C     1 
ATOM   336   O  O     . LEU A 1 45  ? -24.452 37.838 -11.707 1.00 108.28 ? 45  LEU A O     1 
ATOM   337   C  CB    . LEU A 1 45  ? -22.890 35.665 -13.800 1.00 93.01  ? 45  LEU A CB    1 
ATOM   338   C  CG    . LEU A 1 45  ? -23.528 34.606 -14.669 1.00 95.08  ? 45  LEU A CG    1 
ATOM   339   C  CD1   . LEU A 1 45  ? -22.456 33.816 -15.377 1.00 113.88 ? 45  LEU A CD1   1 
ATOM   340   C  CD2   . LEU A 1 45  ? -24.341 33.728 -13.760 1.00 100.68 ? 45  LEU A CD2   1 
ATOM   341   N  N     . TYR A 1 46  ? -22.310 38.200 -12.282 1.00 102.47 ? 46  TYR A N     1 
ATOM   342   C  CA    . TYR A 1 46  ? -21.999 38.915 -11.062 1.00 97.09  ? 46  TYR A CA    1 
ATOM   343   C  C     . TYR A 1 46  ? -22.935 40.105 -10.909 1.00 103.03 ? 46  TYR A C     1 
ATOM   344   O  O     . TYR A 1 46  ? -23.596 40.250 -9.890  1.00 100.96 ? 46  TYR A O     1 
ATOM   345   C  CB    . TYR A 1 46  ? -20.543 39.369 -11.079 1.00 80.96  ? 46  TYR A CB    1 
ATOM   346   C  CG    . TYR A 1 46  ? -20.125 40.202 -9.879  1.00 86.34  ? 46  TYR A CG    1 
ATOM   347   C  CD1   . TYR A 1 46  ? -19.868 41.552 -10.016 1.00 96.19  ? 46  TYR A CD1   1 
ATOM   348   C  CD2   . TYR A 1 46  ? -19.981 39.641 -8.618  1.00 84.40  ? 46  TYR A CD2   1 
ATOM   349   C  CE1   . TYR A 1 46  ? -19.484 42.318 -8.944  1.00 104.21 ? 46  TYR A CE1   1 
ATOM   350   C  CE2   . TYR A 1 46  ? -19.587 40.406 -7.531  1.00 90.44  ? 46  TYR A CE2   1 
ATOM   351   C  CZ    . TYR A 1 46  ? -19.344 41.751 -7.709  1.00 106.59 ? 46  TYR A CZ    1 
ATOM   352   O  OH    . TYR A 1 46  ? -18.954 42.572 -6.673  1.00 111.19 ? 46  TYR A OH    1 
ATOM   353   N  N     . SER A 1 47  ? -23.015 40.938 -11.937 1.00 98.21  ? 47  SER A N     1 
ATOM   354   C  CA    . SER A 1 47  ? -23.830 42.139 -11.864 1.00 95.31  ? 47  SER A CA    1 
ATOM   355   C  C     . SER A 1 47  ? -25.270 41.817 -11.525 1.00 98.82  ? 47  SER A C     1 
ATOM   356   O  O     . SER A 1 47  ? -25.821 42.372 -10.585 1.00 105.59 ? 47  SER A O     1 
ATOM   357   C  CB    . SER A 1 47  ? -23.785 42.894 -13.185 1.00 113.14 ? 47  SER A CB    1 
ATOM   358   O  OG    . SER A 1 47  ? -24.991 43.600 -13.408 1.00 121.24 ? 47  SER A OG    1 
ATOM   359   N  N     . MET A 1 48  ? -25.882 40.924 -12.295 1.00 100.47 ? 48  MET A N     1 
ATOM   360   C  CA    . MET A 1 48  ? -27.282 40.566 -12.073 1.00 87.40  ? 48  MET A CA    1 
ATOM   361   C  C     . MET A 1 48  ? -27.454 40.136 -10.629 1.00 91.01  ? 48  MET A C     1 
ATOM   362   O  O     . MET A 1 48  ? -28.327 40.628 -9.917  1.00 97.74  ? 48  MET A O     1 
ATOM   363   C  CB    . MET A 1 48  ? -27.724 39.423 -13.011 1.00 83.57  ? 48  MET A CB    1 
ATOM   364   C  CG    . MET A 1 48  ? -27.795 39.779 -14.518 1.00 87.32  ? 48  MET A CG    1 
ATOM   365   S  SD    . MET A 1 48  ? -28.761 38.687 -15.607 1.00 124.26 ? 48  MET A SD    1 
ATOM   366   C  CE    . MET A 1 48  ? -30.385 38.745 -14.846 1.00 106.09 ? 48  MET A CE    1 
ATOM   367   N  N     . ASN A 1 49  ? -26.602 39.219 -10.193 1.00 95.33  ? 49  ASN A N     1 
ATOM   368   C  CA    . ASN A 1 49  ? -26.690 38.707 -8.836  1.00 103.85 ? 49  ASN A CA    1 
ATOM   369   C  C     . ASN A 1 49  ? -26.498 39.760 -7.733  1.00 97.52  ? 49  ASN A C     1 
ATOM   370   O  O     . ASN A 1 49  ? -27.213 39.775 -6.738  1.00 82.21  ? 49  ASN A O     1 
ATOM   371   C  CB    . ASN A 1 49  ? -25.727 37.556 -8.651  1.00 102.60 ? 49  ASN A CB    1 
ATOM   372   C  CG    . ASN A 1 49  ? -25.576 37.186 -7.217  1.00 106.73 ? 49  ASN A CG    1 
ATOM   373   O  OD1   . ASN A 1 49  ? -26.477 36.582 -6.613  1.00 109.51 ? 49  ASN A OD1   1 
ATOM   374   N  ND2   . ASN A 1 49  ? -24.446 37.579 -6.634  1.00 98.20  ? 49  ASN A ND2   1 
ATOM   375   N  N     . LYS A 1 50  ? -25.507 40.616 -7.902  1.00 98.33  ? 50  LYS A N     1 
ATOM   376   C  CA    . LYS A 1 50  ? -25.279 41.717 -6.979  1.00 98.37  ? 50  LYS A CA    1 
ATOM   377   C  C     . LYS A 1 50  ? -26.507 42.606 -6.875  1.00 105.79 ? 50  LYS A C     1 
ATOM   378   O  O     . LYS A 1 50  ? -26.870 43.044 -5.793  1.00 129.49 ? 50  LYS A O     1 
ATOM   379   C  CB    . LYS A 1 50  ? -24.072 42.542 -7.430  1.00 99.21  ? 50  LYS A CB    1 
ATOM   380   N  N     . ASP A 1 51  ? -27.119 42.902 -8.014  1.00 109.85 ? 51  ASP A N     1 
ATOM   381   C  CA    . ASP A 1 51  ? -28.373 43.654 -8.068  1.00 119.74 ? 51  ASP A CA    1 
ATOM   382   C  C     . ASP A 1 51  ? -29.602 42.828 -7.614  1.00 111.31 ? 51  ASP A C     1 
ATOM   383   O  O     . ASP A 1 51  ? -30.747 43.176 -7.910  1.00 114.46 ? 51  ASP A O     1 
ATOM   384   C  CB    . ASP A 1 51  ? -28.566 44.292 -9.450  1.00 127.51 ? 51  ASP A CB    1 
ATOM   385   N  N     . SER A 1 52  ? -29.354 41.800 -6.814  1.00 108.87 ? 52  SER A N     1 
ATOM   386   C  CA    . SER A 1 52  ? -30.255 40.656 -6.599  1.00 125.83 ? 52  SER A CA    1 
ATOM   387   C  C     . SER A 1 52  ? -31.418 40.452 -7.577  1.00 116.50 ? 52  SER A C     1 
ATOM   388   O  O     . SER A 1 52  ? -32.606 40.607 -7.238  1.00 100.62 ? 52  SER A O     1 
ATOM   389   C  CB    . SER A 1 52  ? -30.753 40.659 -5.150  1.00 129.42 ? 52  SER A CB    1 
ATOM   390   O  OG    . SER A 1 52  ? -30.991 42.002 -4.754  1.00 126.15 ? 52  SER A OG    1 
ATOM   391   N  N     . ASN A 1 53  ? -31.023 40.048 -8.784  1.00 104.11 ? 53  ASN A N     1 
ATOM   392   C  CA    . ASN A 1 53  ? -31.913 39.696 -9.882  1.00 104.81 ? 53  ASN A CA    1 
ATOM   393   C  C     . ASN A 1 53  ? -31.946 38.177 -10.011 1.00 111.29 ? 53  ASN A C     1 
ATOM   394   O  O     . ASN A 1 53  ? -31.353 37.613 -10.934 1.00 115.97 ? 53  ASN A O     1 
ATOM   395   C  CB    . ASN A 1 53  ? -31.354 40.310 -11.183 1.00 105.26 ? 53  ASN A CB    1 
ATOM   396   C  CG    . ASN A 1 53  ? -32.418 40.525 -12.258 1.00 121.16 ? 53  ASN A CG    1 
ATOM   397   O  OD1   . ASN A 1 53  ? -33.409 39.799 -12.325 1.00 135.54 ? 53  ASN A OD1   1 
ATOM   398   N  ND2   . ASN A 1 53  ? -32.206 41.524 -13.110 1.00 121.51 ? 53  ASN A ND2   1 
ATOM   399   N  N     . THR A 1 54  ? -32.633 37.508 -9.093  1.00 113.36 ? 54  THR A N     1 
ATOM   400   C  CA    . THR A 1 54  ? -32.459 36.060 -8.965  1.00 121.88 ? 54  THR A CA    1 
ATOM   401   C  C     . THR A 1 54  ? -33.706 35.200 -9.164  1.00 131.14 ? 54  THR A C     1 
ATOM   402   O  O     . THR A 1 54  ? -34.837 35.635 -8.925  1.00 131.05 ? 54  THR A O     1 
ATOM   403   C  CB    . THR A 1 54  ? -31.801 35.714 -7.648  1.00 121.31 ? 54  THR A CB    1 
ATOM   404   O  OG1   . THR A 1 54  ? -32.508 36.374 -6.587  1.00 130.75 ? 54  THR A OG1   1 
ATOM   405   C  CG2   . THR A 1 54  ? -30.364 36.203 -7.672  1.00 117.33 ? 54  THR A CG2   1 
ATOM   406   N  N     . PHE A 1 55  ? -33.460 33.964 -9.591  1.00 129.96 ? 55  PHE A N     1 
ATOM   407   C  CA    . PHE A 1 55  ? -34.498 33.011 -9.992  1.00 124.91 ? 55  PHE A CA    1 
ATOM   408   C  C     . PHE A 1 55  ? -35.753 33.045 -9.126  1.00 119.56 ? 55  PHE A C     1 
ATOM   409   O  O     . PHE A 1 55  ? -36.843 32.719 -9.587  1.00 119.23 ? 55  PHE A O     1 
ATOM   410   C  CB    . PHE A 1 55  ? -33.948 31.601 -9.900  1.00 121.52 ? 55  PHE A CB    1 
ATOM   411   C  CG    . PHE A 1 55  ? -34.048 31.043 -8.532  1.00 122.28 ? 55  PHE A CG    1 
ATOM   412   C  CD1   . PHE A 1 55  ? -33.362 31.632 -7.491  1.00 135.11 ? 55  PHE A CD1   1 
ATOM   413   C  CD2   . PHE A 1 55  ? -34.870 29.979 -8.263  1.00 117.03 ? 55  PHE A CD2   1 
ATOM   414   C  CE1   . PHE A 1 55  ? -33.473 31.139 -6.213  1.00 132.74 ? 55  PHE A CE1   1 
ATOM   415   C  CE2   . PHE A 1 55  ? -34.984 29.484 -6.993  1.00 109.25 ? 55  PHE A CE2   1 
ATOM   416   C  CZ    . PHE A 1 55  ? -34.282 30.060 -5.972  1.00 121.08 ? 55  PHE A CZ    1 
ATOM   417   N  N     . ASP A 1 56  ? -35.591 33.394 -7.859  1.00 116.66 ? 56  ASP A N     1 
ATOM   418   C  CA    . ASP A 1 56  ? -36.683 33.274 -6.913  1.00 117.82 ? 56  ASP A CA    1 
ATOM   419   C  C     . ASP A 1 56  ? -37.520 34.538 -6.889  1.00 116.94 ? 56  ASP A C     1 
ATOM   420   O  O     . ASP A 1 56  ? -38.656 34.534 -6.418  1.00 124.79 ? 56  ASP A O     1 
ATOM   421   C  CB    . ASP A 1 56  ? -36.139 33.000 -5.525  1.00 118.35 ? 56  ASP A CB    1 
ATOM   422   C  CG    . ASP A 1 56  ? -35.321 34.142 -5.002  1.00 127.61 ? 56  ASP A CG    1 
ATOM   423   O  OD1   . ASP A 1 56  ? -34.159 34.308 -5.464  1.00 119.53 ? 56  ASP A OD1   1 
ATOM   424   O  OD2   . ASP A 1 56  ? -35.855 34.866 -4.127  1.00 136.24 ? 56  ASP A OD2   1 
ATOM   425   N  N     . LYS A 1 57  ? -36.959 35.628 -7.388  1.00 104.86 ? 57  LYS A N     1 
ATOM   426   C  CA    . LYS A 1 57  ? -37.682 36.888 -7.370  1.00 114.29 ? 57  LYS A CA    1 
ATOM   427   C  C     . LYS A 1 57  ? -38.090 37.292 -8.786  1.00 130.98 ? 57  LYS A C     1 
ATOM   428   O  O     . LYS A 1 57  ? -37.620 36.707 -9.770  1.00 125.00 ? 57  LYS A O     1 
ATOM   429   C  CB    . LYS A 1 57  ? -36.844 37.981 -6.710  1.00 105.75 ? 57  LYS A CB    1 
ATOM   430   C  CG    . LYS A 1 57  ? -36.075 37.524 -5.489  1.00 122.08 ? 57  LYS A CG    1 
ATOM   431   C  CD    . LYS A 1 57  ? -35.104 38.588 -4.994  1.00 133.02 ? 57  LYS A CD    1 
ATOM   432   C  CE    . LYS A 1 57  ? -34.279 38.066 -3.824  1.00 146.10 ? 57  LYS A CE    1 
ATOM   433   N  NZ    . LYS A 1 57  ? -33.429 39.126 -3.224  1.00 155.32 ? 57  LYS A NZ    1 
ATOM   434   N  N     . SER A 1 58  ? -38.969 38.291 -8.871  1.00 131.67 ? 58  SER A N     1 
ATOM   435   C  CA    . SER A 1 58  ? -39.523 38.759 -10.138 1.00 126.02 ? 58  SER A CA    1 
ATOM   436   C  C     . SER A 1 58  ? -38.455 39.034 -11.200 1.00 136.47 ? 58  SER A C     1 
ATOM   437   O  O     . SER A 1 58  ? -37.287 39.271 -10.872 1.00 143.99 ? 58  SER A O     1 
ATOM   438   C  CB    . SER A 1 58  ? -40.358 40.010 -9.884  1.00 133.22 ? 58  SER A CB    1 
ATOM   439   O  OG    . SER A 1 58  ? -40.408 40.827 -11.034 1.00 149.20 ? 58  SER A OG    1 
ATOM   440   N  N     . TYR A 1 59  ? -38.855 38.994 -12.471 1.00 134.25 ? 59  TYR A N     1 
ATOM   441   C  CA    . TYR A 1 59  ? -37.947 39.316 -13.571 1.00 121.82 ? 59  TYR A CA    1 
ATOM   442   C  C     . TYR A 1 59  ? -37.624 40.806 -13.590 1.00 123.91 ? 59  TYR A C     1 
ATOM   443   O  O     . TYR A 1 59  ? -38.202 41.590 -12.836 1.00 139.04 ? 59  TYR A O     1 
ATOM   444   C  CB    . TYR A 1 59  ? -38.574 38.945 -14.906 1.00 118.12 ? 59  TYR A CB    1 
ATOM   445   C  CG    . TYR A 1 59  ? -38.707 37.470 -15.160 1.00 116.22 ? 59  TYR A CG    1 
ATOM   446   C  CD1   . TYR A 1 59  ? -39.933 36.836 -15.074 1.00 122.10 ? 59  TYR A CD1   1 
ATOM   447   C  CD2   . TYR A 1 59  ? -37.610 36.717 -15.514 1.00 123.57 ? 59  TYR A CD2   1 
ATOM   448   C  CE1   . TYR A 1 59  ? -40.054 35.488 -15.333 1.00 130.53 ? 59  TYR A CE1   1 
ATOM   449   C  CE2   . TYR A 1 59  ? -37.722 35.376 -15.771 1.00 126.91 ? 59  TYR A CE2   1 
ATOM   450   C  CZ    . TYR A 1 59  ? -38.938 34.765 -15.677 1.00 126.42 ? 59  TYR A CZ    1 
ATOM   451   O  OH    . TYR A 1 59  ? -39.021 33.423 -15.937 1.00 128.70 ? 59  TYR A OH    1 
ATOM   452   N  N     . ARG A 1 60  ? -36.707 41.203 -14.464 1.00 118.00 ? 60  ARG A N     1 
ATOM   453   C  CA    . ARG A 1 60  ? -36.350 42.615 -14.578 1.00 113.29 ? 60  ARG A CA    1 
ATOM   454   C  C     . ARG A 1 60  ? -35.926 42.999 -16.000 1.00 109.23 ? 60  ARG A C     1 
ATOM   455   O  O     . ARG A 1 60  ? -35.073 42.348 -16.617 1.00 89.35  ? 60  ARG A O     1 
ATOM   456   C  CB    . ARG A 1 60  ? -35.289 43.011 -13.536 1.00 94.83  ? 60  ARG A CB    1 
ATOM   457   N  N     . LYS A 1 61  ? -36.581 44.044 -16.504 1.00 107.83 ? 61  LYS A N     1 
ATOM   458   C  CA    . LYS A 1 61  ? -36.285 44.690 -17.780 1.00 102.83 ? 61  LYS A CA    1 
ATOM   459   C  C     . LYS A 1 61  ? -34.838 44.529 -18.264 1.00 99.42  ? 61  LYS A C     1 
ATOM   460   O  O     . LYS A 1 61  ? -33.951 45.227 -17.791 1.00 85.24  ? 61  LYS A O     1 
ATOM   461   C  CB    . LYS A 1 61  ? -36.702 46.163 -17.750 1.00 120.33 ? 61  LYS A CB    1 
ATOM   462   C  CG    . LYS A 1 61  ? -37.620 46.584 -18.889 1.00 137.59 ? 61  LYS A CG    1 
ATOM   463   C  CD    . LYS A 1 61  ? -39.075 46.407 -18.470 1.00 159.20 ? 61  LYS A CD    1 
ATOM   464   C  CE    . LYS A 1 61  ? -40.058 46.526 -19.637 1.00 167.97 ? 61  LYS A CE    1 
ATOM   465   N  NZ    . LYS A 1 61  ? -40.210 45.262 -20.412 1.00 161.07 ? 61  LYS A NZ    1 
ATOM   466   N  N     . SER A 1 62  ? -34.580 43.559 -19.134 1.00 100.83 ? 62  SER A N     1 
ATOM   467   C  CA    . SER A 1 62  ? -33.225 43.348 -19.648 1.00 91.29  ? 62  SER A CA    1 
ATOM   468   C  C     . SER A 1 62  ? -32.414 44.639 -19.774 1.00 96.17  ? 62  SER A C     1 
ATOM   469   O  O     . SER A 1 62  ? -31.291 44.694 -19.301 1.00 101.97 ? 62  SER A O     1 
ATOM   470   C  CB    . SER A 1 62  ? -33.237 42.635 -21.006 1.00 93.66  ? 62  SER A CB    1 
ATOM   471   O  OG    . SER A 1 62  ? -34.001 41.445 -20.989 1.00 103.62 ? 62  SER A OG    1 
ATOM   472   N  N     . ALA A 1 63  ? -32.966 45.668 -20.412 1.00 86.74  ? 63  ALA A N     1 
ATOM   473   C  CA    . ALA A 1 63  ? -32.197 46.886 -20.671 1.00 80.71  ? 63  ALA A CA    1 
ATOM   474   C  C     . ALA A 1 63  ? -31.626 47.567 -19.413 1.00 84.39  ? 63  ALA A C     1 
ATOM   475   O  O     . ALA A 1 63  ? -30.522 48.111 -19.435 1.00 91.22  ? 63  ALA A O     1 
ATOM   476   C  CB    . ALA A 1 63  ? -32.988 47.855 -21.514 1.00 86.13  ? 63  ALA A CB    1 
ATOM   477   N  N     . LYS A 1 64  ? -32.383 47.552 -18.324 1.00 87.30  ? 64  LYS A N     1 
ATOM   478   C  CA    . LYS A 1 64  ? -31.879 48.013 -17.033 1.00 98.29  ? 64  LYS A CA    1 
ATOM   479   C  C     . LYS A 1 64  ? -30.668 47.185 -16.626 1.00 99.36  ? 64  LYS A C     1 
ATOM   480   O  O     . LYS A 1 64  ? -29.629 47.730 -16.259 1.00 105.25 ? 64  LYS A O     1 
ATOM   481   C  CB    . LYS A 1 64  ? -32.958 47.907 -15.961 1.00 105.30 ? 64  LYS A CB    1 
ATOM   482   C  CG    . LYS A 1 64  ? -32.732 48.797 -14.746 1.00 108.33 ? 64  LYS A CG    1 
ATOM   483   C  CD    . LYS A 1 64  ? -33.713 48.464 -13.636 1.00 115.27 ? 64  LYS A CD    1 
ATOM   484   C  CE    . LYS A 1 64  ? -33.270 49.082 -12.324 1.00 134.72 ? 64  LYS A CE    1 
ATOM   485   N  NZ    . LYS A 1 64  ? -34.078 48.571 -11.172 1.00 150.89 ? 64  LYS A NZ    1 
ATOM   486   N  N     . SER A 1 65  ? -30.803 45.866 -16.698 1.00 94.29  ? 65  SER A N     1 
ATOM   487   C  CA    . SER A 1 65  ? -29.670 44.965 -16.479 1.00 108.20 ? 65  SER A CA    1 
ATOM   488   C  C     . SER A 1 65  ? -28.462 45.346 -17.342 1.00 106.57 ? 65  SER A C     1 
ATOM   489   O  O     . SER A 1 65  ? -27.343 45.453 -16.839 1.00 113.96 ? 65  SER A O     1 
ATOM   490   C  CB    . SER A 1 65  ? -30.058 43.497 -16.761 1.00 118.79 ? 65  SER A CB    1 
ATOM   491   O  OG    . SER A 1 65  ? -30.903 42.931 -15.760 1.00 115.39 ? 65  SER A OG    1 
ATOM   492   N  N     . VAL A 1 66  ? -28.688 45.542 -18.639 1.00 99.47  ? 66  VAL A N     1 
ATOM   493   C  CA    . VAL A 1 66  ? -27.590 45.821 -19.565 1.00 107.47 ? 66  VAL A CA    1 
ATOM   494   C  C     . VAL A 1 66  ? -26.888 47.119 -19.201 1.00 103.04 ? 66  VAL A C     1 
ATOM   495   O  O     . VAL A 1 66  ? -25.655 47.198 -19.195 1.00 108.55 ? 66  VAL A O     1 
ATOM   496   C  CB    . VAL A 1 66  ? -28.045 45.886 -21.052 1.00 94.70  ? 66  VAL A CB    1 
ATOM   497   C  CG1   . VAL A 1 66  ? -26.879 45.625 -21.957 1.00 85.75  ? 66  VAL A CG1   1 
ATOM   498   C  CG2   . VAL A 1 66  ? -29.094 44.846 -21.342 1.00 103.07 ? 66  VAL A CG2   1 
ATOM   499   N  N     . GLY A 1 67  ? -27.680 48.136 -18.895 1.00 98.00  ? 67  GLY A N     1 
ATOM   500   C  CA    . GLY A 1 67  ? -27.128 49.430 -18.546 1.00 111.18 ? 67  GLY A CA    1 
ATOM   501   C  C     . GLY A 1 67  ? -26.199 49.338 -17.352 1.00 105.43 ? 67  GLY A C     1 
ATOM   502   O  O     . GLY A 1 67  ? -25.114 49.917 -17.321 1.00 102.98 ? 67  GLY A O     1 
ATOM   503   N  N     . ASN A 1 68  ? -26.631 48.611 -16.337 1.00 103.89 ? 68  ASN A N     1 
ATOM   504   C  CA    . ASN A 1 68  ? -25.818 48.511 -15.148 1.00 102.25 ? 68  ASN A CA    1 
ATOM   505   C  C     . ASN A 1 68  ? -24.501 47.791 -15.418 1.00 97.44  ? 68  ASN A C     1 
ATOM   506   O  O     . ASN A 1 68  ? -23.445 48.246 -15.005 1.00 102.36 ? 68  ASN A O     1 
ATOM   507   C  CB    . ASN A 1 68  ? -26.632 47.957 -13.967 1.00 104.24 ? 68  ASN A CB    1 
ATOM   508   C  CG    . ASN A 1 68  ? -27.579 49.015 -13.381 1.00 123.30 ? 68  ASN A CG    1 
ATOM   509   O  OD1   . ASN A 1 68  ? -28.681 49.232 -13.887 1.00 130.50 ? 68  ASN A OD1   1 
ATOM   510   N  ND2   . ASN A 1 68  ? -27.129 49.702 -12.337 1.00 127.77 ? 68  ASN A ND2   1 
ATOM   511   N  N     . ILE A 1 69  ? -24.555 46.691 -16.150 1.00 103.19 ? 69  ILE A N     1 
ATOM   512   C  CA    . ILE A 1 69  ? -23.335 45.991 -16.512 1.00 99.63  ? 69  ILE A CA    1 
ATOM   513   C  C     . ILE A 1 69  ? -22.346 46.897 -17.225 1.00 98.15  ? 69  ILE A C     1 
ATOM   514   O  O     . ILE A 1 69  ? -21.173 46.972 -16.858 1.00 94.91  ? 69  ILE A O     1 
ATOM   515   C  CB    . ILE A 1 69  ? -23.639 44.911 -17.469 1.00 93.61  ? 69  ILE A CB    1 
ATOM   516   C  CG1   . ILE A 1 69  ? -24.413 43.813 -16.758 1.00 86.05  ? 69  ILE A CG1   1 
ATOM   517   C  CG2   . ILE A 1 69  ? -22.348 44.423 -18.022 1.00 96.53  ? 69  ILE A CG2   1 
ATOM   518   C  CD1   . ILE A 1 69  ? -24.777 42.686 -17.661 1.00 81.77  ? 69  ILE A CD1   1 
ATOM   519   N  N     . MET A 1 70  ? -22.836 47.565 -18.263 1.00 84.75  ? 70  MET A N     1 
ATOM   520   C  CA    . MET A 1 70  ? -22.047 48.527 -19.020 1.00 88.36  ? 70  MET A CA    1 
ATOM   521   C  C     . MET A 1 70  ? -21.453 49.590 -18.098 1.00 104.06 ? 70  MET A C     1 
ATOM   522   O  O     . MET A 1 70  ? -20.268 49.905 -18.184 1.00 121.64 ? 70  MET A O     1 
ATOM   523   C  CB    . MET A 1 70  ? -22.936 49.207 -20.077 1.00 97.27  ? 70  MET A CB    1 
ATOM   524   C  CG    . MET A 1 70  ? -22.648 48.894 -21.548 1.00 99.73  ? 70  MET A CG    1 
ATOM   525   S  SD    . MET A 1 70  ? -23.637 49.906 -22.706 1.00 127.35 ? 70  MET A SD    1 
ATOM   526   C  CE    . MET A 1 70  ? -25.303 49.450 -22.229 1.00 189.96 ? 70  MET A CE    1 
ATOM   527   N  N     . GLY A 1 71  ? -22.292 50.149 -17.228 1.00 97.15  ? 71  GLY A N     1 
ATOM   528   C  CA    . GLY A 1 71  ? -21.900 51.265 -16.391 1.00 90.32  ? 71  GLY A CA    1 
ATOM   529   C  C     . GLY A 1 71  ? -20.858 50.931 -15.343 1.00 106.43 ? 71  GLY A C     1 
ATOM   530   O  O     . GLY A 1 71  ? -19.913 51.689 -15.134 1.00 117.99 ? 71  GLY A O     1 
ATOM   531   N  N     . ASN A 1 72  ? -21.069 49.822 -14.641 1.00 111.10 ? 72  ASN A N     1 
ATOM   532   C  CA    . ASN A 1 72  ? -20.171 49.378 -13.587 1.00 104.62 ? 72  ASN A CA    1 
ATOM   533   C  C     . ASN A 1 72  ? -18.974 48.576 -14.062 1.00 107.50 ? 72  ASN A C     1 
ATOM   534   O  O     . ASN A 1 72  ? -17.836 48.910 -13.747 1.00 125.29 ? 72  ASN A O     1 
ATOM   535   C  CB    . ASN A 1 72  ? -20.945 48.566 -12.566 1.00 112.16 ? 72  ASN A CB    1 
ATOM   536   C  CG    . ASN A 1 72  ? -22.104 49.341 -11.993 1.00 128.42 ? 72  ASN A CG    1 
ATOM   537   O  OD1   . ASN A 1 72  ? -22.230 50.547 -12.240 1.00 130.69 ? 72  ASN A OD1   1 
ATOM   538   N  ND2   . ASN A 1 72  ? -22.962 48.664 -11.226 1.00 135.84 ? 72  ASN A ND2   1 
ATOM   539   N  N     . PHE A 1 73  ? -19.231 47.479 -14.760 1.00 102.93 ? 73  PHE A N     1 
ATOM   540   C  CA    . PHE A 1 73  ? -18.154 46.549 -15.105 1.00 107.88 ? 73  PHE A CA    1 
ATOM   541   C  C     . PHE A 1 73  ? -17.594 46.528 -16.531 1.00 110.12 ? 73  PHE A C     1 
ATOM   542   O  O     . PHE A 1 73  ? -16.389 46.373 -16.703 1.00 121.76 ? 73  PHE A O     1 
ATOM   543   C  CB    . PHE A 1 73  ? -18.575 45.154 -14.708 1.00 96.68  ? 73  PHE A CB    1 
ATOM   544   C  CG    . PHE A 1 73  ? -19.215 45.115 -13.371 1.00 100.48 ? 73  PHE A CG    1 
ATOM   545   C  CD1   . PHE A 1 73  ? -20.592 45.137 -13.247 1.00 111.72 ? 73  PHE A CD1   1 
ATOM   546   C  CD2   . PHE A 1 73  ? -18.446 45.105 -12.234 1.00 95.03  ? 73  PHE A CD2   1 
ATOM   547   C  CE1   . PHE A 1 73  ? -21.185 45.119 -12.014 1.00 106.68 ? 73  PHE A CE1   1 
ATOM   548   C  CE2   . PHE A 1 73  ? -19.030 45.083 -11.004 1.00 96.44  ? 73  PHE A CE2   1 
ATOM   549   C  CZ    . PHE A 1 73  ? -20.405 45.100 -10.896 1.00 106.62 ? 73  PHE A CZ    1 
ATOM   550   N  N     . HIS A 1 74  ? -18.453 46.666 -17.539 1.00 100.72 ? 74  HIS A N     1 
ATOM   551   C  CA    . HIS A 1 74  ? -18.110 46.228 -18.902 1.00 101.77 ? 74  HIS A CA    1 
ATOM   552   C  C     . HIS A 1 74  ? -18.166 47.304 -19.995 1.00 108.79 ? 74  HIS A C     1 
ATOM   553   O  O     . HIS A 1 74  ? -19.224 47.551 -20.574 1.00 101.12 ? 74  HIS A O     1 
ATOM   554   C  CB    . HIS A 1 74  ? -19.034 45.084 -19.294 1.00 94.46  ? 74  HIS A CB    1 
ATOM   555   C  CG    . HIS A 1 74  ? -18.545 44.289 -20.455 1.00 94.13  ? 74  HIS A CG    1 
ATOM   556   N  ND1   . HIS A 1 74  ? -17.507 43.395 -20.352 1.00 93.16  ? 74  HIS A ND1   1 
ATOM   557   C  CD2   . HIS A 1 74  ? -18.957 44.243 -21.741 1.00 99.64  ? 74  HIS A CD2   1 
ATOM   558   C  CE1   . HIS A 1 74  ? -17.295 42.836 -21.530 1.00 101.38 ? 74  HIS A CE1   1 
ATOM   559   N  NE2   . HIS A 1 74  ? -18.161 43.331 -22.391 1.00 92.15  ? 74  HIS A NE2   1 
ATOM   560   N  N     . PRO A 1 75  ? -17.008 47.903 -20.316 1.00 116.35 ? 75  PRO A N     1 
ATOM   561   C  CA    . PRO A 1 75  ? -16.907 49.099 -21.159 1.00 114.30 ? 75  PRO A CA    1 
ATOM   562   C  C     . PRO A 1 75  ? -17.054 48.818 -22.648 1.00 116.70 ? 75  PRO A C     1 
ATOM   563   O  O     . PRO A 1 75  ? -16.089 49.022 -23.380 1.00 133.47 ? 75  PRO A O     1 
ATOM   564   C  CB    . PRO A 1 75  ? -15.465 49.585 -20.902 1.00 113.20 ? 75  PRO A CB    1 
ATOM   565   C  CG    . PRO A 1 75  ? -14.877 48.667 -19.866 1.00 106.69 ? 75  PRO A CG    1 
ATOM   566   C  CD    . PRO A 1 75  ? -15.678 47.409 -19.932 1.00 116.18 ? 75  PRO A CD    1 
ATOM   567   N  N     . HIS A 1 76  ? -18.222 48.373 -23.094 1.00 108.68 ? 76  HIS A N     1 
ATOM   568   C  CA    . HIS A 1 76  ? -18.398 48.024 -24.501 1.00 101.46 ? 76  HIS A CA    1 
ATOM   569   C  C     . HIS A 1 76  ? -19.831 48.194 -24.956 1.00 102.86 ? 76  HIS A C     1 
ATOM   570   O  O     . HIS A 1 76  ? -20.646 48.789 -24.256 1.00 110.92 ? 76  HIS A O     1 
ATOM   571   C  CB    . HIS A 1 76  ? -17.911 46.609 -24.807 1.00 103.04 ? 76  HIS A CB    1 
ATOM   572   C  CG    . HIS A 1 76  ? -16.577 46.304 -24.211 1.00 117.96 ? 76  HIS A CG    1 
ATOM   573   N  ND1   . HIS A 1 76  ? -15.412 46.322 -24.944 1.00 121.40 ? 76  HIS A ND1   1 
ATOM   574   C  CD2   . HIS A 1 76  ? -16.220 46.010 -22.937 1.00 126.17 ? 76  HIS A CD2   1 
ATOM   575   C  CE1   . HIS A 1 76  ? -14.395 46.033 -24.150 1.00 130.88 ? 76  HIS A CE1   1 
ATOM   576   N  NE2   . HIS A 1 76  ? -14.857 45.846 -22.927 1.00 129.13 ? 76  HIS A NE2   1 
ATOM   577   N  N     . GLY A 1 77  ? -20.127 47.675 -26.142 1.00 112.94 ? 77  GLY A N     1 
ATOM   578   C  CA    . GLY A 1 77  ? -21.434 47.844 -26.740 1.00 122.23 ? 77  GLY A CA    1 
ATOM   579   C  C     . GLY A 1 77  ? -22.506 47.193 -25.901 1.00 127.06 ? 77  GLY A C     1 
ATOM   580   O  O     . GLY A 1 77  ? -22.266 46.197 -25.215 1.00 116.16 ? 77  GLY A O     1 
ATOM   581   N  N     . ASP A 1 78  ? -23.697 47.768 -25.935 1.00 136.40 ? 78  ASP A N     1 
ATOM   582   C  CA    . ASP A 1 78  ? -24.818 47.122 -25.288 1.00 135.80 ? 78  ASP A CA    1 
ATOM   583   C  C     . ASP A 1 78  ? -25.132 45.839 -26.042 1.00 124.80 ? 78  ASP A C     1 
ATOM   584   O  O     . ASP A 1 78  ? -25.278 44.783 -25.437 1.00 123.29 ? 78  ASP A O     1 
ATOM   585   C  CB    . ASP A 1 78  ? -26.029 48.049 -25.225 1.00 149.24 ? 78  ASP A CB    1 
ATOM   586   C  CG    . ASP A 1 78  ? -26.031 49.070 -26.337 1.00 173.74 ? 78  ASP A CG    1 
ATOM   587   O  OD1   . ASP A 1 78  ? -26.141 50.277 -26.023 1.00 181.45 ? 78  ASP A OD1   1 
ATOM   588   O  OD2   . ASP A 1 78  ? -25.907 48.665 -27.519 1.00 180.04 ? 78  ASP A OD2   1 
ATOM   589   N  N     . SER A 1 79  ? -25.194 45.920 -27.367 1.00 116.85 ? 79  SER A N     1 
ATOM   590   C  CA    . SER A 1 79  ? -25.560 44.755 -28.165 1.00 115.45 ? 79  SER A CA    1 
ATOM   591   C  C     . SER A 1 79  ? -24.656 43.566 -27.859 1.00 109.71 ? 79  SER A C     1 
ATOM   592   O  O     . SER A 1 79  ? -25.134 42.450 -27.722 1.00 106.47 ? 79  SER A O     1 
ATOM   593   C  CB    . SER A 1 79  ? -25.505 45.068 -29.650 1.00 131.77 ? 79  SER A CB    1 
ATOM   594   O  OG    . SER A 1 79  ? -24.177 44.902 -30.098 1.00 145.82 ? 79  SER A OG    1 
ATOM   595   N  N     . SER A 1 80  ? -23.350 43.801 -27.754 1.00 120.41 ? 80  SER A N     1 
ATOM   596   C  CA    . SER A 1 80  ? -22.409 42.725 -27.437 1.00 114.17 ? 80  SER A CA    1 
ATOM   597   C  C     . SER A 1 80  ? -22.826 42.031 -26.150 1.00 99.81  ? 80  SER A C     1 
ATOM   598   O  O     . SER A 1 80  ? -22.878 40.805 -26.082 1.00 101.28 ? 80  SER A O     1 
ATOM   599   C  CB    . SER A 1 80  ? -20.978 43.253 -27.294 1.00 116.32 ? 80  SER A CB    1 
ATOM   600   O  OG    . SER A 1 80  ? -20.749 44.357 -28.157 1.00 126.04 ? 80  SER A OG    1 
ATOM   601   N  N     . ILE A 1 81  ? -23.118 42.843 -25.137 1.00 97.13  ? 81  ILE A N     1 
ATOM   602   C  CA    . ILE A 1 81  ? -23.539 42.396 -23.809 1.00 89.61  ? 81  ILE A CA    1 
ATOM   603   C  C     . ILE A 1 81  ? -24.876 41.652 -23.815 1.00 93.34  ? 81  ILE A C     1 
ATOM   604   O  O     . ILE A 1 81  ? -24.963 40.511 -23.381 1.00 99.37  ? 81  ILE A O     1 
ATOM   605   C  CB    . ILE A 1 81  ? -23.650 43.614 -22.873 1.00 84.94  ? 81  ILE A CB    1 
ATOM   606   C  CG1   . ILE A 1 81  ? -22.270 44.182 -22.598 1.00 107.55 ? 81  ILE A CG1   1 
ATOM   607   C  CG2   . ILE A 1 81  ? -24.273 43.263 -21.564 1.00 70.96  ? 81  ILE A CG2   1 
ATOM   608   C  CD1   . ILE A 1 81  ? -22.282 45.372 -21.674 1.00 114.80 ? 81  ILE A CD1   1 
ATOM   609   N  N     . TYR A 1 82  ? -25.922 42.313 -24.292 1.00 81.70  ? 82  TYR A N     1 
ATOM   610   C  CA    . TYR A 1 82  ? -27.257 41.738 -24.297 1.00 85.53  ? 82  TYR A CA    1 
ATOM   611   C  C     . TYR A 1 82  ? -27.369 40.506 -25.168 1.00 89.30  ? 82  TYR A C     1 
ATOM   612   O  O     . TYR A 1 82  ? -28.099 39.569 -24.852 1.00 81.86  ? 82  TYR A O     1 
ATOM   613   C  CB    . TYR A 1 82  ? -28.238 42.748 -24.839 1.00 95.23  ? 82  TYR A CB    1 
ATOM   614   C  CG    . TYR A 1 82  ? -29.631 42.197 -25.016 1.00 103.34 ? 82  TYR A CG    1 
ATOM   615   C  CD1   . TYR A 1 82  ? -30.435 41.921 -23.910 1.00 105.49 ? 82  TYR A CD1   1 
ATOM   616   C  CD2   . TYR A 1 82  ? -30.155 41.987 -26.279 1.00 88.03  ? 82  TYR A CD2   1 
ATOM   617   C  CE1   . TYR A 1 82  ? -31.709 41.439 -24.066 1.00 107.63 ? 82  TYR A CE1   1 
ATOM   618   C  CE2   . TYR A 1 82  ? -31.430 41.515 -26.442 1.00 93.32  ? 82  TYR A CE2   1 
ATOM   619   C  CZ    . TYR A 1 82  ? -32.204 41.237 -25.339 1.00 104.68 ? 82  TYR A CZ    1 
ATOM   620   O  OH    . TYR A 1 82  ? -33.485 40.760 -25.504 1.00 104.08 ? 82  TYR A OH    1 
ATOM   621   N  N     . ASP A 1 83  ? -26.691 40.545 -26.306 1.00 92.37  ? 83  ASP A N     1 
ATOM   622   C  CA    . ASP A 1 83  ? -26.664 39.409 -27.201 1.00 94.17  ? 83  ASP A CA    1 
ATOM   623   C  C     . ASP A 1 83  ? -26.109 38.224 -26.425 1.00 91.54  ? 83  ASP A C     1 
ATOM   624   O  O     . ASP A 1 83  ? -26.656 37.125 -26.469 1.00 99.61  ? 83  ASP A O     1 
ATOM   625   C  CB    . ASP A 1 83  ? -25.834 39.726 -28.459 1.00 108.31 ? 83  ASP A CB    1 
ATOM   626   C  CG    . ASP A 1 83  ? -26.682 40.344 -29.598 1.00 138.67 ? 83  ASP A CG    1 
ATOM   627   O  OD1   . ASP A 1 83  ? -27.927 40.400 -29.459 1.00 149.71 ? 83  ASP A OD1   1 
ATOM   628   O  OD2   . ASP A 1 83  ? -26.111 40.766 -30.639 1.00 132.62 ? 83  ASP A OD2   1 
ATOM   629   N  N     . ALA A 1 84  ? -25.027 38.464 -25.698 1.00 94.61  ? 84  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 84  ? -24.383 37.431 -24.894 1.00 95.24  ? 84  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 84  ? -25.299 36.949 -23.787 1.00 94.70  ? 84  ALA A C     1 
ATOM   632   O  O     . ALA A 1 84  ? -25.368 35.758 -23.500 1.00 88.28  ? 84  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 84  ? -23.103 37.981 -24.298 1.00 97.65  ? 84  ALA A CB    1 
ATOM   634   N  N     . MET A 1 85  ? -25.978 37.896 -23.148 1.00 105.82 ? 85  MET A N     1 
ATOM   635   C  CA    . MET A 1 85  ? -26.909 37.586 -22.077 1.00 108.03 ? 85  MET A CA    1 
ATOM   636   C  C     . MET A 1 85  ? -27.985 36.666 -22.616 1.00 102.41 ? 85  MET A C     1 
ATOM   637   O  O     . MET A 1 85  ? -28.311 35.659 -22.009 1.00 111.36 ? 85  MET A O     1 
ATOM   638   C  CB    . MET A 1 85  ? -27.533 38.867 -21.526 1.00 103.14 ? 85  MET A CB    1 
ATOM   639   C  CG    . MET A 1 85  ? -28.691 38.612 -20.583 1.00 103.59 ? 85  MET A CG    1 
ATOM   640   S  SD    . MET A 1 85  ? -29.365 40.126 -19.878 1.00 113.78 ? 85  MET A SD    1 
ATOM   641   N  N     . VAL A 1 86  ? -28.523 37.025 -23.771 1.00 84.88  ? 86  VAL A N     1 
ATOM   642   C  CA    . VAL A 1 86  ? -29.506 36.206 -24.452 1.00 92.86  ? 86  VAL A CA    1 
ATOM   643   C  C     . VAL A 1 86  ? -29.030 34.788 -24.784 1.00 90.15  ? 86  VAL A C     1 
ATOM   644   O  O     . VAL A 1 86  ? -29.794 33.839 -24.673 1.00 94.13  ? 86  VAL A O     1 
ATOM   645   C  CB    . VAL A 1 86  ? -29.980 36.880 -25.743 1.00 95.91  ? 86  VAL A CB    1 
ATOM   646   C  CG1   . VAL A 1 86  ? -30.792 35.890 -26.604 1.00 86.26  ? 86  VAL A CG1   1 
ATOM   647   C  CG2   . VAL A 1 86  ? -30.774 38.158 -25.414 1.00 88.23  ? 86  VAL A CG2   1 
ATOM   648   N  N     . ARG A 1 87  ? -27.790 34.627 -25.217 1.00 89.87  ? 87  ARG A N     1 
ATOM   649   C  CA    . ARG A 1 87  ? -27.319 33.281 -25.507 1.00 95.15  ? 87  ARG A CA    1 
ATOM   650   C  C     . ARG A 1 87  ? -27.476 32.416 -24.271 1.00 105.60 ? 87  ARG A C     1 
ATOM   651   O  O     . ARG A 1 87  ? -27.884 31.261 -24.350 1.00 114.17 ? 87  ARG A O     1 
ATOM   652   C  CB    . ARG A 1 87  ? -25.866 33.259 -25.944 1.00 96.11  ? 87  ARG A CB    1 
ATOM   653   C  CG    . ARG A 1 87  ? -25.426 31.883 -26.393 1.00 98.88  ? 87  ARG A CG    1 
ATOM   654   C  CD    . ARG A 1 87  ? -24.234 32.013 -27.304 1.00 109.42 ? 87  ARG A CD    1 
ATOM   655   N  NE    . ARG A 1 87  ? -24.000 30.833 -28.117 1.00 115.50 ? 87  ARG A NE    1 
ATOM   656   C  CZ    . ARG A 1 87  ? -23.573 29.680 -27.626 1.00 148.27 ? 87  ARG A CZ    1 
ATOM   657   N  NH1   . ARG A 1 87  ? -23.359 29.559 -26.320 1.00 158.30 ? 87  ARG A NH1   1 
ATOM   658   N  NH2   . ARG A 1 87  ? -23.376 28.648 -28.435 1.00 162.60 ? 87  ARG A NH2   1 
ATOM   659   N  N     . MET A 1 88  ? -27.133 32.990 -23.127 1.00 105.21 ? 88  MET A N     1 
ATOM   660   C  CA    . MET A 1 88  ? -27.193 32.289 -21.853 1.00 105.71 ? 88  MET A CA    1 
ATOM   661   C  C     . MET A 1 88  ? -28.613 31.851 -21.452 1.00 106.34 ? 88  MET A C     1 
ATOM   662   O  O     . MET A 1 88  ? -28.780 31.114 -20.481 1.00 115.23 ? 88  MET A O     1 
ATOM   663   C  CB    . MET A 1 88  ? -26.557 33.139 -20.742 1.00 114.13 ? 88  MET A CB    1 
ATOM   664   C  CG    . MET A 1 88  ? -25.107 33.616 -21.016 1.00 108.34 ? 88  MET A CG    1 
ATOM   665   S  SD    . MET A 1 88  ? -24.205 34.241 -19.552 1.00 124.84 ? 88  MET A SD    1 
ATOM   666   C  CE    . MET A 1 88  ? -24.795 35.934 -19.523 1.00 116.61 ? 88  MET A CE    1 
ATOM   667   N  N     . SER A 1 89  ? -29.621 32.383 -22.144 1.00 97.91  ? 89  SER A N     1 
ATOM   668   C  CA    . SER A 1 89  ? -31.027 32.013 -21.954 1.00 104.42 ? 89  SER A CA    1 
ATOM   669   C  C     . SER A 1 89  ? -31.567 30.986 -22.952 1.00 116.70 ? 89  SER A C     1 
ATOM   670   O  O     . SER A 1 89  ? -32.780 30.752 -23.032 1.00 130.57 ? 89  SER A O     1 
ATOM   671   C  CB    . SER A 1 89  ? -31.903 33.259 -22.065 1.00 110.78 ? 89  SER A CB    1 
ATOM   672   O  OG    . SER A 1 89  ? -31.882 33.788 -23.376 1.00 112.39 ? 89  SER A OG    1 
ATOM   673   N  N     . GLN A 1 90  ? -30.677 30.378 -23.718 1.00 108.98 ? 90  GLN A N     1 
ATOM   674   C  CA    . GLN A 1 90  ? -31.087 29.543 -24.846 1.00 113.73 ? 90  GLN A CA    1 
ATOM   675   C  C     . GLN A 1 90  ? -30.920 28.036 -24.627 1.00 115.00 ? 90  GLN A C     1 
ATOM   676   O  O     . GLN A 1 90  ? -29.812 27.522 -24.726 1.00 111.99 ? 90  GLN A O     1 
ATOM   677   C  CB    . GLN A 1 90  ? -30.459 30.033 -26.152 1.00 108.63 ? 90  GLN A CB    1 
ATOM   678   C  CG    . GLN A 1 90  ? -31.144 31.284 -26.682 1.00 104.45 ? 90  GLN A CG    1 
ATOM   679   C  CD    . GLN A 1 90  ? -30.328 32.047 -27.705 1.00 108.80 ? 90  GLN A CD    1 
ATOM   680   O  OE1   . GLN A 1 90  ? -29.090 32.032 -27.685 1.00 113.94 ? 90  GLN A OE1   1 
ATOM   681   N  NE2   . GLN A 1 90  ? -31.022 32.737 -28.602 1.00 108.91 ? 90  GLN A NE2   1 
ATOM   682   N  N     . ASN A 1 91  ? -31.983 27.362 -24.194 1.00 106.90 ? 91  ASN A N     1 
ATOM   683   C  CA    . ASN A 1 91  ? -31.922 25.911 -23.967 1.00 108.21 ? 91  ASN A CA    1 
ATOM   684   C  C     . ASN A 1 91  ? -31.434 25.022 -25.112 1.00 119.11 ? 91  ASN A C     1 
ATOM   685   O  O     . ASN A 1 91  ? -30.800 24.004 -24.857 1.00 138.68 ? 91  ASN A O     1 
ATOM   686   C  CB    . ASN A 1 91  ? -33.235 25.365 -23.448 1.00 120.01 ? 91  ASN A CB    1 
ATOM   687   C  CG    . ASN A 1 91  ? -34.386 25.989 -24.108 1.00 140.40 ? 91  ASN A CG    1 
ATOM   688   O  OD1   . ASN A 1 91  ? -35.001 26.913 -23.558 1.00 149.95 ? 91  ASN A OD1   1 
ATOM   689   N  ND2   . ASN A 1 91  ? -34.676 25.541 -25.329 1.00 140.37 ? 91  ASN A ND2   1 
ATOM   690   N  N     . TRP A 1 92  ? -31.750 25.349 -26.358 1.00 114.37 ? 92  TRP A N     1 
ATOM   691   C  CA    . TRP A 1 92  ? -31.144 24.602 -27.468 1.00 115.61 ? 92  TRP A CA    1 
ATOM   692   C  C     . TRP A 1 92  ? -29.637 24.850 -27.640 1.00 103.11 ? 92  TRP A C     1 
ATOM   693   O  O     . TRP A 1 92  ? -28.964 24.117 -28.350 1.00 98.68  ? 92  TRP A O     1 
ATOM   694   C  CB    . TRP A 1 92  ? -31.864 24.842 -28.789 1.00 119.79 ? 92  TRP A CB    1 
ATOM   695   C  CG    . TRP A 1 92  ? -31.687 26.202 -29.300 1.00 116.82 ? 92  TRP A CG    1 
ATOM   696   C  CD1   . TRP A 1 92  ? -30.795 26.615 -30.234 1.00 118.11 ? 92  TRP A CD1   1 
ATOM   697   C  CD2   . TRP A 1 92  ? -32.421 27.352 -28.903 1.00 117.01 ? 92  TRP A CD2   1 
ATOM   698   N  NE1   . TRP A 1 92  ? -30.926 27.967 -30.452 1.00 117.78 ? 92  TRP A NE1   1 
ATOM   699   C  CE2   . TRP A 1 92  ? -31.924 28.443 -29.646 1.00 120.38 ? 92  TRP A CE2   1 
ATOM   700   C  CE3   . TRP A 1 92  ? -33.448 27.571 -27.986 1.00 111.38 ? 92  TRP A CE3   1 
ATOM   701   C  CZ2   . TRP A 1 92  ? -32.421 29.733 -29.504 1.00 116.85 ? 92  TRP A CZ2   1 
ATOM   702   C  CZ3   . TRP A 1 92  ? -33.938 28.852 -27.844 1.00 115.05 ? 92  TRP A CZ3   1 
ATOM   703   C  CH2   . TRP A 1 92  ? -33.424 29.919 -28.601 1.00 112.94 ? 92  TRP A CH2   1 
ATOM   704   N  N     . LYS A 1 93  ? -29.135 25.943 -27.080 1.00 101.92 ? 93  LYS A N     1 
ATOM   705   C  CA    . LYS A 1 93  ? -27.693 26.204 -27.041 1.00 110.13 ? 93  LYS A CA    1 
ATOM   706   C  C     . LYS A 1 93  ? -26.934 25.682 -25.804 1.00 115.64 ? 93  LYS A C     1 
ATOM   707   O  O     . LYS A 1 93  ? -25.937 24.967 -25.942 1.00 120.97 ? 93  LYS A O     1 
ATOM   708   C  CB    . LYS A 1 93  ? -27.420 27.691 -27.262 1.00 113.82 ? 93  LYS A CB    1 
ATOM   709   C  CG    . LYS A 1 93  ? -27.693 28.090 -28.715 1.00 137.14 ? 93  LYS A CG    1 
ATOM   710   C  CD    . LYS A 1 93  ? -27.588 29.587 -28.970 1.00 147.93 ? 93  LYS A CD    1 
ATOM   711   C  CE    . LYS A 1 93  ? -27.831 29.897 -30.441 1.00 142.07 ? 93  LYS A CE    1 
ATOM   712   N  NZ    . LYS A 1 93  ? -26.987 29.022 -31.289 1.00 134.33 ? 93  LYS A NZ    1 
ATOM   713   N  N     . ASN A 1 94  ? -27.356 26.089 -24.609 1.00 116.81 ? 94  ASN A N     1 
ATOM   714   C  CA    . ASN A 1 94  ? -26.762 25.591 -23.357 1.00 122.22 ? 94  ASN A CA    1 
ATOM   715   C  C     . ASN A 1 94  ? -27.478 24.382 -22.732 1.00 116.91 ? 94  ASN A C     1 
ATOM   716   O  O     . ASN A 1 94  ? -28.702 24.304 -22.772 1.00 119.60 ? 94  ASN A O     1 
ATOM   717   C  CB    . ASN A 1 94  ? -26.691 26.728 -22.341 1.00 126.40 ? 94  ASN A CB    1 
ATOM   718   C  CG    . ASN A 1 94  ? -25.930 27.924 -22.872 1.00 129.41 ? 94  ASN A CG    1 
ATOM   719   O  OD1   . ASN A 1 94  ? -26.529 28.913 -23.291 1.00 136.67 ? 94  ASN A OD1   1 
ATOM   720   N  ND2   . ASN A 1 94  ? -24.602 27.826 -22.890 1.00 131.94 ? 94  ASN A ND2   1 
ATOM   721   N  N     . ARG A 1 95  ? -26.733 23.453 -22.133 1.00 116.74 ? 95  ARG A N     1 
ATOM   722   C  CA    . ARG A 1 95  ? -27.369 22.297 -21.492 1.00 117.10 ? 95  ARG A CA    1 
ATOM   723   C  C     . ARG A 1 95  ? -28.101 22.779 -20.267 1.00 121.62 ? 95  ARG A C     1 
ATOM   724   O  O     . ARG A 1 95  ? -29.319 22.588 -20.128 1.00 124.08 ? 95  ARG A O     1 
ATOM   725   C  CB    . ARG A 1 95  ? -26.376 21.195 -21.098 1.00 98.51  ? 95  ARG A CB    1 
ATOM   726   N  N     . GLU A 1 96  ? -27.343 23.423 -19.387 1.00 120.66 ? 96  GLU A N     1 
ATOM   727   C  CA    . GLU A 1 96  ? -27.906 23.999 -18.183 1.00 128.44 ? 96  GLU A CA    1 
ATOM   728   C  C     . GLU A 1 96  ? -27.862 25.526 -18.261 1.00 117.01 ? 96  GLU A C     1 
ATOM   729   O  O     . GLU A 1 96  ? -26.824 26.138 -18.045 1.00 105.97 ? 96  GLU A O     1 
ATOM   730   C  CB    . GLU A 1 96  ? -27.159 23.472 -16.957 1.00 128.71 ? 96  GLU A CB    1 
ATOM   731   C  CG    . GLU A 1 96  ? -28.093 23.005 -15.838 1.00 152.65 ? 96  GLU A CG    1 
ATOM   732   C  CD    . GLU A 1 96  ? -28.936 21.783 -16.218 1.00 162.63 ? 96  GLU A CD    1 
ATOM   733   O  OE1   . GLU A 1 96  ? -28.719 21.256 -17.328 1.00 175.55 ? 96  GLU A OE1   1 
ATOM   734   O  OE2   . GLU A 1 96  ? -29.805 21.350 -15.413 1.00 152.18 ? 96  GLU A OE2   1 
ATOM   735   N  N     . ILE A 1 97  ? -29.012 26.114 -18.584 1.00 113.81 ? 97  ILE A N     1 
ATOM   736   C  CA    . ILE A 1 97  ? -29.197 27.558 -18.757 1.00 108.14 ? 97  ILE A CA    1 
ATOM   737   C  C     . ILE A 1 97  ? -28.805 28.399 -17.539 1.00 107.93 ? 97  ILE A C     1 
ATOM   738   O  O     . ILE A 1 97  ? -29.166 28.049 -16.410 1.00 113.28 ? 97  ILE A O     1 
ATOM   739   C  CB    . ILE A 1 97  ? -30.689 27.818 -19.105 1.00 112.13 ? 97  ILE A CB    1 
ATOM   740   C  CG1   . ILE A 1 97  ? -30.849 28.060 -20.597 1.00 129.91 ? 97  ILE A CG1   1 
ATOM   741   C  CG2   . ILE A 1 97  ? -31.296 28.987 -18.323 1.00 90.55  ? 97  ILE A CG2   1 
ATOM   742   C  CD1   . ILE A 1 97  ? -32.288 28.339 -20.977 1.00 151.04 ? 97  ILE A CD1   1 
ATOM   743   N  N     . LEU A 1 98  ? -28.089 29.509 -17.747 1.00 95.22  ? 98  LEU A N     1 
ATOM   744   C  CA    . LEU A 1 98  ? -27.776 30.366 -16.604 1.00 96.13  ? 98  LEU A CA    1 
ATOM   745   C  C     . LEU A 1 98  ? -28.591 31.655 -16.547 1.00 103.29 ? 98  LEU A C     1 
ATOM   746   O  O     . LEU A 1 98  ? -28.404 32.476 -15.656 1.00 101.18 ? 98  LEU A O     1 
ATOM   747   C  CB    . LEU A 1 98  ? -26.316 30.790 -16.664 1.00 87.12  ? 98  LEU A CB    1 
ATOM   748   C  CG    . LEU A 1 98  ? -25.200 29.864 -17.112 1.00 96.41  ? 98  LEU A CG    1 
ATOM   749   C  CD1   . LEU A 1 98  ? -23.878 30.413 -16.587 1.00 95.04  ? 98  LEU A CD1   1 
ATOM   750   C  CD2   . LEU A 1 98  ? -25.406 28.448 -16.630 1.00 100.06 ? 98  LEU A CD2   1 
ATOM   751   N  N     . VAL A 1 99  ? -29.553 31.811 -17.436 1.00 105.57 ? 99  VAL A N     1 
ATOM   752   C  CA    . VAL A 1 99  ? -30.362 33.009 -17.406 1.00 95.15  ? 99  VAL A CA    1 
ATOM   753   C  C     . VAL A 1 99  ? -31.735 32.657 -17.898 1.00 104.81 ? 99  VAL A C     1 
ATOM   754   O  O     . VAL A 1 99  ? -31.872 31.999 -18.924 1.00 121.32 ? 99  VAL A O     1 
ATOM   755   C  CB    . VAL A 1 99  ? -29.812 34.075 -18.335 1.00 85.54  ? 99  VAL A CB    1 
ATOM   756   C  CG1   . VAL A 1 99  ? -30.826 35.169 -18.481 1.00 100.14 ? 99  VAL A CG1   1 
ATOM   757   C  CG2   . VAL A 1 99  ? -28.551 34.663 -17.774 1.00 82.88  ? 99  VAL A CG2   1 
ATOM   758   N  N     . GLU A 1 100 ? -32.767 33.098 -17.196 1.00 94.21  ? 100 GLU A N     1 
ATOM   759   C  CA    . GLU A 1 100 ? -34.097 32.864 -17.718 1.00 105.11 ? 100 GLU A CA    1 
ATOM   760   C  C     . GLU A 1 100 ? -34.664 34.161 -18.253 1.00 117.65 ? 100 GLU A C     1 
ATOM   761   O  O     . GLU A 1 100 ? -34.687 35.179 -17.563 1.00 130.98 ? 100 GLU A O     1 
ATOM   762   C  CB    . GLU A 1 100 ? -35.031 32.184 -16.706 1.00 113.08 ? 100 GLU A CB    1 
ATOM   763   C  CG    . GLU A 1 100 ? -34.604 32.242 -15.248 1.00 133.38 ? 100 GLU A CG    1 
ATOM   764   C  CD    . GLU A 1 100 ? -35.429 31.307 -14.343 1.00 147.34 ? 100 GLU A CD    1 
ATOM   765   O  OE1   . GLU A 1 100 ? -34.828 30.360 -13.774 1.00 157.72 ? 100 GLU A OE1   1 
ATOM   766   O  OE2   . GLU A 1 100 ? -36.665 31.518 -14.202 1.00 134.63 ? 100 GLU A OE2   1 
ATOM   767   N  N     . MET A 1 101 ? -35.098 34.123 -19.505 1.00 110.42 ? 101 MET A N     1 
ATOM   768   C  CA    . MET A 1 101 ? -35.614 35.315 -20.145 1.00 107.79 ? 101 MET A CA    1 
ATOM   769   C  C     . MET A 1 101 ? -37.078 35.105 -20.518 1.00 113.47 ? 101 MET A C     1 
ATOM   770   O  O     . MET A 1 101 ? -37.452 34.064 -21.045 1.00 128.20 ? 101 MET A O     1 
ATOM   771   C  CB    . MET A 1 101 ? -34.762 35.669 -21.371 1.00 103.45 ? 101 MET A CB    1 
ATOM   772   C  CG    . MET A 1 101 ? -34.821 37.138 -21.754 1.00 108.51 ? 101 MET A CG    1 
ATOM   773   S  SD    . MET A 1 101 ? -33.682 37.612 -23.056 1.00 135.64 ? 101 MET A SD    1 
ATOM   774   C  CE    . MET A 1 101 ? -32.102 37.417 -22.226 1.00 127.46 ? 101 MET A CE    1 
ATOM   775   N  N     . HIS A 1 102 ? -37.903 36.103 -20.239 1.00 110.21 ? 102 HIS A N     1 
ATOM   776   C  CA    . HIS A 1 102 ? -39.330 35.998 -20.485 1.00 118.20 ? 102 HIS A CA    1 
ATOM   777   C  C     . HIS A 1 102 ? -39.659 36.896 -21.666 1.00 121.61 ? 102 HIS A C     1 
ATOM   778   O  O     . HIS A 1 102 ? -39.353 38.094 -21.659 1.00 109.65 ? 102 HIS A O     1 
ATOM   779   C  CB    . HIS A 1 102 ? -40.118 36.401 -19.233 1.00 127.01 ? 102 HIS A CB    1 
ATOM   780   C  CG    . HIS A 1 102 ? -41.593 36.513 -19.452 1.00 132.54 ? 102 HIS A CG    1 
ATOM   781   N  ND1   . HIS A 1 102 ? -42.175 37.594 -20.077 1.00 135.07 ? 102 HIS A ND1   1 
ATOM   782   C  CD2   . HIS A 1 102 ? -42.608 35.681 -19.120 1.00 141.74 ? 102 HIS A CD2   1 
ATOM   783   C  CE1   . HIS A 1 102 ? -43.483 37.417 -20.134 1.00 136.72 ? 102 HIS A CE1   1 
ATOM   784   N  NE2   . HIS A 1 102 ? -43.772 36.265 -19.559 1.00 142.89 ? 102 HIS A NE2   1 
ATOM   785   N  N     . GLY A 1 103 ? -40.262 36.292 -22.689 1.00 128.07 ? 103 GLY A N     1 
ATOM   786   C  CA    . GLY A 1 103 ? -40.493 36.948 -23.963 1.00 121.52 ? 103 GLY A CA    1 
ATOM   787   C  C     . GLY A 1 103 ? -39.815 36.182 -25.080 1.00 117.04 ? 103 GLY A C     1 
ATOM   788   O  O     . GLY A 1 103 ? -39.534 34.994 -24.936 1.00 121.11 ? 103 GLY A O     1 
ATOM   789   N  N     . ASN A 1 104 ? -39.541 36.858 -26.190 1.00 117.82 ? 104 ASN A N     1 
ATOM   790   C  CA    . ASN A 1 104 ? -38.920 36.207 -27.342 1.00 116.26 ? 104 ASN A CA    1 
ATOM   791   C  C     . ASN A 1 104 ? -37.396 36.305 -27.337 1.00 105.85 ? 104 ASN A C     1 
ATOM   792   O  O     . ASN A 1 104 ? -36.832 37.376 -27.544 1.00 102.13 ? 104 ASN A O     1 
ATOM   793   C  CB    . ASN A 1 104 ? -39.489 36.767 -28.650 1.00 115.29 ? 104 ASN A CB    1 
ATOM   794   C  CG    . ASN A 1 104 ? -38.626 36.433 -29.855 1.00 123.25 ? 104 ASN A CG    1 
ATOM   795   O  OD1   . ASN A 1 104 ? -37.809 35.512 -29.813 1.00 132.65 ? 104 ASN A OD1   1 
ATOM   796   N  ND2   . ASN A 1 104 ? -38.812 37.177 -30.939 1.00 125.82 ? 104 ASN A ND2   1 
ATOM   797   N  N     . ASN A 1 105 ? -36.731 35.180 -27.116 1.00 102.73 ? 105 ASN A N     1 
ATOM   798   C  CA    . ASN A 1 105 ? -35.279 35.153 -27.157 1.00 102.65 ? 105 ASN A CA    1 
ATOM   799   C  C     . ASN A 1 105 ? -34.778 34.286 -28.294 1.00 112.54 ? 105 ASN A C     1 
ATOM   800   O  O     . ASN A 1 105 ? -33.840 33.515 -28.112 1.00 111.70 ? 105 ASN A O     1 
ATOM   801   C  CB    . ASN A 1 105 ? -34.741 34.578 -25.870 1.00 101.62 ? 105 ASN A CB    1 
ATOM   802   C  CG    . ASN A 1 105 ? -35.210 33.170 -25.658 1.00 116.82 ? 105 ASN A CG    1 
ATOM   803   O  OD1   . ASN A 1 105 ? -36.246 32.766 -26.201 1.00 135.83 ? 105 ASN A OD1   1 
ATOM   804   N  ND2   . ASN A 1 105 ? -34.459 32.402 -24.879 1.00 115.41 ? 105 ASN A ND2   1 
ATOM   805   N  N     . GLY A 1 106 ? -35.403 34.405 -29.460 1.00 124.82 ? 106 GLY A N     1 
ATOM   806   C  CA    . GLY A 1 106 ? -35.023 33.601 -30.611 1.00 131.68 ? 106 GLY A CA    1 
ATOM   807   C  C     . GLY A 1 106 ? -35.581 32.188 -30.541 1.00 126.74 ? 106 GLY A C     1 
ATOM   808   O  O     . GLY A 1 106 ? -36.532 31.941 -29.785 1.00 124.28 ? 106 GLY A O     1 
ATOM   809   N  N     . SER A 1 107 ? -35.002 31.276 -31.332 1.00 113.17 ? 107 SER A N     1 
ATOM   810   C  CA    . SER A 1 107 ? -35.376 29.858 -31.301 1.00 121.90 ? 107 SER A CA    1 
ATOM   811   C  C     . SER A 1 107 ? -34.483 28.994 -32.182 1.00 129.17 ? 107 SER A C     1 
ATOM   812   O  O     . SER A 1 107 ? -33.426 29.428 -32.628 1.00 133.09 ? 107 SER A O     1 
ATOM   813   C  CB    . SER A 1 107 ? -36.846 29.647 -31.695 1.00 129.81 ? 107 SER A CB    1 
ATOM   814   O  OG    . SER A 1 107 ? -37.009 29.470 -33.094 1.00 131.83 ? 107 SER A OG    1 
ATOM   815   N  N     . MET A 1 108 ? -34.922 27.764 -32.431 1.00 138.52 ? 108 MET A N     1 
ATOM   816   C  CA    . MET A 1 108 ? -34.210 26.857 -33.329 1.00 141.91 ? 108 MET A CA    1 
ATOM   817   C  C     . MET A 1 108 ? -34.352 27.245 -34.804 1.00 148.23 ? 108 MET A C     1 
ATOM   818   O  O     . MET A 1 108 ? -33.413 27.095 -35.589 1.00 139.60 ? 108 MET A O     1 
ATOM   819   C  CB    . MET A 1 108 ? -34.699 25.432 -33.120 1.00 137.95 ? 108 MET A CB    1 
ATOM   820   C  CG    . MET A 1 108 ? -34.385 24.904 -31.750 1.00 138.96 ? 108 MET A CG    1 
ATOM   821   S  SD    . MET A 1 108 ? -34.715 23.147 -31.647 1.00 176.29 ? 108 MET A SD    1 
ATOM   822   C  CE    . MET A 1 108 ? -33.493 22.510 -32.787 1.00 119.77 ? 108 MET A CE    1 
ATOM   823   N  N     . ASP A 1 109 ? -35.530 27.737 -35.179 1.00 155.45 ? 109 ASP A N     1 
ATOM   824   C  CA    . ASP A 1 109 ? -35.739 28.242 -36.529 1.00 152.85 ? 109 ASP A CA    1 
ATOM   825   C  C     . ASP A 1 109 ? -34.777 29.396 -36.808 1.00 147.49 ? 109 ASP A C     1 
ATOM   826   O  O     . ASP A 1 109 ? -34.629 29.837 -37.946 1.00 145.85 ? 109 ASP A O     1 
ATOM   827   C  CB    . ASP A 1 109 ? -37.196 28.672 -36.754 1.00 159.22 ? 109 ASP A CB    1 
ATOM   828   C  CG    . ASP A 1 109 ? -38.104 27.502 -37.147 1.00 175.06 ? 109 ASP A CG    1 
ATOM   829   O  OD1   . ASP A 1 109 ? -37.763 26.343 -36.818 1.00 174.02 ? 109 ASP A OD1   1 
ATOM   830   O  OD2   . ASP A 1 109 ? -39.160 27.744 -37.784 1.00 183.14 ? 109 ASP A OD2   1 
ATOM   831   N  N     . GLY A 1 110 ? -34.120 29.879 -35.760 1.00 143.39 ? 110 GLY A N     1 
ATOM   832   C  CA    . GLY A 1 110 ? -33.105 30.904 -35.909 1.00 139.20 ? 110 GLY A CA    1 
ATOM   833   C  C     . GLY A 1 110 ? -33.631 32.322 -35.822 1.00 143.70 ? 110 GLY A C     1 
ATOM   834   O  O     . GLY A 1 110 ? -32.852 33.272 -35.844 1.00 143.19 ? 110 GLY A O     1 
ATOM   835   N  N     . ASP A 1 111 ? -34.949 32.473 -35.731 1.00 152.04 ? 111 ASP A N     1 
ATOM   836   C  CA    . ASP A 1 111 ? -35.548 33.799 -35.594 1.00 151.57 ? 111 ASP A CA    1 
ATOM   837   C  C     . ASP A 1 111 ? -34.789 34.628 -34.565 1.00 136.21 ? 111 ASP A C     1 
ATOM   838   O  O     . ASP A 1 111 ? -34.351 34.093 -33.545 1.00 112.44 ? 111 ASP A O     1 
ATOM   839   C  CB    . ASP A 1 111 ? -37.050 33.732 -35.249 1.00 161.89 ? 111 ASP A CB    1 
ATOM   840   C  CG    . ASP A 1 111 ? -37.503 32.348 -34.804 1.00 175.91 ? 111 ASP A CG    1 
ATOM   841   O  OD1   . ASP A 1 111 ? -38.665 31.976 -35.098 1.00 170.00 ? 111 ASP A OD1   1 
ATOM   842   O  OD2   . ASP A 1 111 ? -36.701 31.635 -34.166 1.00 189.22 ? 111 ASP A OD2   1 
ATOM   843   N  N     . PRO A 1 112 ? -34.613 35.935 -34.844 1.00 136.92 ? 112 PRO A N     1 
ATOM   844   C  CA    . PRO A 1 112 ? -33.787 36.822 -34.025 1.00 119.55 ? 112 PRO A CA    1 
ATOM   845   C  C     . PRO A 1 112 ? -34.510 37.161 -32.747 1.00 111.62 ? 112 PRO A C     1 
ATOM   846   O  O     . PRO A 1 112 ? -35.722 37.372 -32.782 1.00 114.23 ? 112 PRO A O     1 
ATOM   847   C  CB    . PRO A 1 112 ? -33.653 38.084 -34.882 1.00 115.93 ? 112 PRO A CB    1 
ATOM   848   C  CG    . PRO A 1 112 ? -34.262 37.762 -36.194 1.00 122.91 ? 112 PRO A CG    1 
ATOM   849   C  CD    . PRO A 1 112 ? -35.257 36.687 -35.927 1.00 134.48 ? 112 PRO A CD    1 
ATOM   850   N  N     . PRO A 1 113 ? -33.767 37.222 -31.638 1.00 105.69 ? 113 PRO A N     1 
ATOM   851   C  CA    . PRO A 1 113 ? -34.228 37.544 -30.287 1.00 92.69  ? 113 PRO A CA    1 
ATOM   852   C  C     . PRO A 1 113 ? -34.869 38.913 -30.284 1.00 105.12 ? 113 PRO A C     1 
ATOM   853   O  O     . PRO A 1 113 ? -34.443 39.802 -31.027 1.00 111.61 ? 113 PRO A O     1 
ATOM   854   C  CB    . PRO A 1 113 ? -32.935 37.632 -29.488 1.00 100.85 ? 113 PRO A CB    1 
ATOM   855   C  CG    . PRO A 1 113 ? -31.913 36.926 -30.306 1.00 124.65 ? 113 PRO A CG    1 
ATOM   856   C  CD    . PRO A 1 113 ? -32.305 37.115 -31.718 1.00 124.24 ? 113 PRO A CD    1 
ATOM   857   N  N     . ALA A 1 114 ? -35.878 39.090 -29.447 1.00 102.90 ? 114 ALA A N     1 
ATOM   858   C  CA    . ALA A 1 114 ? -36.565 40.363 -29.383 1.00 112.90 ? 114 ALA A CA    1 
ATOM   859   C  C     . ALA A 1 114 ? -35.626 41.440 -28.854 1.00 115.14 ? 114 ALA A C     1 
ATOM   860   O  O     . ALA A 1 114 ? -34.790 41.182 -27.986 1.00 99.03  ? 114 ALA A O     1 
ATOM   861   C  CB    . ALA A 1 114 ? -37.803 40.246 -28.518 1.00 123.46 ? 114 ALA A CB    1 
ATOM   862   N  N     . ALA A 1 115 ? -35.764 42.647 -29.388 1.00 125.25 ? 115 ALA A N     1 
ATOM   863   C  CA    . ALA A 1 115 ? -34.950 43.767 -28.941 1.00 125.41 ? 115 ALA A CA    1 
ATOM   864   C  C     . ALA A 1 115 ? -34.949 43.844 -27.420 1.00 126.88 ? 115 ALA A C     1 
ATOM   865   O  O     . ALA A 1 115 ? -35.930 43.486 -26.763 1.00 115.68 ? 115 ALA A O     1 
ATOM   866   C  CB    . ALA A 1 115 ? -35.456 45.060 -29.540 1.00 133.79 ? 115 ALA A CB    1 
ATOM   867   N  N     . MET A 1 116 ? -33.844 44.322 -26.864 1.00 127.89 ? 116 MET A N     1 
ATOM   868   C  CA    . MET A 1 116 ? -33.671 44.301 -25.426 1.00 115.24 ? 116 MET A CA    1 
ATOM   869   C  C     . MET A 1 116 ? -34.733 45.110 -24.700 1.00 112.37 ? 116 MET A C     1 
ATOM   870   O  O     . MET A 1 116 ? -35.140 44.734 -23.598 1.00 135.51 ? 116 MET A O     1 
ATOM   871   C  CB    . MET A 1 116 ? -32.269 44.759 -25.037 1.00 127.28 ? 116 MET A CB    1 
ATOM   872   C  CG    . MET A 1 116 ? -32.149 46.206 -24.609 1.00 138.89 ? 116 MET A CG    1 
ATOM   873   S  SD    . MET A 1 116 ? -30.423 46.676 -24.301 1.00 112.57 ? 116 MET A SD    1 
ATOM   874   C  CE    . MET A 1 116 ? -30.589 48.458 -24.070 1.00 186.19 ? 116 MET A CE    1 
ATOM   875   N  N     . ARG A 1 117 ? -35.205 46.203 -25.297 1.00 94.74  ? 117 ARG A N     1 
ATOM   876   C  CA    . ARG A 1 117 ? -36.234 47.005 -24.610 1.00 95.22  ? 117 ARG A CA    1 
ATOM   877   C  C     . ARG A 1 117 ? -37.514 46.235 -24.401 1.00 92.50  ? 117 ARG A C     1 
ATOM   878   O  O     . ARG A 1 117 ? -38.343 46.622 -23.591 1.00 97.24  ? 117 ARG A O     1 
ATOM   879   C  CB    . ARG A 1 117 ? -36.586 48.312 -25.311 1.00 103.62 ? 117 ARG A CB    1 
ATOM   880   C  CG    . ARG A 1 117 ? -37.058 48.176 -26.717 1.00 98.37  ? 117 ARG A CG    1 
ATOM   881   C  CD    . ARG A 1 117 ? -35.882 48.411 -27.640 1.00 109.82 ? 117 ARG A CD    1 
ATOM   882   N  NE    . ARG A 1 117 ? -36.292 48.121 -28.998 1.00 117.89 ? 117 ARG A NE    1 
ATOM   883   C  CZ    . ARG A 1 117 ? -37.233 48.804 -29.630 1.00 112.63 ? 117 ARG A CZ    1 
ATOM   884   N  NH1   . ARG A 1 117 ? -37.836 49.812 -29.009 1.00 115.34 ? 117 ARG A NH1   1 
ATOM   885   N  NH2   . ARG A 1 117 ? -37.579 48.472 -30.864 1.00 99.07  ? 117 ARG A NH2   1 
ATOM   886   N  N     . TYR A 1 118 ? -37.672 45.137 -25.125 1.00 100.44 ? 118 TYR A N     1 
ATOM   887   C  CA    . TYR A 1 118 ? -38.876 44.346 -24.986 1.00 96.12  ? 118 TYR A CA    1 
ATOM   888   C  C     . TYR A 1 118 ? -38.779 43.320 -23.856 1.00 97.71  ? 118 TYR A C     1 
ATOM   889   O  O     . TYR A 1 118 ? -39.751 43.088 -23.158 1.00 118.67 ? 118 TYR A O     1 
ATOM   890   C  CB    . TYR A 1 118 ? -39.212 43.628 -26.299 1.00 102.07 ? 118 TYR A CB    1 
ATOM   891   C  CG    . TYR A 1 118 ? -39.576 44.550 -27.444 1.00 118.01 ? 118 TYR A CG    1 
ATOM   892   C  CD1   . TYR A 1 118 ? -40.802 45.203 -27.476 1.00 104.95 ? 118 TYR A CD1   1 
ATOM   893   C  CD2   . TYR A 1 118 ? -38.698 44.755 -28.501 1.00 126.01 ? 118 TYR A CD2   1 
ATOM   894   C  CE1   . TYR A 1 118 ? -41.138 46.042 -28.521 1.00 117.28 ? 118 TYR A CE1   1 
ATOM   895   C  CE2   . TYR A 1 118 ? -39.025 45.591 -29.549 1.00 126.64 ? 118 TYR A CE2   1 
ATOM   896   C  CZ    . TYR A 1 118 ? -40.246 46.235 -29.553 1.00 129.17 ? 118 TYR A CZ    1 
ATOM   897   O  OH    . TYR A 1 118 ? -40.574 47.068 -30.599 1.00 133.02 ? 118 TYR A OH    1 
ATOM   898   N  N     . THR A 1 119 ? -37.613 42.723 -23.651 1.00 86.01  ? 119 THR A N     1 
ATOM   899   C  CA    . THR A 1 119 ? -37.551 41.515 -22.827 1.00 97.36  ? 119 THR A CA    1 
ATOM   900   C  C     . THR A 1 119 ? -37.237 41.759 -21.358 1.00 110.87 ? 119 THR A C     1 
ATOM   901   O  O     . THR A 1 119 ? -36.896 42.879 -20.976 1.00 130.26 ? 119 THR A O     1 
ATOM   902   C  CB    . THR A 1 119 ? -36.569 40.475 -23.418 1.00 100.64 ? 119 THR A CB    1 
ATOM   903   O  OG1   . THR A 1 119 ? -35.231 40.979 -23.390 1.00 99.09  ? 119 THR A OG1   1 
ATOM   904   C  CG2   . THR A 1 119 ? -36.933 40.177 -24.850 1.00 100.64 ? 119 THR A CG2   1 
ATOM   905   N  N     . GLU A 1 120 ? -37.369 40.699 -20.551 1.00 104.20 ? 120 GLU A N     1 
ATOM   906   C  CA    . GLU A 1 120 ? -37.136 40.736 -19.101 1.00 107.78 ? 120 GLU A CA    1 
ATOM   907   C  C     . GLU A 1 120 ? -36.300 39.533 -18.727 1.00 105.95 ? 120 GLU A C     1 
ATOM   908   O  O     . GLU A 1 120 ? -36.448 38.478 -19.330 1.00 109.63 ? 120 GLU A O     1 
ATOM   909   C  CB    . GLU A 1 120 ? -38.450 40.658 -18.320 1.00 126.11 ? 120 GLU A CB    1 
ATOM   910   C  CG    . GLU A 1 120 ? -39.674 41.028 -19.130 1.00 145.93 ? 120 GLU A CG    1 
ATOM   911   C  CD    . GLU A 1 120 ? -40.912 41.250 -18.281 1.00 160.97 ? 120 GLU A CD    1 
ATOM   912   O  OE1   . GLU A 1 120 ? -40.782 41.528 -17.067 1.00 161.55 ? 120 GLU A OE1   1 
ATOM   913   O  OE2   . GLU A 1 120 ? -42.022 41.159 -18.847 1.00 171.83 ? 120 GLU A OE2   1 
ATOM   914   N  N     . ALA A 1 121 ? -35.410 39.674 -17.751 1.00 107.50 ? 121 ALA A N     1 
ATOM   915   C  CA    . ALA A 1 121 ? -34.531 38.554 -17.412 1.00 108.34 ? 121 ALA A CA    1 
ATOM   916   C  C     . ALA A 1 121 ? -34.162 38.434 -15.937 1.00 107.27 ? 121 ALA A C     1 
ATOM   917   O  O     . ALA A 1 121 ? -34.146 39.418 -15.207 1.00 117.70 ? 121 ALA A O     1 
ATOM   918   C  CB    . ALA A 1 121 ? -33.283 38.589 -18.254 1.00 111.76 ? 121 ALA A CB    1 
ATOM   919   N  N     . ARG A 1 122 ? -33.869 37.209 -15.513 1.00 95.31  ? 122 ARG A N     1 
ATOM   920   C  CA    . ARG A 1 122 ? -33.291 36.953 -14.201 1.00 89.45  ? 122 ARG A CA    1 
ATOM   921   C  C     . ARG A 1 122 ? -32.236 35.856 -14.257 1.00 93.44  ? 122 ARG A C     1 
ATOM   922   O  O     . ARG A 1 122 ? -32.100 35.174 -15.271 1.00 106.00 ? 122 ARG A O     1 
ATOM   923   C  CB    . ARG A 1 122 ? -34.381 36.527 -13.261 1.00 100.13 ? 122 ARG A CB    1 
ATOM   924   C  CG    . ARG A 1 122 ? -34.896 35.139 -13.496 1.00 100.70 ? 122 ARG A CG    1 
ATOM   925   C  CD    . ARG A 1 122 ? -36.097 34.922 -12.589 1.00 111.15 ? 122 ARG A CD    1 
ATOM   926   N  NE    . ARG A 1 122 ? -36.981 33.845 -13.010 1.00 113.93 ? 122 ARG A NE    1 
ATOM   927   C  CZ    . ARG A 1 122 ? -38.227 33.743 -12.584 1.00 119.55 ? 122 ARG A CZ    1 
ATOM   928   N  NH1   . ARG A 1 122 ? -38.690 34.661 -11.744 1.00 116.43 ? 122 ARG A NH1   1 
ATOM   929   N  NH2   . ARG A 1 122 ? -39.000 32.741 -12.985 1.00 131.82 ? 122 ARG A NH2   1 
ATOM   930   N  N     . LEU A 1 123 ? -31.516 35.642 -13.162 1.00 92.91  ? 123 LEU A N     1 
ATOM   931   C  CA    . LEU A 1 123 ? -30.540 34.555 -13.158 1.00 103.61 ? 123 LEU A CA    1 
ATOM   932   C  C     . LEU A 1 123 ? -31.298 33.285 -12.834 1.00 111.12 ? 123 LEU A C     1 
ATOM   933   O  O     . LEU A 1 123 ? -32.327 33.332 -12.154 1.00 99.02  ? 123 LEU A O     1 
ATOM   934   C  CB    . LEU A 1 123 ? -29.413 34.759 -12.134 1.00 93.03  ? 123 LEU A CB    1 
ATOM   935   C  CG    . LEU A 1 123 ? -28.450 35.920 -12.348 1.00 98.20  ? 123 LEU A CG    1 
ATOM   936   C  CD1   . LEU A 1 123 ? -27.412 36.056 -11.234 1.00 86.72  ? 123 LEU A CD1   1 
ATOM   937   C  CD2   . LEU A 1 123 ? -27.782 35.757 -13.696 1.00 109.14 ? 123 LEU A CD2   1 
ATOM   938   N  N     . SER A 1 124 ? -30.814 32.155 -13.345 1.00 114.80 ? 124 SER A N     1 
ATOM   939   C  CA    . SER A 1 124 ? -31.489 30.896 -13.092 1.00 111.36 ? 124 SER A CA    1 
ATOM   940   C  C     . SER A 1 124 ? -31.092 30.373 -11.730 1.00 112.44 ? 124 SER A C     1 
ATOM   941   O  O     . SER A 1 124 ? -30.321 31.008 -11.010 1.00 104.10 ? 124 SER A O     1 
ATOM   942   C  CB    . SER A 1 124 ? -31.032 29.880 -14.120 1.00 117.77 ? 124 SER A CB    1 
ATOM   943   O  OG    . SER A 1 124 ? -29.622 29.743 -14.078 1.00 112.05 ? 124 SER A OG    1 
ATOM   944   N  N     . GLU A 1 125 ? -31.542 29.171 -11.405 1.00 119.72 ? 125 GLU A N     1 
ATOM   945   C  CA    . GLU A 1 125 ? -31.282 28.672 -10.073 1.00 118.58 ? 125 GLU A CA    1 
ATOM   946   C  C     . GLU A 1 125 ? -29.848 28.190 -9.955  1.00 113.87 ? 125 GLU A C     1 
ATOM   947   O  O     . GLU A 1 125 ? -29.127 28.615 -9.059  1.00 119.28 ? 125 GLU A O     1 
ATOM   948   C  CB    . GLU A 1 125 ? -32.271 27.589 -9.684  1.00 117.03 ? 125 GLU A CB    1 
ATOM   949   C  CG    . GLU A 1 125 ? -32.339 27.378 -8.190  1.00 120.17 ? 125 GLU A CG    1 
ATOM   950   C  CD    . GLU A 1 125 ? -33.469 26.465 -7.781  1.00 143.89 ? 125 GLU A CD    1 
ATOM   951   O  OE1   . GLU A 1 125 ? -33.881 25.602 -8.587  1.00 145.70 ? 125 GLU A OE1   1 
ATOM   952   O  OE2   . GLU A 1 125 ? -33.951 26.610 -6.641  1.00 161.34 ? 125 GLU A OE2   1 
ATOM   953   N  N     . ILE A 1 126 ? -29.440 27.305 -10.859 1.00 102.98 ? 126 ILE A N     1 
ATOM   954   C  CA    . ILE A 1 126 ? -28.092 26.748 -10.819 1.00 107.40 ? 126 ILE A CA    1 
ATOM   955   C  C     . ILE A 1 126 ? -27.011 27.829 -10.892 1.00 118.14 ? 126 ILE A C     1 
ATOM   956   O  O     . ILE A 1 126 ? -25.872 27.618 -10.451 1.00 110.63 ? 126 ILE A O     1 
ATOM   957   C  CB    . ILE A 1 126 ? -27.852 25.752 -11.956 1.00 103.13 ? 126 ILE A CB    1 
ATOM   958   C  CG1   . ILE A 1 126 ? -26.659 24.871 -11.613 1.00 104.00 ? 126 ILE A CG1   1 
ATOM   959   C  CG2   . ILE A 1 126 ? -27.552 26.480 -13.263 1.00 95.67  ? 126 ILE A CG2   1 
ATOM   960   C  CD1   . ILE A 1 126 ? -26.695 23.517 -12.263 1.00 100.77 ? 126 ILE A CD1   1 
ATOM   961   N  N     . ALA A 1 127 ? -27.365 28.968 -11.484 1.00 112.38 ? 127 ALA A N     1 
ATOM   962   C  CA    . ALA A 1 127 ? -26.434 30.080 -11.628 1.00 111.79 ? 127 ALA A CA    1 
ATOM   963   C  C     . ALA A 1 127 ? -25.957 30.561 -10.266 1.00 105.72 ? 127 ALA A C     1 
ATOM   964   O  O     . ALA A 1 127 ? -24.806 30.965 -10.096 1.00 96.23  ? 127 ALA A O     1 
ATOM   965   C  CB    . ALA A 1 127 ? -27.080 31.216 -12.382 1.00 114.83 ? 127 ALA A CB    1 
ATOM   966   N  N     . GLY A 1 128 ? -26.867 30.535 -9.302  1.00 114.16 ? 128 GLY A N     1 
ATOM   967   C  CA    . GLY A 1 128 ? -26.575 30.966 -7.949  1.00 116.42 ? 128 GLY A CA    1 
ATOM   968   C  C     . GLY A 1 128 ? -25.412 30.170 -7.425  1.00 110.47 ? 128 GLY A C     1 
ATOM   969   O  O     . GLY A 1 128 ? -24.532 30.688 -6.739  1.00 110.67 ? 128 GLY A O     1 
ATOM   970   N  N     . TYR A 1 129 ? -25.423 28.889 -7.762  1.00 103.26 ? 129 TYR A N     1 
ATOM   971   C  CA    . TYR A 1 129 ? -24.341 27.991 -7.406  1.00 97.94  ? 129 TYR A CA    1 
ATOM   972   C  C     . TYR A 1 129 ? -22.996 28.425 -7.976  1.00 104.41 ? 129 TYR A C     1 
ATOM   973   O  O     . TYR A 1 129 ? -21.973 28.321 -7.303  1.00 110.07 ? 129 TYR A O     1 
ATOM   974   C  CB    . TYR A 1 129 ? -24.710 26.554 -7.751  1.00 97.23  ? 129 TYR A CB    1 
ATOM   975   C  CG    . TYR A 1 129 ? -25.702 25.988 -6.743  1.00 101.35 ? 129 TYR A CG    1 
ATOM   976   C  CD1   . TYR A 1 129 ? -25.424 24.843 -6.025  1.00 95.94  ? 129 TYR A CD1   1 
ATOM   977   C  CD2   . TYR A 1 129 ? -26.896 26.639 -6.486  1.00 100.02 ? 129 TYR A CD2   1 
ATOM   978   C  CE1   . TYR A 1 129 ? -26.320 24.345 -5.110  1.00 110.50 ? 129 TYR A CE1   1 
ATOM   979   C  CE2   . TYR A 1 129 ? -27.788 26.160 -5.571  1.00 101.39 ? 129 TYR A CE2   1 
ATOM   980   C  CZ    . TYR A 1 129 ? -27.511 25.010 -4.879  1.00 114.47 ? 129 TYR A CZ    1 
ATOM   981   O  OH    . TYR A 1 129 ? -28.439 24.526 -3.953  1.00 116.54 ? 129 TYR A OH    1 
ATOM   982   N  N     . LEU A 1 130 ? -22.982 28.939 -9.199  1.00 105.12 ? 130 LEU A N     1 
ATOM   983   C  CA    . LEU A 1 130 ? -21.749 29.551 -9.694  1.00 110.33 ? 130 LEU A CA    1 
ATOM   984   C  C     . LEU A 1 130 ? -21.251 30.663 -8.762  1.00 112.21 ? 130 LEU A C     1 
ATOM   985   O  O     . LEU A 1 130 ? -20.051 30.802 -8.537  1.00 123.78 ? 130 LEU A O     1 
ATOM   986   C  CB    . LEU A 1 130 ? -21.905 30.072 -11.124 1.00 106.70 ? 130 LEU A CB    1 
ATOM   987   C  CG    . LEU A 1 130 ? -21.743 28.961 -12.166 1.00 119.18 ? 130 LEU A CG    1 
ATOM   988   C  CD1   . LEU A 1 130 ? -21.602 29.520 -13.569 1.00 124.35 ? 130 LEU A CD1   1 
ATOM   989   C  CD2   . LEU A 1 130 ? -20.549 28.093 -11.832 1.00 123.40 ? 130 LEU A CD2   1 
ATOM   990   N  N     . LEU A 1 131 ? -22.179 31.467 -8.253  1.00 103.66 ? 131 LEU A N     1 
ATOM   991   C  CA    . LEU A 1 131 ? -21.858 32.557 -7.335  1.00 107.44 ? 131 LEU A CA    1 
ATOM   992   C  C     . LEU A 1 131 ? -21.732 32.197 -5.843  1.00 126.67 ? 131 LEU A C     1 
ATOM   993   O  O     . LEU A 1 131 ? -21.215 33.003 -5.070  1.00 138.51 ? 131 LEU A O     1 
ATOM   994   C  CB    . LEU A 1 131 ? -22.879 33.683 -7.507  1.00 100.81 ? 131 LEU A CB    1 
ATOM   995   C  CG    . LEU A 1 131 ? -22.936 34.202 -8.956  1.00 110.45 ? 131 LEU A CG    1 
ATOM   996   C  CD1   . LEU A 1 131 ? -24.312 34.715 -9.338  1.00 109.00 ? 131 LEU A CD1   1 
ATOM   997   C  CD2   . LEU A 1 131 ? -21.869 35.276 -9.245  1.00 108.86 ? 131 LEU A CD2   1 
ATOM   998   N  N     . GLN A 1 132 ? -22.206 31.017 -5.432  1.00 120.78 ? 132 GLN A N     1 
ATOM   999   C  CA    . GLN A 1 132 ? -22.233 30.654 -4.002  1.00 126.61 ? 132 GLN A CA    1 
ATOM   1000  C  C     . GLN A 1 132 ? -20.898 30.860 -3.306  1.00 126.80 ? 132 GLN A C     1 
ATOM   1001  O  O     . GLN A 1 132 ? -19.875 30.339 -3.761  1.00 131.14 ? 132 GLN A O     1 
ATOM   1002  C  CB    . GLN A 1 132 ? -22.680 29.202 -3.775  1.00 135.08 ? 132 GLN A CB    1 
ATOM   1003  N  N     . ASP A 1 133 ? -20.923 31.607 -2.201  1.00 120.10 ? 133 ASP A N     1 
ATOM   1004  C  CA    . ASP A 1 133 ? -19.735 31.851 -1.373  1.00 128.70 ? 133 ASP A CA    1 
ATOM   1005  C  C     . ASP A 1 133 ? -18.949 33.092 -1.816  1.00 113.90 ? 133 ASP A C     1 
ATOM   1006  O  O     . ASP A 1 133 ? -17.989 33.511 -1.155  1.00 86.70  ? 133 ASP A O     1 
ATOM   1007  C  CB    . ASP A 1 133 ? -18.793 30.633 -1.357  1.00 148.59 ? 133 ASP A CB    1 
ATOM   1008  C  CG    . ASP A 1 133 ? -19.487 29.343 -0.944  1.00 167.40 ? 133 ASP A CG    1 
ATOM   1009  O  OD1   . ASP A 1 133 ? -19.710 29.157 0.271   1.00 181.58 ? 133 ASP A OD1   1 
ATOM   1010  O  OD2   . ASP A 1 133 ? -19.782 28.504 -1.829  1.00 169.83 ? 133 ASP A OD2   1 
ATOM   1011  N  N     . ILE A 1 134 ? -19.349 33.667 -2.947  1.00 113.03 ? 134 ILE A N     1 
ATOM   1012  C  CA    . ILE A 1 134 ? -18.681 34.843 -3.499  1.00 100.13 ? 134 ILE A CA    1 
ATOM   1013  C  C     . ILE A 1 134 ? -18.426 35.893 -2.409  1.00 110.04 ? 134 ILE A C     1 
ATOM   1014  O  O     . ILE A 1 134 ? -17.350 36.478 -2.330  1.00 113.98 ? 134 ILE A O     1 
ATOM   1015  C  CB    . ILE A 1 134 ? -19.553 35.438 -4.603  1.00 87.11  ? 134 ILE A CB    1 
ATOM   1016  C  CG1   . ILE A 1 134 ? -18.846 36.570 -5.303  1.00 86.10  ? 134 ILE A CG1   1 
ATOM   1017  C  CG2   . ILE A 1 134 ? -20.841 35.929 -4.036  1.00 111.39 ? 134 ILE A CG2   1 
ATOM   1018  C  CD1   . ILE A 1 134 ? -17.973 36.085 -6.388  1.00 110.07 ? 134 ILE A CD1   1 
ATOM   1019  N  N     . GLU A 1 135 ? -19.417 36.081 -1.544  1.00 117.39 ? 135 GLU A N     1 
ATOM   1020  C  CA    . GLU A 1 135 ? -19.432 37.152 -0.560  1.00 121.08 ? 135 GLU A CA    1 
ATOM   1021  C  C     . GLU A 1 135 ? -18.570 36.870 0.663   1.00 120.42 ? 135 GLU A C     1 
ATOM   1022  O  O     . GLU A 1 135 ? -18.460 37.706 1.561   1.00 136.55 ? 135 GLU A O     1 
ATOM   1023  C  CB    . GLU A 1 135 ? -20.864 37.382 -0.096  1.00 133.25 ? 135 GLU A CB    1 
ATOM   1024  C  CG    . GLU A 1 135 ? -21.335 36.367 0.940   1.00 145.79 ? 135 GLU A CG    1 
ATOM   1025  C  CD    . GLU A 1 135 ? -21.572 34.967 0.363   1.00 165.17 ? 135 GLU A CD    1 
ATOM   1026  O  OE1   . GLU A 1 135 ? -21.591 34.802 -0.881  1.00 164.11 ? 135 GLU A OE1   1 
ATOM   1027  O  OE2   . GLU A 1 135 ? -21.749 34.023 1.164   1.00 174.61 ? 135 GLU A OE2   1 
ATOM   1028  N  N     . LYS A 1 136 ? -17.973 35.689 0.719   1.00 104.51 ? 136 LYS A N     1 
ATOM   1029  C  CA    . LYS A 1 136 ? -17.135 35.351 1.866   1.00 119.79 ? 136 LYS A CA    1 
ATOM   1030  C  C     . LYS A 1 136 ? -15.671 35.227 1.401   1.00 110.61 ? 136 LYS A C     1 
ATOM   1031  O  O     . LYS A 1 136 ? -15.000 34.226 1.641   1.00 109.83 ? 136 LYS A O     1 
ATOM   1032  C  CB    . LYS A 1 136 ? -17.705 34.132 2.691   1.00 74.08  ? 136 LYS A CB    1 
ATOM   1033  N  N     . LYS A 1 137 ? -15.200 36.276 0.730   1.00 119.55 ? 137 LYS A N     1 
ATOM   1034  C  CA    . LYS A 1 137 ? -13.805 36.405 0.282   1.00 130.09 ? 137 LYS A CA    1 
ATOM   1035  C  C     . LYS A 1 137 ? -13.197 35.113 -0.229  1.00 132.82 ? 137 LYS A C     1 
ATOM   1036  O  O     . LYS A 1 137 ? -12.159 34.679 0.265   1.00 135.26 ? 137 LYS A O     1 
ATOM   1037  C  CB    . LYS A 1 137 ? -12.919 36.976 1.393   1.00 126.61 ? 137 LYS A CB    1 
ATOM   1038  C  CG    . LYS A 1 137 ? -13.255 38.404 1.728   1.00 137.21 ? 137 LYS A CG    1 
ATOM   1039  C  CD    . LYS A 1 137 ? -12.167 39.087 2.492   1.00 145.41 ? 137 LYS A CD    1 
ATOM   1040  C  CE    . LYS A 1 137 ? -12.641 40.453 2.927   1.00 165.63 ? 137 LYS A CE    1 
ATOM   1041  N  NZ    . LYS A 1 137 ? -11.508 41.269 3.422   1.00 185.02 ? 137 LYS A NZ    1 
ATOM   1042  N  N     . THR A 1 138 ? -13.834 34.517 -1.230  1.00 120.25 ? 138 THR A N     1 
ATOM   1043  C  CA    . THR A 1 138 ? -13.491 33.175 -1.660  1.00 114.46 ? 138 THR A CA    1 
ATOM   1044  C  C     . THR A 1 138 ? -12.662 33.245 -2.899  1.00 117.71 ? 138 THR A C     1 
ATOM   1045  O  O     . THR A 1 138 ? -12.158 32.230 -3.386  1.00 129.01 ? 138 THR A O     1 
ATOM   1046  C  CB    . THR A 1 138 ? -14.725 32.433 -2.077  1.00 120.57 ? 138 THR A CB    1 
ATOM   1047  O  OG1   . THR A 1 138 ? -15.550 33.335 -2.824  1.00 131.38 ? 138 THR A OG1   1 
ATOM   1048  C  CG2   . THR A 1 138 ? -15.474 31.947 -0.857  1.00 117.96 ? 138 THR A CG2   1 
ATOM   1049  N  N     . VAL A 1 139 ? -12.525 34.454 -3.423  1.00 118.35 ? 139 VAL A N     1 
ATOM   1050  C  CA    . VAL A 1 139 ? -12.060 34.611 -4.787  1.00 104.80 ? 139 VAL A CA    1 
ATOM   1051  C  C     . VAL A 1 139 ? -11.380 35.964 -4.982  1.00 106.25 ? 139 VAL A C     1 
ATOM   1052  O  O     . VAL A 1 139 ? -11.760 36.962 -4.363  1.00 125.20 ? 139 VAL A O     1 
ATOM   1053  C  CB    . VAL A 1 139 ? -13.278 34.481 -5.715  1.00 98.51  ? 139 VAL A CB    1 
ATOM   1054  C  CG1   . VAL A 1 139 ? -13.575 35.785 -6.412  1.00 118.07 ? 139 VAL A CG1   1 
ATOM   1055  C  CG2   . VAL A 1 139 ? -13.093 33.367 -6.696  1.00 82.96  ? 139 VAL A CG2   1 
ATOM   1056  N  N     . PRO A 1 140 ? -10.352 35.998 -5.829  1.00 106.06 ? 140 PRO A N     1 
ATOM   1057  C  CA    . PRO A 1 140 ? -9.609  37.222 -6.164  1.00 114.24 ? 140 PRO A CA    1 
ATOM   1058  C  C     . PRO A 1 140 ? -10.458 38.292 -6.872  1.00 115.35 ? 140 PRO A C     1 
ATOM   1059  O  O     . PRO A 1 140 ? -11.112 38.033 -7.886  1.00 94.40  ? 140 PRO A O     1 
ATOM   1060  C  CB    . PRO A 1 140 ? -8.525  36.704 -7.115  1.00 105.98 ? 140 PRO A CB    1 
ATOM   1061  C  CG    . PRO A 1 140 ? -9.136  35.454 -7.696  1.00 104.65 ? 140 PRO A CG    1 
ATOM   1062  C  CD    . PRO A 1 140 ? -9.770  34.827 -6.491  1.00 108.02 ? 140 PRO A CD    1 
ATOM   1063  N  N     . PHE A 1 141 ? -10.436 39.504 -6.336  1.00 125.69 ? 141 PHE A N     1 
ATOM   1064  C  CA    . PHE A 1 141 ? -11.092 40.628 -6.997  1.00 127.22 ? 141 PHE A CA    1 
ATOM   1065  C  C     . PHE A 1 141 ? -10.090 41.584 -7.665  1.00 126.01 ? 141 PHE A C     1 
ATOM   1066  O  O     . PHE A 1 141 ? -8.897  41.584 -7.345  1.00 138.85 ? 141 PHE A O     1 
ATOM   1067  C  CB    . PHE A 1 141 ? -12.011 41.375 -6.028  1.00 126.25 ? 141 PHE A CB    1 
ATOM   1068  C  CG    . PHE A 1 141 ? -13.378 40.755 -5.888  1.00 130.21 ? 141 PHE A CG    1 
ATOM   1069  C  CD1   . PHE A 1 141 ? -13.607 39.729 -4.980  1.00 125.36 ? 141 PHE A CD1   1 
ATOM   1070  C  CD2   . PHE A 1 141 ? -14.441 41.205 -6.660  1.00 125.39 ? 141 PHE A CD2   1 
ATOM   1071  C  CE1   . PHE A 1 141 ? -14.870 39.159 -4.853  1.00 116.63 ? 141 PHE A CE1   1 
ATOM   1072  C  CE2   . PHE A 1 141 ? -15.704 40.637 -6.533  1.00 123.58 ? 141 PHE A CE2   1 
ATOM   1073  C  CZ    . PHE A 1 141 ? -15.915 39.612 -5.630  1.00 116.81 ? 141 PHE A CZ    1 
ATOM   1074  N  N     . ALA A 1 142 ? -10.577 42.356 -8.633  1.00 105.53 ? 142 ALA A N     1 
ATOM   1075  C  CA    . ALA A 1 142 ? -9.804  43.416 -9.260  1.00 101.29 ? 142 ALA A CA    1 
ATOM   1076  C  C     . ALA A 1 142 ? -10.661 44.663 -9.270  1.00 106.54 ? 142 ALA A C     1 
ATOM   1077  O  O     . ALA A 1 142 ? -11.846 44.596 -8.982  1.00 120.62 ? 142 ALA A O     1 
ATOM   1078  C  CB    . ALA A 1 142 ? -9.424  43.041 -10.674 1.00 110.62 ? 142 ALA A CB    1 
ATOM   1079  N  N     . TRP A 1 143 ? -10.083 45.796 -9.639  1.00 112.07 ? 143 TRP A N     1 
ATOM   1080  C  CA    . TRP A 1 143 ? -10.872 47.013 -9.735  1.00 109.94 ? 143 TRP A CA    1 
ATOM   1081  C  C     . TRP A 1 143 ? -11.558 46.993 -11.080 1.00 105.52 ? 143 TRP A C     1 
ATOM   1082  O  O     . TRP A 1 143 ? -11.077 46.352 -12.007 1.00 108.04 ? 143 TRP A O     1 
ATOM   1083  C  CB    . TRP A 1 143 ? -9.979  48.253 -9.683  1.00 114.01 ? 143 TRP A CB    1 
ATOM   1084  C  CG    . TRP A 1 143 ? -9.650  48.722 -8.339  1.00 120.08 ? 143 TRP A CG    1 
ATOM   1085  C  CD1   . TRP A 1 143 ? -8.423  48.741 -7.761  1.00 123.93 ? 143 TRP A CD1   1 
ATOM   1086  C  CD2   . TRP A 1 143 ? -10.563 49.260 -7.375  1.00 138.06 ? 143 TRP A CD2   1 
ATOM   1087  N  NE1   . TRP A 1 143 ? -8.510  49.249 -6.484  1.00 141.77 ? 143 TRP A NE1   1 
ATOM   1088  C  CE2   . TRP A 1 143 ? -9.815  49.573 -6.223  1.00 137.41 ? 143 TRP A CE2   1 
ATOM   1089  C  CE3   . TRP A 1 143 ? -11.946 49.504 -7.372  1.00 131.95 ? 143 TRP A CE3   1 
ATOM   1090  C  CZ2   . TRP A 1 143 ? -10.392 50.110 -5.090  1.00 121.09 ? 143 TRP A CZ2   1 
ATOM   1091  C  CZ3   . TRP A 1 143 ? -12.517 50.043 -6.250  1.00 112.67 ? 143 TRP A CZ3   1 
ATOM   1092  C  CH2   . TRP A 1 143 ? -11.741 50.337 -5.121  1.00 120.28 ? 143 TRP A CH2   1 
ATOM   1093  N  N     . ASN A 1 144 ? -12.689 47.675 -11.192 1.00 106.95 ? 144 ASN A N     1 
ATOM   1094  C  CA    . ASN A 1 144 ? -13.283 47.878 -12.508 1.00 121.23 ? 144 ASN A CA    1 
ATOM   1095  C  C     . ASN A 1 144 ? -12.515 48.956 -13.265 1.00 113.47 ? 144 ASN A C     1 
ATOM   1096  O  O     . ASN A 1 144 ? -11.596 49.576 -12.715 1.00 105.54 ? 144 ASN A O     1 
ATOM   1097  C  CB    . ASN A 1 144 ? -14.764 48.226 -12.405 1.00 121.08 ? 144 ASN A CB    1 
ATOM   1098  C  CG    . ASN A 1 144 ? -15.006 49.449 -11.592 1.00 118.21 ? 144 ASN A CG    1 
ATOM   1099  O  OD1   . ASN A 1 144 ? -16.050 50.072 -11.694 1.00 140.12 ? 144 ASN A OD1   1 
ATOM   1100  N  ND2   . ASN A 1 144 ? -14.033 49.819 -10.787 1.00 113.30 ? 144 ASN A ND2   1 
ATOM   1101  N  N     . PHE A 1 145 ? -12.869 49.172 -14.527 1.00 91.93  ? 145 PHE A N     1 
ATOM   1102  C  CA    . PHE A 1 145 ? -12.129 50.137 -15.335 1.00 110.11 ? 145 PHE A CA    1 
ATOM   1103  C  C     . PHE A 1 145 ? -12.006 51.519 -14.704 1.00 124.31 ? 145 PHE A C     1 
ATOM   1104  O  O     . PHE A 1 145 ? -11.091 52.256 -15.037 1.00 141.88 ? 145 PHE A O     1 
ATOM   1105  C  CB    . PHE A 1 145 ? -12.763 50.296 -16.704 1.00 119.13 ? 145 PHE A CB    1 
ATOM   1106  C  CG    . PHE A 1 145 ? -14.211 50.647 -16.651 1.00 121.60 ? 145 PHE A CG    1 
ATOM   1107  C  CD1   . PHE A 1 145 ? -14.615 51.908 -16.284 1.00 125.15 ? 145 PHE A CD1   1 
ATOM   1108  C  CD2   . PHE A 1 145 ? -15.168 49.713 -16.960 1.00 121.75 ? 145 PHE A CD2   1 
ATOM   1109  C  CE1   . PHE A 1 145 ? -15.949 52.225 -16.233 1.00 122.33 ? 145 PHE A CE1   1 
ATOM   1110  C  CE2   . PHE A 1 145 ? -16.493 50.030 -16.917 1.00 117.41 ? 145 PHE A CE2   1 
ATOM   1111  C  CZ    . PHE A 1 145 ? -16.883 51.286 -16.554 1.00 118.80 ? 145 PHE A CZ    1 
ATOM   1112  N  N     . ASP A 1 146 ? -12.925 51.879 -13.809 1.00 119.73 ? 146 ASP A N     1 
ATOM   1113  C  CA    . ASP A 1 146 ? -12.965 53.243 -13.274 1.00 102.85 ? 146 ASP A CA    1 
ATOM   1114  C  C     . ASP A 1 146 ? -12.308 53.381 -11.894 1.00 112.62 ? 146 ASP A C     1 
ATOM   1115  O  O     . ASP A 1 146 ? -12.015 54.498 -11.456 1.00 111.98 ? 146 ASP A O     1 
ATOM   1116  C  CB    . ASP A 1 146 ? -14.406 53.784 -13.255 1.00 83.50  ? 146 ASP A CB    1 
ATOM   1117  N  N     . ASP A 1 147 ? -12.060 52.241 -11.240 1.00 122.64 ? 147 ASP A N     1 
ATOM   1118  C  CA    . ASP A 1 147 ? -11.545 52.160 -9.859  1.00 114.48 ? 147 ASP A CA    1 
ATOM   1119  C  C     . ASP A 1 147 ? -12.637 52.483 -8.859  1.00 109.10 ? 147 ASP A C     1 
ATOM   1120  O  O     . ASP A 1 147 ? -12.362 52.766 -7.688  1.00 115.38 ? 147 ASP A O     1 
ATOM   1121  C  CB    . ASP A 1 147 ? -10.349 53.081 -9.605  1.00 127.83 ? 147 ASP A CB    1 
ATOM   1122  C  CG    . ASP A 1 147 ? -9.038  52.481 -10.053 1.00 142.41 ? 147 ASP A CG    1 
ATOM   1123  O  OD1   . ASP A 1 147 ? -9.056  51.605 -10.940 1.00 151.42 ? 147 ASP A OD1   1 
ATOM   1124  O  OD2   . ASP A 1 147 ? -7.983  52.907 -9.533  1.00 150.07 ? 147 ASP A OD2   1 
ATOM   1125  N  N     . THR A 1 148 ? -13.879 52.432 -9.328  1.00 105.70 ? 148 THR A N     1 
ATOM   1126  C  CA    . THR A 1 148 ? -15.018 52.793 -8.500  1.00 111.13 ? 148 THR A CA    1 
ATOM   1127  C  C     . THR A 1 148 ? -15.563 51.617 -7.713  1.00 101.55 ? 148 THR A C     1 
ATOM   1128  O  O     . THR A 1 148 ? -16.102 51.802 -6.625  1.00 110.04 ? 148 THR A O     1 
ATOM   1129  C  CB    . THR A 1 148 ? -16.177 53.364 -9.330  1.00 112.47 ? 148 THR A CB    1 
ATOM   1130  O  OG1   . THR A 1 148 ? -16.829 52.309 -10.040 1.00 123.14 ? 148 THR A OG1   1 
ATOM   1131  C  CG2   . THR A 1 148 ? -15.674 54.383 -10.306 1.00 113.11 ? 148 THR A CG2   1 
ATOM   1132  N  N     . GLU A 1 149 ? -15.420 50.414 -8.253  1.00 93.02  ? 149 GLU A N     1 
ATOM   1133  C  CA    . GLU A 1 149 ? -15.997 49.234 -7.622  1.00 111.72 ? 149 GLU A CA    1 
ATOM   1134  C  C     . GLU A 1 149 ? -15.233 47.970 -7.987  1.00 118.00 ? 149 GLU A C     1 
ATOM   1135  O  O     . GLU A 1 149 ? -14.571 47.921 -9.022  1.00 129.84 ? 149 GLU A O     1 
ATOM   1136  C  CB    . GLU A 1 149 ? -17.456 49.077 -8.019  1.00 127.14 ? 149 GLU A CB    1 
ATOM   1137  C  CG    . GLU A 1 149 ? -18.201 48.169 -7.086  1.00 155.12 ? 149 GLU A CG    1 
ATOM   1138  C  CD    . GLU A 1 149 ? -19.454 47.594 -7.705  1.00 178.82 ? 149 GLU A CD    1 
ATOM   1139  O  OE1   . GLU A 1 149 ? -20.053 48.269 -8.581  1.00 177.71 ? 149 GLU A OE1   1 
ATOM   1140  O  OE2   . GLU A 1 149 ? -19.833 46.465 -7.301  1.00 189.03 ? 149 GLU A OE2   1 
ATOM   1141  N  N     . LYS A 1 150 ? -15.347 46.937 -7.159  1.00 110.28 ? 150 LYS A N     1 
ATOM   1142  C  CA    . LYS A 1 150 ? -14.544 45.730 -7.351  1.00 107.14 ? 150 LYS A CA    1 
ATOM   1143  C  C     . LYS A 1 150 ? -15.310 44.550 -7.973  1.00 116.89 ? 150 LYS A C     1 
ATOM   1144  O  O     . LYS A 1 150 ? -16.502 44.355 -7.745  1.00 128.29 ? 150 LYS A O     1 
ATOM   1145  C  CB    . LYS A 1 150 ? -13.822 45.346 -6.046  1.00 105.97 ? 150 LYS A CB    1 
ATOM   1146  C  CG    . LYS A 1 150 ? -12.377 45.871 -5.946  1.00 119.02 ? 150 LYS A CG    1 
ATOM   1147  C  CD    . LYS A 1 150 ? -11.961 46.253 -4.521  1.00 121.53 ? 150 LYS A CD    1 
ATOM   1148  N  N     . GLU A 1 151 ? -14.592 43.788 -8.788  1.00 115.72 ? 151 GLU A N     1 
ATOM   1149  C  CA    . GLU A 1 151 ? -15.173 42.832 -9.710  1.00 107.91 ? 151 GLU A CA    1 
ATOM   1150  C  C     . GLU A 1 151 ? -14.413 41.518 -9.563  1.00 113.32 ? 151 GLU A C     1 
ATOM   1151  O  O     . GLU A 1 151 ? -13.195 41.534 -9.449  1.00 119.44 ? 151 GLU A O     1 
ATOM   1152  C  CB    . GLU A 1 151 ? -14.956 43.377 -11.118 1.00 103.34 ? 151 GLU A CB    1 
ATOM   1153  C  CG    . GLU A 1 151 ? -15.682 42.637 -12.221 1.00 122.02 ? 151 GLU A CG    1 
ATOM   1154  C  CD    . GLU A 1 151 ? -15.089 42.878 -13.620 1.00 134.94 ? 151 GLU A CD    1 
ATOM   1155  O  OE1   . GLU A 1 151 ? -14.621 44.008 -13.926 1.00 119.64 ? 151 GLU A OE1   1 
ATOM   1156  O  OE2   . GLU A 1 151 ? -15.103 41.913 -14.421 1.00 148.83 ? 151 GLU A OE2   1 
ATOM   1157  N  N     . PRO A 1 152 ? -15.124 40.375 -9.555  1.00 108.25 ? 152 PRO A N     1 
ATOM   1158  C  CA    . PRO A 1 152 ? -14.503 39.046 -9.428  1.00 96.71  ? 152 PRO A CA    1 
ATOM   1159  C  C     . PRO A 1 152 ? -13.674 38.724 -10.648 1.00 104.62 ? 152 PRO A C     1 
ATOM   1160  O  O     . PRO A 1 152 ? -14.100 39.088 -11.746 1.00 113.36 ? 152 PRO A O     1 
ATOM   1161  C  CB    . PRO A 1 152 ? -15.693 38.093 -9.430  1.00 79.03  ? 152 PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1 152 ? -16.870 38.928 -9.167  1.00 88.54  ? 152 PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1 152 ? -16.585 40.285 -9.675  1.00 98.37  ? 152 PRO A CD    1 
ATOM   1164  N  N     . THR A 1 153 ? -12.545 38.040 -10.482 1.00 103.56 ? 153 THR A N     1 
ATOM   1165  C  CA    . THR A 1 153 ? -11.722 37.653 -11.631 1.00 107.70 ? 153 THR A CA    1 
ATOM   1166  C  C     . THR A 1 153 ? -12.073 36.243 -12.094 1.00 116.68 ? 153 THR A C     1 
ATOM   1167  O  O     . THR A 1 153 ? -11.686 35.797 -13.178 1.00 115.00 ? 153 THR A O     1 
ATOM   1168  C  CB    . THR A 1 153 ? -10.242 37.732 -11.322 1.00 101.56 ? 153 THR A CB    1 
ATOM   1169  O  OG1   . THR A 1 153 ? -9.901  36.735 -10.346 1.00 118.59 ? 153 THR A OG1   1 
ATOM   1170  C  CG2   . THR A 1 153 ? -9.935  39.082 -10.774 1.00 97.79  ? 153 THR A CG2   1 
ATOM   1171  N  N     . VAL A 1 154 ? -12.809 35.542 -11.249 1.00 109.56 ? 154 VAL A N     1 
ATOM   1172  C  CA    . VAL A 1 154 ? -13.346 34.248 -11.602 1.00 110.01 ? 154 VAL A CA    1 
ATOM   1173  C  C     . VAL A 1 154 ? -14.445 34.018 -10.596 1.00 102.32 ? 154 VAL A C     1 
ATOM   1174  O  O     . VAL A 1 154 ? -14.502 34.713 -9.584  1.00 94.99  ? 154 VAL A O     1 
ATOM   1175  C  CB    . VAL A 1 154 ? -12.297 33.166 -11.476 1.00 122.52 ? 154 VAL A CB    1 
ATOM   1176  C  CG1   . VAL A 1 154 ? -11.966 32.923 -9.996  1.00 64.69  ? 154 VAL A CG1   1 
ATOM   1177  C  CG2   . VAL A 1 154 ? -12.787 31.908 -12.171 1.00 119.88 ? 154 VAL A CG2   1 
ATOM   1178  N  N     . LEU A 1 155 ? -15.334 33.073 -10.864 1.00 88.16  ? 155 LEU A N     1 
ATOM   1179  C  CA    . LEU A 1 155 ? -16.388 32.814 -9.912  1.00 89.51  ? 155 LEU A CA    1 
ATOM   1180  C  C     . LEU A 1 155 ? -16.016 31.636 -9.030  1.00 101.59 ? 155 LEU A C     1 
ATOM   1181  O  O     . LEU A 1 155 ? -15.077 30.906 -9.337  1.00 103.65 ? 155 LEU A O     1 
ATOM   1182  C  CB    . LEU A 1 155 ? -17.719 32.604 -10.621 1.00 87.18  ? 155 LEU A CB    1 
ATOM   1183  C  CG    . LEU A 1 155 ? -18.190 33.836 -11.389 1.00 88.20  ? 155 LEU A CG    1 
ATOM   1184  C  CD1   . LEU A 1 155 ? -19.693 33.766 -11.618 1.00 100.83 ? 155 LEU A CD1   1 
ATOM   1185  C  CD2   . LEU A 1 155 ? -17.814 35.131 -10.673 1.00 80.62  ? 155 LEU A CD2   1 
ATOM   1186  N  N     . PRO A 1 156 ? -16.728 31.474 -7.907  1.00 107.95 ? 156 PRO A N     1 
ATOM   1187  C  CA    . PRO A 1 156 ? -16.545 30.315 -7.032  1.00 107.84 ? 156 PRO A CA    1 
ATOM   1188  C  C     . PRO A 1 156 ? -16.752 28.995 -7.772  1.00 109.30 ? 156 PRO A C     1 
ATOM   1189  O  O     . PRO A 1 156 ? -15.837 28.173 -7.774  1.00 123.90 ? 156 PRO A O     1 
ATOM   1190  C  CB    . PRO A 1 156 ? -17.615 30.522 -5.963  1.00 119.07 ? 156 PRO A CB    1 
ATOM   1191  C  CG    . PRO A 1 156 ? -17.761 32.021 -5.893  1.00 114.59 ? 156 PRO A CG    1 
ATOM   1192  C  CD    . PRO A 1 156 ? -17.623 32.482 -7.309  1.00 108.73 ? 156 PRO A CD    1 
ATOM   1193  N  N     . ALA A 1 157 ? -17.924 28.789 -8.371  1.00 111.99 ? 157 ALA A N     1 
ATOM   1194  C  CA    . ALA A 1 157 ? -18.157 27.631 -9.247  1.00 124.95 ? 157 ALA A CA    1 
ATOM   1195  C  C     . ALA A 1 157 ? -18.506 26.337 -8.522  1.00 122.76 ? 157 ALA A C     1 
ATOM   1196  O  O     . ALA A 1 157 ? -17.689 25.420 -8.430  1.00 122.08 ? 157 ALA A O     1 
ATOM   1197  C  CB    . ALA A 1 157 ? -16.961 27.395 -10.156 1.00 128.49 ? 157 ALA A CB    1 
ATOM   1198  N  N     . ALA A 1 158 ? -19.733 26.264 -8.030  1.00 115.10 ? 158 ALA A N     1 
ATOM   1199  C  CA    . ALA A 1 158 ? -20.203 25.079 -7.340  1.00 110.19 ? 158 ALA A CA    1 
ATOM   1200  C  C     . ALA A 1 158 ? -20.175 23.852 -8.241  1.00 117.80 ? 158 ALA A C     1 
ATOM   1201  O  O     . ALA A 1 158 ? -20.030 22.728 -7.753  1.00 124.44 ? 158 ALA A O     1 
ATOM   1202  C  CB    . ALA A 1 158 ? -21.600 25.308 -6.818  1.00 108.01 ? 158 ALA A CB    1 
ATOM   1203  N  N     . PHE A 1 159 ? -20.334 24.057 -9.548  1.00 111.02 ? 159 PHE A N     1 
ATOM   1204  C  CA    . PHE A 1 159 ? -20.244 22.944 -10.497 1.00 121.00 ? 159 PHE A CA    1 
ATOM   1205  C  C     . PHE A 1 159 ? -19.329 23.291 -11.664 1.00 130.23 ? 159 PHE A C     1 
ATOM   1206  O  O     . PHE A 1 159 ? -19.072 24.468 -11.915 1.00 138.42 ? 159 PHE A O     1 
ATOM   1207  C  CB    . PHE A 1 159 ? -21.632 22.513 -10.988 1.00 134.08 ? 159 PHE A CB    1 
ATOM   1208  C  CG    . PHE A 1 159 ? -22.291 23.501 -11.904 1.00 139.85 ? 159 PHE A CG    1 
ATOM   1209  C  CD1   . PHE A 1 159 ? -22.795 24.695 -11.413 1.00 134.66 ? 159 PHE A CD1   1 
ATOM   1210  C  CD2   . PHE A 1 159 ? -22.416 23.230 -13.261 1.00 139.07 ? 159 PHE A CD2   1 
ATOM   1211  C  CE1   . PHE A 1 159 ? -23.401 25.607 -12.264 1.00 129.72 ? 159 PHE A CE1   1 
ATOM   1212  C  CE2   . PHE A 1 159 ? -23.017 24.139 -14.117 1.00 132.43 ? 159 PHE A CE2   1 
ATOM   1213  C  CZ    . PHE A 1 159 ? -23.511 25.327 -13.617 1.00 125.44 ? 159 PHE A CZ    1 
ATOM   1214  N  N     . PRO A 1 160 ? -18.819 22.264 -12.366 1.00 127.06 ? 160 PRO A N     1 
ATOM   1215  C  CA    . PRO A 1 160 ? -17.839 22.376 -13.462 1.00 131.98 ? 160 PRO A CA    1 
ATOM   1216  C  C     . PRO A 1 160 ? -18.420 22.906 -14.777 1.00 129.60 ? 160 PRO A C     1 
ATOM   1217  O  O     . PRO A 1 160 ? -18.424 22.205 -15.797 1.00 116.09 ? 160 PRO A O     1 
ATOM   1218  C  CB    . PRO A 1 160 ? -17.343 20.938 -13.641 1.00 128.39 ? 160 PRO A CB    1 
ATOM   1219  C  CG    . PRO A 1 160 ? -17.767 20.227 -12.408 1.00 128.52 ? 160 PRO A CG    1 
ATOM   1220  C  CD    . PRO A 1 160 ? -19.042 20.866 -11.986 1.00 123.05 ? 160 PRO A CD    1 
ATOM   1221  N  N     . ASN A 1 161 ? -18.876 24.154 -14.738 1.00 132.54 ? 161 ASN A N     1 
ATOM   1222  C  CA    . ASN A 1 161 ? -19.560 24.797 -15.852 1.00 134.06 ? 161 ASN A CA    1 
ATOM   1223  C  C     . ASN A 1 161 ? -18.883 24.633 -17.215 1.00 132.13 ? 161 ASN A C     1 
ATOM   1224  O  O     . ASN A 1 161 ? -19.564 24.574 -18.239 1.00 136.50 ? 161 ASN A O     1 
ATOM   1225  C  CB    . ASN A 1 161 ? -19.767 26.276 -15.531 1.00 136.28 ? 161 ASN A CB    1 
ATOM   1226  C  CG    . ASN A 1 161 ? -20.587 26.995 -16.578 1.00 134.04 ? 161 ASN A CG    1 
ATOM   1227  O  OD1   . ASN A 1 161 ? -21.525 26.438 -17.153 1.00 127.02 ? 161 ASN A OD1   1 
ATOM   1228  N  ND2   . ASN A 1 161 ? -20.242 28.253 -16.822 1.00 128.82 ? 161 ASN A ND2   1 
ATOM   1229  N  N     . LEU A 1 162 ? -17.554 24.563 -17.229 1.00 129.14 ? 162 LEU A N     1 
ATOM   1230  C  CA    . LEU A 1 162 ? -16.811 24.515 -18.489 1.00 130.21 ? 162 LEU A CA    1 
ATOM   1231  C  C     . LEU A 1 162 ? -17.269 23.361 -19.378 1.00 129.92 ? 162 LEU A C     1 
ATOM   1232  O  O     . LEU A 1 162 ? -17.661 23.573 -20.524 1.00 125.65 ? 162 LEU A O     1 
ATOM   1233  C  CB    . LEU A 1 162 ? -15.301 24.411 -18.237 1.00 133.26 ? 162 LEU A CB    1 
ATOM   1234  C  CG    . LEU A 1 162 ? -14.340 24.955 -19.310 1.00 109.04 ? 162 LEU A CG    1 
ATOM   1235  C  CD1   . LEU A 1 162 ? -13.156 24.012 -19.516 1.00 104.03 ? 162 LEU A CD1   1 
ATOM   1236  C  CD2   . LEU A 1 162 ? -15.072 25.143 -20.606 1.00 89.39  ? 162 LEU A CD2   1 
ATOM   1237  N  N     . LEU A 1 163 ? -17.197 22.142 -18.854 1.00 133.07 ? 163 LEU A N     1 
ATOM   1238  C  CA    . LEU A 1 163 ? -17.663 20.962 -19.580 1.00 130.97 ? 163 LEU A CA    1 
ATOM   1239  C  C     . LEU A 1 163 ? -19.177 20.942 -19.768 1.00 123.79 ? 163 LEU A C     1 
ATOM   1240  O  O     . LEU A 1 163 ? -19.683 20.533 -20.809 1.00 120.99 ? 163 LEU A O     1 
ATOM   1241  C  CB    . LEU A 1 163 ? -17.229 19.691 -18.862 1.00 122.37 ? 163 LEU A CB    1 
ATOM   1242  C  CG    . LEU A 1 163 ? -15.749 19.418 -19.051 1.00 124.75 ? 163 LEU A CG    1 
ATOM   1243  C  CD1   . LEU A 1 163 ? -15.275 18.446 -17.989 1.00 130.03 ? 163 LEU A CD1   1 
ATOM   1244  C  CD2   . LEU A 1 163 ? -15.470 18.906 -20.467 1.00 111.87 ? 163 LEU A CD2   1 
ATOM   1245  N  N     . VAL A 1 164 ? -19.894 21.373 -18.743 1.00 115.82 ? 164 VAL A N     1 
ATOM   1246  C  CA    . VAL A 1 164 ? -21.344 21.330 -18.763 1.00 106.42 ? 164 VAL A CA    1 
ATOM   1247  C  C     . VAL A 1 164 ? -21.952 22.104 -19.925 1.00 112.57 ? 164 VAL A C     1 
ATOM   1248  O  O     . VAL A 1 164 ? -22.670 21.534 -20.738 1.00 128.70 ? 164 VAL A O     1 
ATOM   1249  C  CB    . VAL A 1 164 ? -21.867 21.877 -17.464 1.00 104.08 ? 164 VAL A CB    1 
ATOM   1250  C  CG1   . VAL A 1 164 ? -23.370 21.880 -17.456 1.00 115.05 ? 164 VAL A CG1   1 
ATOM   1251  C  CG2   . VAL A 1 164 ? -21.313 21.044 -16.338 1.00 107.32 ? 164 VAL A CG2   1 
ATOM   1252  N  N     . ASN A 1 165 ? -21.703 23.408 -19.979 1.00 104.93 ? 165 ASN A N     1 
ATOM   1253  C  CA    . ASN A 1 165 ? -22.217 24.244 -21.062 1.00 106.44 ? 165 ASN A CA    1 
ATOM   1254  C  C     . ASN A 1 165 ? -21.284 24.468 -22.251 1.00 125.91 ? 165 ASN A C     1 
ATOM   1255  O  O     . ASN A 1 165 ? -21.558 25.323 -23.100 1.00 134.38 ? 165 ASN A O     1 
ATOM   1256  C  CB    . ASN A 1 165 ? -22.607 25.598 -20.504 1.00 108.55 ? 165 ASN A CB    1 
ATOM   1257  C  CG    . ASN A 1 165 ? -23.807 25.519 -19.602 1.00 110.37 ? 165 ASN A CG    1 
ATOM   1258  O  OD1   . ASN A 1 165 ? -24.798 24.836 -19.926 1.00 113.00 ? 165 ASN A OD1   1 
ATOM   1259  N  ND2   . ASN A 1 165 ? -23.739 26.219 -18.455 1.00 93.21  ? 165 ASN A ND2   1 
ATOM   1260  N  N     . GLY A 1 166 ? -20.177 23.736 -22.303 1.00 139.00 ? 166 GLY A N     1 
ATOM   1261  C  CA    . GLY A 1 166 ? -19.199 23.924 -23.365 1.00 144.43 ? 166 GLY A CA    1 
ATOM   1262  C  C     . GLY A 1 166 ? -18.867 25.390 -23.585 1.00 127.53 ? 166 GLY A C     1 
ATOM   1263  O  O     . GLY A 1 166 ? -19.067 26.210 -22.681 1.00 117.81 ? 166 GLY A O     1 
ATOM   1264  N  N     . SER A 1 167 ? -18.365 25.719 -24.775 1.00 113.07 ? 167 SER A N     1 
ATOM   1265  C  CA    . SER A 1 167 ? -18.094 27.113 -25.126 1.00 122.29 ? 167 SER A CA    1 
ATOM   1266  C  C     . SER A 1 167 ? -17.346 27.278 -26.438 1.00 112.55 ? 167 SER A C     1 
ATOM   1267  O  O     . SER A 1 167 ? -16.581 26.402 -26.836 1.00 113.70 ? 167 SER A O     1 
ATOM   1268  C  CB    . SER A 1 167 ? -17.311 27.820 -24.027 1.00 149.35 ? 167 SER A CB    1 
ATOM   1269  O  OG    . SER A 1 167 ? -17.392 29.220 -24.207 1.00 160.10 ? 167 SER A OG    1 
ATOM   1270  N  N     . THR A 1 168 ? -17.609 28.394 -27.117 1.00 106.80 ? 168 THR A N     1 
ATOM   1271  C  CA    . THR A 1 168 ? -16.903 28.778 -28.344 1.00 108.90 ? 168 THR A CA    1 
ATOM   1272  C  C     . THR A 1 168 ? -16.905 30.312 -28.422 1.00 117.06 ? 168 THR A C     1 
ATOM   1273  O  O     . THR A 1 168 ? -17.884 30.907 -27.973 1.00 136.16 ? 168 THR A O     1 
ATOM   1274  C  CB    . THR A 1 168 ? -17.667 28.231 -29.561 1.00 107.74 ? 168 THR A CB    1 
ATOM   1275  O  OG1   . THR A 1 168 ? -18.831 29.022 -29.767 1.00 100.33 ? 168 THR A OG1   1 
ATOM   1276  C  CG2   . THR A 1 168 ? -18.119 26.776 -29.329 1.00 116.58 ? 168 THR A CG2   1 
ATOM   1277  N  N     . GLY A 1 169 ? -15.865 30.981 -28.954 1.00 109.32 ? 169 GLY A N     1 
ATOM   1278  C  CA    . GLY A 1 169 ? -14.600 30.402 -29.388 1.00 109.41 ? 169 GLY A CA    1 
ATOM   1279  C  C     . GLY A 1 169 ? -13.839 30.998 -30.590 1.00 121.86 ? 169 GLY A C     1 
ATOM   1280  O  O     . GLY A 1 169 ? -13.367 30.229 -31.427 1.00 139.42 ? 169 GLY A O     1 
ATOM   1281  N  N     . ILE A 1 170 ? -13.696 32.323 -30.709 1.00 95.26  ? 170 ILE A N     1 
ATOM   1282  C  CA    . ILE A 1 170 ? -12.826 32.878 -31.771 1.00 93.84  ? 170 ILE A CA    1 
ATOM   1283  C  C     . ILE A 1 170 ? -11.969 34.069 -31.342 1.00 100.26 ? 170 ILE A C     1 
ATOM   1284  O  O     . ILE A 1 170 ? -12.471 35.172 -31.087 1.00 101.27 ? 170 ILE A O     1 
ATOM   1285  C  CB    . ILE A 1 170 ? -13.574 33.383 -33.032 1.00 109.99 ? 170 ILE A CB    1 
ATOM   1286  C  CG1   . ILE A 1 170 ? -14.382 32.308 -33.729 1.00 118.60 ? 170 ILE A CG1   1 
ATOM   1287  C  CG2   . ILE A 1 170 ? -12.597 33.896 -34.077 1.00 87.67  ? 170 ILE A CG2   1 
ATOM   1288  C  CD1   . ILE A 1 170 ? -15.047 32.859 -35.006 1.00 114.83 ? 170 ILE A CD1   1 
ATOM   1289  N  N     . SER A 1 171 ? -10.663 33.861 -31.333 1.00 99.48  ? 171 SER A N     1 
ATOM   1290  C  CA    . SER A 1 171 ? -9.736  34.890 -30.906 1.00 114.43 ? 171 SER A CA    1 
ATOM   1291  C  C     . SER A 1 171 ? -8.624  35.021 -31.933 1.00 127.60 ? 171 SER A C     1 
ATOM   1292  O  O     . SER A 1 171 ? -8.653  34.353 -32.961 1.00 148.52 ? 171 SER A O     1 
ATOM   1293  C  CB    . SER A 1 171 ? -9.124  34.485 -29.569 1.00 121.42 ? 171 SER A CB    1 
ATOM   1294  O  OG    . SER A 1 171 ? -8.285  33.358 -29.741 1.00 118.44 ? 171 SER A OG    1 
ATOM   1295  N  N     . ALA A 1 172 ? -7.641  35.872 -31.648 1.00 126.08 ? 172 ALA A N     1 
ATOM   1296  C  CA    . ALA A 1 172 ? -6.398  35.915 -32.424 1.00 120.75 ? 172 ALA A CA    1 
ATOM   1297  C  C     . ALA A 1 172 ? -5.486  34.703 -32.140 1.00 114.79 ? 172 ALA A C     1 
ATOM   1298  O  O     . ALA A 1 172 ? -5.063  34.481 -31.006 1.00 114.57 ? 172 ALA A O     1 
ATOM   1299  C  CB    . ALA A 1 172 ? -5.647  37.223 -32.163 1.00 107.82 ? 172 ALA A CB    1 
ATOM   1300  N  N     . GLY A 1 173 ? -5.190  33.925 -33.178 1.00 102.65 ? 173 GLY A N     1 
ATOM   1301  C  CA    . GLY A 1 173 ? -4.330  32.764 -33.048 1.00 106.10 ? 173 GLY A CA    1 
ATOM   1302  C  C     . GLY A 1 173 ? -5.030  31.542 -32.479 1.00 116.26 ? 173 GLY A C     1 
ATOM   1303  O  O     . GLY A 1 173 ? -4.626  30.410 -32.730 1.00 124.41 ? 173 GLY A O     1 
ATOM   1304  N  N     . TYR A 1 174 ? -6.082  31.755 -31.704 1.00 111.79 ? 174 TYR A N     1 
ATOM   1305  C  CA    . TYR A 1 174 ? -6.781  30.627 -31.115 1.00 113.25 ? 174 TYR A CA    1 
ATOM   1306  C  C     . TYR A 1 174 ? -8.281  30.695 -31.330 1.00 121.62 ? 174 TYR A C     1 
ATOM   1307  O  O     . TYR A 1 174 ? -8.873  31.770 -31.370 1.00 122.66 ? 174 TYR A O     1 
ATOM   1308  C  CB    . TYR A 1 174 ? -6.503  30.553 -29.630 1.00 108.73 ? 174 TYR A CB    1 
ATOM   1309  C  CG    . TYR A 1 174 ? -5.069  30.313 -29.267 1.00 108.32 ? 174 TYR A CG    1 
ATOM   1310  C  CD1   . TYR A 1 174 ? -4.626  29.041 -28.967 1.00 109.10 ? 174 TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A 1 174 ? -4.163  31.362 -29.188 1.00 111.97 ? 174 TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A 1 174 ? -3.325  28.809 -28.605 1.00 116.23 ? 174 TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A 1 174 ? -2.854  31.141 -28.832 1.00 118.82 ? 174 TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A 1 174 ? -2.444  29.857 -28.534 1.00 124.27 ? 174 TYR A CZ    1 
ATOM   1315  O  OH    . TYR A 1 174 ? -1.143  29.600 -28.176 1.00 132.83 ? 174 TYR A OH    1 
ATOM   1316  N  N     . ALA A 1 175 ? -8.891  29.532 -31.478 1.00 117.30 ? 175 ALA A N     1 
ATOM   1317  C  CA    . ALA A 1 175 ? -10.337 29.428 -31.462 1.00 124.54 ? 175 ALA A CA    1 
ATOM   1318  C  C     . ALA A 1 175 ? -10.703 28.303 -30.506 1.00 122.39 ? 175 ALA A C     1 
ATOM   1319  O  O     . ALA A 1 175 ? -9.850  27.492 -30.154 1.00 128.33 ? 175 ALA A O     1 
ATOM   1320  C  CB    . ALA A 1 175 ? -10.852 29.157 -32.836 1.00 147.52 ? 175 ALA A CB    1 
ATOM   1321  N  N     . THR A 1 176 ? -11.942 28.276 -30.034 1.00 118.55 ? 176 THR A N     1 
ATOM   1322  C  CA    . THR A 1 176 ? -12.347 27.211 -29.132 1.00 125.48 ? 176 THR A CA    1 
ATOM   1323  C  C     . THR A 1 176 ? -13.720 26.670 -29.484 1.00 126.88 ? 176 THR A C     1 
ATOM   1324  O  O     . THR A 1 176 ? -14.600 27.422 -29.883 1.00 130.31 ? 176 THR A O     1 
ATOM   1325  C  CB    . THR A 1 176 ? -12.352 27.687 -27.657 1.00 126.37 ? 176 THR A CB    1 
ATOM   1326  O  OG1   . THR A 1 176 ? -12.192 26.560 -26.781 1.00 141.11 ? 176 THR A OG1   1 
ATOM   1327  C  CG2   . THR A 1 176 ? -13.642 28.413 -27.326 1.00 108.99 ? 176 THR A CG2   1 
ATOM   1328  N  N     . ASP A 1 177 ? -13.868 25.351 -29.385 1.00 126.51 ? 177 ASP A N     1 
ATOM   1329  C  CA    . ASP A 1 177 ? -15.169 24.692 -29.399 1.00 120.43 ? 177 ASP A CA    1 
ATOM   1330  C  C     . ASP A 1 177 ? -15.182 23.593 -28.344 1.00 119.31 ? 177 ASP A C     1 
ATOM   1331  O  O     . ASP A 1 177 ? -14.339 22.693 -28.369 1.00 119.05 ? 177 ASP A O     1 
ATOM   1332  C  CB    . ASP A 1 177 ? -15.475 24.097 -30.776 1.00 133.48 ? 177 ASP A CB    1 
ATOM   1333  C  CG    . ASP A 1 177 ? -16.191 25.082 -31.704 1.00 158.68 ? 177 ASP A CG    1 
ATOM   1334  O  OD1   . ASP A 1 177 ? -17.307 24.753 -32.174 1.00 166.08 ? 177 ASP A OD1   1 
ATOM   1335  O  OD2   . ASP A 1 177 ? -15.647 26.182 -31.962 1.00 168.50 ? 177 ASP A OD2   1 
ATOM   1336  N  N     . ILE A 1 178 ? -16.131 23.668 -27.414 1.00 123.72 ? 178 ILE A N     1 
ATOM   1337  C  CA    . ILE A 1 178 ? -16.254 22.670 -26.346 1.00 112.03 ? 178 ILE A CA    1 
ATOM   1338  C  C     . ILE A 1 178 ? -17.696 22.202 -26.168 1.00 105.78 ? 178 ILE A C     1 
ATOM   1339  O  O     . ILE A 1 178 ? -18.553 22.964 -25.717 1.00 105.74 ? 178 ILE A O     1 
ATOM   1340  C  CB    . ILE A 1 178 ? -15.762 23.219 -25.005 1.00 102.09 ? 178 ILE A CB    1 
ATOM   1341  C  CG1   . ILE A 1 178 ? -14.343 23.763 -25.161 1.00 100.93 ? 178 ILE A CG1   1 
ATOM   1342  C  CG2   . ILE A 1 178 ? -15.812 22.135 -23.953 1.00 108.40 ? 178 ILE A CG2   1 
ATOM   1343  C  CD1   . ILE A 1 178 ? -13.693 24.181 -23.892 1.00 97.57  ? 178 ILE A CD1   1 
ATOM   1344  N  N     . PRO A 1 179 ? -17.960 20.933 -26.491 1.00 104.30 ? 179 PRO A N     1 
ATOM   1345  C  CA    . PRO A 1 179 ? -19.339 20.451 -26.530 1.00 110.77 ? 179 PRO A CA    1 
ATOM   1346  C  C     . PRO A 1 179 ? -19.888 20.433 -25.128 1.00 120.10 ? 179 PRO A C     1 
ATOM   1347  O  O     . PRO A 1 179 ? -19.135 20.199 -24.184 1.00 117.87 ? 179 PRO A O     1 
ATOM   1348  C  CB    . PRO A 1 179 ? -19.203 19.001 -26.999 1.00 120.88 ? 179 PRO A CB    1 
ATOM   1349  C  CG    . PRO A 1 179 ? -17.734 18.703 -27.016 1.00 128.78 ? 179 PRO A CG    1 
ATOM   1350  C  CD    . PRO A 1 179 ? -17.003 19.829 -26.372 1.00 121.27 ? 179 PRO A CD    1 
ATOM   1351  N  N     . PRO A 1 180 ? -21.194 20.659 -24.990 1.00 121.98 ? 180 PRO A N     1 
ATOM   1352  C  CA    . PRO A 1 180 ? -21.864 20.594 -23.690 1.00 117.10 ? 180 PRO A CA    1 
ATOM   1353  C  C     . PRO A 1 180 ? -21.747 19.196 -23.112 1.00 113.00 ? 180 PRO A C     1 
ATOM   1354  O  O     . PRO A 1 180 ? -21.535 18.249 -23.867 1.00 118.27 ? 180 PRO A O     1 
ATOM   1355  C  CB    . PRO A 1 180 ? -23.324 20.889 -24.040 1.00 121.45 ? 180 PRO A CB    1 
ATOM   1356  C  CG    . PRO A 1 180 ? -23.256 21.619 -25.354 1.00 127.89 ? 180 PRO A CG    1 
ATOM   1357  C  CD    . PRO A 1 180 ? -22.123 20.976 -26.083 1.00 124.42 ? 180 PRO A CD    1 
ATOM   1358  N  N     . HIS A 1 181 ? -21.876 19.066 -21.796 1.00 111.08 ? 181 HIS A N     1 
ATOM   1359  C  CA    . HIS A 1 181 ? -21.833 17.755 -21.160 1.00 120.94 ? 181 HIS A CA    1 
ATOM   1360  C  C     . HIS A 1 181 ? -22.931 17.586 -20.106 1.00 126.24 ? 181 HIS A C     1 
ATOM   1361  O  O     . HIS A 1 181 ? -23.486 18.568 -19.602 1.00 123.89 ? 181 HIS A O     1 
ATOM   1362  C  CB    . HIS A 1 181 ? -20.453 17.500 -20.548 1.00 121.99 ? 181 HIS A CB    1 
ATOM   1363  C  CG    . HIS A 1 181 ? -19.364 17.323 -21.563 1.00 122.19 ? 181 HIS A CG    1 
ATOM   1364  N  ND1   . HIS A 1 181 ? -18.446 18.312 -21.853 1.00 123.35 ? 181 HIS A ND1   1 
ATOM   1365  C  CD2   . HIS A 1 181 ? -19.047 16.273 -22.359 1.00 114.81 ? 181 HIS A CD2   1 
ATOM   1366  C  CE1   . HIS A 1 181 ? -17.618 17.882 -22.787 1.00 114.14 ? 181 HIS A CE1   1 
ATOM   1367  N  NE2   . HIS A 1 181 ? -17.959 16.647 -23.109 1.00 113.89 ? 181 HIS A NE2   1 
ATOM   1368  N  N     . ASN A 1 182 ? -23.239 16.331 -19.795 1.00 120.86 ? 182 ASN A N     1 
ATOM   1369  C  CA    . ASN A 1 182 ? -24.225 15.967 -18.771 1.00 118.79 ? 182 ASN A CA    1 
ATOM   1370  C  C     . ASN A 1 182 ? -23.830 16.273 -17.326 1.00 125.41 ? 182 ASN A C     1 
ATOM   1371  O  O     . ASN A 1 182 ? -23.038 15.534 -16.748 1.00 119.44 ? 182 ASN A O     1 
ATOM   1372  C  CB    . ASN A 1 182 ? -24.658 14.517 -18.878 1.00 120.20 ? 182 ASN A CB    1 
ATOM   1373  C  CG    . ASN A 1 182 ? -25.752 14.178 -17.890 1.00 133.35 ? 182 ASN A CG    1 
ATOM   1374  O  OD1   . ASN A 1 182 ? -26.002 14.925 -16.936 1.00 135.47 ? 182 ASN A OD1   1 
ATOM   1375  N  ND2   . ASN A 1 182 ? -26.417 13.049 -18.111 1.00 147.24 ? 182 ASN A ND2   1 
ATOM   1376  N  N     . LEU A 1 183 ? -24.318 17.382 -16.770 1.00 128.05 ? 183 LEU A N     1 
ATOM   1377  C  CA    . LEU A 1 183 ? -23.935 17.781 -15.410 1.00 119.50 ? 183 LEU A CA    1 
ATOM   1378  C  C     . LEU A 1 183 ? -23.695 16.609 -14.460 1.00 122.83 ? 183 LEU A C     1 
ATOM   1379  O  O     . LEU A 1 183 ? -22.676 16.587 -13.769 1.00 118.42 ? 183 LEU A O     1 
ATOM   1380  C  CB    . LEU A 1 183 ? -24.954 18.747 -14.785 1.00 112.65 ? 183 LEU A CB    1 
ATOM   1381  C  CG    . LEU A 1 183 ? -24.468 19.289 -13.424 1.00 110.03 ? 183 LEU A CG    1 
ATOM   1382  C  CD1   . LEU A 1 183 ? -24.829 20.759 -13.202 1.00 100.67 ? 183 LEU A CD1   1 
ATOM   1383  C  CD2   . LEU A 1 183 ? -24.920 18.434 -12.245 1.00 107.85 ? 183 LEU A CD2   1 
ATOM   1384  N  N     . ALA A 1 184 ? -24.617 15.644 -14.431 1.00 135.98 ? 184 ALA A N     1 
ATOM   1385  C  CA    . ALA A 1 184 ? -24.464 14.452 -13.585 1.00 130.92 ? 184 ALA A CA    1 
ATOM   1386  C  C     . ALA A 1 184 ? -23.134 13.744 -13.855 1.00 122.10 ? 184 ALA A C     1 
ATOM   1387  O  O     . ALA A 1 184 ? -22.239 13.701 -13.008 1.00 121.85 ? 184 ALA A O     1 
ATOM   1388  C  CB    . ALA A 1 184 ? -25.612 13.479 -13.838 1.00 119.12 ? 184 ALA A CB    1 
ATOM   1389  N  N     . GLU A 1 185 ? -23.009 13.215 -15.060 1.00 115.33 ? 185 GLU A N     1 
ATOM   1390  C  CA    . GLU A 1 185 ? -21.818 12.495 -15.477 1.00 130.15 ? 185 GLU A CA    1 
ATOM   1391  C  C     . GLU A 1 185 ? -20.525 13.277 -15.232 1.00 132.85 ? 185 GLU A C     1 
ATOM   1392  O  O     . GLU A 1 185 ? -19.507 12.703 -14.850 1.00 145.25 ? 185 GLU A O     1 
ATOM   1393  C  CB    . GLU A 1 185 ? -21.973 12.095 -16.946 1.00 132.54 ? 185 GLU A CB    1 
ATOM   1394  C  CG    . GLU A 1 185 ? -23.448 11.899 -17.281 1.00 153.48 ? 185 GLU A CG    1 
ATOM   1395  C  CD    . GLU A 1 185 ? -23.712 11.126 -18.558 1.00 164.01 ? 185 GLU A CD    1 
ATOM   1396  O  OE1   . GLU A 1 185 ? -23.111 11.473 -19.604 1.00 155.01 ? 185 GLU A OE1   1 
ATOM   1397  O  OE2   . GLU A 1 185 ? -24.549 10.185 -18.504 1.00 169.18 ? 185 GLU A OE2   1 
ATOM   1398  N  N     . VAL A 1 186 ? -20.547 14.583 -15.443 1.00 126.25 ? 186 VAL A N     1 
ATOM   1399  C  CA    . VAL A 1 186 ? -19.323 15.339 -15.249 1.00 125.67 ? 186 VAL A CA    1 
ATOM   1400  C  C     . VAL A 1 186 ? -18.875 15.249 -13.814 1.00 126.05 ? 186 VAL A C     1 
ATOM   1401  O  O     . VAL A 1 186 ? -17.732 14.892 -13.527 1.00 129.68 ? 186 VAL A O     1 
ATOM   1402  C  CB    . VAL A 1 186 ? -19.503 16.809 -15.521 1.00 120.41 ? 186 VAL A CB    1 
ATOM   1403  C  CG1   . VAL A 1 186 ? -18.246 17.541 -15.091 1.00 102.05 ? 186 VAL A CG1   1 
ATOM   1404  C  CG2   . VAL A 1 186 ? -19.790 17.024 -16.984 1.00 130.97 ? 186 VAL A CG2   1 
ATOM   1405  N  N     . ILE A 1 187 ? -19.789 15.590 -12.913 1.00 125.81 ? 187 ILE A N     1 
ATOM   1406  C  CA    . ILE A 1 187 ? -19.489 15.601 -11.492 1.00 129.81 ? 187 ILE A CA    1 
ATOM   1407  C  C     . ILE A 1 187 ? -18.986 14.231 -11.042 1.00 131.21 ? 187 ILE A C     1 
ATOM   1408  O  O     . ILE A 1 187 ? -18.095 14.151 -10.201 1.00 137.68 ? 187 ILE A O     1 
ATOM   1409  C  CB    . ILE A 1 187 ? -20.704 16.081 -10.663 1.00 121.29 ? 187 ILE A CB    1 
ATOM   1410  C  CG1   . ILE A 1 187 ? -21.118 17.477 -11.120 1.00 116.91 ? 187 ILE A CG1   1 
ATOM   1411  C  CG2   . ILE A 1 187 ? -20.389 16.114 -9.183  1.00 110.68 ? 187 ILE A CG2   1 
ATOM   1412  C  CD1   . ILE A 1 187 ? -22.208 18.077 -10.289 1.00 118.91 ? 187 ILE A CD1   1 
ATOM   1413  N  N     . ASP A 1 188 ? -19.542 13.161 -11.611 1.00 119.33 ? 188 ASP A N     1 
ATOM   1414  C  CA    . ASP A 1 188 ? -19.045 11.814 -11.332 1.00 133.04 ? 188 ASP A CA    1 
ATOM   1415  C  C     . ASP A 1 188 ? -17.549 11.762 -11.588 1.00 131.76 ? 188 ASP A C     1 
ATOM   1416  O  O     . ASP A 1 188 ? -16.766 11.308 -10.750 1.00 128.23 ? 188 ASP A O     1 
ATOM   1417  C  CB    . ASP A 1 188 ? -19.703 10.781 -12.251 1.00 145.96 ? 188 ASP A CB    1 
ATOM   1418  C  CG    . ASP A 1 188 ? -21.164 10.581 -11.959 1.00 151.28 ? 188 ASP A CG    1 
ATOM   1419  O  OD1   . ASP A 1 188 ? -21.613 10.962 -10.860 1.00 147.27 ? 188 ASP A OD1   1 
ATOM   1420  O  OD2   . ASP A 1 188 ? -21.865 10.034 -12.836 1.00 159.83 ? 188 ASP A OD2   1 
ATOM   1421  N  N     . ALA A 1 189 ? -17.164 12.224 -12.770 1.00 133.77 ? 189 ALA A N     1 
ATOM   1422  C  CA    . ALA A 1 189 ? -15.773 12.226 -13.168 1.00 129.03 ? 189 ALA A CA    1 
ATOM   1423  C  C     . ALA A 1 189 ? -14.974 12.987 -12.124 1.00 128.25 ? 189 ALA A C     1 
ATOM   1424  O  O     . ALA A 1 189 ? -13.971 12.493 -11.606 1.00 128.84 ? 189 ALA A O     1 
ATOM   1425  C  CB    . ALA A 1 189 ? -15.633 12.876 -14.533 1.00 116.17 ? 189 ALA A CB    1 
ATOM   1426  N  N     . ALA A 1 190 ? -15.451 14.184 -11.801 1.00 133.14 ? 190 ALA A N     1 
ATOM   1427  C  CA    . ALA A 1 190 ? -14.794 15.044 -10.825 1.00 135.03 ? 190 ALA A CA    1 
ATOM   1428  C  C     . ALA A 1 190 ? -14.540 14.305 -9.518  1.00 128.93 ? 190 ALA A C     1 
ATOM   1429  O  O     . ALA A 1 190 ? -13.407 14.216 -9.048  1.00 119.85 ? 190 ALA A O     1 
ATOM   1430  C  CB    . ALA A 1 190 ? -15.647 16.292 -10.561 1.00 124.71 ? 190 ALA A CB    1 
ATOM   1431  N  N     . VAL A 1 191 ? -15.598 13.771 -8.932  1.00 118.62 ? 191 VAL A N     1 
ATOM   1432  C  CA    . VAL A 1 191 ? -15.458 13.090 -7.664  1.00 123.41 ? 191 VAL A CA    1 
ATOM   1433  C  C     . VAL A 1 191 ? -14.475 11.934 -7.770  1.00 132.41 ? 191 VAL A C     1 
ATOM   1434  O  O     . VAL A 1 191 ? -13.636 11.753 -6.890  1.00 140.37 ? 191 VAL A O     1 
ATOM   1435  C  CB    . VAL A 1 191 ? -16.801 12.611 -7.140  1.00 133.08 ? 191 VAL A CB    1 
ATOM   1436  C  CG1   . VAL A 1 191 ? -16.682 12.219 -5.674  1.00 134.64 ? 191 VAL A CG1   1 
ATOM   1437  C  CG2   . VAL A 1 191 ? -17.810 13.719 -7.295  1.00 136.55 ? 191 VAL A CG2   1 
ATOM   1438  N  N     . TYR A 1 192 ? -14.560 11.151 -8.840  1.00 139.36 ? 192 TYR A N     1 
ATOM   1439  C  CA    . TYR A 1 192 ? -13.635 10.038 -8.971  1.00 137.90 ? 192 TYR A CA    1 
ATOM   1440  C  C     . TYR A 1 192 ? -12.202 10.541 -8.931  1.00 135.05 ? 192 TYR A C     1 
ATOM   1441  O  O     . TYR A 1 192 ? -11.384 10.017 -8.181  1.00 145.07 ? 192 TYR A O     1 
ATOM   1442  C  CB    . TYR A 1 192 ? -13.863 9.231  -10.239 1.00 139.94 ? 192 TYR A CB    1 
ATOM   1443  C  CG    . TYR A 1 192 ? -12.963 8.009  -10.297 1.00 159.13 ? 192 TYR A CG    1 
ATOM   1444  C  CD1   . TYR A 1 192 ? -11.612 8.127  -10.620 1.00 167.15 ? 192 TYR A CD1   1 
ATOM   1445  C  CD2   . TYR A 1 192 ? -13.453 6.739  -10.006 1.00 159.79 ? 192 TYR A CD2   1 
ATOM   1446  C  CE1   . TYR A 1 192 ? -10.779 7.011  -10.666 1.00 162.06 ? 192 TYR A CE1   1 
ATOM   1447  C  CE2   . TYR A 1 192 ? -12.627 5.620  -10.056 1.00 160.06 ? 192 TYR A CE2   1 
ATOM   1448  C  CZ    . TYR A 1 192 ? -11.294 5.765  -10.389 1.00 156.95 ? 192 TYR A CZ    1 
ATOM   1449  O  OH    . TYR A 1 192 ? -10.469 4.666  -10.440 1.00 153.64 ? 192 TYR A OH    1 
ATOM   1450  N  N     . MET A 1 193 ? -11.900 11.553 -9.737  1.00 127.29 ? 193 MET A N     1 
ATOM   1451  C  CA    . MET A 1 193 ? -10.565 12.154 -9.740  1.00 137.22 ? 193 MET A CA    1 
ATOM   1452  C  C     . MET A 1 193 ? -10.159 12.684 -8.366  1.00 146.68 ? 193 MET A C     1 
ATOM   1453  O  O     . MET A 1 193 ? -9.001  12.568 -7.961  1.00 154.64 ? 193 MET A O     1 
ATOM   1454  C  CB    . MET A 1 193 ? -10.451 13.281 -10.776 1.00 134.66 ? 193 MET A CB    1 
ATOM   1455  C  CG    . MET A 1 193 ? -9.987  12.830 -12.152 1.00 131.90 ? 193 MET A CG    1 
ATOM   1456  S  SD    . MET A 1 193 ? -9.288  14.191 -13.102 1.00 208.94 ? 193 MET A SD    1 
ATOM   1457  C  CE    . MET A 1 193 ? -7.764  14.483 -12.204 1.00 148.98 ? 193 MET A CE    1 
ATOM   1458  N  N     . ILE A 1 194 ? -11.109 13.280 -7.657  1.00 140.88 ? 194 ILE A N     1 
ATOM   1459  C  CA    . ILE A 1 194 ? -10.827 13.809 -6.334  1.00 143.03 ? 194 ILE A CA    1 
ATOM   1460  C  C     . ILE A 1 194 ? -10.194 12.731 -5.462  1.00 145.50 ? 194 ILE A C     1 
ATOM   1461  O  O     . ILE A 1 194 ? -9.243  12.994 -4.729  1.00 154.07 ? 194 ILE A O     1 
ATOM   1462  C  CB    . ILE A 1 194 ? -12.105 14.341 -5.671  1.00 147.38 ? 194 ILE A CB    1 
ATOM   1463  C  CG1   . ILE A 1 194 ? -12.728 15.442 -6.541  1.00 149.85 ? 194 ILE A CG1   1 
ATOM   1464  C  CG2   . ILE A 1 194 ? -11.809 14.835 -4.252  1.00 141.23 ? 194 ILE A CG2   1 
ATOM   1465  C  CD1   . ILE A 1 194 ? -14.114 15.895 -6.094  1.00 148.01 ? 194 ILE A CD1   1 
ATOM   1466  N  N     . ASP A 1 195 ? -10.745 11.523 -5.531  1.00 142.19 ? 195 ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 195 ? -10.168 10.377 -4.838  1.00 150.19 ? 195 ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 195 ? -8.919  9.777  -5.515  1.00 160.12 ? 195 ASP A C     1 
ATOM   1469  O  O     . ASP A 1 195 ? -7.865  9.703  -4.887  1.00 170.24 ? 195 ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 195 ? -11.241 9.325  -4.575  1.00 155.05 ? 195 ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 195 ? -12.159 9.719  -3.423  1.00 165.31 ? 195 ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 195 ? -11.651 10.314 -2.446  1.00 161.05 ? 195 ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 195 ? -13.379 9.445  -3.489  1.00 173.56 ? 195 ASP A OD2   1 
ATOM   1474  N  N     . HIS A 1 196 ? -9.053  9.304  -6.758  1.00 155.75 ? 196 HIS A N     1 
ATOM   1475  C  CA    . HIS A 1 196 ? -7.923  8.790  -7.561  1.00 153.36 ? 196 HIS A CA    1 
ATOM   1476  C  C     . HIS A 1 196 ? -7.311  9.772  -8.578  1.00 140.18 ? 196 HIS A C     1 
ATOM   1477  O  O     . HIS A 1 196 ? -7.531  9.632  -9.780  1.00 125.07 ? 196 HIS A O     1 
ATOM   1478  C  CB    . HIS A 1 196 ? -8.379  7.569  -8.335  1.00 149.94 ? 196 HIS A CB    1 
ATOM   1479  C  CG    . HIS A 1 196 ? -9.235  6.657  -7.532  1.00 155.73 ? 196 HIS A CG    1 
ATOM   1480  N  ND1   . HIS A 1 196 ? -10.406 7.077  -6.941  1.00 168.16 ? 196 HIS A ND1   1 
ATOM   1481  C  CD2   . HIS A 1 196 ? -9.092  5.354  -7.206  1.00 168.52 ? 196 HIS A CD2   1 
ATOM   1482  C  CE1   . HIS A 1 196 ? -10.952 6.068  -6.287  1.00 182.02 ? 196 HIS A CE1   1 
ATOM   1483  N  NE2   . HIS A 1 196 ? -10.176 5.009  -6.433  1.00 184.55 ? 196 HIS A NE2   1 
ATOM   1484  N  N     . PRO A 1 197 ? -6.515  10.741 -8.111  1.00 141.83 ? 197 PRO A N     1 
ATOM   1485  C  CA    . PRO A 1 197 ? -5.982  11.812 -8.957  1.00 140.39 ? 197 PRO A CA    1 
ATOM   1486  C  C     . PRO A 1 197 ? -5.221  11.336 -10.185 1.00 147.69 ? 197 PRO A C     1 
ATOM   1487  O  O     . PRO A 1 197 ? -5.355  11.925 -11.258 1.00 135.42 ? 197 PRO A O     1 
ATOM   1488  C  CB    . PRO A 1 197 ? -5.009  12.514 -8.018  1.00 139.66 ? 197 PRO A CB    1 
ATOM   1489  C  CG    . PRO A 1 197 ? -5.612  12.321 -6.679  1.00 141.65 ? 197 PRO A CG    1 
ATOM   1490  C  CD    . PRO A 1 197 ? -6.106  10.915 -6.710  1.00 150.20 ? 197 PRO A CD    1 
ATOM   1491  N  N     . THR A 1 198 ? -4.417  10.294 -10.019 1.00 169.56 ? 198 THR A N     1 
ATOM   1492  C  CA    . THR A 1 198 ? -3.597  9.770  -11.107 1.00 177.87 ? 198 THR A CA    1 
ATOM   1493  C  C     . THR A 1 198 ? -4.439  9.037  -12.153 1.00 170.79 ? 198 THR A C     1 
ATOM   1494  O  O     . THR A 1 198 ? -3.965  8.096  -12.795 1.00 169.59 ? 198 THR A O     1 
ATOM   1495  C  CB    . THR A 1 198 ? -2.556  8.796  -10.541 1.00 183.85 ? 198 THR A CB    1 
ATOM   1496  O  OG1   . THR A 1 198 ? -3.054  8.245  -9.310  1.00 178.69 ? 198 THR A OG1   1 
ATOM   1497  C  CG2   . THR A 1 198 ? -1.241  9.523  -10.279 1.00 184.90 ? 198 THR A CG2   1 
ATOM   1498  N  N     . ALA A 1 199 ? -5.680  9.484  -12.328 1.00 149.95 ? 199 ALA A N     1 
ATOM   1499  C  CA    . ALA A 1 199 ? -6.663  8.760  -13.126 1.00 130.70 ? 199 ALA A CA    1 
ATOM   1500  C  C     . ALA A 1 199 ? -6.361  8.779  -14.617 1.00 146.47 ? 199 ALA A C     1 
ATOM   1501  O  O     . ALA A 1 199 ? -5.983  9.812  -15.179 1.00 150.29 ? 199 ALA A O     1 
ATOM   1502  C  CB    . ALA A 1 199 ? -8.050  9.297  -12.859 1.00 123.13 ? 199 ALA A CB    1 
ATOM   1503  N  N     . LYS A 1 200 ? -6.532  7.623  -15.251 1.00 158.71 ? 200 LYS A N     1 
ATOM   1504  C  CA    . LYS A 1 200 ? -6.346  7.499  -16.691 1.00 160.32 ? 200 LYS A CA    1 
ATOM   1505  C  C     . LYS A 1 200 ? -7.664  7.802  -17.396 1.00 149.94 ? 200 LYS A C     1 
ATOM   1506  O  O     . LYS A 1 200 ? -8.740  7.602  -16.827 1.00 140.20 ? 200 LYS A O     1 
ATOM   1507  C  CB    . LYS A 1 200 ? -5.850  6.090  -17.047 1.00 160.33 ? 200 LYS A CB    1 
ATOM   1508  N  N     . ILE A 1 201 ? -7.576  8.288  -18.630 1.00 141.59 ? 201 ILE A N     1 
ATOM   1509  C  CA    . ILE A 1 201 ? -8.766  8.653  -19.387 1.00 142.18 ? 201 ILE A CA    1 
ATOM   1510  C  C     . ILE A 1 201 ? -9.763  7.513  -19.555 1.00 153.61 ? 201 ILE A C     1 
ATOM   1511  O  O     . ILE A 1 201 ? -10.967 7.712  -19.430 1.00 150.15 ? 201 ILE A O     1 
ATOM   1512  C  CB    . ILE A 1 201 ? -8.412  9.154  -20.773 1.00 142.66 ? 201 ILE A CB    1 
ATOM   1513  C  CG1   . ILE A 1 201 ? -7.928  10.589 -20.696 1.00 160.37 ? 201 ILE A CG1   1 
ATOM   1514  C  CG2   . ILE A 1 201 ? -9.625  9.101  -21.691 1.00 134.72 ? 201 ILE A CG2   1 
ATOM   1515  C  CD1   . ILE A 1 201 ? -8.127  11.335 -21.999 1.00 173.79 ? 201 ILE A CD1   1 
ATOM   1516  N  N     . ASP A 1 202 ? -9.268  6.318  -19.842 1.00 167.19 ? 202 ASP A N     1 
ATOM   1517  C  CA    . ASP A 1 202 ? -10.152 5.173  -20.025 1.00 178.71 ? 202 ASP A CA    1 
ATOM   1518  C  C     . ASP A 1 202 ? -11.155 5.034  -18.875 1.00 166.16 ? 202 ASP A C     1 
ATOM   1519  O  O     . ASP A 1 202 ? -12.354 4.877  -19.105 1.00 156.34 ? 202 ASP A O     1 
ATOM   1520  C  CB    . ASP A 1 202 ? -9.335  3.891  -20.181 1.00 197.77 ? 202 ASP A CB    1 
ATOM   1521  C  CG    . ASP A 1 202 ? -8.413  3.933  -21.382 1.00 204.62 ? 202 ASP A CG    1 
ATOM   1522  O  OD1   . ASP A 1 202 ? -8.698  4.706  -22.322 1.00 198.76 ? 202 ASP A OD1   1 
ATOM   1523  O  OD2   . ASP A 1 202 ? -7.408  3.189  -21.383 1.00 210.23 ? 202 ASP A OD2   1 
ATOM   1524  N  N     . LYS A 1 203 ? -10.664 5.080  -17.640 1.00 159.34 ? 203 LYS A N     1 
ATOM   1525  C  CA    . LYS A 1 203 ? -11.541 4.989  -16.475 1.00 163.97 ? 203 LYS A CA    1 
ATOM   1526  C  C     . LYS A 1 203 ? -12.465 6.201  -16.358 1.00 165.82 ? 203 LYS A C     1 
ATOM   1527  O  O     . LYS A 1 203 ? -13.640 6.061  -16.022 1.00 178.32 ? 203 LYS A O     1 
ATOM   1528  C  CB    . LYS A 1 203 ? -10.755 4.783  -15.168 1.00 160.16 ? 203 LYS A CB    1 
ATOM   1529  N  N     . LEU A 1 204 ? -11.934 7.393  -16.600 1.00 148.62 ? 204 LEU A N     1 
ATOM   1530  C  CA    . LEU A 1 204 ? -12.752 8.590  -16.485 1.00 136.23 ? 204 LEU A CA    1 
ATOM   1531  C  C     . LEU A 1 204 ? -13.916 8.511  -17.452 1.00 142.06 ? 204 LEU A C     1 
ATOM   1532  O  O     . LEU A 1 204 ? -15.012 8.983  -17.161 1.00 153.40 ? 204 LEU A O     1 
ATOM   1533  C  CB    . LEU A 1 204 ? -11.930 9.840  -16.758 1.00 124.99 ? 204 LEU A CB    1 
ATOM   1534  C  CG    . LEU A 1 204 ? -11.096 10.334 -15.582 1.00 135.98 ? 204 LEU A CG    1 
ATOM   1535  C  CD1   . LEU A 1 204 ? -10.206 11.486 -16.018 1.00 148.34 ? 204 LEU A CD1   1 
ATOM   1536  C  CD2   . LEU A 1 204 ? -11.998 10.754 -14.439 1.00 136.84 ? 204 LEU A CD2   1 
ATOM   1537  N  N     . MET A 1 205 ? -13.656 7.918  -18.611 1.00 130.15 ? 205 MET A N     1 
ATOM   1538  C  CA    . MET A 1 205 ? -14.646 7.756  -19.665 1.00 130.53 ? 205 MET A CA    1 
ATOM   1539  C  C     . MET A 1 205 ? -15.855 6.950  -19.217 1.00 144.24 ? 205 MET A C     1 
ATOM   1540  O  O     . MET A 1 205 ? -16.966 7.167  -19.695 1.00 144.83 ? 205 MET A O     1 
ATOM   1541  C  CB    . MET A 1 205 ? -13.987 7.113  -20.868 1.00 133.72 ? 205 MET A CB    1 
ATOM   1542  C  CG    . MET A 1 205 ? -13.114 8.070  -21.607 1.00 112.26 ? 205 MET A CG    1 
ATOM   1543  S  SD    . MET A 1 205 ? -14.124 8.903  -22.808 1.00 171.13 ? 205 MET A SD    1 
ATOM   1544  C  CE    . MET A 1 205 ? -13.476 8.159  -24.291 1.00 97.70  ? 205 MET A CE    1 
ATOM   1545  N  N     . GLU A 1 206 ? -15.626 5.997  -18.321 1.00 160.37 ? 206 GLU A N     1 
ATOM   1546  C  CA    . GLU A 1 206 ? -16.713 5.257  -17.691 1.00 166.58 ? 206 GLU A CA    1 
ATOM   1547  C  C     . GLU A 1 206 ? -17.710 6.218  -17.043 1.00 160.47 ? 206 GLU A C     1 
ATOM   1548  O  O     . GLU A 1 206 ? -18.915 5.964  -17.053 1.00 165.11 ? 206 GLU A O     1 
ATOM   1549  C  CB    . GLU A 1 206 ? -16.183 4.246  -16.666 1.00 165.74 ? 206 GLU A CB    1 
ATOM   1550  N  N     . PHE A 1 207 ? -17.203 7.294  -16.445 1.00 150.17 ? 207 PHE A N     1 
ATOM   1551  C  CA    . PHE A 1 207 ? -18.059 8.381  -15.957 1.00 154.26 ? 207 PHE A CA    1 
ATOM   1552  C  C     . PHE A 1 207 ? -18.510 9.397  -17.029 1.00 149.68 ? 207 PHE A C     1 
ATOM   1553  O  O     . PHE A 1 207 ? -19.688 9.431  -17.376 1.00 141.81 ? 207 PHE A O     1 
ATOM   1554  C  CB    . PHE A 1 207 ? -17.395 9.082  -14.775 1.00 159.38 ? 207 PHE A CB    1 
ATOM   1555  C  CG    . PHE A 1 207 ? -17.147 8.168  -13.612 1.00 161.35 ? 207 PHE A CG    1 
ATOM   1556  C  CD1   . PHE A 1 207 ? -15.945 7.494  -13.489 1.00 150.23 ? 207 PHE A CD1   1 
ATOM   1557  C  CD2   . PHE A 1 207 ? -18.134 7.961  -12.656 1.00 162.12 ? 207 PHE A CD2   1 
ATOM   1558  C  CE1   . PHE A 1 207 ? -15.726 6.652  -12.427 1.00 143.66 ? 207 PHE A CE1   1 
ATOM   1559  C  CE2   . PHE A 1 207 ? -17.924 7.109  -11.592 1.00 153.57 ? 207 PHE A CE2   1 
ATOM   1560  C  CZ    . PHE A 1 207 ? -16.720 6.453  -11.478 1.00 147.79 ? 207 PHE A CZ    1 
ATOM   1561  N  N     . LEU A 1 208 ? -17.597 10.251 -17.506 1.00 154.10 ? 208 LEU A N     1 
ATOM   1562  C  CA    . LEU A 1 208 ? -17.866 11.137 -18.654 1.00 156.91 ? 208 LEU A CA    1 
ATOM   1563  C  C     . LEU A 1 208 ? -17.585 10.427 -19.989 1.00 155.27 ? 208 LEU A C     1 
ATOM   1564  O  O     . LEU A 1 208 ? -16.447 10.414 -20.458 1.00 162.36 ? 208 LEU A O     1 
ATOM   1565  C  CB    . LEU A 1 208 ? -17.098 12.485 -18.569 1.00 93.74  ? 208 LEU A CB    1 
ATOM   1566  N  N     . PRO A 1 209 ? -18.626 9.839  -20.606 1.00 139.09 ? 209 PRO A N     1 
ATOM   1567  C  CA    . PRO A 1 209 ? -18.529 9.065  -21.846 1.00 130.37 ? 209 PRO A CA    1 
ATOM   1568  C  C     . PRO A 1 209 ? -18.710 9.895  -23.104 1.00 135.66 ? 209 PRO A C     1 
ATOM   1569  O  O     . PRO A 1 209 ? -19.101 9.339  -24.122 1.00 147.01 ? 209 PRO A O     1 
ATOM   1570  C  CB    . PRO A 1 209 ? -19.740 8.127  -21.756 1.00 125.51 ? 209 PRO A CB    1 
ATOM   1571  C  CG    . PRO A 1 209 ? -20.388 8.391  -20.410 1.00 119.59 ? 209 PRO A CG    1 
ATOM   1572  C  CD    . PRO A 1 209 ? -19.977 9.756  -20.039 1.00 129.61 ? 209 PRO A CD    1 
ATOM   1573  N  N     . GLY A 1 210 ? -18.458 11.193 -23.050 1.00 136.30 ? 210 GLY A N     1 
ATOM   1574  C  CA    . GLY A 1 210 ? -18.678 12.017 -24.222 1.00 139.87 ? 210 GLY A CA    1 
ATOM   1575  C  C     . GLY A 1 210 ? -19.824 12.995 -24.059 1.00 138.89 ? 210 GLY A C     1 
ATOM   1576  O  O     . GLY A 1 210 ? -20.607 12.899 -23.115 1.00 146.07 ? 210 GLY A O     1 
ATOM   1577  N  N     . PRO A 1 211 ? -19.940 13.934 -25.005 1.00 129.74 ? 211 PRO A N     1 
ATOM   1578  C  CA    . PRO A 1 211 ? -20.826 15.106 -24.972 1.00 128.05 ? 211 PRO A CA    1 
ATOM   1579  C  C     . PRO A 1 211 ? -22.289 14.777 -24.706 1.00 127.88 ? 211 PRO A C     1 
ATOM   1580  O  O     . PRO A 1 211 ? -22.736 13.672 -24.993 1.00 130.43 ? 211 PRO A O     1 
ATOM   1581  C  CB    . PRO A 1 211 ? -20.702 15.678 -26.389 1.00 130.18 ? 211 PRO A CB    1 
ATOM   1582  C  CG    . PRO A 1 211 ? -19.422 15.157 -26.902 1.00 133.32 ? 211 PRO A CG    1 
ATOM   1583  C  CD    . PRO A 1 211 ? -19.218 13.817 -26.281 1.00 129.23 ? 211 PRO A CD    1 
ATOM   1584  N  N     . ASP A 1 212 ? -23.024 15.745 -24.172 1.00 130.18 ? 212 ASP A N     1 
ATOM   1585  C  CA    . ASP A 1 212 ? -24.476 15.655 -24.112 1.00 140.54 ? 212 ASP A CA    1 
ATOM   1586  C  C     . ASP A 1 212 ? -25.106 16.930 -24.686 1.00 150.49 ? 212 ASP A C     1 
ATOM   1587  O  O     . ASP A 1 212 ? -25.143 17.969 -24.020 1.00 148.93 ? 212 ASP A O     1 
ATOM   1588  C  CB    . ASP A 1 212 ? -24.949 15.422 -22.679 1.00 141.90 ? 212 ASP A CB    1 
ATOM   1589  C  CG    . ASP A 1 212 ? -26.351 14.836 -22.620 1.00 141.62 ? 212 ASP A CG    1 
ATOM   1590  O  OD1   . ASP A 1 212 ? -26.816 14.324 -23.665 1.00 140.09 ? 212 ASP A OD1   1 
ATOM   1591  O  OD2   . ASP A 1 212 ? -26.983 14.877 -21.535 1.00 136.55 ? 212 ASP A OD2   1 
ATOM   1592  N  N     . PHE A 1 213 ? -25.588 16.854 -25.927 1.00 156.23 ? 213 PHE A N     1 
ATOM   1593  C  CA    . PHE A 1 213 ? -26.191 18.015 -26.584 1.00 141.50 ? 213 PHE A CA    1 
ATOM   1594  C  C     . PHE A 1 213 ? -27.618 18.245 -26.107 1.00 130.36 ? 213 PHE A C     1 
ATOM   1595  O  O     . PHE A 1 213 ? -28.398 17.303 -25.988 1.00 121.65 ? 213 PHE A O     1 
ATOM   1596  C  CB    . PHE A 1 213 ? -26.169 17.876 -28.111 1.00 132.43 ? 213 PHE A CB    1 
ATOM   1597  C  CG    . PHE A 1 213 ? -24.788 17.806 -28.696 1.00 125.02 ? 213 PHE A CG    1 
ATOM   1598  C  CD1   . PHE A 1 213 ? -23.896 18.850 -28.524 1.00 130.09 ? 213 PHE A CD1   1 
ATOM   1599  C  CD2   . PHE A 1 213 ? -24.382 16.698 -29.424 1.00 119.85 ? 213 PHE A CD2   1 
ATOM   1600  C  CE1   . PHE A 1 213 ? -22.618 18.787 -29.070 1.00 137.00 ? 213 PHE A CE1   1 
ATOM   1601  C  CE2   . PHE A 1 213 ? -23.107 16.626 -29.968 1.00 119.66 ? 213 PHE A CE2   1 
ATOM   1602  C  CZ    . PHE A 1 213 ? -22.224 17.669 -29.794 1.00 128.21 ? 213 PHE A CZ    1 
ATOM   1603  N  N     . PRO A 1 214 ? -27.963 19.512 -25.843 1.00 128.02 ? 214 PRO A N     1 
ATOM   1604  C  CA    . PRO A 1 214 ? -29.283 19.901 -25.344 1.00 124.23 ? 214 PRO A CA    1 
ATOM   1605  C  C     . PRO A 1 214 ? -30.325 19.615 -26.405 1.00 137.32 ? 214 PRO A C     1 
ATOM   1606  O  O     . PRO A 1 214 ? -31.516 19.541 -26.114 1.00 148.77 ? 214 PRO A O     1 
ATOM   1607  C  CB    . PRO A 1 214 ? -29.161 21.415 -25.167 1.00 111.71 ? 214 PRO A CB    1 
ATOM   1608  C  CG    . PRO A 1 214 ? -27.699 21.719 -25.269 1.00 108.80 ? 214 PRO A CG    1 
ATOM   1609  C  CD    . PRO A 1 214 ? -27.137 20.682 -26.162 1.00 121.77 ? 214 PRO A CD    1 
ATOM   1610  N  N     . THR A 1 215 ? -29.861 19.464 -27.639 1.00 132.66 ? 215 THR A N     1 
ATOM   1611  C  CA    . THR A 1 215 ? -30.743 19.243 -28.765 1.00 133.72 ? 215 THR A CA    1 
ATOM   1612  C  C     . THR A 1 215 ? -30.948 17.758 -28.989 1.00 145.12 ? 215 THR A C     1 
ATOM   1613  O  O     . THR A 1 215 ? -31.466 17.340 -30.026 1.00 153.55 ? 215 THR A O     1 
ATOM   1614  C  CB    . THR A 1 215 ? -30.116 19.801 -30.014 1.00 132.31 ? 215 THR A CB    1 
ATOM   1615  O  OG1   . THR A 1 215 ? -28.880 19.110 -30.260 1.00 148.50 ? 215 THR A OG1   1 
ATOM   1616  C  CG2   . THR A 1 215 ? -29.848 21.270 -29.830 1.00 116.96 ? 215 THR A CG2   1 
ATOM   1617  N  N     . GLY A 1 216 ? -30.526 16.958 -28.017 1.00 141.54 ? 216 GLY A N     1 
ATOM   1618  C  CA    . GLY A 1 216 ? -30.607 15.516 -28.143 1.00 141.37 ? 216 GLY A CA    1 
ATOM   1619  C  C     . GLY A 1 216 ? -29.627 14.986 -29.167 1.00 130.34 ? 216 GLY A C     1 
ATOM   1620  O  O     . GLY A 1 216 ? -28.445 15.314 -29.113 1.00 131.70 ? 216 GLY A O     1 
ATOM   1621  N  N     . ALA A 1 217 ? -30.122 14.154 -30.082 1.00 131.44 ? 217 ALA A N     1 
ATOM   1622  C  CA    . ALA A 1 217 ? -29.337 13.641 -31.212 1.00 146.76 ? 217 ALA A CA    1 
ATOM   1623  C  C     . ALA A 1 217 ? -28.499 12.391 -30.918 1.00 141.66 ? 217 ALA A C     1 
ATOM   1624  O  O     . ALA A 1 217 ? -28.389 11.942 -29.773 1.00 141.89 ? 217 ALA A O     1 
ATOM   1625  C  CB    . ALA A 1 217 ? -28.481 14.738 -31.826 1.00 164.51 ? 217 ALA A CB    1 
ATOM   1626  N  N     . ILE A 1 218 ? -27.919 11.832 -31.974 1.00 138.39 ? 218 ILE A N     1 
ATOM   1627  C  CA    . ILE A 1 218 ? -27.130 10.614 -31.864 1.00 146.29 ? 218 ILE A CA    1 
ATOM   1628  C  C     . ILE A 1 218 ? -25.664 10.904 -32.145 1.00 148.19 ? 218 ILE A C     1 
ATOM   1629  O  O     . ILE A 1 218 ? -25.334 11.539 -33.145 1.00 148.95 ? 218 ILE A O     1 
ATOM   1630  C  CB    . ILE A 1 218 ? -27.597 9.587  -32.889 1.00 146.46 ? 218 ILE A CB    1 
ATOM   1631  C  CG1   . ILE A 1 218 ? -29.111 9.371  -32.781 1.00 155.58 ? 218 ILE A CG1   1 
ATOM   1632  C  CG2   . ILE A 1 218 ? -26.828 8.306  -32.708 1.00 144.34 ? 218 ILE A CG2   1 
ATOM   1633  C  CD1   . ILE A 1 218 ? -29.697 8.484  -33.886 1.00 163.74 ? 218 ILE A CD1   1 
ATOM   1634  N  N     . ILE A 1 219 ? -24.783 10.421 -31.274 1.00 140.57 ? 219 ILE A N     1 
ATOM   1635  C  CA    . ILE A 1 219 ? -23.358 10.694 -31.409 1.00 136.33 ? 219 ILE A CA    1 
ATOM   1636  C  C     . ILE A 1 219 ? -22.597 9.410  -31.591 1.00 140.79 ? 219 ILE A C     1 
ATOM   1637  O  O     . ILE A 1 219 ? -22.609 8.556  -30.714 1.00 150.02 ? 219 ILE A O     1 
ATOM   1638  C  CB    . ILE A 1 219 ? -22.742 11.316 -30.161 1.00 132.65 ? 219 ILE A CB    1 
ATOM   1639  C  CG1   . ILE A 1 219 ? -23.230 12.749 -29.925 1.00 130.90 ? 219 ILE A CG1   1 
ATOM   1640  C  CG2   . ILE A 1 219 ? -21.240 11.304 -30.311 1.00 129.20 ? 219 ILE A CG2   1 
ATOM   1641  C  CD1   . ILE A 1 219 ? -22.627 13.389 -28.675 1.00 119.28 ? 219 ILE A CD1   1 
ATOM   1642  N  N     . GLN A 1 220 ? -21.906 9.287  -32.714 1.00 146.14 ? 220 GLN A N     1 
ATOM   1643  C  CA    . GLN A 1 220 ? -21.176 8.067  -33.017 1.00 158.90 ? 220 GLN A CA    1 
ATOM   1644  C  C     . GLN A 1 220 ? -19.729 8.427  -33.280 1.00 172.72 ? 220 GLN A C     1 
ATOM   1645  O  O     . GLN A 1 220 ? -19.429 9.257  -34.145 1.00 171.69 ? 220 GLN A O     1 
ATOM   1646  C  CB    . GLN A 1 220 ? -21.783 7.332  -34.229 1.00 147.56 ? 220 GLN A CB    1 
ATOM   1647  N  N     . GLY A 1 221 ? -18.835 7.813  -32.515 1.00 176.85 ? 221 GLY A N     1 
ATOM   1648  C  CA    . GLY A 1 221 ? -17.416 8.017  -32.711 1.00 176.92 ? 221 GLY A CA    1 
ATOM   1649  C  C     . GLY A 1 221 ? -16.638 7.828  -31.432 1.00 171.79 ? 221 GLY A C     1 
ATOM   1650  O  O     . GLY A 1 221 ? -15.819 8.667  -31.069 1.00 175.98 ? 221 GLY A O     1 
ATOM   1651  N  N     . ARG A 1 222 ? -16.897 6.725  -30.742 1.00 165.25 ? 222 ARG A N     1 
ATOM   1652  C  CA    . ARG A 1 222 ? -16.184 6.433  -29.506 1.00 164.72 ? 222 ARG A CA    1 
ATOM   1653  C  C     . ARG A 1 222 ? -14.689 6.734  -29.641 1.00 169.52 ? 222 ARG A C     1 
ATOM   1654  O  O     . ARG A 1 222 ? -14.117 7.457  -28.816 1.00 155.14 ? 222 ARG A O     1 
ATOM   1655  C  CB    . ARG A 1 222 ? -16.410 4.981  -29.074 1.00 162.07 ? 222 ARG A CB    1 
ATOM   1656  N  N     . ASP A 1 223 ? -14.074 6.196  -30.697 1.00 178.32 ? 223 ASP A N     1 
ATOM   1657  C  CA    . ASP A 1 223 ? -12.624 6.276  -30.882 1.00 170.13 ? 223 ASP A CA    1 
ATOM   1658  C  C     . ASP A 1 223 ? -12.101 7.718  -30.886 1.00 163.24 ? 223 ASP A C     1 
ATOM   1659  O  O     . ASP A 1 223 ? -11.234 8.073  -30.082 1.00 155.03 ? 223 ASP A O     1 
ATOM   1660  C  CB    . ASP A 1 223 ? -12.195 5.535  -32.156 1.00 162.10 ? 223 ASP A CB    1 
ATOM   1661  N  N     . GLU A 1 224 ? -12.626 8.543  -31.789 1.00 157.82 ? 224 GLU A N     1 
ATOM   1662  C  CA    . GLU A 1 224 ? -12.233 9.953  -31.857 1.00 148.30 ? 224 GLU A CA    1 
ATOM   1663  C  C     . GLU A 1 224 ? -12.605 10.770 -30.596 1.00 154.16 ? 224 GLU A C     1 
ATOM   1664  O  O     . GLU A 1 224 ? -11.951 11.764 -30.288 1.00 153.26 ? 224 GLU A O     1 
ATOM   1665  C  CB    . GLU A 1 224 ? -12.747 10.622 -33.147 1.00 124.65 ? 224 GLU A CB    1 
ATOM   1666  N  N     . ILE A 1 225 ? -13.664 10.377 -29.888 1.00 152.91 ? 225 ILE A N     1 
ATOM   1667  C  CA    . ILE A 1 225 ? -14.024 11.054 -28.638 1.00 141.68 ? 225 ILE A CA    1 
ATOM   1668  C  C     . ILE A 1 225 ? -12.926 10.918 -27.603 1.00 136.67 ? 225 ILE A C     1 
ATOM   1669  O  O     . ILE A 1 225 ? -12.623 11.865 -26.874 1.00 126.76 ? 225 ILE A O     1 
ATOM   1670  C  CB    . ILE A 1 225 ? -15.278 10.497 -27.972 1.00 131.21 ? 225 ILE A CB    1 
ATOM   1671  C  CG1   . ILE A 1 225 ? -16.506 10.723 -28.851 1.00 126.22 ? 225 ILE A CG1   1 
ATOM   1672  C  CG2   . ILE A 1 225 ? -15.457 11.155 -26.593 1.00 110.25 ? 225 ILE A CG2   1 
ATOM   1673  C  CD1   . ILE A 1 225 ? -17.811 10.515 -28.116 1.00 117.02 ? 225 ILE A CD1   1 
ATOM   1674  N  N     . LYS A 1 226 ? -12.362 9.719  -27.509 1.00 139.33 ? 226 LYS A N     1 
ATOM   1675  C  CA    . LYS A 1 226 ? -11.200 9.522  -26.660 1.00 144.26 ? 226 LYS A CA    1 
ATOM   1676  C  C     . LYS A 1 226 ? -10.098 10.478 -27.125 1.00 140.10 ? 226 LYS A C     1 
ATOM   1677  O  O     . LYS A 1 226 ? -9.534  11.223 -26.318 1.00 120.75 ? 226 LYS A O     1 
ATOM   1678  C  CB    . LYS A 1 226 ? -10.719 8.061  -26.684 1.00 136.26 ? 226 LYS A CB    1 
ATOM   1679  N  N     . LYS A 1 227 ? -9.811  10.476 -28.427 1.00 136.33 ? 227 LYS A N     1 
ATOM   1680  C  CA    . LYS A 1 227 ? -8.750  11.328 -28.958 1.00 135.21 ? 227 LYS A CA    1 
ATOM   1681  C  C     . LYS A 1 227 ? -8.950  12.748 -28.454 1.00 138.94 ? 227 LYS A C     1 
ATOM   1682  O  O     . LYS A 1 227 ? -8.017  13.383 -27.972 1.00 130.38 ? 227 LYS A O     1 
ATOM   1683  C  CB    . LYS A 1 227 ? -8.717  11.307 -30.494 1.00 119.58 ? 227 LYS A CB    1 
ATOM   1684  N  N     . ALA A 1 228 ? -10.184 13.228 -28.563 1.00 145.49 ? 228 ALA A N     1 
ATOM   1685  C  CA    . ALA A 1 228 ? -10.547 14.560 -28.110 1.00 138.81 ? 228 ALA A CA    1 
ATOM   1686  C  C     . ALA A 1 228 ? -10.271 14.735 -26.616 1.00 138.67 ? 228 ALA A C     1 
ATOM   1687  O  O     . ALA A 1 228 ? -9.606  15.688 -26.205 1.00 137.83 ? 228 ALA A O     1 
ATOM   1688  C  CB    . ALA A 1 228 ? -12.004 14.802 -28.409 1.00 132.51 ? 228 ALA A CB    1 
ATOM   1689  N  N     . TYR A 1 229 ? -10.793 13.818 -25.808 1.00 130.35 ? 229 TYR A N     1 
ATOM   1690  C  CA    . TYR A 1 229 ? -10.587 13.868 -24.365 1.00 135.08 ? 229 TYR A CA    1 
ATOM   1691  C  C     . TYR A 1 229 ? -9.115  13.806 -23.933 1.00 144.25 ? 229 TYR A C     1 
ATOM   1692  O  O     . TYR A 1 229 ? -8.745  14.406 -22.923 1.00 156.09 ? 229 TYR A O     1 
ATOM   1693  C  CB    . TYR A 1 229 ? -11.420 12.812 -23.633 1.00 135.18 ? 229 TYR A CB    1 
ATOM   1694  C  CG    . TYR A 1 229 ? -12.901 13.148 -23.534 1.00 129.01 ? 229 TYR A CG    1 
ATOM   1695  C  CD1   . TYR A 1 229 ? -13.386 14.386 -23.951 1.00 123.33 ? 229 TYR A CD1   1 
ATOM   1696  C  CD2   . TYR A 1 229 ? -13.807 12.235 -22.995 1.00 124.43 ? 229 TYR A CD2   1 
ATOM   1697  C  CE1   . TYR A 1 229 ? -14.737 14.691 -23.863 1.00 127.65 ? 229 TYR A CE1   1 
ATOM   1698  C  CE2   . TYR A 1 229 ? -15.155 12.532 -22.894 1.00 127.19 ? 229 TYR A CE2   1 
ATOM   1699  C  CZ    . TYR A 1 229 ? -15.616 13.760 -23.330 1.00 135.58 ? 229 TYR A CZ    1 
ATOM   1700  O  OH    . TYR A 1 229 ? -16.956 14.059 -23.226 1.00 138.44 ? 229 TYR A OH    1 
ATOM   1701  N  N     . GLU A 1 230 ? -8.286  13.056 -24.654 1.00 135.05 ? 230 GLU A N     1 
ATOM   1702  C  CA    . GLU A 1 230 ? -6.844  13.075 -24.392 1.00 136.72 ? 230 GLU A CA    1 
ATOM   1703  C  C     . GLU A 1 230 ? -6.137  14.333 -24.938 1.00 140.26 ? 230 GLU A C     1 
ATOM   1704  O  O     . GLU A 1 230 ? -5.556  15.105 -24.177 1.00 142.16 ? 230 GLU A O     1 
ATOM   1705  C  CB    . GLU A 1 230 ? -6.170  11.795 -24.907 1.00 130.04 ? 230 GLU A CB    1 
ATOM   1706  N  N     . THR A 1 231 ? -6.186  14.517 -26.255 1.00 132.68 ? 231 THR A N     1 
ATOM   1707  C  CA    . THR A 1 231 ? -5.467  15.590 -26.944 1.00 136.53 ? 231 THR A CA    1 
ATOM   1708  C  C     . THR A 1 231 ? -6.074  16.992 -26.828 1.00 136.72 ? 231 THR A C     1 
ATOM   1709  O  O     . THR A 1 231 ? -5.353  17.979 -26.656 1.00 134.00 ? 231 THR A O     1 
ATOM   1710  C  CB    . THR A 1 231 ? -5.329  15.280 -28.436 1.00 155.27 ? 231 THR A CB    1 
ATOM   1711  O  OG1   . THR A 1 231 ? -6.596  15.440 -29.084 1.00 161.16 ? 231 THR A OG1   1 
ATOM   1712  C  CG2   . THR A 1 231 ? -4.862  13.866 -28.616 1.00 170.70 ? 231 THR A CG2   1 
ATOM   1713  N  N     . GLY A 1 232 ? -7.392  17.082 -26.966 1.00 136.47 ? 232 GLY A N     1 
ATOM   1714  C  CA    . GLY A 1 232 ? -8.068  18.369 -27.003 1.00 132.19 ? 232 GLY A CA    1 
ATOM   1715  C  C     . GLY A 1 232 ? -8.733  18.656 -28.342 1.00 125.92 ? 232 GLY A C     1 
ATOM   1716  O  O     . GLY A 1 232 ? -9.623  19.511 -28.434 1.00 111.01 ? 232 GLY A O     1 
ATOM   1717  N  N     . LYS A 1 233 ? -8.285  17.946 -29.379 1.00 126.67 ? 233 LYS A N     1 
ATOM   1718  C  CA    . LYS A 1 233 ? -8.872  18.023 -30.717 1.00 120.16 ? 233 LYS A CA    1 
ATOM   1719  C  C     . LYS A 1 233 ? -9.423  16.655 -31.113 1.00 125.89 ? 233 LYS A C     1 
ATOM   1720  O  O     . LYS A 1 233 ? -8.842  15.625 -30.777 1.00 134.45 ? 233 LYS A O     1 
ATOM   1721  C  CB    . LYS A 1 233 ? -7.838  18.523 -31.753 1.00 112.70 ? 233 LYS A CB    1 
ATOM   1722  C  CG    . LYS A 1 233 ? -7.857  20.050 -32.006 1.00 116.82 ? 233 LYS A CG    1 
ATOM   1723  C  CD    . LYS A 1 233 ? -6.713  20.545 -32.906 1.00 109.40 ? 233 LYS A CD    1 
ATOM   1724  N  N     . GLY A 1 234 ? -10.573 16.647 -31.779 1.00 125.23 ? 234 GLY A N     1 
ATOM   1725  C  CA    . GLY A 1 234 ? -11.156 15.420 -32.301 1.00 130.00 ? 234 GLY A CA    1 
ATOM   1726  C  C     . GLY A 1 234 ? -12.345 15.696 -33.207 1.00 141.79 ? 234 GLY A C     1 
ATOM   1727  O  O     . GLY A 1 234 ? -12.971 16.745 -33.108 1.00 146.88 ? 234 GLY A O     1 
ATOM   1728  N  N     . ARG A 1 235 ? -12.673 14.768 -34.095 1.00 145.09 ? 235 ARG A N     1 
ATOM   1729  C  CA    . ARG A 1 235 ? -13.904 14.915 -34.873 1.00 140.68 ? 235 ARG A CA    1 
ATOM   1730  C  C     . ARG A 1 235 ? -14.863 13.755 -34.613 1.00 151.73 ? 235 ARG A C     1 
ATOM   1731  O  O     . ARG A 1 235 ? -14.468 12.584 -34.587 1.00 147.73 ? 235 ARG A O     1 
ATOM   1732  C  CB    . ARG A 1 235 ? -13.656 15.122 -36.379 1.00 117.74 ? 235 ARG A CB    1 
ATOM   1733  N  N     . VAL A 1 236 ? -16.127 14.112 -34.420 1.00 154.44 ? 236 VAL A N     1 
ATOM   1734  C  CA    . VAL A 1 236 ? -17.169 13.184 -34.010 1.00 147.26 ? 236 VAL A CA    1 
ATOM   1735  C  C     . VAL A 1 236 ? -18.310 13.271 -35.010 1.00 136.77 ? 236 VAL A C     1 
ATOM   1736  O  O     . VAL A 1 236 ? -18.458 14.280 -35.689 1.00 130.68 ? 236 VAL A O     1 
ATOM   1737  C  CB    . VAL A 1 236 ? -17.679 13.548 -32.594 1.00 151.30 ? 236 VAL A CB    1 
ATOM   1738  C  CG1   . VAL A 1 236 ? -19.165 13.258 -32.452 1.00 163.16 ? 236 VAL A CG1   1 
ATOM   1739  C  CG2   . VAL A 1 236 ? -16.875 12.821 -31.535 1.00 148.79 ? 236 VAL A CG2   1 
ATOM   1740  N  N     . VAL A 1 237 ? -19.118 12.223 -35.114 1.00 139.25 ? 237 VAL A N     1 
ATOM   1741  C  CA    . VAL A 1 237 ? -20.268 12.284 -36.005 1.00 141.62 ? 237 VAL A CA    1 
ATOM   1742  C  C     . VAL A 1 237 ? -21.566 12.389 -35.226 1.00 143.73 ? 237 VAL A C     1 
ATOM   1743  O  O     . VAL A 1 237 ? -21.753 11.728 -34.204 1.00 152.35 ? 237 VAL A O     1 
ATOM   1744  C  CB    . VAL A 1 237 ? -20.381 11.073 -36.909 1.00 145.80 ? 237 VAL A CB    1 
ATOM   1745  C  CG1   . VAL A 1 237 ? -21.466 11.337 -37.939 1.00 142.06 ? 237 VAL A CG1   1 
ATOM   1746  C  CG2   . VAL A 1 237 ? -19.044 10.778 -37.569 1.00 158.51 ? 237 VAL A CG2   1 
ATOM   1747  N  N     . VAL A 1 238 ? -22.458 13.236 -35.718 1.00 129.44 ? 238 VAL A N     1 
ATOM   1748  C  CA    . VAL A 1 238 ? -23.716 13.508 -35.042 1.00 132.47 ? 238 VAL A CA    1 
ATOM   1749  C  C     . VAL A 1 238 ? -24.845 13.311 -36.036 1.00 142.63 ? 238 VAL A C     1 
ATOM   1750  O  O     . VAL A 1 238 ? -24.850 13.932 -37.099 1.00 160.77 ? 238 VAL A O     1 
ATOM   1751  C  CB    . VAL A 1 238 ? -23.749 14.976 -34.524 1.00 119.54 ? 238 VAL A CB    1 
ATOM   1752  C  CG1   . VAL A 1 238 ? -25.181 15.410 -34.205 1.00 102.17 ? 238 VAL A CG1   1 
ATOM   1753  C  CG2   . VAL A 1 238 ? -22.800 15.154 -33.333 1.00 114.79 ? 238 VAL A CG2   1 
ATOM   1754  N  N     . ARG A 1 239 ? -25.802 12.455 -35.703 1.00 141.62 ? 239 ARG A N     1 
ATOM   1755  C  CA    . ARG A 1 239 ? -26.896 12.183 -36.627 1.00 151.36 ? 239 ARG A CA    1 
ATOM   1756  C  C     . ARG A 1 239 ? -28.239 12.473 -35.991 1.00 151.51 ? 239 ARG A C     1 
ATOM   1757  O  O     . ARG A 1 239 ? -28.512 12.055 -34.861 1.00 152.54 ? 239 ARG A O     1 
ATOM   1758  C  CB    . ARG A 1 239 ? -26.860 10.739 -37.149 1.00 146.75 ? 239 ARG A CB    1 
ATOM   1759  N  N     . SER A 1 240 ? -29.064 13.213 -36.722 1.00 143.23 ? 240 SER A N     1 
ATOM   1760  C  CA    . SER A 1 240 ? -30.438 13.445 -36.316 1.00 147.50 ? 240 SER A CA    1 
ATOM   1761  C  C     . SER A 1 240 ? -31.129 12.110 -36.063 1.00 140.12 ? 240 SER A C     1 
ATOM   1762  O  O     . SER A 1 240 ? -30.703 11.080 -36.576 1.00 151.62 ? 240 SER A O     1 
ATOM   1763  C  CB    . SER A 1 240 ? -31.187 14.274 -37.359 1.00 155.96 ? 240 SER A CB    1 
ATOM   1764  O  OG    . SER A 1 240 ? -30.665 14.060 -38.651 1.00 164.94 ? 240 SER A OG    1 
ATOM   1765  N  N     . LYS A 1 241 ? -32.195 12.132 -35.271 1.00 135.67 ? 241 LYS A N     1 
ATOM   1766  C  CA    . LYS A 1 241 ? -32.825 10.908 -34.796 1.00 149.55 ? 241 LYS A CA    1 
ATOM   1767  C  C     . LYS A 1 241 ? -34.090 10.643 -35.590 1.00 162.60 ? 241 LYS A C     1 
ATOM   1768  O  O     . LYS A 1 241 ? -34.992 11.476 -35.633 1.00 169.19 ? 241 LYS A O     1 
ATOM   1769  C  CB    . LYS A 1 241 ? -33.133 11.005 -33.294 1.00 145.37 ? 241 LYS A CB    1 
ATOM   1770  C  CG    . LYS A 1 241 ? -34.212 10.028 -32.784 1.00 144.64 ? 241 LYS A CG    1 
ATOM   1771  C  CD    . LYS A 1 241 ? -34.305 9.980  -31.248 1.00 131.51 ? 241 LYS A CD    1 
ATOM   1772  N  N     . THR A 1 242 ? -34.156 9.464  -36.203 1.00 162.79 ? 242 THR A N     1 
ATOM   1773  C  CA    . THR A 1 242 ? -35.155 9.202  -37.229 1.00 151.20 ? 242 THR A CA    1 
ATOM   1774  C  C     . THR A 1 242 ? -36.129 8.093  -36.840 1.00 169.40 ? 242 THR A C     1 
ATOM   1775  O  O     . THR A 1 242 ? -35.770 7.146  -36.133 1.00 173.95 ? 242 THR A O     1 
ATOM   1776  C  CB    . THR A 1 242 ? -34.497 8.888  -38.592 1.00 129.78 ? 242 THR A CB    1 
ATOM   1777  N  N     . GLU A 1 243 ? -37.375 8.259  -37.282 1.00 171.93 ? 243 GLU A N     1 
ATOM   1778  C  CA    . GLU A 1 243 ? -38.442 7.280  -37.100 1.00 163.86 ? 243 GLU A CA    1 
ATOM   1779  C  C     . GLU A 1 243 ? -39.217 7.138  -38.419 1.00 173.70 ? 243 GLU A C     1 
ATOM   1780  O  O     . GLU A 1 243 ? -39.356 8.114  -39.158 1.00 176.78 ? 243 GLU A O     1 
ATOM   1781  C  CB    . GLU A 1 243 ? -39.381 7.747  -35.978 1.00 135.54 ? 243 GLU A CB    1 
ATOM   1782  N  N     . ILE A 1 244 ? -39.721 5.943  -38.728 1.00 173.20 ? 244 ILE A N     1 
ATOM   1783  C  CA    . ILE A 1 244 ? -40.536 5.779  -39.941 1.00 178.42 ? 244 ILE A CA    1 
ATOM   1784  C  C     . ILE A 1 244 ? -42.001 5.483  -39.608 1.00 180.64 ? 244 ILE A C     1 
ATOM   1785  O  O     . ILE A 1 244 ? -42.307 4.545  -38.879 1.00 184.97 ? 244 ILE A O     1 
ATOM   1786  C  CB    . ILE A 1 244 ? -39.978 4.715  -40.939 1.00 104.54 ? 244 ILE A CB    1 
ATOM   1787  N  N     . GLU A 1 245 ? -42.898 6.296  -40.160 1.00 181.39 ? 245 GLU A N     1 
ATOM   1788  C  CA    . GLU A 1 245 ? -44.328 6.190  -39.899 1.00 184.65 ? 245 GLU A CA    1 
ATOM   1789  C  C     . GLU A 1 245 ? -45.003 5.771  -41.189 1.00 190.43 ? 245 GLU A C     1 
ATOM   1790  O  O     . GLU A 1 245 ? -44.595 6.197  -42.272 1.00 193.48 ? 245 GLU A O     1 
ATOM   1791  C  CB    . GLU A 1 245 ? -44.913 7.532  -39.419 1.00 183.80 ? 245 GLU A CB    1 
ATOM   1792  C  CG    . GLU A 1 245 ? -44.819 7.808  -37.904 1.00 191.39 ? 245 GLU A CG    1 
ATOM   1793  C  CD    . GLU A 1 245 ? -45.486 9.129  -37.460 1.00 188.84 ? 245 GLU A CD    1 
ATOM   1794  O  OE1   . GLU A 1 245 ? -46.373 9.647  -38.184 1.00 186.40 ? 245 GLU A OE1   1 
ATOM   1795  O  OE2   . GLU A 1 245 ? -45.123 9.643  -36.370 1.00 178.88 ? 245 GLU A OE2   1 
ATOM   1796  N  N     . LYS A 1 246 ? -46.030 4.933  -41.073 1.00 194.72 ? 246 LYS A N     1 
ATOM   1797  C  CA    . LYS A 1 246 ? -46.697 4.360  -42.241 1.00 188.31 ? 246 LYS A CA    1 
ATOM   1798  C  C     . LYS A 1 246 ? -48.195 4.649  -42.240 1.00 184.15 ? 246 LYS A C     1 
ATOM   1799  O  O     . LYS A 1 246 ? -48.720 5.247  -41.300 1.00 183.68 ? 246 LYS A O     1 
ATOM   1800  C  CB    . LYS A 1 246 ? -46.446 2.847  -42.318 1.00 181.37 ? 246 LYS A CB    1 
ATOM   1801  N  N     . GLN A 1 253 ? -43.096 7.400  -44.571 1.00 167.95 ? 253 GLN A N     1 
ATOM   1802  C  CA    . GLN A 1 253 ? -42.891 8.728  -43.987 1.00 163.60 ? 253 GLN A CA    1 
ATOM   1803  C  C     . GLN A 1 253 ? -41.739 8.778  -42.982 1.00 161.58 ? 253 GLN A C     1 
ATOM   1804  O  O     . GLN A 1 253 ? -41.637 7.932  -42.096 1.00 168.83 ? 253 GLN A O     1 
ATOM   1805  C  CB    . GLN A 1 253 ? -44.174 9.205  -43.309 1.00 150.10 ? 253 GLN A CB    1 
ATOM   1806  C  CG    . GLN A 1 253 ? -43.992 10.405 -42.415 1.00 155.37 ? 253 GLN A CG    1 
ATOM   1807  C  CD    . GLN A 1 253 ? -45.166 11.364 -42.506 1.00 171.83 ? 253 GLN A CD    1 
ATOM   1808  O  OE1   . GLN A 1 253 ? -45.613 11.699 -43.607 1.00 176.43 ? 253 GLN A OE1   1 
ATOM   1809  N  NE2   . GLN A 1 253 ? -45.671 11.816 -41.350 1.00 171.79 ? 253 GLN A NE2   1 
ATOM   1810  N  N     . ILE A 1 254 ? -40.896 9.797  -43.102 1.00 151.48 ? 254 ILE A N     1 
ATOM   1811  C  CA    . ILE A 1 254 ? -39.743 9.940  -42.226 1.00 150.32 ? 254 ILE A CA    1 
ATOM   1812  C  C     . ILE A 1 254 ? -39.985 11.068 -41.238 1.00 155.90 ? 254 ILE A C     1 
ATOM   1813  O  O     . ILE A 1 254 ? -40.266 12.202 -41.627 1.00 152.89 ? 254 ILE A O     1 
ATOM   1814  C  CB    . ILE A 1 254 ? -38.453 10.278 -42.983 1.00 141.70 ? 254 ILE A CB    1 
ATOM   1815  C  CG1   . ILE A 1 254 ? -38.417 9.606  -44.351 1.00 151.16 ? 254 ILE A CG1   1 
ATOM   1816  C  CG2   . ILE A 1 254 ? -37.246 9.876  -42.151 1.00 142.48 ? 254 ILE A CG2   1 
ATOM   1817  C  CD1   . ILE A 1 254 ? -36.999 9.471  -44.928 1.00 156.80 ? 254 ILE A CD1   1 
ATOM   1818  N  N     . VAL A 1 255 ? -39.847 10.759 -39.956 1.00 160.28 ? 255 VAL A N     1 
ATOM   1819  C  CA    . VAL A 1 255 ? -40.117 11.733 -38.910 1.00 166.20 ? 255 VAL A CA    1 
ATOM   1820  C  C     . VAL A 1 255 ? -38.820 12.109 -38.217 1.00 171.55 ? 255 VAL A C     1 
ATOM   1821  O  O     . VAL A 1 255 ? -38.036 11.240 -37.832 1.00 179.51 ? 255 VAL A O     1 
ATOM   1822  C  CB    . VAL A 1 255 ? -41.098 11.178 -37.858 1.00 164.20 ? 255 VAL A CB    1 
ATOM   1823  C  CG1   . VAL A 1 255 ? -41.612 12.297 -36.974 1.00 154.76 ? 255 VAL A CG1   1 
ATOM   1824  C  CG2   . VAL A 1 255 ? -42.247 10.465 -38.537 1.00 169.86 ? 255 VAL A CG2   1 
ATOM   1825  N  N     . ILE A 1 256 ? -38.600 13.408 -38.056 1.00 160.71 ? 256 ILE A N     1 
ATOM   1826  C  CA    . ILE A 1 256 ? -37.368 13.886 -37.455 1.00 160.27 ? 256 ILE A CA    1 
ATOM   1827  C  C     . ILE A 1 256 ? -37.702 14.583 -36.151 1.00 160.88 ? 256 ILE A C     1 
ATOM   1828  O  O     . ILE A 1 256 ? -38.536 15.484 -36.131 1.00 166.30 ? 256 ILE A O     1 
ATOM   1829  C  CB    . ILE A 1 256 ? -36.656 14.878 -38.377 1.00 146.32 ? 256 ILE A CB    1 
ATOM   1830  C  CG1   . ILE A 1 256 ? -36.750 14.415 -39.821 1.00 130.60 ? 256 ILE A CG1   1 
ATOM   1831  C  CG2   . ILE A 1 256 ? -35.199 15.060 -37.954 1.00 152.83 ? 256 ILE A CG2   1 
ATOM   1832  C  CD1   . ILE A 1 256 ? -35.558 14.830 -40.630 1.00 134.54 ? 256 ILE A CD1   1 
ATOM   1833  N  N     . THR A 1 257 ? -37.074 14.159 -35.057 1.00 157.50 ? 257 THR A N     1 
ATOM   1834  C  CA    . THR A 1 257 ? -37.440 14.711 -33.763 1.00 160.31 ? 257 THR A CA    1 
ATOM   1835  C  C     . THR A 1 257 ? -36.247 15.161 -32.938 1.00 150.46 ? 257 THR A C     1 
ATOM   1836  O  O     . THR A 1 257 ? -36.398 15.525 -31.774 1.00 145.40 ? 257 THR A O     1 
ATOM   1837  C  CB    . THR A 1 257 ? -38.167 13.618 -32.932 1.00 162.79 ? 257 THR A CB    1 
ATOM   1838  O  OG1   . THR A 1 257 ? -37.216 12.665 -32.436 1.00 154.99 ? 257 THR A OG1   1 
ATOM   1839  C  CG2   . THR A 1 257 ? -39.176 12.888 -33.789 1.00 162.49 ? 257 THR A CG2   1 
ATOM   1840  N  N     . GLU A 1 258 ? -35.078 15.200 -33.561 1.00 145.98 ? 258 GLU A N     1 
ATOM   1841  C  CA    . GLU A 1 258 ? -33.872 15.711 -32.925 1.00 143.24 ? 258 GLU A CA    1 
ATOM   1842  C  C     . GLU A 1 258 ? -32.926 16.057 -34.057 1.00 136.42 ? 258 GLU A C     1 
ATOM   1843  O  O     . GLU A 1 258 ? -32.869 15.342 -35.045 1.00 152.40 ? 258 GLU A O     1 
ATOM   1844  C  CB    . GLU A 1 258 ? -33.244 14.659 -32.000 1.00 145.91 ? 258 GLU A CB    1 
ATOM   1845  C  CG    . GLU A 1 258 ? -34.167 14.212 -30.850 1.00 163.75 ? 258 GLU A CG    1 
ATOM   1846  C  CD    . GLU A 1 258 ? -33.445 13.505 -29.700 1.00 181.51 ? 258 GLU A CD    1 
ATOM   1847  O  OE1   . GLU A 1 258 ? -32.286 13.085 -29.884 1.00 197.89 ? 258 GLU A OE1   1 
ATOM   1848  O  OE2   . GLU A 1 258 ? -34.038 13.361 -28.603 1.00 177.07 ? 258 GLU A OE2   1 
ATOM   1849  N  N     . ILE A 1 259 ? -32.209 17.164 -33.951 1.00 129.16 ? 259 ILE A N     1 
ATOM   1850  C  CA    . ILE A 1 259 ? -31.232 17.498 -34.980 1.00 128.89 ? 259 ILE A CA    1 
ATOM   1851  C  C     . ILE A 1 259 ? -29.877 17.858 -34.374 1.00 136.42 ? 259 ILE A C     1 
ATOM   1852  O  O     . ILE A 1 259 ? -29.757 18.089 -33.168 1.00 139.14 ? 259 ILE A O     1 
ATOM   1853  C  CB    . ILE A 1 259 ? -31.727 18.619 -35.898 1.00 123.98 ? 259 ILE A CB    1 
ATOM   1854  C  CG1   . ILE A 1 259 ? -32.133 19.833 -35.071 1.00 127.20 ? 259 ILE A CG1   1 
ATOM   1855  C  CG2   . ILE A 1 259 ? -32.907 18.135 -36.728 1.00 111.23 ? 259 ILE A CG2   1 
ATOM   1856  C  CD1   . ILE A 1 259 ? -32.059 21.116 -35.822 1.00 124.63 ? 259 ILE A CD1   1 
ATOM   1857  N  N     . PRO A 1 260 ? -28.842 17.875 -35.211 1.00 130.97 ? 260 PRO A N     1 
ATOM   1858  C  CA    . PRO A 1 260 ? -27.473 18.109 -34.748 1.00 129.84 ? 260 PRO A CA    1 
ATOM   1859  C  C     . PRO A 1 260 ? -27.243 19.486 -34.141 1.00 123.20 ? 260 PRO A C     1 
ATOM   1860  O  O     . PRO A 1 260 ? -27.440 20.500 -34.805 1.00 132.26 ? 260 PRO A O     1 
ATOM   1861  C  CB    . PRO A 1 260 ? -26.656 17.959 -36.027 1.00 138.70 ? 260 PRO A CB    1 
ATOM   1862  C  CG    . PRO A 1 260 ? -27.434 16.974 -36.819 1.00 146.20 ? 260 PRO A CG    1 
ATOM   1863  C  CD    . PRO A 1 260 ? -28.877 17.314 -36.567 1.00 136.45 ? 260 PRO A CD    1 
ATOM   1864  N  N     . TYR A 1 261 ? -26.822 19.500 -32.881 1.00 110.95 ? 261 TYR A N     1 
ATOM   1865  C  CA    . TYR A 1 261 ? -26.352 20.704 -32.199 1.00 107.19 ? 261 TYR A CA    1 
ATOM   1866  C  C     . TYR A 1 261 ? -25.769 21.786 -33.104 1.00 116.61 ? 261 TYR A C     1 
ATOM   1867  O  O     . TYR A 1 261 ? -25.002 21.508 -34.024 1.00 115.87 ? 261 TYR A O     1 
ATOM   1868  C  CB    . TYR A 1 261 ? -25.279 20.300 -31.192 1.00 114.54 ? 261 TYR A CB    1 
ATOM   1869  C  CG    . TYR A 1 261 ? -24.808 21.409 -30.291 1.00 118.27 ? 261 TYR A CG    1 
ATOM   1870  C  CD1   . TYR A 1 261 ? -25.694 22.074 -29.453 1.00 115.36 ? 261 TYR A CD1   1 
ATOM   1871  C  CD2   . TYR A 1 261 ? -23.477 21.770 -30.249 1.00 123.38 ? 261 TYR A CD2   1 
ATOM   1872  C  CE1   . TYR A 1 261 ? -25.271 23.081 -28.622 1.00 112.60 ? 261 TYR A CE1   1 
ATOM   1873  C  CE2   . TYR A 1 261 ? -23.044 22.780 -29.409 1.00 124.86 ? 261 TYR A CE2   1 
ATOM   1874  C  CZ    . TYR A 1 261 ? -23.944 23.433 -28.601 1.00 116.40 ? 261 TYR A CZ    1 
ATOM   1875  O  OH    . TYR A 1 261 ? -23.503 24.437 -27.766 1.00 120.54 ? 261 TYR A OH    1 
ATOM   1876  N  N     . GLU A 1 262 ? -26.126 23.030 -32.811 1.00 132.27 ? 262 GLU A N     1 
ATOM   1877  C  CA    . GLU A 1 262 ? -25.582 24.192 -33.514 1.00 131.78 ? 262 GLU A CA    1 
ATOM   1878  C  C     . GLU A 1 262 ? -26.039 24.236 -34.964 1.00 127.68 ? 262 GLU A C     1 
ATOM   1879  O  O     . GLU A 1 262 ? -25.439 24.917 -35.793 1.00 132.37 ? 262 GLU A O     1 
ATOM   1880  C  CB    . GLU A 1 262 ? -24.052 24.213 -33.430 1.00 128.31 ? 262 GLU A CB    1 
ATOM   1881  C  CG    . GLU A 1 262 ? -23.511 24.725 -32.107 1.00 140.35 ? 262 GLU A CG    1 
ATOM   1882  C  CD    . GLU A 1 262 ? -21.984 24.796 -32.081 1.00 169.70 ? 262 GLU A CD    1 
ATOM   1883  O  OE1   . GLU A 1 262 ? -21.364 24.618 -33.156 1.00 171.64 ? 262 GLU A OE1   1 
ATOM   1884  O  OE2   . GLU A 1 262 ? -21.402 25.029 -30.989 1.00 181.69 ? 262 GLU A OE2   1 
ATOM   1885  N  N     . ILE A 1 263 ? -27.109 23.513 -35.265 1.00 114.20 ? 263 ILE A N     1 
ATOM   1886  C  CA    . ILE A 1 263 ? -27.614 23.463 -36.625 1.00 120.67 ? 263 ILE A CA    1 
ATOM   1887  C  C     . ILE A 1 263 ? -28.961 24.185 -36.697 1.00 138.74 ? 263 ILE A C     1 
ATOM   1888  O  O     . ILE A 1 263 ? -29.718 24.195 -35.732 1.00 150.24 ? 263 ILE A O     1 
ATOM   1889  C  CB    . ILE A 1 263 ? -27.710 21.992 -37.103 1.00 124.86 ? 263 ILE A CB    1 
ATOM   1890  C  CG1   . ILE A 1 263 ? -27.100 21.825 -38.490 1.00 127.61 ? 263 ILE A CG1   1 
ATOM   1891  C  CG2   . ILE A 1 263 ? -29.143 21.484 -37.045 1.00 125.65 ? 263 ILE A CG2   1 
ATOM   1892  C  CD1   . ILE A 1 263 ? -27.872 22.536 -39.561 1.00 134.38 ? 263 ILE A CD1   1 
ATOM   1893  N  N     . ASN A 1 264 ? -29.249 24.790 -37.844 1.00 146.75 ? 264 ASN A N     1 
ATOM   1894  C  CA    . ASN A 1 264 ? -30.407 25.680 -38.019 1.00 155.22 ? 264 ASN A CA    1 
ATOM   1895  C  C     . ASN A 1 264 ? -31.697 25.067 -38.569 1.00 149.73 ? 264 ASN A C     1 
ATOM   1896  O  O     . ASN A 1 264 ? -31.890 25.039 -39.778 1.00 160.34 ? 264 ASN A O     1 
ATOM   1897  C  CB    . ASN A 1 264 ? -30.060 26.928 -38.832 1.00 165.38 ? 264 ASN A CB    1 
ATOM   1898  C  CG    . ASN A 1 264 ? -31.218 27.925 -38.885 1.00 166.09 ? 264 ASN A CG    1 
ATOM   1899  O  OD1   . ASN A 1 264 ? -32.183 27.744 -39.634 1.00 156.13 ? 264 ASN A OD1   1 
ATOM   1900  N  ND2   . ASN A 1 264 ? -31.123 28.985 -38.083 1.00 174.52 ? 264 ASN A ND2   1 
ATOM   1901  N  N     . LYS A 1 265 ? -32.551 24.536 -37.703 1.00 126.39 ? 265 LYS A N     1 
ATOM   1902  C  CA    . LYS A 1 265 ? -33.779 23.872 -38.156 1.00 126.43 ? 265 LYS A CA    1 
ATOM   1903  C  C     . LYS A 1 265 ? -34.408 24.472 -39.413 1.00 125.03 ? 265 LYS A C     1 
ATOM   1904  O  O     . LYS A 1 265 ? -34.779 23.744 -40.326 1.00 122.45 ? 265 LYS A O     1 
ATOM   1905  C  CB    . LYS A 1 265 ? -34.824 23.866 -37.035 1.00 130.89 ? 265 LYS A CB    1 
ATOM   1906  C  CG    . LYS A 1 265 ? -36.174 23.245 -37.385 1.00 130.47 ? 265 LYS A CG    1 
ATOM   1907  C  CD    . LYS A 1 265 ? -37.065 23.182 -36.139 1.00 138.38 ? 265 LYS A CD    1 
ATOM   1908  C  CE    . LYS A 1 265 ? -38.541 23.089 -36.502 1.00 145.32 ? 265 LYS A CE    1 
ATOM   1909  N  N     . ALA A 1 266 ? -34.524 25.793 -39.464 1.00 130.24 ? 266 ALA A N     1 
ATOM   1910  C  CA    . ALA A 1 266 ? -35.194 26.454 -40.583 1.00 121.01 ? 266 ALA A CA    1 
ATOM   1911  C  C     . ALA A 1 266 ? -34.525 26.149 -41.906 1.00 121.92 ? 266 ALA A C     1 
ATOM   1912  O  O     . ALA A 1 266 ? -35.136 25.558 -42.795 1.00 125.42 ? 266 ALA A O     1 
ATOM   1913  C  CB    . ALA A 1 266 ? -35.220 27.951 -40.370 1.00 127.48 ? 266 ALA A CB    1 
ATOM   1914  N  N     . ASN A 1 267 ? -33.270 26.568 -42.038 1.00 136.77 ? 267 ASN A N     1 
ATOM   1915  C  CA    . ASN A 1 267 ? -32.495 26.312 -43.250 1.00 144.28 ? 267 ASN A CA    1 
ATOM   1916  C  C     . ASN A 1 267 ? -32.376 24.824 -43.514 1.00 149.35 ? 267 ASN A C     1 
ATOM   1917  O  O     . ASN A 1 267 ? -32.494 24.389 -44.649 1.00 160.34 ? 267 ASN A O     1 
ATOM   1918  C  CB    . ASN A 1 267 ? -31.100 26.934 -43.181 1.00 151.16 ? 267 ASN A CB    1 
ATOM   1919  C  CG    . ASN A 1 267 ? -31.105 28.308 -42.537 1.00 169.65 ? 267 ASN A CG    1 
ATOM   1920  O  OD1   . ASN A 1 267 ? -30.193 28.642 -41.780 1.00 179.13 ? 267 ASN A OD1   1 
ATOM   1921  N  ND2   . ASN A 1 267 ? -32.136 29.108 -42.821 1.00 165.37 ? 267 ASN A ND2   1 
ATOM   1922  N  N     . LEU A 1 268 ? -32.159 24.044 -42.460 1.00 147.49 ? 268 LEU A N     1 
ATOM   1923  C  CA    . LEU A 1 268 ? -32.071 22.594 -42.598 1.00 154.00 ? 268 LEU A CA    1 
ATOM   1924  C  C     . LEU A 1 268 ? -33.261 22.076 -43.398 1.00 149.09 ? 268 LEU A C     1 
ATOM   1925  O  O     . LEU A 1 268 ? -33.106 21.270 -44.318 1.00 147.27 ? 268 LEU A O     1 
ATOM   1926  C  CB    . LEU A 1 268 ? -31.999 21.922 -41.219 1.00 156.10 ? 268 LEU A CB    1 
ATOM   1927  C  CG    . LEU A 1 268 ? -31.794 20.399 -41.144 1.00 155.66 ? 268 LEU A CG    1 
ATOM   1928  C  CD1   . LEU A 1 268 ? -33.127 19.648 -41.087 1.00 152.73 ? 268 LEU A CD1   1 
ATOM   1929  C  CD2   . LEU A 1 268 ? -30.879 19.857 -42.278 1.00 132.39 ? 268 LEU A CD2   1 
ATOM   1930  N  N     . VAL A 1 269 ? -34.449 22.554 -43.047 1.00 141.70 ? 269 VAL A N     1 
ATOM   1931  C  CA    . VAL A 1 269 ? -35.651 22.200 -43.782 1.00 136.15 ? 269 VAL A CA    1 
ATOM   1932  C  C     . VAL A 1 269 ? -35.622 22.649 -45.249 1.00 141.68 ? 269 VAL A C     1 
ATOM   1933  O  O     . VAL A 1 269 ? -35.903 21.851 -46.141 1.00 145.33 ? 269 VAL A O     1 
ATOM   1934  C  CB    . VAL A 1 269 ? -36.902 22.726 -43.081 1.00 124.39 ? 269 VAL A CB    1 
ATOM   1935  C  CG1   . VAL A 1 269 ? -37.977 23.034 -44.102 1.00 131.85 ? 269 VAL A CG1   1 
ATOM   1936  C  CG2   . VAL A 1 269 ? -37.388 21.712 -42.065 1.00 109.79 ? 269 VAL A CG2   1 
ATOM   1937  N  N     . LYS A 1 270 ? -35.281 23.909 -45.514 1.00 138.95 ? 270 LYS A N     1 
ATOM   1938  C  CA    . LYS A 1 270 ? -35.188 24.365 -46.907 1.00 138.18 ? 270 LYS A CA    1 
ATOM   1939  C  C     . LYS A 1 270 ? -34.225 23.483 -47.699 1.00 139.82 ? 270 LYS A C     1 
ATOM   1940  O  O     . LYS A 1 270 ? -34.564 22.981 -48.761 1.00 135.35 ? 270 LYS A O     1 
ATOM   1941  C  CB    . LYS A 1 270 ? -34.748 25.831 -47.020 1.00 120.79 ? 270 LYS A CB    1 
ATOM   1942  N  N     . LYS A 1 271 ? -33.029 23.282 -47.162 1.00 138.81 ? 271 LYS A N     1 
ATOM   1943  C  CA    . LYS A 1 271 ? -32.015 22.497 -47.841 1.00 133.63 ? 271 LYS A CA    1 
ATOM   1944  C  C     . LYS A 1 271 ? -32.501 21.113 -48.215 1.00 136.74 ? 271 LYS A C     1 
ATOM   1945  O  O     . LYS A 1 271 ? -32.082 20.569 -49.237 1.00 136.00 ? 271 LYS A O     1 
ATOM   1946  C  CB    . LYS A 1 271 ? -30.761 22.371 -46.988 1.00 129.53 ? 271 LYS A CB    1 
ATOM   1947  C  CG    . LYS A 1 271 ? -29.599 23.209 -47.485 1.00 154.87 ? 271 LYS A CG    1 
ATOM   1948  C  CD    . LYS A 1 271 ? -28.408 22.304 -47.760 1.00 168.90 ? 271 LYS A CD    1 
ATOM   1949  C  CE    . LYS A 1 271 ? -28.783 21.250 -48.797 1.00 174.25 ? 271 LYS A CE    1 
ATOM   1950  N  NZ    . LYS A 1 271 ? -27.804 20.139 -48.849 1.00 182.86 ? 271 LYS A NZ    1 
ATOM   1951  N  N     . ILE A 1 272 ? -33.348 20.527 -47.372 1.00 140.54 ? 272 ILE A N     1 
ATOM   1952  C  CA    . ILE A 1 272 ? -33.947 19.231 -47.693 1.00 157.89 ? 272 ILE A CA    1 
ATOM   1953  C  C     . ILE A 1 272 ? -34.909 19.305 -48.873 1.00 161.19 ? 272 ILE A C     1 
ATOM   1954  O  O     . ILE A 1 272 ? -34.785 18.543 -49.824 1.00 158.33 ? 272 ILE A O     1 
ATOM   1955  C  CB    . ILE A 1 272 ? -34.698 18.615 -46.509 1.00 156.94 ? 272 ILE A CB    1 
ATOM   1956  C  CG1   . ILE A 1 272 ? -33.696 17.997 -45.530 1.00 168.39 ? 272 ILE A CG1   1 
ATOM   1957  C  CG2   . ILE A 1 272 ? -35.718 17.574 -47.010 1.00 141.71 ? 272 ILE A CG2   1 
ATOM   1958  C  CD1   . ILE A 1 272 ? -34.316 17.071 -44.509 1.00 173.97 ? 272 ILE A CD1   1 
ATOM   1959  N  N     . ASP A 1 273 ? -35.871 20.219 -48.803 1.00 166.52 ? 273 ASP A N     1 
ATOM   1960  C  CA    . ASP A 1 273 ? -36.830 20.407 -49.889 1.00 174.72 ? 273 ASP A CA    1 
ATOM   1961  C  C     . ASP A 1 273 ? -36.141 20.787 -51.199 1.00 171.70 ? 273 ASP A C     1 
ATOM   1962  O  O     . ASP A 1 273 ? -36.613 20.446 -52.282 1.00 173.72 ? 273 ASP A O     1 
ATOM   1963  C  CB    . ASP A 1 273 ? -37.877 21.464 -49.527 1.00 176.31 ? 273 ASP A CB    1 
ATOM   1964  C  CG    . ASP A 1 273 ? -39.089 21.418 -50.443 1.00 179.85 ? 273 ASP A CG    1 
ATOM   1965  O  OD1   . ASP A 1 273 ? -40.002 20.605 -50.184 1.00 182.52 ? 273 ASP A OD1   1 
ATOM   1966  O  OD2   . ASP A 1 273 ? -39.130 22.197 -51.419 1.00 178.43 ? 273 ASP A OD2   1 
ATOM   1967  N  N     . ASP A 1 274 ? -35.046 21.528 -51.092 1.00 163.95 ? 274 ASP A N     1 
ATOM   1968  C  CA    . ASP A 1 274 ? -34.235 21.868 -52.248 1.00 161.45 ? 274 ASP A CA    1 
ATOM   1969  C  C     . ASP A 1 274 ? -33.760 20.582 -52.938 1.00 172.77 ? 274 ASP A C     1 
ATOM   1970  O  O     . ASP A 1 274 ? -33.649 20.520 -54.167 1.00 174.98 ? 274 ASP A O     1 
ATOM   1971  C  CB    . ASP A 1 274 ? -33.065 22.768 -51.830 1.00 147.56 ? 274 ASP A CB    1 
ATOM   1972  N  N     . VAL A 1 275 ? -33.477 19.557 -52.137 1.00 175.47 ? 275 VAL A N     1 
ATOM   1973  C  CA    . VAL A 1 275 ? -33.136 18.242 -52.672 1.00 181.01 ? 275 VAL A CA    1 
ATOM   1974  C  C     . VAL A 1 275 ? -34.266 17.699 -53.535 1.00 186.22 ? 275 VAL A C     1 
ATOM   1975  O  O     . VAL A 1 275 ? -34.035 17.234 -54.651 1.00 196.81 ? 275 VAL A O     1 
ATOM   1976  C  CB    . VAL A 1 275 ? -32.825 17.229 -51.555 1.00 182.36 ? 275 VAL A CB    1 
ATOM   1977  C  CG1   . VAL A 1 275 ? -33.411 15.875 -51.886 1.00 182.03 ? 275 VAL A CG1   1 
ATOM   1978  C  CG2   . VAL A 1 275 ? -31.334 17.115 -51.358 1.00 190.79 ? 275 VAL A CG2   1 
ATOM   1979  N  N     . ARG A 1 276 ? -35.489 17.757 -53.019 1.00 176.57 ? 276 ARG A N     1 
ATOM   1980  C  CA    . ARG A 1 276 ? -36.644 17.326 -53.790 1.00 178.87 ? 276 ARG A CA    1 
ATOM   1981  C  C     . ARG A 1 276 ? -36.785 18.080 -55.112 1.00 190.98 ? 276 ARG A C     1 
ATOM   1982  O  O     . ARG A 1 276 ? -36.829 17.460 -56.174 1.00 206.62 ? 276 ARG A O     1 
ATOM   1983  C  CB    . ARG A 1 276 ? -37.940 17.470 -53.006 1.00 167.89 ? 276 ARG A CB    1 
ATOM   1984  C  CG    . ARG A 1 276 ? -39.136 17.235 -53.898 1.00 173.29 ? 276 ARG A CG    1 
ATOM   1985  C  CD    . ARG A 1 276 ? -40.457 17.493 -53.215 1.00 183.06 ? 276 ARG A CD    1 
ATOM   1986  N  NE    . ARG A 1 276 ? -40.741 18.907 -52.966 1.00 181.45 ? 276 ARG A NE    1 
ATOM   1987  C  CZ    . ARG A 1 276 ? -40.725 19.863 -53.891 1.00 176.59 ? 276 ARG A CZ    1 
ATOM   1988  N  NH1   . ARG A 1 276 ? -40.389 19.578 -55.147 1.00 176.94 ? 276 ARG A NH1   1 
ATOM   1989  N  NH2   . ARG A 1 276 ? -41.022 21.115 -53.548 1.00 163.88 ? 276 ARG A NH2   1 
ATOM   1990  N  N     . VAL A 1 277 ? -36.859 19.408 -55.049 1.00 180.25 ? 277 VAL A N     1 
ATOM   1991  C  CA    . VAL A 1 277 ? -37.050 20.224 -56.253 1.00 179.89 ? 277 VAL A CA    1 
ATOM   1992  C  C     . VAL A 1 277 ? -35.966 20.026 -57.311 1.00 185.18 ? 277 VAL A C     1 
ATOM   1993  O  O     . VAL A 1 277 ? -36.258 19.898 -58.501 1.00 185.53 ? 277 VAL A O     1 
ATOM   1994  C  CB    . VAL A 1 277 ? -37.102 21.704 -55.933 1.00 182.97 ? 277 VAL A CB    1 
ATOM   1995  C  CG1   . VAL A 1 277 ? -36.564 22.501 -57.121 1.00 186.07 ? 277 VAL A CG1   1 
ATOM   1996  C  CG2   . VAL A 1 277 ? -38.524 22.112 -55.576 1.00 188.36 ? 277 VAL A CG2   1 
ATOM   1997  N  N     . ASN A 1 278 ? -34.712 20.044 -56.880 1.00 187.05 ? 278 ASN A N     1 
ATOM   1998  C  CA    . ASN A 1 278 ? -33.616 19.679 -57.764 1.00 191.14 ? 278 ASN A CA    1 
ATOM   1999  C  C     . ASN A 1 278 ? -33.672 18.193 -58.144 1.00 202.31 ? 278 ASN A C     1 
ATOM   2000  O  O     . ASN A 1 278 ? -32.852 17.718 -58.931 1.00 220.96 ? 278 ASN A O     1 
ATOM   2001  C  CB    . ASN A 1 278 ? -32.277 20.020 -57.103 1.00 188.11 ? 278 ASN A CB    1 
ATOM   2002  N  N     . ASN A 1 279 ? -34.646 17.470 -57.592 1.00 193.97 ? 279 ASN A N     1 
ATOM   2003  C  CA    . ASN A 1 279 ? -34.736 16.016 -57.756 1.00 198.12 ? 279 ASN A CA    1 
ATOM   2004  C  C     . ASN A 1 279 ? -33.359 15.365 -57.788 1.00 206.12 ? 279 ASN A C     1 
ATOM   2005  O  O     . ASN A 1 279 ? -33.063 14.552 -58.670 1.00 198.88 ? 279 ASN A O     1 
ATOM   2006  C  CB    . ASN A 1 279 ? -35.535 15.638 -59.007 1.00 193.60 ? 279 ASN A CB    1 
ATOM   2007  N  N     . LYS A 1 280 ? -32.522 15.746 -56.826 1.00 208.25 ? 280 LYS A N     1 
ATOM   2008  C  CA    . LYS A 1 280 ? -31.150 15.262 -56.751 1.00 201.38 ? 280 LYS A CA    1 
ATOM   2009  C  C     . LYS A 1 280 ? -31.120 13.798 -56.326 1.00 204.26 ? 280 LYS A C     1 
ATOM   2010  O  O     . LYS A 1 280 ? -30.129 13.099 -56.544 1.00 206.41 ? 280 LYS A O     1 
ATOM   2011  C  CB    . LYS A 1 280 ? -30.313 16.136 -55.810 1.00 187.05 ? 280 LYS A CB    1 
ATOM   2012  N  N     . VAL A 1 281 ? -32.212 13.333 -55.724 1.00 198.78 ? 281 VAL A N     1 
ATOM   2013  C  CA    . VAL A 1 281 ? -32.328 11.917 -55.389 1.00 196.12 ? 281 VAL A CA    1 
ATOM   2014  C  C     . VAL A 1 281 ? -33.714 11.361 -55.695 1.00 201.25 ? 281 VAL A C     1 
ATOM   2015  O  O     . VAL A 1 281 ? -34.669 12.112 -55.913 1.00 202.21 ? 281 VAL A O     1 
ATOM   2016  C  CB    . VAL A 1 281 ? -31.994 11.621 -53.924 1.00 185.04 ? 281 VAL A CB    1 
ATOM   2017  C  CG1   . VAL A 1 281 ? -33.268 11.553 -53.099 1.00 178.09 ? 281 VAL A CG1   1 
ATOM   2018  C  CG2   . VAL A 1 281 ? -31.245 10.308 -53.829 1.00 185.63 ? 281 VAL A CG2   1 
ATOM   2019  N  N     . ALA A 1 282 ? -33.801 10.032 -55.693 1.00 198.30 ? 282 ALA A N     1 
ATOM   2020  C  CA    . ALA A 1 282 ? -34.997 9.303  -56.102 1.00 190.92 ? 282 ALA A CA    1 
ATOM   2021  C  C     . ALA A 1 282 ? -36.297 9.758  -55.429 1.00 200.09 ? 282 ALA A C     1 
ATOM   2022  O  O     . ALA A 1 282 ? -36.863 10.802 -55.770 1.00 197.39 ? 282 ALA A O     1 
ATOM   2023  C  CB    . ALA A 1 282 ? -34.785 7.797  -55.887 1.00 177.68 ? 282 ALA A CB    1 
ATOM   2024  N  N     . GLY A 1 283 ? -36.764 8.958  -54.476 1.00 208.90 ? 283 GLY A N     1 
ATOM   2025  C  CA    . GLY A 1 283 ? -38.099 9.106  -53.924 1.00 217.62 ? 283 GLY A CA    1 
ATOM   2026  C  C     . GLY A 1 283 ? -38.445 10.391 -53.190 1.00 223.00 ? 283 GLY A C     1 
ATOM   2027  O  O     . GLY A 1 283 ? -39.479 10.453 -52.518 1.00 220.41 ? 283 GLY A O     1 
ATOM   2028  N  N     . ILE A 1 284 ? -37.595 11.410 -53.298 1.00 233.51 ? 284 ILE A N     1 
ATOM   2029  C  CA    . ILE A 1 284 ? -37.906 12.713 -52.710 1.00 230.49 ? 284 ILE A CA    1 
ATOM   2030  C  C     . ILE A 1 284 ? -39.348 13.003 -53.049 1.00 213.29 ? 284 ILE A C     1 
ATOM   2031  O  O     . ILE A 1 284 ? -39.760 12.825 -54.193 1.00 235.80 ? 284 ILE A O     1 
ATOM   2032  C  CB    . ILE A 1 284 ? -37.025 13.844 -53.265 1.00 239.04 ? 284 ILE A CB    1 
ATOM   2033  N  N     . ALA A 1 285 ? -40.130 13.426 -52.069 1.00 169.11 ? 285 ALA A N     1 
ATOM   2034  C  CA    . ALA A 1 285 ? -41.562 13.530 -52.303 1.00 162.14 ? 285 ALA A CA    1 
ATOM   2035  C  C     . ALA A 1 285 ? -42.162 14.876 -51.911 1.00 180.32 ? 285 ALA A C     1 
ATOM   2036  O  O     . ALA A 1 285 ? -43.332 15.148 -52.187 1.00 184.09 ? 285 ALA A O     1 
ATOM   2037  C  CB    . ALA A 1 285 ? -42.272 12.405 -51.596 1.00 150.98 ? 285 ALA A CB    1 
ATOM   2038  N  N     . VAL A 1 287 ? -41.435 17.524 -48.359 1.00 143.23 ? 287 VAL A N     1 
ATOM   2039  C  CA    . VAL A 1 287 ? -40.850 17.934 -47.071 1.00 147.33 ? 287 VAL A CA    1 
ATOM   2040  C  C     . VAL A 1 287 ? -41.655 19.040 -46.362 1.00 130.27 ? 287 VAL A C     1 
ATOM   2041  O  O     . VAL A 1 287 ? -41.810 20.143 -46.889 1.00 128.00 ? 287 VAL A O     1 
ATOM   2042  C  CB    . VAL A 1 287 ? -39.371 18.391 -47.227 1.00 127.57 ? 287 VAL A CB    1 
ATOM   2043  N  N     . ARG A 1 288 ? -42.156 18.736 -45.166 1.00 119.52 ? 288 ARG A N     1 
ATOM   2044  C  CA    . ARG A 1 288 ? -42.977 19.677 -44.396 1.00 122.67 ? 288 ARG A CA    1 
ATOM   2045  C  C     . ARG A 1 288 ? -42.460 19.830 -42.956 1.00 138.48 ? 288 ARG A C     1 
ATOM   2046  O  O     . ARG A 1 288 ? -41.976 18.866 -42.361 1.00 153.91 ? 288 ARG A O     1 
ATOM   2047  C  CB    . ARG A 1 288 ? -44.459 19.248 -44.395 1.00 98.92  ? 288 ARG A CB    1 
ATOM   2048  N  N     . ASP A 1 289 ? -42.555 21.032 -42.396 1.00 121.68 ? 289 ASP A N     1 
ATOM   2049  C  CA    . ASP A 1 289 ? -42.205 21.201 -40.995 1.00 143.15 ? 289 ASP A CA    1 
ATOM   2050  C  C     . ASP A 1 289 ? -43.472 21.499 -40.218 1.00 157.12 ? 289 ASP A C     1 
ATOM   2051  O  O     . ASP A 1 289 ? -44.151 22.490 -40.476 1.00 175.53 ? 289 ASP A O     1 
ATOM   2052  C  CB    . ASP A 1 289 ? -41.155 22.303 -40.776 1.00 161.79 ? 289 ASP A CB    1 
ATOM   2053  C  CG    . ASP A 1 289 ? -40.890 22.600 -39.273 1.00 188.28 ? 289 ASP A CG    1 
ATOM   2054  O  OD1   . ASP A 1 289 ? -40.014 23.445 -38.978 1.00 185.15 ? 289 ASP A OD1   1 
ATOM   2055  O  OD2   . ASP A 1 289 ? -41.549 22.002 -38.389 1.00 180.94 ? 289 ASP A OD2   1 
ATOM   2056  N  N     . GLU A 1 290 ? -43.794 20.630 -39.268 1.00 153.29 ? 290 GLU A N     1 
ATOM   2057  C  CA    . GLU A 1 290 ? -44.970 20.835 -38.443 1.00 156.86 ? 290 GLU A CA    1 
ATOM   2058  C  C     . GLU A 1 290 ? -44.547 20.841 -36.985 1.00 146.39 ? 290 GLU A C     1 
ATOM   2059  O  O     . GLU A 1 290 ? -44.788 19.888 -36.245 1.00 145.69 ? 290 GLU A O     1 
ATOM   2060  C  CB    . GLU A 1 290 ? -45.986 19.721 -38.691 1.00 173.95 ? 290 GLU A CB    1 
ATOM   2061  N  N     . SER A 1 291 ? -43.962 21.952 -36.561 1.00 146.51 ? 291 SER A N     1 
ATOM   2062  C  CA    . SER A 1 291 ? -43.421 22.053 -35.215 1.00 148.63 ? 291 SER A CA    1 
ATOM   2063  C  C     . SER A 1 291 ? -44.111 23.174 -34.458 1.00 155.13 ? 291 SER A C     1 
ATOM   2064  O  O     . SER A 1 291 ? -44.318 24.264 -34.993 1.00 159.28 ? 291 SER A O     1 
ATOM   2065  C  CB    . SER A 1 291 ? -41.913 22.306 -35.271 1.00 134.77 ? 291 SER A CB    1 
ATOM   2066  O  OG    . SER A 1 291 ? -41.185 21.156 -35.658 1.00 121.37 ? 291 SER A OG    1 
ATOM   2067  N  N     . ASP A 1 292 ? -44.482 22.895 -33.216 1.00 158.20 ? 292 ASP A N     1 
ATOM   2068  C  CA    . ASP A 1 292 ? -45.126 23.896 -32.382 1.00 181.94 ? 292 ASP A CA    1 
ATOM   2069  C  C     . ASP A 1 292 ? -44.491 23.952 -31.003 1.00 188.08 ? 292 ASP A C     1 
ATOM   2070  O  O     . ASP A 1 292 ? -43.772 23.039 -30.602 1.00 190.78 ? 292 ASP A O     1 
ATOM   2071  C  CB    . ASP A 1 292 ? -46.617 23.594 -32.248 1.00 205.38 ? 292 ASP A CB    1 
ATOM   2072  C  CG    . ASP A 1 292 ? -46.887 22.278 -31.535 1.00 215.72 ? 292 ASP A CG    1 
ATOM   2073  O  OD1   . ASP A 1 292 ? -46.412 22.098 -30.388 1.00 209.20 ? 292 ASP A OD1   1 
ATOM   2074  O  OD2   . ASP A 1 292 ? -47.591 21.429 -32.125 1.00 223.29 ? 292 ASP A OD2   1 
ATOM   2075  N  N     . ARG A 1 293 ? -44.764 25.036 -30.289 1.00 197.79 ? 293 ARG A N     1 
ATOM   2076  C  CA    . ARG A 1 293 ? -44.352 25.188 -28.896 1.00 209.97 ? 293 ARG A CA    1 
ATOM   2077  C  C     . ARG A 1 293 ? -44.565 23.887 -28.096 1.00 218.92 ? 293 ARG A C     1 
ATOM   2078  O  O     . ARG A 1 293 ? -45.659 23.626 -27.608 1.00 231.56 ? 293 ARG A O     1 
ATOM   2079  C  CB    . ARG A 1 293 ? -45.022 26.436 -28.248 1.00 184.25 ? 293 ARG A CB    1 
ATOM   2080  C  CG    . ARG A 1 293 ? -46.092 26.204 -27.157 1.00 177.97 ? 293 ARG A CG    1 
ATOM   2081  C  CD    . ARG A 1 293 ? -47.411 26.961 -27.425 1.00 171.64 ? 293 ARG A CD    1 
ATOM   2082  N  NE    . ARG A 1 293 ? -48.260 26.227 -28.365 1.00 179.39 ? 293 ARG A NE    1 
ATOM   2083  C  CZ    . ARG A 1 293 ? -48.742 26.713 -29.507 1.00 175.70 ? 293 ARG A CZ    1 
ATOM   2084  N  NH1   . ARG A 1 293 ? -48.494 27.969 -29.854 1.00 187.78 ? 293 ARG A NH1   1 
ATOM   2085  N  NH2   . ARG A 1 293 ? -49.490 25.942 -30.297 1.00 149.44 ? 293 ARG A NH2   1 
ATOM   2086  N  N     . ASP A 1 294 ? -43.506 23.074 -28.020 1.00 210.18 ? 294 ASP A N     1 
ATOM   2087  C  CA    . ASP A 1 294 ? -43.456 21.781 -27.301 1.00 205.84 ? 294 ASP A CA    1 
ATOM   2088  C  C     . ASP A 1 294 ? -43.311 20.530 -28.198 1.00 191.70 ? 294 ASP A C     1 
ATOM   2089  O  O     . ASP A 1 294 ? -44.173 19.645 -28.229 1.00 183.58 ? 294 ASP A O     1 
ATOM   2090  C  CB    . ASP A 1 294 ? -44.599 21.616 -26.283 1.00 215.99 ? 294 ASP A CB    1 
ATOM   2091  C  CG    . ASP A 1 294 ? -45.946 21.312 -26.935 1.00 232.29 ? 294 ASP A CG    1 
ATOM   2092  O  OD1   . ASP A 1 294 ? -46.969 21.410 -26.221 1.00 241.33 ? 294 ASP A OD1   1 
ATOM   2093  O  OD2   . ASP A 1 294 ? -45.994 20.993 -28.146 1.00 232.51 ? 294 ASP A OD2   1 
ATOM   2094  N  N     . GLY A 1 295 ? -42.192 20.459 -28.911 1.00 181.21 ? 295 GLY A N     1 
ATOM   2095  C  CA    . GLY A 1 295 ? -41.891 19.300 -29.729 1.00 169.95 ? 295 GLY A CA    1 
ATOM   2096  C  C     . GLY A 1 295 ? -41.356 19.648 -31.104 1.00 158.99 ? 295 GLY A C     1 
ATOM   2097  O  O     . GLY A 1 295 ? -41.839 20.574 -31.753 1.00 164.88 ? 295 GLY A O     1 
ATOM   2098  N  N     . LEU A 1 296 ? -40.375 18.882 -31.567 1.00 143.53 ? 296 LEU A N     1 
ATOM   2099  C  CA    . LEU A 1 296 ? -39.823 19.086 -32.896 1.00 129.11 ? 296 LEU A CA    1 
ATOM   2100  C  C     . LEU A 1 296 ? -40.311 17.977 -33.810 1.00 142.15 ? 296 LEU A C     1 
ATOM   2101  O  O     . LEU A 1 296 ? -40.258 16.800 -33.456 1.00 151.94 ? 296 LEU A O     1 
ATOM   2102  C  CB    . LEU A 1 296 ? -38.298 19.103 -32.843 1.00 129.86 ? 296 LEU A CB    1 
ATOM   2103  C  CG    . LEU A 1 296 ? -37.613 19.548 -34.140 1.00 125.88 ? 296 LEU A CG    1 
ATOM   2104  C  CD1   . LEU A 1 296 ? -36.189 20.104 -33.891 1.00 115.13 ? 296 LEU A CD1   1 
ATOM   2105  C  CD2   . LEU A 1 296 ? -37.613 18.416 -35.172 1.00 124.15 ? 296 LEU A CD2   1 
ATOM   2106  N  N     . ARG A 1 297 ? -40.832 18.364 -34.969 1.00 150.51 ? 297 ARG A N     1 
ATOM   2107  C  CA    . ARG A 1 297 ? -41.344 17.404 -35.942 1.00 152.15 ? 297 ARG A CA    1 
ATOM   2108  C  C     . ARG A 1 297 ? -41.068 17.868 -37.368 1.00 144.52 ? 297 ARG A C     1 
ATOM   2109  O  O     . ARG A 1 297 ? -41.572 18.904 -37.795 1.00 148.24 ? 297 ARG A O     1 
ATOM   2110  C  CB    . ARG A 1 297 ? -42.844 17.129 -35.698 1.00 150.62 ? 297 ARG A CB    1 
ATOM   2111  C  CG    . ARG A 1 297 ? -43.626 16.549 -36.880 1.00 153.56 ? 297 ARG A CG    1 
ATOM   2112  C  CD    . ARG A 1 297 ? -44.992 15.961 -36.451 1.00 159.82 ? 297 ARG A CD    1 
ATOM   2113  N  NE    . ARG A 1 297 ? -44.950 14.502 -36.336 1.00 163.59 ? 297 ARG A NE    1 
ATOM   2114  C  CZ    . ARG A 1 297 ? -45.308 13.665 -37.309 1.00 166.80 ? 297 ARG A CZ    1 
ATOM   2115  N  NH1   . ARG A 1 297 ? -45.760 14.135 -38.466 1.00 165.31 ? 297 ARG A NH1   1 
ATOM   2116  N  NH2   . ARG A 1 297 ? -45.221 12.355 -37.126 1.00 173.45 ? 297 ARG A NH2   1 
ATOM   2117  N  N     . ILE A 1 298 ? -40.275 17.100 -38.107 1.00 141.94 ? 298 ILE A N     1 
ATOM   2118  C  CA    . ILE A 1 298 ? -40.068 17.379 -39.524 1.00 143.14 ? 298 ILE A CA    1 
ATOM   2119  C  C     . ILE A 1 298 ? -40.438 16.140 -40.290 1.00 157.13 ? 298 ILE A C     1 
ATOM   2120  O  O     . ILE A 1 298 ? -39.874 15.069 -40.054 1.00 166.36 ? 298 ILE A O     1 
ATOM   2121  C  CB    . ILE A 1 298 ? -38.620 17.742 -39.897 1.00 133.97 ? 298 ILE A CB    1 
ATOM   2122  C  CG1   . ILE A 1 298 ? -38.109 18.908 -39.047 1.00 143.81 ? 298 ILE A CG1   1 
ATOM   2123  C  CG2   . ILE A 1 298 ? -38.548 18.107 -41.368 1.00 110.70 ? 298 ILE A CG2   1 
ATOM   2124  C  CD1   . ILE A 1 298 ? -36.647 19.196 -39.257 1.00 145.12 ? 298 ILE A CD1   1 
ATOM   2125  N  N     . ALA A 1 299 ? -41.370 16.298 -41.225 1.00 154.77 ? 299 ALA A N     1 
ATOM   2126  C  CA    . ALA A 1 299 ? -41.937 15.167 -41.937 1.00 151.77 ? 299 ALA A CA    1 
ATOM   2127  C  C     . ALA A 1 299 ? -41.452 15.122 -43.374 1.00 154.39 ? 299 ALA A C     1 
ATOM   2128  O  O     . ALA A 1 299 ? -41.638 16.064 -44.145 1.00 155.46 ? 299 ALA A O     1 
ATOM   2129  N  N     . ILE A 1 300 ? -40.834 14.004 -43.723 1.00 149.03 ? 300 ILE A N     1 
ATOM   2130  C  CA    . ILE A 1 300 ? -40.417 13.754 -45.083 1.00 158.38 ? 300 ILE A CA    1 
ATOM   2131  C  C     . ILE A 1 300 ? -41.222 12.556 -45.542 1.00 176.19 ? 300 ILE A C     1 
ATOM   2132  O  O     . ILE A 1 300 ? -40.872 11.413 -45.255 1.00 182.01 ? 300 ILE A O     1 
ATOM   2133  C  CB    . ILE A 1 300 ? -38.921 13.423 -45.146 1.00 166.56 ? 300 ILE A CB    1 
ATOM   2134  C  CG1   . ILE A 1 300 ? -38.088 14.631 -44.726 1.00 176.51 ? 300 ILE A CG1   1 
ATOM   2135  C  CG2   . ILE A 1 300 ? -38.528 13.010 -46.538 1.00 166.52 ? 300 ILE A CG2   1 
ATOM   2136  C  CD1   . ILE A 1 300 ? -36.623 14.502 -45.080 1.00 177.48 ? 300 ILE A CD1   1 
ATOM   2137  N  N     . GLU A 1 301 ? -42.281 12.824 -46.296 1.00 182.87 ? 301 GLU A N     1 
ATOM   2138  C  CA    . GLU A 1 301 ? -43.249 11.795 -46.647 1.00 186.07 ? 301 GLU A CA    1 
ATOM   2139  C  C     . GLU A 1 301 ? -42.998 11.387 -48.084 1.00 188.97 ? 301 GLU A C     1 
ATOM   2140  O  O     . GLU A 1 301 ? -42.913 12.235 -48.966 1.00 193.54 ? 301 GLU A O     1 
ATOM   2141  C  CB    . GLU A 1 301 ? -44.679 12.316 -46.457 1.00 173.93 ? 301 GLU A CB    1 
ATOM   2142  N  N     . LEU A 1 302 ? -42.905 10.085 -48.321 1.00 180.25 ? 302 LEU A N     1 
ATOM   2143  C  CA    . LEU A 1 302 ? -42.271 9.587  -49.533 1.00 179.76 ? 302 LEU A CA    1 
ATOM   2144  C  C     . LEU A 1 302 ? -43.268 9.092  -50.570 1.00 193.32 ? 302 LEU A C     1 
ATOM   2145  O  O     . LEU A 1 302 ? -44.450 8.924  -50.273 1.00 201.76 ? 302 LEU A O     1 
ATOM   2146  C  CB    . LEU A 1 302 ? -41.224 8.534  -49.178 1.00 171.59 ? 302 LEU A CB    1 
ATOM   2147  C  CG    . LEU A 1 302 ? -40.080 9.180  -48.400 1.00 166.16 ? 302 LEU A CG    1 
ATOM   2148  C  CD1   . LEU A 1 302 ? -38.902 8.235  -48.157 1.00 152.58 ? 302 LEU A CD1   1 
ATOM   2149  C  CD2   . LEU A 1 302 ? -39.638 10.419 -49.169 1.00 172.74 ? 302 LEU A CD2   1 
ATOM   2150  N  N     . LYS A 1 303 ? -42.785 8.857  -51.787 1.00 195.34 ? 303 LYS A N     1 
ATOM   2151  C  CA    . LYS A 1 303 ? -43.667 8.701  -52.941 1.00 186.86 ? 303 LYS A CA    1 
ATOM   2152  C  C     . LYS A 1 303 ? -44.014 7.237  -53.226 1.00 207.14 ? 303 LYS A C     1 
ATOM   2153  O  O     . LYS A 1 303 ? -44.766 6.617  -52.470 1.00 213.15 ? 303 LYS A O     1 
ATOM   2154  C  CB    . LYS A 1 303 ? -43.072 9.403  -54.178 1.00 158.95 ? 303 LYS A CB    1 
ATOM   2155  N  N     . LYS A 1 304 ? -43.482 6.686  -54.312 1.00 208.63 ? 304 LYS A N     1 
ATOM   2156  C  CA    . LYS A 1 304 ? -43.827 5.326  -54.714 1.00 202.12 ? 304 LYS A CA    1 
ATOM   2157  C  C     . LYS A 1 304 ? -42.710 4.346  -54.369 1.00 217.64 ? 304 LYS A C     1 
ATOM   2158  O  O     . LYS A 1 304 ? -42.787 3.631  -53.365 1.00 218.07 ? 304 LYS A O     1 
ATOM   2159  C  CB    . LYS A 1 304 ? -44.128 5.285  -56.213 1.00 188.47 ? 304 LYS A CB    1 
ATOM   2160  N  N     . ASP A 1 305 ? -41.681 4.313  -55.213 1.00 227.92 ? 305 ASP A N     1 
ATOM   2161  C  CA    . ASP A 1 305 ? -40.481 3.529  -54.939 1.00 222.07 ? 305 ASP A CA    1 
ATOM   2162  C  C     . ASP A 1 305 ? -39.870 3.969  -53.607 1.00 222.19 ? 305 ASP A C     1 
ATOM   2163  O  O     . ASP A 1 305 ? -39.066 4.909  -53.547 1.00 201.09 ? 305 ASP A O     1 
ATOM   2164  C  CB    . ASP A 1 305 ? -39.470 3.644  -56.088 1.00 206.46 ? 305 ASP A CB    1 
ATOM   2165  N  N     . ALA A 1 306 ? -40.273 3.286  -52.539 1.00 234.82 ? 306 ALA A N     1 
ATOM   2166  C  CA    . ALA A 1 306 ? -39.817 3.609  -51.195 1.00 235.04 ? 306 ALA A CA    1 
ATOM   2167  C  C     . ALA A 1 306 ? -38.360 3.207  -50.990 1.00 238.27 ? 306 ALA A C     1 
ATOM   2168  O  O     . ALA A 1 306 ? -38.026 2.479  -50.054 1.00 240.17 ? 306 ALA A O     1 
ATOM   2169  C  CB    . ALA A 1 306 ? -40.715 2.962  -50.148 1.00 235.30 ? 306 ALA A CB    1 
ATOM   2170  N  N     . ASN A 1 307 ? -37.504 3.680  -51.889 1.00 235.62 ? 307 ASN A N     1 
ATOM   2171  C  CA    . ASN A 1 307 ? -36.060 3.601  -51.725 1.00 234.90 ? 307 ASN A CA    1 
ATOM   2172  C  C     . ASN A 1 307 ? -35.636 4.349  -50.472 1.00 246.48 ? 307 ASN A C     1 
ATOM   2173  O  O     . ASN A 1 307 ? -34.566 4.942  -50.441 1.00 254.83 ? 307 ASN A O     1 
ATOM   2174  C  CB    . ASN A 1 307 ? -35.338 4.172  -52.944 1.00 226.33 ? 307 ASN A CB    1 
ATOM   2175  N  N     . THR A 1 308 ? -36.513 4.377  -49.471 1.00 243.60 ? 308 THR A N     1 
ATOM   2176  C  CA    . THR A 1 308 ? -36.331 5.202  -48.278 1.00 229.53 ? 308 THR A CA    1 
ATOM   2177  C  C     . THR A 1 308 ? -34.926 5.125  -47.680 1.00 216.35 ? 308 THR A C     1 
ATOM   2178  O  O     . THR A 1 308 ? -34.347 6.148  -47.351 1.00 216.21 ? 308 THR A O     1 
ATOM   2179  C  CB    . THR A 1 308 ? -37.392 4.895  -47.187 1.00 170.78 ? 308 THR A CB    1 
ATOM   2180  O  OG1   . THR A 1 308 ? -36.877 3.921  -46.274 1.00 180.96 ? 308 THR A OG1   1 
ATOM   2181  C  CG2   . THR A 1 308 ? -38.692 4.377  -47.813 1.00 167.78 ? 308 THR A CG2   1 
ATOM   2182  N  N     . GLU A 1 309 ? -34.383 3.921  -47.532 1.00 210.44 ? 309 GLU A N     1 
ATOM   2183  C  CA    . GLU A 1 309 ? -33.045 3.756  -46.959 1.00 213.22 ? 309 GLU A CA    1 
ATOM   2184  C  C     . GLU A 1 309 ? -31.969 4.499  -47.754 1.00 209.18 ? 309 GLU A C     1 
ATOM   2185  O  O     . GLU A 1 309 ? -31.081 5.127  -47.182 1.00 211.03 ? 309 GLU A O     1 
ATOM   2186  C  CB    . GLU A 1 309 ? -32.689 2.274  -46.850 1.00 227.34 ? 309 GLU A CB    1 
ATOM   2187  C  CG    . GLU A 1 309 ? -33.378 1.560  -45.705 1.00 235.62 ? 309 GLU A CG    1 
ATOM   2188  C  CD    . GLU A 1 309 ? -32.825 1.976  -44.361 1.00 240.33 ? 309 GLU A CD    1 
ATOM   2189  O  OE1   . GLU A 1 309 ? -31.614 2.282  -44.288 1.00 242.32 ? 309 GLU A OE1   1 
ATOM   2190  O  OE2   . GLU A 1 309 ? -33.600 1.994  -43.381 1.00 241.96 ? 309 GLU A OE2   1 
ATOM   2191  N  N     . LEU A 1 310 ? -32.038 4.386  -49.075 1.00 209.80 ? 310 LEU A N     1 
ATOM   2192  C  CA    . LEU A 1 310 ? -31.191 5.158  -49.978 1.00 203.33 ? 310 LEU A CA    1 
ATOM   2193  C  C     . LEU A 1 310 ? -31.444 6.662  -49.831 1.00 204.66 ? 310 LEU A C     1 
ATOM   2194  O  O     . LEU A 1 310 ? -30.501 7.449  -49.836 1.00 207.51 ? 310 LEU A O     1 
ATOM   2195  C  CB    . LEU A 1 310 ? -31.393 4.705  -51.436 1.00 192.27 ? 310 LEU A CB    1 
ATOM   2196  N  N     . VAL A 1 311 ? -32.714 7.055  -49.717 1.00 203.51 ? 311 VAL A N     1 
ATOM   2197  C  CA    . VAL A 1 311 ? -33.085 8.468  -49.556 1.00 201.17 ? 311 VAL A CA    1 
ATOM   2198  C  C     . VAL A 1 311 ? -32.563 9.063  -48.243 1.00 191.32 ? 311 VAL A C     1 
ATOM   2199  O  O     . VAL A 1 311 ? -32.000 10.159 -48.222 1.00 182.37 ? 311 VAL A O     1 
ATOM   2200  C  CB    . VAL A 1 311 ? -34.626 8.695  -49.646 1.00 141.41 ? 311 VAL A CB    1 
ATOM   2201  N  N     . LEU A 1 312 ? -32.776 8.335  -47.152 1.00 186.42 ? 312 LEU A N     1 
ATOM   2202  C  CA    . LEU A 1 312 ? -32.294 8.717  -45.832 1.00 182.04 ? 312 LEU A CA    1 
ATOM   2203  C  C     . LEU A 1 312 ? -30.769 8.760  -45.816 1.00 179.36 ? 312 LEU A C     1 
ATOM   2204  O  O     . LEU A 1 312 ? -30.172 9.746  -45.378 1.00 179.72 ? 312 LEU A O     1 
ATOM   2205  C  CB    . LEU A 1 312 ? -32.788 7.714  -44.784 1.00 179.14 ? 312 LEU A CB    1 
ATOM   2206  C  CG    . LEU A 1 312 ? -32.992 8.167  -43.331 1.00 172.33 ? 312 LEU A CG    1 
ATOM   2207  C  CD1   . LEU A 1 312 ? -33.110 6.946  -42.430 1.00 175.08 ? 312 LEU A CD1   1 
ATOM   2208  C  CD2   . LEU A 1 312 ? -31.883 9.092  -42.839 1.00 158.81 ? 312 LEU A CD2   1 
ATOM   2209  N  N     . ASN A 1 313 ? -30.147 7.678  -46.279 1.00 175.58 ? 313 ASN A N     1 
ATOM   2210  C  CA    . ASN A 1 313 ? -28.690 7.590  -46.342 1.00 167.20 ? 313 ASN A CA    1 
ATOM   2211  C  C     . ASN A 1 313 ? -28.108 8.732  -47.176 1.00 180.69 ? 313 ASN A C     1 
ATOM   2212  O  O     . ASN A 1 313 ? -27.041 9.263  -46.863 1.00 180.44 ? 313 ASN A O     1 
ATOM   2213  C  CB    . ASN A 1 313 ? -28.224 6.207  -46.838 1.00 135.45 ? 313 ASN A CB    1 
ATOM   2214  N  N     . TYR A 1 314 ? -28.808 9.101  -48.246 1.00 188.29 ? 314 TYR A N     1 
ATOM   2215  C  CA    . TYR A 1 314 ? -28.400 10.249 -49.049 1.00 187.39 ? 314 TYR A CA    1 
ATOM   2216  C  C     . TYR A 1 314 ? -28.523 11.536 -48.244 1.00 174.73 ? 314 TYR A C     1 
ATOM   2217  O  O     . TYR A 1 314 ? -27.564 12.295 -48.127 1.00 169.42 ? 314 TYR A O     1 
ATOM   2218  C  CB    . TYR A 1 314 ? -29.205 10.350 -50.358 1.00 187.22 ? 314 TYR A CB    1 
ATOM   2219  C  CG    . TYR A 1 314 ? -28.858 11.579 -51.178 1.00 181.57 ? 314 TYR A CG    1 
ATOM   2220  C  CD1   . TYR A 1 314 ? -29.735 12.661 -51.253 1.00 183.59 ? 314 TYR A CD1   1 
ATOM   2221  C  CD2   . TYR A 1 314 ? -27.639 11.673 -51.847 1.00 172.91 ? 314 TYR A CD2   1 
ATOM   2222  C  CE1   . TYR A 1 314 ? -29.414 13.793 -51.984 1.00 184.80 ? 314 TYR A CE1   1 
ATOM   2223  C  CE2   . TYR A 1 314 ? -27.309 12.801 -52.579 1.00 174.79 ? 314 TYR A CE2   1 
ATOM   2224  C  CZ    . TYR A 1 314 ? -28.202 13.856 -52.645 1.00 186.97 ? 314 TYR A CZ    1 
ATOM   2225  O  OH    . TYR A 1 314 ? -27.885 14.981 -53.371 1.00 194.80 ? 314 TYR A OH    1 
ATOM   2226  N  N     . LEU A 1 315 ? -29.703 11.772 -47.681 1.00 166.73 ? 315 LEU A N     1 
ATOM   2227  C  CA    . LEU A 1 315 ? -29.934 12.978 -46.896 1.00 156.84 ? 315 LEU A CA    1 
ATOM   2228  C  C     . LEU A 1 315 ? -28.833 13.189 -45.864 1.00 160.67 ? 315 LEU A C     1 
ATOM   2229  O  O     . LEU A 1 315 ? -28.333 14.301 -45.712 1.00 158.25 ? 315 LEU A O     1 
ATOM   2230  C  CB    . LEU A 1 315 ? -31.296 12.936 -46.208 1.00 141.29 ? 315 LEU A CB    1 
ATOM   2231  C  CG    . LEU A 1 315 ? -32.494 13.389 -47.042 1.00 134.04 ? 315 LEU A CG    1 
ATOM   2232  C  CD1   . LEU A 1 315 ? -33.742 13.387 -46.171 1.00 131.08 ? 315 LEU A CD1   1 
ATOM   2233  C  CD2   . LEU A 1 315 ? -32.291 14.775 -47.674 1.00 126.47 ? 315 LEU A CD2   1 
ATOM   2234  N  N     . PHE A 1 316 ? -28.451 12.124 -45.164 1.00 164.00 ? 316 PHE A N     1 
ATOM   2235  C  CA    . PHE A 1 316 ? -27.362 12.218 -44.198 1.00 161.90 ? 316 PHE A CA    1 
ATOM   2236  C  C     . PHE A 1 316 ? -26.102 12.791 -44.846 1.00 165.58 ? 316 PHE A C     1 
ATOM   2237  O  O     . PHE A 1 316 ? -25.528 13.766 -44.354 1.00 166.49 ? 316 PHE A O     1 
ATOM   2238  C  CB    . PHE A 1 316 ? -27.061 10.860 -43.571 1.00 168.46 ? 316 PHE A CB    1 
ATOM   2239  C  CG    . PHE A 1 316 ? -28.001 10.476 -42.471 1.00 186.77 ? 316 PHE A CG    1 
ATOM   2240  C  CD1   . PHE A 1 316 ? -28.187 9.144  -42.134 1.00 196.28 ? 316 PHE A CD1   1 
ATOM   2241  C  CD2   . PHE A 1 316 ? -28.700 11.442 -41.771 1.00 197.19 ? 316 PHE A CD2   1 
ATOM   2242  C  CE1   . PHE A 1 316 ? -29.047 8.779  -41.113 1.00 201.69 ? 316 PHE A CE1   1 
ATOM   2243  C  CE2   . PHE A 1 316 ? -29.565 11.085 -40.750 1.00 204.43 ? 316 PHE A CE2   1 
ATOM   2244  C  CZ    . PHE A 1 316 ? -29.739 9.750  -40.422 1.00 205.30 ? 316 PHE A CZ    1 
ATOM   2245  N  N     . LYS A 1 317 ? -25.677 12.190 -45.953 1.00 166.02 ? 317 LYS A N     1 
ATOM   2246  C  CA    . LYS A 1 317 ? -24.484 12.653 -46.653 1.00 159.65 ? 317 LYS A CA    1 
ATOM   2247  C  C     . LYS A 1 317 ? -24.654 14.090 -47.161 1.00 164.91 ? 317 LYS A C     1 
ATOM   2248  O  O     . LYS A 1 317 ? -23.949 15.004 -46.725 1.00 159.78 ? 317 LYS A O     1 
ATOM   2249  C  CB    . LYS A 1 317 ? -24.124 11.699 -47.805 1.00 139.72 ? 317 LYS A CB    1 
ATOM   2250  N  N     . TYR A 1 318 ? -25.610 14.273 -48.068 1.00 172.50 ? 318 TYR A N     1 
ATOM   2251  C  CA    . TYR A 1 318 ? -25.813 15.535 -48.788 1.00 177.70 ? 318 TYR A CA    1 
ATOM   2252  C  C     . TYR A 1 318 ? -26.370 16.747 -48.009 1.00 168.50 ? 318 TYR A C     1 
ATOM   2253  O  O     . TYR A 1 318 ? -26.283 17.874 -48.504 1.00 156.46 ? 318 TYR A O     1 
ATOM   2254  C  CB    . TYR A 1 318 ? -26.675 15.288 -50.033 1.00 181.15 ? 318 TYR A CB    1 
ATOM   2255  N  N     . THR A 1 319 ? -26.964 16.531 -46.832 1.00 168.40 ? 319 THR A N     1 
ATOM   2256  C  CA    . THR A 1 319 ? -27.448 17.653 -46.009 1.00 159.92 ? 319 THR A CA    1 
ATOM   2257  C  C     . THR A 1 319 ? -26.963 17.603 -44.566 1.00 154.90 ? 319 THR A C     1 
ATOM   2258  O  O     . THR A 1 319 ? -26.236 16.686 -44.162 1.00 150.26 ? 319 THR A O     1 
ATOM   2259  C  CB    . THR A 1 319 ? -28.991 17.779 -45.963 1.00 161.67 ? 319 THR A CB    1 
ATOM   2260  O  OG1   . THR A 1 319 ? -29.531 16.843 -45.020 1.00 158.89 ? 319 THR A OG1   1 
ATOM   2261  C  CG2   . THR A 1 319 ? -29.605 17.553 -47.327 1.00 170.95 ? 319 THR A CG2   1 
ATOM   2262  N  N     . ASP A 1 320 ? -27.387 18.597 -43.791 1.00 150.10 ? 320 ASP A N     1 
ATOM   2263  C  CA    . ASP A 1 320 ? -26.906 18.745 -42.425 1.00 141.75 ? 320 ASP A CA    1 
ATOM   2264  C  C     . ASP A 1 320 ? -27.753 17.965 -41.419 1.00 148.93 ? 320 ASP A C     1 
ATOM   2265  O  O     . ASP A 1 320 ? -27.772 18.304 -40.240 1.00 153.07 ? 320 ASP A O     1 
ATOM   2266  C  CB    . ASP A 1 320 ? -26.803 20.227 -42.041 1.00 117.26 ? 320 ASP A CB    1 
ATOM   2267  N  N     . LEU A 1 321 ? -28.447 16.926 -41.887 1.00 143.19 ? 321 LEU A N     1 
ATOM   2268  C  CA    . LEU A 1 321 ? -29.118 15.983 -40.992 1.00 135.21 ? 321 LEU A CA    1 
ATOM   2269  C  C     . LEU A 1 321 ? -28.084 15.156 -40.233 1.00 136.19 ? 321 LEU A C     1 
ATOM   2270  O  O     . LEU A 1 321 ? -28.322 14.688 -39.116 1.00 143.32 ? 321 LEU A O     1 
ATOM   2271  C  CB    . LEU A 1 321 ? -30.048 15.062 -41.771 1.00 136.75 ? 321 LEU A CB    1 
ATOM   2272  C  CG    . LEU A 1 321 ? -31.503 15.499 -41.837 1.00 138.49 ? 321 LEU A CG    1 
ATOM   2273  C  CD1   . LEU A 1 321 ? -32.360 14.333 -42.267 1.00 134.37 ? 321 LEU A CD1   1 
ATOM   2274  C  CD2   . LEU A 1 321 ? -31.938 15.998 -40.474 1.00 146.99 ? 321 LEU A CD2   1 
ATOM   2275  N  N     . GLN A 1 322 ? -26.935 14.965 -40.863 1.00 127.51 ? 322 GLN A N     1 
ATOM   2276  C  CA    . GLN A 1 322 ? -25.786 14.393 -40.190 1.00 137.81 ? 322 GLN A CA    1 
ATOM   2277  C  C     . GLN A 1 322 ? -24.599 15.279 -40.515 1.00 141.53 ? 322 GLN A C     1 
ATOM   2278  O  O     . GLN A 1 322 ? -24.336 15.589 -41.682 1.00 153.40 ? 322 GLN A O     1 
ATOM   2279  C  CB    . GLN A 1 322 ? -25.527 12.946 -40.642 1.00 151.36 ? 322 GLN A CB    1 
ATOM   2280  N  N     . ILE A 1 323 ? -23.909 15.713 -39.470 1.00 132.13 ? 323 ILE A N     1 
ATOM   2281  C  CA    . ILE A 1 323 ? -22.721 16.538 -39.604 1.00 129.61 ? 323 ILE A CA    1 
ATOM   2282  C  C     . ILE A 1 323 ? -21.684 15.964 -38.687 1.00 133.87 ? 323 ILE A C     1 
ATOM   2283  O  O     . ILE A 1 323 ? -21.929 14.967 -38.004 1.00 143.92 ? 323 ILE A O     1 
ATOM   2284  C  CB    . ILE A 1 323 ? -22.951 17.970 -39.144 1.00 126.88 ? 323 ILE A CB    1 
ATOM   2285  C  CG1   . ILE A 1 323 ? -23.029 18.009 -37.611 1.00 119.82 ? 323 ILE A CG1   1 
ATOM   2286  C  CG2   . ILE A 1 323 ? -24.198 18.554 -39.826 1.00 127.80 ? 323 ILE A CG2   1 
ATOM   2287  C  CD1   . ILE A 1 323 ? -23.661 19.261 -37.079 1.00 122.24 ? 323 ILE A CD1   1 
ATOM   2288  N  N     . ASN A 1 324 ? -20.512 16.576 -38.683 1.00 134.78 ? 324 ASN A N     1 
ATOM   2289  C  CA    . ASN A 1 324 ? -19.555 16.269 -37.638 1.00 152.83 ? 324 ASN A CA    1 
ATOM   2290  C  C     . ASN A 1 324 ? -19.303 17.456 -36.743 1.00 151.54 ? 324 ASN A C     1 
ATOM   2291  O  O     . ASN A 1 324 ? -19.337 18.606 -37.175 1.00 161.75 ? 324 ASN A O     1 
ATOM   2292  C  CB    . ASN A 1 324 ? -18.210 15.806 -38.199 1.00 163.36 ? 324 ASN A CB    1 
ATOM   2293  C  CG    . ASN A 1 324 ? -18.292 15.387 -39.631 1.00 163.16 ? 324 ASN A CG    1 
ATOM   2294  O  OD1   . ASN A 1 324 ? -18.441 14.206 -39.929 1.00 153.11 ? 324 ASN A OD1   1 
ATOM   2295  N  ND2   . ASN A 1 324 ? -18.196 16.356 -40.538 1.00 168.21 ? 324 ASN A ND2   1 
ATOM   2296  N  N     . TYR A 1 325 ? -19.068 17.157 -35.478 1.00 140.79 ? 325 TYR A N     1 
ATOM   2297  C  CA    . TYR A 1 325 ? -18.792 18.185 -34.513 1.00 133.02 ? 325 TYR A CA    1 
ATOM   2298  C  C     . TYR A 1 325 ? -17.327 18.066 -34.180 1.00 135.21 ? 325 TYR A C     1 
ATOM   2299  O  O     . TYR A 1 325 ? -16.788 16.965 -34.046 1.00 123.73 ? 325 TYR A O     1 
ATOM   2300  C  CB    . TYR A 1 325 ? -19.655 18.007 -33.264 1.00 127.70 ? 325 TYR A CB    1 
ATOM   2301  C  CG    . TYR A 1 325 ? -19.325 19.022 -32.213 1.00 118.81 ? 325 TYR A CG    1 
ATOM   2302  C  CD1   . TYR A 1 325 ? -18.279 18.806 -31.321 1.00 107.40 ? 325 TYR A CD1   1 
ATOM   2303  C  CD2   . TYR A 1 325 ? -20.029 20.213 -32.138 1.00 124.74 ? 325 TYR A CD2   1 
ATOM   2304  C  CE1   . TYR A 1 325 ? -17.949 19.743 -30.378 1.00 118.80 ? 325 TYR A CE1   1 
ATOM   2305  C  CE2   . TYR A 1 325 ? -19.711 21.159 -31.199 1.00 137.60 ? 325 TYR A CE2   1 
ATOM   2306  C  CZ    . TYR A 1 325 ? -18.667 20.924 -30.316 1.00 139.24 ? 325 TYR A CZ    1 
ATOM   2307  O  OH    . TYR A 1 325 ? -18.350 21.876 -29.372 1.00 145.77 ? 325 TYR A OH    1 
ATOM   2308  N  N     . ASN A 1 326 ? -16.675 19.209 -34.054 1.00 144.64 ? 326 ASN A N     1 
ATOM   2309  C  CA    . ASN A 1 326 ? -15.249 19.205 -33.843 1.00 138.85 ? 326 ASN A CA    1 
ATOM   2310  C  C     . ASN A 1 326 ? -14.881 19.686 -32.477 1.00 136.05 ? 326 ASN A C     1 
ATOM   2311  O  O     . ASN A 1 326 ? -15.482 20.610 -31.947 1.00 153.29 ? 326 ASN A O     1 
ATOM   2312  C  CB    . ASN A 1 326 ? -14.552 20.015 -34.906 1.00 136.85 ? 326 ASN A CB    1 
ATOM   2313  C  CG    . ASN A 1 326 ? -14.223 19.181 -36.105 1.00 143.48 ? 326 ASN A CG    1 
ATOM   2314  O  OD1   . ASN A 1 326 ? -13.448 18.218 -36.019 1.00 137.24 ? 326 ASN A OD1   1 
ATOM   2315  N  ND2   . ASN A 1 326 ? -14.825 19.522 -37.236 1.00 142.94 ? 326 ASN A ND2   1 
ATOM   2316  N  N     . PHE A 1 327 ? -13.869 19.052 -31.914 1.00 124.27 ? 327 PHE A N     1 
ATOM   2317  C  CA    . PHE A 1 327 ? -13.445 19.372 -30.582 1.00 124.43 ? 327 PHE A CA    1 
ATOM   2318  C  C     . PHE A 1 327 ? -12.216 20.213 -30.728 1.00 124.74 ? 327 PHE A C     1 
ATOM   2319  O  O     . PHE A 1 327 ? -11.263 19.846 -31.418 1.00 133.13 ? 327 PHE A O     1 
ATOM   2320  C  CB    . PHE A 1 327 ? -13.110 18.112 -29.802 1.00 128.73 ? 327 PHE A CB    1 
ATOM   2321  C  CG    . PHE A 1 327 ? -14.306 17.336 -29.344 1.00 132.52 ? 327 PHE A CG    1 
ATOM   2322  C  CD1   . PHE A 1 327 ? -14.512 17.092 -27.994 1.00 137.70 ? 327 PHE A CD1   1 
ATOM   2323  C  CD2   . PHE A 1 327 ? -15.211 16.835 -30.257 1.00 143.36 ? 327 PHE A CD2   1 
ATOM   2324  C  CE1   . PHE A 1 327 ? -15.599 16.360 -27.564 1.00 144.10 ? 327 PHE A CE1   1 
ATOM   2325  C  CE2   . PHE A 1 327 ? -16.305 16.103 -29.833 1.00 153.92 ? 327 PHE A CE2   1 
ATOM   2326  C  CZ    . PHE A 1 327 ? -16.497 15.864 -28.484 1.00 151.62 ? 327 PHE A CZ    1 
ATOM   2327  N  N     . ASN A 1 328 ? -12.270 21.381 -30.117 1.00 111.45 ? 328 ASN A N     1 
ATOM   2328  C  CA    . ASN A 1 328 ? -11.097 22.196 -29.993 1.00 121.61 ? 328 ASN A CA    1 
ATOM   2329  C  C     . ASN A 1 328 ? -11.119 22.790 -28.612 1.00 130.21 ? 328 ASN A C     1 
ATOM   2330  O  O     . ASN A 1 328 ? -11.502 23.948 -28.420 1.00 125.70 ? 328 ASN A O     1 
ATOM   2331  C  CB    . ASN A 1 328 ? -11.145 23.301 -31.016 1.00 116.34 ? 328 ASN A CB    1 
ATOM   2332  C  CG    . ASN A 1 328 ? -9.798  23.832 -31.309 1.00 119.67 ? 328 ASN A CG    1 
ATOM   2333  O  OD1   . ASN A 1 328 ? -9.655  24.967 -31.764 1.00 131.41 ? 328 ASN A OD1   1 
ATOM   2334  N  ND2   . ASN A 1 328 ? -8.772  23.015 -31.041 1.00 115.89 ? 328 ASN A ND2   1 
ATOM   2335  N  N     . MET A 1 329 ? -10.641 22.027 -27.644 1.00 130.69 ? 329 MET A N     1 
ATOM   2336  C  CA    . MET A 1 329 ? -10.885 22.439 -26.285 1.00 129.27 ? 329 MET A CA    1 
ATOM   2337  C  C     . MET A 1 329 ? -9.703  23.243 -25.836 1.00 124.43 ? 329 MET A C     1 
ATOM   2338  O  O     . MET A 1 329 ? -8.611  22.735 -25.602 1.00 125.57 ? 329 MET A O     1 
ATOM   2339  C  CB    . MET A 1 329 ? -11.217 21.259 -25.373 1.00 129.45 ? 329 MET A CB    1 
ATOM   2340  C  CG    . MET A 1 329 ? -12.565 20.647 -25.714 1.00 136.24 ? 329 MET A CG    1 
ATOM   2341  S  SD    . MET A 1 329 ? -13.249 19.599 -24.434 1.00 166.40 ? 329 MET A SD    1 
ATOM   2342  C  CE    . MET A 1 329 ? -11.963 18.372 -24.306 1.00 111.02 ? 329 MET A CE    1 
ATOM   2343  N  N     . VAL A 1 330 ? -9.963  24.535 -25.760 1.00 116.36 ? 330 VAL A N     1 
ATOM   2344  C  CA    . VAL A 1 330 ? -8.959  25.511 -25.461 1.00 109.27 ? 330 VAL A CA    1 
ATOM   2345  C  C     . VAL A 1 330 ? -9.520  26.438 -24.417 1.00 110.14 ? 330 VAL A C     1 
ATOM   2346  O  O     . VAL A 1 330 ? -10.548 27.071 -24.626 1.00 117.30 ? 330 VAL A O     1 
ATOM   2347  C  CB    . VAL A 1 330 ? -8.719  26.322 -26.672 1.00 103.11 ? 330 VAL A CB    1 
ATOM   2348  C  CG1   . VAL A 1 330 ? -7.791  27.467 -26.334 1.00 103.50 ? 330 VAL A CG1   1 
ATOM   2349  C  CG2   . VAL A 1 330 ? -8.172  25.427 -27.733 1.00 107.36 ? 330 VAL A CG2   1 
ATOM   2350  N  N     . ALA A 1 331 ? -8.851  26.519 -23.283 1.00 106.61 ? 331 ALA A N     1 
ATOM   2351  C  CA    . ALA A 1 331 ? -9.287  27.445 -22.264 1.00 116.96 ? 331 ALA A CA    1 
ATOM   2352  C  C     . ALA A 1 331 ? -8.120  28.248 -21.721 1.00 117.22 ? 331 ALA A C     1 
ATOM   2353  O  O     . ALA A 1 331 ? -6.955  27.993 -22.032 1.00 106.57 ? 331 ALA A O     1 
ATOM   2354  C  CB    . ALA A 1 331 ? -10.007 26.723 -21.153 1.00 129.80 ? 331 ALA A CB    1 
ATOM   2355  N  N     . ILE A 1 332 ? -8.442  29.209 -20.874 1.00 117.42 ? 332 ILE A N     1 
ATOM   2356  C  CA    . ILE A 1 332 ? -7.411  29.993 -20.252 1.00 111.27 ? 332 ILE A CA    1 
ATOM   2357  C  C     . ILE A 1 332 ? -7.078  29.413 -18.893 1.00 127.24 ? 332 ILE A C     1 
ATOM   2358  O  O     . ILE A 1 332 ? -7.913  29.418 -17.984 1.00 128.90 ? 332 ILE A O     1 
ATOM   2359  C  CB    . ILE A 1 332 ? -7.884  31.389 -20.065 1.00 102.92 ? 332 ILE A CB    1 
ATOM   2360  C  CG1   . ILE A 1 332 ? -8.045  32.043 -21.426 1.00 106.04 ? 332 ILE A CG1   1 
ATOM   2361  C  CG2   . ILE A 1 332 ? -6.901  32.122 -19.220 1.00 109.58 ? 332 ILE A CG2   1 
ATOM   2362  C  CD1   . ILE A 1 332 ? -6.778  32.023 -22.244 1.00 107.28 ? 332 ILE A CD1   1 
ATOM   2363  N  N     . ASP A 1 333 ? -5.853  28.897 -18.778 1.00 138.28 ? 333 ASP A N     1 
ATOM   2364  C  CA    . ASP A 1 333 ? -5.295  28.451 -17.500 1.00 135.34 ? 333 ASP A CA    1 
ATOM   2365  C  C     . ASP A 1 333 ? -4.030  29.258 -17.254 1.00 138.21 ? 333 ASP A C     1 
ATOM   2366  O  O     . ASP A 1 333 ? -3.253  29.512 -18.173 1.00 130.81 ? 333 ASP A O     1 
ATOM   2367  C  CB    . ASP A 1 333 ? -4.994  26.933 -17.458 1.00 102.90 ? 333 ASP A CB    1 
ATOM   2368  N  N     . ASN A 1 334 ? -3.848  29.689 -16.014 1.00 144.58 ? 334 ASN A N     1 
ATOM   2369  C  CA    . ASN A 1 334 ? -2.679  30.466 -15.658 1.00 138.54 ? 334 ASN A CA    1 
ATOM   2370  C  C     . ASN A 1 334 ? -2.520  31.699 -16.543 1.00 128.89 ? 334 ASN A C     1 
ATOM   2371  O  O     . ASN A 1 334 ? -1.416  32.033 -16.972 1.00 123.85 ? 334 ASN A O     1 
ATOM   2372  C  CB    . ASN A 1 334 ? -1.442  29.592 -15.741 1.00 140.79 ? 334 ASN A CB    1 
ATOM   2373  C  CG    . ASN A 1 334 ? -0.329  30.115 -14.898 1.00 144.99 ? 334 ASN A CG    1 
ATOM   2374  O  OD1   . ASN A 1 334 ? 0.846   29.886 -15.198 1.00 154.95 ? 334 ASN A OD1   1 
ATOM   2375  N  ND2   . ASN A 1 334 ? -0.684  30.843 -13.829 1.00 131.73 ? 334 ASN A ND2   1 
ATOM   2376  N  N     . PHE A 1 335 ? -3.630  32.377 -16.808 1.00 116.65 ? 335 PHE A N     1 
ATOM   2377  C  CA    . PHE A 1 335 ? -3.602  33.597 -17.609 1.00 110.41 ? 335 PHE A CA    1 
ATOM   2378  C  C     . PHE A 1 335 ? -3.192  33.343 -19.052 1.00 104.41 ? 335 PHE A C     1 
ATOM   2379  O  O     . PHE A 1 335 ? -2.899  34.293 -19.777 1.00 98.01  ? 335 PHE A O     1 
ATOM   2380  C  CB    . PHE A 1 335 ? -2.645  34.630 -17.014 1.00 115.18 ? 335 PHE A CB    1 
ATOM   2381  C  CG    . PHE A 1 335 ? -2.994  35.053 -15.629 1.00 129.23 ? 335 PHE A CG    1 
ATOM   2382  C  CD1   . PHE A 1 335 ? -2.170  34.736 -14.571 1.00 126.90 ? 335 PHE A CD1   1 
ATOM   2383  C  CD2   . PHE A 1 335 ? -4.157  35.768 -15.378 1.00 149.30 ? 335 PHE A CD2   1 
ATOM   2384  C  CE1   . PHE A 1 335 ? -2.502  35.124 -13.280 1.00 133.47 ? 335 PHE A CE1   1 
ATOM   2385  C  CE2   . PHE A 1 335 ? -4.495  36.164 -14.085 1.00 146.06 ? 335 PHE A CE2   1 
ATOM   2386  C  CZ    . PHE A 1 335 ? -3.666  35.840 -13.037 1.00 132.86 ? 335 PHE A CZ    1 
ATOM   2387  N  N     . THR A 1 336 ? -3.175  32.079 -19.473 1.00 108.70 ? 336 THR A N     1 
ATOM   2388  C  CA    . THR A 1 336 ? -2.733  31.747 -20.830 1.00 112.36 ? 336 THR A CA    1 
ATOM   2389  C  C     . THR A 1 336 ? -3.532  30.661 -21.572 1.00 116.68 ? 336 THR A C     1 
ATOM   2390  O  O     . THR A 1 336 ? -4.140  29.790 -20.948 1.00 123.76 ? 336 THR A O     1 
ATOM   2391  C  CB    . THR A 1 336 ? -1.253  31.376 -20.842 1.00 107.47 ? 336 THR A CB    1 
ATOM   2392  O  OG1   . THR A 1 336 ? -1.107  30.102 -21.469 1.00 116.85 ? 336 THR A OG1   1 
ATOM   2393  C  CG2   . THR A 1 336 ? -0.729  31.288 -19.439 1.00 91.63  ? 336 THR A CG2   1 
ATOM   2394  N  N     . PRO A 1 337 ? -3.516  30.717 -22.919 1.00 109.49 ? 337 PRO A N     1 
ATOM   2395  C  CA    . PRO A 1 337 ? -4.216  29.762 -23.791 1.00 96.99  ? 337 PRO A CA    1 
ATOM   2396  C  C     . PRO A 1 337 ? -3.608  28.388 -23.705 1.00 103.82 ? 337 PRO A C     1 
ATOM   2397  O  O     . PRO A 1 337 ? -2.441  28.234 -24.033 1.00 111.81 ? 337 PRO A O     1 
ATOM   2398  C  CB    . PRO A 1 337 ? -3.941  30.287 -25.211 1.00 93.65  ? 337 PRO A CB    1 
ATOM   2399  C  CG    . PRO A 1 337 ? -3.413  31.666 -25.048 1.00 104.64 ? 337 PRO A CG    1 
ATOM   2400  C  CD    . PRO A 1 337 ? -2.775  31.733 -23.692 1.00 109.04 ? 337 PRO A CD    1 
ATOM   2401  N  N     . ARG A 1 338 ? -4.380  27.405 -23.269 1.00 119.20 ? 338 ARG A N     1 
ATOM   2402  C  CA    . ARG A 1 338 ? -3.955  26.013 -23.356 1.00 128.12 ? 338 ARG A CA    1 
ATOM   2403  C  C     . ARG A 1 338 ? -4.988  25.224 -24.154 1.00 121.78 ? 338 ARG A C     1 
ATOM   2404  O  O     . ARG A 1 338 ? -6.194  25.457 -24.039 1.00 121.81 ? 338 ARG A O     1 
ATOM   2405  C  CB    . ARG A 1 338 ? -3.747  25.373 -21.957 1.00 75.40  ? 338 ARG A CB    1 
ATOM   2406  N  N     . GLN A 1 339 ? -4.517  24.282 -24.957 1.00 110.75 ? 339 GLN A N     1 
ATOM   2407  C  CA    . GLN A 1 339 ? -5.434  23.322 -25.528 1.00 110.90 ? 339 GLN A CA    1 
ATOM   2408  C  C     . GLN A 1 339 ? -5.343  22.115 -24.629 1.00 119.13 ? 339 GLN A C     1 
ATOM   2409  O  O     . GLN A 1 339 ? -4.277  21.530 -24.459 1.00 120.64 ? 339 GLN A O     1 
ATOM   2410  C  CB    . GLN A 1 339 ? -5.090  22.968 -26.966 1.00 109.85 ? 339 GLN A CB    1 
ATOM   2411  C  CG    . GLN A 1 339 ? -5.341  21.510 -27.268 1.00 130.29 ? 339 GLN A CG    1 
ATOM   2412  C  CD    . GLN A 1 339 ? -5.432  21.225 -28.747 1.00 148.10 ? 339 GLN A CD    1 
ATOM   2413  O  OE1   . GLN A 1 339 ? -5.085  20.128 -29.198 1.00 154.56 ? 339 GLN A OE1   1 
ATOM   2414  N  NE2   . GLN A 1 339 ? -5.906  22.208 -29.517 1.00 146.58 ? 339 GLN A NE2   1 
ATOM   2415  N  N     . VAL A 1 340 ? -6.470  21.763 -24.029 1.00 129.30 ? 340 VAL A N     1 
ATOM   2416  C  CA    . VAL A 1 340 ? -6.469  20.833 -22.918 1.00 133.52 ? 340 VAL A CA    1 
ATOM   2417  C  C     . VAL A 1 340 ? -7.478  19.722 -23.108 1.00 126.22 ? 340 VAL A C     1 
ATOM   2418  O  O     . VAL A 1 340 ? -8.494  19.901 -23.768 1.00 125.46 ? 340 VAL A O     1 
ATOM   2419  C  CB    . VAL A 1 340 ? -6.795  21.578 -21.634 1.00 137.31 ? 340 VAL A CB    1 
ATOM   2420  C  CG1   . VAL A 1 340 ? -5.687  22.579 -21.342 1.00 145.21 ? 340 VAL A CG1   1 
ATOM   2421  C  CG2   . VAL A 1 340 ? -8.134  22.284 -21.778 1.00 125.60 ? 340 VAL A CG2   1 
ATOM   2422  N  N     . GLY A 1 341 ? -7.181  18.569 -22.524 1.00 132.33 ? 341 GLY A N     1 
ATOM   2423  C  CA    . GLY A 1 341 ? -8.108  17.455 -22.522 1.00 143.15 ? 341 GLY A CA    1 
ATOM   2424  C  C     . GLY A 1 341 ? -9.026  17.468 -21.311 1.00 133.65 ? 341 GLY A C     1 
ATOM   2425  O  O     . GLY A 1 341 ? -9.150  18.475 -20.614 1.00 125.09 ? 341 GLY A O     1 
ATOM   2426  N  N     . ILE A 1 342 ? -9.680  16.344 -21.056 1.00 126.84 ? 342 ILE A N     1 
ATOM   2427  C  CA    . ILE A 1 342 ? -10.586 16.275 -19.933 1.00 129.08 ? 342 ILE A CA    1 
ATOM   2428  C  C     . ILE A 1 342 ? -9.823  16.329 -18.620 1.00 131.57 ? 342 ILE A C     1 
ATOM   2429  O  O     . ILE A 1 342 ? -10.232 17.016 -17.686 1.00 130.95 ? 342 ILE A O     1 
ATOM   2430  C  CB    . ILE A 1 342 ? -11.441 15.025 -19.992 1.00 135.88 ? 342 ILE A CB    1 
ATOM   2431  C  CG1   . ILE A 1 342 ? -12.843 15.403 -20.476 1.00 151.76 ? 342 ILE A CG1   1 
ATOM   2432  C  CG2   . ILE A 1 342 ? -11.498 14.374 -18.624 1.00 129.79 ? 342 ILE A CG2   1 
ATOM   2433  C  CD1   . ILE A 1 342 ? -13.940 14.428 -20.051 1.00 163.98 ? 342 ILE A CD1   1 
ATOM   2434  N  N     . VAL A 1 343 ? -8.710  15.608 -18.560 1.00 142.63 ? 343 VAL A N     1 
ATOM   2435  C  CA    . VAL A 1 343 ? -7.917  15.509 -17.337 1.00 139.06 ? 343 VAL A CA    1 
ATOM   2436  C  C     . VAL A 1 343 ? -7.432  16.851 -16.771 1.00 134.54 ? 343 VAL A C     1 
ATOM   2437  O  O     . VAL A 1 343 ? -7.551  17.096 -15.572 1.00 133.04 ? 343 VAL A O     1 
ATOM   2438  C  CB    . VAL A 1 343 ? -6.732  14.567 -17.540 1.00 130.27 ? 343 VAL A CB    1 
ATOM   2439  C  CG1   . VAL A 1 343 ? -5.682  14.827 -16.494 1.00 125.35 ? 343 VAL A CG1   1 
ATOM   2440  C  CG2   . VAL A 1 343 ? -7.211  13.132 -17.501 1.00 122.83 ? 343 VAL A CG2   1 
ATOM   2441  N  N     . PRO A 1 344 ? -6.856  17.710 -17.625 1.00 136.02 ? 344 PRO A N     1 
ATOM   2442  C  CA    . PRO A 1 344 ? -6.477  19.061 -17.201 1.00 137.16 ? 344 PRO A CA    1 
ATOM   2443  C  C     . PRO A 1 344 ? -7.679  19.890 -16.767 1.00 144.15 ? 344 PRO A C     1 
ATOM   2444  O  O     . PRO A 1 344 ? -7.589  20.584 -15.758 1.00 151.18 ? 344 PRO A O     1 
ATOM   2445  C  CB    . PRO A 1 344 ? -5.871  19.666 -18.464 1.00 137.67 ? 344 PRO A CB    1 
ATOM   2446  C  CG    . PRO A 1 344 ? -5.362  18.496 -19.215 1.00 154.80 ? 344 PRO A CG    1 
ATOM   2447  C  CD    . PRO A 1 344 ? -6.346  17.395 -18.967 1.00 150.09 ? 344 PRO A CD    1 
ATOM   2448  N  N     . ILE A 1 345 ? -8.776  19.837 -17.519 1.00 142.83 ? 345 ILE A N     1 
ATOM   2449  C  CA    . ILE A 1 345 ? -9.959  20.611 -17.158 1.00 134.31 ? 345 ILE A CA    1 
ATOM   2450  C  C     . ILE A 1 345 ? -10.446 20.186 -15.797 1.00 127.15 ? 345 ILE A C     1 
ATOM   2451  O  O     . ILE A 1 345 ? -10.549 21.001 -14.881 1.00 136.92 ? 345 ILE A O     1 
ATOM   2452  C  CB    . ILE A 1 345 ? -11.128 20.417 -18.125 1.00 131.10 ? 345 ILE A CB    1 
ATOM   2453  C  CG1   . ILE A 1 345 ? -10.727 20.824 -19.542 1.00 132.83 ? 345 ILE A CG1   1 
ATOM   2454  C  CG2   . ILE A 1 345 ? -12.334 21.238 -17.660 1.00 119.04 ? 345 ILE A CG2   1 
ATOM   2455  C  CD1   . ILE A 1 345 ? -11.642 20.260 -20.597 1.00 134.48 ? 345 ILE A CD1   1 
ATOM   2456  N  N     . LEU A 1 346 ? -10.740 18.897 -15.671 1.00 127.15 ? 346 LEU A N     1 
ATOM   2457  C  CA    . LEU A 1 346 ? -11.236 18.348 -14.418 1.00 140.16 ? 346 LEU A CA    1 
ATOM   2458  C  C     . LEU A 1 346 ? -10.292 18.669 -13.266 1.00 134.79 ? 346 LEU A C     1 
ATOM   2459  O  O     . LEU A 1 346 ? -10.708 19.191 -12.226 1.00 139.00 ? 346 LEU A O     1 
ATOM   2460  C  CB    . LEU A 1 346 ? -11.440 16.840 -14.548 1.00 141.86 ? 346 LEU A CB    1 
ATOM   2461  C  CG    . LEU A 1 346 ? -12.733 16.427 -15.251 1.00 139.81 ? 346 LEU A CG    1 
ATOM   2462  C  CD1   . LEU A 1 346 ? -12.800 14.918 -15.361 1.00 139.41 ? 346 LEU A CD1   1 
ATOM   2463  C  CD2   . LEU A 1 346 ? -13.948 16.966 -14.495 1.00 134.42 ? 346 LEU A CD2   1 
ATOM   2464  N  N     . SER A 1 347 ? -9.016  18.376 -13.459 1.00 119.96 ? 347 SER A N     1 
ATOM   2465  C  CA    . SER A 1 347 ? -8.057  18.627 -12.408 1.00 124.84 ? 347 SER A CA    1 
ATOM   2466  C  C     . SER A 1 347 ? -8.046  20.080 -11.985 1.00 128.85 ? 347 SER A C     1 
ATOM   2467  O  O     . SER A 1 347 ? -8.168  20.386 -10.806 1.00 140.21 ? 347 SER A O     1 
ATOM   2468  C  CB    . SER A 1 347 ? -6.663  18.269 -12.852 1.00 136.69 ? 347 SER A CB    1 
ATOM   2469  O  OG    . SER A 1 347 ? -5.758  18.902 -11.972 1.00 156.70 ? 347 SER A OG    1 
ATOM   2470  N  N     . SER A 1 348 ? -7.866  20.973 -12.948 1.00 127.83 ? 348 SER A N     1 
ATOM   2471  C  CA    . SER A 1 348 ? -7.752  22.391 -12.648 1.00 131.93 ? 348 SER A CA    1 
ATOM   2472  C  C     . SER A 1 348 ? -9.005  22.904 -11.954 1.00 122.39 ? 348 SER A C     1 
ATOM   2473  O  O     . SER A 1 348 ? -8.923  23.785 -11.100 1.00 127.39 ? 348 SER A O     1 
ATOM   2474  C  CB    . SER A 1 348 ? -7.438  23.208 -13.904 1.00 146.47 ? 348 SER A CB    1 
ATOM   2475  O  OG    . SER A 1 348 ? -8.502  23.158 -14.831 1.00 152.63 ? 348 SER A OG    1 
ATOM   2476  N  N     . TYR A 1 349 ? -10.163 22.372 -12.335 1.00 119.25 ? 349 TYR A N     1 
ATOM   2477  C  CA    . TYR A 1 349 ? -11.407 22.724 -11.649 1.00 128.60 ? 349 TYR A CA    1 
ATOM   2478  C  C     . TYR A 1 349 ? -11.353 22.289 -10.180 1.00 111.50 ? 349 TYR A C     1 
ATOM   2479  O  O     . TYR A 1 349 ? -11.660 23.061 -9.260  1.00 98.94  ? 349 TYR A O     1 
ATOM   2480  C  CB    . TYR A 1 349 ? -12.635 22.103 -12.341 1.00 133.99 ? 349 TYR A CB    1 
ATOM   2481  C  CG    . TYR A 1 349 ? -13.860 22.183 -11.467 1.00 130.00 ? 349 TYR A CG    1 
ATOM   2482  C  CD1   . TYR A 1 349 ? -14.643 23.325 -11.432 1.00 133.85 ? 349 TYR A CD1   1 
ATOM   2483  C  CD2   . TYR A 1 349 ? -14.199 21.139 -10.634 1.00 119.03 ? 349 TYR A CD2   1 
ATOM   2484  C  CE1   . TYR A 1 349 ? -15.743 23.405 -10.603 1.00 133.96 ? 349 TYR A CE1   1 
ATOM   2485  C  CE2   . TYR A 1 349 ? -15.290 21.213 -9.803  1.00 111.58 ? 349 TYR A CE2   1 
ATOM   2486  C  CZ    . TYR A 1 349 ? -16.058 22.337 -9.789  1.00 128.61 ? 349 TYR A CZ    1 
ATOM   2487  O  OH    . TYR A 1 349 ? -17.147 22.383 -8.950  1.00 141.92 ? 349 TYR A OH    1 
ATOM   2488  N  N     . ILE A 1 350 ? -10.965 21.038 -9.972  1.00 99.47  ? 350 ILE A N     1 
ATOM   2489  C  CA    . ILE A 1 350 ? -10.812 20.507 -8.630  1.00 117.03 ? 350 ILE A CA    1 
ATOM   2490  C  C     . ILE A 1 350 ? -9.907  21.374 -7.755  1.00 115.00 ? 350 ILE A C     1 
ATOM   2491  O  O     . ILE A 1 350 ? -10.288 21.773 -6.653  1.00 106.47 ? 350 ILE A O     1 
ATOM   2492  C  CB    . ILE A 1 350 ? -10.232 19.091 -8.668  1.00 117.50 ? 350 ILE A CB    1 
ATOM   2493  C  CG1   . ILE A 1 350 ? -11.306 18.097 -9.098  1.00 122.77 ? 350 ILE A CG1   1 
ATOM   2494  C  CG2   . ILE A 1 350 ? -9.680  18.722 -7.301  1.00 111.46 ? 350 ILE A CG2   1 
ATOM   2495  C  CD1   . ILE A 1 350 ? -10.797 16.691 -9.256  1.00 126.79 ? 350 ILE A CD1   1 
ATOM   2496  N  N     . ALA A 1 351 ? -8.706  21.655 -8.247  1.00 110.55 ? 351 ALA A N     1 
ATOM   2497  C  CA    . ALA A 1 351 ? -7.740  22.441 -7.496  1.00 112.42 ? 351 ALA A CA    1 
ATOM   2498  C  C     . ALA A 1 351 ? -8.299  23.818 -7.180  1.00 115.28 ? 351 ALA A C     1 
ATOM   2499  O  O     . ALA A 1 351 ? -7.924  24.439 -6.174  1.00 115.98 ? 351 ALA A O     1 
ATOM   2500  C  CB    . ALA A 1 351 ? -6.450  22.556 -8.242  1.00 114.42 ? 351 ALA A CB    1 
ATOM   2501  N  N     . HIS A 1 352 ? -9.176  24.303 -8.058  1.00 115.93 ? 352 HIS A N     1 
ATOM   2502  C  CA    . HIS A 1 352 ? -9.838  25.585 -7.837  1.00 112.14 ? 352 HIS A CA    1 
ATOM   2503  C  C     . HIS A 1 352 ? -10.749 25.475 -6.655  1.00 112.05 ? 352 HIS A C     1 
ATOM   2504  O  O     . HIS A 1 352 ? -10.676 26.251 -5.713  1.00 116.56 ? 352 HIS A O     1 
ATOM   2505  C  CB    . HIS A 1 352 ? -10.710 25.951 -9.017  1.00 113.83 ? 352 HIS A CB    1 
ATOM   2506  C  CG    . HIS A 1 352 ? -11.361 27.286 -8.880  1.00 118.51 ? 352 HIS A CG    1 
ATOM   2507  N  ND1   . HIS A 1 352 ? -12.727 27.446 -8.847  1.00 121.22 ? 352 HIS A ND1   1 
ATOM   2508  C  CD2   . HIS A 1 352 ? -10.831 28.525 -8.763  1.00 126.44 ? 352 HIS A CD2   1 
ATOM   2509  C  CE1   . HIS A 1 352 ? -13.013 28.729 -8.720  1.00 125.55 ? 352 HIS A CE1   1 
ATOM   2510  N  NE2   . HIS A 1 352 ? -11.881 29.405 -8.671  1.00 125.23 ? 352 HIS A NE2   1 
ATOM   2511  N  N     . ARG A 1 353 ? -11.628 24.494 -6.716  1.00 117.02 ? 353 ARG A N     1 
ATOM   2512  C  CA    . ARG A 1 353 ? -12.558 24.293 -5.634  1.00 121.64 ? 353 ARG A CA    1 
ATOM   2513  C  C     . ARG A 1 353 ? -11.809 24.207 -4.314  1.00 111.83 ? 353 ARG A C     1 
ATOM   2514  O  O     . ARG A 1 353 ? -12.344 24.612 -3.289  1.00 115.68 ? 353 ARG A O     1 
ATOM   2515  C  CB    . ARG A 1 353 ? -13.435 23.063 -5.897  1.00 123.89 ? 353 ARG A CB    1 
ATOM   2516  C  CG    . ARG A 1 353 ? -14.467 23.271 -7.038  1.00 129.64 ? 353 ARG A CG    1 
ATOM   2517  C  CD    . ARG A 1 353 ? -15.558 24.302 -6.662  1.00 130.19 ? 353 ARG A CD    1 
ATOM   2518  N  NE    . ARG A 1 353 ? -16.097 24.036 -5.329  1.00 139.89 ? 353 ARG A NE    1 
ATOM   2519  C  CZ    . ARG A 1 353 ? -16.911 24.842 -4.653  1.00 137.67 ? 353 ARG A CZ    1 
ATOM   2520  N  NH1   . ARG A 1 353 ? -17.311 25.995 -5.180  1.00 125.57 ? 353 ARG A NH1   1 
ATOM   2521  N  NH2   . ARG A 1 353 ? -17.327 24.480 -3.443  1.00 140.04 ? 353 ARG A NH2   1 
ATOM   2522  N  N     . ARG A 1 354 ? -10.577 23.691 -4.337  1.00 94.27  ? 354 ARG A N     1 
ATOM   2523  C  CA    . ARG A 1 354 ? -9.776  23.587 -3.108  1.00 116.47 ? 354 ARG A CA    1 
ATOM   2524  C  C     . ARG A 1 354 ? -9.434  24.954 -2.535  1.00 123.62 ? 354 ARG A C     1 
ATOM   2525  O  O     . ARG A 1 354 ? -9.650  25.224 -1.347  1.00 123.92 ? 354 ARG A O     1 
ATOM   2526  C  CB    . ARG A 1 354 ? -8.481  22.799 -3.316  1.00 109.56 ? 354 ARG A CB    1 
ATOM   2527  C  CG    . ARG A 1 354 ? -7.518  22.844 -2.098  1.00 111.61 ? 354 ARG A CG    1 
ATOM   2528  C  CD    . ARG A 1 354 ? -6.242  22.002 -2.323  1.00 115.25 ? 354 ARG A CD    1 
ATOM   2529  N  NE    . ARG A 1 354 ? -5.179  22.271 -1.352  1.00 121.02 ? 354 ARG A NE    1 
ATOM   2530  C  CZ    . ARG A 1 354 ? -4.265  23.233 -1.477  1.00 135.18 ? 354 ARG A CZ    1 
ATOM   2531  N  NH1   . ARG A 1 354 ? -4.277  24.042 -2.534  1.00 144.18 ? 354 ARG A NH1   1 
ATOM   2532  N  NH2   . ARG A 1 354 ? -3.335  23.394 -0.541  1.00 131.73 ? 354 ARG A NH2   1 
ATOM   2533  N  N     . GLU A 1 355 ? -8.880  25.811 -3.381  1.00 122.28 ? 355 GLU A N     1 
ATOM   2534  C  CA    . GLU A 1 355 ? -8.614  27.177 -2.974  1.00 132.15 ? 355 GLU A CA    1 
ATOM   2535  C  C     . GLU A 1 355 ? -9.902  27.799 -2.456  1.00 117.95 ? 355 GLU A C     1 
ATOM   2536  O  O     . GLU A 1 355 ? -9.900  28.474 -1.430  1.00 111.65 ? 355 GLU A O     1 
ATOM   2537  C  CB    . GLU A 1 355 ? -8.061  27.996 -4.143  1.00 149.54 ? 355 GLU A CB    1 
ATOM   2538  C  CG    . GLU A 1 355 ? -6.737  27.485 -4.690  1.00 166.53 ? 355 GLU A CG    1 
ATOM   2539  C  CD    . GLU A 1 355 ? -5.584  27.690 -3.725  1.00 175.81 ? 355 GLU A CD    1 
ATOM   2540  O  OE1   . GLU A 1 355 ? -4.468  27.212 -4.030  1.00 181.45 ? 355 GLU A OE1   1 
ATOM   2541  O  OE2   . GLU A 1 355 ? -5.794  28.327 -2.666  1.00 173.59 ? 355 GLU A OE2   1 
ATOM   2542  N  N     . VAL A 1 356 ? -11.006 27.568 -3.157  1.00 113.88 ? 356 VAL A N     1 
ATOM   2543  C  CA    . VAL A 1 356 ? -12.255 28.196 -2.759  1.00 119.95 ? 356 VAL A CA    1 
ATOM   2544  C  C     . VAL A 1 356 ? -12.624 27.768 -1.354  1.00 113.90 ? 356 VAL A C     1 
ATOM   2545  O  O     . VAL A 1 356 ? -12.817 28.598 -0.475  1.00 113.79 ? 356 VAL A O     1 
ATOM   2546  C  CB    . VAL A 1 356 ? -13.411 27.837 -3.675  1.00 116.88 ? 356 VAL A CB    1 
ATOM   2547  C  CG1   . VAL A 1 356 ? -14.654 28.609 -3.239  1.00 101.54 ? 356 VAL A CG1   1 
ATOM   2548  C  CG2   . VAL A 1 356 ? -13.056 28.173 -5.097  1.00 129.00 ? 356 VAL A CG2   1 
ATOM   2549  N  N     . ILE A 1 357 ? -12.700 26.462 -1.146  1.00 109.68 ? 357 ILE A N     1 
ATOM   2550  C  CA    . ILE A 1 357 ? -13.091 25.924 0.139   1.00 110.36 ? 357 ILE A CA    1 
ATOM   2551  C  C     . ILE A 1 357 ? -12.211 26.452 1.262   1.00 114.00 ? 357 ILE A C     1 
ATOM   2552  O  O     . ILE A 1 357 ? -12.720 26.965 2.259   1.00 114.43 ? 357 ILE A O     1 
ATOM   2553  C  CB    . ILE A 1 357 ? -13.022 24.413 0.129   1.00 115.78 ? 357 ILE A CB    1 
ATOM   2554  C  CG1   . ILE A 1 357 ? -14.111 23.861 -0.778  1.00 122.75 ? 357 ILE A CG1   1 
ATOM   2555  C  CG2   . ILE A 1 357 ? -13.206 23.874 1.532   1.00 118.44 ? 357 ILE A CG2   1 
ATOM   2556  C  CD1   . ILE A 1 357 ? -14.666 22.558 -0.279  1.00 134.37 ? 357 ILE A CD1   1 
ATOM   2557  N  N     . LEU A 1 358 ? -10.895 26.334 1.098   1.00 105.74 ? 358 LEU A N     1 
ATOM   2558  C  CA    . LEU A 1 358 ? -9.957  26.843 2.097   1.00 103.59 ? 358 LEU A CA    1 
ATOM   2559  C  C     . LEU A 1 358 ? -10.135 28.342 2.371   1.00 111.47 ? 358 LEU A C     1 
ATOM   2560  O  O     . LEU A 1 358 ? -10.182 28.771 3.520   1.00 130.04 ? 358 LEU A O     1 
ATOM   2561  C  CB    . LEU A 1 358 ? -8.509  26.554 1.692   1.00 106.32 ? 358 LEU A CB    1 
ATOM   2562  C  CG    . LEU A 1 358 ? -8.070  25.098 1.541   1.00 112.43 ? 358 LEU A CG    1 
ATOM   2563  C  CD1   . LEU A 1 358 ? -6.557  25.015 1.469   1.00 106.30 ? 358 LEU A CD1   1 
ATOM   2564  C  CD2   . LEU A 1 358 ? -8.596  24.255 2.694   1.00 123.92 ? 358 LEU A CD2   1 
ATOM   2565  N  N     . ALA A 1 359 ? -10.218 29.142 1.317   1.00 112.45 ? 359 ALA A N     1 
ATOM   2566  C  CA    . ALA A 1 359 ? -10.389 30.578 1.479   1.00 121.42 ? 359 ALA A CA    1 
ATOM   2567  C  C     . ALA A 1 359 ? -11.693 30.883 2.205   1.00 124.44 ? 359 ALA A C     1 
ATOM   2568  O  O     . ALA A 1 359 ? -11.749 31.743 3.081   1.00 129.99 ? 359 ALA A O     1 
ATOM   2569  C  CB    . ALA A 1 359 ? -10.368 31.245 0.149   1.00 131.09 ? 359 ALA A CB    1 
ATOM   2570  N  N     . ARG A 1 360 ? -12.743 30.169 1.828   1.00 125.78 ? 360 ARG A N     1 
ATOM   2571  C  CA    . ARG A 1 360 ? -14.036 30.324 2.466   1.00 124.00 ? 360 ARG A CA    1 
ATOM   2572  C  C     . ARG A 1 360 ? -13.907 30.076 3.954   1.00 120.56 ? 360 ARG A C     1 
ATOM   2573  O  O     . ARG A 1 360 ? -14.237 30.925 4.776   1.00 117.75 ? 360 ARG A O     1 
ATOM   2574  C  CB    . ARG A 1 360 ? -15.012 29.308 1.896   1.00 118.13 ? 360 ARG A CB    1 
ATOM   2575  C  CG    . ARG A 1 360 ? -16.394 29.464 2.437   1.00 125.35 ? 360 ARG A CG    1 
ATOM   2576  C  CD    . ARG A 1 360 ? -16.960 28.120 2.824   1.00 142.64 ? 360 ARG A CD    1 
ATOM   2577  N  NE    . ARG A 1 360 ? -17.291 27.305 1.665   1.00 144.02 ? 360 ARG A NE    1 
ATOM   2578  C  CZ    . ARG A 1 360 ? -17.286 25.982 1.683   1.00 151.11 ? 360 ARG A CZ    1 
ATOM   2579  N  NH1   . ARG A 1 360 ? -16.946 25.336 2.801   1.00 148.03 ? 360 ARG A NH1   1 
ATOM   2580  N  NH2   . ARG A 1 360 ? -17.604 25.312 0.586   1.00 155.08 ? 360 ARG A NH2   1 
ATOM   2581  N  N     . SER A 1 361 ? -13.421 28.895 4.298   1.00 126.37 ? 361 SER A N     1 
ATOM   2582  C  CA    . SER A 1 361 ? -13.312 28.521 5.697   1.00 129.90 ? 361 SER A CA    1 
ATOM   2583  C  C     . SER A 1 361 ? -12.485 29.540 6.477   1.00 133.86 ? 361 SER A C     1 
ATOM   2584  O  O     . SER A 1 361 ? -12.860 29.915 7.576   1.00 143.44 ? 361 SER A O     1 
ATOM   2585  C  CB    . SER A 1 361 ? -12.771 27.097 5.827   1.00 124.89 ? 361 SER A CB    1 
ATOM   2586  O  OG    . SER A 1 361 ? -13.676 26.187 5.210   1.00 125.93 ? 361 SER A OG    1 
ATOM   2587  N  N     . ARG A 1 362 ? -11.378 30.005 5.904   1.00 124.25 ? 362 ARG A N     1 
ATOM   2588  C  CA    . ARG A 1 362 ? -10.557 31.004 6.581   1.00 112.36 ? 362 ARG A CA    1 
ATOM   2589  C  C     . ARG A 1 362 ? -11.371 32.235 6.951   1.00 122.12 ? 362 ARG A C     1 
ATOM   2590  O  O     . ARG A 1 362 ? -11.251 32.763 8.055   1.00 133.02 ? 362 ARG A O     1 
ATOM   2591  C  CB    . ARG A 1 362 ? -9.344  31.383 5.748   1.00 103.56 ? 362 ARG A CB    1 
ATOM   2592  C  CG    . ARG A 1 362 ? -8.130  30.539 6.065   1.00 121.71 ? 362 ARG A CG    1 
ATOM   2593  C  CD    . ARG A 1 362 ? -6.877  30.967 5.303   1.00 135.27 ? 362 ARG A CD    1 
ATOM   2594  N  NE    . ARG A 1 362 ? -6.683  30.221 4.062   1.00 136.61 ? 362 ARG A NE    1 
ATOM   2595  C  CZ    . ARG A 1 362 ? -6.877  30.732 2.854   1.00 148.50 ? 362 ARG A CZ    1 
ATOM   2596  N  NH1   . ARG A 1 362 ? -7.271  31.996 2.721   1.00 142.12 ? 362 ARG A NH1   1 
ATOM   2597  N  NH2   . ARG A 1 362 ? -6.678  29.975 1.781   1.00 160.14 ? 362 ARG A NH2   1 
ATOM   2598  N  N     . PHE A 1 363 ? -12.198 32.691 6.020   1.00 112.48 ? 363 PHE A N     1 
ATOM   2599  C  CA    . PHE A 1 363 ? -13.092 33.818 6.261   1.00 112.58 ? 363 PHE A CA    1 
ATOM   2600  C  C     . PHE A 1 363 ? -14.123 33.512 7.332   1.00 107.86 ? 363 PHE A C     1 
ATOM   2601  O  O     . PHE A 1 363 ? -14.382 34.344 8.190   1.00 108.95 ? 363 PHE A O     1 
ATOM   2602  C  CB    . PHE A 1 363 ? -13.826 34.175 4.984   1.00 116.77 ? 363 PHE A CB    1 
ATOM   2603  C  CG    . PHE A 1 363 ? -14.781 35.326 5.121   1.00 120.19 ? 363 PHE A CG    1 
ATOM   2604  C  CD1   . PHE A 1 363 ? -14.334 36.628 5.014   1.00 144.14 ? 363 PHE A CD1   1 
ATOM   2605  C  CD2   . PHE A 1 363 ? -16.129 35.105 5.292   1.00 102.16 ? 363 PHE A CD2   1 
ATOM   2606  C  CE1   . PHE A 1 363 ? -15.217 37.689 5.090   1.00 148.96 ? 363 PHE A CE1   1 
ATOM   2607  C  CE2   . PHE A 1 363 ? -17.012 36.153 5.374   1.00 113.57 ? 363 PHE A CE2   1 
ATOM   2608  C  CZ    . PHE A 1 363 ? -16.560 37.445 5.272   1.00 138.40 ? 363 PHE A CZ    1 
ATOM   2609  N  N     . ASP A 1 364 ? -14.727 32.330 7.256   1.00 112.55 ? 364 ASP A N     1 
ATOM   2610  C  CA    . ASP A 1 364 ? -15.733 31.899 8.233   1.00 130.32 ? 364 ASP A CA    1 
ATOM   2611  C  C     . ASP A 1 364 ? -15.170 31.833 9.651   1.00 124.47 ? 364 ASP A C     1 
ATOM   2612  O  O     . ASP A 1 364 ? -15.840 32.189 10.627  1.00 103.04 ? 364 ASP A O     1 
ATOM   2613  C  CB    . ASP A 1 364 ? -16.265 30.512 7.859   1.00 156.15 ? 364 ASP A CB    1 
ATOM   2614  C  CG    . ASP A 1 364 ? -17.578 30.566 7.087   1.00 182.32 ? 364 ASP A CG    1 
ATOM   2615  O  OD1   . ASP A 1 364 ? -18.267 31.611 7.135   1.00 188.52 ? 364 ASP A OD1   1 
ATOM   2616  O  OD2   . ASP A 1 364 ? -17.926 29.550 6.442   1.00 192.39 ? 364 ASP A OD2   1 
ATOM   2617  N  N     . LYS A 1 365 ? -13.938 31.343 9.742   1.00 130.00 ? 365 LYS A N     1 
ATOM   2618  C  CA    . LYS A 1 365 ? -13.244 31.182 11.004  1.00 123.18 ? 365 LYS A CA    1 
ATOM   2619  C  C     . LYS A 1 365 ? -13.037 32.536 11.658  1.00 126.58 ? 365 LYS A C     1 
ATOM   2620  O  O     . LYS A 1 365 ? -13.426 32.721 12.802  1.00 131.06 ? 365 LYS A O     1 
ATOM   2621  C  CB    . LYS A 1 365 ? -11.917 30.446 10.790  1.00 119.71 ? 365 LYS A CB    1 
ATOM   2622  C  CG    . LYS A 1 365 ? -11.161 30.088 12.068  1.00 122.94 ? 365 LYS A CG    1 
ATOM   2623  C  CD    . LYS A 1 365 ? -10.229 28.891 11.876  1.00 116.03 ? 365 LYS A CD    1 
ATOM   2624  C  CE    . LYS A 1 365 ? -8.779  29.215 12.285  1.00 121.29 ? 365 LYS A CE    1 
ATOM   2625  N  NZ    . LYS A 1 365 ? -8.574  29.546 13.722  1.00 121.35 ? 365 LYS A NZ    1 
ATOM   2626  N  N     . GLU A 1 366 ? -12.461 33.492 10.932  1.00 126.56 ? 366 GLU A N     1 
ATOM   2627  C  CA    . GLU A 1 366 ? -12.265 34.835 11.489  1.00 125.16 ? 366 GLU A CA    1 
ATOM   2628  C  C     . GLU A 1 366 ? -13.579 35.379 12.050  1.00 125.22 ? 366 GLU A C     1 
ATOM   2629  O  O     . GLU A 1 366 ? -13.631 35.829 13.192  1.00 120.97 ? 366 GLU A O     1 
ATOM   2630  C  CB    . GLU A 1 366 ? -11.664 35.821 10.462  1.00 101.44 ? 366 GLU A CB    1 
ATOM   2631  N  N     . LYS A 1 367 ? -14.642 35.318 11.254  1.00 123.86 ? 367 LYS A N     1 
ATOM   2632  C  CA    . LYS A 1 367 ? -15.949 35.801 11.696  1.00 113.10 ? 367 LYS A CA    1 
ATOM   2633  C  C     . LYS A 1 367 ? -16.364 35.099 12.977  1.00 118.42 ? 367 LYS A C     1 
ATOM   2634  O  O     . LYS A 1 367 ? -16.797 35.748 13.927  1.00 124.05 ? 367 LYS A O     1 
ATOM   2635  C  CB    . LYS A 1 367 ? -17.044 35.667 10.615  1.00 98.35  ? 367 LYS A CB    1 
ATOM   2636  N  N     . ALA A 1 368 ? -16.222 33.777 13.008  1.00 119.95 ? 368 ALA A N     1 
ATOM   2637  C  CA    . ALA A 1 368 ? -16.539 33.026 14.218  1.00 119.67 ? 368 ALA A CA    1 
ATOM   2638  C  C     . ALA A 1 368 ? -15.754 33.587 15.401  1.00 124.99 ? 368 ALA A C     1 
ATOM   2639  O  O     . ALA A 1 368 ? -16.333 34.004 16.394  1.00 132.35 ? 368 ALA A O     1 
ATOM   2640  C  CB    . ALA A 1 368 ? -16.237 31.547 14.030  1.00 103.00 ? 368 ALA A CB    1 
ATOM   2641  N  N     . GLU A 1 369 ? -14.435 33.624 15.269  1.00 123.97 ? 369 GLU A N     1 
ATOM   2642  C  CA    . GLU A 1 369 ? -13.562 34.083 16.333  1.00 121.87 ? 369 GLU A CA    1 
ATOM   2643  C  C     . GLU A 1 369 ? -13.919 35.474 16.846  1.00 124.02 ? 369 GLU A C     1 
ATOM   2644  O  O     . GLU A 1 369 ? -13.814 35.732 18.044  1.00 130.16 ? 369 GLU A O     1 
ATOM   2645  C  CB    . GLU A 1 369 ? -12.112 34.019 15.871  1.00 129.02 ? 369 GLU A CB    1 
ATOM   2646  C  CG    . GLU A 1 369 ? -11.635 32.593 15.654  1.00 159.37 ? 369 GLU A CG    1 
ATOM   2647  C  CD    . GLU A 1 369 ? -10.378 32.505 14.802  1.00 191.92 ? 369 GLU A CD    1 
ATOM   2648  O  OE1   . GLU A 1 369 ? -9.512  31.655 15.114  1.00 207.24 ? 369 GLU A OE1   1 
ATOM   2649  O  OE2   . GLU A 1 369 ? -10.258 33.278 13.822  1.00 194.19 ? 369 GLU A OE2   1 
ATOM   2650  N  N     . LYS A 1 370 ? -14.329 36.371 15.955  1.00 114.93 ? 370 LYS A N     1 
ATOM   2651  C  CA    . LYS A 1 370 ? -14.697 37.728 16.374  1.00 118.75 ? 370 LYS A CA    1 
ATOM   2652  C  C     . LYS A 1 370 ? -15.914 37.732 17.287  1.00 129.86 ? 370 LYS A C     1 
ATOM   2653  O  O     . LYS A 1 370 ? -15.832 38.205 18.418  1.00 134.40 ? 370 LYS A O     1 
ATOM   2654  C  CB    . LYS A 1 370 ? -14.950 38.668 15.185  1.00 99.92  ? 370 LYS A CB    1 
ATOM   2655  N  N     . ARG A 1 371 ? -17.039 37.206 16.802  1.00 128.61 ? 371 ARG A N     1 
ATOM   2656  C  CA    . ARG A 1 371 ? -18.259 37.176 17.609  1.00 120.02 ? 371 ARG A CA    1 
ATOM   2657  C  C     . ARG A 1 371 ? -18.001 36.414 18.883  1.00 122.22 ? 371 ARG A C     1 
ATOM   2658  O  O     . ARG A 1 371 ? -18.532 36.760 19.925  1.00 125.73 ? 371 ARG A O     1 
ATOM   2659  C  CB    . ARG A 1 371 ? -19.387 36.503 16.851  1.00 111.15 ? 371 ARG A CB    1 
ATOM   2660  C  CG    . ARG A 1 371 ? -20.596 36.209 17.695  1.00 120.21 ? 371 ARG A CG    1 
ATOM   2661  C  CD    . ARG A 1 371 ? -21.518 37.404 17.849  1.00 132.65 ? 371 ARG A CD    1 
ATOM   2662  N  NE    . ARG A 1 371 ? -22.717 37.029 18.594  1.00 149.38 ? 371 ARG A NE    1 
ATOM   2663  C  CZ    . ARG A 1 371 ? -23.579 37.893 19.115  1.00 162.69 ? 371 ARG A CZ    1 
ATOM   2664  N  NH1   . ARG A 1 371 ? -23.373 39.196 18.975  1.00 175.36 ? 371 ARG A NH1   1 
ATOM   2665  N  NH2   . ARG A 1 371 ? -24.643 37.454 19.781  1.00 156.19 ? 371 ARG A NH2   1 
ATOM   2666  N  N     . LEU A 1 372 ? -17.195 35.362 18.780  1.00 123.71 ? 372 LEU A N     1 
ATOM   2667  C  CA    . LEU A 1 372 ? -16.828 34.541 19.926  1.00 109.29 ? 372 LEU A CA    1 
ATOM   2668  C  C     . LEU A 1 372 ? -16.164 35.406 20.974  1.00 121.57 ? 372 LEU A C     1 
ATOM   2669  O  O     . LEU A 1 372 ? -16.558 35.378 22.132  1.00 132.39 ? 372 LEU A O     1 
ATOM   2670  C  CB    . LEU A 1 372 ? -15.928 33.378 19.506  1.00 108.47 ? 372 LEU A CB    1 
ATOM   2671  C  CG    . LEU A 1 372 ? -15.138 32.490 20.485  1.00 127.95 ? 372 LEU A CG    1 
ATOM   2672  C  CD1   . LEU A 1 372 ? -13.778 33.114 20.847  1.00 140.52 ? 372 LEU A CD1   1 
ATOM   2673  C  CD2   . LEU A 1 372 ? -15.916 32.141 21.725  1.00 94.14  ? 372 LEU A CD2   1 
ATOM   2674  N  N     . HIS A 1 373 ? -15.170 36.187 20.570  1.00 123.63 ? 373 HIS A N     1 
ATOM   2675  C  CA    . HIS A 1 373 ? -14.509 37.106 21.492  1.00 132.63 ? 373 HIS A CA    1 
ATOM   2676  C  C     . HIS A 1 373 ? -15.521 38.067 22.121  1.00 138.10 ? 373 HIS A C     1 
ATOM   2677  O  O     . HIS A 1 373 ? -15.458 38.359 23.311  1.00 146.40 ? 373 HIS A O     1 
ATOM   2678  C  CB    . HIS A 1 373 ? -13.411 37.865 20.767  1.00 135.94 ? 373 HIS A CB    1 
ATOM   2679  C  CG    . HIS A 1 373 ? -12.716 38.897 21.600  1.00 144.04 ? 373 HIS A CG    1 
ATOM   2680  N  ND1   . HIS A 1 373 ? -11.915 38.574 22.677  1.00 152.29 ? 373 HIS A ND1   1 
ATOM   2681  C  CD2   . HIS A 1 373 ? -12.654 40.246 21.474  1.00 139.07 ? 373 HIS A CD2   1 
ATOM   2682  C  CE1   . HIS A 1 373 ? -11.408 39.682 23.189  1.00 152.83 ? 373 HIS A CE1   1 
ATOM   2683  N  NE2   . HIS A 1 373 ? -11.838 40.710 22.476  1.00 144.45 ? 373 HIS A NE2   1 
ATOM   2684  N  N     . ILE A 1 374 ? -16.452 38.555 21.310  1.00 132.55 ? 374 ILE A N     1 
ATOM   2685  C  CA    . ILE A 1 374 ? -17.536 39.417 21.786  1.00 128.66 ? 374 ILE A CA    1 
ATOM   2686  C  C     . ILE A 1 374 ? -18.514 38.721 22.759  1.00 127.05 ? 374 ILE A C     1 
ATOM   2687  O  O     . ILE A 1 374 ? -18.874 39.275 23.793  1.00 120.48 ? 374 ILE A O     1 
ATOM   2688  C  CB    . ILE A 1 374 ? -18.289 40.049 20.591  1.00 110.97 ? 374 ILE A CB    1 
ATOM   2689  C  CG1   . ILE A 1 374 ? -17.356 41.033 19.890  1.00 137.57 ? 374 ILE A CG1   1 
ATOM   2690  C  CG2   . ILE A 1 374 ? -19.563 40.751 21.026  1.00 93.25  ? 374 ILE A CG2   1 
ATOM   2691  C  CD1   . ILE A 1 374 ? -18.060 42.162 19.152  1.00 157.06 ? 374 ILE A CD1   1 
ATOM   2692  N  N     . VAL A 1 375 ? -18.937 37.512 22.421  1.00 127.57 ? 375 VAL A N     1 
ATOM   2693  C  CA    . VAL A 1 375 ? -19.773 36.696 23.295  1.00 133.42 ? 375 VAL A CA    1 
ATOM   2694  C  C     . VAL A 1 375 ? -19.064 36.369 24.602  1.00 125.17 ? 375 VAL A C     1 
ATOM   2695  O  O     . VAL A 1 375 ? -19.652 36.423 25.680  1.00 124.05 ? 375 VAL A O     1 
ATOM   2696  C  CB    . VAL A 1 375 ? -20.101 35.365 22.619  1.00 136.78 ? 375 VAL A CB    1 
ATOM   2697  C  CG1   . VAL A 1 375 ? -20.724 34.371 23.632  1.00 130.64 ? 375 VAL A CG1   1 
ATOM   2698  C  CG2   . VAL A 1 375 ? -20.977 35.601 21.385  1.00 130.16 ? 375 VAL A CG2   1 
ATOM   2699  N  N     . GLU A 1 376 ? -17.798 36.001 24.492  1.00 106.96 ? 376 GLU A N     1 
ATOM   2700  C  CA    . GLU A 1 376 ? -17.005 35.740 25.663  1.00 118.55 ? 376 GLU A CA    1 
ATOM   2701  C  C     . GLU A 1 376 ? -17.156 36.975 26.537  1.00 135.48 ? 376 GLU A C     1 
ATOM   2702  O  O     . GLU A 1 376 ? -17.273 36.872 27.759  1.00 138.92 ? 376 GLU A O     1 
ATOM   2703  C  CB    . GLU A 1 376 ? -15.538 35.464 25.281  1.00 108.98 ? 376 GLU A CB    1 
ATOM   2704  N  N     . GLY A 1 377 ? -17.189 38.137 25.887  1.00 138.67 ? 377 GLY A N     1 
ATOM   2705  C  CA    . GLY A 1 377 ? -17.280 39.423 26.560  1.00 137.39 ? 377 GLY A CA    1 
ATOM   2706  C  C     . GLY A 1 377 ? -18.585 39.692 27.287  1.00 140.67 ? 377 GLY A C     1 
ATOM   2707  O  O     . GLY A 1 377 ? -18.585 39.953 28.485  1.00 155.09 ? 377 GLY A O     1 
ATOM   2708  N  N     . LEU A 1 378 ? -19.700 39.631 26.569  1.00 123.72 ? 378 LEU A N     1 
ATOM   2709  C  CA    . LEU A 1 378 ? -21.010 39.833 27.177  1.00 115.07 ? 378 LEU A CA    1 
ATOM   2710  C  C     . LEU A 1 378 ? -21.256 38.880 28.345  1.00 135.82 ? 378 LEU A C     1 
ATOM   2711  O  O     . LEU A 1 378 ? -21.852 39.259 29.352  1.00 141.02 ? 378 LEU A O     1 
ATOM   2712  C  CB    . LEU A 1 378 ? -22.107 39.665 26.138  1.00 111.84 ? 378 LEU A CB    1 
ATOM   2713  C  CG    . LEU A 1 378 ? -21.940 40.655 24.996  1.00 124.95 ? 378 LEU A CG    1 
ATOM   2714  C  CD1   . LEU A 1 378 ? -23.159 40.654 24.122  1.00 109.65 ? 378 LEU A CD1   1 
ATOM   2715  C  CD2   . LEU A 1 378 ? -21.673 42.044 25.569  1.00 141.42 ? 378 LEU A CD2   1 
ATOM   2716  N  N     . ILE A 1 379 ? -20.805 37.639 28.206  1.00 144.33 ? 379 ILE A N     1 
ATOM   2717  C  CA    . ILE A 1 379 ? -20.911 36.677 29.298  1.00 148.99 ? 379 ILE A CA    1 
ATOM   2718  C  C     . ILE A 1 379 ? -20.271 37.215 30.578  1.00 159.08 ? 379 ILE A C     1 
ATOM   2719  O  O     . ILE A 1 379 ? -20.850 37.107 31.659  1.00 166.85 ? 379 ILE A O     1 
ATOM   2720  C  CB    . ILE A 1 379 ? -20.307 35.320 28.909  1.00 131.94 ? 379 ILE A CB    1 
ATOM   2721  C  CG1   . ILE A 1 379 ? -21.366 34.480 28.200  1.00 124.79 ? 379 ILE A CG1   1 
ATOM   2722  C  CG2   . ILE A 1 379 ? -19.809 34.593 30.126  1.00 115.64 ? 379 ILE A CG2   1 
ATOM   2723  C  CD1   . ILE A 1 379 ? -20.793 33.377 27.348  1.00 123.75 ? 379 ILE A CD1   1 
ATOM   2724  N  N     . ARG A 1 380 ? -19.083 37.799 30.458  1.00 155.43 ? 380 ARG A N     1 
ATOM   2725  C  CA    . ARG A 1 380 ? -18.456 38.437 31.611  1.00 166.77 ? 380 ARG A CA    1 
ATOM   2726  C  C     . ARG A 1 380 ? -19.353 39.558 32.138  1.00 166.67 ? 380 ARG A C     1 
ATOM   2727  O  O     . ARG A 1 380 ? -19.639 39.621 33.328  1.00 173.07 ? 380 ARG A O     1 
ATOM   2728  C  CB    . ARG A 1 380 ? -17.075 39.012 31.261  1.00 167.17 ? 380 ARG A CB    1 
ATOM   2729  C  CG    . ARG A 1 380 ? -15.984 38.696 32.281  1.00 157.80 ? 380 ARG A CG    1 
ATOM   2730  C  CD    . ARG A 1 380 ? -15.109 39.908 32.632  1.00 153.71 ? 380 ARG A CD    1 
ATOM   2731  N  NE    . ARG A 1 380 ? -14.290 40.418 31.535  1.00 162.27 ? 380 ARG A NE    1 
ATOM   2732  C  CZ    . ARG A 1 380 ? -13.470 41.463 31.648  1.00 171.93 ? 380 ARG A CZ    1 
ATOM   2733  N  NH1   . ARG A 1 380 ? -13.373 42.090 32.811  1.00 170.50 ? 380 ARG A NH1   1 
ATOM   2734  N  NH2   . ARG A 1 380 ? -12.749 41.887 30.607  1.00 170.36 ? 380 ARG A NH2   1 
ATOM   2735  N  N     . VAL A 1 381 ? -19.808 40.431 31.246  1.00 149.61 ? 381 VAL A N     1 
ATOM   2736  C  CA    . VAL A 1 381 ? -20.602 41.588 31.648  1.00 143.61 ? 381 VAL A CA    1 
ATOM   2737  C  C     . VAL A 1 381 ? -21.864 41.236 32.408  1.00 144.32 ? 381 VAL A C     1 
ATOM   2738  O  O     . VAL A 1 381 ? -22.185 41.876 33.401  1.00 141.89 ? 381 VAL A O     1 
ATOM   2739  C  CB    . VAL A 1 381 ? -21.049 42.445 30.472  1.00 148.09 ? 381 VAL A CB    1 
ATOM   2740  C  CG1   . VAL A 1 381 ? -22.255 43.302 30.885  1.00 136.96 ? 381 VAL A CG1   1 
ATOM   2741  C  CG2   . VAL A 1 381 ? -19.904 43.311 29.989  1.00 156.42 ? 381 VAL A CG2   1 
ATOM   2742  N  N     . ILE A 1 382 ? -22.602 40.244 31.928  1.00 161.87 ? 382 ILE A N     1 
ATOM   2743  C  CA    . ILE A 1 382 ? -23.882 39.909 32.547  1.00 170.93 ? 382 ILE A CA    1 
ATOM   2744  C  C     . ILE A 1 382 ? -23.715 39.712 34.069  1.00 170.52 ? 382 ILE A C     1 
ATOM   2745  O  O     . ILE A 1 382 ? -24.656 39.921 34.832  1.00 171.15 ? 382 ILE A O     1 
ATOM   2746  C  CB    . ILE A 1 382 ? -24.641 38.722 31.802  1.00 104.25 ? 382 ILE A CB    1 
ATOM   2747  N  N     . SER A 1 383 ? -22.517 39.311 34.500  1.00 165.07 ? 383 SER A N     1 
ATOM   2748  C  CA    . SER A 1 383 ? -22.181 39.186 35.930  1.00 165.07 ? 383 SER A CA    1 
ATOM   2749  C  C     . SER A 1 383 ? -21.948 40.512 36.675  1.00 163.77 ? 383 SER A C     1 
ATOM   2750  O  O     . SER A 1 383 ? -22.175 40.601 37.877  1.00 159.45 ? 383 SER A O     1 
ATOM   2751  C  CB    . SER A 1 383 ? -20.930 38.334 36.092  1.00 162.43 ? 383 SER A CB    1 
ATOM   2752  O  OG    . SER A 1 383 ? -19.784 39.071 35.699  1.00 159.84 ? 383 SER A OG    1 
ATOM   2753  N  N     . ILE A 1 384 ? -21.458 41.521 35.961  1.00 172.04 ? 384 ILE A N     1 
ATOM   2754  C  CA    . ILE A 1 384 ? -21.140 42.835 36.534  1.00 170.40 ? 384 ILE A CA    1 
ATOM   2755  C  C     . ILE A 1 384 ? -22.162 43.917 36.137  1.00 155.10 ? 384 ILE A C     1 
ATOM   2756  O  O     . ILE A 1 384 ? -21.936 45.104 36.376  1.00 138.95 ? 384 ILE A O     1 
ATOM   2757  C  CB    . ILE A 1 384 ? -19.681 43.296 36.190  1.00 99.19  ? 384 ILE A CB    1 
ATOM   2758  N  N     . LEU A 1 385 ? -23.267 43.503 35.513  1.00 146.27 ? 385 LEU A N     1 
ATOM   2759  C  CA    . LEU A 1 385 ? -24.216 44.438 34.905  1.00 143.36 ? 385 LEU A CA    1 
ATOM   2760  C  C     . LEU A 1 385 ? -24.472 45.663 35.748  1.00 149.71 ? 385 LEU A C     1 
ATOM   2761  O  O     . LEU A 1 385 ? -24.393 46.788 35.256  1.00 161.38 ? 385 LEU A O     1 
ATOM   2762  C  CB    . LEU A 1 385 ? -25.561 43.775 34.605  1.00 137.91 ? 385 LEU A CB    1 
ATOM   2763  C  CG    . LEU A 1 385 ? -25.943 43.462 33.154  1.00 137.95 ? 385 LEU A CG    1 
ATOM   2764  C  CD1   . LEU A 1 385 ? -27.314 42.787 33.139  1.00 119.20 ? 385 LEU A CD1   1 
ATOM   2765  C  CD2   . LEU A 1 385 ? -25.899 44.716 32.200  1.00 114.30 ? 385 LEU A CD2   1 
ATOM   2766  N  N     . ASP A 1 386 ? -24.783 45.453 37.018  1.00 150.98 ? 386 ASP A N     1 
ATOM   2767  C  CA    . ASP A 1 386 ? -25.102 46.583 37.866  1.00 147.61 ? 386 ASP A CA    1 
ATOM   2768  C  C     . ASP A 1 386 ? -23.971 47.620 37.784  1.00 154.46 ? 386 ASP A C     1 
ATOM   2769  O  O     . ASP A 1 386 ? -24.161 48.703 37.219  1.00 142.28 ? 386 ASP A O     1 
ATOM   2770  C  CB    . ASP A 1 386 ? -25.390 46.113 39.292  1.00 128.14 ? 386 ASP A CB    1 
ATOM   2771  N  N     . GLU A 1 387 ? -22.790 47.267 38.294  1.00 166.03 ? 387 GLU A N     1 
ATOM   2772  C  CA    . GLU A 1 387 ? -21.640 48.182 38.334  1.00 164.98 ? 387 GLU A CA    1 
ATOM   2773  C  C     . GLU A 1 387 ? -21.263 48.743 36.953  1.00 171.13 ? 387 GLU A C     1 
ATOM   2774  O  O     . GLU A 1 387 ? -20.830 49.896 36.830  1.00 174.91 ? 387 GLU A O     1 
ATOM   2775  C  CB    . GLU A 1 387 ? -20.428 47.528 39.026  1.00 138.64 ? 387 GLU A CB    1 
ATOM   2776  N  N     . VAL A 1 388 ? -21.417 47.921 35.921  1.00 165.77 ? 388 VAL A N     1 
ATOM   2777  C  CA    . VAL A 1 388 ? -21.121 48.347 34.555  1.00 160.44 ? 388 VAL A CA    1 
ATOM   2778  C  C     . VAL A 1 388 ? -21.991 49.527 34.122  1.00 155.46 ? 388 VAL A C     1 
ATOM   2779  O  O     . VAL A 1 388 ? -21.477 50.567 33.704  1.00 153.66 ? 388 VAL A O     1 
ATOM   2780  C  CB    . VAL A 1 388 ? -21.277 47.178 33.562  1.00 142.20 ? 388 VAL A CB    1 
ATOM   2781  C  CG1   . VAL A 1 388 ? -21.042 47.650 32.126  1.00 106.38 ? 388 VAL A CG1   1 
ATOM   2782  C  CG2   . VAL A 1 388 ? -20.322 46.041 33.951  1.00 145.23 ? 388 VAL A CG2   1 
ATOM   2783  N  N     . ILE A 1 389 ? -23.307 49.363 34.225  1.00 142.88 ? 389 ILE A N     1 
ATOM   2784  C  CA    . ILE A 1 389 ? -24.223 50.441 33.885  1.00 131.63 ? 389 ILE A CA    1 
ATOM   2785  C  C     . ILE A 1 389 ? -23.883 51.680 34.702  1.00 141.84 ? 389 ILE A C     1 
ATOM   2786  O  O     . ILE A 1 389 ? -23.763 52.782 34.161  1.00 142.61 ? 389 ILE A O     1 
ATOM   2787  C  CB    . ILE A 1 389 ? -25.687 50.048 34.145  1.00 122.94 ? 389 ILE A CB    1 
ATOM   2788  C  CG1   . ILE A 1 389 ? -25.982 48.656 33.573  1.00 126.79 ? 389 ILE A CG1   1 
ATOM   2789  C  CG2   . ILE A 1 389 ? -26.638 51.108 33.568  1.00 118.83 ? 389 ILE A CG2   1 
ATOM   2790  C  CD1   . ILE A 1 389 ? -27.470 48.272 33.579  1.00 122.17 ? 389 ILE A CD1   1 
ATOM   2791  N  N     . ALA A 1 390 ? -23.711 51.485 36.007  1.00 136.18 ? 390 ALA A N     1 
ATOM   2792  C  CA    . ALA A 1 390 ? -23.399 52.579 36.913  1.00 138.72 ? 390 ALA A CA    1 
ATOM   2793  C  C     . ALA A 1 390 ? -22.213 53.383 36.405  1.00 147.07 ? 390 ALA A C     1 
ATOM   2794  O  O     . ALA A 1 390 ? -22.222 54.618 36.443  1.00 152.91 ? 390 ALA A O     1 
ATOM   2795  C  CB    . ALA A 1 390 ? -23.104 52.039 38.269  1.00 155.75 ? 390 ALA A CB    1 
ATOM   2796  N  N     . LEU A 1 391 ? -21.187 52.671 35.947  1.00 146.73 ? 391 LEU A N     1 
ATOM   2797  C  CA    . LEU A 1 391 ? -20.030 53.300 35.323  1.00 149.75 ? 391 LEU A CA    1 
ATOM   2798  C  C     . LEU A 1 391 ? -20.444 54.134 34.115  1.00 148.41 ? 391 LEU A C     1 
ATOM   2799  O  O     . LEU A 1 391 ? -20.080 55.305 34.004  1.00 146.13 ? 391 LEU A O     1 
ATOM   2800  C  CB    . LEU A 1 391 ? -19.004 52.242 34.901  1.00 149.78 ? 391 LEU A CB    1 
ATOM   2801  C  CG    . LEU A 1 391 ? -17.964 52.670 33.851  1.00 149.78 ? 391 LEU A CG    1 
ATOM   2802  C  CD1   . LEU A 1 391 ? -16.665 51.901 34.006  1.00 149.01 ? 391 LEU A CD1   1 
ATOM   2803  C  CD2   . LEU A 1 391 ? -18.481 52.537 32.416  1.00 141.17 ? 391 LEU A CD2   1 
ATOM   2804  N  N     . ILE A 1 392 ? -21.208 53.524 33.213  1.00 148.59 ? 392 ILE A N     1 
ATOM   2805  C  CA    . ILE A 1 392 ? -21.582 54.181 31.961  1.00 148.57 ? 392 ILE A CA    1 
ATOM   2806  C  C     . ILE A 1 392 ? -22.280 55.506 32.222  1.00 150.61 ? 392 ILE A C     1 
ATOM   2807  O  O     . ILE A 1 392 ? -22.065 56.484 31.503  1.00 148.25 ? 392 ILE A O     1 
ATOM   2808  C  CB    . ILE A 1 392 ? -22.533 53.312 31.116  1.00 137.76 ? 392 ILE A CB    1 
ATOM   2809  C  CG1   . ILE A 1 392 ? -22.134 51.834 31.197  1.00 140.94 ? 392 ILE A CG1   1 
ATOM   2810  C  CG2   . ILE A 1 392 ? -22.619 53.842 29.677  1.00 113.60 ? 392 ILE A CG2   1 
ATOM   2811  C  CD1   . ILE A 1 392 ? -21.228 51.364 30.096  1.00 144.87 ? 392 ILE A CD1   1 
ATOM   2812  N  N     . ARG A 1 393 ? -23.147 55.513 33.231  1.00 146.46 ? 393 ARG A N     1 
ATOM   2813  C  CA    . ARG A 1 393 ? -23.867 56.713 33.631  1.00 147.03 ? 393 ARG A CA    1 
ATOM   2814  C  C     . ARG A 1 393 ? -22.899 57.774 34.167  1.00 151.92 ? 393 ARG A C     1 
ATOM   2815  O  O     . ARG A 1 393 ? -22.965 58.953 33.792  1.00 144.20 ? 393 ARG A O     1 
ATOM   2816  C  CB    . ARG A 1 393 ? -24.912 56.336 34.672  1.00 152.34 ? 393 ARG A CB    1 
ATOM   2817  C  CG    . ARG A 1 393 ? -25.734 55.094 34.310  1.00 149.07 ? 393 ARG A CG    1 
ATOM   2818  C  CD    . ARG A 1 393 ? -27.153 55.427 33.829  1.00 160.29 ? 393 ARG A CD    1 
ATOM   2819  N  NE    . ARG A 1 393 ? -27.916 56.257 34.774  1.00 172.83 ? 393 ARG A NE    1 
ATOM   2820  C  CZ    . ARG A 1 393 ? -28.833 55.810 35.634  1.00 166.10 ? 393 ARG A CZ    1 
ATOM   2821  N  NH1   . ARG A 1 393 ? -29.126 54.517 35.698  1.00 164.55 ? 393 ARG A NH1   1 
ATOM   2822  N  NH2   . ARG A 1 393 ? -29.459 56.662 36.437  1.00 158.38 ? 393 ARG A NH2   1 
ATOM   2823  N  N     . ALA A 1 394 ? -22.005 57.344 35.053  1.00 158.06 ? 394 ALA A N     1 
ATOM   2824  C  CA    . ALA A 1 394 ? -20.945 58.210 35.563  1.00 162.09 ? 394 ALA A CA    1 
ATOM   2825  C  C     . ALA A 1 394 ? -19.928 58.621 34.487  1.00 156.79 ? 394 ALA A C     1 
ATOM   2826  O  O     . ALA A 1 394 ? -18.889 59.203 34.796  1.00 157.06 ? 394 ALA A O     1 
ATOM   2827  C  CB    . ALA A 1 394 ? -20.241 57.547 36.742  1.00 163.45 ? 394 ALA A CB    1 
ATOM   2828  N  N     . SER A 1 395 ? -20.216 58.320 33.228  1.00 155.79 ? 395 SER A N     1 
ATOM   2829  C  CA    . SER A 1 395 ? -19.283 58.657 32.159  1.00 152.45 ? 395 SER A CA    1 
ATOM   2830  C  C     . SER A 1 395 ? -19.750 59.869 31.362  1.00 151.75 ? 395 SER A C     1 
ATOM   2831  O  O     . SER A 1 395 ? -20.941 60.167 31.304  1.00 143.83 ? 395 SER A O     1 
ATOM   2832  C  CB    . SER A 1 395 ? -19.043 57.458 31.246  1.00 140.26 ? 395 SER A CB    1 
ATOM   2833  O  OG    . SER A 1 395 ? -18.181 56.513 31.859  1.00 130.94 ? 395 SER A OG    1 
ATOM   2834  N  N     . GLU A 1 396 ? -18.801 60.572 30.756  1.00 156.15 ? 396 GLU A N     1 
ATOM   2835  C  CA    . GLU A 1 396 ? -19.103 61.845 30.115  1.00 153.75 ? 396 GLU A CA    1 
ATOM   2836  C  C     . GLU A 1 396 ? -19.617 61.676 28.679  1.00 146.50 ? 396 GLU A C     1 
ATOM   2837  O  O     . GLU A 1 396 ? -20.717 62.121 28.357  1.00 132.11 ? 396 GLU A O     1 
ATOM   2838  C  CB    . GLU A 1 396 ? -17.880 62.777 30.189  1.00 147.18 ? 396 GLU A CB    1 
ATOM   2839  N  N     . ASN A 1 397 ? -18.814 61.020 27.839  1.00 152.59 ? 397 ASN A N     1 
ATOM   2840  C  CA    . ASN A 1 397 ? -19.088 60.833 26.413  1.00 150.77 ? 397 ASN A CA    1 
ATOM   2841  C  C     . ASN A 1 397 ? -19.235 59.340 26.082  1.00 148.44 ? 397 ASN A C     1 
ATOM   2842  O  O     . ASN A 1 397 ? -18.815 58.500 26.879  1.00 137.83 ? 397 ASN A O     1 
ATOM   2843  C  CB    . ASN A 1 397 ? -17.931 61.436 25.604  1.00 95.65  ? 397 ASN A CB    1 
ATOM   2844  N  N     . LYS A 1 398 ? -19.827 58.992 24.933  1.00 155.90 ? 398 LYS A N     1 
ATOM   2845  C  CA    . LYS A 1 398 ? -19.856 57.578 24.533  1.00 146.44 ? 398 LYS A CA    1 
ATOM   2846  C  C     . LYS A 1 398 ? -18.440 57.041 24.567  1.00 136.00 ? 398 LYS A C     1 
ATOM   2847  O  O     . LYS A 1 398 ? -18.161 55.989 25.154  1.00 112.76 ? 398 LYS A O     1 
ATOM   2848  C  CB    . LYS A 1 398 ? -20.402 57.352 23.124  1.00 124.38 ? 398 LYS A CB    1 
ATOM   2849  N  N     . ALA A 1 399 ? -17.554 57.783 23.911  1.00 138.04 ? 399 ALA A N     1 
ATOM   2850  C  CA    . ALA A 1 399 ? -16.138 57.468 23.883  1.00 132.69 ? 399 ALA A CA    1 
ATOM   2851  C  C     . ALA A 1 399 ? -15.538 57.374 25.292  1.00 128.47 ? 399 ALA A C     1 
ATOM   2852  O  O     . ALA A 1 399 ? -14.865 56.395 25.617  1.00 129.95 ? 399 ALA A O     1 
ATOM   2853  C  CB    . ALA A 1 399 ? -15.408 58.494 23.046  1.00 131.82 ? 399 ALA A CB    1 
ATOM   2854  N  N     . ASP A 1 400 ? -15.785 58.377 26.128  1.00 131.06 ? 400 ASP A N     1 
ATOM   2855  C  CA    . ASP A 1 400 ? -15.314 58.312 27.512  1.00 150.34 ? 400 ASP A CA    1 
ATOM   2856  C  C     . ASP A 1 400 ? -15.879 57.072 28.185  1.00 145.92 ? 400 ASP A C     1 
ATOM   2857  O  O     . ASP A 1 400 ? -15.184 56.378 28.925  1.00 145.84 ? 400 ASP A O     1 
ATOM   2858  C  CB    . ASP A 1 400 ? -15.699 59.559 28.318  1.00 160.95 ? 400 ASP A CB    1 
ATOM   2859  N  N     . ALA A 1 401 ? -17.149 56.800 27.916  1.00 146.61 ? 401 ALA A N     1 
ATOM   2860  C  CA    . ALA A 1 401 ? -17.804 55.610 28.437  1.00 147.70 ? 401 ALA A CA    1 
ATOM   2861  C  C     . ALA A 1 401 ? -16.948 54.384 28.144  1.00 148.32 ? 401 ALA A C     1 
ATOM   2862  O  O     . ALA A 1 401 ? -16.573 53.644 29.063  1.00 132.91 ? 401 ALA A O     1 
ATOM   2863  C  CB    . ALA A 1 401 ? -19.190 55.460 27.816  1.00 136.25 ? 401 ALA A CB    1 
ATOM   2864  N  N     . LYS A 1 402 ? -16.622 54.199 26.863  1.00 150.57 ? 402 LYS A N     1 
ATOM   2865  C  CA    . LYS A 1 402 ? -15.787 53.088 26.414  1.00 138.29 ? 402 LYS A CA    1 
ATOM   2866  C  C     . LYS A 1 402 ? -14.440 53.051 27.140  1.00 145.02 ? 402 LYS A C     1 
ATOM   2867  O  O     . LYS A 1 402 ? -14.077 52.032 27.733  1.00 142.66 ? 402 LYS A O     1 
ATOM   2868  C  CB    . LYS A 1 402 ? -15.553 53.166 24.905  1.00 118.95 ? 402 LYS A CB    1 
ATOM   2869  C  CG    . LYS A 1 402 ? -16.777 52.895 24.024  1.00 121.18 ? 402 LYS A CG    1 
ATOM   2870  C  CD    . LYS A 1 402 ? -16.466 53.107 22.506  1.00 103.21 ? 402 LYS A CD    1 
ATOM   2871  N  N     . GLU A 1 403 ? -13.714 54.169 27.098  1.00 148.31 ? 403 GLU A N     1 
ATOM   2872  C  CA    . GLU A 1 403 ? -12.382 54.271 27.716  1.00 148.22 ? 403 GLU A CA    1 
ATOM   2873  C  C     . GLU A 1 403 ? -12.359 53.916 29.206  1.00 156.27 ? 403 GLU A C     1 
ATOM   2874  O  O     . GLU A 1 403 ? -11.356 53.409 29.716  1.00 150.33 ? 403 GLU A O     1 
ATOM   2875  C  CB    . GLU A 1 403 ? -11.762 55.660 27.512  1.00 127.97 ? 403 GLU A CB    1 
ATOM   2876  N  N     . ASN A 1 404 ? -13.446 54.223 29.908  1.00 158.60 ? 404 ASN A N     1 
ATOM   2877  C  CA    . ASN A 1 404 ? -13.560 53.872 31.318  1.00 146.85 ? 404 ASN A CA    1 
ATOM   2878  C  C     . ASN A 1 404 ? -13.682 52.358 31.564  1.00 156.36 ? 404 ASN A C     1 
ATOM   2879  O  O     . ASN A 1 404 ? -13.080 51.844 32.505  1.00 165.37 ? 404 ASN A O     1 
ATOM   2880  C  CB    . ASN A 1 404 ? -14.677 54.669 32.002  1.00 129.99 ? 404 ASN A CB    1 
ATOM   2881  N  N     . LEU A 1 405 ? -14.458 51.645 30.742  1.00 152.17 ? 405 LEU A N     1 
ATOM   2882  C  CA    . LEU A 1 405 ? -14.581 50.188 30.903  1.00 147.08 ? 405 LEU A CA    1 
ATOM   2883  C  C     . LEU A 1 405 ? -13.270 49.489 30.612  1.00 149.47 ? 405 LEU A C     1 
ATOM   2884  O  O     . LEU A 1 405 ? -12.881 48.553 31.309  1.00 156.59 ? 405 LEU A O     1 
ATOM   2885  C  CB    . LEU A 1 405 ? -15.629 49.575 29.985  1.00 136.53 ? 405 LEU A CB    1 
ATOM   2886  C  CG    . LEU A 1 405 ? -17.066 50.062 30.022  1.00 134.86 ? 405 LEU A CG    1 
ATOM   2887  C  CD1   . LEU A 1 405 ? -17.324 50.841 28.746  1.00 129.96 ? 405 LEU A CD1   1 
ATOM   2888  C  CD2   . LEU A 1 405 ? -18.021 48.878 30.147  1.00 123.23 ? 405 LEU A CD2   1 
ATOM   2889  N  N     . LYS A 1 406 ? -12.608 49.925 29.550  1.00 144.19 ? 406 LYS A N     1 
ATOM   2890  C  CA    . LYS A 1 406 ? -11.310 49.370 29.202  1.00 151.09 ? 406 LYS A CA    1 
ATOM   2891  C  C     . LYS A 1 406 ? -10.318 49.545 30.363  1.00 156.78 ? 406 LYS A C     1 
ATOM   2892  O  O     . LYS A 1 406 ? -9.643  48.592 30.757  1.00 161.69 ? 406 LYS A O     1 
ATOM   2893  C  CB    . LYS A 1 406 ? -10.791 49.965 27.884  1.00 141.78 ? 406 LYS A CB    1 
ATOM   2894  N  N     . VAL A 1 407 ? -10.245 50.753 30.921  1.00 152.31 ? 407 VAL A N     1 
ATOM   2895  C  CA    . VAL A 1 407 ? -9.375  51.008 32.074  1.00 148.78 ? 407 VAL A CA    1 
ATOM   2896  C  C     . VAL A 1 407 ? -9.730  50.156 33.296  1.00 159.83 ? 407 VAL A C     1 
ATOM   2897  O  O     . VAL A 1 407 ? -8.878  49.441 33.818  1.00 166.86 ? 407 VAL A O     1 
ATOM   2898  C  CB    . VAL A 1 407 ? -9.392  52.482 32.509  1.00 125.85 ? 407 VAL A CB    1 
ATOM   2899  N  N     . SER A 1 408 ? -10.982 50.246 33.748  1.00 156.31 ? 408 SER A N     1 
ATOM   2900  C  CA    . SER A 1 408 ? -11.442 49.547 34.953  1.00 151.87 ? 408 SER A CA    1 
ATOM   2901  C  C     . SER A 1 408 ? -11.520 48.014 34.847  1.00 168.09 ? 408 SER A C     1 
ATOM   2902  O  O     . SER A 1 408 ? -10.738 47.306 35.477  1.00 179.15 ? 408 SER A O     1 
ATOM   2903  C  CB    . SER A 1 408 ? -12.794 50.106 35.401  1.00 137.04 ? 408 SER A CB    1 
ATOM   2904  N  N     . TYR A 1 409 ? -12.490 47.508 34.088  1.00 170.26 ? 409 TYR A N     1 
ATOM   2905  C  CA    . TYR A 1 409 ? -12.688 46.062 33.920  1.00 164.73 ? 409 TYR A CA    1 
ATOM   2906  C  C     . TYR A 1 409 ? -11.867 45.432 32.792  1.00 159.64 ? 409 TYR A C     1 
ATOM   2907  O  O     . TYR A 1 409 ? -12.234 44.368 32.281  1.00 144.79 ? 409 TYR A O     1 
ATOM   2908  C  CB    . TYR A 1 409 ? -14.166 45.777 33.652  1.00 159.69 ? 409 TYR A CB    1 
ATOM   2909  C  CG    . TYR A 1 409 ? -15.084 46.199 34.777  1.00 154.73 ? 409 TYR A CG    1 
ATOM   2910  C  CD1   . TYR A 1 409 ? -16.187 45.429 35.124  1.00 164.87 ? 409 TYR A CD1   1 
ATOM   2911  C  CD2   . TYR A 1 409 ? -14.849 47.357 35.492  1.00 143.72 ? 409 TYR A CD2   1 
ATOM   2912  C  CE1   . TYR A 1 409 ? -17.034 45.808 36.146  1.00 168.76 ? 409 TYR A CE1   1 
ATOM   2913  C  CE2   . TYR A 1 409 ? -15.683 47.745 36.515  1.00 155.51 ? 409 TYR A CE2   1 
ATOM   2914  C  CZ    . TYR A 1 409 ? -16.776 46.970 36.847  1.00 165.01 ? 409 TYR A CZ    1 
ATOM   2915  O  OH    . TYR A 1 409 ? -17.613 47.359 37.882  1.00 162.07 ? 409 TYR A OH    1 
ATOM   2916  N  N     . ASP A 1 410 ? -10.779 46.092 32.401  1.00 169.24 ? 410 ASP A N     1 
ATOM   2917  C  CA    . ASP A 1 410 ? -9.945  45.656 31.275  1.00 168.99 ? 410 ASP A CA    1 
ATOM   2918  C  C     . ASP A 1 410 ? -10.692 44.821 30.221  1.00 157.57 ? 410 ASP A C     1 
ATOM   2919  O  O     . ASP A 1 410 ? -10.295 43.701 29.904  1.00 157.63 ? 410 ASP A O     1 
ATOM   2920  C  CB    . ASP A 1 410 ? -8.677  44.944 31.768  1.00 167.44 ? 410 ASP A CB    1 
ATOM   2921  N  N     . PHE A 1 411 ? -11.788 45.371 29.705  1.00 139.74 ? 411 PHE A N     1 
ATOM   2922  C  CA    . PHE A 1 411 ? -12.451 44.820 28.533  1.00 135.08 ? 411 PHE A CA    1 
ATOM   2923  C  C     . PHE A 1 411 ? -11.626 45.247 27.330  1.00 144.26 ? 411 PHE A C     1 
ATOM   2924  O  O     . PHE A 1 411 ? -10.764 46.127 27.464  1.00 143.01 ? 411 PHE A O     1 
ATOM   2925  C  CB    . PHE A 1 411 ? -13.844 45.420 28.390  1.00 133.20 ? 411 PHE A CB    1 
ATOM   2926  C  CG    . PHE A 1 411 ? -14.917 44.691 29.138  1.00 135.27 ? 411 PHE A CG    1 
ATOM   2927  C  CD1   . PHE A 1 411 ? -15.294 43.409 28.761  1.00 133.36 ? 411 PHE A CD1   1 
ATOM   2928  C  CD2   . PHE A 1 411 ? -15.585 45.302 30.188  1.00 141.39 ? 411 PHE A CD2   1 
ATOM   2929  C  CE1   . PHE A 1 411 ? -16.306 42.730 29.441  1.00 132.12 ? 411 PHE A CE1   1 
ATOM   2930  C  CE2   . PHE A 1 411 ? -16.596 44.629 30.865  1.00 146.84 ? 411 PHE A CE2   1 
ATOM   2931  C  CZ    . PHE A 1 411 ? -16.956 43.337 30.493  1.00 133.91 ? 411 PHE A CZ    1 
ATOM   2932  N  N     . THR A 1 412 ? -11.880 44.661 26.155  1.00 144.42 ? 412 THR A N     1 
ATOM   2933  C  CA    . THR A 1 412 ? -11.132 45.081 24.968  1.00 145.81 ? 412 THR A CA    1 
ATOM   2934  C  C     . THR A 1 412 ? -11.819 46.237 24.256  1.00 165.24 ? 412 THR A C     1 
ATOM   2935  O  O     . THR A 1 412 ? -12.794 46.795 24.759  1.00 179.98 ? 412 THR A O     1 
ATOM   2936  C  CB    . THR A 1 412 ? -11.005 43.950 23.928  1.00 129.22 ? 412 THR A CB    1 
ATOM   2937  O  OG1   . THR A 1 412 ? -12.238 43.814 23.197  1.00 123.90 ? 412 THR A OG1   1 
ATOM   2938  C  CG2   . THR A 1 412 ? -10.646 42.646 24.607  1.00 122.29 ? 412 THR A CG2   1 
ATOM   2939  N  N     . GLU A 1 413 ? -11.360 46.540 23.048  1.00 163.14 ? 413 GLU A N     1 
ATOM   2940  C  CA    . GLU A 1 413 ? -11.904 47.662 22.297  1.00 163.14 ? 413 GLU A CA    1 
ATOM   2941  C  C     . GLU A 1 413 ? -13.273 47.303 21.721  1.00 158.73 ? 413 GLU A C     1 
ATOM   2942  O  O     . GLU A 1 413 ? -14.277 47.949 22.025  1.00 151.96 ? 413 GLU A O     1 
ATOM   2943  C  CB    . GLU A 1 413 ? -10.933 48.092 21.188  1.00 178.35 ? 413 GLU A CB    1 
ATOM   2944  C  CG    . GLU A 1 413 ? -11.555 48.927 20.062  1.00 193.57 ? 413 GLU A CG    1 
ATOM   2945  C  CD    . GLU A 1 413 ? -12.213 50.203 20.559  1.00 199.28 ? 413 GLU A CD    1 
ATOM   2946  O  OE1   . GLU A 1 413 ? -13.156 50.683 19.888  1.00 199.22 ? 413 GLU A OE1   1 
ATOM   2947  O  OE2   . GLU A 1 413 ? -11.789 50.719 21.619  1.00 196.88 ? 413 GLU A OE2   1 
ATOM   2948  N  N     . GLU A 1 414 ? -13.302 46.264 20.889  1.00 158.21 ? 414 GLU A N     1 
ATOM   2949  C  CA    . GLU A 1 414 ? -14.538 45.811 20.260  1.00 155.54 ? 414 GLU A CA    1 
ATOM   2950  C  C     . GLU A 1 414 ? -15.548 45.354 21.307  1.00 152.48 ? 414 GLU A C     1 
ATOM   2951  O  O     . GLU A 1 414 ? -16.747 45.592 21.156  1.00 151.78 ? 414 GLU A O     1 
ATOM   2952  C  CB    . GLU A 1 414 ? -14.304 44.722 19.199  1.00 152.29 ? 414 GLU A CB    1 
ATOM   2953  C  CG    . GLU A 1 414 ? -13.138 43.793 19.490  1.00 172.30 ? 414 GLU A CG    1 
ATOM   2954  C  CD    . GLU A 1 414 ? -11.809 44.535 19.599  1.00 187.71 ? 414 GLU A CD    1 
ATOM   2955  O  OE1   . GLU A 1 414 ? -11.094 44.336 20.609  1.00 186.56 ? 414 GLU A OE1   1 
ATOM   2956  O  OE2   . GLU A 1 414 ? -11.488 45.330 18.684  1.00 197.99 ? 414 GLU A OE2   1 
ATOM   2957  N  N     . GLN A 1 415 ? -15.060 44.697 22.360  1.00 142.71 ? 415 GLN A N     1 
ATOM   2958  C  CA    . GLN A 1 415 ? -15.927 44.256 23.445  1.00 141.23 ? 415 GLN A CA    1 
ATOM   2959  C  C     . GLN A 1 415 ? -16.685 45.457 23.991  1.00 140.55 ? 415 GLN A C     1 
ATOM   2960  O  O     . GLN A 1 415 ? -17.898 45.397 24.209  1.00 126.27 ? 415 GLN A O     1 
ATOM   2961  C  CB    . GLN A 1 415 ? -15.108 43.588 24.551  1.00 148.54 ? 415 GLN A CB    1 
ATOM   2962  C  CG    . GLN A 1 415 ? -14.827 42.104 24.329  1.00 147.51 ? 415 GLN A CG    1 
ATOM   2963  C  CD    . GLN A 1 415 ? -13.856 41.508 25.358  1.00 147.50 ? 415 GLN A CD    1 
ATOM   2964  O  OE1   . GLN A 1 415 ? -13.157 42.228 26.087  1.00 148.49 ? 415 GLN A OE1   1 
ATOM   2965  N  NE2   . GLN A 1 415 ? -13.805 40.181 25.408  1.00 141.14 ? 415 GLN A NE2   1 
ATOM   2966  N  N     . ALA A 1 416 ? -15.951 46.549 24.198  1.00 150.40 ? 416 ALA A N     1 
ATOM   2967  C  CA    . ALA A 1 416 ? -16.523 47.814 24.657  1.00 151.19 ? 416 ALA A CA    1 
ATOM   2968  C  C     . ALA A 1 416 ? -17.603 48.381 23.719  1.00 144.69 ? 416 ALA A C     1 
ATOM   2969  O  O     . ALA A 1 416 ? -18.726 48.646 24.153  1.00 136.69 ? 416 ALA A O     1 
ATOM   2970  C  CB    . ALA A 1 416 ? -15.414 48.843 24.888  1.00 144.41 ? 416 ALA A CB    1 
ATOM   2971  N  N     . GLU A 1 417 ? -17.277 48.574 22.442  1.00 140.31 ? 417 GLU A N     1 
ATOM   2972  C  CA    . GLU A 1 417 ? -18.285 49.095 21.526  1.00 146.69 ? 417 GLU A CA    1 
ATOM   2973  C  C     . GLU A 1 417 ? -19.539 48.227 21.645  1.00 141.89 ? 417 GLU A C     1 
ATOM   2974  O  O     . GLU A 1 417 ? -20.643 48.746 21.775  1.00 144.57 ? 417 GLU A O     1 
ATOM   2975  C  CB    . GLU A 1 417 ? -17.785 49.238 20.057  1.00 94.81  ? 417 GLU A CB    1 
ATOM   2976  N  N     . ALA A 1 418 ? -19.363 46.907 21.639  1.00 133.67 ? 418 ALA A N     1 
ATOM   2977  C  CA    . ALA A 1 418 ? -20.501 45.988 21.718  1.00 126.82 ? 418 ALA A CA    1 
ATOM   2978  C  C     . ALA A 1 418 ? -21.342 46.162 22.988  1.00 127.66 ? 418 ALA A C     1 
ATOM   2979  O  O     . ALA A 1 418 ? -22.570 46.183 22.922  1.00 130.39 ? 418 ALA A O     1 
ATOM   2980  C  CB    . ALA A 1 418 ? -20.060 44.539 21.548  1.00 118.30 ? 418 ALA A CB    1 
ATOM   2981  N  N     . ILE A 1 419 ? -20.694 46.271 24.141  1.00 123.00 ? 419 ILE A N     1 
ATOM   2982  C  CA    . ILE A 1 419 ? -21.448 46.502 25.359  1.00 127.47 ? 419 ILE A CA    1 
ATOM   2983  C  C     . ILE A 1 419 ? -22.148 47.848 25.295  1.00 128.11 ? 419 ILE A C     1 
ATOM   2984  O  O     . ILE A 1 419 ? -23.342 47.954 25.541  1.00 145.05 ? 419 ILE A O     1 
ATOM   2985  C  CB    . ILE A 1 419 ? -20.565 46.488 26.588  1.00 128.05 ? 419 ILE A CB    1 
ATOM   2986  C  CG1   . ILE A 1 419 ? -19.512 45.396 26.462  1.00 133.46 ? 419 ILE A CG1   1 
ATOM   2987  C  CG2   . ILE A 1 419 ? -21.414 46.237 27.817  1.00 120.47 ? 419 ILE A CG2   1 
ATOM   2988  C  CD1   . ILE A 1 419 ? -18.429 45.495 27.513  1.00 139.09 ? 419 ILE A CD1   1 
ATOM   2989  N  N     . VAL A 1 420 ? -21.386 48.878 24.968  1.00 128.17 ? 420 VAL A N     1 
ATOM   2990  C  CA    . VAL A 1 420 ? -21.901 50.244 24.923  1.00 137.03 ? 420 VAL A CA    1 
ATOM   2991  C  C     . VAL A 1 420 ? -23.058 50.481 23.939  1.00 123.87 ? 420 VAL A C     1 
ATOM   2992  O  O     . VAL A 1 420 ? -24.005 51.192 24.260  1.00 126.79 ? 420 VAL A O     1 
ATOM   2993  C  CB    . VAL A 1 420 ? -20.774 51.236 24.600  1.00 132.70 ? 420 VAL A CB    1 
ATOM   2994  C  CG1   . VAL A 1 420 ? -21.362 52.553 24.178  1.00 114.24 ? 420 VAL A CG1   1 
ATOM   2995  C  CG2   . VAL A 1 420 ? -19.870 51.395 25.806  1.00 141.82 ? 420 VAL A CG2   1 
ATOM   2996  N  N     . THR A 1 421 ? -22.957 49.935 22.732  1.00 113.38 ? 421 THR A N     1 
ATOM   2997  C  CA    . THR A 1 421 ? -23.991 50.124 21.719  1.00 120.95 ? 421 THR A CA    1 
ATOM   2998  C  C     . THR A 1 421 ? -25.224 49.250 21.918  1.00 136.94 ? 421 THR A C     1 
ATOM   2999  O  O     . THR A 1 421 ? -26.257 49.497 21.297  1.00 142.04 ? 421 THR A O     1 
ATOM   3000  C  CB    . THR A 1 421 ? -23.479 49.878 20.301  1.00 127.05 ? 421 THR A CB    1 
ATOM   3001  O  OG1   . THR A 1 421 ? -22.782 48.631 20.253  1.00 133.53 ? 421 THR A OG1   1 
ATOM   3002  C  CG2   . THR A 1 421 ? -22.553 50.997 19.865  1.00 136.51 ? 421 THR A CG2   1 
ATOM   3003  N  N     . LEU A 1 422 ? -25.111 48.216 22.749  1.00 147.20 ? 422 LEU A N     1 
ATOM   3004  C  CA    . LEU A 1 422 ? -26.272 47.403 23.114  1.00 146.46 ? 422 LEU A CA    1 
ATOM   3005  C  C     . LEU A 1 422 ? -27.459 48.320 23.328  1.00 139.64 ? 422 LEU A C     1 
ATOM   3006  O  O     . LEU A 1 422 ? -27.333 49.324 24.034  1.00 121.76 ? 422 LEU A O     1 
ATOM   3007  C  CB    . LEU A 1 422 ? -26.023 46.676 24.433  1.00 138.19 ? 422 LEU A CB    1 
ATOM   3008  C  CG    . LEU A 1 422 ? -25.063 45.496 24.506  1.00 126.55 ? 422 LEU A CG    1 
ATOM   3009  C  CD1   . LEU A 1 422 ? -24.621 45.306 25.952  1.00 129.00 ? 422 LEU A CD1   1 
ATOM   3010  C  CD2   . LEU A 1 422 ? -25.747 44.266 23.974  1.00 118.34 ? 422 LEU A CD2   1 
ATOM   3011  N  N     . GLN A 1 423 ? -28.612 47.994 22.747  1.00 142.13 ? 423 GLN A N     1 
ATOM   3012  C  CA    . GLN A 1 423 ? -29.769 48.836 22.996  1.00 138.53 ? 423 GLN A CA    1 
ATOM   3013  C  C     . GLN A 1 423 ? -30.263 48.527 24.413  1.00 145.52 ? 423 GLN A C     1 
ATOM   3014  O  O     . GLN A 1 423 ? -29.582 47.828 25.154  1.00 160.68 ? 423 GLN A O     1 
ATOM   3015  C  CB    . GLN A 1 423 ? -30.842 48.558 21.951  1.00 130.76 ? 423 GLN A CB    1 
ATOM   3016  C  CG    . GLN A 1 423 ? -30.295 48.084 20.606  1.00 126.91 ? 423 GLN A CG    1 
ATOM   3017  C  CD    . GLN A 1 423 ? -31.352 48.158 19.501  1.00 138.55 ? 423 GLN A CD    1 
ATOM   3018  O  OE1   . GLN A 1 423 ? -31.858 47.135 19.031  1.00 143.80 ? 423 GLN A OE1   1 
ATOM   3019  N  NE2   . GLN A 1 423 ? -31.706 49.376 19.100  1.00 134.67 ? 423 GLN A NE2   1 
ATOM   3020  N  N     . LEU A 1 424 ? -31.462 48.962 24.777  1.00 135.16 ? 424 LEU A N     1 
ATOM   3021  C  CA    . LEU A 1 424 ? -31.886 48.821 26.172  1.00 130.64 ? 424 LEU A CA    1 
ATOM   3022  C  C     . LEU A 1 424 ? -32.661 47.547 26.456  1.00 138.14 ? 424 LEU A C     1 
ATOM   3023  O  O     . LEU A 1 424 ? -32.449 46.904 27.480  1.00 142.56 ? 424 LEU A O     1 
ATOM   3024  C  CB    . LEU A 1 424 ? -32.688 50.030 26.639  1.00 125.18 ? 424 LEU A CB    1 
ATOM   3025  C  CG    . LEU A 1 424 ? -31.841 51.087 27.324  1.00 129.59 ? 424 LEU A CG    1 
ATOM   3026  C  CD1   . LEU A 1 424 ? -32.693 52.304 27.679  1.00 125.47 ? 424 LEU A CD1   1 
ATOM   3027  C  CD2   . LEU A 1 424 ? -31.152 50.488 28.551  1.00 130.38 ? 424 LEU A CD2   1 
ATOM   3028  N  N     . TYR A 1 425 ? -33.578 47.201 25.559  1.00 135.04 ? 425 TYR A N     1 
ATOM   3029  C  CA    . TYR A 1 425 ? -34.376 46.004 25.742  1.00 128.74 ? 425 TYR A CA    1 
ATOM   3030  C  C     . TYR A 1 425 ? -33.476 44.786 25.739  1.00 132.06 ? 425 TYR A C     1 
ATOM   3031  O  O     . TYR A 1 425 ? -33.899 43.697 26.109  1.00 148.28 ? 425 TYR A O     1 
ATOM   3032  C  CB    . TYR A 1 425 ? -35.449 45.867 24.668  1.00 119.56 ? 425 TYR A CB    1 
ATOM   3033  C  CG    . TYR A 1 425 ? -34.921 45.550 23.294  1.00 124.32 ? 425 TYR A CG    1 
ATOM   3034  C  CD1   . TYR A 1 425 ? -34.698 46.557 22.366  1.00 136.99 ? 425 TYR A CD1   1 
ATOM   3035  C  CD2   . TYR A 1 425 ? -34.657 44.252 22.913  1.00 120.97 ? 425 TYR A CD2   1 
ATOM   3036  C  CE1   . TYR A 1 425 ? -34.224 46.276 21.087  1.00 140.05 ? 425 TYR A CE1   1 
ATOM   3037  C  CE2   . TYR A 1 425 ? -34.175 43.961 21.636  1.00 134.56 ? 425 TYR A CE2   1 
ATOM   3038  C  CZ    . TYR A 1 425 ? -33.963 44.976 20.727  1.00 137.66 ? 425 TYR A CZ    1 
ATOM   3039  O  OH    . TYR A 1 425 ? -33.492 44.691 19.461  1.00 131.56 ? 425 TYR A OH    1 
ATOM   3040  N  N     . ARG A 1 426 ? -32.242 44.955 25.289  1.00 118.81 ? 426 ARG A N     1 
ATOM   3041  C  CA    . ARG A 1 426 ? -31.294 43.856 25.360  1.00 134.13 ? 426 ARG A CA    1 
ATOM   3042  C  C     . ARG A 1 426 ? -31.034 43.431 26.817  1.00 144.19 ? 426 ARG A C     1 
ATOM   3043  O  O     . ARG A 1 426 ? -30.685 42.282 27.087  1.00 145.50 ? 426 ARG A O     1 
ATOM   3044  C  CB    . ARG A 1 426 ? -30.007 44.228 24.628  1.00 135.33 ? 426 ARG A CB    1 
ATOM   3045  C  CG    . ARG A 1 426 ? -30.143 44.175 23.132  1.00 141.75 ? 426 ARG A CG    1 
ATOM   3046  C  CD    . ARG A 1 426 ? -30.653 42.816 22.700  1.00 140.08 ? 426 ARG A CD    1 
ATOM   3047  N  NE    . ARG A 1 426 ? -30.580 42.611 21.252  1.00 143.51 ? 426 ARG A NE    1 
ATOM   3048  C  CZ    . ARG A 1 426 ? -29.492 42.210 20.591  1.00 159.64 ? 426 ARG A CZ    1 
ATOM   3049  N  NH1   . ARG A 1 426 ? -28.339 41.982 21.215  1.00 154.92 ? 426 ARG A NH1   1 
ATOM   3050  N  NH2   . ARG A 1 426 ? -29.555 42.044 19.280  1.00 175.50 ? 426 ARG A NH2   1 
ATOM   3051  N  N     . LEU A 1 427 ? -31.191 44.374 27.744  1.00 145.77 ? 427 LEU A N     1 
ATOM   3052  C  CA    . LEU A 1 427 ? -31.101 44.097 29.175  1.00 145.42 ? 427 LEU A CA    1 
ATOM   3053  C  C     . LEU A 1 427 ? -32.266 43.224 29.648  1.00 149.60 ? 427 LEU A C     1 
ATOM   3054  O  O     . LEU A 1 427 ? -32.201 42.591 30.704  1.00 151.66 ? 427 LEU A O     1 
ATOM   3055  C  CB    . LEU A 1 427 ? -31.084 45.399 29.982  1.00 144.60 ? 427 LEU A CB    1 
ATOM   3056  C  CG    . LEU A 1 427 ? -29.907 46.342 29.769  1.00 143.84 ? 427 LEU A CG    1 
ATOM   3057  C  CD1   . LEU A 1 427 ? -29.748 47.259 30.972  1.00 145.31 ? 427 LEU A CD1   1 
ATOM   3058  C  CD2   . LEU A 1 427 ? -28.660 45.527 29.553  1.00 140.89 ? 427 LEU A CD2   1 
ATOM   3059  N  N     . THR A 1 428 ? -33.345 43.225 28.875  1.00 148.11 ? 428 THR A N     1 
ATOM   3060  C  CA    . THR A 1 428 ? -34.487 42.367 29.152  1.00 152.76 ? 428 THR A CA    1 
ATOM   3061  C  C     . THR A 1 428 ? -34.050 40.907 29.121  1.00 163.58 ? 428 THR A C     1 
ATOM   3062  O  O     . THR A 1 428 ? -34.669 40.047 29.745  1.00 174.85 ? 428 THR A O     1 
ATOM   3063  C  CB    . THR A 1 428 ? -35.603 42.583 28.110  1.00 155.49 ? 428 THR A CB    1 
ATOM   3064  O  OG1   . THR A 1 428 ? -36.866 42.727 28.770  1.00 159.48 ? 428 THR A OG1   1 
ATOM   3065  C  CG2   . THR A 1 428 ? -35.656 41.426 27.104  1.00 150.99 ? 428 THR A CG2   1 
ATOM   3066  N  N     . ASN A 1 429 ? -32.973 40.638 28.388  1.00 167.26 ? 429 ASN A N     1 
ATOM   3067  C  CA    . ASN A 1 429 ? -32.424 39.290 28.271  1.00 172.91 ? 429 ASN A CA    1 
ATOM   3068  C  C     . ASN A 1 429 ? -31.050 39.137 28.949  1.00 166.48 ? 429 ASN A C     1 
ATOM   3069  O  O     . ASN A 1 429 ? -30.007 39.132 28.288  1.00 165.52 ? 429 ASN A O     1 
ATOM   3070  C  CB    . ASN A 1 429 ? -32.378 38.875 26.790  1.00 179.56 ? 429 ASN A CB    1 
ATOM   3071  C  CG    . ASN A 1 429 ? -31.559 37.612 26.546  1.00 186.11 ? 429 ASN A CG    1 
ATOM   3072  O  OD1   . ASN A 1 429 ? -31.222 36.875 27.477  1.00 191.07 ? 429 ASN A OD1   1 
ATOM   3073  N  ND2   . ASN A 1 429 ? -31.235 37.361 25.280  1.00 182.66 ? 429 ASN A ND2   1 
ATOM   3074  N  N     . THR A 1 430 ? -31.061 39.017 30.272  1.00 187.63 ? 430 THR A N     1 
ATOM   3075  C  CA    . THR A 1 430 ? -29.848 38.725 31.018  1.00 171.78 ? 430 THR A CA    1 
ATOM   3076  C  C     . THR A 1 430 ? -29.845 37.243 31.359  1.00 177.43 ? 430 THR A C     1 
ATOM   3077  O  O     . THR A 1 430 ? -30.566 36.805 32.252  1.00 181.88 ? 430 THR A O     1 
ATOM   3078  C  CB    . THR A 1 430 ? -29.790 39.543 32.303  1.00 144.21 ? 430 THR A CB    1 
ATOM   3079  N  N     . ASP A 1 431 ? -29.032 36.473 30.642  1.00 183.27 ? 431 ASP A N     1 
ATOM   3080  C  CA    . ASP A 1 431 ? -29.098 35.014 30.709  1.00 188.97 ? 431 ASP A CA    1 
ATOM   3081  C  C     . ASP A 1 431 ? -27.878 34.295 30.147  1.00 185.02 ? 431 ASP A C     1 
ATOM   3082  O  O     . ASP A 1 431 ? -27.897 33.855 28.999  1.00 177.44 ? 431 ASP A O     1 
ATOM   3083  C  CB    . ASP A 1 431 ? -30.354 34.456 30.051  1.00 197.30 ? 431 ASP A CB    1 
ATOM   3084  C  CG    . ASP A 1 431 ? -30.591 33.000 30.422  1.00 206.82 ? 431 ASP A CG    1 
ATOM   3085  O  OD1   . ASP A 1 431 ? -30.914 32.188 29.524  1.00 202.32 ? 431 ASP A OD1   1 
ATOM   3086  O  OD2   . ASP A 1 431 ? -30.430 32.669 31.622  1.00 212.05 ? 431 ASP A OD2   1 
ATOM   3087  N  N     . VAL A 1 432 ? -26.798 34.257 30.918  1.00 182.35 ? 432 VAL A N     1 
ATOM   3088  C  CA    . VAL A 1 432 ? -25.577 33.549 30.518  1.00 176.13 ? 432 VAL A CA    1 
ATOM   3089  C  C     . VAL A 1 432 ? -25.752 32.136 29.903  1.00 182.83 ? 432 VAL A C     1 
ATOM   3090  O  O     . VAL A 1 432 ? -24.858 31.649 29.210  1.00 193.91 ? 432 VAL A O     1 
ATOM   3091  C  CB    . VAL A 1 432 ? -24.545 33.521 31.661  1.00 159.12 ? 432 VAL A CB    1 
ATOM   3092  C  CG1   . VAL A 1 432 ? -23.554 32.356 31.487  1.00 144.04 ? 432 VAL A CG1   1 
ATOM   3093  C  CG2   . VAL A 1 432 ? -23.824 34.861 31.733  1.00 164.57 ? 432 VAL A CG2   1 
ATOM   3094  N  N     . VAL A 1 433 ? -26.879 31.473 30.151  1.00 158.92 ? 433 VAL A N     1 
ATOM   3095  C  CA    . VAL A 1 433 ? -27.158 30.207 29.464  1.00 145.78 ? 433 VAL A CA    1 
ATOM   3096  C  C     . VAL A 1 433 ? -27.198 30.329 27.933  1.00 136.57 ? 433 VAL A C     1 
ATOM   3097  O  O     . VAL A 1 433 ? -26.543 29.571 27.221  1.00 131.27 ? 433 VAL A O     1 
ATOM   3098  C  CB    . VAL A 1 433 ? -28.509 29.625 29.852  1.00 157.35 ? 433 VAL A CB    1 
ATOM   3099  C  CG1   . VAL A 1 433 ? -28.801 28.371 29.017  1.00 121.05 ? 433 VAL A CG1   1 
ATOM   3100  C  CG2   . VAL A 1 433 ? -28.537 29.332 31.330  1.00 162.75 ? 433 VAL A CG2   1 
ATOM   3101  N  N     . VAL A 1 434 ? -27.990 31.271 27.431  1.00 140.60 ? 434 VAL A N     1 
ATOM   3102  C  CA    . VAL A 1 434 ? -28.163 31.454 25.994  1.00 150.80 ? 434 VAL A CA    1 
ATOM   3103  C  C     . VAL A 1 434 ? -26.854 31.771 25.294  1.00 162.17 ? 434 VAL A C     1 
ATOM   3104  O  O     . VAL A 1 434 ? -26.528 31.183 24.261  1.00 163.19 ? 434 VAL A O     1 
ATOM   3105  C  CB    . VAL A 1 434 ? -29.065 32.628 25.699  1.00 148.97 ? 434 VAL A CB    1 
ATOM   3106  C  CG1   . VAL A 1 434 ? -29.889 32.325 24.464  1.00 130.21 ? 434 VAL A CG1   1 
ATOM   3107  C  CG2   . VAL A 1 434 ? -29.936 32.924 26.904  1.00 165.68 ? 434 VAL A CG2   1 
ATOM   3108  N  N     . LEU A 1 435 ? -26.123 32.729 25.851  1.00 158.37 ? 435 LEU A N     1 
ATOM   3109  C  CA    . LEU A 1 435 ? -24.836 33.111 25.305  1.00 151.98 ? 435 LEU A CA    1 
ATOM   3110  C  C     . LEU A 1 435 ? -23.909 31.908 25.293  1.00 153.88 ? 435 LEU A C     1 
ATOM   3111  O  O     . LEU A 1 435 ? -23.208 31.670 24.313  1.00 150.84 ? 435 LEU A O     1 
ATOM   3112  C  CB    . LEU A 1 435 ? -24.229 34.247 26.123  1.00 159.63 ? 435 LEU A CB    1 
ATOM   3113  C  CG    . LEU A 1 435 ? -25.074 35.516 26.247  1.00 154.61 ? 435 LEU A CG    1 
ATOM   3114  C  CD1   . LEU A 1 435 ? -24.205 36.704 26.634  1.00 158.99 ? 435 LEU A CD1   1 
ATOM   3115  C  CD2   . LEU A 1 435 ? -25.804 35.791 24.947  1.00 139.60 ? 435 LEU A CD2   1 
ATOM   3116  N  N     . GLN A 1 436 ? -23.901 31.158 26.393  1.00 153.60 ? 436 GLN A N     1 
ATOM   3117  C  CA    . GLN A 1 436 ? -23.084 29.947 26.494  1.00 149.97 ? 436 GLN A CA    1 
ATOM   3118  C  C     . GLN A 1 436 ? -23.446 28.943 25.401  1.00 132.78 ? 436 GLN A C     1 
ATOM   3119  O  O     . GLN A 1 436 ? -22.581 28.241 24.884  1.00 136.05 ? 436 GLN A O     1 
ATOM   3120  C  CB    . GLN A 1 436 ? -23.184 29.303 27.891  1.00 155.83 ? 436 GLN A CB    1 
ATOM   3121  N  N     . GLU A 1 437 ? -24.729 28.870 25.064  1.00 118.91 ? 437 GLU A N     1 
ATOM   3122  C  CA    . GLU A 1 437 ? -25.173 28.015 23.973  1.00 132.35 ? 437 GLU A CA    1 
ATOM   3123  C  C     . GLU A 1 437 ? -24.487 28.384 22.661  1.00 131.09 ? 437 GLU A C     1 
ATOM   3124  O  O     . GLU A 1 437 ? -23.924 27.515 21.992  1.00 120.12 ? 437 GLU A O     1 
ATOM   3125  C  CB    . GLU A 1 437 ? -26.688 28.084 23.815  1.00 146.53 ? 437 GLU A CB    1 
ATOM   3126  C  CG    . GLU A 1 437 ? -27.425 26.918 24.446  1.00 154.95 ? 437 GLU A CG    1 
ATOM   3127  C  CD    . GLU A 1 437 ? -28.753 27.328 25.063  1.00 161.72 ? 437 GLU A CD    1 
ATOM   3128  O  OE1   . GLU A 1 437 ? -29.776 26.652 24.796  1.00 160.66 ? 437 GLU A OE1   1 
ATOM   3129  O  OE2   . GLU A 1 437 ? -28.766 28.330 25.814  1.00 161.15 ? 437 GLU A OE2   1 
ATOM   3130  N  N     . GLU A 1 438 ? -24.542 29.667 22.297  1.00 136.65 ? 438 GLU A N     1 
ATOM   3131  C  CA    . GLU A 1 438 ? -23.848 30.159 21.102  1.00 139.88 ? 438 GLU A CA    1 
ATOM   3132  C  C     . GLU A 1 438 ? -22.345 29.949 21.230  1.00 146.29 ? 438 GLU A C     1 
ATOM   3133  O  O     . GLU A 1 438 ? -21.689 29.578 20.259  1.00 151.17 ? 438 GLU A O     1 
ATOM   3134  C  CB    . GLU A 1 438 ? -24.148 31.640 20.793  1.00 109.35 ? 438 GLU A CB    1 
ATOM   3135  N  N     . GLU A 1 439 ? -21.801 30.188 22.423  1.00 135.30 ? 439 GLU A N     1 
ATOM   3136  C  CA    . GLU A 1 439 ? -20.367 30.022 22.636  1.00 139.39 ? 439 GLU A CA    1 
ATOM   3137  C  C     . GLU A 1 439 ? -19.929 28.605 22.261  1.00 148.55 ? 439 GLU A C     1 
ATOM   3138  O  O     . GLU A 1 439 ? -18.925 28.417 21.572  1.00 158.12 ? 439 GLU A O     1 
ATOM   3139  C  CB    . GLU A 1 439 ? -19.955 30.372 24.067  1.00 138.02 ? 439 GLU A CB    1 
ATOM   3140  C  CG    . GLU A 1 439 ? -18.451 30.215 24.336  1.00 147.86 ? 439 GLU A CG    1 
ATOM   3141  C  CD    . GLU A 1 439 ? -18.124 30.035 25.816  1.00 180.29 ? 439 GLU A CD    1 
ATOM   3142  O  OE1   . GLU A 1 439 ? -17.038 29.502 26.121  1.00 190.60 ? 439 GLU A OE1   1 
ATOM   3143  O  OE2   . GLU A 1 439 ? -18.949 30.413 26.678  1.00 191.45 ? 439 GLU A OE2   1 
ATOM   3144  N  N     . ALA A 1 440 ? -20.690 27.608 22.698  1.00 138.27 ? 440 ALA A N     1 
ATOM   3145  C  CA    . ALA A 1 440 ? -20.411 26.235 22.300  1.00 129.67 ? 440 ALA A CA    1 
ATOM   3146  C  C     . ALA A 1 440 ? -20.421 26.169 20.793  1.00 134.60 ? 440 ALA A C     1 
ATOM   3147  O  O     . ALA A 1 440 ? -19.485 25.667 20.171  1.00 141.75 ? 440 ALA A O     1 
ATOM   3148  C  CB    . ALA A 1 440 ? -21.460 25.319 22.826  1.00 123.88 ? 440 ALA A CB    1 
ATOM   3149  N  N     . GLU A 1 441 ? -21.490 26.702 20.213  1.00 128.28 ? 441 GLU A N     1 
ATOM   3150  C  CA    . GLU A 1 441 ? -21.727 26.584 18.788  1.00 125.00 ? 441 GLU A CA    1 
ATOM   3151  C  C     . GLU A 1 441 ? -20.509 27.088 18.039  1.00 132.37 ? 441 GLU A C     1 
ATOM   3152  O  O     . GLU A 1 441 ? -19.977 26.411 17.155  1.00 135.68 ? 441 GLU A O     1 
ATOM   3153  C  CB    . GLU A 1 441 ? -22.957 27.398 18.403  1.00 125.68 ? 441 GLU A CB    1 
ATOM   3154  C  CG    . GLU A 1 441 ? -23.887 26.683 17.450  1.00 135.65 ? 441 GLU A CG    1 
ATOM   3155  C  CD    . GLU A 1 441 ? -24.439 27.604 16.384  1.00 155.31 ? 441 GLU A CD    1 
ATOM   3156  O  OE1   . GLU A 1 441 ? -23.853 28.690 16.165  1.00 166.05 ? 441 GLU A OE1   1 
ATOM   3157  O  OE2   . GLU A 1 441 ? -25.456 27.241 15.755  1.00 159.48 ? 441 GLU A OE2   1 
ATOM   3158  N  N     . LEU A 1 442 ? -20.055 28.275 18.418  1.00 137.09 ? 442 LEU A N     1 
ATOM   3159  C  CA    . LEU A 1 442 ? -18.902 28.879 17.777  1.00 143.55 ? 442 LEU A CA    1 
ATOM   3160  C  C     . LEU A 1 442 ? -17.677 27.992 17.939  1.00 136.77 ? 442 LEU A C     1 
ATOM   3161  O  O     . LEU A 1 442 ? -17.035 27.630 16.963  1.00 137.93 ? 442 LEU A O     1 
ATOM   3162  C  CB    . LEU A 1 442 ? -18.628 30.267 18.359  1.00 154.05 ? 442 LEU A CB    1 
ATOM   3163  C  CG    . LEU A 1 442 ? -19.736 31.312 18.193  1.00 151.96 ? 442 LEU A CG    1 
ATOM   3164  C  CD1   . LEU A 1 442 ? -19.167 32.713 18.326  1.00 150.46 ? 442 LEU A CD1   1 
ATOM   3165  C  CD2   . LEU A 1 442 ? -20.458 31.153 16.855  1.00 137.92 ? 442 LEU A CD2   1 
ATOM   3166  N  N     . ARG A 1 443 ? -17.366 27.617 19.171  1.00 133.11 ? 443 ARG A N     1 
ATOM   3167  C  CA    . ARG A 1 443 ? -16.144 26.866 19.418  1.00 140.17 ? 443 ARG A CA    1 
ATOM   3168  C  C     . ARG A 1 443 ? -16.108 25.603 18.567  1.00 142.02 ? 443 ARG A C     1 
ATOM   3169  O  O     . ARG A 1 443 ? -15.084 25.286 17.960  1.00 139.20 ? 443 ARG A O     1 
ATOM   3170  C  CB    . ARG A 1 443 ? -16.011 26.540 20.899  1.00 139.38 ? 443 ARG A CB    1 
ATOM   3171  C  CG    . ARG A 1 443 ? -14.692 26.976 21.487  1.00 138.91 ? 443 ARG A CG    1 
ATOM   3172  C  CD    . ARG A 1 443 ? -14.864 27.520 22.901  1.00 154.05 ? 443 ARG A CD    1 
ATOM   3173  N  NE    . ARG A 1 443 ? -13.949 28.637 23.113  1.00 174.02 ? 443 ARG A NE    1 
ATOM   3174  C  CZ    . ARG A 1 443 ? -14.001 29.474 24.141  1.00 172.64 ? 443 ARG A CZ    1 
ATOM   3175  N  NH1   . ARG A 1 443 ? -14.933 29.311 25.068  1.00 159.99 ? 443 ARG A NH1   1 
ATOM   3176  N  NH2   . ARG A 1 443 ? -13.121 30.474 24.234  1.00 172.19 ? 443 ARG A NH2   1 
ATOM   3177  N  N     . GLU A 1 444 ? -17.234 24.898 18.513  1.00 147.52 ? 444 GLU A N     1 
ATOM   3178  C  CA    . GLU A 1 444 ? -17.371 23.733 17.644  1.00 153.10 ? 444 GLU A CA    1 
ATOM   3179  C  C     . GLU A 1 444 ? -17.168 24.067 16.144  1.00 120.58 ? 444 GLU A C     1 
ATOM   3180  O  O     . GLU A 1 444 ? -16.466 23.334 15.449  1.00 129.27 ? 444 GLU A O     1 
ATOM   3181  C  CB    . GLU A 1 444 ? -18.688 22.984 17.921  1.00 113.21 ? 444 GLU A CB    1 
ATOM   3182  N  N     . LYS A 1 445 ? -17.763 25.152 15.643  1.00 110.55 ? 445 LYS A N     1 
ATOM   3183  C  CA    . LYS A 1 445 ? -17.507 25.555 14.241  1.00 134.14 ? 445 LYS A CA    1 
ATOM   3184  C  C     . LYS A 1 445 ? -16.025 25.851 13.995  1.00 127.92 ? 445 LYS A C     1 
ATOM   3185  O  O     . LYS A 1 445 ? -15.447 25.379 13.026  1.00 126.16 ? 445 LYS A O     1 
ATOM   3186  C  CB    . LYS A 1 445 ? -18.374 26.751 13.715  1.00 103.52 ? 445 LYS A CB    1 
ATOM   3187  N  N     . ILE A 1 446 ? -15.415 26.633 14.874  1.00 116.66 ? 446 ILE A N     1 
ATOM   3188  C  CA    . ILE A 1 446 ? -14.027 27.014 14.698  1.00 120.09 ? 446 ILE A CA    1 
ATOM   3189  C  C     . ILE A 1 446 ? -13.162 25.778 14.593  1.00 140.00 ? 446 ILE A C     1 
ATOM   3190  O  O     . ILE A 1 446 ? -12.366 25.656 13.673  1.00 142.76 ? 446 ILE A O     1 
ATOM   3191  C  CB    . ILE A 1 446 ? -13.530 27.863 15.879  1.00 128.42 ? 446 ILE A CB    1 
ATOM   3192  C  CG1   . ILE A 1 446 ? -14.313 29.168 15.957  1.00 129.22 ? 446 ILE A CG1   1 
ATOM   3193  C  CG2   . ILE A 1 446 ? -12.051 28.164 15.754  1.00 131.33 ? 446 ILE A CG2   1 
ATOM   3194  C  CD1   . ILE A 1 446 ? -13.849 30.078 17.042  1.00 121.57 ? 446 ILE A CD1   1 
ATOM   3195  N  N     . ALA A 1 447 ? -13.319 24.862 15.541  1.00 146.27 ? 447 ALA A N     1 
ATOM   3196  C  CA    . ALA A 1 447 ? -12.522 23.642 15.557  1.00 140.70 ? 447 ALA A CA    1 
ATOM   3197  C  C     . ALA A 1 447 ? -12.775 22.761 14.337  1.00 146.05 ? 447 ALA A C     1 
ATOM   3198  O  O     . ALA A 1 447 ? -11.854 22.144 13.812  1.00 161.47 ? 447 ALA A O     1 
ATOM   3199  C  CB    . ALA A 1 447 ? -12.769 22.904 16.776  1.00 142.27 ? 447 ALA A CB    1 
ATOM   3200  N  N     . MET A 1 448 ? -14.027 22.684 13.902  1.00 135.95 ? 448 MET A N     1 
ATOM   3201  C  CA    . MET A 1 448 ? -14.340 22.008 12.650  1.00 138.43 ? 448 MET A CA    1 
ATOM   3202  C  C     . MET A 1 448 ? -13.544 22.622 11.498  1.00 139.62 ? 448 MET A C     1 
ATOM   3203  O  O     . MET A 1 448 ? -12.873 21.910 10.751  1.00 142.71 ? 448 MET A O     1 
ATOM   3204  C  CB    . MET A 1 448 ? -15.844 22.079 12.360  1.00 138.75 ? 448 MET A CB    1 
ATOM   3205  C  CG    . MET A 1 448 ? -16.203 22.103 10.888  1.00 130.68 ? 448 MET A CG    1 
ATOM   3206  N  N     . LEU A 1 449 ? -13.620 23.947 11.373  1.00 134.89 ? 449 LEU A N     1 
ATOM   3207  C  CA    . LEU A 1 449 ? -12.946 24.697 10.303  1.00 123.31 ? 449 LEU A CA    1 
ATOM   3208  C  C     . LEU A 1 449 ? -11.443 24.525 10.323  1.00 131.73 ? 449 LEU A C     1 
ATOM   3209  O  O     . LEU A 1 449 ? -10.828 24.242 9.301   1.00 140.37 ? 449 LEU A O     1 
ATOM   3210  C  CB    . LEU A 1 449 ? -13.230 26.191 10.422  1.00 109.81 ? 449 LEU A CB    1 
ATOM   3211  C  CG    . LEU A 1 449 ? -14.657 26.613 10.094  1.00 113.53 ? 449 LEU A CG    1 
ATOM   3212  C  CD1   . LEU A 1 449 ? -14.816 28.120 10.219  1.00 112.17 ? 449 LEU A CD1   1 
ATOM   3213  C  CD2   . LEU A 1 449 ? -15.028 26.149 8.705   1.00 109.77 ? 449 LEU A CD2   1 
ATOM   3214  N  N     . ALA A 1 450 ? -10.851 24.719 11.492  1.00 140.68 ? 450 ALA A N     1 
ATOM   3215  C  CA    . ALA A 1 450 ? -9.413  24.626 11.630  1.00 156.78 ? 450 ALA A CA    1 
ATOM   3216  C  C     . ALA A 1 450 ? -8.950  23.299 11.057  1.00 165.83 ? 450 ALA A C     1 
ATOM   3217  O  O     . ALA A 1 450 ? -7.872  23.212 10.464  1.00 173.02 ? 450 ALA A O     1 
ATOM   3218  C  CB    . ALA A 1 450 ? -9.017  24.756 13.074  1.00 159.29 ? 450 ALA A CB    1 
ATOM   3219  N  N     . ALA A 1 451 ? -9.776  22.270 11.231  1.00 153.04 ? 451 ALA A N     1 
ATOM   3220  C  CA    . ALA A 1 451 ? -9.515  20.978 10.617  1.00 150.47 ? 451 ALA A CA    1 
ATOM   3221  C  C     . ALA A 1 451 ? -9.391  21.125 9.101   1.00 154.00 ? 451 ALA A C     1 
ATOM   3222  O  O     . ALA A 1 451 ? -8.303  20.977 8.550   1.00 168.06 ? 451 ALA A O     1 
ATOM   3223  C  CB    . ALA A 1 451 ? -10.609 20.029 10.948  1.00 147.29 ? 451 ALA A CB    1 
ATOM   3224  N  N     . ILE A 1 452 ? -10.486 21.477 8.434   1.00 134.02 ? 452 ILE A N     1 
ATOM   3225  C  CA    . ILE A 1 452 ? -10.479 21.614 6.978   1.00 124.76 ? 452 ILE A CA    1 
ATOM   3226  C  C     . ILE A 1 452 ? -9.255  22.366 6.490   1.00 132.86 ? 452 ILE A C     1 
ATOM   3227  O  O     . ILE A 1 452 ? -8.595  21.954 5.546   1.00 145.06 ? 452 ILE A O     1 
ATOM   3228  C  CB    . ILE A 1 452 ? -11.693 22.402 6.478   1.00 121.97 ? 452 ILE A CB    1 
ATOM   3229  C  CG1   . ILE A 1 452 ? -12.908 22.109 7.355   1.00 123.07 ? 452 ILE A CG1   1 
ATOM   3230  C  CG2   . ILE A 1 452 ? -11.951 22.105 4.997   1.00 119.13 ? 452 ILE A CG2   1 
ATOM   3231  C  CD1   . ILE A 1 452 ? -14.168 22.772 6.895   1.00 104.71 ? 452 ILE A CD1   1 
ATOM   3232  N  N     . ILE A 1 453 ? -8.966  23.478 7.147   1.00 142.27 ? 453 ILE A N     1 
ATOM   3233  C  CA    . ILE A 1 453 ? -7.837  24.321 6.794   1.00 154.11 ? 453 ILE A CA    1 
ATOM   3234  C  C     . ILE A 1 453 ? -6.502  23.573 6.740   1.00 168.52 ? 453 ILE A C     1 
ATOM   3235  O  O     . ILE A 1 453 ? -5.735  23.744 5.791   1.00 183.03 ? 453 ILE A O     1 
ATOM   3236  C  CB    . ILE A 1 453 ? -7.768  25.520 7.750   1.00 157.68 ? 453 ILE A CB    1 
ATOM   3237  C  CG1   . ILE A 1 453 ? -8.565  26.679 7.155   1.00 156.23 ? 453 ILE A CG1   1 
ATOM   3238  C  CG2   . ILE A 1 453 ? -6.334  25.915 8.043   1.00 163.36 ? 453 ILE A CG2   1 
ATOM   3239  C  CD1   . ILE A 1 453 ? -8.808  27.794 8.114   1.00 167.64 ? 453 ILE A CD1   1 
ATOM   3240  N  N     . GLY A 1 454 ? -6.224  22.742 7.741   1.00 157.30 ? 454 GLY A N     1 
ATOM   3241  C  CA    . GLY A 1 454 ? -4.971  22.008 7.764   1.00 162.50 ? 454 GLY A CA    1 
ATOM   3242  C  C     . GLY A 1 454 ? -5.114  20.500 7.855   1.00 178.15 ? 454 GLY A C     1 
ATOM   3243  O  O     . GLY A 1 454 ? -4.380  19.849 8.604   1.00 190.26 ? 454 GLY A O     1 
ATOM   3244  N  N     . ASP A 1 455 ? -6.038  19.937 7.082   1.00 180.59 ? 455 ASP A N     1 
ATOM   3245  C  CA    . ASP A 1 455 ? -6.395  18.522 7.225   1.00 199.28 ? 455 ASP A CA    1 
ATOM   3246  C  C     . ASP A 1 455 ? -6.531  17.800 5.900   1.00 194.37 ? 455 ASP A C     1 
ATOM   3247  O  O     . ASP A 1 455 ? -7.217  16.797 5.820   1.00 203.27 ? 455 ASP A O     1 
ATOM   3248  C  CB    . ASP A 1 455 ? -7.682  18.336 8.034   1.00 209.65 ? 455 ASP A CB    1 
ATOM   3249  N  N     . GLU A 1 456 ? -5.826  18.284 4.890   1.00 147.68 ? 456 GLU A N     1 
ATOM   3250  C  CA    . GLU A 1 456 ? -6.093  18.000 3.471   1.00 153.43 ? 456 GLU A CA    1 
ATOM   3251  C  C     . GLU A 1 456 ? -7.176  16.976 3.050   1.00 159.74 ? 456 GLU A C     1 
ATOM   3252  O  O     . GLU A 1 456 ? -7.941  17.254 2.133   1.00 150.43 ? 456 GLU A O     1 
ATOM   3253  C  CB    . GLU A 1 456 ? -4.768  17.756 2.725   1.00 144.49 ? 456 GLU A CB    1 
ATOM   3254  C  CG    . GLU A 1 456 ? -4.843  18.018 1.209   1.00 164.68 ? 456 GLU A CG    1 
ATOM   3255  C  CD    . GLU A 1 456 ? -4.662  19.496 0.786   1.00 166.18 ? 456 GLU A CD    1 
ATOM   3256  O  OE1   . GLU A 1 456 ? -4.623  19.759 -0.446  1.00 155.66 ? 456 GLU A OE1   1 
ATOM   3257  O  OE2   . GLU A 1 456 ? -4.557  20.383 1.667   1.00 162.31 ? 456 GLU A OE2   1 
ATOM   3258  N  N     . ARG A 1 457 ? -7.247  15.801 3.665   1.00 179.10 ? 457 ARG A N     1 
ATOM   3259  C  CA    . ARG A 1 457 ? -8.327  14.873 3.302   1.00 177.93 ? 457 ARG A CA    1 
ATOM   3260  C  C     . ARG A 1 457 ? -9.707  15.334 3.808   1.00 158.42 ? 457 ARG A C     1 
ATOM   3261  O  O     . ARG A 1 457 ? -10.703 15.196 3.102   1.00 162.94 ? 457 ARG A O     1 
ATOM   3262  C  CB    . ARG A 1 457 ? -8.012  13.419 3.720   1.00 182.38 ? 457 ARG A CB    1 
ATOM   3263  C  CG    . ARG A 1 457 ? -8.718  12.303 2.882   1.00 159.77 ? 457 ARG A CG    1 
ATOM   3264  C  CD    . ARG A 1 457 ? -9.432  12.834 1.613   1.00 162.48 ? 457 ARG A CD    1 
ATOM   3265  N  NE    . ARG A 1 457 ? -8.961  12.367 0.291   1.00 169.68 ? 457 ARG A NE    1 
ATOM   3266  C  CZ    . ARG A 1 457 ? -7.695  12.167 -0.094  1.00 165.84 ? 457 ARG A CZ    1 
ATOM   3267  N  NH1   . ARG A 1 457 ? -6.683  12.381 0.740   1.00 171.16 ? 457 ARG A NH1   1 
ATOM   3268  N  NH2   . ARG A 1 457 ? -7.440  11.752 -1.337  1.00 139.24 ? 457 ARG A NH2   1 
ATOM   3269  N  N     . THR A 1 458 ? -9.767  15.879 5.019   1.00 144.32 ? 458 THR A N     1 
ATOM   3270  C  CA    . THR A 1 458 ? -11.012 16.448 5.535   1.00 156.86 ? 458 THR A CA    1 
ATOM   3271  C  C     . THR A 1 458 ? -11.522 17.518 4.559   1.00 152.47 ? 458 THR A C     1 
ATOM   3272  O  O     . THR A 1 458 ? -12.731 17.656 4.347   1.00 150.12 ? 458 THR A O     1 
ATOM   3273  C  CB    . THR A 1 458 ? -10.889 16.984 7.028   1.00 94.52  ? 458 THR A CB    1 
ATOM   3274  N  N     . MET A 1 459 ? -10.593 18.266 3.965   1.00 142.67 ? 459 MET A N     1 
ATOM   3275  C  CA    . MET A 1 459 ? -10.935 19.264 2.949   1.00 135.19 ? 459 MET A CA    1 
ATOM   3276  C  C     . MET A 1 459 ? -11.567 18.611 1.722   1.00 141.02 ? 459 MET A C     1 
ATOM   3277  O  O     . MET A 1 459 ? -12.653 19.009 1.296   1.00 147.35 ? 459 MET A O     1 
ATOM   3278  C  CB    . MET A 1 459 ? -9.682  20.041 2.528   1.00 136.61 ? 459 MET A CB    1 
ATOM   3279  C  CG    . MET A 1 459 ? -9.908  21.301 1.694   1.00 134.39 ? 459 MET A CG    1 
ATOM   3280  S  SD    . MET A 1 459 ? -10.266 21.089 -0.077  1.00 191.05 ? 459 MET A SD    1 
ATOM   3281  C  CE    . MET A 1 459 ? -8.859  20.149 -0.618  1.00 92.95  ? 459 MET A CE    1 
ATOM   3282  N  N     . TYR A 1 460 ? -10.878 17.615 1.157   1.00 133.05 ? 460 TYR A N     1 
ATOM   3283  C  CA    . TYR A 1 460 ? -11.326 16.934 -0.059  1.00 118.57 ? 460 TYR A CA    1 
ATOM   3284  C  C     . TYR A 1 460 ? -12.678 16.269 0.098   1.00 123.16 ? 460 TYR A C     1 
ATOM   3285  O  O     . TYR A 1 460 ? -13.485 16.262 -0.832  1.00 116.49 ? 460 TYR A O     1 
ATOM   3286  C  CB    . TYR A 1 460 ? -10.288 15.919 -0.531  1.00 118.78 ? 460 TYR A CB    1 
ATOM   3287  C  CG    . TYR A 1 460 ? -9.121  16.597 -1.201  1.00 136.76 ? 460 TYR A CG    1 
ATOM   3288  C  CD1   . TYR A 1 460 ? -9.206  17.045 -2.515  1.00 129.04 ? 460 TYR A CD1   1 
ATOM   3289  C  CD2   . TYR A 1 460 ? -7.946  16.825 -0.507  1.00 146.96 ? 460 TYR A CD2   1 
ATOM   3290  C  CE1   . TYR A 1 460 ? -8.139  17.687 -3.120  1.00 125.77 ? 460 TYR A CE1   1 
ATOM   3291  C  CE2   . TYR A 1 460 ? -6.878  17.466 -1.102  1.00 145.88 ? 460 TYR A CE2   1 
ATOM   3292  C  CZ    . TYR A 1 460 ? -6.975  17.899 -2.400  1.00 132.05 ? 460 TYR A CZ    1 
ATOM   3293  O  OH    . TYR A 1 460 ? -5.892  18.546 -2.954  1.00 129.63 ? 460 TYR A OH    1 
ATOM   3294  N  N     . ASN A 1 461 ? -12.916 15.699 1.274   1.00 135.02 ? 461 ASN A N     1 
ATOM   3295  C  CA    . ASN A 1 461 ? -14.208 15.104 1.579   1.00 138.75 ? 461 ASN A CA    1 
ATOM   3296  C  C     . ASN A 1 461 ? -15.341 16.119 1.468   1.00 139.38 ? 461 ASN A C     1 
ATOM   3297  O  O     . ASN A 1 461 ? -16.320 15.876 0.767   1.00 139.71 ? 461 ASN A O     1 
ATOM   3298  C  CB    . ASN A 1 461 ? -14.186 14.460 2.955   1.00 143.58 ? 461 ASN A CB    1 
ATOM   3299  C  CG    . ASN A 1 461 ? -13.320 13.220 2.999   1.00 154.04 ? 461 ASN A CG    1 
ATOM   3300  O  OD1   . ASN A 1 461 ? -12.911 12.697 1.957   1.00 149.86 ? 461 ASN A OD1   1 
ATOM   3301  N  ND2   . ASN A 1 461 ? -13.037 12.736 4.212   1.00 165.23 ? 461 ASN A ND2   1 
ATOM   3302  N  N     . LEU A 1 462 ? -15.191 17.262 2.137   1.00 138.59 ? 462 LEU A N     1 
ATOM   3303  C  CA    . LEU A 1 462 ? -16.155 18.363 2.022   1.00 127.90 ? 462 LEU A CA    1 
ATOM   3304  C  C     . LEU A 1 462 ? -16.408 18.732 0.551   1.00 122.37 ? 462 LEU A C     1 
ATOM   3305  O  O     . LEU A 1 462 ? -17.550 18.983 0.155   1.00 128.38 ? 462 LEU A O     1 
ATOM   3306  C  CB    . LEU A 1 462 ? -15.670 19.592 2.787   1.00 122.92 ? 462 LEU A CB    1 
ATOM   3307  C  CG    . LEU A 1 462 ? -16.689 20.467 3.523   1.00 126.33 ? 462 LEU A CG    1 
ATOM   3308  C  CD1   . LEU A 1 462 ? -15.973 21.656 4.137   1.00 131.24 ? 462 LEU A CD1   1 
ATOM   3309  C  CD2   . LEU A 1 462 ? -17.827 20.941 2.630   1.00 130.65 ? 462 LEU A CD2   1 
ATOM   3310  N  N     . MET A 1 463 ? -15.349 18.766 -0.257  1.00 113.78 ? 463 MET A N     1 
ATOM   3311  C  CA    . MET A 1 463 ? -15.519 18.966 -1.692  1.00 123.46 ? 463 MET A CA    1 
ATOM   3312  C  C     . MET A 1 463 ? -16.454 17.927 -2.258  1.00 137.85 ? 463 MET A C     1 
ATOM   3313  O  O     . MET A 1 463 ? -17.434 18.257 -2.930  1.00 135.98 ? 463 MET A O     1 
ATOM   3314  C  CB    . MET A 1 463 ? -14.186 18.893 -2.413  1.00 134.28 ? 463 MET A CB    1 
ATOM   3315  C  CG    . MET A 1 463 ? -13.994 20.029 -3.377  1.00 143.36 ? 463 MET A CG    1 
ATOM   3316  S  SD    . MET A 1 463 ? -12.454 19.836 -4.249  1.00 142.64 ? 463 MET A SD    1 
ATOM   3317  C  CE    . MET A 1 463 ? -12.979 18.600 -5.410  1.00 112.45 ? 463 MET A CE    1 
ATOM   3318  N  N     . LYS A 1 464 ? -16.137 16.665 -1.986  1.00 148.73 ? 464 LYS A N     1 
ATOM   3319  C  CA    . LYS A 1 464 ? -16.909 15.560 -2.534  1.00 141.17 ? 464 LYS A CA    1 
ATOM   3320  C  C     . LYS A 1 464 ? -18.382 15.708 -2.134  1.00 137.44 ? 464 LYS A C     1 
ATOM   3321  O  O     . LYS A 1 464 ? -19.278 15.576 -2.976  1.00 135.19 ? 464 LYS A O     1 
ATOM   3322  C  CB    . LYS A 1 464 ? -16.299 14.203 -2.127  1.00 113.11 ? 464 LYS A CB    1 
ATOM   3323  N  N     . LYS A 1 465 ? -18.631 16.017 -0.863  1.00 126.31 ? 465 LYS A N     1 
ATOM   3324  C  CA    . LYS A 1 465 ? -20.005 16.182 -0.389  1.00 138.69 ? 465 LYS A CA    1 
ATOM   3325  C  C     . LYS A 1 465 ? -20.724 17.268 -1.190  1.00 135.91 ? 465 LYS A C     1 
ATOM   3326  O  O     . LYS A 1 465 ? -21.716 16.995 -1.868  1.00 141.27 ? 465 LYS A O     1 
ATOM   3327  C  CB    . LYS A 1 465 ? -20.092 16.464 1.133   1.00 94.08  ? 465 LYS A CB    1 
ATOM   3328  N  N     . GLU A 1 466 ? -20.210 18.490 -1.141  1.00 125.00 ? 466 GLU A N     1 
ATOM   3329  C  CA    . GLU A 1 466 ? -20.892 19.579 -1.809  1.00 142.83 ? 466 GLU A CA    1 
ATOM   3330  C  C     . GLU A 1 466 ? -21.177 19.200 -3.261  1.00 139.86 ? 466 GLU A C     1 
ATOM   3331  O  O     . GLU A 1 466 ? -22.272 19.442 -3.772  1.00 141.83 ? 466 GLU A O     1 
ATOM   3332  C  CB    . GLU A 1 466 ? -20.070 20.858 -1.712  1.00 168.13 ? 466 GLU A CB    1 
ATOM   3333  C  CG    . GLU A 1 466 ? -19.754 21.242 -0.278  1.00 183.86 ? 466 GLU A CG    1 
ATOM   3334  C  CD    . GLU A 1 466 ? -19.116 22.615 -0.155  1.00 200.63 ? 466 GLU A CD    1 
ATOM   3335  O  OE1   . GLU A 1 466 ? -18.673 23.174 -1.193  1.00 198.87 ? 466 GLU A OE1   1 
ATOM   3336  O  OE2   . GLU A 1 466 ? -19.061 23.129 0.988   1.00 208.64 ? 466 GLU A OE2   1 
ATOM   3337  N  N     . LEU A 1 467 ? -20.194 18.591 -3.916  1.00 123.00 ? 467 LEU A N     1 
ATOM   3338  C  CA    . LEU A 1 467 ? -20.359 18.195 -5.306  1.00 117.56 ? 467 LEU A CA    1 
ATOM   3339  C  C     . LEU A 1 467 ? -21.520 17.236 -5.478  1.00 120.71 ? 467 LEU A C     1 
ATOM   3340  O  O     . LEU A 1 467 ? -22.332 17.386 -6.400  1.00 117.55 ? 467 LEU A O     1 
ATOM   3341  C  CB    . LEU A 1 467 ? -19.081 17.568 -5.846  1.00 124.63 ? 467 LEU A CB    1 
ATOM   3342  C  CG    . LEU A 1 467 ? -18.125 18.523 -6.566  1.00 124.19 ? 467 LEU A CG    1 
ATOM   3343  C  CD1   . LEU A 1 467 ? -16.857 17.797 -6.980  1.00 136.77 ? 467 LEU A CD1   1 
ATOM   3344  C  CD2   . LEU A 1 467 ? -18.795 19.150 -7.779  1.00 112.41 ? 467 LEU A CD2   1 
ATOM   3345  N  N     . ARG A 1 468 ? -21.586 16.239 -4.596  1.00 123.65 ? 468 ARG A N     1 
ATOM   3346  C  CA    . ARG A 1 468 ? -22.674 15.267 -4.632  1.00 121.86 ? 468 ARG A CA    1 
ATOM   3347  C  C     . ARG A 1 468 ? -24.019 15.935 -4.403  1.00 135.18 ? 468 ARG A C     1 
ATOM   3348  O  O     . ARG A 1 468 ? -24.990 15.624 -5.094  1.00 143.54 ? 468 ARG A O     1 
ATOM   3349  C  CB    . ARG A 1 468 ? -22.455 14.132 -3.641  1.00 121.43 ? 468 ARG A CB    1 
ATOM   3350  C  CG    . ARG A 1 468 ? -21.303 13.228 -4.029  1.00 136.56 ? 468 ARG A CG    1 
ATOM   3351  C  CD    . ARG A 1 468 ? -21.653 11.744 -3.910  1.00 153.58 ? 468 ARG A CD    1 
ATOM   3352  N  NE    . ARG A 1 468 ? -20.463 10.905 -4.046  1.00 157.37 ? 468 ARG A NE    1 
ATOM   3353  C  CZ    . ARG A 1 468 ? -19.531 10.775 -3.101  1.00 153.42 ? 468 ARG A CZ    1 
ATOM   3354  N  NH1   . ARG A 1 468 ? -19.643 11.432 -1.932  1.00 135.19 ? 468 ARG A NH1   1 
ATOM   3355  N  NH2   . ARG A 1 468 ? -18.482 9.988  -3.329  1.00 148.53 ? 468 ARG A NH2   1 
ATOM   3356  N  N     . GLU A 1 469 ? -24.068 16.856 -3.442  1.00 137.69 ? 469 GLU A N     1 
ATOM   3357  C  CA    . GLU A 1 469 ? -25.278 17.637 -3.173  1.00 129.54 ? 469 GLU A CA    1 
ATOM   3358  C  C     . GLU A 1 469 ? -25.743 18.407 -4.426  1.00 126.74 ? 469 GLU A C     1 
ATOM   3359  O  O     . GLU A 1 469 ? -26.944 18.482 -4.718  1.00 131.15 ? 469 GLU A O     1 
ATOM   3360  C  CB    . GLU A 1 469 ? -25.093 18.566 -1.961  1.00 98.99  ? 469 GLU A CB    1 
ATOM   3361  N  N     . VAL A 1 470 ? -24.790 18.979 -5.160  1.00 101.49 ? 470 VAL A N     1 
ATOM   3362  C  CA    . VAL A 1 470 ? -25.104 19.671 -6.402  1.00 123.71 ? 470 VAL A CA    1 
ATOM   3363  C  C     . VAL A 1 470 ? -25.628 18.724 -7.484  1.00 140.86 ? 470 VAL A C     1 
ATOM   3364  O  O     . VAL A 1 470 ? -26.552 19.070 -8.232  1.00 143.46 ? 470 VAL A O     1 
ATOM   3365  C  CB    . VAL A 1 470 ? -23.901 20.471 -6.926  1.00 132.16 ? 470 VAL A CB    1 
ATOM   3366  C  CG1   . VAL A 1 470 ? -23.939 20.568 -8.437  1.00 122.90 ? 470 VAL A CG1   1 
ATOM   3367  C  CG2   . VAL A 1 470 ? -23.888 21.851 -6.303  1.00 132.93 ? 470 VAL A CG2   1 
ATOM   3368  N  N     . LYS A 1 471 ? -25.026 17.541 -7.582  1.00 143.67 ? 471 LYS A N     1 
ATOM   3369  C  CA    . LYS A 1 471 ? -25.501 16.535 -8.532  1.00 140.86 ? 471 LYS A CA    1 
ATOM   3370  C  C     . LYS A 1 471 ? -26.950 16.149 -8.223  1.00 136.19 ? 471 LYS A C     1 
ATOM   3371  O  O     . LYS A 1 471 ? -27.798 16.107 -9.114  1.00 124.69 ? 471 LYS A O     1 
ATOM   3372  C  CB    . LYS A 1 471 ? -24.596 15.296 -8.548  1.00 133.11 ? 471 LYS A CB    1 
ATOM   3373  N  N     . LYS A 1 472 ? -27.235 15.884 -6.953  1.00 143.32 ? 472 LYS A N     1 
ATOM   3374  C  CA    . LYS A 1 472 ? -28.589 15.512 -6.553  1.00 147.40 ? 472 LYS A CA    1 
ATOM   3375  C  C     . LYS A 1 472 ? -29.597 16.585 -6.947  1.00 151.49 ? 472 LYS A C     1 
ATOM   3376  O  O     . LYS A 1 472 ? -30.619 16.271 -7.551  1.00 167.26 ? 472 LYS A O     1 
ATOM   3377  C  CB    . LYS A 1 472 ? -28.694 15.187 -5.056  1.00 137.60 ? 472 LYS A CB    1 
ATOM   3378  N  N     . LYS A 1 473 ? -29.310 17.843 -6.615  1.00 138.44 ? 473 LYS A N     1 
ATOM   3379  C  CA    . LYS A 1 473 ? -30.219 18.937 -6.955  1.00 141.13 ? 473 LYS A CA    1 
ATOM   3380  C  C     . LYS A 1 473 ? -30.421 19.051 -8.477  1.00 131.51 ? 473 LYS A C     1 
ATOM   3381  O  O     . LYS A 1 473 ? -31.532 18.926 -8.983  1.00 129.92 ? 473 LYS A O     1 
ATOM   3382  C  CB    . LYS A 1 473 ? -29.714 20.279 -6.370  1.00 153.73 ? 473 LYS A CB    1 
ATOM   3383  C  CG    . LYS A 1 473 ? -30.785 21.397 -6.118  1.00 87.88  ? 473 LYS A CG    1 
ATOM   3384  N  N     . PHE A 1 474 ? -29.348 19.302 -9.209  1.00 128.58 ? 474 PHE A N     1 
ATOM   3385  C  CA    . PHE A 1 474 ? -29.506 19.667 -10.610 1.00 144.43 ? 474 PHE A CA    1 
ATOM   3386  C  C     . PHE A 1 474 ? -29.414 18.576 -11.687 1.00 146.63 ? 474 PHE A C     1 
ATOM   3387  O  O     . PHE A 1 474 ? -29.498 18.889 -12.879 1.00 151.99 ? 474 PHE A O     1 
ATOM   3388  C  CB    . PHE A 1 474 ? -28.537 20.795 -10.935 1.00 153.32 ? 474 PHE A CB    1 
ATOM   3389  C  CG    . PHE A 1 474 ? -28.788 22.035 -10.136 1.00 145.49 ? 474 PHE A CG    1 
ATOM   3390  C  CD1   . PHE A 1 474 ? -29.668 22.997 -10.584 1.00 150.80 ? 474 PHE A CD1   1 
ATOM   3391  C  CD2   . PHE A 1 474 ? -28.158 22.230 -8.927  1.00 124.93 ? 474 PHE A CD2   1 
ATOM   3392  C  CE1   . PHE A 1 474 ? -29.899 24.128 -9.841  1.00 148.99 ? 474 PHE A CE1   1 
ATOM   3393  C  CE2   . PHE A 1 474 ? -28.386 23.361 -8.192  1.00 116.81 ? 474 PHE A CE2   1 
ATOM   3394  C  CZ    . PHE A 1 474 ? -29.255 24.304 -8.643  1.00 136.45 ? 474 PHE A CZ    1 
ATOM   3395  N  N     . ALA A 1 475 ? -29.241 17.317 -11.298 1.00 136.22 ? 475 ALA A N     1 
ATOM   3396  C  CA    . ALA A 1 475 ? -28.968 16.276 -12.293 1.00 128.88 ? 475 ALA A CA    1 
ATOM   3397  C  C     . ALA A 1 475 ? -30.168 15.993 -13.178 1.00 128.49 ? 475 ALA A C     1 
ATOM   3398  O  O     . ALA A 1 475 ? -31.304 16.033 -12.712 1.00 136.53 ? 475 ALA A O     1 
ATOM   3399  C  CB    . ALA A 1 475 ? -28.524 15.019 -11.624 1.00 133.39 ? 475 ALA A CB    1 
ATOM   3400  N  N     . THR A 1 476 ? -29.910 15.710 -14.454 1.00 131.60 ? 476 THR A N     1 
ATOM   3401  C  CA    . THR A 1 476 ? -30.966 15.339 -15.408 1.00 139.28 ? 476 THR A CA    1 
ATOM   3402  C  C     . THR A 1 476 ? -30.532 14.246 -16.371 1.00 136.24 ? 476 THR A C     1 
ATOM   3403  O  O     . THR A 1 476 ? -29.357 14.148 -16.705 1.00 147.21 ? 476 THR A O     1 
ATOM   3404  C  CB    . THR A 1 476 ? -31.413 16.520 -16.264 1.00 146.60 ? 476 THR A CB    1 
ATOM   3405  O  OG1   . THR A 1 476 ? -30.435 17.565 -16.179 1.00 155.85 ? 476 THR A OG1   1 
ATOM   3406  C  CG2   . THR A 1 476 ? -32.756 17.033 -15.779 1.00 148.76 ? 476 THR A CG2   1 
ATOM   3407  N  N     . PRO A 1 477 ? -31.489 13.430 -16.828 1.00 132.14 ? 477 PRO A N     1 
ATOM   3408  C  CA    . PRO A 1 477 ? -31.251 12.318 -17.752 1.00 145.71 ? 477 PRO A CA    1 
ATOM   3409  C  C     . PRO A 1 477 ? -30.439 12.764 -18.958 1.00 153.70 ? 477 PRO A C     1 
ATOM   3410  O  O     . PRO A 1 477 ? -30.391 13.964 -19.226 1.00 155.12 ? 477 PRO A O     1 
ATOM   3411  C  CB    . PRO A 1 477 ? -32.658 11.973 -18.212 1.00 146.07 ? 477 PRO A CB    1 
ATOM   3412  C  CG    . PRO A 1 477 ? -33.516 12.332 -17.049 1.00 138.25 ? 477 PRO A CG    1 
ATOM   3413  C  CD    . PRO A 1 477 ? -32.901 13.525 -16.428 1.00 133.53 ? 477 PRO A CD    1 
ATOM   3414  N  N     . ARG A 1 478 ? -29.811 11.825 -19.667 1.00 153.75 ? 478 ARG A N     1 
ATOM   3415  C  CA    . ARG A 1 478 ? -29.090 12.169 -20.893 1.00 141.44 ? 478 ARG A CA    1 
ATOM   3416  C  C     . ARG A 1 478 ? -30.059 12.517 -21.992 1.00 131.21 ? 478 ARG A C     1 
ATOM   3417  O  O     . ARG A 1 478 ? -31.148 11.959 -22.074 1.00 148.88 ? 478 ARG A O     1 
ATOM   3418  C  CB    . ARG A 1 478 ? -28.230 11.021 -21.385 1.00 147.23 ? 478 ARG A CB    1 
ATOM   3419  C  CG    . ARG A 1 478 ? -26.806 11.087 -20.914 1.00 150.66 ? 478 ARG A CG    1 
ATOM   3420  C  CD    . ARG A 1 478 ? -25.957 10.135 -21.710 1.00 149.19 ? 478 ARG A CD    1 
ATOM   3421  N  NE    . ARG A 1 478 ? -25.547 10.706 -22.979 1.00 134.23 ? 478 ARG A NE    1 
ATOM   3422  C  CZ    . ARG A 1 478 ? -24.352 11.240 -23.177 1.00 141.12 ? 478 ARG A CZ    1 
ATOM   3423  N  NH1   . ARG A 1 478 ? -23.464 11.271 -22.185 1.00 130.81 ? 478 ARG A NH1   1 
ATOM   3424  N  NH2   . ARG A 1 478 ? -24.047 11.737 -24.365 1.00 151.76 ? 478 ARG A NH2   1 
ATOM   3425  N  N     . LEU A 1 479 ? -29.662 13.435 -22.850 1.00 116.62 ? 479 LEU A N     1 
ATOM   3426  C  CA    . LEU A 1 479 ? -30.531 13.822 -23.937 1.00 132.69 ? 479 LEU A CA    1 
ATOM   3427  C  C     . LEU A 1 479 ? -29.960 13.223 -25.229 1.00 133.93 ? 479 LEU A C     1 
ATOM   3428  O  O     . LEU A 1 479 ? -30.704 12.750 -26.099 1.00 124.95 ? 479 LEU A O     1 
ATOM   3429  C  CB    . LEU A 1 479 ? -30.733 15.361 -23.950 1.00 97.64  ? 479 LEU A CB    1 
ATOM   3430  N  N     . SER A 1 480 ? -28.630 13.206 -25.314 1.00 140.24 ? 480 SER A N     1 
ATOM   3431  C  CA    . SER A 1 480 ? -27.905 12.678 -26.476 1.00 140.48 ? 480 SER A CA    1 
ATOM   3432  C  C     . SER A 1 480 ? -27.485 11.203 -26.281 1.00 149.14 ? 480 SER A C     1 
ATOM   3433  O  O     . SER A 1 480 ? -27.120 10.787 -25.175 1.00 145.74 ? 480 SER A O     1 
ATOM   3434  C  CB    . SER A 1 480 ? -26.703 13.586 -26.829 1.00 109.29 ? 480 SER A CB    1 
ATOM   3435  N  N     . SER A 1 481 ? -27.523 10.426 -27.364 1.00 142.82 ? 481 SER A N     1 
ATOM   3436  C  CA    . SER A 1 481 ? -27.282 8.983  -27.298 1.00 148.74 ? 481 SER A CA    1 
ATOM   3437  C  C     . SER A 1 481 ? -25.957 8.608  -27.951 1.00 156.67 ? 481 SER A C     1 
ATOM   3438  O  O     . SER A 1 481 ? -25.446 9.345  -28.791 1.00 161.01 ? 481 SER A O     1 
ATOM   3439  C  CB    . SER A 1 481 ? -28.422 8.210  -27.966 1.00 149.87 ? 481 SER A CB    1 
ATOM   3440  O  OG    . SER A 1 481 ? -28.493 8.507  -29.352 1.00 141.44 ? 481 SER A OG    1 
ATOM   3441  N  N     . LEU A 1 482 ? -25.398 7.464  -27.568 1.00 153.65 ? 482 LEU A N     1 
ATOM   3442  C  CA    . LEU A 1 482 ? -24.061 7.106  -28.026 1.00 153.81 ? 482 LEU A CA    1 
ATOM   3443  C  C     . LEU A 1 482 ? -24.012 5.816  -28.851 1.00 184.09 ? 482 LEU A C     1 
ATOM   3444  O  O     . LEU A 1 482 ? -24.448 4.759  -28.399 1.00 203.74 ? 482 LEU A O     1 
ATOM   3445  C  CB    . LEU A 1 482 ? -23.119 7.038  -26.829 1.00 148.15 ? 482 LEU A CB    1 
ATOM   3446  C  CG    . LEU A 1 482 ? -23.299 8.242  -25.891 1.00 149.88 ? 482 LEU A CG    1 
ATOM   3447  C  CD1   . LEU A 1 482 ? -22.314 8.257  -24.724 1.00 144.37 ? 482 LEU A CD1   1 
ATOM   3448  C  CD2   . LEU A 1 482 ? -23.183 9.535  -26.669 1.00 154.55 ? 482 LEU A CD2   1 
ATOM   3449  N  N     . GLU A 1 483 ? -23.477 5.926  -30.068 1.00 160.72 ? 483 GLU A N     1 
ATOM   3450  C  CA    . GLU A 1 483 ? -23.303 4.794  -30.977 1.00 154.70 ? 483 GLU A CA    1 
ATOM   3451  C  C     . GLU A 1 483 ? -21.874 4.745  -31.516 1.00 154.14 ? 483 GLU A C     1 
ATOM   3452  O  O     . GLU A 1 483 ? -21.071 3.893  -31.124 1.00 153.58 ? 483 GLU A O     1 
ATOM   3453  C  CB    . GLU A 1 483 ? -24.297 4.882  -32.141 1.00 140.20 ? 483 GLU A CB    1 
ATOM   3454  N  N     . ASN B 1 3   ? -65.797 32.809 -30.750 1.00 152.77 ? 3   ASN B N     1 
ATOM   3455  C  CA    . ASN B 1 3   ? -66.026 34.127 -30.154 1.00 151.91 ? 3   ASN B CA    1 
ATOM   3456  C  C     . ASN B 1 3   ? -65.574 35.245 -31.073 1.00 159.92 ? 3   ASN B C     1 
ATOM   3457  O  O     . ASN B 1 3   ? -64.509 35.185 -31.688 1.00 149.81 ? 3   ASN B O     1 
ATOM   3458  C  CB    . ASN B 1 3   ? -65.400 34.300 -28.764 1.00 124.63 ? 3   ASN B CB    1 
ATOM   3459  N  N     . ILE B 1 4   ? -66.431 36.244 -31.204 1.00 169.78 ? 4   ILE B N     1 
ATOM   3460  C  CA    . ILE B 1 4   ? -66.166 37.368 -32.077 1.00 154.24 ? 4   ILE B CA    1 
ATOM   3461  C  C     . ILE B 1 4   ? -67.053 38.551 -31.662 1.00 154.38 ? 4   ILE B C     1 
ATOM   3462  O  O     . ILE B 1 4   ? -68.267 38.400 -31.485 1.00 157.84 ? 4   ILE B O     1 
ATOM   3463  C  CB    . ILE B 1 4   ? -66.398 36.972 -33.554 1.00 137.00 ? 4   ILE B CB    1 
ATOM   3464  C  CG1   . ILE B 1 4   ? -66.552 38.201 -34.435 1.00 141.23 ? 4   ILE B CG1   1 
ATOM   3465  C  CG2   . ILE B 1 4   ? -67.625 36.104 -33.689 1.00 141.55 ? 4   ILE B CG2   1 
ATOM   3466  C  CD1   . ILE B 1 4   ? -65.382 38.429 -35.326 1.00 150.86 ? 4   ILE B CD1   1 
ATOM   3467  N  N     . GLN B 1 5   ? -66.452 39.726 -31.508 1.00 146.86 ? 5   GLN B N     1 
ATOM   3468  C  CA    . GLN B 1 5   ? -67.226 40.942 -31.282 1.00 134.03 ? 5   GLN B CA    1 
ATOM   3469  C  C     . GLN B 1 5   ? -67.188 41.771 -32.552 1.00 144.72 ? 5   GLN B C     1 
ATOM   3470  O  O     . GLN B 1 5   ? -66.135 41.997 -33.156 1.00 143.77 ? 5   GLN B O     1 
ATOM   3471  C  CB    . GLN B 1 5   ? -66.768 41.773 -30.063 1.00 98.70  ? 5   GLN B CB    1 
ATOM   3472  N  N     . ASN B 1 6   ? -68.360 42.237 -32.937 1.00 142.39 ? 6   ASN B N     1 
ATOM   3473  C  CA    . ASN B 1 6   ? -68.544 42.838 -34.226 1.00 140.95 ? 6   ASN B CA    1 
ATOM   3474  C  C     . ASN B 1 6   ? -68.597 44.331 -33.971 1.00 136.09 ? 6   ASN B C     1 
ATOM   3475  O  O     . ASN B 1 6   ? -69.407 44.803 -33.187 1.00 151.60 ? 6   ASN B O     1 
ATOM   3476  C  CB    . ASN B 1 6   ? -69.855 42.291 -34.812 1.00 138.21 ? 6   ASN B CB    1 
ATOM   3477  C  CG    . ASN B 1 6   ? -69.785 42.043 -36.318 1.00 133.62 ? 6   ASN B CG    1 
ATOM   3478  O  OD1   . ASN B 1 6   ? -68.950 42.624 -37.022 1.00 132.74 ? 6   ASN B OD1   1 
ATOM   3479  N  ND2   . ASN B 1 6   ? -70.680 41.186 -36.819 1.00 121.57 ? 6   ASN B ND2   1 
ATOM   3480  N  N     . MET B 1 7   ? -67.699 45.079 -34.591 1.00 122.15 ? 7   MET B N     1 
ATOM   3481  C  CA    . MET B 1 7   ? -67.672 46.516 -34.366 1.00 127.22 ? 7   MET B CA    1 
ATOM   3482  C  C     . MET B 1 7   ? -67.609 47.282 -35.675 1.00 137.89 ? 7   MET B C     1 
ATOM   3483  O  O     . MET B 1 7   ? -67.081 46.775 -36.670 1.00 147.10 ? 7   MET B O     1 
ATOM   3484  C  CB    . MET B 1 7   ? -66.477 46.891 -33.505 1.00 132.58 ? 7   MET B CB    1 
ATOM   3485  C  CG    . MET B 1 7   ? -66.543 46.364 -32.100 1.00 135.53 ? 7   MET B CG    1 
ATOM   3486  S  SD    . MET B 1 7   ? -65.496 47.380 -31.069 1.00 152.25 ? 7   MET B SD    1 
ATOM   3487  C  CE    . MET B 1 7   ? -65.489 46.440 -29.542 1.00 327.88 ? 7   MET B CE    1 
ATOM   3488  N  N     . SER B 1 8   ? -68.126 48.510 -35.683 1.00 135.28 ? 8   SER B N     1 
ATOM   3489  C  CA    . SER B 1 8   ? -68.105 49.265 -36.923 1.00 143.86 ? 8   SER B CA    1 
ATOM   3490  C  C     . SER B 1 8   ? -66.719 49.849 -37.183 1.00 138.41 ? 8   SER B C     1 
ATOM   3491  O  O     . SER B 1 8   ? -65.775 49.618 -36.435 1.00 149.64 ? 8   SER B O     1 
ATOM   3492  C  CB    . SER B 1 8   ? -69.120 50.406 -36.859 1.00 151.95 ? 8   SER B CB    1 
ATOM   3493  O  OG    . SER B 1 8   ? -68.465 51.636 -36.593 1.00 156.79 ? 8   SER B OG    1 
ATOM   3494  N  N     . LEU B 1 9   ? -66.621 50.647 -38.232 1.00 124.77 ? 9   LEU B N     1 
ATOM   3495  C  CA    . LEU B 1 9   ? -65.356 51.214 -38.639 1.00 117.92 ? 9   LEU B CA    1 
ATOM   3496  C  C     . LEU B 1 9   ? -65.297 52.588 -38.026 1.00 124.03 ? 9   LEU B C     1 
ATOM   3497  O  O     . LEU B 1 9   ? -64.239 53.057 -37.612 1.00 130.26 ? 9   LEU B O     1 
ATOM   3498  C  CB    . LEU B 1 9   ? -65.293 51.290 -40.167 1.00 120.41 ? 9   LEU B CB    1 
ATOM   3499  C  CG    . LEU B 1 9   ? -63.940 51.574 -40.801 1.00 123.38 ? 9   LEU B CG    1 
ATOM   3500  C  CD1   . LEU B 1 9   ? -63.790 53.048 -41.049 1.00 126.62 ? 9   LEU B CD1   1 
ATOM   3501  C  CD2   . LEU B 1 9   ? -62.832 51.073 -39.906 1.00 125.28 ? 9   LEU B CD2   1 
ATOM   3502  N  N     . GLU B 1 10  ? -66.454 53.242 -38.005 1.00 134.62 ? 10  GLU B N     1 
ATOM   3503  C  CA    . GLU B 1 10  ? -66.563 54.598 -37.497 1.00 132.85 ? 10  GLU B CA    1 
ATOM   3504  C  C     . GLU B 1 10  ? -66.205 54.596 -36.020 1.00 139.88 ? 10  GLU B C     1 
ATOM   3505  O  O     . GLU B 1 10  ? -65.302 55.318 -35.581 1.00 128.32 ? 10  GLU B O     1 
ATOM   3506  C  CB    . GLU B 1 10  ? -67.987 55.126 -37.703 1.00 114.20 ? 10  GLU B CB    1 
ATOM   3507  N  N     . ASP B 1 11  ? -66.912 53.756 -35.265 1.00 142.46 ? 11  ASP B N     1 
ATOM   3508  C  CA    . ASP B 1 11  ? -66.736 53.653 -33.816 1.00 133.41 ? 11  ASP B CA    1 
ATOM   3509  C  C     . ASP B 1 11  ? -65.329 53.172 -33.409 1.00 126.64 ? 11  ASP B C     1 
ATOM   3510  O  O     . ASP B 1 11  ? -64.684 53.773 -32.548 1.00 123.72 ? 11  ASP B O     1 
ATOM   3511  C  CB    . ASP B 1 11  ? -67.848 52.789 -33.192 1.00 110.13 ? 11  ASP B CB    1 
ATOM   3512  N  N     . ILE B 1 12  ? -64.857 52.098 -34.028 1.00 116.77 ? 12  ILE B N     1 
ATOM   3513  C  CA    . ILE B 1 12  ? -63.499 51.628 -33.785 1.00 113.03 ? 12  ILE B CA    1 
ATOM   3514  C  C     . ILE B 1 12  ? -62.445 52.703 -34.037 1.00 109.52 ? 12  ILE B C     1 
ATOM   3515  O  O     . ILE B 1 12  ? -61.537 52.881 -33.237 1.00 101.18 ? 12  ILE B O     1 
ATOM   3516  C  CB    . ILE B 1 12  ? -63.176 50.432 -34.662 1.00 106.38 ? 12  ILE B CB    1 
ATOM   3517  C  CG1   . ILE B 1 12  ? -63.890 49.209 -34.102 1.00 104.16 ? 12  ILE B CG1   1 
ATOM   3518  C  CG2   . ILE B 1 12  ? -61.650 50.261 -34.788 1.00 83.90  ? 12  ILE B CG2   1 
ATOM   3519  C  CD1   . ILE B 1 12  ? -63.613 47.975 -34.871 1.00 118.35 ? 12  ILE B CD1   1 
ATOM   3520  N  N     . MET B 1 13  ? -62.561 53.390 -35.169 1.00 116.01 ? 13  MET B N     1 
ATOM   3521  C  CA    . MET B 1 13  ? -61.654 54.472 -35.526 1.00 110.93 ? 13  MET B CA    1 
ATOM   3522  C  C     . MET B 1 13  ? -61.755 55.590 -34.506 1.00 115.89 ? 13  MET B C     1 
ATOM   3523  O  O     . MET B 1 13  ? -60.749 56.220 -34.151 1.00 103.43 ? 13  MET B O     1 
ATOM   3524  C  CB    . MET B 1 13  ? -61.978 54.997 -36.921 1.00 116.62 ? 13  MET B CB    1 
ATOM   3525  C  CG    . MET B 1 13  ? -61.255 54.274 -38.056 1.00 119.90 ? 13  MET B CG    1 
ATOM   3526  S  SD    . MET B 1 13  ? -59.679 55.075 -38.438 1.00 149.20 ? 13  MET B SD    1 
ATOM   3527  C  CE    . MET B 1 13  ? -60.209 56.777 -38.578 1.00 205.83 ? 13  MET B CE    1 
ATOM   3528  N  N     . GLY B 1 14  ? -62.984 55.830 -34.047 1.00 121.66 ? 14  GLY B N     1 
ATOM   3529  C  CA    . GLY B 1 14  ? -63.259 56.769 -32.969 1.00 121.25 ? 14  GLY B CA    1 
ATOM   3530  C  C     . GLY B 1 14  ? -62.472 56.500 -31.691 1.00 114.39 ? 14  GLY B C     1 
ATOM   3531  O  O     . GLY B 1 14  ? -61.599 57.293 -31.348 1.00 111.25 ? 14  GLY B O     1 
ATOM   3532  N  N     . GLU B 1 15  ? -62.735 55.381 -31.007 1.00 108.70 ? 15  GLU B N     1 
ATOM   3533  C  CA    . GLU B 1 15  ? -61.982 55.043 -29.786 1.00 104.28 ? 15  GLU B CA    1 
ATOM   3534  C  C     . GLU B 1 15  ? -60.489 55.076 -30.032 1.00 103.90 ? 15  GLU B C     1 
ATOM   3535  O  O     . GLU B 1 15  ? -59.762 55.825 -29.384 1.00 104.06 ? 15  GLU B O     1 
ATOM   3536  C  CB    . GLU B 1 15  ? -62.323 53.658 -29.221 1.00 87.73  ? 15  GLU B CB    1 
ATOM   3537  N  N     . ARG B 1 16  ? -60.035 54.272 -30.985 1.00 100.03 ? 16  ARG B N     1 
ATOM   3538  C  CA    . ARG B 1 16  ? -58.607 54.143 -31.213 1.00 106.51 ? 16  ARG B CA    1 
ATOM   3539  C  C     . ARG B 1 16  ? -57.935 55.488 -31.448 1.00 115.18 ? 16  ARG B C     1 
ATOM   3540  O  O     . ARG B 1 16  ? -56.809 55.695 -31.000 1.00 125.04 ? 16  ARG B O     1 
ATOM   3541  C  CB    . ARG B 1 16  ? -58.276 53.158 -32.332 1.00 108.42 ? 16  ARG B CB    1 
ATOM   3542  C  CG    . ARG B 1 16  ? -58.773 51.735 -32.101 1.00 113.20 ? 16  ARG B CG    1 
ATOM   3543  C  CD    . ARG B 1 16  ? -58.846 51.406 -30.640 1.00 131.14 ? 16  ARG B CD    1 
ATOM   3544  N  NE    . ARG B 1 16  ? -58.379 50.050 -30.372 1.00 144.54 ? 16  ARG B NE    1 
ATOM   3545  C  CZ    . ARG B 1 16  ? -59.117 48.956 -30.513 1.00 146.14 ? 16  ARG B CZ    1 
ATOM   3546  N  NH1   . ARG B 1 16  ? -60.380 49.044 -30.937 1.00 150.09 ? 16  ARG B NH1   1 
ATOM   3547  N  NH2   . ARG B 1 16  ? -58.585 47.772 -30.227 1.00 133.49 ? 16  ARG B NH2   1 
ATOM   3548  N  N     . PHE B 1 17  ? -58.588 56.407 -32.151 1.00 113.75 ? 17  PHE B N     1 
ATOM   3549  C  CA    . PHE B 1 17  ? -57.956 57.710 -32.298 1.00 123.80 ? 17  PHE B CA    1 
ATOM   3550  C  C     . PHE B 1 17  ? -57.923 58.463 -30.979 1.00 124.10 ? 17  PHE B C     1 
ATOM   3551  O  O     . PHE B 1 17  ? -56.864 58.925 -30.548 1.00 115.61 ? 17  PHE B O     1 
ATOM   3552  C  CB    . PHE B 1 17  ? -58.601 58.579 -33.358 1.00 128.35 ? 17  PHE B CB    1 
ATOM   3553  C  CG    . PHE B 1 17  ? -57.677 59.636 -33.877 1.00 137.39 ? 17  PHE B CG    1 
ATOM   3554  C  CD1   . PHE B 1 17  ? -57.924 60.980 -33.625 1.00 126.97 ? 17  PHE B CD1   1 
ATOM   3555  C  CD2   . PHE B 1 17  ? -56.519 59.273 -34.589 1.00 145.83 ? 17  PHE B CD2   1 
ATOM   3556  C  CE1   . PHE B 1 17  ? -57.050 61.948 -34.099 1.00 138.04 ? 17  PHE B CE1   1 
ATOM   3557  C  CE2   . PHE B 1 17  ? -55.635 60.229 -35.072 1.00 145.51 ? 17  PHE B CE2   1 
ATOM   3558  C  CZ    . PHE B 1 17  ? -55.899 61.569 -34.828 1.00 149.53 ? 17  PHE B CZ    1 
ATOM   3559  N  N     . GLY B 1 18  ? -59.087 58.573 -30.343 1.00 117.56 ? 18  GLY B N     1 
ATOM   3560  C  CA    . GLY B 1 18  ? -59.223 59.285 -29.082 1.00 112.98 ? 18  GLY B CA    1 
ATOM   3561  C  C     . GLY B 1 18  ? -58.209 58.868 -28.026 1.00 113.08 ? 18  GLY B C     1 
ATOM   3562  O  O     . GLY B 1 18  ? -57.664 59.717 -27.304 1.00 98.40  ? 18  GLY B O     1 
ATOM   3563  N  N     . ARG B 1 19  ? -57.957 57.564 -27.925 1.00 104.76 ? 19  ARG B N     1 
ATOM   3564  C  CA    . ARG B 1 19  ? -56.957 57.084 -26.989 1.00 104.04 ? 19  ARG B CA    1 
ATOM   3565  C  C     . ARG B 1 19  ? -55.610 57.711 -27.289 1.00 115.88 ? 19  ARG B C     1 
ATOM   3566  O  O     . ARG B 1 19  ? -55.016 58.398 -26.442 1.00 121.26 ? 19  ARG B O     1 
ATOM   3567  C  CB    . ARG B 1 19  ? -56.840 55.571 -27.057 1.00 100.59 ? 19  ARG B CB    1 
ATOM   3568  C  CG    . ARG B 1 19  ? -57.744 54.868 -26.054 1.00 119.34 ? 19  ARG B CG    1 
ATOM   3569  C  CD    . ARG B 1 19  ? -57.818 53.390 -26.294 1.00 119.24 ? 19  ARG B CD    1 
ATOM   3570  N  NE    . ARG B 1 19  ? -56.616 52.747 -25.803 1.00 136.99 ? 19  ARG B NE    1 
ATOM   3571  C  CZ    . ARG B 1 19  ? -56.190 51.564 -26.223 1.00 165.74 ? 19  ARG B CZ    1 
ATOM   3572  N  NH1   . ARG B 1 19  ? -56.870 50.904 -27.158 1.00 160.57 ? 19  ARG B NH1   1 
ATOM   3573  N  NH2   . ARG B 1 19  ? -55.080 51.044 -25.707 1.00 183.88 ? 19  ARG B NH2   1 
ATOM   3574  N  N     . TYR B 1 20  ? -55.138 57.490 -28.508 1.00 102.88 ? 20  TYR B N     1 
ATOM   3575  C  CA    . TYR B 1 20  ? -53.837 58.000 -28.910 1.00 102.17 ? 20  TYR B CA    1 
ATOM   3576  C  C     . TYR B 1 20  ? -53.753 59.519 -28.821 1.00 94.78  ? 20  TYR B C     1 
ATOM   3577  O  O     . TYR B 1 20  ? -52.830 60.057 -28.224 1.00 101.58 ? 20  TYR B O     1 
ATOM   3578  C  CB    . TYR B 1 20  ? -53.536 57.534 -30.317 1.00 95.60  ? 20  TYR B CB    1 
ATOM   3579  C  CG    . TYR B 1 20  ? -52.175 57.883 -30.842 1.00 98.95  ? 20  TYR B CG    1 
ATOM   3580  C  CD1   . TYR B 1 20  ? -51.067 57.120 -30.510 1.00 122.94 ? 20  TYR B CD1   1 
ATOM   3581  C  CD2   . TYR B 1 20  ? -52.006 58.939 -31.725 1.00 93.79  ? 20  TYR B CD2   1 
ATOM   3582  C  CE1   . TYR B 1 20  ? -49.814 57.417 -31.024 1.00 134.93 ? 20  TYR B CE1   1 
ATOM   3583  C  CE2   . TYR B 1 20  ? -50.764 59.239 -32.243 1.00 115.26 ? 20  TYR B CE2   1 
ATOM   3584  C  CZ    . TYR B 1 20  ? -49.668 58.477 -31.888 1.00 127.94 ? 20  TYR B CZ    1 
ATOM   3585  O  OH    . TYR B 1 20  ? -48.424 58.772 -32.397 1.00 126.84 ? 20  TYR B OH    1 
ATOM   3586  N  N     . SER B 1 21  ? -54.714 60.218 -29.404 1.00 90.33  ? 21  SER B N     1 
ATOM   3587  C  CA    . SER B 1 21  ? -54.627 61.669 -29.450 1.00 111.31 ? 21  SER B CA    1 
ATOM   3588  C  C     . SER B 1 21  ? -54.420 62.205 -28.048 1.00 112.52 ? 21  SER B C     1 
ATOM   3589  O  O     . SER B 1 21  ? -53.584 63.079 -27.810 1.00 108.71 ? 21  SER B O     1 
ATOM   3590  C  CB    . SER B 1 21  ? -55.910 62.203 -29.996 1.00 112.82 ? 21  SER B CB    1 
ATOM   3591  O  OG    . SER B 1 21  ? -56.926 61.384 -29.461 1.00 137.38 ? 21  SER B OG    1 
ATOM   3592  N  N     . LYS B 1 22  ? -55.196 61.661 -27.121 1.00 103.86 ? 22  LYS B N     1 
ATOM   3593  C  CA    . LYS B 1 22  ? -55.107 62.032 -25.726 1.00 103.12 ? 22  LYS B CA    1 
ATOM   3594  C  C     . LYS B 1 22  ? -53.713 61.725 -25.139 1.00 117.85 ? 22  LYS B C     1 
ATOM   3595  O  O     . LYS B 1 22  ? -53.032 62.621 -24.639 1.00 120.94 ? 22  LYS B O     1 
ATOM   3596  C  CB    . LYS B 1 22  ? -56.200 61.295 -24.975 1.00 108.72 ? 22  LYS B CB    1 
ATOM   3597  C  CG    . LYS B 1 22  ? -56.709 61.995 -23.742 1.00 124.96 ? 22  LYS B CG    1 
ATOM   3598  C  CD    . LYS B 1 22  ? -57.166 60.954 -22.729 1.00 136.98 ? 22  LYS B CD    1 
ATOM   3599  C  CE    . LYS B 1 22  ? -57.788 61.580 -21.502 1.00 145.02 ? 22  LYS B CE    1 
ATOM   3600  N  NZ    . LYS B 1 22  ? -58.046 60.534 -20.473 1.00 154.18 ? 22  LYS B NZ    1 
ATOM   3601  N  N     . TYR B 1 23  ? -53.276 60.469 -25.217 1.00 106.03 ? 23  TYR B N     1 
ATOM   3602  C  CA    . TYR B 1 23  ? -51.989 60.084 -24.630 1.00 99.56  ? 23  TYR B CA    1 
ATOM   3603  C  C     . TYR B 1 23  ? -50.847 60.962 -25.116 1.00 107.60 ? 23  TYR B C     1 
ATOM   3604  O  O     . TYR B 1 23  ? -49.961 61.307 -24.352 1.00 123.22 ? 23  TYR B O     1 
ATOM   3605  C  CB    . TYR B 1 23  ? -51.659 58.646 -24.978 1.00 104.89 ? 23  TYR B CB    1 
ATOM   3606  C  CG    . TYR B 1 23  ? -50.430 58.087 -24.296 1.00 102.43 ? 23  TYR B CG    1 
ATOM   3607  C  CD1   . TYR B 1 23  ? -49.324 57.673 -25.032 1.00 123.59 ? 23  TYR B CD1   1 
ATOM   3608  C  CD2   . TYR B 1 23  ? -50.401 57.924 -22.922 1.00 125.36 ? 23  TYR B CD2   1 
ATOM   3609  C  CE1   . TYR B 1 23  ? -48.211 57.128 -24.407 1.00 135.37 ? 23  TYR B CE1   1 
ATOM   3610  C  CE2   . TYR B 1 23  ? -49.307 57.387 -22.287 1.00 140.39 ? 23  TYR B CE2   1 
ATOM   3611  C  CZ    . TYR B 1 23  ? -48.209 56.994 -23.024 1.00 150.95 ? 23  TYR B CZ    1 
ATOM   3612  O  OH    . TYR B 1 23  ? -47.119 56.471 -22.354 1.00 164.27 ? 23  TYR B OH    1 
ATOM   3613  N  N     . ILE B 1 24  ? -50.868 61.286 -26.403 1.00 112.54 ? 24  ILE B N     1 
ATOM   3614  C  CA    . ILE B 1 24  ? -49.855 62.111 -27.041 1.00 107.66 ? 24  ILE B CA    1 
ATOM   3615  C  C     . ILE B 1 24  ? -49.830 63.492 -26.429 1.00 102.38 ? 24  ILE B C     1 
ATOM   3616  O  O     . ILE B 1 24  ? -48.776 63.998 -26.059 1.00 112.57 ? 24  ILE B O     1 
ATOM   3617  C  CB    . ILE B 1 24  ? -50.188 62.296 -28.537 1.00 127.71 ? 24  ILE B CB    1 
ATOM   3618  C  CG1   . ILE B 1 24  ? -49.761 61.068 -29.322 1.00 121.79 ? 24  ILE B CG1   1 
ATOM   3619  C  CG2   . ILE B 1 24  ? -49.486 63.514 -29.090 1.00 146.13 ? 24  ILE B CG2   1 
ATOM   3620  C  CD1   . ILE B 1 24  ? -48.439 60.524 -28.824 1.00 128.12 ? 24  ILE B CD1   1 
ATOM   3621  N  N     . ILE B 1 25  ? -51.004 64.106 -26.345 1.00 93.35  ? 25  ILE B N     1 
ATOM   3622  C  CA    . ILE B 1 25  ? -51.138 65.451 -25.813 1.00 103.91 ? 25  ILE B CA    1 
ATOM   3623  C  C     . ILE B 1 25  ? -50.662 65.593 -24.369 1.00 108.51 ? 25  ILE B C     1 
ATOM   3624  O  O     . ILE B 1 25  ? -49.793 66.408 -24.075 1.00 113.45 ? 25  ILE B O     1 
ATOM   3625  C  CB    . ILE B 1 25  ? -52.574 65.874 -25.814 1.00 98.35  ? 25  ILE B CB    1 
ATOM   3626  C  CG1   . ILE B 1 25  ? -53.090 65.931 -27.220 1.00 86.05  ? 25  ILE B CG1   1 
ATOM   3627  C  CG2   . ILE B 1 25  ? -52.718 67.223 -25.148 1.00 103.65 ? 25  ILE B CG2   1 
ATOM   3628  C  CD1   . ILE B 1 25  ? -54.462 66.478 -27.245 1.00 100.94 ? 25  ILE B CD1   1 
ATOM   3629  N  N     . GLN B 1 26  ? -51.268 64.828 -23.467 1.00 108.09 ? 26  GLN B N     1 
ATOM   3630  C  CA    . GLN B 1 26  ? -50.872 64.847 -22.064 1.00 126.62 ? 26  GLN B CA    1 
ATOM   3631  C  C     . GLN B 1 26  ? -49.490 64.236 -21.868 1.00 128.89 ? 26  GLN B C     1 
ATOM   3632  O  O     . GLN B 1 26  ? -48.542 64.924 -21.506 1.00 137.98 ? 26  GLN B O     1 
ATOM   3633  C  CB    . GLN B 1 26  ? -51.891 64.095 -21.205 1.00 135.04 ? 26  GLN B CB    1 
ATOM   3634  C  CG    . GLN B 1 26  ? -53.332 64.606 -21.350 1.00 134.75 ? 26  GLN B CG    1 
ATOM   3635  C  CD    . GLN B 1 26  ? -54.357 63.726 -20.634 1.00 131.37 ? 26  GLN B CD    1 
ATOM   3636  O  OE1   . GLN B 1 26  ? -54.204 62.504 -20.572 1.00 144.89 ? 26  GLN B OE1   1 
ATOM   3637  N  NE2   . GLN B 1 26  ? -55.408 64.346 -20.096 1.00 108.28 ? 26  GLN B NE2   1 
ATOM   3638  N  N     . ASP B 1 27  ? -49.399 62.937 -22.126 1.00 117.92 ? 27  ASP B N     1 
ATOM   3639  C  CA    . ASP B 1 27  ? -48.217 62.138 -21.827 1.00 128.21 ? 27  ASP B CA    1 
ATOM   3640  C  C     . ASP B 1 27  ? -46.952 62.256 -22.683 1.00 131.04 ? 27  ASP B C     1 
ATOM   3641  O  O     . ASP B 1 27  ? -45.893 61.815 -22.241 1.00 148.61 ? 27  ASP B O     1 
ATOM   3642  C  CB    . ASP B 1 27  ? -48.590 60.667 -21.675 1.00 163.03 ? 27  ASP B CB    1 
ATOM   3643  C  CG    . ASP B 1 27  ? -48.839 60.291 -20.224 1.00 192.93 ? 27  ASP B CG    1 
ATOM   3644  O  OD1   . ASP B 1 27  ? -49.503 61.092 -19.520 1.00 195.79 ? 27  ASP B OD1   1 
ATOM   3645  O  OD2   . ASP B 1 27  ? -48.357 59.213 -19.791 1.00 202.45 ? 27  ASP B OD2   1 
ATOM   3646  N  N     . ARG B 1 28  ? -47.034 62.711 -23.927 1.00 127.39 ? 28  ARG B N     1 
ATOM   3647  C  CA    . ARG B 1 28  ? -45.785 62.809 -24.694 1.00 128.95 ? 28  ARG B CA    1 
ATOM   3648  C  C     . ARG B 1 28  ? -45.246 64.211 -24.957 1.00 123.71 ? 28  ARG B C     1 
ATOM   3649  O  O     . ARG B 1 28  ? -44.159 64.566 -24.506 1.00 116.58 ? 28  ARG B O     1 
ATOM   3650  C  CB    . ARG B 1 28  ? -45.870 62.108 -26.056 1.00 114.41 ? 28  ARG B CB    1 
ATOM   3651  C  CG    . ARG B 1 28  ? -44.966 60.904 -26.140 1.00 106.70 ? 28  ARG B CG    1 
ATOM   3652  C  CD    . ARG B 1 28  ? -44.536 60.596 -27.537 1.00 124.88 ? 28  ARG B CD    1 
ATOM   3653  N  NE    . ARG B 1 28  ? -45.533 59.874 -28.331 1.00 122.92 ? 28  ARG B NE    1 
ATOM   3654  C  CZ    . ARG B 1 28  ? -45.784 58.569 -28.241 1.00 126.00 ? 28  ARG B CZ    1 
ATOM   3655  N  NH1   . ARG B 1 28  ? -45.150 57.800 -27.357 1.00 113.02 ? 28  ARG B NH1   1 
ATOM   3656  N  NH2   . ARG B 1 28  ? -46.700 58.036 -29.035 1.00 137.01 ? 28  ARG B NH2   1 
ATOM   3657  N  N     . ALA B 1 29  ? -45.983 64.979 -25.744 1.00 101.27 ? 29  ALA B N     1 
ATOM   3658  C  CA    . ALA B 1 29  ? -45.419 66.168 -26.378 1.00 104.38 ? 29  ALA B CA    1 
ATOM   3659  C  C     . ALA B 1 29  ? -45.467 67.411 -25.532 1.00 116.49 ? 29  ALA B C     1 
ATOM   3660  O  O     . ALA B 1 29  ? -44.478 68.128 -25.402 1.00 125.95 ? 29  ALA B O     1 
ATOM   3661  C  CB    . ALA B 1 29  ? -46.122 66.454 -27.648 1.00 107.51 ? 29  ALA B CB    1 
ATOM   3662  N  N     . LEU B 1 30  ? -46.642 67.683 -24.986 1.00 117.35 ? 30  LEU B N     1 
ATOM   3663  C  CA    . LEU B 1 30  ? -46.890 68.961 -24.356 1.00 117.45 ? 30  LEU B CA    1 
ATOM   3664  C  C     . LEU B 1 30  ? -46.436 69.005 -22.908 1.00 132.74 ? 30  LEU B C     1 
ATOM   3665  O  O     . LEU B 1 30  ? -46.705 68.091 -22.121 1.00 138.38 ? 30  LEU B O     1 
ATOM   3666  C  CB    . LEU B 1 30  ? -48.355 69.327 -24.473 1.00 119.08 ? 30  LEU B CB    1 
ATOM   3667  C  CG    . LEU B 1 30  ? -48.782 69.114 -25.909 1.00 112.37 ? 30  LEU B CG    1 
ATOM   3668  C  CD1   . LEU B 1 30  ? -50.157 69.699 -26.148 1.00 96.55  ? 30  LEU B CD1   1 
ATOM   3669  C  CD2   . LEU B 1 30  ? -47.740 69.777 -26.771 1.00 130.03 ? 30  LEU B CD2   1 
ATOM   3670  N  N     . PRO B 1 31  ? -45.741 70.089 -22.561 1.00 101.20 ? 31  PRO B N     1 
ATOM   3671  C  CA    . PRO B 1 31  ? -45.191 70.391 -21.237 1.00 97.31  ? 31  PRO B CA    1 
ATOM   3672  C  C     . PRO B 1 31  ? -46.283 70.714 -20.228 1.00 101.83 ? 31  PRO B C     1 
ATOM   3673  O  O     . PRO B 1 31  ? -47.322 71.251 -20.592 1.00 106.81 ? 31  PRO B O     1 
ATOM   3674  C  CB    . PRO B 1 31  ? -44.374 71.657 -21.484 1.00 108.35 ? 31  PRO B CB    1 
ATOM   3675  C  CG    . PRO B 1 31  ? -44.966 72.270 -22.708 1.00 115.22 ? 31  PRO B CG    1 
ATOM   3676  C  CD    . PRO B 1 31  ? -45.500 71.153 -23.547 1.00 100.59 ? 31  PRO B CD    1 
ATOM   3677  N  N     . ASP B 1 32  ? -46.049 70.389 -18.963 1.00 112.68 ? 32  ASP B N     1 
ATOM   3678  C  CA    . ASP B 1 32  ? -46.964 70.811 -17.922 1.00 119.16 ? 32  ASP B CA    1 
ATOM   3679  C  C     . ASP B 1 32  ? -46.744 72.291 -17.713 1.00 122.19 ? 32  ASP B C     1 
ATOM   3680  O  O     . ASP B 1 32  ? -45.606 72.757 -17.671 1.00 118.34 ? 32  ASP B O     1 
ATOM   3681  C  CB    . ASP B 1 32  ? -46.728 70.052 -16.615 1.00 122.91 ? 32  ASP B CB    1 
ATOM   3682  C  CG    . ASP B 1 32  ? -48.014 69.872 -15.803 1.00 134.79 ? 32  ASP B CG    1 
ATOM   3683  O  OD1   . ASP B 1 32  ? -48.653 68.802 -15.957 1.00 135.61 ? 32  ASP B OD1   1 
ATOM   3684  O  OD2   . ASP B 1 32  ? -48.397 70.793 -15.032 1.00 130.81 ? 32  ASP B OD2   1 
ATOM   3685  N  N     . ILE B 1 33  ? -47.837 73.031 -17.584 1.00 122.64 ? 33  ILE B N     1 
ATOM   3686  C  CA    . ILE B 1 33  ? -47.743 74.465 -17.381 1.00 113.71 ? 33  ILE B CA    1 
ATOM   3687  C  C     . ILE B 1 33  ? -47.107 74.820 -16.031 1.00 115.83 ? 33  ILE B C     1 
ATOM   3688  O  O     . ILE B 1 33  ? -46.753 75.975 -15.796 1.00 115.89 ? 33  ILE B O     1 
ATOM   3689  C  CB    . ILE B 1 33  ? -49.121 75.121 -17.484 1.00 100.28 ? 33  ILE B CB    1 
ATOM   3690  C  CG1   . ILE B 1 33  ? -48.972 76.545 -18.033 1.00 102.09 ? 33  ILE B CG1   1 
ATOM   3691  C  CG2   . ILE B 1 33  ? -49.834 75.072 -16.136 1.00 86.59  ? 33  ILE B CG2   1 
ATOM   3692  C  CD1   . ILE B 1 33  ? -50.199 77.406 -17.916 1.00 93.60  ? 33  ILE B CD1   1 
ATOM   3693  N  N     . ARG B 1 34  ? -46.943 73.820 -15.163 1.00 122.73 ? 34  ARG B N     1 
ATOM   3694  C  CA    . ARG B 1 34  ? -46.485 74.038 -13.781 1.00 116.00 ? 34  ARG B CA    1 
ATOM   3695  C  C     . ARG B 1 34  ? -44.983 73.929 -13.593 1.00 106.52 ? 34  ARG B C     1 
ATOM   3696  O  O     . ARG B 1 34  ? -44.393 74.743 -12.902 1.00 108.28 ? 34  ARG B O     1 
ATOM   3697  C  CB    . ARG B 1 34  ? -47.169 73.079 -12.812 1.00 106.29 ? 34  ARG B CB    1 
ATOM   3698  C  CG    . ARG B 1 34  ? -48.664 73.191 -12.828 1.00 112.13 ? 34  ARG B CG    1 
ATOM   3699  C  CD    . ARG B 1 34  ? -49.322 72.234 -11.874 1.00 110.50 ? 34  ARG B CD    1 
ATOM   3700  N  NE    . ARG B 1 34  ? -49.079 70.843 -12.218 1.00 111.22 ? 34  ARG B NE    1 
ATOM   3701  C  CZ    . ARG B 1 34  ? -49.829 69.848 -11.766 1.00 124.92 ? 34  ARG B CZ    1 
ATOM   3702  N  NH1   . ARG B 1 34  ? -50.869 70.125 -10.988 1.00 143.91 ? 34  ARG B NH1   1 
ATOM   3703  N  NH2   . ARG B 1 34  ? -49.555 68.587 -12.091 1.00 109.83 ? 34  ARG B NH2   1 
ATOM   3704  N  N     . ASP B 1 35  ? -44.376 72.907 -14.181 1.00 101.85 ? 35  ASP B N     1 
ATOM   3705  C  CA    . ASP B 1 35  ? -42.937 72.723 -14.085 1.00 99.53  ? 35  ASP B CA    1 
ATOM   3706  C  C     . ASP B 1 35  ? -42.338 72.809 -15.475 1.00 100.95 ? 35  ASP B C     1 
ATOM   3707  O  O     . ASP B 1 35  ? -41.140 72.610 -15.665 1.00 92.04  ? 35  ASP B O     1 
ATOM   3708  C  CB    . ASP B 1 35  ? -42.611 71.362 -13.473 1.00 113.12 ? 35  ASP B CB    1 
ATOM   3709  C  CG    . ASP B 1 35  ? -42.990 70.214 -14.384 1.00 118.38 ? 35  ASP B CG    1 
ATOM   3710  O  OD1   . ASP B 1 35  ? -43.679 70.477 -15.398 1.00 131.79 ? 35  ASP B OD1   1 
ATOM   3711  O  OD2   . ASP B 1 35  ? -42.608 69.058 -14.088 1.00 100.58 ? 35  ASP B OD2   1 
ATOM   3712  N  N     . GLY B 1 36  ? -43.198 73.086 -16.447 1.00 107.58 ? 36  GLY B N     1 
ATOM   3713  C  CA    . GLY B 1 36  ? -42.778 73.254 -17.822 1.00 107.41 ? 36  GLY B CA    1 
ATOM   3714  C  C     . GLY B 1 36  ? -42.009 72.086 -18.411 1.00 114.95 ? 36  GLY B C     1 
ATOM   3715  O  O     . GLY B 1 36  ? -41.169 72.276 -19.295 1.00 132.75 ? 36  GLY B O     1 
ATOM   3716  N  N     . LEU B 1 37  ? -42.304 70.876 -17.944 1.00 106.14 ? 37  LEU B N     1 
ATOM   3717  C  CA    . LEU B 1 37  ? -41.624 69.685 -18.450 1.00 98.09  ? 37  LEU B CA    1 
ATOM   3718  C  C     . LEU B 1 37  ? -42.523 68.704 -19.199 1.00 112.80 ? 37  LEU B C     1 
ATOM   3719  O  O     . LEU B 1 37  ? -43.691 68.515 -18.853 1.00 126.67 ? 37  LEU B O     1 
ATOM   3720  C  CB    . LEU B 1 37  ? -40.993 68.945 -17.292 1.00 94.19  ? 37  LEU B CB    1 
ATOM   3721  C  CG    . LEU B 1 37  ? -39.805 69.686 -16.711 1.00 99.83  ? 37  LEU B CG    1 
ATOM   3722  C  CD1   . LEU B 1 37  ? -39.235 68.937 -15.494 1.00 82.12  ? 37  LEU B CD1   1 
ATOM   3723  C  CD2   . LEU B 1 37  ? -38.779 69.830 -17.820 1.00 103.14 ? 37  LEU B CD2   1 
ATOM   3724  N  N     . LYS B 1 38  ? -41.968 68.072 -20.228 1.00 112.26 ? 38  LYS B N     1 
ATOM   3725  C  CA    . LYS B 1 38  ? -42.589 66.884 -20.798 1.00 109.16 ? 38  LYS B CA    1 
ATOM   3726  C  C     . LYS B 1 38  ? -42.169 65.686 -19.938 1.00 106.81 ? 38  LYS B C     1 
ATOM   3727  O  O     . LYS B 1 38  ? -41.086 65.684 -19.345 1.00 104.47 ? 38  LYS B O     1 
ATOM   3728  C  CB    . LYS B 1 38  ? -42.155 66.660 -22.246 1.00 103.12 ? 38  LYS B CB    1 
ATOM   3729  C  CG    . LYS B 1 38  ? -42.355 67.808 -23.202 1.00 101.66 ? 38  LYS B CG    1 
ATOM   3730  C  CD    . LYS B 1 38  ? -41.103 67.926 -24.075 1.00 114.26 ? 38  LYS B CD    1 
ATOM   3731  C  CE    . LYS B 1 38  ? -41.389 68.167 -25.558 1.00 126.19 ? 38  LYS B CE    1 
ATOM   3732  N  NZ    . LYS B 1 38  ? -40.136 67.955 -26.344 1.00 124.68 ? 38  LYS B NZ    1 
ATOM   3733  N  N     . PRO B 1 39  ? -43.036 64.670 -19.859 1.00 100.00 ? 39  PRO B N     1 
ATOM   3734  C  CA    . PRO B 1 39  ? -42.838 63.424 -19.122 1.00 99.25  ? 39  PRO B CA    1 
ATOM   3735  C  C     . PRO B 1 39  ? -41.423 62.863 -19.189 1.00 110.23 ? 39  PRO B C     1 
ATOM   3736  O  O     . PRO B 1 39  ? -40.854 62.603 -18.127 1.00 97.90  ? 39  PRO B O     1 
ATOM   3737  C  CB    . PRO B 1 39  ? -43.856 62.503 -19.762 1.00 106.52 ? 39  PRO B CB    1 
ATOM   3738  C  CG    . PRO B 1 39  ? -45.006 63.433 -19.992 1.00 107.39 ? 39  PRO B CG    1 
ATOM   3739  C  CD    . PRO B 1 39  ? -44.436 64.800 -20.285 1.00 99.40  ? 39  PRO B CD    1 
ATOM   3740  N  N     . VAL B 1 40  ? -40.869 62.671 -20.388 1.00 118.43 ? 40  VAL B N     1 
ATOM   3741  C  CA    . VAL B 1 40  ? -39.532 62.103 -20.501 1.00 93.53  ? 40  VAL B CA    1 
ATOM   3742  C  C     . VAL B 1 40  ? -38.586 62.964 -19.707 1.00 89.85  ? 40  VAL B C     1 
ATOM   3743  O  O     . VAL B 1 40  ? -37.842 62.465 -18.867 1.00 97.00  ? 40  VAL B O     1 
ATOM   3744  C  CB    . VAL B 1 40  ? -39.073 62.036 -21.946 1.00 99.35  ? 40  VAL B CB    1 
ATOM   3745  C  CG1   . VAL B 1 40  ? -38.061 60.877 -22.141 1.00 87.71  ? 40  VAL B CG1   1 
ATOM   3746  C  CG2   . VAL B 1 40  ? -40.296 61.851 -22.848 1.00 106.92 ? 40  VAL B CG2   1 
ATOM   3747  N  N     . GLN B 1 41  ? -38.639 64.271 -19.934 1.00 98.76  ? 41  GLN B N     1 
ATOM   3748  C  CA    . GLN B 1 41  ? -37.816 65.177 -19.135 1.00 102.04 ? 41  GLN B CA    1 
ATOM   3749  C  C     . GLN B 1 41  ? -37.946 64.891 -17.652 1.00 91.43  ? 41  GLN B C     1 
ATOM   3750  O  O     . GLN B 1 41  ? -36.945 64.582 -16.997 1.00 84.55  ? 41  GLN B O     1 
ATOM   3751  C  CB    . GLN B 1 41  ? -38.184 66.624 -19.392 1.00 81.93  ? 41  GLN B CB    1 
ATOM   3752  C  CG    . GLN B 1 41  ? -37.517 67.133 -20.593 1.00 83.81  ? 41  GLN B CG    1 
ATOM   3753  C  CD    . GLN B 1 41  ? -38.394 68.032 -21.341 1.00 105.90 ? 41  GLN B CD    1 
ATOM   3754  O  OE1   . GLN B 1 41  ? -39.567 68.189 -21.016 1.00 112.87 ? 41  GLN B OE1   1 
ATOM   3755  N  NE2   . GLN B 1 41  ? -37.849 68.645 -22.363 1.00 127.92 ? 41  GLN B NE2   1 
ATOM   3756  N  N     . ARG B 1 42  ? -39.180 64.955 -17.147 1.00 77.45  ? 42  ARG B N     1 
ATOM   3757  C  CA    . ARG B 1 42  ? -39.456 64.740 -15.733 1.00 79.86  ? 42  ARG B CA    1 
ATOM   3758  C  C     . ARG B 1 42  ? -38.878 63.422 -15.226 1.00 81.80  ? 42  ARG B C     1 
ATOM   3759  O  O     . ARG B 1 42  ? -38.210 63.385 -14.191 1.00 78.57  ? 42  ARG B O     1 
ATOM   3760  C  CB    . ARG B 1 42  ? -40.962 64.802 -15.460 1.00 88.02  ? 42  ARG B CB    1 
ATOM   3761  C  CG    . ARG B 1 42  ? -41.334 65.093 -13.986 1.00 90.28  ? 42  ARG B CG    1 
ATOM   3762  C  CD    . ARG B 1 42  ? -42.847 65.311 -13.763 1.00 95.59  ? 42  ARG B CD    1 
ATOM   3763  N  NE    . ARG B 1 42  ? -43.414 66.354 -14.621 1.00 114.31 ? 42  ARG B NE    1 
ATOM   3764  C  CZ    . ARG B 1 42  ? -44.140 66.108 -15.713 1.00 134.35 ? 42  ARG B CZ    1 
ATOM   3765  N  NH1   . ARG B 1 42  ? -44.394 64.850 -16.070 1.00 142.93 ? 42  ARG B NH1   1 
ATOM   3766  N  NH2   . ARG B 1 42  ? -44.616 67.112 -16.452 1.00 128.57 ? 42  ARG B NH2   1 
ATOM   3767  N  N     . ARG B 1 43  ? -39.133 62.340 -15.951 1.00 78.42  ? 43  ARG B N     1 
ATOM   3768  C  CA    . ARG B 1 43  ? -38.661 61.023 -15.537 1.00 83.70  ? 43  ARG B CA    1 
ATOM   3769  C  C     . ARG B 1 43  ? -37.153 60.915 -15.523 1.00 89.82  ? 43  ARG B C     1 
ATOM   3770  O  O     . ARG B 1 43  ? -36.586 60.264 -14.660 1.00 108.28 ? 43  ARG B O     1 
ATOM   3771  C  CB    . ARG B 1 43  ? -39.243 59.945 -16.407 1.00 86.59  ? 43  ARG B CB    1 
ATOM   3772  C  CG    . ARG B 1 43  ? -40.565 59.458 -15.930 1.00 87.00  ? 43  ARG B CG    1 
ATOM   3773  C  CD    . ARG B 1 43  ? -41.227 58.741 -17.055 1.00 102.87 ? 43  ARG B CD    1 
ATOM   3774  N  NE    . ARG B 1 43  ? -42.635 58.553 -16.787 1.00 107.83 ? 43  ARG B NE    1 
ATOM   3775  C  CZ    . ARG B 1 43  ? -43.514 58.220 -17.716 1.00 106.35 ? 43  ARG B CZ    1 
ATOM   3776  N  NH1   . ARG B 1 43  ? -43.110 58.038 -18.964 1.00 108.81 ? 43  ARG B NH1   1 
ATOM   3777  N  NH2   . ARG B 1 43  ? -44.785 58.058 -17.391 1.00 110.63 ? 43  ARG B NH2   1 
ATOM   3778  N  N     . ILE B 1 44  ? -36.504 61.534 -16.498 1.00 83.77  ? 44  ILE B N     1 
ATOM   3779  C  CA    . ILE B 1 44  ? -35.056 61.629 -16.473 1.00 96.86  ? 44  ILE B CA    1 
ATOM   3780  C  C     . ILE B 1 44  ? -34.613 62.326 -15.189 1.00 104.13 ? 44  ILE B C     1 
ATOM   3781  O  O     . ILE B 1 44  ? -33.865 61.769 -14.384 1.00 97.61  ? 44  ILE B O     1 
ATOM   3782  C  CB    . ILE B 1 44  ? -34.509 62.412 -17.682 1.00 84.43  ? 44  ILE B CB    1 
ATOM   3783  C  CG1   . ILE B 1 44  ? -35.128 61.878 -18.976 1.00 87.51  ? 44  ILE B CG1   1 
ATOM   3784  C  CG2   . ILE B 1 44  ? -32.982 62.334 -17.699 1.00 66.74  ? 44  ILE B CG2   1 
ATOM   3785  C  CD1   . ILE B 1 44  ? -34.168 61.768 -20.145 1.00 95.74  ? 44  ILE B CD1   1 
ATOM   3786  N  N     . LEU B 1 45  ? -35.105 63.541 -14.987 1.00 98.71  ? 45  LEU B N     1 
ATOM   3787  C  CA    . LEU B 1 45  ? -34.736 64.319 -13.817 1.00 102.23 ? 45  LEU B CA    1 
ATOM   3788  C  C     . LEU B 1 45  ? -34.934 63.552 -12.508 1.00 108.12 ? 45  LEU B C     1 
ATOM   3789  O  O     . LEU B 1 45  ? -34.008 63.429 -11.702 1.00 107.80 ? 45  LEU B O     1 
ATOM   3790  C  CB    . LEU B 1 45  ? -35.556 65.591 -13.810 1.00 92.92  ? 45  LEU B CB    1 
ATOM   3791  C  CG    . LEU B 1 45  ? -34.933 66.659 -14.672 1.00 93.22  ? 45  LEU B CG    1 
ATOM   3792  C  CD1   . LEU B 1 45  ? -36.005 67.455 -15.364 1.00 113.07 ? 45  LEU B CD1   1 
ATOM   3793  C  CD2   . LEU B 1 45  ? -34.144 67.534 -13.753 1.00 101.62 ? 45  LEU B CD2   1 
ATOM   3794  N  N     . TYR B 1 46  ? -36.142 63.037 -12.302 1.00 102.72 ? 46  TYR B N     1 
ATOM   3795  C  CA    . TYR B 1 46  ? -36.463 62.320 -11.080 1.00 99.88  ? 46  TYR B CA    1 
ATOM   3796  C  C     . TYR B 1 46  ? -35.522 61.135 -10.903 1.00 105.25 ? 46  TYR B C     1 
ATOM   3797  O  O     . TYR B 1 46  ? -34.855 61.010 -9.881  1.00 100.30 ? 46  TYR B O     1 
ATOM   3798  C  CB    . TYR B 1 46  ? -37.917 61.846 -11.117 1.00 80.27  ? 46  TYR B CB    1 
ATOM   3799  C  CG    . TYR B 1 46  ? -38.341 61.038 -9.906  1.00 84.28  ? 46  TYR B CG    1 
ATOM   3800  C  CD1   . TYR B 1 46  ? -38.598 59.693 -10.028 1.00 95.17  ? 46  TYR B CD1   1 
ATOM   3801  C  CD2   . TYR B 1 46  ? -38.477 61.619 -8.646  1.00 82.53  ? 46  TYR B CD2   1 
ATOM   3802  C  CE1   . TYR B 1 46  ? -38.981 58.938 -8.952  1.00 106.20 ? 46  TYR B CE1   1 
ATOM   3803  C  CE2   . TYR B 1 46  ? -38.877 60.863 -7.546  1.00 91.49  ? 46  TYR B CE2   1 
ATOM   3804  C  CZ    . TYR B 1 46  ? -39.122 59.513 -7.714  1.00 107.53 ? 46  TYR B CZ    1 
ATOM   3805  O  OH    . TYR B 1 46  ? -39.511 58.697 -6.673  1.00 109.79 ? 46  TYR B OH    1 
ATOM   3806  N  N     . SER B 1 47  ? -35.446 60.288 -11.920 1.00 98.80  ? 47  SER B N     1 
ATOM   3807  C  CA    . SER B 1 47  ? -34.621 59.094 -11.856 1.00 95.28  ? 47  SER B CA    1 
ATOM   3808  C  C     . SER B 1 47  ? -33.180 59.421 -11.525 1.00 99.79  ? 47  SER B C     1 
ATOM   3809  O  O     . SER B 1 47  ? -32.633 58.886 -10.572 1.00 106.30 ? 47  SER B O     1 
ATOM   3810  C  CB    . SER B 1 47  ? -34.660 58.355 -13.184 1.00 111.59 ? 47  SER B CB    1 
ATOM   3811  O  OG    . SER B 1 47  ? -33.444 57.669 -13.406 1.00 120.00 ? 47  SER B OG    1 
ATOM   3812  N  N     . MET B 1 48  ? -32.563 60.299 -12.310 1.00 100.80 ? 48  MET B N     1 
ATOM   3813  C  CA    . MET B 1 48  ? -31.167 60.672 -12.079 1.00 87.15  ? 48  MET B CA    1 
ATOM   3814  C  C     . MET B 1 48  ? -31.000 61.105 -10.630 1.00 92.12  ? 48  MET B C     1 
ATOM   3815  O  O     . MET B 1 48  ? -30.132 60.607 -9.912  1.00 96.73  ? 48  MET B O     1 
ATOM   3816  C  CB    . MET B 1 48  ? -30.730 61.816 -13.015 1.00 82.60  ? 48  MET B CB    1 
ATOM   3817  C  CG    . MET B 1 48  ? -30.647 61.457 -14.517 1.00 85.81  ? 48  MET B CG    1 
ATOM   3818  S  SD    . MET B 1 48  ? -29.705 62.577 -15.600 1.00 123.20 ? 48  MET B SD    1 
ATOM   3819  C  CE    . MET B 1 48  ? -28.072 62.517 -14.859 1.00 105.73 ? 48  MET B CE    1 
ATOM   3820  N  N     . ASN B 1 49  ? -31.853 62.024 -10.196 1.00 95.29  ? 49  ASN B N     1 
ATOM   3821  C  CA    . ASN B 1 49  ? -31.767 62.539 -8.839  1.00 104.39 ? 49  ASN B CA    1 
ATOM   3822  C  C     . ASN B 1 49  ? -31.964 61.490 -7.738  1.00 98.71  ? 49  ASN B C     1 
ATOM   3823  O  O     . ASN B 1 49  ? -31.251 61.481 -6.739  1.00 83.54  ? 49  ASN B O     1 
ATOM   3824  C  CB    . ASN B 1 49  ? -32.726 63.691 -8.650  1.00 104.17 ? 49  ASN B CB    1 
ATOM   3825  C  CG    . ASN B 1 49  ? -32.864 64.069 -7.211  1.00 106.56 ? 49  ASN B CG    1 
ATOM   3826  O  OD1   . ASN B 1 49  ? -31.951 64.658 -6.614  1.00 108.04 ? 49  ASN B OD1   1 
ATOM   3827  N  ND2   . ASN B 1 49  ? -33.997 63.705 -6.623  1.00 98.08  ? 49  ASN B ND2   1 
ATOM   3828  N  N     . LYS B 1 50  ? -32.956 60.631 -7.907  1.00 97.82  ? 50  LYS B N     1 
ATOM   3829  C  CA    . LYS B 1 50  ? -33.177 59.528 -6.982  1.00 99.43  ? 50  LYS B CA    1 
ATOM   3830  C  C     . LYS B 1 50  ? -31.951 58.635 -6.886  1.00 106.82 ? 50  LYS B C     1 
ATOM   3831  O  O     . LYS B 1 50  ? -31.584 58.189 -5.808  1.00 128.48 ? 50  LYS B O     1 
ATOM   3832  C  CB    . LYS B 1 50  ? -34.381 58.703 -7.415  1.00 107.16 ? 50  LYS B CB    1 
ATOM   3833  C  CG    . LYS B 1 50  ? -34.340 57.254 -7.030  1.00 109.42 ? 50  LYS B CG    1 
ATOM   3834  C  CD    . LYS B 1 50  ? -35.711 56.626 -7.246  1.00 120.30 ? 50  LYS B CD    1 
ATOM   3835  C  CE    . LYS B 1 50  ? -35.661 55.112 -7.062  1.00 143.01 ? 50  LYS B CE    1 
ATOM   3836  N  NZ    . LYS B 1 50  ? -35.080 54.379 -8.241  1.00 146.45 ? 50  LYS B NZ    1 
ATOM   3837  N  N     . ASP B 1 51  ? -31.344 58.345 -8.027  1.00 109.78 ? 51  ASP B N     1 
ATOM   3838  C  CA    . ASP B 1 51  ? -30.087 57.599 -8.083  1.00 121.11 ? 51  ASP B CA    1 
ATOM   3839  C  C     . ASP B 1 51  ? -28.858 58.420 -7.621  1.00 110.16 ? 51  ASP B C     1 
ATOM   3840  O  O     . ASP B 1 51  ? -27.711 58.074 -7.911  1.00 111.78 ? 51  ASP B O     1 
ATOM   3841  C  CB    . ASP B 1 51  ? -29.895 56.970 -9.471  1.00 129.15 ? 51  ASP B CB    1 
ATOM   3842  N  N     . SER B 1 52  ? -29.109 59.440 -6.815  1.00 109.52 ? 52  SER B N     1 
ATOM   3843  C  CA    . SER B 1 52  ? -28.206 60.584 -6.601  1.00 127.15 ? 52  SER B CA    1 
ATOM   3844  C  C     . SER B 1 52  ? -27.038 60.792 -7.580  1.00 116.18 ? 52  SER B C     1 
ATOM   3845  O  O     . SER B 1 52  ? -25.847 60.657 -7.232  1.00 97.02  ? 52  SER B O     1 
ATOM   3846  C  CB    . SER B 1 52  ? -27.714 60.592 -5.147  1.00 130.02 ? 52  SER B CB    1 
ATOM   3847  O  OG    . SER B 1 52  ? -27.460 59.256 -4.737  1.00 127.08 ? 52  SER B OG    1 
ATOM   3848  N  N     . ASN B 1 53  ? -27.435 61.180 -8.794  1.00 104.79 ? 53  ASN B N     1 
ATOM   3849  C  CA    . ASN B 1 53  ? -26.550 61.551 -9.890  1.00 105.21 ? 53  ASN B CA    1 
ATOM   3850  C  C     . ASN B 1 53  ? -26.519 63.070 -10.015 1.00 110.61 ? 53  ASN B C     1 
ATOM   3851  O  O     . ASN B 1 53  ? -27.115 63.632 -10.937 1.00 113.44 ? 53  ASN B O     1 
ATOM   3852  C  CB    . ASN B 1 53  ? -27.105 60.951 -11.188 1.00 104.11 ? 53  ASN B CB    1 
ATOM   3853  C  CG    . ASN B 1 53  ? -26.040 60.733 -12.249 1.00 120.95 ? 53  ASN B CG    1 
ATOM   3854  O  OD1   . ASN B 1 53  ? -25.044 61.457 -12.306 1.00 134.88 ? 53  ASN B OD1   1 
ATOM   3855  N  ND2   . ASN B 1 53  ? -26.251 59.731 -13.106 1.00 122.67 ? 53  ASN B ND2   1 
ATOM   3856  N  N     . THR B 1 54  ? -25.827 63.737 -9.096  1.00 110.74 ? 54  THR B N     1 
ATOM   3857  C  CA    . THR B 1 54  ? -25.993 65.183 -8.962  1.00 121.97 ? 54  THR B CA    1 
ATOM   3858  C  C     . THR B 1 54  ? -24.747 66.040 -9.162  1.00 130.50 ? 54  THR B C     1 
ATOM   3859  O  O     . THR B 1 54  ? -23.620 65.603 -8.924  1.00 130.69 ? 54  THR B O     1 
ATOM   3860  C  CB    . THR B 1 54  ? -26.647 65.529 -7.637  1.00 121.86 ? 54  THR B CB    1 
ATOM   3861  O  OG1   . THR B 1 54  ? -25.933 64.879 -6.579  1.00 130.74 ? 54  THR B OG1   1 
ATOM   3862  C  CG2   . THR B 1 54  ? -28.084 65.028 -7.647  1.00 119.47 ? 54  THR B CG2   1 
ATOM   3863  N  N     . PHE B 1 55  ? -24.991 67.276 -9.589  1.00 129.79 ? 55  PHE B N     1 
ATOM   3864  C  CA    . PHE B 1 55  ? -23.956 68.226 -9.996  1.00 124.70 ? 55  PHE B CA    1 
ATOM   3865  C  C     . PHE B 1 55  ? -22.701 68.192 -9.136  1.00 119.91 ? 55  PHE B C     1 
ATOM   3866  O  O     . PHE B 1 55  ? -21.611 68.510 -9.605  1.00 120.30 ? 55  PHE B O     1 
ATOM   3867  C  CB    . PHE B 1 55  ? -24.502 69.641 -9.905  1.00 122.50 ? 55  PHE B CB    1 
ATOM   3868  C  CG    . PHE B 1 55  ? -24.398 70.201 -8.533  1.00 123.83 ? 55  PHE B CG    1 
ATOM   3869  C  CD1   . PHE B 1 55  ? -25.084 69.611 -7.488  1.00 135.53 ? 55  PHE B CD1   1 
ATOM   3870  C  CD2   . PHE B 1 55  ? -23.575 71.264 -8.267  1.00 117.51 ? 55  PHE B CD2   1 
ATOM   3871  C  CE1   . PHE B 1 55  ? -24.971 70.099 -6.213  1.00 132.92 ? 55  PHE B CE1   1 
ATOM   3872  C  CE2   . PHE B 1 55  ? -23.461 71.750 -7.000  1.00 111.25 ? 55  PHE B CE2   1 
ATOM   3873  C  CZ    . PHE B 1 55  ? -24.162 71.171 -5.974  1.00 122.15 ? 55  PHE B CZ    1 
ATOM   3874  N  N     . ASP B 1 56  ? -22.863 67.853 -7.865  1.00 117.93 ? 56  ASP B N     1 
ATOM   3875  C  CA    . ASP B 1 56  ? -21.773 67.974 -6.913  1.00 118.62 ? 56  ASP B CA    1 
ATOM   3876  C  C     . ASP B 1 56  ? -20.934 66.712 -6.884  1.00 116.89 ? 56  ASP B C     1 
ATOM   3877  O  O     . ASP B 1 56  ? -19.797 66.724 -6.420  1.00 124.38 ? 56  ASP B O     1 
ATOM   3878  C  CB    . ASP B 1 56  ? -22.323 68.243 -5.528  1.00 119.28 ? 56  ASP B CB    1 
ATOM   3879  C  CG    . ASP B 1 56  ? -23.135 67.089 -5.007  1.00 129.83 ? 56  ASP B CG    1 
ATOM   3880  O  OD1   . ASP B 1 56  ? -24.294 66.905 -5.476  1.00 123.10 ? 56  ASP B OD1   1 
ATOM   3881  O  OD2   . ASP B 1 56  ? -22.600 66.370 -4.128  1.00 139.01 ? 56  ASP B OD2   1 
ATOM   3882  N  N     . LYS B 1 57  ? -21.494 65.617 -7.377  1.00 105.33 ? 57  LYS B N     1 
ATOM   3883  C  CA    . LYS B 1 57  ? -20.771 64.357 -7.370  1.00 114.05 ? 57  LYS B CA    1 
ATOM   3884  C  C     . LYS B 1 57  ? -20.361 63.956 -8.788  1.00 132.57 ? 57  LYS B C     1 
ATOM   3885  O  O     . LYS B 1 57  ? -20.826 64.546 -9.773  1.00 125.92 ? 57  LYS B O     1 
ATOM   3886  C  CB    . LYS B 1 57  ? -21.612 63.262 -6.716  1.00 97.79  ? 57  LYS B CB    1 
ATOM   3887  N  N     . SER B 1 58  ? -19.489 62.951 -8.876  1.00 132.35 ? 58  SER B N     1 
ATOM   3888  C  CA    . SER B 1 58  ? -18.936 62.486 -10.144 1.00 124.80 ? 58  SER B CA    1 
ATOM   3889  C  C     . SER B 1 58  ? -20.001 62.214 -11.205 1.00 135.18 ? 58  SER B C     1 
ATOM   3890  O  O     . SER B 1 58  ? -21.167 61.979 -10.880 1.00 143.04 ? 58  SER B O     1 
ATOM   3891  C  CB    . SER B 1 58  ? -18.117 61.230 -9.893  1.00 133.16 ? 58  SER B CB    1 
ATOM   3892  O  OG    . SER B 1 58  ? -18.060 60.432 -11.058 1.00 149.69 ? 58  SER B OG    1 
ATOM   3893  N  N     . TYR B 1 59  ? -19.596 62.250 -12.473 1.00 133.13 ? 59  TYR B N     1 
ATOM   3894  C  CA    . TYR B 1 59  ? -20.502 61.924 -13.574 1.00 121.45 ? 59  TYR B CA    1 
ATOM   3895  C  C     . TYR B 1 59  ? -20.821 60.436 -13.597 1.00 122.56 ? 59  TYR B C     1 
ATOM   3896  O  O     . TYR B 1 59  ? -20.234 59.654 -12.856 1.00 138.73 ? 59  TYR B O     1 
ATOM   3897  C  CB    . TYR B 1 59  ? -19.880 62.297 -14.909 1.00 118.28 ? 59  TYR B CB    1 
ATOM   3898  C  CG    . TYR B 1 59  ? -19.747 63.772 -15.160 1.00 116.31 ? 59  TYR B CG    1 
ATOM   3899  C  CD1   . TYR B 1 59  ? -18.527 64.410 -15.053 1.00 122.67 ? 59  TYR B CD1   1 
ATOM   3900  C  CD2   . TYR B 1 59  ? -20.841 64.523 -15.529 1.00 125.21 ? 59  TYR B CD2   1 
ATOM   3901  C  CE1   . TYR B 1 59  ? -18.405 65.761 -15.308 1.00 131.37 ? 59  TYR B CE1   1 
ATOM   3902  C  CE2   . TYR B 1 59  ? -20.730 65.873 -15.780 1.00 128.38 ? 59  TYR B CE2   1 
ATOM   3903  C  CZ    . TYR B 1 59  ? -19.516 66.485 -15.667 1.00 126.86 ? 59  TYR B CZ    1 
ATOM   3904  O  OH    . TYR B 1 59  ? -19.427 67.826 -15.922 1.00 128.48 ? 59  TYR B OH    1 
ATOM   3905  N  N     . ARG B 1 60  ? -21.745 60.041 -14.462 1.00 117.63 ? 60  ARG B N     1 
ATOM   3906  C  CA    . ARG B 1 60  ? -22.100 58.629 -14.579 1.00 114.49 ? 60  ARG B CA    1 
ATOM   3907  C  C     . ARG B 1 60  ? -22.529 58.241 -15.998 1.00 110.01 ? 60  ARG B C     1 
ATOM   3908  O  O     . ARG B 1 60  ? -23.395 58.887 -16.601 1.00 89.50  ? 60  ARG B O     1 
ATOM   3909  C  CB    . ARG B 1 60  ? -23.162 58.231 -13.543 1.00 95.62  ? 60  ARG B CB    1 
ATOM   3910  N  N     . LYS B 1 61  ? -21.867 57.204 -16.513 1.00 108.10 ? 61  LYS B N     1 
ATOM   3911  C  CA    . LYS B 1 61  ? -22.171 56.556 -17.789 1.00 104.41 ? 61  LYS B CA    1 
ATOM   3912  C  C     . LYS B 1 61  ? -23.624 56.717 -18.281 1.00 101.14 ? 61  LYS B C     1 
ATOM   3913  O  O     . LYS B 1 61  ? -24.520 56.008 -17.835 1.00 85.70  ? 61  LYS B O     1 
ATOM   3914  C  CB    . LYS B 1 61  ? -21.756 55.085 -17.755 1.00 120.13 ? 61  LYS B CB    1 
ATOM   3915  C  CG    . LYS B 1 61  ? -20.849 54.670 -18.898 1.00 137.57 ? 61  LYS B CG    1 
ATOM   3916  C  CD    . LYS B 1 61  ? -19.392 54.852 -18.472 1.00 160.51 ? 61  LYS B CD    1 
ATOM   3917  C  CE    . LYS B 1 61  ? -18.398 54.734 -19.633 1.00 168.86 ? 61  LYS B CE    1 
ATOM   3918  N  NZ    . LYS B 1 61  ? -18.255 55.993 -20.424 1.00 161.89 ? 61  LYS B NZ    1 
ATOM   3919  N  N     . SER B 1 62  ? -23.878 57.701 -19.130 1.00 100.45 ? 62  SER B N     1 
ATOM   3920  C  CA    . SER B 1 62  ? -25.230 57.907 -19.640 1.00 89.89  ? 62  SER B CA    1 
ATOM   3921  C  C     . SER B 1 62  ? -26.041 56.615 -19.763 1.00 94.46  ? 62  SER B C     1 
ATOM   3922  O  O     . SER B 1 62  ? -27.161 56.560 -19.292 1.00 101.17 ? 62  SER B O     1 
ATOM   3923  C  CB    . SER B 1 62  ? -25.223 58.632 -20.998 1.00 96.08  ? 62  SER B CB    1 
ATOM   3924  O  OG    . SER B 1 62  ? -24.483 59.847 -20.984 1.00 105.62 ? 62  SER B OG    1 
ATOM   3925  N  N     . ALA B 1 63  ? -25.493 55.587 -20.404 1.00 88.72  ? 63  ALA B N     1 
ATOM   3926  C  CA    . ALA B 1 63  ? -26.260 54.365 -20.667 1.00 83.72  ? 63  ALA B CA    1 
ATOM   3927  C  C     . ALA B 1 63  ? -26.826 53.680 -19.404 1.00 84.02  ? 63  ALA B C     1 
ATOM   3928  O  O     . ALA B 1 63  ? -27.927 53.141 -19.416 1.00 91.63  ? 63  ALA B O     1 
ATOM   3929  C  CB    . ALA B 1 63  ? -25.464 53.391 -21.522 1.00 89.16  ? 63  ALA B CB    1 
ATOM   3930  N  N     . LYS B 1 64  ? -26.068 53.690 -18.322 1.00 85.41  ? 64  LYS B N     1 
ATOM   3931  C  CA    . LYS B 1 64  ? -26.579 53.230 -17.039 1.00 98.13  ? 64  LYS B CA    1 
ATOM   3932  C  C     . LYS B 1 64  ? -27.798 54.056 -16.638 1.00 99.60  ? 64  LYS B C     1 
ATOM   3933  O  O     . LYS B 1 64  ? -28.835 53.507 -16.272 1.00 105.45 ? 64  LYS B O     1 
ATOM   3934  C  CB    . LYS B 1 64  ? -25.497 53.346 -15.967 1.00 105.70 ? 64  LYS B CB    1 
ATOM   3935  C  CG    . LYS B 1 64  ? -25.714 52.453 -14.753 1.00 109.39 ? 64  LYS B CG    1 
ATOM   3936  C  CD    . LYS B 1 64  ? -24.738 52.789 -13.637 1.00 115.32 ? 64  LYS B CD    1 
ATOM   3937  C  CE    . LYS B 1 64  ? -25.181 52.174 -12.327 1.00 134.38 ? 64  LYS B CE    1 
ATOM   3938  N  NZ    . LYS B 1 64  ? -24.361 52.680 -11.188 1.00 150.02 ? 64  LYS B NZ    1 
ATOM   3939  N  N     . SER B 1 65  ? -27.667 55.376 -16.706 1.00 94.22  ? 65  SER B N     1 
ATOM   3940  C  CA    . SER B 1 65  ? -28.798 56.278 -16.475 1.00 107.12 ? 65  SER B CA    1 
ATOM   3941  C  C     . SER B 1 65  ? -30.000 55.900 -17.340 1.00 107.05 ? 65  SER B C     1 
ATOM   3942  O  O     . SER B 1 65  ? -31.121 55.798 -16.842 1.00 114.33 ? 65  SER B O     1 
ATOM   3943  C  CB    . SER B 1 65  ? -28.424 57.748 -16.759 1.00 119.28 ? 65  SER B CB    1 
ATOM   3944  O  OG    . SER B 1 65  ? -27.602 58.341 -15.757 1.00 116.71 ? 65  SER B OG    1 
ATOM   3945  N  N     . VAL B 1 66  ? -29.769 55.700 -18.636 1.00 98.91  ? 66  VAL B N     1 
ATOM   3946  C  CA    . VAL B 1 66  ? -30.864 55.433 -19.564 1.00 104.13 ? 66  VAL B CA    1 
ATOM   3947  C  C     . VAL B 1 66  ? -31.568 54.140 -19.200 1.00 102.45 ? 66  VAL B C     1 
ATOM   3948  O  O     . VAL B 1 66  ? -32.799 54.062 -19.201 1.00 108.50 ? 66  VAL B O     1 
ATOM   3949  C  CB    . VAL B 1 66  ? -30.406 55.361 -21.039 1.00 96.05  ? 66  VAL B CB    1 
ATOM   3950  C  CG1   . VAL B 1 66  ? -31.579 55.625 -21.966 1.00 87.21  ? 66  VAL B CG1   1 
ATOM   3951  C  CG2   . VAL B 1 66  ? -29.335 56.383 -21.314 1.00 103.19 ? 66  VAL B CG2   1 
ATOM   3952  N  N     . GLY B 1 67  ? -30.777 53.123 -18.887 1.00 99.53  ? 67  GLY B N     1 
ATOM   3953  C  CA    . GLY B 1 67  ? -31.325 51.822 -18.555 1.00 110.16 ? 67  GLY B CA    1 
ATOM   3954  C  C     . GLY B 1 67  ? -32.254 51.918 -17.368 1.00 104.12 ? 67  GLY B C     1 
ATOM   3955  O  O     . GLY B 1 67  ? -33.338 51.343 -17.347 1.00 102.65 ? 67  GLY B O     1 
ATOM   3956  N  N     . ASN B 1 68  ? -31.819 52.646 -16.355 1.00 103.04 ? 68  ASN B N     1 
ATOM   3957  C  CA    . ASN B 1 68  ? -32.630 52.753 -15.165 1.00 103.45 ? 68  ASN B CA    1 
ATOM   3958  C  C     . ASN B 1 68  ? -33.947 53.477 -15.425 1.00 96.98  ? 68  ASN B C     1 
ATOM   3959  O  O     . ASN B 1 68  ? -35.006 53.011 -15.024 1.00 102.55 ? 68  ASN B O     1 
ATOM   3960  C  CB    . ASN B 1 68  ? -31.811 53.302 -13.988 1.00 104.77 ? 68  ASN B CB    1 
ATOM   3961  C  CG    . ASN B 1 68  ? -30.874 52.236 -13.401 1.00 123.83 ? 68  ASN B CG    1 
ATOM   3962  O  OD1   . ASN B 1 68  ? -29.780 52.002 -13.920 1.00 130.54 ? 68  ASN B OD1   1 
ATOM   3963  N  ND2   . ASN B 1 68  ? -31.323 51.558 -12.342 1.00 128.67 ? 68  ASN B ND2   1 
ATOM   3964  N  N     . ILE B 1 69  ? -33.894 54.589 -16.135 1.00 100.90 ? 69  ILE B N     1 
ATOM   3965  C  CA    . ILE B 1 69  ? -35.120 55.268 -16.513 1.00 100.30 ? 69  ILE B CA    1 
ATOM   3966  C  C     . ILE B 1 69  ? -36.109 54.355 -17.236 1.00 99.87  ? 69  ILE B C     1 
ATOM   3967  O  O     . ILE B 1 69  ? -37.289 54.281 -16.874 1.00 95.22  ? 69  ILE B O     1 
ATOM   3968  C  CB    . ILE B 1 69  ? -34.817 56.352 -17.467 1.00 93.02  ? 69  ILE B CB    1 
ATOM   3969  C  CG1   . ILE B 1 69  ? -34.042 57.434 -16.745 1.00 85.09  ? 69  ILE B CG1   1 
ATOM   3970  C  CG2   . ILE B 1 69  ? -36.108 56.843 -18.039 1.00 91.97  ? 69  ILE B CG2   1 
ATOM   3971  C  CD1   . ILE B 1 69  ? -33.668 58.567 -17.637 1.00 82.88  ? 69  ILE B CD1   1 
ATOM   3972  N  N     . MET B 1 70  ? -35.617 53.684 -18.276 1.00 85.77  ? 70  MET B N     1 
ATOM   3973  C  CA    . MET B 1 70  ? -36.404 52.715 -19.026 1.00 89.59  ? 70  MET B CA    1 
ATOM   3974  C  C     . MET B 1 70  ? -36.991 51.654 -18.096 1.00 104.41 ? 70  MET B C     1 
ATOM   3975  O  O     . MET B 1 70  ? -38.177 51.343 -18.164 1.00 123.35 ? 70  MET B O     1 
ATOM   3976  C  CB    . MET B 1 70  ? -35.529 52.025 -20.084 1.00 97.83  ? 70  MET B CB    1 
ATOM   3977  C  CG    . MET B 1 70  ? -35.824 52.350 -21.550 1.00 101.26 ? 70  MET B CG    1 
ATOM   3978  S  SD    . MET B 1 70  ? -34.806 51.418 -22.741 1.00 124.99 ? 70  MET B SD    1 
ATOM   3979  C  CE    . MET B 1 70  ? -33.142 51.825 -22.226 1.00 190.05 ? 70  MET B CE    1 
ATOM   3980  N  N     . GLY B 1 71  ? -36.152 51.094 -17.234 1.00 96.79  ? 71  GLY B N     1 
ATOM   3981  C  CA    . GLY B 1 71  ? -36.556 49.982 -16.396 1.00 91.86  ? 71  GLY B CA    1 
ATOM   3982  C  C     . GLY B 1 71  ? -37.595 50.314 -15.341 1.00 107.88 ? 71  GLY B C     1 
ATOM   3983  O  O     . GLY B 1 71  ? -38.536 49.555 -15.129 1.00 119.40 ? 71  GLY B O     1 
ATOM   3984  N  N     . ASN B 1 72  ? -37.384 51.420 -14.633 1.00 113.34 ? 72  ASN B N     1 
ATOM   3985  C  CA    . ASN B 1 72  ? -38.289 51.869 -13.583 1.00 103.04 ? 72  ASN B CA    1 
ATOM   3986  C  C     . ASN B 1 72  ? -39.489 52.675 -14.059 1.00 107.15 ? 72  ASN B C     1 
ATOM   3987  O  O     . ASN B 1 72  ? -40.626 52.338 -13.749 1.00 122.50 ? 72  ASN B O     1 
ATOM   3988  C  CB    . ASN B 1 72  ? -37.512 52.680 -12.568 1.00 108.40 ? 72  ASN B CB    1 
ATOM   3989  C  CG    . ASN B 1 72  ? -36.330 51.918 -12.034 1.00 127.25 ? 72  ASN B CG    1 
ATOM   3990  O  OD1   . ASN B 1 72  ? -36.188 50.729 -12.311 1.00 131.27 ? 72  ASN B OD1   1 
ATOM   3991  N  ND2   . ASN B 1 72  ? -35.474 52.585 -11.265 1.00 137.41 ? 72  ASN B ND2   1 
ATOM   3992  N  N     . PHE B 1 73  ? -39.231 53.774 -14.758 1.00 105.32 ? 73  PHE B N     1 
ATOM   3993  C  CA    . PHE B 1 73  ? -40.299 54.713 -15.112 1.00 108.42 ? 73  PHE B CA    1 
ATOM   3994  C  C     . PHE B 1 73  ? -40.860 54.729 -16.537 1.00 109.58 ? 73  PHE B C     1 
ATOM   3995  O  O     . PHE B 1 73  ? -42.065 54.882 -16.710 1.00 122.83 ? 73  PHE B O     1 
ATOM   3996  C  CB    . PHE B 1 73  ? -39.862 56.113 -14.723 1.00 97.91  ? 73  PHE B CB    1 
ATOM   3997  C  CG    . PHE B 1 73  ? -39.224 56.155 -13.379 1.00 99.28  ? 73  PHE B CG    1 
ATOM   3998  C  CD1   . PHE B 1 73  ? -37.854 56.138 -13.254 1.00 110.08 ? 73  PHE B CD1   1 
ATOM   3999  C  CD2   . PHE B 1 73  ? -39.996 56.146 -12.239 1.00 92.48  ? 73  PHE B CD2   1 
ATOM   4000  C  CE1   . PHE B 1 73  ? -37.269 56.150 -12.016 1.00 108.76 ? 73  PHE B CE1   1 
ATOM   4001  C  CE2   . PHE B 1 73  ? -39.424 56.166 -11.016 1.00 94.72  ? 73  PHE B CE2   1 
ATOM   4002  C  CZ    . PHE B 1 73  ? -38.054 56.158 -10.902 1.00 108.02 ? 73  PHE B CZ    1 
ATOM   4003  N  N     . HIS B 1 74  ? -40.001 54.588 -17.542 1.00 98.87  ? 74  HIS B N     1 
ATOM   4004  C  CA    . HIS B 1 74  ? -40.343 55.021 -18.910 1.00 102.50 ? 74  HIS B CA    1 
ATOM   4005  C  C     . HIS B 1 74  ? -40.286 53.945 -20.011 1.00 109.19 ? 74  HIS B C     1 
ATOM   4006  O  O     . HIS B 1 74  ? -39.226 53.698 -20.598 1.00 97.24  ? 74  HIS B O     1 
ATOM   4007  C  CB    . HIS B 1 74  ? -39.432 56.179 -19.298 1.00 96.41  ? 74  HIS B CB    1 
ATOM   4008  C  CG    . HIS B 1 74  ? -39.922 56.969 -20.464 1.00 91.83  ? 74  HIS B CG    1 
ATOM   4009  N  ND1   . HIS B 1 74  ? -40.935 57.889 -20.355 1.00 88.14  ? 74  HIS B ND1   1 
ATOM   4010  C  CD2   . HIS B 1 74  ? -39.525 56.993 -21.755 1.00 97.76  ? 74  HIS B CD2   1 
ATOM   4011  C  CE1   . HIS B 1 74  ? -41.152 58.437 -21.536 1.00 100.14 ? 74  HIS B CE1   1 
ATOM   4012  N  NE2   . HIS B 1 74  ? -40.308 57.916 -22.403 1.00 92.12  ? 74  HIS B NE2   1 
ATOM   4013  N  N     . PRO B 1 75  ? -41.445 53.343 -20.329 1.00 118.27 ? 75  PRO B N     1 
ATOM   4014  C  CA    . PRO B 1 75  ? -41.549 52.147 -21.174 1.00 113.15 ? 75  PRO B CA    1 
ATOM   4015  C  C     . PRO B 1 75  ? -41.407 52.435 -22.658 1.00 115.70 ? 75  PRO B C     1 
ATOM   4016  O  O     . PRO B 1 75  ? -42.370 52.225 -23.388 1.00 133.22 ? 75  PRO B O     1 
ATOM   4017  C  CB    . PRO B 1 75  ? -42.988 51.659 -20.923 1.00 112.09 ? 75  PRO B CB    1 
ATOM   4018  C  CG    . PRO B 1 75  ? -43.581 52.577 -19.870 1.00 108.35 ? 75  PRO B CG    1 
ATOM   4019  C  CD    . PRO B 1 75  ? -42.772 53.835 -19.922 1.00 118.02 ? 75  PRO B CD    1 
ATOM   4020  N  N     . HIS B 1 76  ? -40.243 52.891 -23.104 1.00 109.95 ? 76  HIS B N     1 
ATOM   4021  C  CA    . HIS B 1 76  ? -40.058 53.235 -24.512 1.00 99.93  ? 76  HIS B CA    1 
ATOM   4022  C  C     . HIS B 1 76  ? -38.619 53.059 -24.970 1.00 100.24 ? 76  HIS B C     1 
ATOM   4023  O  O     . HIS B 1 76  ? -37.799 52.465 -24.277 1.00 106.32 ? 76  HIS B O     1 
ATOM   4024  C  CB    . HIS B 1 76  ? -40.543 54.652 -24.823 1.00 101.49 ? 76  HIS B CB    1 
ATOM   4025  C  CG    . HIS B 1 76  ? -41.872 54.969 -24.221 1.00 117.06 ? 76  HIS B CG    1 
ATOM   4026  N  ND1   . HIS B 1 76  ? -43.038 54.968 -24.953 1.00 123.01 ? 76  HIS B ND1   1 
ATOM   4027  C  CD2   . HIS B 1 76  ? -42.225 55.263 -22.947 1.00 124.49 ? 76  HIS B CD2   1 
ATOM   4028  C  CE1   . HIS B 1 76  ? -44.053 55.260 -24.158 1.00 131.71 ? 76  HIS B CE1   1 
ATOM   4029  N  NE2   . HIS B 1 76  ? -43.587 55.442 -22.934 1.00 127.77 ? 76  HIS B NE2   1 
ATOM   4030  N  N     . GLY B 1 77  ? -38.326 53.575 -26.157 1.00 113.65 ? 77  GLY B N     1 
ATOM   4031  C  CA    . GLY B 1 77  ? -37.017 53.409 -26.749 1.00 122.61 ? 77  GLY B CA    1 
ATOM   4032  C  C     . GLY B 1 77  ? -35.947 54.056 -25.902 1.00 126.68 ? 77  GLY B C     1 
ATOM   4033  O  O     . GLY B 1 77  ? -36.181 55.055 -25.222 1.00 116.12 ? 77  GLY B O     1 
ATOM   4034  N  N     . ASP B 1 78  ? -34.759 53.475 -25.925 1.00 136.63 ? 78  ASP B N     1 
ATOM   4035  C  CA    . ASP B 1 78  ? -33.637 54.125 -25.290 1.00 135.83 ? 78  ASP B CA    1 
ATOM   4036  C  C     . ASP B 1 78  ? -33.320 55.404 -26.056 1.00 125.22 ? 78  ASP B C     1 
ATOM   4037  O  O     . ASP B 1 78  ? -33.161 56.456 -25.454 1.00 125.75 ? 78  ASP B O     1 
ATOM   4038  C  CB    . ASP B 1 78  ? -32.431 53.193 -25.220 1.00 149.72 ? 78  ASP B CB    1 
ATOM   4039  C  CG    . ASP B 1 78  ? -32.424 52.178 -26.334 1.00 173.55 ? 78  ASP B CG    1 
ATOM   4040  O  OD1   . ASP B 1 78  ? -32.318 50.971 -26.025 1.00 180.20 ? 78  ASP B OD1   1 
ATOM   4041  O  OD2   . ASP B 1 78  ? -32.539 52.589 -27.513 1.00 180.33 ? 78  ASP B OD2   1 
ATOM   4042  N  N     . SER B 1 79  ? -33.256 55.325 -27.380 1.00 113.81 ? 79  SER B N     1 
ATOM   4043  C  CA    . SER B 1 79  ? -32.888 56.489 -28.173 1.00 113.19 ? 79  SER B CA    1 
ATOM   4044  C  C     . SER B 1 79  ? -33.788 57.679 -27.869 1.00 110.22 ? 79  SER B C     1 
ATOM   4045  O  O     . SER B 1 79  ? -33.308 58.792 -27.735 1.00 108.45 ? 79  SER B O     1 
ATOM   4046  C  CB    . SER B 1 79  ? -32.958 56.181 -29.652 1.00 131.96 ? 79  SER B CB    1 
ATOM   4047  O  OG    . SER B 1 79  ? -34.294 56.336 -30.086 1.00 145.92 ? 79  SER B OG    1 
ATOM   4048  N  N     . SER B 1 80  ? -35.093 57.449 -27.769 1.00 122.02 ? 80  SER B N     1 
ATOM   4049  C  CA    . SER B 1 80  ? -36.035 58.529 -27.457 1.00 115.69 ? 80  SER B CA    1 
ATOM   4050  C  C     . SER B 1 80  ? -35.622 59.223 -26.166 1.00 101.20 ? 80  SER B C     1 
ATOM   4051  O  O     . SER B 1 80  ? -35.550 60.445 -26.106 1.00 104.03 ? 80  SER B O     1 
ATOM   4052  C  CB    . SER B 1 80  ? -37.471 57.999 -27.325 1.00 117.98 ? 80  SER B CB    1 
ATOM   4053  O  OG    . SER B 1 80  ? -37.706 56.894 -28.188 1.00 125.31 ? 80  SER B OG    1 
ATOM   4054  N  N     . ILE B 1 81  ? -35.361 58.415 -25.142 1.00 96.75  ? 81  ILE B N     1 
ATOM   4055  C  CA    . ILE B 1 81  ? -34.921 58.862 -23.823 1.00 89.90  ? 81  ILE B CA    1 
ATOM   4056  C  C     . ILE B 1 81  ? -33.582 59.601 -23.845 1.00 94.41  ? 81  ILE B C     1 
ATOM   4057  O  O     . ILE B 1 81  ? -33.497 60.745 -23.415 1.00 101.35 ? 81  ILE B O     1 
ATOM   4058  C  CB    . ILE B 1 81  ? -34.809 57.652 -22.883 1.00 85.30  ? 81  ILE B CB    1 
ATOM   4059  C  CG1   . ILE B 1 81  ? -36.190 57.079 -22.621 1.00 106.24 ? 81  ILE B CG1   1 
ATOM   4060  C  CG2   . ILE B 1 81  ? -34.178 58.017 -21.578 1.00 71.40  ? 81  ILE B CG2   1 
ATOM   4061  C  CD1   . ILE B 1 81  ? -36.179 55.885 -21.698 1.00 114.42 ? 81  ILE B CD1   1 
ATOM   4062  N  N     . TYR B 1 82  ? -32.534 58.938 -24.323 1.00 81.47  ? 82  TYR B N     1 
ATOM   4063  C  CA    . TYR B 1 82  ? -31.195 59.509 -24.310 1.00 86.30  ? 82  TYR B CA    1 
ATOM   4064  C  C     . TYR B 1 82  ? -31.068 60.738 -25.175 1.00 89.36  ? 82  TYR B C     1 
ATOM   4065  O  O     . TYR B 1 82  ? -30.327 61.669 -24.856 1.00 82.32  ? 82  TYR B O     1 
ATOM   4066  C  CB    . TYR B 1 82  ? -30.216 58.507 -24.836 1.00 94.12  ? 82  TYR B CB    1 
ATOM   4067  C  CG    . TYR B 1 82  ? -28.830 59.061 -25.011 1.00 103.42 ? 82  TYR B CG    1 
ATOM   4068  C  CD1   . TYR B 1 82  ? -28.017 59.319 -23.904 1.00 103.95 ? 82  TYR B CD1   1 
ATOM   4069  C  CD2   . TYR B 1 82  ? -28.311 59.288 -26.277 1.00 91.03  ? 82  TYR B CD2   1 
ATOM   4070  C  CE1   . TYR B 1 82  ? -26.727 59.791 -24.060 1.00 107.06 ? 82  TYR B CE1   1 
ATOM   4071  C  CE2   . TYR B 1 82  ? -27.022 59.763 -26.444 1.00 96.20  ? 82  TYR B CE2   1 
ATOM   4072  C  CZ    . TYR B 1 82  ? -26.233 60.012 -25.340 1.00 105.86 ? 82  TYR B CZ    1 
ATOM   4073  O  OH    . TYR B 1 82  ? -24.950 60.487 -25.509 1.00 103.34 ? 82  TYR B OH    1 
ATOM   4074  N  N     . ASP B 1 83  ? -31.749 60.703 -26.311 1.00 90.67  ? 83  ASP B N     1 
ATOM   4075  C  CA    . ASP B 1 83  ? -31.783 61.843 -27.208 1.00 95.75  ? 83  ASP B CA    1 
ATOM   4076  C  C     . ASP B 1 83  ? -32.341 63.033 -26.442 1.00 92.63  ? 83  ASP B C     1 
ATOM   4077  O  O     . ASP B 1 83  ? -31.802 64.135 -26.505 1.00 99.43  ? 83  ASP B O     1 
ATOM   4078  C  CB    . ASP B 1 83  ? -32.615 61.525 -28.471 1.00 108.36 ? 83  ASP B CB    1 
ATOM   4079  C  CG    . ASP B 1 83  ? -31.765 60.906 -29.618 1.00 141.36 ? 83  ASP B CG    1 
ATOM   4080  O  OD1   . ASP B 1 83  ? -30.518 60.868 -29.491 1.00 150.86 ? 83  ASP B OD1   1 
ATOM   4081  O  OD2   . ASP B 1 83  ? -32.336 60.471 -30.654 1.00 130.87 ? 83  ASP B OD2   1 
ATOM   4082  N  N     . ALA B 1 84  ? -33.421 62.795 -25.707 1.00 96.11  ? 84  ALA B N     1 
ATOM   4083  C  CA    . ALA B 1 84  ? -34.065 63.830 -24.902 1.00 96.03  ? 84  ALA B CA    1 
ATOM   4084  C  C     . ALA B 1 84  ? -33.149 64.308 -23.788 1.00 95.29  ? 84  ALA B C     1 
ATOM   4085  O  O     . ALA B 1 84  ? -33.079 65.499 -23.494 1.00 87.01  ? 84  ALA B O     1 
ATOM   4086  C  CB    . ALA B 1 84  ? -35.358 63.295 -24.318 1.00 97.27  ? 84  ALA B CB    1 
ATOM   4087  N  N     . MET B 1 85  ? -32.471 63.355 -23.155 1.00 105.38 ? 85  MET B N     1 
ATOM   4088  C  CA    . MET B 1 85  ? -31.544 63.655 -22.081 1.00 107.39 ? 85  MET B CA    1 
ATOM   4089  C  C     . MET B 1 85  ? -30.473 64.578 -22.619 1.00 102.80 ? 85  MET B C     1 
ATOM   4090  O  O     . MET B 1 85  ? -30.153 65.587 -22.013 1.00 112.17 ? 85  MET B O     1 
ATOM   4091  C  CB    . MET B 1 85  ? -30.920 62.370 -21.536 1.00 101.09 ? 85  MET B CB    1 
ATOM   4092  C  CG    . MET B 1 85  ? -29.758 62.626 -20.593 1.00 103.49 ? 85  MET B CG    1 
ATOM   4093  S  SD    . MET B 1 85  ? -29.087 61.133 -19.829 1.00 113.06 ? 85  MET B SD    1 
ATOM   4094  N  N     . VAL B 1 86  ? -29.931 64.222 -23.774 1.00 87.01  ? 86  VAL B N     1 
ATOM   4095  C  CA    . VAL B 1 86  ? -28.944 65.046 -24.451 1.00 93.41  ? 86  VAL B CA    1 
ATOM   4096  C  C     . VAL B 1 86  ? -29.419 66.469 -24.778 1.00 89.22  ? 86  VAL B C     1 
ATOM   4097  O  O     . VAL B 1 86  ? -28.659 67.414 -24.659 1.00 93.45  ? 86  VAL B O     1 
ATOM   4098  C  CB    . VAL B 1 86  ? -28.459 64.374 -25.744 1.00 94.67  ? 86  VAL B CB    1 
ATOM   4099  C  CG1   . VAL B 1 86  ? -27.622 65.363 -26.592 1.00 84.41  ? 86  VAL B CG1   1 
ATOM   4100  C  CG2   . VAL B 1 86  ? -27.688 63.084 -25.430 1.00 85.76  ? 86  VAL B CG2   1 
ATOM   4101  N  N     . ARG B 1 87  ? -30.656 66.635 -25.216 1.00 89.97  ? 87  ARG B N     1 
ATOM   4102  C  CA    . ARG B 1 87  ? -31.128 67.980 -25.507 1.00 94.33  ? 87  ARG B CA    1 
ATOM   4103  C  C     . ARG B 1 87  ? -30.973 68.849 -24.271 1.00 104.60 ? 87  ARG B C     1 
ATOM   4104  O  O     . ARG B 1 87  ? -30.559 70.001 -24.345 1.00 111.60 ? 87  ARG B O     1 
ATOM   4105  C  CB    . ARG B 1 87  ? -32.587 67.980 -25.936 1.00 95.17  ? 87  ARG B CB    1 
ATOM   4106  C  CG    . ARG B 1 87  ? -33.062 69.352 -26.365 1.00 101.73 ? 87  ARG B CG    1 
ATOM   4107  C  CD    . ARG B 1 87  ? -34.238 69.218 -27.307 1.00 109.48 ? 87  ARG B CD    1 
ATOM   4108  N  NE    . ARG B 1 87  ? -34.457 70.403 -28.116 1.00 115.39 ? 87  ARG B NE    1 
ATOM   4109  C  CZ    . ARG B 1 87  ? -34.864 71.563 -27.617 1.00 149.65 ? 87  ARG B CZ    1 
ATOM   4110  N  NH1   . ARG B 1 87  ? -35.073 71.683 -26.307 1.00 159.08 ? 87  ARG B NH1   1 
ATOM   4111  N  NH2   . ARG B 1 87  ? -35.050 72.604 -28.422 1.00 163.89 ? 87  ARG B NH2   1 
ATOM   4112  N  N     . MET B 1 88  ? -31.322 68.277 -23.130 1.00 106.40 ? 88  MET B N     1 
ATOM   4113  C  CA    . MET B 1 88  ? -31.261 68.976 -21.853 1.00 106.83 ? 88  MET B CA    1 
ATOM   4114  C  C     . MET B 1 88  ? -29.840 69.416 -21.455 1.00 106.75 ? 88  MET B C     1 
ATOM   4115  O  O     . MET B 1 88  ? -29.674 70.150 -20.483 1.00 115.58 ? 88  MET B O     1 
ATOM   4116  C  CB    . MET B 1 88  ? -31.898 68.121 -20.741 1.00 113.73 ? 88  MET B CB    1 
ATOM   4117  C  CG    . MET B 1 88  ? -33.334 67.640 -21.024 1.00 109.23 ? 88  MET B CG    1 
ATOM   4118  S  SD    . MET B 1 88  ? -34.228 67.022 -19.563 1.00 125.36 ? 88  MET B SD    1 
ATOM   4119  C  CE    . MET B 1 88  ? -33.624 65.336 -19.499 1.00 116.22 ? 88  MET B CE    1 
ATOM   4120  N  N     . SER B 1 89  ? -28.830 68.881 -22.141 1.00 98.81  ? 89  SER B N     1 
ATOM   4121  C  CA    . SER B 1 89  ? -27.422 69.245 -21.943 1.00 105.70 ? 89  SER B CA    1 
ATOM   4122  C  C     . SER B 1 89  ? -26.878 70.273 -22.943 1.00 117.57 ? 89  SER B C     1 
ATOM   4123  O  O     . SER B 1 89  ? -25.661 70.512 -23.018 1.00 129.42 ? 89  SER B O     1 
ATOM   4124  C  CB    . SER B 1 89  ? -26.550 67.995 -22.037 1.00 111.06 ? 89  SER B CB    1 
ATOM   4125  O  OG    . SER B 1 89  ? -26.589 67.444 -23.339 1.00 113.78 ? 89  SER B OG    1 
ATOM   4126  N  N     . GLN B 1 90  ? -27.769 70.877 -23.713 1.00 109.33 ? 90  GLN B N     1 
ATOM   4127  C  CA    . GLN B 1 90  ? -27.358 71.707 -24.844 1.00 113.06 ? 90  GLN B CA    1 
ATOM   4128  C  C     . GLN B 1 90  ? -27.528 73.211 -24.623 1.00 113.46 ? 90  GLN B C     1 
ATOM   4129  O  O     . GLN B 1 90  ? -28.635 73.723 -24.722 1.00 112.41 ? 90  GLN B O     1 
ATOM   4130  C  CB    . GLN B 1 90  ? -27.978 71.214 -26.152 1.00 108.69 ? 90  GLN B CB    1 
ATOM   4131  C  CG    . GLN B 1 90  ? -27.304 69.949 -26.664 1.00 102.96 ? 90  GLN B CG    1 
ATOM   4132  C  CD    . GLN B 1 90  ? -28.114 69.207 -27.705 1.00 107.87 ? 90  GLN B CD    1 
ATOM   4133  O  OE1   . GLN B 1 90  ? -29.348 69.238 -27.699 1.00 114.15 ? 90  GLN B OE1   1 
ATOM   4134  N  NE2   . GLN B 1 90  ? -27.421 68.522 -28.604 1.00 107.77 ? 90  GLN B NE2   1 
ATOM   4135  N  N     . ASN B 1 91  ? -26.468 73.885 -24.182 1.00 105.53 ? 91  ASN B N     1 
ATOM   4136  C  CA    . ASN B 1 91  ? -26.527 75.338 -23.955 1.00 108.84 ? 91  ASN B CA    1 
ATOM   4137  C  C     . ASN B 1 91  ? -27.016 76.231 -25.105 1.00 120.25 ? 91  ASN B C     1 
ATOM   4138  O  O     . ASN B 1 91  ? -27.649 77.249 -24.856 1.00 139.47 ? 91  ASN B O     1 
ATOM   4139  C  CB    . ASN B 1 91  ? -25.207 75.876 -23.432 1.00 120.44 ? 91  ASN B CB    1 
ATOM   4140  C  CG    . ASN B 1 91  ? -24.053 75.248 -24.099 1.00 140.22 ? 91  ASN B CG    1 
ATOM   4141  O  OD1   . ASN B 1 91  ? -23.450 74.314 -23.558 1.00 148.15 ? 91  ASN B OD1   1 
ATOM   4142  N  ND2   . ASN B 1 91  ? -23.749 75.710 -25.314 1.00 141.89 ? 91  ASN B ND2   1 
ATOM   4143  N  N     . TRP B 1 92  ? -26.698 75.905 -26.351 1.00 115.37 ? 92  TRP B N     1 
ATOM   4144  C  CA    . TRP B 1 92  ? -27.302 76.650 -27.457 1.00 114.81 ? 92  TRP B CA    1 
ATOM   4145  C  C     . TRP B 1 92  ? -28.806 76.394 -27.630 1.00 103.79 ? 92  TRP B C     1 
ATOM   4146  O  O     . TRP B 1 92  ? -29.477 77.117 -28.355 1.00 102.82 ? 92  TRP B O     1 
ATOM   4147  C  CB    . TRP B 1 92  ? -26.584 76.402 -28.776 1.00 119.58 ? 92  TRP B CB    1 
ATOM   4148  C  CG    . TRP B 1 92  ? -26.765 75.041 -29.285 1.00 116.17 ? 92  TRP B CG    1 
ATOM   4149  C  CD1   . TRP B 1 92  ? -27.662 74.629 -30.210 1.00 116.96 ? 92  TRP B CD1   1 
ATOM   4150  C  CD2   . TRP B 1 92  ? -26.025 73.892 -28.898 1.00 115.43 ? 92  TRP B CD2   1 
ATOM   4151  N  NE1   . TRP B 1 92  ? -27.528 73.281 -30.433 1.00 117.32 ? 92  TRP B NE1   1 
ATOM   4152  C  CE2   . TRP B 1 92  ? -26.522 72.807 -29.639 1.00 119.33 ? 92  TRP B CE2   1 
ATOM   4153  C  CE3   . TRP B 1 92  ? -24.990 73.674 -27.993 1.00 110.51 ? 92  TRP B CE3   1 
ATOM   4154  C  CZ2   . TRP B 1 92  ? -26.018 71.517 -29.504 1.00 117.27 ? 92  TRP B CZ2   1 
ATOM   4155  C  CZ3   . TRP B 1 92  ? -24.493 72.394 -27.859 1.00 114.20 ? 92  TRP B CZ3   1 
ATOM   4156  C  CH2   . TRP B 1 92  ? -25.004 71.331 -28.613 1.00 112.22 ? 92  TRP B CH2   1 
ATOM   4157  N  N     . LYS B 1 93  ? -29.309 75.306 -27.063 1.00 101.57 ? 93  LYS B N     1 
ATOM   4158  C  CA    . LYS B 1 93  ? -30.749 75.047 -27.036 1.00 109.29 ? 93  LYS B CA    1 
ATOM   4159  C  C     . LYS B 1 93  ? -31.506 75.572 -25.806 1.00 113.93 ? 93  LYS B C     1 
ATOM   4160  O  O     . LYS B 1 93  ? -32.495 76.290 -25.947 1.00 120.28 ? 93  LYS B O     1 
ATOM   4161  C  CB    . LYS B 1 93  ? -31.018 73.559 -27.254 1.00 115.34 ? 93  LYS B CB    1 
ATOM   4162  C  CG    . LYS B 1 93  ? -30.742 73.154 -28.712 1.00 138.34 ? 93  LYS B CG    1 
ATOM   4163  C  CD    . LYS B 1 93  ? -30.845 71.654 -28.966 1.00 147.21 ? 93  LYS B CD    1 
ATOM   4164  C  CE    . LYS B 1 93  ? -30.620 71.347 -30.437 1.00 142.20 ? 93  LYS B CE    1 
ATOM   4165  N  NZ    . LYS B 1 93  ? -31.459 72.255 -31.270 1.00 136.01 ? 93  LYS B NZ    1 
ATOM   4166  N  N     . ASN B 1 94  ? -31.091 75.165 -24.611 1.00 116.23 ? 94  ASN B N     1 
ATOM   4167  C  CA    . ASN B 1 94  ? -31.685 75.667 -23.362 1.00 121.59 ? 94  ASN B CA    1 
ATOM   4168  C  C     . ASN B 1 94  ? -30.963 76.877 -22.741 1.00 115.22 ? 94  ASN B C     1 
ATOM   4169  O  O     . ASN B 1 94  ? -29.739 76.954 -22.781 1.00 115.60 ? 94  ASN B O     1 
ATOM   4170  C  CB    . ASN B 1 94  ? -31.769 74.531 -22.344 1.00 126.81 ? 94  ASN B CB    1 
ATOM   4171  C  CG    . ASN B 1 94  ? -32.518 73.337 -22.880 1.00 130.64 ? 94  ASN B CG    1 
ATOM   4172  O  OD1   . ASN B 1 94  ? -31.910 72.346 -23.292 1.00 138.23 ? 94  ASN B OD1   1 
ATOM   4173  N  ND2   . ASN B 1 94  ? -33.849 73.433 -22.915 1.00 132.83 ? 94  ASN B ND2   1 
ATOM   4174  N  N     . ARG B 1 95  ? -31.707 77.804 -22.141 1.00 116.78 ? 95  ARG B N     1 
ATOM   4175  C  CA    . ARG B 1 95  ? -31.075 78.959 -21.495 1.00 117.59 ? 95  ARG B CA    1 
ATOM   4176  C  C     . ARG B 1 95  ? -30.333 78.475 -20.274 1.00 123.60 ? 95  ARG B C     1 
ATOM   4177  O  O     . ARG B 1 95  ? -29.113 78.674 -20.140 1.00 124.85 ? 95  ARG B O     1 
ATOM   4178  C  CB    . ARG B 1 95  ? -32.081 80.045 -21.092 1.00 97.86  ? 95  ARG B CB    1 
ATOM   4179  N  N     . GLU B 1 96  ? -31.087 77.824 -19.393 1.00 123.57 ? 96  GLU B N     1 
ATOM   4180  C  CA    . GLU B 1 96  ? -30.524 77.248 -18.184 1.00 128.83 ? 96  GLU B CA    1 
ATOM   4181  C  C     . GLU B 1 96  ? -30.573 75.722 -18.264 1.00 115.02 ? 96  GLU B C     1 
ATOM   4182  O  O     . GLU B 1 96  ? -31.608 75.118 -18.031 1.00 104.89 ? 96  GLU B O     1 
ATOM   4183  C  CB    . GLU B 1 96  ? -31.276 77.775 -16.956 1.00 129.90 ? 96  GLU B CB    1 
ATOM   4184  C  CG    . GLU B 1 96  ? -30.351 78.241 -15.832 1.00 152.26 ? 96  GLU B CG    1 
ATOM   4185  C  CD    . GLU B 1 96  ? -29.505 79.451 -16.214 1.00 162.17 ? 96  GLU B CD    1 
ATOM   4186  O  OE1   . GLU B 1 96  ? -29.726 79.988 -17.319 1.00 175.21 ? 96  GLU B OE1   1 
ATOM   4187  O  OE2   . GLU B 1 96  ? -28.628 79.866 -15.415 1.00 152.27 ? 96  GLU B OE2   1 
ATOM   4188  N  N     . ILE B 1 97  ? -29.435 75.128 -18.614 1.00 112.65 ? 97  ILE B N     1 
ATOM   4189  C  CA    . ILE B 1 97  ? -29.246 73.681 -18.764 1.00 106.83 ? 97  ILE B CA    1 
ATOM   4190  C  C     . ILE B 1 97  ? -29.630 72.837 -17.536 1.00 108.57 ? 97  ILE B C     1 
ATOM   4191  O  O     . ILE B 1 97  ? -29.276 73.189 -16.406 1.00 112.12 ? 97  ILE B O     1 
ATOM   4192  C  CB    . ILE B 1 97  ? -27.760 73.425 -19.111 1.00 109.90 ? 97  ILE B CB    1 
ATOM   4193  C  CG1   . ILE B 1 97  ? -27.596 73.182 -20.596 1.00 129.00 ? 97  ILE B CG1   1 
ATOM   4194  C  CG2   . ILE B 1 97  ? -27.172 72.255 -18.351 1.00 90.32  ? 97  ILE B CG2   1 
ATOM   4195  C  CD1   . ILE B 1 97  ? -26.160 72.888 -20.961 1.00 151.20 ? 97  ILE B CD1   1 
ATOM   4196  N  N     . LEU B 1 98  ? -30.335 71.719 -17.741 1.00 98.36  ? 98  LEU B N     1 
ATOM   4197  C  CA    . LEU B 1 98  ? -30.665 70.874 -16.591 1.00 95.65  ? 98  LEU B CA    1 
ATOM   4198  C  C     . LEU B 1 98  ? -29.863 69.589 -16.546 1.00 102.84 ? 98  LEU B C     1 
ATOM   4199  O  O     . LEU B 1 98  ? -30.064 68.763 -15.667 1.00 102.05 ? 98  LEU B O     1 
ATOM   4200  C  CB    . LEU B 1 98  ? -32.130 70.447 -16.628 1.00 85.56  ? 98  LEU B CB    1 
ATOM   4201  C  CG    . LEU B 1 98  ? -33.249 71.365 -17.110 1.00 98.33  ? 98  LEU B CG    1 
ATOM   4202  C  CD1   . LEU B 1 98  ? -34.574 70.810 -16.592 1.00 97.65  ? 98  LEU B CD1   1 
ATOM   4203  C  CD2   . LEU B 1 98  ? -33.059 72.802 -16.640 1.00 102.04 ? 98  LEU B CD2   1 
ATOM   4204  N  N     . VAL B 1 99  ? -28.900 69.437 -17.434 1.00 106.99 ? 99  VAL B N     1 
ATOM   4205  C  CA    . VAL B 1 99  ? -28.093 68.233 -17.413 1.00 97.20  ? 99  VAL B CA    1 
ATOM   4206  C  C     . VAL B 1 99  ? -26.717 68.580 -17.908 1.00 105.49 ? 99  VAL B C     1 
ATOM   4207  O  O     . VAL B 1 99  ? -26.585 69.214 -18.950 1.00 120.97 ? 99  VAL B O     1 
ATOM   4208  C  CB    . VAL B 1 99  ? -28.639 67.169 -18.345 1.00 84.44  ? 99  VAL B CB    1 
ATOM   4209  C  CG1   . VAL B 1 99  ? -27.621 66.092 -18.491 1.00 98.93  ? 99  VAL B CG1   1 
ATOM   4210  C  CG2   . VAL B 1 99  ? -29.900 66.571 -17.784 1.00 82.59  ? 99  VAL B CG2   1 
ATOM   4211  N  N     . GLU B 1 100 ? -25.684 68.157 -17.195 1.00 95.45  ? 100 GLU B N     1 
ATOM   4212  C  CA    . GLU B 1 100 ? -24.351 68.386 -17.716 1.00 104.91 ? 100 GLU B CA    1 
ATOM   4213  C  C     . GLU B 1 100 ? -23.782 67.086 -18.248 1.00 118.47 ? 100 GLU B C     1 
ATOM   4214  O  O     . GLU B 1 100 ? -23.751 66.071 -17.554 1.00 130.75 ? 100 GLU B O     1 
ATOM   4215  C  CB    . GLU B 1 100 ? -23.418 69.064 -16.704 1.00 112.39 ? 100 GLU B CB    1 
ATOM   4216  C  CG    . GLU B 1 100 ? -23.835 68.999 -15.242 1.00 133.37 ? 100 GLU B CG    1 
ATOM   4217  C  CD    . GLU B 1 100 ? -23.009 69.940 -14.338 1.00 147.15 ? 100 GLU B CD    1 
ATOM   4218  O  OE1   . GLU B 1 100 ? -23.601 70.892 -13.765 1.00 157.12 ? 100 GLU B OE1   1 
ATOM   4219  O  OE2   . GLU B 1 100 ? -21.777 69.728 -14.199 1.00 134.03 ? 100 GLU B OE2   1 
ATOM   4220  N  N     . MET B 1 101 ? -23.354 67.121 -19.503 1.00 112.13 ? 101 MET B N     1 
ATOM   4221  C  CA    . MET B 1 101 ? -22.839 65.928 -20.144 1.00 107.99 ? 101 MET B CA    1 
ATOM   4222  C  C     . MET B 1 101 ? -21.376 66.137 -20.520 1.00 114.25 ? 101 MET B C     1 
ATOM   4223  O  O     . MET B 1 101 ? -20.997 67.183 -21.045 1.00 130.54 ? 101 MET B O     1 
ATOM   4224  C  CB    . MET B 1 101 ? -23.679 65.584 -21.374 1.00 102.65 ? 101 MET B CB    1 
ATOM   4225  C  CG    . MET B 1 101 ? -23.639 64.115 -21.745 1.00 108.84 ? 101 MET B CG    1 
ATOM   4226  S  SD    . MET B 1 101 ? -24.788 63.652 -23.049 1.00 137.15 ? 101 MET B SD    1 
ATOM   4227  C  CE    . MET B 1 101 ? -26.370 63.838 -22.222 1.00 126.47 ? 101 MET B CE    1 
ATOM   4228  N  N     . HIS B 1 102 ? -20.553 65.136 -20.244 1.00 109.98 ? 102 HIS B N     1 
ATOM   4229  C  CA    . HIS B 1 102 ? -19.123 65.242 -20.487 1.00 119.03 ? 102 HIS B CA    1 
ATOM   4230  C  C     . HIS B 1 102 ? -18.790 64.348 -21.673 1.00 122.57 ? 102 HIS B C     1 
ATOM   4231  O  O     . HIS B 1 102 ? -19.103 63.149 -21.676 1.00 111.02 ? 102 HIS B O     1 
ATOM   4232  C  CB    . HIS B 1 102 ? -18.334 64.842 -19.229 1.00 127.57 ? 102 HIS B CB    1 
ATOM   4233  C  CG    . HIS B 1 102 ? -16.857 64.734 -19.442 1.00 131.11 ? 102 HIS B CG    1 
ATOM   4234  N  ND1   . HIS B 1 102 ? -16.271 63.652 -20.058 1.00 133.91 ? 102 HIS B ND1   1 
ATOM   4235  C  CD2   . HIS B 1 102 ? -15.846 65.569 -19.112 1.00 139.95 ? 102 HIS B CD2   1 
ATOM   4236  C  CE1   . HIS B 1 102 ? -14.965 63.830 -20.112 1.00 136.28 ? 102 HIS B CE1   1 
ATOM   4237  N  NE2   . HIS B 1 102 ? -14.680 64.986 -19.543 1.00 141.50 ? 102 HIS B NE2   1 
ATOM   4238  N  N     . GLY B 1 103 ? -18.177 64.953 -22.690 1.00 128.39 ? 103 GLY B N     1 
ATOM   4239  C  CA    . GLY B 1 103 ? -17.953 64.302 -23.969 1.00 122.98 ? 103 GLY B CA    1 
ATOM   4240  C  C     . GLY B 1 103 ? -18.637 65.067 -25.090 1.00 118.56 ? 103 GLY B C     1 
ATOM   4241  O  O     . GLY B 1 103 ? -18.926 66.256 -24.950 1.00 124.05 ? 103 GLY B O     1 
ATOM   4242  N  N     . ASN B 1 104 ? -18.906 64.392 -26.201 1.00 116.77 ? 104 ASN B N     1 
ATOM   4243  C  CA    . ASN B 1 104 ? -19.532 65.041 -27.351 1.00 114.65 ? 104 ASN B CA    1 
ATOM   4244  C  C     . ASN B 1 104 ? -21.060 64.945 -27.353 1.00 105.01 ? 104 ASN B C     1 
ATOM   4245  O  O     . ASN B 1 104 ? -21.633 63.879 -27.575 1.00 101.16 ? 104 ASN B O     1 
ATOM   4246  C  CB    . ASN B 1 104 ? -18.955 64.485 -28.658 1.00 115.41 ? 104 ASN B CB    1 
ATOM   4247  C  CG    . ASN B 1 104 ? -19.806 64.828 -29.873 1.00 124.15 ? 104 ASN B CG    1 
ATOM   4248  O  OD1   . ASN B 1 104 ? -20.620 65.754 -29.843 1.00 134.63 ? 104 ASN B OD1   1 
ATOM   4249  N  ND2   . ASN B 1 104 ? -19.611 64.085 -30.953 1.00 125.10 ? 104 ASN B ND2   1 
ATOM   4250  N  N     . ASN B 1 105 ? -21.721 66.070 -27.126 1.00 102.27 ? 105 ASN B N     1 
ATOM   4251  C  CA    . ASN B 1 105 ? -23.173 66.101 -27.168 1.00 101.86 ? 105 ASN B CA    1 
ATOM   4252  C  C     . ASN B 1 105 ? -23.665 66.973 -28.306 1.00 113.26 ? 105 ASN B C     1 
ATOM   4253  O  O     . ASN B 1 105 ? -24.593 67.761 -28.124 1.00 114.80 ? 105 ASN B O     1 
ATOM   4254  C  CB    . ASN B 1 105 ? -23.718 66.675 -25.876 1.00 102.10 ? 105 ASN B CB    1 
ATOM   4255  C  CG    . ASN B 1 105 ? -23.242 68.085 -25.647 1.00 116.88 ? 105 ASN B CG    1 
ATOM   4256  O  OD1   . ASN B 1 105 ? -22.197 68.491 -26.175 1.00 136.39 ? 105 ASN B OD1   1 
ATOM   4257  N  ND2   . ASN B 1 105 ? -23.997 68.848 -24.869 1.00 114.48 ? 105 ASN B ND2   1 
ATOM   4258  N  N     . GLY B 1 106 ? -23.046 66.845 -29.475 1.00 124.44 ? 106 GLY B N     1 
ATOM   4259  C  CA    . GLY B 1 106 ? -23.428 67.649 -30.624 1.00 130.12 ? 106 GLY B CA    1 
ATOM   4260  C  C     . GLY B 1 106 ? -22.882 69.063 -30.540 1.00 127.02 ? 106 GLY B C     1 
ATOM   4261  O  O     . GLY B 1 106 ? -21.944 69.316 -29.771 1.00 126.19 ? 106 GLY B O     1 
ATOM   4262  N  N     . SER B 1 107 ? -23.454 69.974 -31.336 1.00 114.62 ? 107 SER B N     1 
ATOM   4263  C  CA    . SER B 1 107 ? -23.077 71.392 -31.307 1.00 122.46 ? 107 SER B CA    1 
ATOM   4264  C  C     . SER B 1 107 ? -23.967 72.257 -32.192 1.00 128.30 ? 107 SER B C     1 
ATOM   4265  O  O     . SER B 1 107 ? -25.017 71.822 -32.652 1.00 130.83 ? 107 SER B O     1 
ATOM   4266  C  CB    . SER B 1 107 ? -21.610 71.600 -31.708 1.00 130.00 ? 107 SER B CB    1 
ATOM   4267  O  OG    . SER B 1 107 ? -21.465 71.788 -33.109 1.00 132.51 ? 107 SER B OG    1 
ATOM   4268  N  N     . MET B 1 108 ? -23.529 73.489 -32.430 1.00 137.17 ? 108 MET B N     1 
ATOM   4269  C  CA    . MET B 1 108 ? -24.239 74.395 -33.326 1.00 142.11 ? 108 MET B CA    1 
ATOM   4270  C  C     . MET B 1 108 ? -24.092 74.006 -34.802 1.00 148.80 ? 108 MET B C     1 
ATOM   4271  O  O     . MET B 1 108 ? -25.028 74.161 -35.592 1.00 139.66 ? 108 MET B O     1 
ATOM   4272  C  CB    . MET B 1 108 ? -23.752 75.823 -33.117 1.00 137.83 ? 108 MET B CB    1 
ATOM   4273  C  CG    . MET B 1 108 ? -24.058 76.350 -31.745 1.00 139.12 ? 108 MET B CG    1 
ATOM   4274  S  SD    . MET B 1 108 ? -23.747 78.108 -31.630 1.00 174.98 ? 108 MET B SD    1 
ATOM   4275  C  CE    . MET B 1 108 ? -24.971 78.718 -32.773 1.00 120.53 ? 108 MET B CE    1 
ATOM   4276  N  N     . ASP B 1 109 ? -22.914 73.513 -35.175 1.00 155.23 ? 109 ASP B N     1 
ATOM   4277  C  CA    . ASP B 1 109 ? -22.703 73.007 -36.525 1.00 152.60 ? 109 ASP B CA    1 
ATOM   4278  C  C     . ASP B 1 109 ? -23.668 71.853 -36.809 1.00 147.61 ? 109 ASP B C     1 
ATOM   4279  O  O     . ASP B 1 109 ? -23.815 71.413 -37.947 1.00 145.53 ? 109 ASP B O     1 
ATOM   4280  C  CB    . ASP B 1 109 ? -21.246 72.580 -36.742 1.00 158.51 ? 109 ASP B CB    1 
ATOM   4281  C  CG    . ASP B 1 109 ? -20.345 73.749 -37.139 1.00 175.17 ? 109 ASP B CG    1 
ATOM   4282  O  OD1   . ASP B 1 109 ? -20.690 74.907 -36.813 1.00 174.41 ? 109 ASP B OD1   1 
ATOM   4283  O  OD2   . ASP B 1 109 ? -19.292 73.512 -37.779 1.00 183.76 ? 109 ASP B OD2   1 
ATOM   4284  N  N     . GLY B 1 110 ? -24.329 71.370 -35.762 1.00 143.75 ? 110 GLY B N     1 
ATOM   4285  C  CA    . GLY B 1 110 ? -25.344 70.347 -35.916 1.00 138.68 ? 110 GLY B CA    1 
ATOM   4286  C  C     . GLY B 1 110 ? -24.814 68.929 -35.838 1.00 143.63 ? 110 GLY B C     1 
ATOM   4287  O  O     . GLY B 1 110 ? -25.589 67.978 -35.869 1.00 143.12 ? 110 GLY B O     1 
ATOM   4288  N  N     . ASP B 1 111 ? -23.497 68.779 -35.742 1.00 151.47 ? 111 ASP B N     1 
ATOM   4289  C  CA    . ASP B 1 111 ? -22.902 67.453 -35.595 1.00 150.59 ? 111 ASP B CA    1 
ATOM   4290  C  C     . ASP B 1 111 ? -23.667 66.620 -34.564 1.00 136.81 ? 111 ASP B C     1 
ATOM   4291  O  O     . ASP B 1 111 ? -24.103 67.143 -33.534 1.00 113.47 ? 111 ASP B O     1 
ATOM   4292  C  CB    . ASP B 1 111 ? -21.402 67.522 -35.247 1.00 160.50 ? 111 ASP B CB    1 
ATOM   4293  C  CG    . ASP B 1 111 ? -20.956 68.904 -34.801 1.00 175.56 ? 111 ASP B CG    1 
ATOM   4294  O  OD1   . ASP B 1 111 ? -19.796 69.280 -35.090 1.00 171.09 ? 111 ASP B OD1   1 
ATOM   4295  O  OD2   . ASP B 1 111 ? -21.761 69.617 -34.168 1.00 188.74 ? 111 ASP B OD2   1 
ATOM   4296  N  N     . PRO B 1 112 ? -23.847 65.318 -34.853 1.00 137.59 ? 112 PRO B N     1 
ATOM   4297  C  CA    . PRO B 1 112 ? -24.668 64.432 -34.031 1.00 119.69 ? 112 PRO B CA    1 
ATOM   4298  C  C     . PRO B 1 112 ? -23.942 64.100 -32.754 1.00 113.01 ? 112 PRO B C     1 
ATOM   4299  O  O     . PRO B 1 112 ? -22.725 63.899 -32.797 1.00 114.11 ? 112 PRO B O     1 
ATOM   4300  C  CB    . PRO B 1 112 ? -24.783 63.164 -34.883 1.00 116.78 ? 112 PRO B CB    1 
ATOM   4301  C  CG    . PRO B 1 112 ? -24.197 63.494 -36.210 1.00 123.18 ? 112 PRO B CG    1 
ATOM   4302  C  CD    . PRO B 1 112 ? -23.210 64.571 -35.945 1.00 135.89 ? 112 PRO B CD    1 
ATOM   4303  N  N     . PRO B 1 113 ? -24.685 64.027 -31.642 1.00 107.70 ? 113 PRO B N     1 
ATOM   4304  C  CA    . PRO B 1 113 ? -24.228 63.708 -30.288 1.00 89.81  ? 113 PRO B CA    1 
ATOM   4305  C  C     . PRO B 1 113 ? -23.577 62.347 -30.286 1.00 102.66 ? 113 PRO B C     1 
ATOM   4306  O  O     . PRO B 1 113 ? -23.987 61.466 -31.047 1.00 110.06 ? 113 PRO B O     1 
ATOM   4307  C  CB    . PRO B 1 113 ? -25.523 63.609 -29.500 1.00 99.76  ? 113 PRO B CB    1 
ATOM   4308  C  CG    . PRO B 1 113 ? -26.552 64.309 -30.315 1.00 124.23 ? 113 PRO B CG    1 
ATOM   4309  C  CD    . PRO B 1 113 ? -26.149 64.136 -31.729 1.00 124.73 ? 113 PRO B CD    1 
ATOM   4310  N  N     . ALA B 1 114 ? -22.578 62.166 -29.436 1.00 101.78 ? 114 ALA B N     1 
ATOM   4311  C  CA    . ALA B 1 114 ? -21.885 60.892 -29.375 1.00 112.42 ? 114 ALA B CA    1 
ATOM   4312  C  C     . ALA B 1 114 ? -22.815 59.808 -28.841 1.00 114.54 ? 114 ALA B C     1 
ATOM   4313  O  O     . ALA B 1 114 ? -23.645 60.060 -27.968 1.00 100.47 ? 114 ALA B O     1 
ATOM   4314  C  CB    . ALA B 1 114 ? -20.651 61.008 -28.518 1.00 123.80 ? 114 ALA B CB    1 
ATOM   4315  N  N     . ALA B 1 115 ? -22.674 58.600 -29.375 1.00 123.81 ? 115 ALA B N     1 
ATOM   4316  C  CA    . ALA B 1 115 ? -23.497 57.482 -28.947 1.00 123.83 ? 115 ALA B CA    1 
ATOM   4317  C  C     . ALA B 1 115 ? -23.493 57.396 -27.433 1.00 127.62 ? 115 ALA B C     1 
ATOM   4318  O  O     . ALA B 1 115 ? -22.509 57.758 -26.776 1.00 115.57 ? 115 ALA B O     1 
ATOM   4319  C  CB    . ALA B 1 115 ? -22.992 56.195 -29.553 1.00 131.99 ? 115 ALA B CB    1 
ATOM   4320  N  N     . MET B 1 116 ? -24.598 56.907 -26.882 1.00 128.74 ? 116 MET B N     1 
ATOM   4321  C  CA    . MET B 1 116 ? -24.783 56.937 -25.447 1.00 116.11 ? 116 MET B CA    1 
ATOM   4322  C  C     . MET B 1 116 ? -23.718 56.138 -24.715 1.00 112.94 ? 116 MET B C     1 
ATOM   4323  O  O     . MET B 1 116 ? -23.299 56.534 -23.628 1.00 134.61 ? 116 MET B O     1 
ATOM   4324  C  CB    . MET B 1 116 ? -26.188 56.472 -25.079 1.00 128.44 ? 116 MET B CB    1 
ATOM   4325  C  CG    . MET B 1 116 ? -26.313 55.029 -24.639 1.00 139.17 ? 116 MET B CG    1 
ATOM   4326  S  SD    . MET B 1 116 ? -28.048 54.589 -24.340 1.00 106.68 ? 116 MET B SD    1 
ATOM   4327  C  CE    . MET B 1 116 ? -27.885 52.812 -24.072 1.00 186.10 ? 116 MET B CE    1 
ATOM   4328  N  N     . ARG B 1 117 ? -23.254 55.037 -25.303 1.00 91.92  ? 117 ARG B N     1 
ATOM   4329  C  CA    . ARG B 1 117 ? -22.228 54.246 -24.613 1.00 95.57  ? 117 ARG B CA    1 
ATOM   4330  C  C     . ARG B 1 117 ? -20.952 55.022 -24.396 1.00 92.95  ? 117 ARG B C     1 
ATOM   4331  O  O     . ARG B 1 117 ? -20.125 54.650 -23.572 1.00 94.32  ? 117 ARG B O     1 
ATOM   4332  C  CB    . ARG B 1 117 ? -21.872 52.957 -25.326 1.00 104.99 ? 117 ARG B CB    1 
ATOM   4333  C  CG    . ARG B 1 117 ? -21.398 53.116 -26.717 1.00 97.57  ? 117 ARG B CG    1 
ATOM   4334  C  CD    . ARG B 1 117 ? -22.577 52.866 -27.634 1.00 110.76 ? 117 ARG B CD    1 
ATOM   4335  N  NE    . ARG B 1 117 ? -22.169 53.137 -29.001 1.00 121.20 ? 117 ARG B NE    1 
ATOM   4336  C  CZ    . ARG B 1 117 ? -21.228 52.454 -29.636 1.00 115.06 ? 117 ARG B CZ    1 
ATOM   4337  N  NH1   . ARG B 1 117 ? -20.606 51.443 -29.018 1.00 112.96 ? 117 ARG B NH1   1 
ATOM   4338  N  NH2   . ARG B 1 117 ? -20.906 52.801 -30.877 1.00 97.79  ? 117 ARG B NH2   1 
ATOM   4339  N  N     . TYR B 1 118 ? -20.793 56.111 -25.133 1.00 101.43 ? 118 TYR B N     1 
ATOM   4340  C  CA    . TYR B 1 118 ? -19.587 56.905 -24.999 1.00 98.41  ? 118 TYR B CA    1 
ATOM   4341  C  C     . TYR B 1 118 ? -19.682 57.924 -23.863 1.00 99.70  ? 118 TYR B C     1 
ATOM   4342  O  O     . TYR B 1 118 ? -18.704 58.152 -23.167 1.00 119.90 ? 118 TYR B O     1 
ATOM   4343  C  CB    . TYR B 1 118 ? -19.246 57.622 -26.308 1.00 101.33 ? 118 TYR B CB    1 
ATOM   4344  C  CG    . TYR B 1 118 ? -18.879 56.700 -27.451 1.00 116.84 ? 118 TYR B CG    1 
ATOM   4345  C  CD1   . TYR B 1 118 ? -17.652 56.047 -27.480 1.00 102.64 ? 118 TYR B CD1   1 
ATOM   4346  C  CD2   . TYR B 1 118 ? -19.754 56.495 -28.509 1.00 125.83 ? 118 TYR B CD2   1 
ATOM   4347  C  CE1   . TYR B 1 118 ? -17.313 55.208 -28.527 1.00 117.15 ? 118 TYR B CE1   1 
ATOM   4348  C  CE2   . TYR B 1 118 ? -19.425 55.659 -29.556 1.00 126.12 ? 118 TYR B CE2   1 
ATOM   4349  C  CZ    . TYR B 1 118 ? -18.204 55.014 -29.560 1.00 130.63 ? 118 TYR B CZ    1 
ATOM   4350  O  OH    . TYR B 1 118 ? -17.881 54.185 -30.614 1.00 134.35 ? 118 TYR B OH    1 
ATOM   4351  N  N     . THR B 1 119 ? -20.852 58.516 -23.649 1.00 86.42  ? 119 THR B N     1 
ATOM   4352  C  CA    . THR B 1 119 ? -20.911 59.728 -22.827 1.00 96.71  ? 119 THR B CA    1 
ATOM   4353  C  C     . THR B 1 119 ? -21.211 59.491 -21.351 1.00 110.29 ? 119 THR B C     1 
ATOM   4354  O  O     . THR B 1 119 ? -21.536 58.377 -20.957 1.00 130.37 ? 119 THR B O     1 
ATOM   4355  C  CB    . THR B 1 119 ? -21.895 60.760 -23.425 1.00 100.12 ? 119 THR B CB    1 
ATOM   4356  O  OG1   . THR B 1 119 ? -23.226 60.234 -23.433 1.00 99.53  ? 119 THR B OG1   1 
ATOM   4357  C  CG2   . THR B 1 119 ? -21.504 61.079 -24.847 1.00 100.09 ? 119 THR B CG2   1 
ATOM   4358  N  N     . GLU B 1 120 ? -21.084 60.551 -20.549 1.00 103.25 ? 120 GLU B N     1 
ATOM   4359  C  CA    . GLU B 1 120 ? -21.315 60.507 -19.099 1.00 108.08 ? 120 GLU B CA    1 
ATOM   4360  C  C     . GLU B 1 120 ? -22.149 61.716 -18.717 1.00 107.81 ? 120 GLU B C     1 
ATOM   4361  O  O     . GLU B 1 120 ? -22.003 62.775 -19.322 1.00 112.82 ? 120 GLU B O     1 
ATOM   4362  C  CB    . GLU B 1 120 ? -20.001 60.583 -18.322 1.00 126.62 ? 120 GLU B CB    1 
ATOM   4363  C  CG    . GLU B 1 120 ? -18.773 60.224 -19.137 1.00 145.35 ? 120 GLU B CG    1 
ATOM   4364  C  CD    . GLU B 1 120 ? -17.530 60.012 -18.290 1.00 160.71 ? 120 GLU B CD    1 
ATOM   4365  O  OE1   . GLU B 1 120 ? -17.658 59.751 -17.071 1.00 161.77 ? 120 GLU B OE1   1 
ATOM   4366  O  OE2   . GLU B 1 120 ? -16.420 60.093 -18.858 1.00 170.71 ? 120 GLU B OE2   1 
ATOM   4367  N  N     . ALA B 1 121 ? -23.035 61.578 -17.737 1.00 109.24 ? 121 ALA B N     1 
ATOM   4368  C  CA    . ALA B 1 121 ? -23.922 62.695 -17.411 1.00 109.51 ? 121 ALA B CA    1 
ATOM   4369  C  C     . ALA B 1 121 ? -24.293 62.815 -15.940 1.00 107.66 ? 121 ALA B C     1 
ATOM   4370  O  O     . ALA B 1 121 ? -24.313 61.827 -15.213 1.00 117.83 ? 121 ALA B O     1 
ATOM   4371  C  CB    . ALA B 1 121 ? -25.178 62.650 -18.262 1.00 110.50 ? 121 ALA B CB    1 
ATOM   4372  N  N     . ARG B 1 122 ? -24.584 64.040 -15.518 1.00 95.00  ? 122 ARG B N     1 
ATOM   4373  C  CA    . ARG B 1 122 ? -25.158 64.296 -14.203 1.00 89.24  ? 122 ARG B CA    1 
ATOM   4374  C  C     . ARG B 1 122 ? -26.212 65.393 -14.251 1.00 94.94  ? 122 ARG B C     1 
ATOM   4375  O  O     . ARG B 1 122 ? -26.353 66.075 -15.263 1.00 108.53 ? 122 ARG B O     1 
ATOM   4376  C  CB    . ARG B 1 122 ? -24.061 64.721 -13.265 1.00 99.79  ? 122 ARG B CB    1 
ATOM   4377  C  CG    . ARG B 1 122 ? -23.542 66.097 -13.504 1.00 99.61  ? 122 ARG B CG    1 
ATOM   4378  C  CD    . ARG B 1 122 ? -22.342 66.295 -12.604 1.00 110.35 ? 122 ARG B CD    1 
ATOM   4379  N  NE    . ARG B 1 122 ? -21.465 67.373 -13.029 1.00 113.82 ? 122 ARG B NE    1 
ATOM   4380  C  CZ    . ARG B 1 122 ? -20.232 67.497 -12.579 1.00 119.50 ? 122 ARG B CZ    1 
ATOM   4381  N  NH1   . ARG B 1 122 ? -19.789 66.599 -11.715 1.00 117.53 ? 122 ARG B NH1   1 
ATOM   4382  N  NH2   . ARG B 1 122 ? -19.454 68.494 -12.983 1.00 132.07 ? 122 ARG B NH2   1 
ATOM   4383  N  N     . LEU B 1 123 ? -26.926 65.609 -13.151 1.00 95.03  ? 123 LEU B N     1 
ATOM   4384  C  CA    . LEU B 1 123 ? -27.906 66.691 -13.145 1.00 104.96 ? 123 LEU B CA    1 
ATOM   4385  C  C     . LEU B 1 123 ? -27.151 67.957 -12.825 1.00 110.74 ? 123 LEU B C     1 
ATOM   4386  O  O     . LEU B 1 123 ? -26.129 67.909 -12.141 1.00 97.00  ? 123 LEU B O     1 
ATOM   4387  C  CB    . LEU B 1 123 ? -29.026 66.490 -12.111 1.00 95.18  ? 123 LEU B CB    1 
ATOM   4388  C  CG    . LEU B 1 123 ? -30.007 65.344 -12.346 1.00 100.73 ? 123 LEU B CG    1 
ATOM   4389  C  CD1   . LEU B 1 123 ? -31.052 65.197 -11.235 1.00 89.58  ? 123 LEU B CD1   1 
ATOM   4390  C  CD2   . LEU B 1 123 ? -30.676 65.509 -13.701 1.00 109.11 ? 123 LEU B CD2   1 
ATOM   4391  N  N     . SER B 1 124 ? -27.632 69.084 -13.345 1.00 114.79 ? 124 SER B N     1 
ATOM   4392  C  CA    . SER B 1 124 ? -26.969 70.349 -13.088 1.00 111.77 ? 124 SER B CA    1 
ATOM   4393  C  C     . SER B 1 124 ? -27.367 70.869 -11.723 1.00 111.40 ? 124 SER B C     1 
ATOM   4394  O  O     . SER B 1 124 ? -28.122 70.221 -10.993 1.00 101.47 ? 124 SER B O     1 
ATOM   4395  C  CB    . SER B 1 124 ? -27.424 71.371 -14.120 1.00 117.98 ? 124 SER B CB    1 
ATOM   4396  O  OG    . SER B 1 124 ? -28.832 71.532 -14.084 1.00 112.86 ? 124 SER B OG    1 
ATOM   4397  N  N     . GLU B 1 125 ? -26.929 72.078 -11.406 1.00 119.18 ? 125 GLU B N     1 
ATOM   4398  C  CA    . GLU B 1 125 ? -27.182 72.578 -10.071 1.00 119.40 ? 125 GLU B CA    1 
ATOM   4399  C  C     . GLU B 1 125 ? -28.609 73.065 -9.948  1.00 113.81 ? 125 GLU B C     1 
ATOM   4400  O  O     . GLU B 1 125 ? -29.333 72.642 -9.049  1.00 119.84 ? 125 GLU B O     1 
ATOM   4401  C  CB    . GLU B 1 125 ? -26.194 73.658 -9.680  1.00 117.58 ? 125 GLU B CB    1 
ATOM   4402  C  CG    . GLU B 1 125 ? -26.111 73.851 -8.181  1.00 121.26 ? 125 GLU B CG    1 
ATOM   4403  C  CD    . GLU B 1 125 ? -24.989 74.781 -7.767  1.00 144.37 ? 125 GLU B CD    1 
ATOM   4404  O  OE1   . GLU B 1 125 ? -24.588 75.663 -8.566  1.00 145.24 ? 125 GLU B OE1   1 
ATOM   4405  O  OE2   . GLU B 1 125 ? -24.506 74.626 -6.627  1.00 160.97 ? 125 GLU B OE2   1 
ATOM   4406  N  N     . ILE B 1 126 ? -29.013 73.947 -10.857 1.00 103.53 ? 126 ILE B N     1 
ATOM   4407  C  CA    . ILE B 1 126 ? -30.363 74.503 -10.826 1.00 107.12 ? 126 ILE B CA    1 
ATOM   4408  C  C     . ILE B 1 126 ? -31.446 73.428 -10.903 1.00 116.97 ? 126 ILE B C     1 
ATOM   4409  O  O     . ILE B 1 126 ? -32.581 73.646 -10.454 1.00 109.50 ? 126 ILE B O     1 
ATOM   4410  C  CB    . ILE B 1 126 ? -30.602 75.497 -11.963 1.00 102.11 ? 126 ILE B CB    1 
ATOM   4411  C  CG1   . ILE B 1 126 ? -31.804 76.373 -11.631 1.00 103.25 ? 126 ILE B CG1   1 
ATOM   4412  C  CG2   . ILE B 1 126 ? -30.875 74.764 -13.267 1.00 96.21  ? 126 ILE B CG2   1 
ATOM   4413  C  CD1   . ILE B 1 126 ? -31.758 77.734 -12.279 1.00 99.92  ? 126 ILE B CD1   1 
ATOM   4414  N  N     . ALA B 1 127 ? -31.097 72.289 -11.502 1.00 111.80 ? 127 ALA B N     1 
ATOM   4415  C  CA    . ALA B 1 127 ? -32.022 71.167 -11.635 1.00 111.42 ? 127 ALA B CA    1 
ATOM   4416  C  C     . ALA B 1 127 ? -32.489 70.681 -10.272 1.00 106.48 ? 127 ALA B C     1 
ATOM   4417  O  O     . ALA B 1 127 ? -33.636 70.266 -10.105 1.00 99.65  ? 127 ALA B O     1 
ATOM   4418  C  CB    . ALA B 1 127 ? -31.380 70.027 -12.389 1.00 114.64 ? 127 ALA B CB    1 
ATOM   4419  N  N     . GLY B 1 128 ? -31.577 70.712 -9.306  1.00 114.99 ? 128 GLY B N     1 
ATOM   4420  C  CA    . GLY B 1 128 ? -31.871 70.283 -7.949  1.00 117.36 ? 128 GLY B CA    1 
ATOM   4421  C  C     . GLY B 1 128 ? -33.035 71.081 -7.422  1.00 112.63 ? 128 GLY B C     1 
ATOM   4422  O  O     . GLY B 1 128 ? -33.918 70.558 -6.743  1.00 113.22 ? 128 GLY B O     1 
ATOM   4423  N  N     . TYR B 1 129 ? -33.021 72.365 -7.750  1.00 104.52 ? 129 TYR B N     1 
ATOM   4424  C  CA    . TYR B 1 129 ? -34.103 73.264 -7.408  1.00 96.32  ? 129 TYR B CA    1 
ATOM   4425  C  C     . TYR B 1 129 ? -35.450 72.830 -7.977  1.00 104.37 ? 129 TYR B C     1 
ATOM   4426  O  O     . TYR B 1 129 ? -36.469 72.935 -7.298  1.00 111.66 ? 129 TYR B O     1 
ATOM   4427  C  CB    . TYR B 1 129 ? -33.726 74.691 -7.777  1.00 96.74  ? 129 TYR B CB    1 
ATOM   4428  C  CG    . TYR B 1 129 ? -32.743 75.259 -6.763  1.00 102.44 ? 129 TYR B CG    1 
ATOM   4429  C  CD1   . TYR B 1 129 ? -33.022 76.420 -6.050  1.00 96.05  ? 129 TYR B CD1   1 
ATOM   4430  C  CD2   . TYR B 1 129 ? -31.556 74.597 -6.490  1.00 99.78  ? 129 TYR B CD2   1 
ATOM   4431  C  CE1   . TYR B 1 129 ? -32.129 76.917 -5.119  1.00 111.10 ? 129 TYR B CE1   1 
ATOM   4432  C  CE2   . TYR B 1 129 ? -30.665 75.080 -5.564  1.00 103.29 ? 129 TYR B CE2   1 
ATOM   4433  C  CZ    . TYR B 1 129 ? -30.941 76.240 -4.871  1.00 115.31 ? 129 TYR B CZ    1 
ATOM   4434  O  OH    . TYR B 1 129 ? -30.017 76.715 -3.937  1.00 114.42 ? 129 TYR B OH    1 
ATOM   4435  N  N     . LEU B 1 130 ? -35.469 72.320 -9.202  1.00 104.40 ? 130 LEU B N     1 
ATOM   4436  C  CA    . LEU B 1 130 ? -36.699 71.703 -9.698  1.00 109.72 ? 130 LEU B CA    1 
ATOM   4437  C  C     . LEU B 1 130 ? -37.195 70.584 -8.768  1.00 112.47 ? 130 LEU B C     1 
ATOM   4438  O  O     . LEU B 1 130 ? -38.397 70.436 -8.548  1.00 125.19 ? 130 LEU B O     1 
ATOM   4439  C  CB    . LEU B 1 130 ? -36.538 71.181 -11.128 1.00 105.18 ? 130 LEU B CB    1 
ATOM   4440  C  CG    . LEU B 1 130 ? -36.702 72.291 -12.166 1.00 120.23 ? 130 LEU B CG    1 
ATOM   4441  C  CD1   . LEU B 1 130 ? -36.845 71.737 -13.572 1.00 124.80 ? 130 LEU B CD1   1 
ATOM   4442  C  CD2   . LEU B 1 130 ? -37.896 73.155 -11.830 1.00 124.61 ? 130 LEU B CD2   1 
ATOM   4443  N  N     . LEU B 1 131 ? -36.268 69.782 -8.259  1.00 101.12 ? 131 LEU B N     1 
ATOM   4444  C  CA    . LEU B 1 131 ? -36.597 68.692 -7.345  1.00 107.47 ? 131 LEU B CA    1 
ATOM   4445  C  C     . LEU B 1 131 ? -36.730 69.055 -5.847  1.00 128.25 ? 131 LEU B C     1 
ATOM   4446  O  O     . LEU B 1 131 ? -37.245 68.252 -5.066  1.00 139.78 ? 131 LEU B O     1 
ATOM   4447  C  CB    . LEU B 1 131 ? -35.575 67.569 -7.520  1.00 101.04 ? 131 LEU B CB    1 
ATOM   4448  C  CG    . LEU B 1 131 ? -35.510 67.048 -8.956  1.00 108.35 ? 131 LEU B CG    1 
ATOM   4449  C  CD1   . LEU B 1 131 ? -34.123 66.547 -9.301  1.00 108.61 ? 131 LEU B CD1   1 
ATOM   4450  C  CD2   . LEU B 1 131 ? -36.570 65.970 -9.237  1.00 107.70 ? 131 LEU B CD2   1 
ATOM   4451  N  N     . GLN B 1 132 ? -36.264 70.237 -5.440  1.00 121.34 ? 132 GLN B N     1 
ATOM   4452  C  CA    . GLN B 1 132 ? -36.238 70.597 -4.012  1.00 128.25 ? 132 GLN B CA    1 
ATOM   4453  C  C     . GLN B 1 132 ? -37.574 70.385 -3.314  1.00 127.76 ? 132 GLN B C     1 
ATOM   4454  O  O     . GLN B 1 132 ? -38.601 70.902 -3.765  1.00 129.83 ? 132 GLN B O     1 
ATOM   4455  C  CB    . GLN B 1 132 ? -35.791 72.054 -3.784  1.00 136.87 ? 132 GLN B CB    1 
ATOM   4456  N  N     . ASP B 1 133 ? -37.542 69.637 -2.208  1.00 123.44 ? 133 ASP B N     1 
ATOM   4457  C  CA    . ASP B 1 133 ? -38.723 69.394 -1.374  1.00 129.90 ? 133 ASP B CA    1 
ATOM   4458  C  C     . ASP B 1 133 ? -39.504 68.158 -1.824  1.00 113.97 ? 133 ASP B C     1 
ATOM   4459  O  O     . ASP B 1 133 ? -40.467 67.742 -1.171  1.00 88.19  ? 133 ASP B O     1 
ATOM   4460  C  CB    . ASP B 1 133 ? -39.663 70.611 -1.361  1.00 149.00 ? 133 ASP B CB    1 
ATOM   4461  C  CG    . ASP B 1 133 ? -38.965 71.899 -0.955  1.00 167.61 ? 133 ASP B CG    1 
ATOM   4462  O  OD1   . ASP B 1 133 ? -38.730 72.083 0.260   1.00 181.66 ? 133 ASP B OD1   1 
ATOM   4463  O  OD2   . ASP B 1 133 ? -38.678 72.736 -1.848  1.00 169.53 ? 133 ASP B OD2   1 
ATOM   4464  N  N     . ILE B 1 134 ? -39.097 67.583 -2.949  1.00 110.60 ? 134 ILE B N     1 
ATOM   4465  C  CA    . ILE B 1 134 ? -39.771 66.416 -3.503  1.00 100.02 ? 134 ILE B CA    1 
ATOM   4466  C  C     . ILE B 1 134 ? -40.028 65.364 -2.419  1.00 110.12 ? 134 ILE B C     1 
ATOM   4467  O  O     . ILE B 1 134 ? -41.106 64.779 -2.349  1.00 114.33 ? 134 ILE B O     1 
ATOM   4468  C  CB    . ILE B 1 134 ? -38.898 65.814 -4.604  1.00 89.65  ? 134 ILE B CB    1 
ATOM   4469  C  CG1   . ILE B 1 134 ? -39.606 64.684 -5.310  1.00 88.04  ? 134 ILE B CG1   1 
ATOM   4470  C  CG2   . ILE B 1 134 ? -37.609 65.319 -4.031  1.00 113.37 ? 134 ILE B CG2   1 
ATOM   4471  C  CD1   . ILE B 1 134 ? -40.465 65.184 -6.414  1.00 111.77 ? 134 ILE B CD1   1 
ATOM   4472  N  N     . GLU B 1 135 ? -39.037 65.172 -1.554  1.00 117.08 ? 135 GLU B N     1 
ATOM   4473  C  CA    . GLU B 1 135 ? -39.021 64.097 -0.572  1.00 121.93 ? 135 GLU B CA    1 
ATOM   4474  C  C     . GLU B 1 135 ? -39.888 64.371 0.657   1.00 120.78 ? 135 GLU B C     1 
ATOM   4475  O  O     . GLU B 1 135 ? -39.999 63.531 1.553   1.00 136.12 ? 135 GLU B O     1 
ATOM   4476  C  CB    . GLU B 1 135 ? -37.586 63.870 -0.116  1.00 134.02 ? 135 GLU B CB    1 
ATOM   4477  C  CG    . GLU B 1 135 ? -37.119 64.882 0.924   1.00 146.64 ? 135 GLU B CG    1 
ATOM   4478  C  CD    . GLU B 1 135 ? -36.882 66.280 0.348   1.00 165.27 ? 135 GLU B CD    1 
ATOM   4479  O  OE1   . GLU B 1 135 ? -36.873 66.445 -0.896  1.00 163.46 ? 135 GLU B OE1   1 
ATOM   4480  O  OE2   . GLU B 1 135 ? -36.696 67.220 1.152   1.00 174.23 ? 135 GLU B OE2   1 
ATOM   4481  N  N     . LYS B 1 136 ? -40.486 65.552 0.716   1.00 105.07 ? 136 LYS B N     1 
ATOM   4482  C  CA    . LYS B 1 136 ? -41.322 65.894 1.865   1.00 120.56 ? 136 LYS B CA    1 
ATOM   4483  C  C     . LYS B 1 136 ? -42.784 66.019 1.394   1.00 111.32 ? 136 LYS B C     1 
ATOM   4484  O  O     . LYS B 1 136 ? -43.460 67.018 1.638   1.00 109.75 ? 136 LYS B O     1 
ATOM   4485  C  CB    . LYS B 1 136 ? -40.756 67.119 2.697   1.00 79.90  ? 136 LYS B CB    1 
ATOM   4486  N  N     . LYS B 1 137 ? -43.250 64.972 0.713   1.00 119.21 ? 137 LYS B N     1 
ATOM   4487  C  CA    . LYS B 1 137 ? -44.646 64.843 0.268   1.00 130.23 ? 137 LYS B CA    1 
ATOM   4488  C  C     . LYS B 1 137 ? -45.252 66.140 -0.226  1.00 133.27 ? 137 LYS B C     1 
ATOM   4489  O  O     . LYS B 1 137 ? -46.283 66.577 0.283   1.00 135.75 ? 137 LYS B O     1 
ATOM   4490  C  CB    . LYS B 1 137 ? -45.533 64.269 1.377   1.00 129.11 ? 137 LYS B CB    1 
ATOM   4491  C  CG    . LYS B 1 137 ? -45.195 62.837 1.725   1.00 139.36 ? 137 LYS B CG    1 
ATOM   4492  C  CD    . LYS B 1 137 ? -46.282 62.159 2.509   1.00 146.24 ? 137 LYS B CD    1 
ATOM   4493  C  CE    . LYS B 1 137 ? -45.820 60.783 2.922   1.00 165.17 ? 137 LYS B CE    1 
ATOM   4494  N  NZ    . LYS B 1 137 ? -46.956 59.971 3.413   1.00 184.46 ? 137 LYS B NZ    1 
ATOM   4495  N  N     . THR B 1 138 ? -44.618 66.739 -1.228  1.00 121.27 ? 138 THR B N     1 
ATOM   4496  C  CA    . THR B 1 138 ? -44.964 68.080 -1.657  1.00 114.05 ? 138 THR B CA    1 
ATOM   4497  C  C     . THR B 1 138 ? -45.793 68.002 -2.892  1.00 117.52 ? 138 THR B C     1 
ATOM   4498  O  O     . THR B 1 138 ? -46.302 69.012 -3.373  1.00 130.35 ? 138 THR B O     1 
ATOM   4499  C  CB    . THR B 1 138 ? -43.732 68.824 -2.072  1.00 120.51 ? 138 THR B CB    1 
ATOM   4500  O  OG1   . THR B 1 138 ? -42.900 67.921 -2.815  1.00 132.94 ? 138 THR B OG1   1 
ATOM   4501  C  CG2   . THR B 1 138 ? -42.991 69.310 -0.856  1.00 116.35 ? 138 THR B CG2   1 
ATOM   4502  N  N     . VAL B 1 139 ? -45.924 66.793 -3.416  1.00 115.98 ? 139 VAL B N     1 
ATOM   4503  C  CA    . VAL B 1 139 ? -46.389 66.640 -4.782  1.00 104.03 ? 139 VAL B CA    1 
ATOM   4504  C  C     . VAL B 1 139 ? -47.070 65.286 -4.981  1.00 108.65 ? 139 VAL B C     1 
ATOM   4505  O  O     . VAL B 1 139 ? -46.679 64.284 -4.366  1.00 126.11 ? 139 VAL B O     1 
ATOM   4506  C  CB    . VAL B 1 139 ? -45.175 66.782 -5.721  1.00 98.64  ? 139 VAL B CB    1 
ATOM   4507  C  CG1   . VAL B 1 139 ? -44.864 65.480 -6.427  1.00 118.04 ? 139 VAL B CG1   1 
ATOM   4508  C  CG2   . VAL B 1 139 ? -45.381 67.893 -6.691  1.00 81.50  ? 139 VAL B CG2   1 
ATOM   4509  N  N     . PRO B 1 140 ? -48.106 65.253 -5.828  1.00 107.84 ? 140 PRO B N     1 
ATOM   4510  C  CA    . PRO B 1 140 ? -48.845 64.032 -6.166  1.00 114.51 ? 140 PRO B CA    1 
ATOM   4511  C  C     . PRO B 1 140 ? -47.986 62.970 -6.880  1.00 117.52 ? 140 PRO B C     1 
ATOM   4512  O  O     . PRO B 1 140 ? -47.314 63.244 -7.885  1.00 94.63  ? 140 PRO B O     1 
ATOM   4513  C  CB    . PRO B 1 140 ? -49.931 64.560 -7.108  1.00 105.91 ? 140 PRO B CB    1 
ATOM   4514  C  CG    . PRO B 1 140 ? -49.312 65.790 -7.705  1.00 104.03 ? 140 PRO B CG    1 
ATOM   4515  C  CD    . PRO B 1 140 ? -48.694 66.417 -6.497  1.00 109.75 ? 140 PRO B CD    1 
ATOM   4516  N  N     . PHE B 1 141 ? -48.015 61.753 -6.352  1.00 127.54 ? 141 PHE B N     1 
ATOM   4517  C  CA    . PHE B 1 141 ? -47.366 60.628 -7.010  1.00 127.10 ? 141 PHE B CA    1 
ATOM   4518  C  C     . PHE B 1 141 ? -48.371 59.678 -7.683  1.00 125.04 ? 141 PHE B C     1 
ATOM   4519  O  O     . PHE B 1 141 ? -49.562 59.688 -7.376  1.00 137.63 ? 141 PHE B O     1 
ATOM   4520  C  CB    . PHE B 1 141 ? -46.455 59.887 -6.029  1.00 126.46 ? 141 PHE B CB    1 
ATOM   4521  C  CG    . PHE B 1 141 ? -45.087 60.505 -5.887  1.00 130.06 ? 141 PHE B CG    1 
ATOM   4522  C  CD1   . PHE B 1 141 ? -44.861 61.530 -4.981  1.00 123.96 ? 141 PHE B CD1   1 
ATOM   4523  C  CD2   . PHE B 1 141 ? -44.021 60.056 -6.660  1.00 126.35 ? 141 PHE B CD2   1 
ATOM   4524  C  CE1   . PHE B 1 141 ? -43.594 62.094 -4.851  1.00 116.78 ? 141 PHE B CE1   1 
ATOM   4525  C  CE2   . PHE B 1 141 ? -42.751 60.618 -6.532  1.00 123.25 ? 141 PHE B CE2   1 
ATOM   4526  C  CZ    . PHE B 1 141 ? -42.541 61.637 -5.629  1.00 117.02 ? 141 PHE B CZ    1 
ATOM   4527  N  N     . ALA B 1 142 ? -47.885 58.902 -8.644  1.00 107.63 ? 142 ALA B N     1 
ATOM   4528  C  CA    . ALA B 1 142 ? -48.657 57.840 -9.271  1.00 102.70 ? 142 ALA B CA    1 
ATOM   4529  C  C     . ALA B 1 142 ? -47.801 56.588 -9.263  1.00 106.77 ? 142 ALA B C     1 
ATOM   4530  O  O     . ALA B 1 142 ? -46.623 56.649 -8.931  1.00 119.27 ? 142 ALA B O     1 
ATOM   4531  C  CB    . ALA B 1 142 ? -49.034 58.209 -10.699 1.00 107.87 ? 142 ALA B CB    1 
ATOM   4532  N  N     . TRP B 1 143 ? -48.372 55.457 -9.656  1.00 113.92 ? 143 TRP B N     1 
ATOM   4533  C  CA    . TRP B 1 143 ? -47.586 54.236 -9.752  1.00 110.88 ? 143 TRP B CA    1 
ATOM   4534  C  C     . TRP B 1 143 ? -46.900 54.251 -11.098 1.00 104.59 ? 143 TRP B C     1 
ATOM   4535  O  O     . TRP B 1 143 ? -47.375 54.891 -12.027 1.00 105.57 ? 143 TRP B O     1 
ATOM   4536  C  CB    . TRP B 1 143 ? -48.478 52.992 -9.700  1.00 113.91 ? 143 TRP B CB    1 
ATOM   4537  C  CG    . TRP B 1 143 ? -48.804 52.520 -8.351  1.00 118.76 ? 143 TRP B CG    1 
ATOM   4538  C  CD1   . TRP B 1 143 ? -50.030 52.500 -7.773  1.00 121.92 ? 143 TRP B CD1   1 
ATOM   4539  C  CD2   . TRP B 1 143 ? -47.892 51.986 -7.390  1.00 135.64 ? 143 TRP B CD2   1 
ATOM   4540  N  NE1   . TRP B 1 143 ? -49.943 51.995 -6.498  1.00 139.35 ? 143 TRP B NE1   1 
ATOM   4541  C  CE2   . TRP B 1 143 ? -48.639 51.675 -6.238  1.00 136.07 ? 143 TRP B CE2   1 
ATOM   4542  C  CE3   . TRP B 1 143 ? -46.513 51.745 -7.389  1.00 131.05 ? 143 TRP B CE3   1 
ATOM   4543  C  CZ2   . TRP B 1 143 ? -48.061 51.144 -5.098  1.00 122.39 ? 143 TRP B CZ2   1 
ATOM   4544  C  CZ3   . TRP B 1 143 ? -45.939 51.205 -6.264  1.00 114.39 ? 143 TRP B CZ3   1 
ATOM   4545  C  CH2   . TRP B 1 143 ? -46.713 50.916 -5.129  1.00 121.16 ? 143 TRP B CH2   1 
ATOM   4546  N  N     . ASN B 1 144 ? -45.768 53.571 -11.207 1.00 106.76 ? 144 ASN B N     1 
ATOM   4547  C  CA    . ASN B 1 144 ? -45.173 53.375 -12.519 1.00 120.81 ? 144 ASN B CA    1 
ATOM   4548  C  C     . ASN B 1 144 ? -45.936 52.293 -13.272 1.00 112.74 ? 144 ASN B C     1 
ATOM   4549  O  O     . ASN B 1 144 ? -46.847 51.664 -12.715 1.00 104.58 ? 144 ASN B O     1 
ATOM   4550  C  CB    . ASN B 1 144 ? -43.693 53.027 -12.410 1.00 120.88 ? 144 ASN B CB    1 
ATOM   4551  C  CG    . ASN B 1 144 ? -43.452 51.805 -11.590 1.00 117.96 ? 144 ASN B CG    1 
ATOM   4552  O  OD1   . ASN B 1 144 ? -42.411 51.178 -11.690 1.00 140.42 ? 144 ASN B OD1   1 
ATOM   4553  N  ND2   . ASN B 1 144 ? -44.421 51.441 -10.786 1.00 113.70 ? 144 ASN B ND2   1 
ATOM   4554  N  N     . PHE B 1 145 ? -45.582 52.081 -14.534 1.00 92.07  ? 145 PHE B N     1 
ATOM   4555  C  CA    . PHE B 1 145 ? -46.325 51.120 -15.345 1.00 110.71 ? 145 PHE B CA    1 
ATOM   4556  C  C     . PHE B 1 145 ? -46.458 49.739 -14.713 1.00 123.98 ? 145 PHE B C     1 
ATOM   4557  O  O     . PHE B 1 145 ? -47.382 49.011 -15.044 1.00 140.68 ? 145 PHE B O     1 
ATOM   4558  C  CB    . PHE B 1 145 ? -45.690 50.954 -16.718 1.00 118.27 ? 145 PHE B CB    1 
ATOM   4559  C  CG    . PHE B 1 145 ? -44.244 50.609 -16.663 1.00 119.65 ? 145 PHE B CG    1 
ATOM   4560  C  CD1   . PHE B 1 145 ? -43.838 49.352 -16.293 1.00 123.93 ? 145 PHE B CD1   1 
ATOM   4561  C  CD2   . PHE B 1 145 ? -43.288 51.547 -16.968 1.00 120.42 ? 145 PHE B CD2   1 
ATOM   4562  C  CE1   . PHE B 1 145 ? -42.504 49.037 -16.237 1.00 122.30 ? 145 PHE B CE1   1 
ATOM   4563  C  CE2   . PHE B 1 145 ? -41.958 51.236 -16.921 1.00 116.91 ? 145 PHE B CE2   1 
ATOM   4564  C  CZ    . PHE B 1 145 ? -41.565 49.982 -16.557 1.00 119.50 ? 145 PHE B CZ    1 
ATOM   4565  N  N     . ASP B 1 146 ? -45.539 49.372 -13.819 1.00 120.51 ? 146 ASP B N     1 
ATOM   4566  C  CA    . ASP B 1 146 ? -45.504 48.005 -13.290 1.00 101.70 ? 146 ASP B CA    1 
ATOM   4567  C  C     . ASP B 1 146 ? -46.152 47.871 -11.913 1.00 110.38 ? 146 ASP B C     1 
ATOM   4568  O  O     . ASP B 1 146 ? -46.447 46.756 -11.479 1.00 111.98 ? 146 ASP B O     1 
ATOM   4569  C  CB    . ASP B 1 146 ? -44.077 47.430 -13.300 1.00 83.95  ? 146 ASP B CB    1 
ATOM   4570  N  N     . ASP B 1 147 ? -46.397 49.009 -11.257 1.00 121.35 ? 147 ASP B N     1 
ATOM   4571  C  CA    . ASP B 1 147 ? -46.909 49.083 -9.872  1.00 115.33 ? 147 ASP B CA    1 
ATOM   4572  C  C     . ASP B 1 147 ? -45.816 48.761 -8.867  1.00 109.08 ? 147 ASP B C     1 
ATOM   4573  O  O     . ASP B 1 147 ? -46.085 48.479 -7.695  1.00 114.35 ? 147 ASP B O     1 
ATOM   4574  C  CB    . ASP B 1 147 ? -48.112 48.163 -9.619  1.00 127.73 ? 147 ASP B CB    1 
ATOM   4575  C  CG    . ASP B 1 147 ? -49.428 48.770 -10.063 1.00 143.06 ? 147 ASP B CG    1 
ATOM   4576  O  OD1   . ASP B 1 147 ? -49.415 49.636 -10.970 1.00 151.29 ? 147 ASP B OD1   1 
ATOM   4577  O  OD2   . ASP B 1 147 ? -50.480 48.357 -9.515  1.00 150.64 ? 147 ASP B OD2   1 
ATOM   4578  N  N     . THR B 1 148 ? -44.577 48.809 -9.338  1.00 106.23 ? 148 THR B N     1 
ATOM   4579  C  CA    . THR B 1 148 ? -43.439 48.451 -8.512  1.00 111.86 ? 148 THR B CA    1 
ATOM   4580  C  C     . THR B 1 148 ? -42.893 49.631 -7.719  1.00 101.09 ? 148 THR B C     1 
ATOM   4581  O  O     . THR B 1 148 ? -42.350 49.447 -6.638  1.00 107.45 ? 148 THR B O     1 
ATOM   4582  C  CB    . THR B 1 148 ? -42.281 47.884 -9.356  1.00 114.95 ? 148 THR B CB    1 
ATOM   4583  O  OG1   . THR B 1 148 ? -41.646 48.942 -10.076 1.00 126.41 ? 148 THR B OG1   1 
ATOM   4584  C  CG2   . THR B 1 148 ? -42.778 46.866 -10.333 1.00 111.58 ? 148 THR B CG2   1 
ATOM   4585  N  N     . GLU B 1 149 ? -43.035 50.835 -8.257  1.00 94.38  ? 149 GLU B N     1 
ATOM   4586  C  CA    . GLU B 1 149 ? -42.457 52.014 -7.633  1.00 111.68 ? 149 GLU B CA    1 
ATOM   4587  C  C     . GLU B 1 149 ? -43.223 53.277 -7.999  1.00 117.63 ? 149 GLU B C     1 
ATOM   4588  O  O     . GLU B 1 149 ? -43.874 53.327 -9.042  1.00 129.05 ? 149 GLU B O     1 
ATOM   4589  C  CB    . GLU B 1 149 ? -41.005 52.172 -8.047  1.00 127.05 ? 149 GLU B CB    1 
ATOM   4590  C  CG    . GLU B 1 149 ? -40.255 53.082 -7.108  1.00 155.93 ? 149 GLU B CG    1 
ATOM   4591  C  CD    . GLU B 1 149 ? -39.002 53.660 -7.725  1.00 178.78 ? 149 GLU B CD    1 
ATOM   4592  O  OE1   . GLU B 1 149 ? -38.403 52.986 -8.602  1.00 176.71 ? 149 GLU B OE1   1 
ATOM   4593  O  OE2   . GLU B 1 149 ? -38.625 54.790 -7.321  1.00 189.11 ? 149 GLU B OE2   1 
ATOM   4594  N  N     . LYS B 1 150 ? -43.118 54.308 -7.165  1.00 109.42 ? 150 LYS B N     1 
ATOM   4595  C  CA    . LYS B 1 150 ? -43.917 55.517 -7.356  1.00 105.85 ? 150 LYS B CA    1 
ATOM   4596  C  C     . LYS B 1 150 ? -43.147 56.694 -7.978  1.00 116.65 ? 150 LYS B C     1 
ATOM   4597  O  O     . LYS B 1 150 ? -41.953 56.882 -7.747  1.00 128.64 ? 150 LYS B O     1 
ATOM   4598  C  CB    . LYS B 1 150 ? -44.632 55.901 -6.051  1.00 105.60 ? 150 LYS B CB    1 
ATOM   4599  C  CG    . LYS B 1 150 ? -46.069 55.371 -5.962  1.00 120.39 ? 150 LYS B CG    1 
ATOM   4600  C  CD    . LYS B 1 150 ? -46.480 54.968 -4.536  1.00 123.02 ? 150 LYS B CD    1 
ATOM   4601  N  N     . GLU B 1 151 ? -43.858 57.461 -8.794  1.00 113.71 ? 151 GLU B N     1 
ATOM   4602  C  CA    . GLU B 1 151 ? -43.266 58.412 -9.711  1.00 106.18 ? 151 GLU B CA    1 
ATOM   4603  C  C     . GLU B 1 151 ? -44.026 59.723 -9.560  1.00 113.51 ? 151 GLU B C     1 
ATOM   4604  O  O     . GLU B 1 151 ? -45.242 59.697 -9.432  1.00 120.35 ? 151 GLU B O     1 
ATOM   4605  C  CB    . GLU B 1 151 ? -43.482 57.867 -11.121 1.00 102.77 ? 151 GLU B CB    1 
ATOM   4606  C  CG    . GLU B 1 151 ? -42.793 58.636 -12.225 1.00 122.25 ? 151 GLU B CG    1 
ATOM   4607  C  CD    . GLU B 1 151 ? -43.381 58.385 -13.628 1.00 133.53 ? 151 GLU B CD    1 
ATOM   4608  O  OE1   . GLU B 1 151 ? -43.837 57.254 -13.946 1.00 117.37 ? 151 GLU B OE1   1 
ATOM   4609  O  OE2   . GLU B 1 151 ? -43.365 59.347 -14.427 1.00 148.06 ? 151 GLU B OE2   1 
ATOM   4610  N  N     . PRO B 1 152 ? -43.319 60.872 -9.561  1.00 109.38 ? 152 PRO B N     1 
ATOM   4611  C  CA    . PRO B 1 152 ? -43.947 62.200 -9.431  1.00 96.72  ? 152 PRO B CA    1 
ATOM   4612  C  C     . PRO B 1 152 ? -44.771 62.523 -10.659 1.00 103.83 ? 152 PRO B C     1 
ATOM   4613  O  O     . PRO B 1 152 ? -44.343 62.158 -11.754 1.00 111.56 ? 152 PRO B O     1 
ATOM   4614  C  CB    . PRO B 1 152 ? -42.760 63.164 -9.390  1.00 80.23  ? 152 PRO B CB    1 
ATOM   4615  C  CG    . PRO B 1 152 ? -41.575 62.333 -9.136  1.00 88.72  ? 152 PRO B CG    1 
ATOM   4616  C  CD    . PRO B 1 152 ? -41.856 60.968 -9.673  1.00 98.50  ? 152 PRO B CD    1 
ATOM   4617  N  N     . THR B 1 153 ? -45.903 63.205 -10.495 1.00 104.05 ? 153 THR B N     1 
ATOM   4618  C  CA    . THR B 1 153 ? -46.724 63.600 -11.645 1.00 108.74 ? 153 THR B CA    1 
ATOM   4619  C  C     . THR B 1 153 ? -46.380 65.017 -12.111 1.00 117.49 ? 153 THR B C     1 
ATOM   4620  O  O     . THR B 1 153 ? -46.770 65.462 -13.202 1.00 112.94 ? 153 THR B O     1 
ATOM   4621  C  CB    . THR B 1 153 ? -48.200 63.518 -11.337 1.00 102.48 ? 153 THR B CB    1 
ATOM   4622  O  OG1   . THR B 1 153 ? -48.538 64.497 -10.337 1.00 120.29 ? 153 THR B OG1   1 
ATOM   4623  C  CG2   . THR B 1 153 ? -48.495 62.153 -10.827 1.00 98.98  ? 153 THR B CG2   1 
ATOM   4624  N  N     . VAL B 1 154 ? -45.651 65.723 -11.259 1.00 109.32 ? 154 VAL B N     1 
ATOM   4625  C  CA    . VAL B 1 154 ? -45.105 67.014 -11.608 1.00 108.82 ? 154 VAL B CA    1 
ATOM   4626  C  C     . VAL B 1 154 ? -44.002 67.241 -10.605 1.00 101.50 ? 154 VAL B C     1 
ATOM   4627  O  O     . VAL B 1 154 ? -43.942 66.551 -9.593  1.00 93.91  ? 154 VAL B O     1 
ATOM   4628  C  CB    . VAL B 1 154 ? -46.153 68.101 -11.491 1.00 122.26 ? 154 VAL B CB    1 
ATOM   4629  C  CG1   . VAL B 1 154 ? -46.480 68.368 -10.019 1.00 69.80  ? 154 VAL B CG1   1 
ATOM   4630  C  CG2   . VAL B 1 154 ? -45.667 69.344 -12.194 1.00 119.32 ? 154 VAL B CG2   1 
ATOM   4631  N  N     . LEU B 1 155 ? -43.108 68.178 -10.877 1.00 88.95  ? 155 LEU B N     1 
ATOM   4632  C  CA    . LEU B 1 155 ? -42.058 68.436 -9.919  1.00 88.00  ? 155 LEU B CA    1 
ATOM   4633  C  C     . LEU B 1 155 ? -42.424 69.619 -9.043  1.00 101.58 ? 155 LEU B C     1 
ATOM   4634  O  O     . LEU B 1 155 ? -43.360 70.352 -9.353  1.00 104.50 ? 155 LEU B O     1 
ATOM   4635  C  CB    . LEU B 1 155 ? -40.720 68.638 -10.607 1.00 87.01  ? 155 LEU B CB    1 
ATOM   4636  C  CG    . LEU B 1 155 ? -40.265 67.398 -11.379 1.00 89.73  ? 155 LEU B CG    1 
ATOM   4637  C  CD1   . LEU B 1 155 ? -38.758 67.450 -11.632 1.00 100.90 ? 155 LEU B CD1   1 
ATOM   4638  C  CD2   . LEU B 1 155 ? -40.663 66.096 -10.679 1.00 78.52  ? 155 LEU B CD2   1 
ATOM   4639  N  N     . PRO B 1 156 ? -41.712 69.782 -7.918  1.00 107.89 ? 156 PRO B N     1 
ATOM   4640  C  CA    . PRO B 1 156 ? -41.913 70.933 -7.037  1.00 106.90 ? 156 PRO B CA    1 
ATOM   4641  C  C     . PRO B 1 156 ? -41.704 72.253 -7.773  1.00 108.00 ? 156 PRO B C     1 
ATOM   4642  O  O     . PRO B 1 156 ? -42.612 73.074 -7.775  1.00 123.35 ? 156 PRO B O     1 
ATOM   4643  C  CB    . PRO B 1 156 ? -40.854 70.723 -5.959  1.00 119.08 ? 156 PRO B CB    1 
ATOM   4644  C  CG    . PRO B 1 156 ? -40.711 69.223 -5.892  1.00 115.26 ? 156 PRO B CG    1 
ATOM   4645  C  CD    . PRO B 1 156 ? -40.816 68.777 -7.317  1.00 109.55 ? 156 PRO B CD    1 
ATOM   4646  N  N     . ALA B 1 157 ? -40.535 72.455 -8.373  1.00 111.43 ? 157 ALA B N     1 
ATOM   4647  C  CA    . ALA B 1 157 ? -40.300 73.613 -9.246  1.00 126.25 ? 157 ALA B CA    1 
ATOM   4648  C  C     . ALA B 1 157 ? -39.948 74.909 -8.518  1.00 124.29 ? 157 ALA B C     1 
ATOM   4649  O  O     . ALA B 1 157 ? -40.766 75.829 -8.428  1.00 122.71 ? 157 ALA B O     1 
ATOM   4650  C  CB    . ALA B 1 157 ? -41.494 73.843 -10.174 1.00 128.32 ? 157 ALA B CB    1 
ATOM   4651  N  N     . ALA B 1 158 ? -38.718 74.982 -8.027  1.00 116.72 ? 158 ALA B N     1 
ATOM   4652  C  CA    . ALA B 1 158 ? -38.244 76.167 -7.337  1.00 110.56 ? 158 ALA B CA    1 
ATOM   4653  C  C     . ALA B 1 158 ? -38.266 77.397 -8.240  1.00 117.26 ? 158 ALA B C     1 
ATOM   4654  O  O     . ALA B 1 158 ? -38.405 78.522 -7.752  1.00 124.09 ? 158 ALA B O     1 
ATOM   4655  C  CB    . ALA B 1 158 ? -36.858 75.933 -6.797  1.00 107.54 ? 158 ALA B CB    1 
ATOM   4656  N  N     . PHE B 1 159 ? -38.118 77.190 -9.548  1.00 110.78 ? 159 PHE B N     1 
ATOM   4657  C  CA    . PHE B 1 159 ? -38.210 78.302 -10.496 1.00 121.31 ? 159 PHE B CA    1 
ATOM   4658  C  C     . PHE B 1 159 ? -39.128 77.952 -11.660 1.00 130.52 ? 159 PHE B C     1 
ATOM   4659  O  O     . PHE B 1 159 ? -39.392 76.774 -11.899 1.00 137.54 ? 159 PHE B O     1 
ATOM   4660  C  CB    . PHE B 1 159 ? -36.828 78.732 -10.995 1.00 134.51 ? 159 PHE B CB    1 
ATOM   4661  C  CG    . PHE B 1 159 ? -36.168 77.741 -11.911 1.00 139.94 ? 159 PHE B CG    1 
ATOM   4662  C  CD1   . PHE B 1 159 ? -35.660 76.546 -11.417 1.00 134.43 ? 159 PHE B CD1   1 
ATOM   4663  C  CD2   . PHE B 1 159 ? -36.037 78.015 -13.265 1.00 138.30 ? 159 PHE B CD2   1 
ATOM   4664  C  CE1   . PHE B 1 159 ? -35.048 75.639 -12.261 1.00 127.65 ? 159 PHE B CE1   1 
ATOM   4665  C  CE2   . PHE B 1 159 ? -35.429 77.109 -14.113 1.00 132.47 ? 159 PHE B CE2   1 
ATOM   4666  C  CZ    . PHE B 1 159 ? -34.933 75.919 -13.608 1.00 124.27 ? 159 PHE B CZ    1 
ATOM   4667  N  N     . PRO B 1 160 ? -39.637 78.982 -12.368 1.00 129.59 ? 160 PRO B N     1 
ATOM   4668  C  CA    . PRO B 1 160 ? -40.616 78.874 -13.466 1.00 131.81 ? 160 PRO B CA    1 
ATOM   4669  C  C     . PRO B 1 160 ? -40.029 78.347 -14.777 1.00 128.57 ? 160 PRO B C     1 
ATOM   4670  O  O     . PRO B 1 160 ? -40.015 79.051 -15.788 1.00 115.45 ? 160 PRO B O     1 
ATOM   4671  C  CB    . PRO B 1 160 ? -41.106 80.316 -13.650 1.00 127.17 ? 160 PRO B CB    1 
ATOM   4672  C  CG    . PRO B 1 160 ? -40.690 81.032 -12.421 1.00 128.46 ? 160 PRO B CG    1 
ATOM   4673  C  CD    . PRO B 1 160 ? -39.410 80.384 -11.993 1.00 125.12 ? 160 PRO B CD    1 
ATOM   4674  N  N     . ASN B 1 161 ? -39.577 77.099 -14.742 1.00 132.63 ? 161 ASN B N     1 
ATOM   4675  C  CA    . ASN B 1 161 ? -38.891 76.454 -15.856 1.00 134.00 ? 161 ASN B CA    1 
ATOM   4676  C  C     . ASN B 1 161 ? -39.566 76.611 -17.220 1.00 132.55 ? 161 ASN B C     1 
ATOM   4677  O  O     . ASN B 1 161 ? -38.887 76.661 -18.244 1.00 137.73 ? 161 ASN B O     1 
ATOM   4678  C  CB    . ASN B 1 161 ? -38.699 74.970 -15.532 1.00 137.36 ? 161 ASN B CB    1 
ATOM   4679  C  CG    . ASN B 1 161 ? -37.865 74.249 -16.563 1.00 135.22 ? 161 ASN B CG    1 
ATOM   4680  O  OD1   . ASN B 1 161 ? -36.908 74.803 -17.108 1.00 130.81 ? 161 ASN B OD1   1 
ATOM   4681  N  ND2   . ASN B 1 161 ? -38.216 72.997 -16.826 1.00 128.88 ? 161 ASN B ND2   1 
ATOM   4682  N  N     . LEU B 1 162 ? -40.895 76.679 -17.236 1.00 131.17 ? 162 LEU B N     1 
ATOM   4683  C  CA    . LEU B 1 162 ? -41.640 76.737 -18.496 1.00 131.13 ? 162 LEU B CA    1 
ATOM   4684  C  C     . LEU B 1 162 ? -41.179 77.889 -19.388 1.00 129.68 ? 162 LEU B C     1 
ATOM   4685  O  O     . LEU B 1 162 ? -40.779 77.672 -20.532 1.00 124.18 ? 162 LEU B O     1 
ATOM   4686  C  CB    . LEU B 1 162 ? -43.147 76.866 -18.235 1.00 133.39 ? 162 LEU B CB    1 
ATOM   4687  C  CG    . LEU B 1 162 ? -44.112 76.317 -19.298 1.00 110.45 ? 162 LEU B CG    1 
ATOM   4688  C  CD1   . LEU B 1 162 ? -45.273 77.272 -19.522 1.00 104.68 ? 162 LEU B CD1   1 
ATOM   4689  C  CD2   . LEU B 1 162 ? -43.391 76.085 -20.591 1.00 91.78  ? 162 LEU B CD2   1 
ATOM   4690  N  N     . LEU B 1 163 ? -41.255 79.109 -18.865 1.00 133.05 ? 163 LEU B N     1 
ATOM   4691  C  CA    . LEU B 1 163 ? -40.780 80.292 -19.582 1.00 131.22 ? 163 LEU B CA    1 
ATOM   4692  C  C     . LEU B 1 163 ? -39.263 80.310 -19.764 1.00 123.25 ? 163 LEU B C     1 
ATOM   4693  O  O     . LEU B 1 163 ? -38.750 80.702 -20.806 1.00 120.05 ? 163 LEU B O     1 
ATOM   4694  C  CB    . LEU B 1 163 ? -41.215 81.555 -18.855 1.00 122.14 ? 163 LEU B CB    1 
ATOM   4695  C  CG    . LEU B 1 163 ? -42.699 81.827 -19.047 1.00 125.41 ? 163 LEU B CG    1 
ATOM   4696  C  CD1   . LEU B 1 163 ? -43.189 82.806 -17.991 1.00 130.91 ? 163 LEU B CD1   1 
ATOM   4697  C  CD2   . LEU B 1 163 ? -42.985 82.328 -20.470 1.00 111.89 ? 163 LEU B CD2   1 
ATOM   4698  N  N     . VAL B 1 164 ? -38.548 79.893 -18.735 1.00 114.49 ? 164 VAL B N     1 
ATOM   4699  C  CA    . VAL B 1 164 ? -37.100 79.924 -18.761 1.00 105.60 ? 164 VAL B CA    1 
ATOM   4700  C  C     . VAL B 1 164 ? -36.499 79.148 -19.926 1.00 110.79 ? 164 VAL B C     1 
ATOM   4701  O  O     . VAL B 1 164 ? -35.782 79.715 -20.739 1.00 126.30 ? 164 VAL B O     1 
ATOM   4702  C  CB    . VAL B 1 164 ? -36.579 79.364 -17.459 1.00 104.73 ? 164 VAL B CB    1 
ATOM   4703  C  CG1   . VAL B 1 164 ? -35.072 79.363 -17.440 1.00 116.15 ? 164 VAL B CG1   1 
ATOM   4704  C  CG2   . VAL B 1 164 ? -37.134 80.190 -16.330 1.00 108.80 ? 164 VAL B CG2   1 
ATOM   4705  N  N     . ASN B 1 165 ? -36.746 77.844 -19.975 1.00 105.04 ? 165 ASN B N     1 
ATOM   4706  C  CA    . ASN B 1 165 ? -36.238 77.003 -21.059 1.00 107.61 ? 165 ASN B CA    1 
ATOM   4707  C  C     . ASN B 1 165 ? -37.171 76.779 -22.247 1.00 127.49 ? 165 ASN B C     1 
ATOM   4708  O  O     . ASN B 1 165 ? -36.893 75.929 -23.099 1.00 134.56 ? 165 ASN B O     1 
ATOM   4709  C  CB    . ASN B 1 165 ? -35.839 75.652 -20.507 1.00 106.72 ? 165 ASN B CB    1 
ATOM   4710  C  CG    . ASN B 1 165 ? -34.633 75.742 -19.621 1.00 109.33 ? 165 ASN B CG    1 
ATOM   4711  O  OD1   . ASN B 1 165 ? -33.657 76.430 -19.959 1.00 110.94 ? 165 ASN B OD1   1 
ATOM   4712  N  ND2   . ASN B 1 165 ? -34.682 75.052 -18.467 1.00 94.93  ? 165 ASN B ND2   1 
ATOM   4713  N  N     . GLY B 1 166 ? -38.280 77.510 -22.295 1.00 140.19 ? 166 GLY B N     1 
ATOM   4714  C  CA    . GLY B 1 166 ? -39.256 77.330 -23.358 1.00 144.41 ? 166 GLY B CA    1 
ATOM   4715  C  C     . GLY B 1 166 ? -39.596 75.866 -23.569 1.00 127.63 ? 166 GLY B C     1 
ATOM   4716  O  O     . GLY B 1 166 ? -39.414 75.050 -22.654 1.00 117.57 ? 166 GLY B O     1 
ATOM   4717  N  N     . SER B 1 167 ? -40.087 75.535 -24.764 1.00 113.75 ? 167 SER B N     1 
ATOM   4718  C  CA    . SER B 1 167 ? -40.355 74.141 -25.120 1.00 122.98 ? 167 SER B CA    1 
ATOM   4719  C  C     . SER B 1 167 ? -41.097 73.981 -26.438 1.00 112.78 ? 167 SER B C     1 
ATOM   4720  O  O     . SER B 1 167 ? -41.856 74.861 -26.832 1.00 115.98 ? 167 SER B O     1 
ATOM   4721  C  CB    . SER B 1 167 ? -41.141 73.434 -24.021 1.00 149.40 ? 167 SER B CB    1 
ATOM   4722  O  OG    . SER B 1 167 ? -41.062 72.031 -24.199 1.00 159.94 ? 167 SER B OG    1 
ATOM   4723  N  N     . THR B 1 168 ? -40.837 72.867 -27.126 1.00 106.38 ? 168 THR B N     1 
ATOM   4724  C  CA    . THR B 1 168 ? -41.549 72.484 -28.351 1.00 107.45 ? 168 THR B CA    1 
ATOM   4725  C  C     . THR B 1 168 ? -41.543 70.951 -28.431 1.00 116.70 ? 168 THR B C     1 
ATOM   4726  O  O     . THR B 1 168 ? -40.560 70.356 -27.992 1.00 136.03 ? 168 THR B O     1 
ATOM   4727  C  CB    . THR B 1 168 ? -40.780 73.021 -29.567 1.00 107.51 ? 168 THR B CB    1 
ATOM   4728  O  OG1   . THR B 1 168 ? -39.611 72.224 -29.757 1.00 101.15 ? 168 THR B OG1   1 
ATOM   4729  C  CG2   . THR B 1 168 ? -40.331 74.483 -29.344 1.00 115.63 ? 168 THR B CG2   1 
ATOM   4730  N  N     . GLY B 1 169 ? -42.581 70.282 -28.960 1.00 111.03 ? 169 GLY B N     1 
ATOM   4731  C  CA    . GLY B 1 169 ? -43.845 70.859 -29.395 1.00 110.75 ? 169 GLY B CA    1 
ATOM   4732  C  C     . GLY B 1 169 ? -44.602 70.252 -30.596 1.00 121.94 ? 169 GLY B C     1 
ATOM   4733  O  O     . GLY B 1 169 ? -45.074 71.017 -31.435 1.00 140.71 ? 169 GLY B O     1 
ATOM   4734  N  N     . ILE B 1 170 ? -44.744 68.927 -30.715 1.00 93.80  ? 170 ILE B N     1 
ATOM   4735  C  CA    . ILE B 1 170 ? -45.618 68.375 -31.777 1.00 94.98  ? 170 ILE B CA    1 
ATOM   4736  C  C     . ILE B 1 170 ? -46.484 67.186 -31.359 1.00 99.85  ? 170 ILE B C     1 
ATOM   4737  O  O     . ILE B 1 170 ? -45.985 66.084 -31.111 1.00 101.32 ? 170 ILE B O     1 
ATOM   4738  C  CB    . ILE B 1 170 ? -44.864 67.877 -33.037 1.00 110.55 ? 170 ILE B CB    1 
ATOM   4739  C  CG1   . ILE B 1 170 ? -44.073 68.960 -33.735 1.00 118.44 ? 170 ILE B CG1   1 
ATOM   4740  C  CG2   . ILE B 1 170 ? -45.832 67.357 -34.081 1.00 87.46  ? 170 ILE B CG2   1 
ATOM   4741  C  CD1   . ILE B 1 170 ? -43.414 68.408 -35.005 1.00 115.04 ? 170 ILE B CD1   1 
ATOM   4742  N  N     . SER B 1 171 ? -47.792 67.392 -31.357 1.00 97.99  ? 171 SER B N     1 
ATOM   4743  C  CA    . SER B 1 171 ? -48.721 66.362 -30.922 1.00 113.64 ? 171 SER B CA    1 
ATOM   4744  C  C     . SER B 1 171 ? -49.833 66.231 -31.939 1.00 127.08 ? 171 SER B C     1 
ATOM   4745  O  O     . SER B 1 171 ? -49.806 66.893 -32.968 1.00 149.03 ? 171 SER B O     1 
ATOM   4746  C  CB    . SER B 1 171 ? -49.346 66.771 -29.593 1.00 122.41 ? 171 SER B CB    1 
ATOM   4747  O  OG    . SER B 1 171 ? -50.198 67.895 -29.781 1.00 117.89 ? 171 SER B OG    1 
ATOM   4748  N  N     . ALA B 1 172 ? -50.819 65.388 -31.644 1.00 125.28 ? 172 ALA B N     1 
ATOM   4749  C  CA    . ALA B 1 172 ? -52.060 65.340 -32.420 1.00 119.78 ? 172 ALA B CA    1 
ATOM   4750  C  C     . ALA B 1 172 ? -52.974 66.549 -32.137 1.00 114.17 ? 172 ALA B C     1 
ATOM   4751  O  O     . ALA B 1 172 ? -53.401 66.769 -31.002 1.00 113.79 ? 172 ALA B O     1 
ATOM   4752  C  CB    . ALA B 1 172 ? -52.802 64.045 -32.138 1.00 106.96 ? 172 ALA B CB    1 
ATOM   4753  N  N     . GLY B 1 173 ? -53.271 67.328 -33.174 1.00 100.72 ? 173 GLY B N     1 
ATOM   4754  C  CA    . GLY B 1 173 ? -54.125 68.493 -33.042 1.00 103.62 ? 173 GLY B CA    1 
ATOM   4755  C  C     . GLY B 1 173 ? -53.422 69.720 -32.484 1.00 115.17 ? 173 GLY B C     1 
ATOM   4756  O  O     . GLY B 1 173 ? -53.820 70.852 -32.741 1.00 121.95 ? 173 GLY B O     1 
ATOM   4757  N  N     . TYR B 1 174 ? -52.371 69.508 -31.708 1.00 114.61 ? 174 TYR B N     1 
ATOM   4758  C  CA    . TYR B 1 174 ? -51.668 70.632 -31.115 1.00 114.99 ? 174 TYR B CA    1 
ATOM   4759  C  C     . TYR B 1 174 ? -50.167 70.564 -31.325 1.00 122.16 ? 174 TYR B C     1 
ATOM   4760  O  O     . TYR B 1 174 ? -49.572 69.493 -31.353 1.00 122.89 ? 174 TYR B O     1 
ATOM   4761  C  CB    . TYR B 1 174 ? -51.944 70.696 -29.632 1.00 107.31 ? 174 TYR B CB    1 
ATOM   4762  C  CG    . TYR B 1 174 ? -53.378 70.942 -29.276 1.00 107.28 ? 174 TYR B CG    1 
ATOM   4763  C  CD1   . TYR B 1 174 ? -53.818 72.217 -28.970 1.00 108.90 ? 174 TYR B CD1   1 
ATOM   4764  C  CD2   . TYR B 1 174 ? -54.290 69.897 -29.218 1.00 111.13 ? 174 TYR B CD2   1 
ATOM   4765  C  CE1   . TYR B 1 174 ? -55.121 72.453 -28.617 1.00 115.97 ? 174 TYR B CE1   1 
ATOM   4766  C  CE2   . TYR B 1 174 ? -55.602 70.124 -28.868 1.00 118.48 ? 174 TYR B CE2   1 
ATOM   4767  C  CZ    . TYR B 1 174 ? -56.007 71.408 -28.562 1.00 124.00 ? 174 TYR B CZ    1 
ATOM   4768  O  OH    . TYR B 1 174 ? -57.309 71.669 -28.212 1.00 132.67 ? 174 TYR B OH    1 
ATOM   4769  N  N     . ALA B 1 175 ? -49.561 71.727 -31.480 1.00 117.11 ? 175 ALA B N     1 
ATOM   4770  C  CA    . ALA B 1 175 ? -48.116 71.829 -31.465 1.00 125.44 ? 175 ALA B CA    1 
ATOM   4771  C  C     . ALA B 1 175 ? -47.745 72.951 -30.502 1.00 123.17 ? 175 ALA B C     1 
ATOM   4772  O  O     . ALA B 1 175 ? -48.597 73.758 -30.138 1.00 130.75 ? 175 ALA B O     1 
ATOM   4773  C  CB    . ALA B 1 175 ? -47.605 72.096 -32.849 1.00 148.05 ? 175 ALA B CB    1 
ATOM   4774  N  N     . THR B 1 176 ? -46.504 72.982 -30.036 1.00 118.55 ? 176 THR B N     1 
ATOM   4775  C  CA    . THR B 1 176 ? -46.100 74.049 -29.133 1.00 126.61 ? 176 THR B CA    1 
ATOM   4776  C  C     . THR B 1 176 ? -44.731 74.594 -29.490 1.00 127.54 ? 176 THR B C     1 
ATOM   4777  O  O     . THR B 1 176 ? -43.848 73.842 -29.891 1.00 130.24 ? 176 THR B O     1 
ATOM   4778  C  CB    . THR B 1 176 ? -46.090 73.571 -27.647 1.00 127.70 ? 176 THR B CB    1 
ATOM   4779  O  OG1   . THR B 1 176 ? -46.246 74.694 -26.769 1.00 140.20 ? 176 THR B OG1   1 
ATOM   4780  C  CG2   . THR B 1 176 ? -44.800 72.828 -27.311 1.00 109.06 ? 176 THR B CG2   1 
ATOM   4781  N  N     . ASP B 1 177 ? -44.588 75.914 -29.389 1.00 125.41 ? 177 ASP B N     1 
ATOM   4782  C  CA    . ASP B 1 177 ? -43.287 76.571 -29.403 1.00 120.05 ? 177 ASP B CA    1 
ATOM   4783  C  C     . ASP B 1 177 ? -43.264 77.670 -28.347 1.00 117.97 ? 177 ASP B C     1 
ATOM   4784  O  O     . ASP B 1 177 ? -44.096 78.572 -28.374 1.00 118.75 ? 177 ASP B O     1 
ATOM   4785  C  CB    . ASP B 1 177 ? -42.985 77.161 -30.782 1.00 132.96 ? 177 ASP B CB    1 
ATOM   4786  C  CG    . ASP B 1 177 ? -42.258 76.182 -31.695 1.00 157.93 ? 177 ASP B CG    1 
ATOM   4787  O  OD1   . ASP B 1 177 ? -41.143 76.514 -32.156 1.00 165.90 ? 177 ASP B OD1   1 
ATOM   4788  O  OD2   . ASP B 1 177 ? -42.793 75.079 -31.946 1.00 168.68 ? 177 ASP B OD2   1 
ATOM   4789  N  N     . ILE B 1 178 ? -42.316 77.593 -27.417 1.00 123.24 ? 178 ILE B N     1 
ATOM   4790  C  CA    . ILE B 1 178 ? -42.193 78.592 -26.351 1.00 111.40 ? 178 ILE B CA    1 
ATOM   4791  C  C     . ILE B 1 178 ? -40.750 79.055 -26.178 1.00 105.64 ? 178 ILE B C     1 
ATOM   4792  O  O     . ILE B 1 178 ? -39.894 78.291 -25.721 1.00 106.26 ? 178 ILE B O     1 
ATOM   4793  C  CB    . ILE B 1 178 ? -42.689 78.049 -24.999 1.00 101.48 ? 178 ILE B CB    1 
ATOM   4794  C  CG1   . ILE B 1 178 ? -44.107 77.512 -25.147 1.00 101.54 ? 178 ILE B CG1   1 
ATOM   4795  C  CG2   . ILE B 1 178 ? -42.638 79.138 -23.946 1.00 109.10 ? 178 ILE B CG2   1 
ATOM   4796  C  CD1   . ILE B 1 178 ? -44.756 77.111 -23.878 1.00 96.90  ? 178 ILE B CD1   1 
ATOM   4797  N  N     . PRO B 1 179 ? -40.482 80.324 -26.502 1.00 104.90 ? 179 PRO B N     1 
ATOM   4798  C  CA    . PRO B 1 179 ? -39.105 80.807 -26.540 1.00 111.51 ? 179 PRO B CA    1 
ATOM   4799  C  C     . PRO B 1 179 ? -38.559 80.838 -25.140 1.00 120.59 ? 179 PRO B C     1 
ATOM   4800  O  O     . PRO B 1 179 ? -39.320 81.079 -24.199 1.00 117.48 ? 179 PRO B O     1 
ATOM   4801  C  CB    . PRO B 1 179 ? -39.244 82.253 -27.015 1.00 121.72 ? 179 PRO B CB    1 
ATOM   4802  C  CG    . PRO B 1 179 ? -40.709 82.563 -26.998 1.00 128.58 ? 179 PRO B CG    1 
ATOM   4803  C  CD    . PRO B 1 179 ? -41.435 81.429 -26.362 1.00 122.27 ? 179 PRO B CD    1 
ATOM   4804  N  N     . PRO B 1 180 ? -37.251 80.614 -24.999 1.00 121.72 ? 180 PRO B N     1 
ATOM   4805  C  CA    . PRO B 1 180 ? -36.588 80.663 -23.697 1.00 117.16 ? 180 PRO B CA    1 
ATOM   4806  C  C     . PRO B 1 180 ? -36.702 82.064 -23.118 1.00 114.71 ? 180 PRO B C     1 
ATOM   4807  O  O     . PRO B 1 180 ? -36.919 83.006 -23.882 1.00 116.90 ? 180 PRO B O     1 
ATOM   4808  C  CB    . PRO B 1 180 ? -35.134 80.345 -24.040 1.00 119.80 ? 180 PRO B CB    1 
ATOM   4809  C  CG    . PRO B 1 180 ? -35.200 79.636 -25.352 1.00 126.41 ? 180 PRO B CG    1 
ATOM   4810  C  CD    . PRO B 1 180 ? -36.317 80.299 -26.086 1.00 122.92 ? 180 PRO B CD    1 
ATOM   4811  N  N     . HIS B 1 181 ? -36.575 82.195 -21.799 1.00 113.01 ? 181 HIS B N     1 
ATOM   4812  C  CA    . HIS B 1 181 ? -36.613 83.503 -21.153 1.00 119.73 ? 181 HIS B CA    1 
ATOM   4813  C  C     . HIS B 1 181 ? -35.515 83.663 -20.101 1.00 125.35 ? 181 HIS B C     1 
ATOM   4814  O  O     . HIS B 1 181 ? -34.964 82.681 -19.598 1.00 123.18 ? 181 HIS B O     1 
ATOM   4815  C  CB    . HIS B 1 181 ? -37.988 83.769 -20.538 1.00 119.46 ? 181 HIS B CB    1 
ATOM   4816  C  CG    . HIS B 1 181 ? -39.076 83.942 -21.552 1.00 120.56 ? 181 HIS B CG    1 
ATOM   4817  N  ND1   . HIS B 1 181 ? -39.989 82.952 -21.844 1.00 123.48 ? 181 HIS B ND1   1 
ATOM   4818  C  CD2   . HIS B 1 181 ? -39.386 84.986 -22.355 1.00 115.38 ? 181 HIS B CD2   1 
ATOM   4819  C  CE1   . HIS B 1 181 ? -40.814 83.378 -22.781 1.00 114.83 ? 181 HIS B CE1   1 
ATOM   4820  N  NE2   . HIS B 1 181 ? -40.474 84.612 -23.104 1.00 115.26 ? 181 HIS B NE2   1 
ATOM   4821  N  N     . ASN B 1 182 ? -35.205 84.916 -19.786 1.00 122.31 ? 182 ASN B N     1 
ATOM   4822  C  CA    . ASN B 1 182 ? -34.218 85.284 -18.764 1.00 118.64 ? 182 ASN B CA    1 
ATOM   4823  C  C     . ASN B 1 182 ? -34.616 84.981 -17.321 1.00 123.92 ? 182 ASN B C     1 
ATOM   4824  O  O     . ASN B 1 182 ? -35.411 85.717 -16.749 1.00 118.63 ? 182 ASN B O     1 
ATOM   4825  C  CB    . ASN B 1 182 ? -33.784 86.734 -18.883 1.00 118.03 ? 182 ASN B CB    1 
ATOM   4826  C  CG    . ASN B 1 182 ? -32.689 87.075 -17.908 1.00 132.54 ? 182 ASN B CG    1 
ATOM   4827  O  OD1   . ASN B 1 182 ? -32.441 86.336 -16.950 1.00 135.82 ? 182 ASN B OD1   1 
ATOM   4828  N  ND2   . ASN B 1 182 ? -32.022 88.198 -18.137 1.00 147.00 ? 182 ASN B ND2   1 
ATOM   4829  N  N     . LEU B 1 183 ? -34.130 83.873 -16.762 1.00 127.12 ? 183 LEU B N     1 
ATOM   4830  C  CA    . LEU B 1 183 ? -34.511 83.476 -15.400 1.00 119.47 ? 183 LEU B CA    1 
ATOM   4831  C  C     . LEU B 1 183 ? -34.751 84.648 -14.456 1.00 122.53 ? 183 LEU B C     1 
ATOM   4832  O  O     . LEU B 1 183 ? -35.770 84.677 -13.769 1.00 117.84 ? 183 LEU B O     1 
ATOM   4833  C  CB    . LEU B 1 183 ? -33.483 82.526 -14.766 1.00 111.54 ? 183 LEU B CB    1 
ATOM   4834  C  CG    . LEU B 1 183 ? -33.970 81.967 -13.412 1.00 108.05 ? 183 LEU B CG    1 
ATOM   4835  C  CD1   . LEU B 1 183 ? -33.589 80.505 -13.192 1.00 101.11 ? 183 LEU B CD1   1 
ATOM   4836  C  CD2   . LEU B 1 183 ? -33.531 82.806 -12.239 1.00 106.49 ? 183 LEU B CD2   1 
ATOM   4837  N  N     . ALA B 1 184 ? -33.827 85.607 -14.424 1.00 135.32 ? 184 ALA B N     1 
ATOM   4838  C  CA    . ALA B 1 184 ? -33.978 86.799 -13.584 1.00 128.95 ? 184 ALA B CA    1 
ATOM   4839  C  C     . ALA B 1 184 ? -35.309 87.507 -13.850 1.00 121.20 ? 184 ALA B C     1 
ATOM   4840  O  O     . ALA B 1 184 ? -36.202 87.544 -13.004 1.00 122.03 ? 184 ALA B O     1 
ATOM   4841  C  CB    . ALA B 1 184 ? -32.840 87.760 -13.860 1.00 117.92 ? 184 ALA B CB    1 
ATOM   4842  N  N     . GLU B 1 185 ? -35.435 88.048 -15.051 1.00 116.51 ? 185 GLU B N     1 
ATOM   4843  C  CA    . GLU B 1 185 ? -36.633 88.758 -15.473 1.00 129.93 ? 185 GLU B CA    1 
ATOM   4844  C  C     . GLU B 1 185 ? -37.924 87.971 -15.233 1.00 132.29 ? 185 GLU B C     1 
ATOM   4845  O  O     . GLU B 1 185 ? -38.941 88.540 -14.854 1.00 145.67 ? 185 GLU B O     1 
ATOM   4846  C  CB    . GLU B 1 185 ? -36.480 89.154 -16.943 1.00 132.40 ? 185 GLU B CB    1 
ATOM   4847  C  CG    . GLU B 1 185 ? -35.007 89.358 -17.272 1.00 153.94 ? 185 GLU B CG    1 
ATOM   4848  C  CD    . GLU B 1 185 ? -34.743 90.129 -18.549 1.00 164.43 ? 185 GLU B CD    1 
ATOM   4849  O  OE1   . GLU B 1 185 ? -35.362 89.791 -19.590 1.00 155.97 ? 185 GLU B OE1   1 
ATOM   4850  O  OE2   . GLU B 1 185 ? -33.890 91.059 -18.498 1.00 169.24 ? 185 GLU B OE2   1 
ATOM   4851  N  N     . VAL B 1 186 ? -37.901 86.666 -15.444 1.00 125.41 ? 186 VAL B N     1 
ATOM   4852  C  CA    . VAL B 1 186 ? -39.124 85.910 -15.241 1.00 125.63 ? 186 VAL B CA    1 
ATOM   4853  C  C     . VAL B 1 186 ? -39.571 86.007 -13.803 1.00 124.53 ? 186 VAL B C     1 
ATOM   4854  O  O     . VAL B 1 186 ? -40.708 86.370 -13.510 1.00 127.32 ? 186 VAL B O     1 
ATOM   4855  C  CB    . VAL B 1 186 ? -38.944 84.431 -15.520 1.00 120.50 ? 186 VAL B CB    1 
ATOM   4856  C  CG1   . VAL B 1 186 ? -40.194 83.689 -15.099 1.00 100.69 ? 186 VAL B CG1   1 
ATOM   4857  C  CG2   . VAL B 1 186 ? -38.664 84.216 -16.981 1.00 131.50 ? 186 VAL B CG2   1 
ATOM   4858  N  N     . ILE B 1 187 ? -38.661 85.663 -12.905 1.00 124.92 ? 187 ILE B N     1 
ATOM   4859  C  CA    . ILE B 1 187 ? -38.965 85.651 -11.486 1.00 129.31 ? 187 ILE B CA    1 
ATOM   4860  C  C     . ILE B 1 187 ? -39.466 87.022 -11.038 1.00 131.08 ? 187 ILE B C     1 
ATOM   4861  O  O     . ILE B 1 187 ? -40.359 87.102 -10.203 1.00 137.80 ? 187 ILE B O     1 
ATOM   4862  C  CB    . ILE B 1 187 ? -37.750 85.168 -10.660 1.00 120.74 ? 187 ILE B CB    1 
ATOM   4863  C  CG1   . ILE B 1 187 ? -37.336 83.771 -11.121 1.00 116.04 ? 187 ILE B CG1   1 
ATOM   4864  C  CG2   . ILE B 1 187 ? -38.062 85.144 -9.179  1.00 110.22 ? 187 ILE B CG2   1 
ATOM   4865  C  CD1   . ILE B 1 187 ? -36.230 83.174 -10.307 1.00 119.33 ? 187 ILE B CD1   1 
ATOM   4866  N  N     . ASP B 1 188 ? -38.906 88.093 -11.599 1.00 118.35 ? 188 ASP B N     1 
ATOM   4867  C  CA    . ASP B 1 188 ? -39.405 89.440 -11.319 1.00 132.33 ? 188 ASP B CA    1 
ATOM   4868  C  C     . ASP B 1 188 ? -40.903 89.500 -11.580 1.00 132.12 ? 188 ASP B C     1 
ATOM   4869  O  O     . ASP B 1 188 ? -41.683 89.960 -10.742 1.00 127.03 ? 188 ASP B O     1 
ATOM   4870  C  CB    . ASP B 1 188 ? -38.741 90.469 -12.232 1.00 146.04 ? 188 ASP B CB    1 
ATOM   4871  C  CG    . ASP B 1 188 ? -37.281 90.652 -11.941 1.00 151.43 ? 188 ASP B CG    1 
ATOM   4872  O  OD1   . ASP B 1 188 ? -36.840 90.262 -10.844 1.00 146.73 ? 188 ASP B OD1   1 
ATOM   4873  O  OD2   . ASP B 1 188 ? -36.573 91.196 -12.812 1.00 160.98 ? 188 ASP B OD2   1 
ATOM   4874  N  N     . ALA B 1 189 ? -41.289 89.043 -12.766 1.00 135.38 ? 189 ALA B N     1 
ATOM   4875  C  CA    . ALA B 1 189 ? -42.681 89.032 -13.168 1.00 129.27 ? 189 ALA B CA    1 
ATOM   4876  C  C     . ALA B 1 189 ? -43.478 88.267 -12.127 1.00 129.49 ? 189 ALA B C     1 
ATOM   4877  O  O     . ALA B 1 189 ? -44.479 88.764 -11.608 1.00 129.00 ? 189 ALA B O     1 
ATOM   4878  C  CB    . ALA B 1 189 ? -42.818 88.377 -14.528 1.00 114.76 ? 189 ALA B CB    1 
ATOM   4879  N  N     . ALA B 1 190 ? -43.004 87.065 -11.810 1.00 133.89 ? 190 ALA B N     1 
ATOM   4880  C  CA    . ALA B 1 190 ? -43.657 86.203 -10.828 1.00 135.40 ? 190 ALA B CA    1 
ATOM   4881  C  C     . ALA B 1 190 ? -43.908 86.940 -9.513  1.00 129.19 ? 190 ALA B C     1 
ATOM   4882  O  O     . ALA B 1 190 ? -45.041 87.039 -9.041  1.00 119.65 ? 190 ALA B O     1 
ATOM   4883  C  CB    . ALA B 1 190 ? -42.805 84.950 -10.572 1.00 123.78 ? 190 ALA B CB    1 
ATOM   4884  N  N     . VAL B 1 191 ? -42.847 87.466 -8.923  1.00 118.45 ? 191 VAL B N     1 
ATOM   4885  C  CA    . VAL B 1 191 ? -42.990 88.154 -7.662  1.00 124.21 ? 191 VAL B CA    1 
ATOM   4886  C  C     . VAL B 1 191 ? -43.973 89.312 -7.773  1.00 133.97 ? 191 VAL B C     1 
ATOM   4887  O  O     . VAL B 1 191 ? -44.812 89.497 -6.893  1.00 141.78 ? 191 VAL B O     1 
ATOM   4888  C  CB    . VAL B 1 191 ? -41.644 88.633 -7.139  1.00 132.83 ? 191 VAL B CB    1 
ATOM   4889  C  CG1   . VAL B 1 191 ? -41.757 89.031 -5.672  1.00 133.56 ? 191 VAL B CG1   1 
ATOM   4890  C  CG2   . VAL B 1 191 ? -40.642 87.519 -7.292  1.00 135.98 ? 191 VAL B CG2   1 
ATOM   4891  N  N     . TYR B 1 192 ? -43.888 90.092 -8.845  1.00 141.02 ? 192 TYR B N     1 
ATOM   4892  C  CA    . TYR B 1 192 ? -44.812 91.208 -8.970  1.00 139.47 ? 192 TYR B CA    1 
ATOM   4893  C  C     . TYR B 1 192 ? -46.243 90.706 -8.931  1.00 136.22 ? 192 TYR B C     1 
ATOM   4894  O  O     . TYR B 1 192 ? -47.066 91.242 -8.195  1.00 146.78 ? 192 TYR B O     1 
ATOM   4895  C  CB    . TYR B 1 192 ? -44.584 92.026 -10.232 1.00 141.30 ? 192 TYR B CB    1 
ATOM   4896  C  CG    . TYR B 1 192 ? -45.484 93.249 -10.282 1.00 159.20 ? 192 TYR B CG    1 
ATOM   4897  C  CD1   . TYR B 1 192 ? -46.835 93.133 -10.613 1.00 167.02 ? 192 TYR B CD1   1 
ATOM   4898  C  CD2   . TYR B 1 192 ? -44.994 94.514 -9.983  1.00 159.27 ? 192 TYR B CD2   1 
ATOM   4899  C  CE1   . TYR B 1 192 ? -47.667 94.248 -10.655 1.00 162.53 ? 192 TYR B CE1   1 
ATOM   4900  C  CE2   . TYR B 1 192 ? -45.818 95.634 -10.027 1.00 159.68 ? 192 TYR B CE2   1 
ATOM   4901  C  CZ    . TYR B 1 192 ? -47.151 95.494 -10.365 1.00 156.96 ? 192 TYR B CZ    1 
ATOM   4902  O  OH    . TYR B 1 192 ? -47.967 96.600 -10.410 1.00 151.67 ? 192 TYR B OH    1 
ATOM   4903  N  N     . MET B 1 193 ? -46.539 89.681 -9.723  1.00 126.18 ? 193 MET B N     1 
ATOM   4904  C  CA    . MET B 1 193 ? -47.880 89.094 -9.736  1.00 136.49 ? 193 MET B CA    1 
ATOM   4905  C  C     . MET B 1 193 ? -48.290 88.565 -8.367  1.00 146.35 ? 193 MET B C     1 
ATOM   4906  O  O     . MET B 1 193 ? -49.450 88.683 -7.965  1.00 153.54 ? 193 MET B O     1 
ATOM   4907  C  CB    . MET B 1 193 ? -48.001 87.972 -10.777 1.00 133.55 ? 193 MET B CB    1 
ATOM   4908  C  CG    . MET B 1 193 ? -48.457 88.427 -12.153 1.00 131.09 ? 193 MET B CG    1 
ATOM   4909  S  SD    . MET B 1 193 ? -49.151 87.071 -13.113 1.00 209.85 ? 193 MET B SD    1 
ATOM   4910  C  CE    . MET B 1 193 ? -50.675 86.776 -12.215 1.00 150.85 ? 193 MET B CE    1 
ATOM   4911  N  N     . ILE B 1 194 ? -47.342 87.969 -7.657  1.00 141.40 ? 194 ILE B N     1 
ATOM   4912  C  CA    . ILE B 1 194 ? -47.625 87.442 -6.332  1.00 143.04 ? 194 ILE B CA    1 
ATOM   4913  C  C     . ILE B 1 194 ? -48.256 88.523 -5.463  1.00 144.38 ? 194 ILE B C     1 
ATOM   4914  O  O     . ILE B 1 194 ? -49.213 88.265 -4.736  1.00 153.72 ? 194 ILE B O     1 
ATOM   4915  C  CB    . ILE B 1 194 ? -46.351 86.903 -5.664  1.00 147.30 ? 194 ILE B CB    1 
ATOM   4916  C  CG1   . ILE B 1 194 ? -45.719 85.810 -6.539  1.00 149.63 ? 194 ILE B CG1   1 
ATOM   4917  C  CG2   . ILE B 1 194 ? -46.658 86.392 -4.256  1.00 140.83 ? 194 ILE B CG2   1 
ATOM   4918  C  CD1   . ILE B 1 194 ? -44.330 85.356 -6.089  1.00 147.71 ? 194 ILE B CD1   1 
ATOM   4919  N  N     . ASP B 1 195 ? -47.701 89.728 -5.526  1.00 141.66 ? 195 ASP B N     1 
ATOM   4920  C  CA    . ASP B 1 195 ? -48.276 90.876 -4.834  1.00 150.61 ? 195 ASP B CA    1 
ATOM   4921  C  C     . ASP B 1 195 ? -49.527 91.475 -5.509  1.00 160.60 ? 195 ASP B C     1 
ATOM   4922  O  O     . ASP B 1 195 ? -50.581 91.545 -4.879  1.00 170.70 ? 195 ASP B O     1 
ATOM   4923  C  CB    . ASP B 1 195 ? -47.197 91.929 -4.574  1.00 154.93 ? 195 ASP B CB    1 
ATOM   4924  C  CG    . ASP B 1 195 ? -46.271 91.537 -3.413  1.00 165.75 ? 195 ASP B CG    1 
ATOM   4925  O  OD1   . ASP B 1 195 ? -46.765 90.941 -2.426  1.00 161.23 ? 195 ASP B OD1   1 
ATOM   4926  O  OD2   . ASP B 1 195 ? -45.051 91.817 -3.476  1.00 173.49 ? 195 ASP B OD2   1 
ATOM   4927  N  N     . HIS B 1 196 ? -49.394 91.950 -6.752  1.00 156.31 ? 196 HIS B N     1 
ATOM   4928  C  CA    . HIS B 1 196 ? -50.523 92.464 -7.558  1.00 153.28 ? 196 HIS B CA    1 
ATOM   4929  C  C     . HIS B 1 196 ? -51.135 91.489 -8.578  1.00 140.45 ? 196 HIS B C     1 
ATOM   4930  O  O     . HIS B 1 196 ? -50.917 91.648 -9.777  1.00 124.40 ? 196 HIS B O     1 
ATOM   4931  C  CB    . HIS B 1 196 ? -50.062 93.680 -8.334  1.00 150.06 ? 196 HIS B CB    1 
ATOM   4932  C  CG    . HIS B 1 196 ? -49.211 94.596 -7.528  1.00 156.03 ? 196 HIS B CG    1 
ATOM   4933  N  ND1   . HIS B 1 196 ? -48.040 94.180 -6.935  1.00 168.95 ? 196 HIS B ND1   1 
ATOM   4934  C  CD2   . HIS B 1 196 ? -49.358 95.901 -7.203  1.00 167.54 ? 196 HIS B CD2   1 
ATOM   4935  C  CE1   . HIS B 1 196 ? -47.498 95.191 -6.282  1.00 182.62 ? 196 HIS B CE1   1 
ATOM   4936  N  NE2   . HIS B 1 196 ? -48.276 96.249 -6.430  1.00 184.03 ? 196 HIS B NE2   1 
ATOM   4937  N  N     . PRO B 1 197 ? -51.927 90.509 -8.115  1.00 142.95 ? 197 PRO B N     1 
ATOM   4938  C  CA    . PRO B 1 197 ? -52.461 89.434 -8.960  1.00 140.49 ? 197 PRO B CA    1 
ATOM   4939  C  C     . PRO B 1 197 ? -53.222 89.911 -10.193 1.00 148.78 ? 197 PRO B C     1 
ATOM   4940  O  O     . PRO B 1 197 ? -53.083 89.329 -11.276 1.00 133.76 ? 197 PRO B O     1 
ATOM   4941  C  CB    . PRO B 1 197 ? -53.434 88.732 -8.019  1.00 139.04 ? 197 PRO B CB    1 
ATOM   4942  C  CG    . PRO B 1 197 ? -52.837 88.929 -6.681  1.00 141.60 ? 197 PRO B CG    1 
ATOM   4943  C  CD    . PRO B 1 197 ? -52.334 90.333 -6.712  1.00 150.11 ? 197 PRO B CD    1 
ATOM   4944  N  N     . THR B 1 198 ? -54.029 90.952 -10.020 1.00 171.45 ? 198 THR B N     1 
ATOM   4945  C  CA    . THR B 1 198 ? -54.847 91.488 -11.107 1.00 179.23 ? 198 THR B CA    1 
ATOM   4946  C  C     . THR B 1 198 ? -54.001 92.223 -12.150 1.00 171.43 ? 198 THR B C     1 
ATOM   4947  O  O     . THR B 1 198 ? -54.468 93.180 -12.775 1.00 169.13 ? 198 THR B O     1 
ATOM   4948  C  CB    . THR B 1 198 ? -55.887 92.467 -10.534 1.00 184.16 ? 198 THR B CB    1 
ATOM   4949  O  OG1   . THR B 1 198 ? -55.392 93.005 -9.294  1.00 177.74 ? 198 THR B OG1   1 
ATOM   4950  C  CG2   . THR B 1 198 ? -57.210 91.748 -10.283 1.00 185.67 ? 198 THR B CG2   1 
ATOM   4951  N  N     . ALA B 1 199 ? -52.765 91.762 -12.335 1.00 150.49 ? 199 ALA B N     1 
ATOM   4952  C  CA    . ALA B 1 199 ? -51.777 92.485 -13.127 1.00 131.27 ? 199 ALA B CA    1 
ATOM   4953  C  C     . ALA B 1 199 ? -52.073 92.472 -14.622 1.00 146.98 ? 199 ALA B C     1 
ATOM   4954  O  O     . ALA B 1 199 ? -52.444 91.441 -15.193 1.00 150.26 ? 199 ALA B O     1 
ATOM   4955  C  CB    . ALA B 1 199 ? -50.388 91.946 -12.850 1.00 122.35 ? 199 ALA B CB    1 
ATOM   4956  N  N     . LYS B 1 200 ? -51.914 93.632 -15.250 1.00 159.36 ? 200 LYS B N     1 
ATOM   4957  C  CA    . LYS B 1 200 ? -52.100 93.756 -16.688 1.00 160.44 ? 200 LYS B CA    1 
ATOM   4958  C  C     . LYS B 1 200 ? -50.780 93.441 -17.386 1.00 150.61 ? 200 LYS B C     1 
ATOM   4959  O  O     . LYS B 1 200 ? -49.704 93.621 -16.806 1.00 140.26 ? 200 LYS B O     1 
ATOM   4960  C  CB    . LYS B 1 200 ? -52.591 95.170 -17.043 1.00 159.59 ? 200 LYS B CB    1 
ATOM   4961  N  N     . ILE B 1 201 ? -50.864 92.967 -18.625 1.00 143.17 ? 201 ILE B N     1 
ATOM   4962  C  CA    . ILE B 1 201 ? -49.674 92.600 -19.385 1.00 142.58 ? 201 ILE B CA    1 
ATOM   4963  C  C     . ILE B 1 201 ? -48.675 93.737 -19.559 1.00 153.64 ? 201 ILE B C     1 
ATOM   4964  O  O     . ILE B 1 201 ? -47.473 93.530 -19.443 1.00 150.58 ? 201 ILE B O     1 
ATOM   4965  C  CB    . ILE B 1 201 ? -50.032 92.110 -20.774 1.00 141.89 ? 201 ILE B CB    1 
ATOM   4966  C  CG1   . ILE B 1 201 ? -50.524 90.677 -20.705 1.00 160.26 ? 201 ILE B CG1   1 
ATOM   4967  C  CG2   . ILE B 1 201 ? -48.820 92.172 -21.696 1.00 133.59 ? 201 ILE B CG2   1 
ATOM   4968  C  CD1   . ILE B 1 201 ? -50.321 89.937 -22.010 1.00 173.81 ? 201 ILE B CD1   1 
ATOM   4969  N  N     . ASP B 1 202 ? -49.170 94.934 -19.843 1.00 166.85 ? 202 ASP B N     1 
ATOM   4970  C  CA    . ASP B 1 202 ? -48.290 96.083 -20.021 1.00 178.72 ? 202 ASP B CA    1 
ATOM   4971  C  C     . ASP B 1 202 ? -47.288 96.221 -18.869 1.00 166.11 ? 202 ASP B C     1 
ATOM   4972  O  O     . ASP B 1 202 ? -46.090 96.382 -19.098 1.00 156.58 ? 202 ASP B O     1 
ATOM   4973  C  CB    . ASP B 1 202 ? -49.109 97.365 -20.172 1.00 197.98 ? 202 ASP B CB    1 
ATOM   4974  C  CG    . ASP B 1 202 ? -50.029 97.328 -21.376 1.00 205.13 ? 202 ASP B CG    1 
ATOM   4975  O  OD1   . ASP B 1 202 ? -49.746 96.555 -22.319 1.00 199.02 ? 202 ASP B OD1   1 
ATOM   4976  O  OD2   . ASP B 1 202 ? -51.030 98.077 -21.377 1.00 210.45 ? 202 ASP B OD2   1 
ATOM   4977  N  N     . LYS B 1 203 ? -47.779 96.170 -17.635 1.00 158.68 ? 203 LYS B N     1 
ATOM   4978  C  CA    . LYS B 1 203 ? -46.901 96.262 -16.470 1.00 162.92 ? 203 LYS B CA    1 
ATOM   4979  C  C     . LYS B 1 203 ? -45.976 95.054 -16.355 1.00 165.40 ? 203 LYS B C     1 
ATOM   4980  O  O     . LYS B 1 203 ? -44.802 95.195 -16.012 1.00 177.70 ? 203 LYS B O     1 
ATOM   4981  C  CB    . LYS B 1 203 ? -47.685 96.461 -15.164 1.00 159.91 ? 203 LYS B CB    1 
ATOM   4982  N  N     . LEU B 1 204 ? -46.507 93.862 -16.607 1.00 151.10 ? 204 LEU B N     1 
ATOM   4983  C  CA    . LEU B 1 204 ? -45.693 92.655 -16.493 1.00 138.31 ? 204 LEU B CA    1 
ATOM   4984  C  C     . LEU B 1 204 ? -44.528 92.727 -17.458 1.00 142.73 ? 204 LEU B C     1 
ATOM   4985  O  O     . LEU B 1 204 ? -43.435 92.251 -17.164 1.00 153.08 ? 204 LEU B O     1 
ATOM   4986  C  CB    . LEU B 1 204 ? -46.518 91.407 -16.763 1.00 122.89 ? 204 LEU B CB    1 
ATOM   4987  C  CG    . LEU B 1 204 ? -47.347 90.919 -15.584 1.00 134.65 ? 204 LEU B CG    1 
ATOM   4988  C  CD1   . LEU B 1 204 ? -48.257 89.788 -16.022 1.00 148.06 ? 204 LEU B CD1   1 
ATOM   4989  C  CD2   . LEU B 1 204 ? -46.437 90.476 -14.457 1.00 135.60 ? 204 LEU B CD2   1 
ATOM   4990  N  N     . MET B 1 205 ? -44.785 93.325 -18.614 1.00 130.96 ? 205 MET B N     1 
ATOM   4991  C  CA    . MET B 1 205 ? -43.794 93.491 -19.666 1.00 130.79 ? 205 MET B CA    1 
ATOM   4992  C  C     . MET B 1 205 ? -42.588 94.301 -19.214 1.00 145.89 ? 205 MET B C     1 
ATOM   4993  O  O     . MET B 1 205 ? -41.477 94.086 -19.694 1.00 147.53 ? 205 MET B O     1 
ATOM   4994  C  CB    . MET B 1 205 ? -44.454 94.134 -20.866 1.00 133.41 ? 205 MET B CB    1 
ATOM   4995  C  CG    . MET B 1 205 ? -45.326 93.179 -21.601 1.00 111.22 ? 205 MET B CG    1 
ATOM   4996  S  SD    . MET B 1 205 ? -44.304 92.344 -22.798 1.00 172.13 ? 205 MET B SD    1 
ATOM   4997  C  CE    . MET B 1 205 ? -44.982 93.058 -24.290 1.00 96.47  ? 205 MET B CE    1 
ATOM   4998  N  N     . GLU B 1 206 ? -42.818 95.251 -18.313 1.00 160.39 ? 206 GLU B N     1 
ATOM   4999  C  CA    . GLU B 1 206 ? -41.733 95.997 -17.686 1.00 165.74 ? 206 GLU B CA    1 
ATOM   5000  C  C     . GLU B 1 206 ? -40.733 95.039 -17.049 1.00 159.50 ? 206 GLU B C     1 
ATOM   5001  O  O     . GLU B 1 206 ? -39.527 95.293 -17.074 1.00 164.01 ? 206 GLU B O     1 
ATOM   5002  C  CB    . GLU B 1 206 ? -42.260 96.999 -16.650 1.00 165.60 ? 206 GLU B CB    1 
ATOM   5003  N  N     . PHE B 1 207 ? -41.239 93.962 -16.446 1.00 149.68 ? 207 PHE B N     1 
ATOM   5004  C  CA    . PHE B 1 207 ? -40.386 92.869 -15.959 1.00 154.71 ? 207 PHE B CA    1 
ATOM   5005  C  C     . PHE B 1 207 ? -39.935 91.852 -17.036 1.00 149.91 ? 207 PHE B C     1 
ATOM   5006  O  O     . PHE B 1 207 ? -38.758 91.817 -17.392 1.00 140.71 ? 207 PHE B O     1 
ATOM   5007  C  CB    . PHE B 1 207 ? -41.056 92.166 -14.774 1.00 159.26 ? 207 PHE B CB    1 
ATOM   5008  C  CG    . PHE B 1 207 ? -41.301 93.079 -13.605 1.00 162.42 ? 207 PHE B CG    1 
ATOM   5009  C  CD1   . PHE B 1 207 ? -42.504 93.761 -13.482 1.00 151.81 ? 207 PHE B CD1   1 
ATOM   5010  C  CD2   . PHE B 1 207 ? -40.312 93.285 -12.646 1.00 162.08 ? 207 PHE B CD2   1 
ATOM   5011  C  CE1   . PHE B 1 207 ? -42.720 94.611 -12.412 1.00 143.14 ? 207 PHE B CE1   1 
ATOM   5012  C  CE2   . PHE B 1 207 ? -40.523 94.140 -11.581 1.00 152.63 ? 207 PHE B CE2   1 
ATOM   5013  C  CZ    . PHE B 1 207 ? -41.727 94.804 -11.465 1.00 145.59 ? 207 PHE B CZ    1 
ATOM   5014  N  N     . LEU B 1 208 ? -40.848 91.000 -17.510 1.00 155.00 ? 208 LEU B N     1 
ATOM   5015  C  CA    . LEU B 1 208 ? -40.579 90.116 -18.658 1.00 158.42 ? 208 LEU B CA    1 
ATOM   5016  C  C     . LEU B 1 208 ? -40.859 90.831 -19.993 1.00 155.90 ? 208 LEU B C     1 
ATOM   5017  O  O     . LEU B 1 208 ? -41.997 90.849 -20.468 1.00 162.62 ? 208 LEU B O     1 
ATOM   5018  C  CB    . LEU B 1 208 ? -41.340 88.756 -18.578 1.00 94.88  ? 208 LEU B CB    1 
ATOM   5019  N  N     . PRO B 1 209 ? -39.817 91.417 -20.605 1.00 138.31 ? 209 PRO B N     1 
ATOM   5020  C  CA    . PRO B 1 209 ? -39.919 92.194 -21.842 1.00 130.42 ? 209 PRO B CA    1 
ATOM   5021  C  C     . PRO B 1 209 ? -39.746 91.363 -23.100 1.00 136.34 ? 209 PRO B C     1 
ATOM   5022  O  O     . PRO B 1 209 ? -39.367 91.916 -24.123 1.00 146.68 ? 209 PRO B O     1 
ATOM   5023  C  CB    . PRO B 1 209 ? -38.708 93.132 -21.753 1.00 126.46 ? 209 PRO B CB    1 
ATOM   5024  C  CG    . PRO B 1 209 ? -38.052 92.857 -20.414 1.00 120.37 ? 209 PRO B CG    1 
ATOM   5025  C  CD    . PRO B 1 209 ? -38.465 91.493 -20.039 1.00 128.94 ? 209 PRO B CD    1 
ATOM   5026  N  N     . GLY B 1 210 ? -39.989 90.063 -23.040 1.00 137.85 ? 210 GLY B N     1 
ATOM   5027  C  CA    . GLY B 1 210 ? -39.764 89.238 -24.211 1.00 141.95 ? 210 GLY B CA    1 
ATOM   5028  C  C     . GLY B 1 210 ? -38.615 88.261 -24.052 1.00 138.50 ? 210 GLY B C     1 
ATOM   5029  O  O     . GLY B 1 210 ? -37.834 88.353 -23.108 1.00 144.44 ? 210 GLY B O     1 
ATOM   5030  N  N     . PRO B 1 211 ? -38.499 87.328 -25.002 1.00 127.94 ? 211 PRO B N     1 
ATOM   5031  C  CA    . PRO B 1 211 ? -37.617 86.156 -24.977 1.00 127.79 ? 211 PRO B CA    1 
ATOM   5032  C  C     . PRO B 1 211 ? -36.159 86.482 -24.706 1.00 126.89 ? 211 PRO B C     1 
ATOM   5033  O  O     . PRO B 1 211 ? -35.724 87.592 -24.974 1.00 130.27 ? 211 PRO B O     1 
ATOM   5034  C  CB    . PRO B 1 211 ? -37.731 85.611 -26.405 1.00 132.59 ? 211 PRO B CB    1 
ATOM   5035  C  CG    . PRO B 1 211 ? -39.023 86.124 -26.913 1.00 133.49 ? 211 PRO B CG    1 
ATOM   5036  C  CD    . PRO B 1 211 ? -39.229 87.450 -26.272 1.00 128.27 ? 211 PRO B CD    1 
ATOM   5037  N  N     . ASP B 1 212 ? -35.417 85.508 -24.191 1.00 129.64 ? 212 ASP B N     1 
ATOM   5038  C  CA    . ASP B 1 212 ? -33.964 85.605 -24.120 1.00 140.16 ? 212 ASP B CA    1 
ATOM   5039  C  C     . ASP B 1 212 ? -33.332 84.329 -24.684 1.00 149.40 ? 212 ASP B C     1 
ATOM   5040  O  O     . ASP B 1 212 ? -33.288 83.299 -24.009 1.00 148.21 ? 212 ASP B O     1 
ATOM   5041  C  CB    . ASP B 1 212 ? -33.492 85.847 -22.683 1.00 143.09 ? 212 ASP B CB    1 
ATOM   5042  C  CG    . ASP B 1 212 ? -32.077 86.434 -22.619 1.00 142.04 ? 212 ASP B CG    1 
ATOM   5043  O  OD1   . ASP B 1 212 ? -31.601 86.951 -23.658 1.00 139.80 ? 212 ASP B OD1   1 
ATOM   5044  O  OD2   . ASP B 1 212 ? -31.445 86.390 -21.532 1.00 136.64 ? 212 ASP B OD2   1 
ATOM   5045  N  N     . PHE B 1 213 ? -32.853 84.400 -25.925 1.00 155.88 ? 213 PHE B N     1 
ATOM   5046  C  CA    . PHE B 1 213 ? -32.252 83.237 -26.581 1.00 141.18 ? 213 PHE B CA    1 
ATOM   5047  C  C     . PHE B 1 213 ? -30.826 83.008 -26.105 1.00 130.73 ? 213 PHE B C     1 
ATOM   5048  O  O     . PHE B 1 213 ? -30.047 83.954 -25.990 1.00 121.79 ? 213 PHE B O     1 
ATOM   5049  C  CB    . PHE B 1 213 ? -32.274 83.371 -28.108 1.00 131.93 ? 213 PHE B CB    1 
ATOM   5050  C  CG    . PHE B 1 213 ? -33.653 83.444 -28.691 1.00 123.44 ? 213 PHE B CG    1 
ATOM   5051  C  CD1   . PHE B 1 213 ? -34.541 82.399 -28.531 1.00 129.87 ? 213 PHE B CD1   1 
ATOM   5052  C  CD2   . PHE B 1 213 ? -34.061 84.558 -29.399 1.00 119.05 ? 213 PHE B CD2   1 
ATOM   5053  C  CE1   . PHE B 1 213 ? -35.817 82.461 -29.071 1.00 137.37 ? 213 PHE B CE1   1 
ATOM   5054  C  CE2   . PHE B 1 213 ? -35.335 84.631 -29.937 1.00 122.34 ? 213 PHE B CE2   1 
ATOM   5055  C  CZ    . PHE B 1 213 ? -36.216 83.581 -29.775 1.00 129.48 ? 213 PHE B CZ    1 
ATOM   5056  N  N     . PRO B 1 214 ? -30.483 81.740 -25.836 1.00 130.16 ? 214 PRO B N     1 
ATOM   5057  C  CA    . PRO B 1 214 ? -29.163 81.348 -25.338 1.00 123.85 ? 214 PRO B CA    1 
ATOM   5058  C  C     . PRO B 1 214 ? -28.123 81.629 -26.403 1.00 137.43 ? 214 PRO B C     1 
ATOM   5059  O  O     . PRO B 1 214 ? -26.932 81.694 -26.109 1.00 148.49 ? 214 PRO B O     1 
ATOM   5060  C  CB    . PRO B 1 214 ? -29.291 79.837 -25.159 1.00 110.15 ? 214 PRO B CB    1 
ATOM   5061  C  CG    . PRO B 1 214 ? -30.755 79.543 -25.238 1.00 107.18 ? 214 PRO B CG    1 
ATOM   5062  C  CD    . PRO B 1 214 ? -31.312 80.568 -26.148 1.00 122.44 ? 214 PRO B CD    1 
ATOM   5063  N  N     . THR B 1 215 ? -28.587 81.789 -27.637 1.00 133.69 ? 215 THR B N     1 
ATOM   5064  C  CA    . THR B 1 215 ? -27.706 82.012 -28.767 1.00 134.49 ? 215 THR B CA    1 
ATOM   5065  C  C     . THR B 1 215 ? -27.509 83.497 -28.999 1.00 143.81 ? 215 THR B C     1 
ATOM   5066  O  O     . THR B 1 215 ? -26.998 83.910 -30.040 1.00 152.02 ? 215 THR B O     1 
ATOM   5067  C  CB    . THR B 1 215 ? -28.329 81.455 -30.005 1.00 131.88 ? 215 THR B CB    1 
ATOM   5068  O  OG1   . THR B 1 215 ? -29.550 82.164 -30.249 1.00 147.78 ? 215 THR B OG1   1 
ATOM   5069  C  CG2   . THR B 1 215 ? -28.624 79.987 -29.805 1.00 115.84 ? 215 THR B CG2   1 
ATOM   5070  N  N     . GLY B 1 216 ? -27.928 84.298 -28.027 1.00 140.88 ? 216 GLY B N     1 
ATOM   5071  C  CA    . GLY B 1 216 ? -27.830 85.738 -28.139 1.00 140.88 ? 216 GLY B CA    1 
ATOM   5072  C  C     . GLY B 1 216 ? -28.812 86.266 -29.154 1.00 129.69 ? 216 GLY B C     1 
ATOM   5073  O  O     . GLY B 1 216 ? -29.992 85.931 -29.097 1.00 130.25 ? 216 GLY B O     1 
ATOM   5074  N  N     . ALA B 1 217 ? -28.320 87.102 -30.065 1.00 130.76 ? 217 ALA B N     1 
ATOM   5075  C  CA    . ALA B 1 217 ? -29.110 87.617 -31.193 1.00 148.21 ? 217 ALA B CA    1 
ATOM   5076  C  C     . ALA B 1 217 ? -29.944 88.874 -30.910 1.00 141.86 ? 217 ALA B C     1 
ATOM   5077  O  O     . ALA B 1 217 ? -30.052 89.333 -29.771 1.00 142.00 ? 217 ALA B O     1 
ATOM   5078  C  CB    . ALA B 1 217 ? -29.971 86.516 -31.808 1.00 164.84 ? 217 ALA B CB    1 
ATOM   5079  N  N     . ILE B 1 218 ? -30.522 89.426 -31.968 1.00 137.13 ? 218 ILE B N     1 
ATOM   5080  C  CA    . ILE B 1 218 ? -31.312 90.640 -31.861 1.00 146.30 ? 218 ILE B CA    1 
ATOM   5081  C  C     . ILE B 1 218 ? -32.780 90.345 -32.138 1.00 148.74 ? 218 ILE B C     1 
ATOM   5082  O  O     . ILE B 1 218 ? -33.111 89.700 -33.133 1.00 148.79 ? 218 ILE B O     1 
ATOM   5083  C  CB    . ILE B 1 218 ? -30.843 91.670 -32.889 1.00 147.49 ? 218 ILE B CB    1 
ATOM   5084  C  CG1   . ILE B 1 218 ? -29.330 91.885 -32.788 1.00 156.23 ? 218 ILE B CG1   1 
ATOM   5085  C  CG2   . ILE B 1 218 ? -31.611 92.959 -32.712 1.00 145.10 ? 218 ILE B CG2   1 
ATOM   5086  C  CD1   . ILE B 1 218 ? -28.752 92.782 -33.892 1.00 163.41 ? 218 ILE B CD1   1 
ATOM   5087  N  N     . ILE B 1 219 ? -33.662 90.832 -31.269 1.00 142.17 ? 219 ILE B N     1 
ATOM   5088  C  CA    . ILE B 1 219 ? -35.088 90.562 -31.403 1.00 137.19 ? 219 ILE B CA    1 
ATOM   5089  C  C     . ILE B 1 219 ? -35.844 91.851 -31.587 1.00 141.38 ? 219 ILE B C     1 
ATOM   5090  O  O     . ILE B 1 219 ? -35.828 92.707 -30.712 1.00 148.83 ? 219 ILE B O     1 
ATOM   5091  C  CB    . ILE B 1 219 ? -35.703 89.939 -30.153 1.00 132.01 ? 219 ILE B CB    1 
ATOM   5092  C  CG1   . ILE B 1 219 ? -35.217 88.507 -29.923 1.00 130.28 ? 219 ILE B CG1   1 
ATOM   5093  C  CG2   . ILE B 1 219 ? -37.197 89.939 -30.309 1.00 129.52 ? 219 ILE B CG2   1 
ATOM   5094  C  CD1   . ILE B 1 219 ? -35.812 87.868 -28.675 1.00 118.79 ? 219 ILE B CD1   1 
ATOM   5095  N  N     . GLN B 1 220 ? -36.534 91.975 -32.710 1.00 146.56 ? 220 GLN B N     1 
ATOM   5096  C  CA    . GLN B 1 220 ? -37.264 93.194 -33.009 1.00 158.93 ? 220 GLN B CA    1 
ATOM   5097  C  C     . GLN B 1 220 ? -38.710 92.835 -33.275 1.00 172.63 ? 220 GLN B C     1 
ATOM   5098  O  O     . GLN B 1 220 ? -39.008 92.009 -34.143 1.00 171.76 ? 220 GLN B O     1 
ATOM   5099  C  CB    . GLN B 1 220 ? -36.659 93.925 -34.220 1.00 148.41 ? 220 GLN B CB    1 
ATOM   5100  N  N     . GLY B 1 221 ? -39.606 93.447 -32.511 1.00 176.87 ? 221 GLY B N     1 
ATOM   5101  C  CA    . GLY B 1 221 ? -41.025 93.239 -32.707 1.00 176.68 ? 221 GLY B CA    1 
ATOM   5102  C  C     . GLY B 1 221 ? -41.806 93.430 -31.428 1.00 172.02 ? 221 GLY B C     1 
ATOM   5103  O  O     . GLY B 1 221 ? -42.629 92.594 -31.069 1.00 175.99 ? 221 GLY B O     1 
ATOM   5104  N  N     . ARG B 1 222 ? -41.544 94.531 -30.735 1.00 165.62 ? 222 ARG B N     1 
ATOM   5105  C  CA    . ARG B 1 222 ? -42.258 94.826 -29.503 1.00 164.38 ? 222 ARG B CA    1 
ATOM   5106  C  C     . ARG B 1 222 ? -43.750 94.524 -29.647 1.00 169.40 ? 222 ARG B C     1 
ATOM   5107  O  O     . ARG B 1 222 ? -44.324 93.796 -28.831 1.00 157.03 ? 222 ARG B O     1 
ATOM   5108  C  CB    . ARG B 1 222 ? -42.038 96.281 -29.075 1.00 162.39 ? 222 ARG B CB    1 
ATOM   5109  N  N     . ASP B 1 223 ? -44.363 95.065 -30.700 1.00 178.05 ? 223 ASP B N     1 
ATOM   5110  C  CA    . ASP B 1 223 ? -45.815 94.985 -30.883 1.00 170.31 ? 223 ASP B CA    1 
ATOM   5111  C  C     . ASP B 1 223 ? -46.340 93.546 -30.884 1.00 162.29 ? 223 ASP B C     1 
ATOM   5112  O  O     . ASP B 1 223 ? -47.213 93.202 -30.084 1.00 154.14 ? 223 ASP B O     1 
ATOM   5113  C  CB    . ASP B 1 223 ? -46.252 95.731 -32.154 1.00 162.64 ? 223 ASP B CB    1 
ATOM   5114  N  N     . GLU B 1 224 ? -45.814 92.715 -31.781 1.00 156.52 ? 224 GLU B N     1 
ATOM   5115  C  CA    . GLU B 1 224 ? -46.212 91.306 -31.851 1.00 147.34 ? 224 GLU B CA    1 
ATOM   5116  C  C     . GLU B 1 224 ? -45.837 90.483 -30.595 1.00 154.61 ? 224 GLU B C     1 
ATOM   5117  O  O     . GLU B 1 224 ? -46.493 89.491 -30.287 1.00 152.73 ? 224 GLU B O     1 
ATOM   5118  C  CB    . GLU B 1 224 ? -45.712 90.639 -33.143 1.00 122.94 ? 224 GLU B CB    1 
ATOM   5119  N  N     . ILE B 1 225 ? -44.776 90.871 -29.887 1.00 153.54 ? 225 ILE B N     1 
ATOM   5120  C  CA    . ILE B 1 225 ? -44.418 90.197 -28.636 1.00 140.44 ? 225 ILE B CA    1 
ATOM   5121  C  C     . ILE B 1 225 ? -45.517 90.333 -27.603 1.00 134.77 ? 225 ILE B C     1 
ATOM   5122  O  O     . ILE B 1 225 ? -45.834 89.382 -26.889 1.00 126.86 ? 225 ILE B O     1 
ATOM   5123  C  CB    . ILE B 1 225 ? -43.165 90.763 -27.981 1.00 130.82 ? 225 ILE B CB    1 
ATOM   5124  C  CG1   . ILE B 1 225 ? -41.938 90.514 -28.854 1.00 125.21 ? 225 ILE B CG1   1 
ATOM   5125  C  CG2   . ILE B 1 225 ? -42.978 90.133 -26.592 1.00 110.63 ? 225 ILE B CG2   1 
ATOM   5126  C  CD1   . ILE B 1 225 ? -40.650 90.722 -28.111 1.00 116.81 ? 225 ILE B CD1   1 
ATOM   5127  N  N     . LYS B 1 226 ? -46.073 91.534 -27.499 1.00 137.49 ? 226 LYS B N     1 
ATOM   5128  C  CA    . LYS B 1 226 ? -47.238 91.732 -26.656 1.00 143.76 ? 226 LYS B CA    1 
ATOM   5129  C  C     . LYS B 1 226 ? -48.338 90.775 -27.122 1.00 138.87 ? 226 LYS B C     1 
ATOM   5130  O  O     . LYS B 1 226 ? -48.903 90.032 -26.318 1.00 118.51 ? 226 LYS B O     1 
ATOM   5131  C  CB    . LYS B 1 226 ? -47.718 93.195 -26.689 1.00 136.05 ? 226 LYS B CB    1 
ATOM   5132  N  N     . LYS B 1 227 ? -48.622 90.773 -28.423 1.00 136.73 ? 227 LYS B N     1 
ATOM   5133  C  CA    . LYS B 1 227 ? -49.683 89.921 -28.956 1.00 136.26 ? 227 LYS B CA    1 
ATOM   5134  C  C     . LYS B 1 227 ? -49.486 88.503 -28.451 1.00 139.04 ? 227 LYS B C     1 
ATOM   5135  O  O     . LYS B 1 227 ? -50.421 87.865 -27.981 1.00 130.88 ? 227 LYS B O     1 
ATOM   5136  C  CB    . LYS B 1 227 ? -49.719 89.942 -30.493 1.00 119.07 ? 227 LYS B CB    1 
ATOM   5137  N  N     . ALA B 1 228 ? -48.249 88.029 -28.543 1.00 146.08 ? 228 ALA B N     1 
ATOM   5138  C  CA    . ALA B 1 228 ? -47.888 86.694 -28.094 1.00 138.49 ? 228 ALA B CA    1 
ATOM   5139  C  C     . ALA B 1 228 ? -48.167 86.520 -26.609 1.00 136.58 ? 228 ALA B C     1 
ATOM   5140  O  O     . ALA B 1 228 ? -48.831 85.570 -26.202 1.00 135.90 ? 228 ALA B O     1 
ATOM   5141  C  CB    . ALA B 1 228 ? -46.434 86.452 -28.375 1.00 132.26 ? 228 ALA B CB    1 
ATOM   5142  N  N     . TYR B 1 229 ? -47.646 87.436 -25.800 1.00 129.01 ? 229 TYR B N     1 
ATOM   5143  C  CA    . TYR B 1 229 ? -47.855 87.383 -24.357 1.00 134.25 ? 229 TYR B CA    1 
ATOM   5144  C  C     . TYR B 1 229 ? -49.328 87.439 -23.931 1.00 143.55 ? 229 TYR B C     1 
ATOM   5145  O  O     . TYR B 1 229 ? -49.698 86.834 -22.924 1.00 153.96 ? 229 TYR B O     1 
ATOM   5146  C  CB    . TYR B 1 229 ? -47.029 88.437 -23.614 1.00 133.67 ? 229 TYR B CB    1 
ATOM   5147  C  CG    . TYR B 1 229 ? -45.553 88.108 -23.521 1.00 127.51 ? 229 TYR B CG    1 
ATOM   5148  C  CD1   . TYR B 1 229 ? -45.068 86.868 -23.932 1.00 122.66 ? 229 TYR B CD1   1 
ATOM   5149  C  CD2   . TYR B 1 229 ? -44.643 89.028 -22.997 1.00 124.45 ? 229 TYR B CD2   1 
ATOM   5150  C  CE1   . TYR B 1 229 ? -43.708 86.560 -23.849 1.00 127.72 ? 229 TYR B CE1   1 
ATOM   5151  C  CE2   . TYR B 1 229 ? -43.285 88.733 -22.904 1.00 128.11 ? 229 TYR B CE2   1 
ATOM   5152  C  CZ    . TYR B 1 229 ? -42.823 87.499 -23.333 1.00 135.83 ? 229 TYR B CZ    1 
ATOM   5153  O  OH    . TYR B 1 229 ? -41.483 87.196 -23.241 1.00 137.33 ? 229 TYR B OH    1 
ATOM   5154  N  N     . GLU B 1 230 ? -50.156 88.188 -24.655 1.00 136.19 ? 230 GLU B N     1 
ATOM   5155  C  CA    . GLU B 1 230 ? -51.601 88.176 -24.397 1.00 137.58 ? 230 GLU B CA    1 
ATOM   5156  C  C     . GLU B 1 230 ? -52.307 86.921 -24.946 1.00 139.45 ? 230 GLU B C     1 
ATOM   5157  O  O     . GLU B 1 230 ? -52.889 86.143 -24.193 1.00 142.85 ? 230 GLU B O     1 
ATOM   5158  C  CB    . GLU B 1 230 ? -52.277 89.464 -24.905 1.00 129.95 ? 230 GLU B CB    1 
ATOM   5159  N  N     . THR B 1 231 ? -52.258 86.742 -26.261 1.00 130.24 ? 231 THR B N     1 
ATOM   5160  C  CA    . THR B 1 231 ? -52.977 85.671 -26.945 1.00 136.12 ? 231 THR B CA    1 
ATOM   5161  C  C     . THR B 1 231 ? -52.367 84.274 -26.828 1.00 136.67 ? 231 THR B C     1 
ATOM   5162  O  O     . THR B 1 231 ? -53.083 83.288 -26.656 1.00 135.91 ? 231 THR B O     1 
ATOM   5163  C  CB    . THR B 1 231 ? -53.103 85.977 -28.434 1.00 156.74 ? 231 THR B CB    1 
ATOM   5164  O  OG1   . THR B 1 231 ? -51.829 85.814 -29.071 1.00 161.89 ? 231 THR B OG1   1 
ATOM   5165  C  CG2   . THR B 1 231 ? -53.573 87.397 -28.620 1.00 171.94 ? 231 THR B CG2   1 
ATOM   5166  N  N     . GLY B 1 232 ? -51.051 84.185 -26.971 1.00 135.87 ? 232 GLY B N     1 
ATOM   5167  C  CA    . GLY B 1 232 ? -50.379 82.898 -27.004 1.00 131.43 ? 232 GLY B CA    1 
ATOM   5168  C  C     . GLY B 1 232 ? -49.721 82.607 -28.343 1.00 125.10 ? 232 GLY B C     1 
ATOM   5169  O  O     . GLY B 1 232 ? -48.837 81.749 -28.439 1.00 112.91 ? 232 GLY B O     1 
ATOM   5170  N  N     . LYS B 1 233 ? -50.167 83.315 -29.379 1.00 127.11 ? 233 LYS B N     1 
ATOM   5171  C  CA    . LYS B 1 233 ? -49.571 83.229 -30.712 1.00 122.28 ? 233 LYS B CA    1 
ATOM   5172  C  C     . LYS B 1 233 ? -49.020 84.596 -31.120 1.00 126.91 ? 233 LYS B C     1 
ATOM   5173  O  O     . LYS B 1 233 ? -49.611 85.628 -30.802 1.00 135.71 ? 233 LYS B O     1 
ATOM   5174  C  CB    . LYS B 1 233 ? -50.601 82.713 -31.743 1.00 112.80 ? 233 LYS B CB    1 
ATOM   5175  C  CG    . LYS B 1 233 ? -50.583 81.189 -31.964 1.00 115.63 ? 233 LYS B CG    1 
ATOM   5176  C  CD    . LYS B 1 233 ? -51.705 80.677 -32.890 1.00 110.34 ? 233 LYS B CD    1 
ATOM   5177  N  N     . GLY B 1 234 ? -47.864 84.602 -31.776 1.00 122.55 ? 234 GLY B N     1 
ATOM   5178  C  CA    . GLY B 1 234 ? -47.285 85.827 -32.297 1.00 127.82 ? 234 GLY B CA    1 
ATOM   5179  C  C     . GLY B 1 234 ? -46.091 85.556 -33.194 1.00 141.44 ? 234 GLY B C     1 
ATOM   5180  O  O     . GLY B 1 234 ? -45.463 84.507 -33.091 1.00 146.34 ? 234 GLY B O     1 
ATOM   5181  N  N     . ARG B 1 235 ? -45.762 86.490 -34.079 1.00 145.70 ? 235 ARG B N     1 
ATOM   5182  C  CA    . ARG B 1 235 ? -44.534 86.347 -34.863 1.00 140.18 ? 235 ARG B CA    1 
ATOM   5183  C  C     . ARG B 1 235 ? -43.575 87.506 -34.602 1.00 150.45 ? 235 ARG B C     1 
ATOM   5184  O  O     . ARG B 1 235 ? -43.968 88.674 -34.580 1.00 147.28 ? 235 ARG B O     1 
ATOM   5185  C  CB    . ARG B 1 235 ? -44.797 86.142 -36.368 1.00 116.08 ? 235 ARG B CB    1 
ATOM   5186  N  N     . VAL B 1 236 ? -42.313 87.150 -34.401 1.00 153.41 ? 236 VAL B N     1 
ATOM   5187  C  CA    . VAL B 1 236 ? -41.270 88.078 -33.995 1.00 146.43 ? 236 VAL B CA    1 
ATOM   5188  C  C     . VAL B 1 236 ? -40.126 87.989 -34.994 1.00 137.40 ? 236 VAL B C     1 
ATOM   5189  O  O     . VAL B 1 236 ? -39.972 86.977 -35.665 1.00 134.62 ? 236 VAL B O     1 
ATOM   5190  C  CB    . VAL B 1 236 ? -40.754 87.721 -32.582 1.00 150.48 ? 236 VAL B CB    1 
ATOM   5191  C  CG1   . VAL B 1 236 ? -39.278 88.024 -32.450 1.00 162.42 ? 236 VAL B CG1   1 
ATOM   5192  C  CG2   . VAL B 1 236 ? -41.544 88.453 -31.522 1.00 148.21 ? 236 VAL B CG2   1 
ATOM   5193  N  N     . VAL B 1 237 ? -39.319 89.036 -35.102 1.00 139.53 ? 237 VAL B N     1 
ATOM   5194  C  CA    . VAL B 1 237 ? -38.174 88.970 -35.996 1.00 141.40 ? 237 VAL B CA    1 
ATOM   5195  C  C     . VAL B 1 237 ? -36.876 88.864 -35.215 1.00 143.44 ? 237 VAL B C     1 
ATOM   5196  O  O     . VAL B 1 237 ? -36.689 89.528 -34.193 1.00 150.55 ? 237 VAL B O     1 
ATOM   5197  C  CB    . VAL B 1 237 ? -38.065 90.169 -36.914 1.00 145.37 ? 237 VAL B CB    1 
ATOM   5198  C  CG1   . VAL B 1 237 ? -36.981 89.894 -37.942 1.00 140.16 ? 237 VAL B CG1   1 
ATOM   5199  C  CG2   . VAL B 1 237 ? -39.405 90.451 -37.577 1.00 158.42 ? 237 VAL B CG2   1 
ATOM   5200  N  N     . VAL B 1 238 ? -35.986 88.011 -35.705 1.00 129.06 ? 238 VAL B N     1 
ATOM   5201  C  CA    . VAL B 1 238 ? -34.725 87.745 -35.037 1.00 131.11 ? 238 VAL B CA    1 
ATOM   5202  C  C     . VAL B 1 238 ? -33.602 87.944 -36.033 1.00 140.43 ? 238 VAL B C     1 
ATOM   5203  O  O     . VAL B 1 238 ? -33.600 87.325 -37.095 1.00 158.57 ? 238 VAL B O     1 
ATOM   5204  C  CB    . VAL B 1 238 ? -34.685 86.282 -34.517 1.00 119.24 ? 238 VAL B CB    1 
ATOM   5205  C  CG1   . VAL B 1 238 ? -33.255 85.857 -34.187 1.00 102.14 ? 238 VAL B CG1   1 
ATOM   5206  C  CG2   . VAL B 1 238 ? -35.629 86.099 -33.317 1.00 115.72 ? 238 VAL B CG2   1 
ATOM   5207  N  N     . ARG B 1 239 ? -32.644 88.800 -35.700 1.00 140.37 ? 239 ARG B N     1 
ATOM   5208  C  CA    . ARG B 1 239 ? -31.548 89.076 -36.622 1.00 150.15 ? 239 ARG B CA    1 
ATOM   5209  C  C     . ARG B 1 239 ? -30.200 88.793 -35.992 1.00 150.53 ? 239 ARG B C     1 
ATOM   5210  O  O     . ARG B 1 239 ? -29.918 89.222 -34.869 1.00 151.91 ? 239 ARG B O     1 
ATOM   5211  C  CB    . ARG B 1 239 ? -31.590 90.520 -37.139 1.00 145.88 ? 239 ARG B CB    1 
ATOM   5212  N  N     . SER B 1 240 ? -29.379 88.050 -36.724 1.00 142.16 ? 240 SER B N     1 
ATOM   5213  C  CA    . SER B 1 240 ? -28.007 87.814 -36.317 1.00 147.38 ? 240 SER B CA    1 
ATOM   5214  C  C     . SER B 1 240 ? -27.316 89.146 -36.064 1.00 139.46 ? 240 SER B C     1 
ATOM   5215  O  O     . SER B 1 240 ? -27.737 90.174 -36.583 1.00 149.82 ? 240 SER B O     1 
ATOM   5216  C  CB    . SER B 1 240 ? -27.260 86.985 -37.360 1.00 156.54 ? 240 SER B CB    1 
ATOM   5217  O  OG    . SER B 1 240 ? -27.787 87.202 -38.650 1.00 164.53 ? 240 SER B OG    1 
ATOM   5218  N  N     . LYS B 1 241 ? -26.254 89.119 -35.266 1.00 136.01 ? 241 LYS B N     1 
ATOM   5219  C  CA    . LYS B 1 241 ? -25.616 90.338 -34.786 1.00 150.15 ? 241 LYS B CA    1 
ATOM   5220  C  C     . LYS B 1 241 ? -24.350 90.605 -35.589 1.00 163.66 ? 241 LYS B C     1 
ATOM   5221  O  O     . LYS B 1 241 ? -23.449 89.769 -35.640 1.00 170.23 ? 241 LYS B O     1 
ATOM   5222  C  CB    . LYS B 1 241 ? -25.313 90.233 -33.277 1.00 143.95 ? 241 LYS B CB    1 
ATOM   5223  C  CG    . LYS B 1 241 ? -24.231 91.198 -32.763 1.00 142.00 ? 241 LYS B CG    1 
ATOM   5224  C  CD    . LYS B 1 241 ? -24.135 91.243 -31.234 1.00 128.86 ? 241 LYS B CD    1 
ATOM   5225  N  N     . THR B 1 242 ? -24.283 91.785 -36.201 1.00 163.04 ? 242 THR B N     1 
ATOM   5226  C  CA    . THR B 1 242 ? -23.282 92.047 -37.223 1.00 151.25 ? 242 THR B CA    1 
ATOM   5227  C  C     . THR B 1 242 ? -22.307 93.154 -36.832 1.00 168.74 ? 242 THR B C     1 
ATOM   5228  O  O     . THR B 1 242 ? -22.664 94.100 -36.126 1.00 174.00 ? 242 THR B O     1 
ATOM   5229  C  CB    . THR B 1 242 ? -23.936 92.359 -38.589 1.00 130.22 ? 242 THR B CB    1 
ATOM   5230  N  N     . GLU B 1 243 ? -21.063 92.989 -37.272 1.00 171.51 ? 243 GLU B N     1 
ATOM   5231  C  CA    . GLU B 1 243 ? -19.998 93.972 -37.090 1.00 163.85 ? 243 GLU B CA    1 
ATOM   5232  C  C     . GLU B 1 243 ? -19.223 94.117 -38.408 1.00 173.67 ? 243 GLU B C     1 
ATOM   5233  O  O     . GLU B 1 243 ? -19.086 93.143 -39.148 1.00 177.02 ? 243 GLU B O     1 
ATOM   5234  C  CB    . GLU B 1 243 ? -19.059 93.502 -35.969 1.00 135.24 ? 243 GLU B CB    1 
ATOM   5235  N  N     . ILE B 1 244 ? -18.717 95.311 -38.715 1.00 172.92 ? 244 ILE B N     1 
ATOM   5236  C  CA    . ILE B 1 244 ? -17.898 95.474 -39.924 1.00 178.07 ? 244 ILE B CA    1 
ATOM   5237  C  C     . ILE B 1 244 ? -16.434 95.770 -39.589 1.00 180.08 ? 244 ILE B C     1 
ATOM   5238  O  O     . ILE B 1 244 ? -16.128 96.703 -38.854 1.00 184.03 ? 244 ILE B O     1 
ATOM   5239  C  CB    . ILE B 1 244 ? -18.453 96.526 -40.929 1.00 102.50 ? 244 ILE B CB    1 
ATOM   5240  N  N     . GLU B 1 245 ? -15.538 94.960 -40.144 1.00 181.18 ? 245 GLU B N     1 
ATOM   5241  C  CA    . GLU B 1 245 ? -14.110 95.067 -39.884 1.00 184.34 ? 245 GLU B CA    1 
ATOM   5242  C  C     . GLU B 1 245 ? -13.439 95.485 -41.177 1.00 190.43 ? 245 GLU B C     1 
ATOM   5243  O  O     . GLU B 1 245 ? -13.852 95.061 -42.258 1.00 192.57 ? 245 GLU B O     1 
ATOM   5244  C  CB    . GLU B 1 245 ? -13.524 93.724 -39.407 1.00 183.36 ? 245 GLU B CB    1 
ATOM   5245  N  N     . LYS B 1 246 ? -12.410 96.322 -41.064 1.00 195.07 ? 246 LYS B N     1 
ATOM   5246  C  CA    . LYS B 1 246 ? -11.744 96.891 -42.235 1.00 188.18 ? 246 LYS B CA    1 
ATOM   5247  C  C     . LYS B 1 246 ? -10.246 96.596 -42.234 1.00 183.85 ? 246 LYS B C     1 
ATOM   5248  O  O     . LYS B 1 246 ? -9.724  96.000 -41.294 1.00 182.95 ? 246 LYS B O     1 
ATOM   5249  C  CB    . LYS B 1 246 ? -11.994 98.404 -42.314 1.00 180.27 ? 246 LYS B CB    1 
ATOM   5250  N  N     . GLN B 1 253 ? -15.344 93.855 -44.565 1.00 168.32 ? 253 GLN B N     1 
ATOM   5251  C  CA    . GLN B 1 253 ? -15.552 92.527 -43.972 1.00 164.82 ? 253 GLN B CA    1 
ATOM   5252  C  C     . GLN B 1 253 ? -16.702 92.479 -42.966 1.00 161.33 ? 253 GLN B C     1 
ATOM   5253  O  O     . GLN B 1 253 ? -16.802 93.327 -42.083 1.00 167.86 ? 253 GLN B O     1 
ATOM   5254  C  CB    . GLN B 1 253 ? -14.272 92.044 -43.288 1.00 150.55 ? 253 GLN B CB    1 
ATOM   5255  C  CG    . GLN B 1 253 ? -14.457 90.847 -42.395 1.00 154.84 ? 253 GLN B CG    1 
ATOM   5256  C  CD    . GLN B 1 253 ? -13.287 89.887 -42.486 1.00 171.05 ? 253 GLN B CD    1 
ATOM   5257  O  OE1   . GLN B 1 253 ? -12.851 89.545 -43.587 1.00 175.59 ? 253 GLN B OE1   1 
ATOM   5258  N  NE2   . GLN B 1 253 ? -12.772 89.439 -41.330 1.00 170.31 ? 253 GLN B NE2   1 
ATOM   5259  N  N     . ILE B 1 254 ? -17.545 91.458 -43.085 1.00 151.38 ? 254 ILE B N     1 
ATOM   5260  C  CA    . ILE B 1 254 ? -18.704 91.313 -42.214 1.00 150.67 ? 254 ILE B CA    1 
ATOM   5261  C  C     . ILE B 1 254 ? -18.462 90.187 -41.227 1.00 156.35 ? 254 ILE B C     1 
ATOM   5262  O  O     . ILE B 1 254 ? -18.188 89.054 -41.618 1.00 154.09 ? 254 ILE B O     1 
ATOM   5263  C  CB    . ILE B 1 254 ? -19.996 90.969 -42.975 1.00 141.24 ? 254 ILE B CB    1 
ATOM   5264  C  CG1   . ILE B 1 254 ? -20.041 91.649 -44.336 1.00 151.10 ? 254 ILE B CG1   1 
ATOM   5265  C  CG2   . ILE B 1 254 ? -21.203 91.367 -42.152 1.00 141.44 ? 254 ILE B CG2   1 
ATOM   5266  C  CD1   . ILE B 1 254 ? -21.460 91.767 -44.909 1.00 155.79 ? 254 ILE B CD1   1 
ATOM   5267  N  N     . VAL B 1 255 ? -18.597 90.496 -39.945 1.00 159.52 ? 255 VAL B N     1 
ATOM   5268  C  CA    . VAL B 1 255 ? -18.327 89.523 -38.899 1.00 165.13 ? 255 VAL B CA    1 
ATOM   5269  C  C     . VAL B 1 255 ? -19.620 89.145 -38.200 1.00 171.47 ? 255 VAL B C     1 
ATOM   5270  O  O     . VAL B 1 255 ? -20.402 90.014 -37.808 1.00 179.45 ? 255 VAL B O     1 
ATOM   5271  C  CB    . VAL B 1 255 ? -17.353 90.082 -37.851 1.00 163.16 ? 255 VAL B CB    1 
ATOM   5272  C  CG1   . VAL B 1 255 ? -16.837 88.961 -36.968 1.00 155.02 ? 255 VAL B CG1   1 
ATOM   5273  C  CG2   . VAL B 1 255 ? -16.211 90.798 -38.532 1.00 169.73 ? 255 VAL B CG2   1 
ATOM   5274  N  N     . ILE B 1 256 ? -19.840 87.846 -38.041 1.00 161.67 ? 256 ILE B N     1 
ATOM   5275  C  CA    . ILE B 1 256 ? -21.073 87.368 -37.445 1.00 160.06 ? 256 ILE B CA    1 
ATOM   5276  C  C     . ILE B 1 256 ? -20.737 86.673 -36.146 1.00 159.63 ? 256 ILE B C     1 
ATOM   5277  O  O     . ILE B 1 256 ? -19.901 85.776 -36.130 1.00 165.36 ? 256 ILE B O     1 
ATOM   5278  C  CB    . ILE B 1 256 ? -21.780 86.369 -38.362 1.00 146.62 ? 256 ILE B CB    1 
ATOM   5279  C  CG1   . ILE B 1 256 ? -21.686 86.823 -39.812 1.00 130.62 ? 256 ILE B CG1   1 
ATOM   5280  C  CG2   . ILE B 1 256 ? -23.236 86.181 -37.930 1.00 153.08 ? 256 ILE B CG2   1 
ATOM   5281  C  CD1   . ILE B 1 256 ? -22.884 86.418 -40.611 1.00 134.13 ? 256 ILE B CD1   1 
ATOM   5282  N  N     . THR B 1 257 ? -21.366 87.094 -35.052 1.00 157.39 ? 257 THR B N     1 
ATOM   5283  C  CA    . THR B 1 257 ? -21.000 86.542 -33.757 1.00 160.77 ? 257 THR B CA    1 
ATOM   5284  C  C     . THR B 1 257 ? -22.195 86.091 -32.938 1.00 150.60 ? 257 THR B C     1 
ATOM   5285  O  O     . THR B 1 257 ? -22.046 85.717 -31.780 1.00 144.94 ? 257 THR B O     1 
ATOM   5286  C  CB    . THR B 1 257 ? -20.281 87.633 -32.918 1.00 163.22 ? 257 THR B CB    1 
ATOM   5287  O  OG1   . THR B 1 257 ? -21.238 88.585 -32.428 1.00 155.10 ? 257 THR B OG1   1 
ATOM   5288  C  CG2   . THR B 1 257 ? -19.260 88.366 -33.767 1.00 163.06 ? 257 THR B CG2   1 
ATOM   5289  N  N     . GLU B 1 258 ? -23.363 86.064 -33.562 1.00 147.26 ? 258 GLU B N     1 
ATOM   5290  C  CA    . GLU B 1 258 ? -24.570 85.552 -32.929 1.00 143.83 ? 258 GLU B CA    1 
ATOM   5291  C  C     . GLU B 1 258 ? -25.519 85.205 -34.060 1.00 136.46 ? 258 GLU B C     1 
ATOM   5292  O  O     . GLU B 1 258 ? -25.575 85.917 -35.051 1.00 150.57 ? 258 GLU B O     1 
ATOM   5293  C  CB    . GLU B 1 258 ? -25.194 86.603 -31.998 1.00 143.30 ? 258 GLU B CB    1 
ATOM   5294  N  N     . ILE B 1 259 ? -26.238 84.100 -33.949 1.00 130.22 ? 259 ILE B N     1 
ATOM   5295  C  CA    . ILE B 1 259 ? -27.212 83.762 -34.980 1.00 131.20 ? 259 ILE B CA    1 
ATOM   5296  C  C     . ILE B 1 259 ? -28.566 83.397 -34.369 1.00 137.27 ? 259 ILE B C     1 
ATOM   5297  O  O     . ILE B 1 259 ? -28.677 83.150 -33.163 1.00 137.44 ? 259 ILE B O     1 
ATOM   5298  C  CB    . ILE B 1 259 ? -26.707 82.641 -35.903 1.00 124.75 ? 259 ILE B CB    1 
ATOM   5299  C  CG1   . ILE B 1 259 ? -26.302 81.428 -35.073 1.00 128.50 ? 259 ILE B CG1   1 
ATOM   5300  C  CG2   . ILE B 1 259 ? -25.529 83.128 -36.732 1.00 109.35 ? 259 ILE B CG2   1 
ATOM   5301  C  CD1   . ILE B 1 259 ? -26.382 80.144 -35.829 1.00 126.80 ? 259 ILE B CD1   1 
ATOM   5302  N  N     . PRO B 1 260 ? -29.607 83.393 -35.201 1.00 132.09 ? 260 PRO B N     1 
ATOM   5303  C  CA    . PRO B 1 260 ? -30.975 83.151 -34.745 1.00 129.76 ? 260 PRO B CA    1 
ATOM   5304  C  C     . PRO B 1 260 ? -31.198 81.770 -34.142 1.00 123.29 ? 260 PRO B C     1 
ATOM   5305  O  O     . PRO B 1 260 ? -30.996 80.758 -34.812 1.00 132.13 ? 260 PRO B O     1 
ATOM   5306  C  CB    . PRO B 1 260 ? -31.787 83.298 -36.028 1.00 137.46 ? 260 PRO B CB    1 
ATOM   5307  C  CG    . PRO B 1 260 ? -31.015 84.280 -36.815 1.00 144.86 ? 260 PRO B CG    1 
ATOM   5308  C  CD    . PRO B 1 260 ? -29.571 83.953 -36.558 1.00 136.81 ? 260 PRO B CD    1 
ATOM   5309  N  N     . TYR B 1 261 ? -31.623 81.754 -32.882 1.00 109.28 ? 261 TYR B N     1 
ATOM   5310  C  CA    . TYR B 1 261 ? -32.098 80.552 -32.200 1.00 106.17 ? 261 TYR B CA    1 
ATOM   5311  C  C     . TYR B 1 261 ? -32.674 79.468 -33.108 1.00 117.58 ? 261 TYR B C     1 
ATOM   5312  O  O     . TYR B 1 261 ? -33.427 79.745 -34.048 1.00 116.90 ? 261 TYR B O     1 
ATOM   5313  C  CB    . TYR B 1 261 ? -33.178 80.955 -31.203 1.00 113.27 ? 261 TYR B CB    1 
ATOM   5314  C  CG    . TYR B 1 261 ? -33.639 79.845 -30.299 1.00 118.52 ? 261 TYR B CG    1 
ATOM   5315  C  CD1   . TYR B 1 261 ? -32.750 79.189 -29.462 1.00 114.98 ? 261 TYR B CD1   1 
ATOM   5316  C  CD2   . TYR B 1 261 ? -34.966 79.477 -30.256 1.00 123.82 ? 261 TYR B CD2   1 
ATOM   5317  C  CE1   . TYR B 1 261 ? -33.170 78.186 -28.625 1.00 114.12 ? 261 TYR B CE1   1 
ATOM   5318  C  CE2   . TYR B 1 261 ? -35.398 78.473 -29.413 1.00 124.90 ? 261 TYR B CE2   1 
ATOM   5319  C  CZ    . TYR B 1 261 ? -34.498 77.825 -28.601 1.00 117.59 ? 261 TYR B CZ    1 
ATOM   5320  O  OH    . TYR B 1 261 ? -34.931 76.812 -27.765 1.00 118.65 ? 261 TYR B OH    1 
ATOM   5321  N  N     . GLU B 1 262 ? -32.322 78.224 -32.802 1.00 131.42 ? 262 GLU B N     1 
ATOM   5322  C  CA    . GLU B 1 262 ? -32.859 77.063 -33.509 1.00 131.29 ? 262 GLU B CA    1 
ATOM   5323  C  C     . GLU B 1 262 ? -32.410 77.028 -34.964 1.00 127.33 ? 262 GLU B C     1 
ATOM   5324  O  O     . GLU B 1 262 ? -33.014 76.357 -35.796 1.00 133.44 ? 262 GLU B O     1 
ATOM   5325  C  CB    . GLU B 1 262 ? -34.386 77.042 -33.418 1.00 130.03 ? 262 GLU B CB    1 
ATOM   5326  C  CG    . GLU B 1 262 ? -34.931 76.541 -32.091 1.00 139.86 ? 262 GLU B CG    1 
ATOM   5327  C  CD    . GLU B 1 262 ? -36.459 76.460 -32.083 1.00 169.37 ? 262 GLU B CD    1 
ATOM   5328  O  OE1   . GLU B 1 262 ? -37.074 76.619 -33.163 1.00 171.86 ? 262 GLU B OE1   1 
ATOM   5329  O  OE2   . GLU B 1 262 ? -37.050 76.238 -30.997 1.00 181.87 ? 262 GLU B OE2   1 
ATOM   5330  N  N     . ILE B 1 263 ? -31.342 77.750 -35.266 1.00 116.04 ? 263 ILE B N     1 
ATOM   5331  C  CA    . ILE B 1 263 ? -30.835 77.802 -36.624 1.00 121.19 ? 263 ILE B CA    1 
ATOM   5332  C  C     . ILE B 1 263 ? -29.486 77.072 -36.697 1.00 139.70 ? 263 ILE B C     1 
ATOM   5333  O  O     . ILE B 1 263 ? -28.727 77.060 -35.733 1.00 151.53 ? 263 ILE B O     1 
ATOM   5334  C  CB    . ILE B 1 263 ? -30.740 79.276 -37.089 1.00 123.94 ? 263 ILE B CB    1 
ATOM   5335  C  CG1   . ILE B 1 263 ? -31.344 79.448 -38.477 1.00 128.57 ? 263 ILE B CG1   1 
ATOM   5336  C  CG2   . ILE B 1 263 ? -29.309 79.785 -37.026 1.00 124.48 ? 263 ILE B CG2   1 
ATOM   5337  C  CD1   . ILE B 1 263 ? -30.560 78.741 -39.563 1.00 135.05 ? 263 ILE B CD1   1 
ATOM   5338  N  N     . ASN B 1 264 ? -29.199 76.462 -37.843 1.00 147.71 ? 264 ASN B N     1 
ATOM   5339  C  CA    . ASN B 1 264 ? -28.040 75.573 -38.014 1.00 155.63 ? 264 ASN B CA    1 
ATOM   5340  C  C     . ASN B 1 264 ? -26.746 76.183 -38.560 1.00 149.68 ? 264 ASN B C     1 
ATOM   5341  O  O     . ASN B 1 264 ? -26.549 76.210 -39.768 1.00 160.03 ? 264 ASN B O     1 
ATOM   5342  C  CB    . ASN B 1 264 ? -28.385 74.326 -38.829 1.00 165.29 ? 264 ASN B CB    1 
ATOM   5343  C  CG    . ASN B 1 264 ? -27.228 73.330 -38.879 1.00 166.44 ? 264 ASN B CG    1 
ATOM   5344  O  OD1   . ASN B 1 264 ? -26.259 73.515 -39.620 1.00 157.39 ? 264 ASN B OD1   1 
ATOM   5345  N  ND2   . ASN B 1 264 ? -27.328 72.268 -38.082 1.00 174.60 ? 264 ASN B ND2   1 
ATOM   5346  N  N     . LYS B 1 265 ? -25.895 76.715 -37.692 1.00 126.40 ? 265 LYS B N     1 
ATOM   5347  C  CA    . LYS B 1 265 ? -24.668 77.377 -38.144 1.00 126.73 ? 265 LYS B CA    1 
ATOM   5348  C  C     . LYS B 1 265 ? -24.036 76.774 -39.399 1.00 125.18 ? 265 LYS B C     1 
ATOM   5349  O  O     . LYS B 1 265 ? -23.655 77.501 -40.312 1.00 122.63 ? 265 LYS B O     1 
ATOM   5350  C  CB    . LYS B 1 265 ? -23.631 77.396 -37.019 1.00 129.93 ? 265 LYS B CB    1 
ATOM   5351  C  CG    . LYS B 1 265 ? -22.283 78.004 -37.382 1.00 130.02 ? 265 LYS B CG    1 
ATOM   5352  C  CD    . LYS B 1 265 ? -21.385 78.059 -36.143 1.00 139.07 ? 265 LYS B CD    1 
ATOM   5353  C  CE    . LYS B 1 265 ? -19.909 78.166 -36.515 1.00 145.67 ? 265 LYS B CE    1 
ATOM   5354  N  N     . ALA B 1 266 ? -23.931 75.453 -39.451 1.00 127.87 ? 266 ALA B N     1 
ATOM   5355  C  CA    . ALA B 1 266 ? -23.260 74.797 -40.571 1.00 121.17 ? 266 ALA B CA    1 
ATOM   5356  C  C     . ALA B 1 266 ? -23.917 75.116 -41.900 1.00 121.74 ? 266 ALA B C     1 
ATOM   5357  O  O     . ALA B 1 266 ? -23.303 75.715 -42.779 1.00 121.95 ? 266 ALA B O     1 
ATOM   5358  C  CB    . ALA B 1 266 ? -23.244 73.293 -40.362 1.00 126.43 ? 266 ALA B CB    1 
ATOM   5359  N  N     . ASN B 1 267 ? -25.171 74.698 -42.040 1.00 137.77 ? 267 ASN B N     1 
ATOM   5360  C  CA    . ASN B 1 267 ? -25.943 74.947 -43.251 1.00 143.26 ? 267 ASN B CA    1 
ATOM   5361  C  C     . ASN B 1 267 ? -26.060 76.434 -43.505 1.00 148.03 ? 267 ASN B C     1 
ATOM   5362  O  O     . ASN B 1 267 ? -25.937 76.875 -44.634 1.00 160.88 ? 267 ASN B O     1 
ATOM   5363  C  CB    . ASN B 1 267 ? -27.335 74.314 -43.181 1.00 151.42 ? 267 ASN B CB    1 
ATOM   5364  C  CG    . ASN B 1 267 ? -27.324 72.935 -42.517 1.00 169.82 ? 267 ASN B CG    1 
ATOM   5365  O  OD1   . ASN B 1 267 ? -28.228 72.605 -41.748 1.00 178.79 ? 267 ASN B OD1   1 
ATOM   5366  N  ND2   . ASN B 1 267 ? -26.295 72.132 -42.799 1.00 164.32 ? 267 ASN B ND2   1 
ATOM   5367  N  N     . LEU B 1 268 ? -26.278 77.212 -42.452 1.00 146.44 ? 268 LEU B N     1 
ATOM   5368  C  CA    . LEU B 1 268 ? -26.371 78.661 -42.597 1.00 153.94 ? 268 LEU B CA    1 
ATOM   5369  C  C     . LEU B 1 268 ? -25.183 79.178 -43.394 1.00 148.67 ? 268 LEU B C     1 
ATOM   5370  O  O     . LEU B 1 268 ? -25.339 79.991 -44.306 1.00 145.97 ? 268 LEU B O     1 
ATOM   5371  C  CB    . LEU B 1 268 ? -26.445 79.344 -41.224 1.00 157.66 ? 268 LEU B CB    1 
ATOM   5372  C  CG    . LEU B 1 268 ? -26.647 80.870 -41.146 1.00 154.21 ? 268 LEU B CG    1 
ATOM   5373  C  CD1   . LEU B 1 268 ? -25.317 81.614 -41.084 1.00 153.26 ? 268 LEU B CD1   1 
ATOM   5374  C  CD2   . LEU B 1 268 ? -27.549 81.418 -42.276 1.00 132.86 ? 268 LEU B CD2   1 
ATOM   5375  N  N     . VAL B 1 269 ? -23.997 78.695 -43.048 1.00 141.75 ? 269 VAL B N     1 
ATOM   5376  C  CA    . VAL B 1 269 ? -22.793 79.053 -43.780 1.00 136.67 ? 269 VAL B CA    1 
ATOM   5377  C  C     . VAL B 1 269 ? -22.817 78.606 -45.247 1.00 142.27 ? 269 VAL B C     1 
ATOM   5378  O  O     . VAL B 1 269 ? -22.530 79.406 -46.139 1.00 144.71 ? 269 VAL B O     1 
ATOM   5379  C  CB    . VAL B 1 269 ? -21.542 78.526 -43.080 1.00 124.94 ? 269 VAL B CB    1 
ATOM   5380  C  CG1   . VAL B 1 269 ? -20.468 78.218 -44.097 1.00 131.82 ? 269 VAL B CG1   1 
ATOM   5381  C  CG2   . VAL B 1 269 ? -21.053 79.543 -42.073 1.00 111.31 ? 269 VAL B CG2   1 
ATOM   5382  N  N     . LYS B 1 270 ? -23.161 77.346 -45.510 1.00 139.20 ? 270 LYS B N     1 
ATOM   5383  C  CA    . LYS B 1 270 ? -23.252 76.885 -46.901 1.00 137.27 ? 270 LYS B CA    1 
ATOM   5384  C  C     . LYS B 1 270 ? -24.210 77.773 -47.696 1.00 140.88 ? 270 LYS B C     1 
ATOM   5385  O  O     . LYS B 1 270 ? -23.862 78.277 -48.759 1.00 135.22 ? 270 LYS B O     1 
ATOM   5386  C  CB    . LYS B 1 270 ? -23.688 75.415 -47.019 1.00 117.65 ? 270 LYS B CB    1 
ATOM   5387  N  N     . LYS B 1 271 ? -25.406 77.980 -47.158 1.00 140.50 ? 271 LYS B N     1 
ATOM   5388  C  CA    . LYS B 1 271 ? -26.426 78.765 -47.833 1.00 133.61 ? 271 LYS B CA    1 
ATOM   5389  C  C     . LYS B 1 271 ? -25.949 80.153 -48.207 1.00 136.85 ? 271 LYS B C     1 
ATOM   5390  O  O     . LYS B 1 271 ? -26.384 80.701 -49.221 1.00 135.84 ? 271 LYS B O     1 
ATOM   5391  C  CB    . LYS B 1 271 ? -27.680 78.878 -46.976 1.00 124.33 ? 271 LYS B CB    1 
ATOM   5392  N  N     . ILE B 1 272 ? -25.094 80.737 -47.371 1.00 140.50 ? 272 ILE B N     1 
ATOM   5393  C  CA    . ILE B 1 272 ? -24.496 82.033 -47.688 1.00 158.01 ? 272 ILE B CA    1 
ATOM   5394  C  C     . ILE B 1 272 ? -23.533 81.961 -48.862 1.00 162.38 ? 272 ILE B C     1 
ATOM   5395  O  O     . ILE B 1 272 ? -23.651 82.735 -49.808 1.00 157.62 ? 272 ILE B O     1 
ATOM   5396  C  CB    . ILE B 1 272 ? -23.737 82.639 -46.506 1.00 158.10 ? 272 ILE B CB    1 
ATOM   5397  C  CG1   . ILE B 1 272 ? -24.735 83.255 -45.522 1.00 170.05 ? 272 ILE B CG1   1 
ATOM   5398  C  CG2   . ILE B 1 272 ? -22.721 83.681 -47.008 1.00 141.18 ? 272 ILE B CG2   1 
ATOM   5399  C  CD1   . ILE B 1 272 ? -24.112 84.173 -44.498 1.00 174.98 ? 272 ILE B CD1   1 
ATOM   5400  N  N     . ASP B 1 273 ? -22.575 81.039 -48.792 1.00 168.07 ? 273 ASP B N     1 
ATOM   5401  C  CA    . ASP B 1 273 ? -21.614 80.846 -49.879 1.00 175.92 ? 273 ASP B CA    1 
ATOM   5402  C  C     . ASP B 1 273 ? -22.299 80.470 -51.196 1.00 172.68 ? 273 ASP B C     1 
ATOM   5403  O  O     . ASP B 1 273 ? -21.825 80.821 -52.278 1.00 173.99 ? 273 ASP B O     1 
ATOM   5404  C  CB    . ASP B 1 273 ? -20.568 79.790 -49.513 1.00 177.00 ? 273 ASP B CB    1 
ATOM   5405  C  CG    . ASP B 1 273 ? -19.350 79.835 -50.428 1.00 181.16 ? 273 ASP B CG    1 
ATOM   5406  O  OD1   . ASP B 1 273 ? -18.437 80.648 -50.166 1.00 184.25 ? 273 ASP B OD1   1 
ATOM   5407  O  OD2   . ASP B 1 273 ? -19.305 79.058 -51.408 1.00 179.34 ? 273 ASP B OD2   1 
ATOM   5408  N  N     . ASP B 1 274 ? -23.393 79.722 -51.094 1.00 164.92 ? 274 ASP B N     1 
ATOM   5409  C  CA    . ASP B 1 274 ? -24.210 79.391 -52.252 1.00 162.26 ? 274 ASP B CA    1 
ATOM   5410  C  C     . ASP B 1 274 ? -24.687 80.676 -52.942 1.00 172.28 ? 274 ASP B C     1 
ATOM   5411  O  O     . ASP B 1 274 ? -24.798 80.731 -54.169 1.00 173.62 ? 274 ASP B O     1 
ATOM   5412  C  CB    . ASP B 1 274 ? -25.383 78.489 -51.838 1.00 147.28 ? 274 ASP B CB    1 
ATOM   5413  N  N     . VAL B 1 275 ? -24.971 81.705 -52.145 1.00 175.70 ? 275 VAL B N     1 
ATOM   5414  C  CA    . VAL B 1 275 ? -25.312 83.021 -52.680 1.00 180.25 ? 275 VAL B CA    1 
ATOM   5415  C  C     . VAL B 1 275 ? -24.179 83.568 -53.539 1.00 186.02 ? 275 VAL B C     1 
ATOM   5416  O  O     . VAL B 1 275 ? -24.409 84.042 -54.650 1.00 195.71 ? 275 VAL B O     1 
ATOM   5417  C  CB    . VAL B 1 275 ? -25.629 84.032 -51.563 1.00 182.26 ? 275 VAL B CB    1 
ATOM   5418  C  CG1   . VAL B 1 275 ? -25.051 85.392 -51.895 1.00 182.06 ? 275 VAL B CG1   1 
ATOM   5419  C  CG2   . VAL B 1 275 ? -27.119 84.137 -51.365 1.00 189.68 ? 275 VAL B CG2   1 
ATOM   5420  N  N     . ARG B 1 276 ? -22.955 83.504 -53.024 1.00 178.20 ? 276 ARG B N     1 
ATOM   5421  C  CA    . ARG B 1 276 ? -21.797 83.934 -53.794 1.00 179.18 ? 276 ARG B CA    1 
ATOM   5422  C  C     . ARG B 1 276 ? -21.654 83.180 -55.113 1.00 190.45 ? 276 ARG B C     1 
ATOM   5423  O  O     . ARG B 1 276 ? -21.603 83.800 -56.172 1.00 205.67 ? 276 ARG B O     1 
ATOM   5424  C  CB    . ARG B 1 276 ? -20.501 83.778 -53.008 1.00 169.44 ? 276 ARG B CB    1 
ATOM   5425  C  CG    . ARG B 1 276 ? -19.302 84.019 -53.898 1.00 174.67 ? 276 ARG B CG    1 
ATOM   5426  C  CD    . ARG B 1 276 ? -17.981 83.757 -53.215 1.00 183.22 ? 276 ARG B CD    1 
ATOM   5427  N  NE    . ARG B 1 276 ? -17.710 82.342 -52.968 1.00 180.27 ? 276 ARG B NE    1 
ATOM   5428  C  CZ    . ARG B 1 276 ? -17.725 81.392 -53.897 1.00 175.80 ? 276 ARG B CZ    1 
ATOM   5429  N  NH1   . ARG B 1 276 ? -18.041 81.686 -55.152 1.00 177.25 ? 276 ARG B NH1   1 
ATOM   5430  N  NH2   . ARG B 1 276 ? -17.445 80.137 -53.564 1.00 163.56 ? 276 ARG B NH2   1 
ATOM   5431  N  N     . VAL B 1 277 ? -21.581 81.852 -55.048 1.00 179.96 ? 277 VAL B N     1 
ATOM   5432  C  CA    . VAL B 1 277 ? -21.391 81.034 -56.251 1.00 179.98 ? 277 VAL B CA    1 
ATOM   5433  C  C     . VAL B 1 277 ? -22.475 81.236 -57.308 1.00 185.67 ? 277 VAL B C     1 
ATOM   5434  O  O     . VAL B 1 277 ? -22.182 81.372 -58.497 1.00 185.47 ? 277 VAL B O     1 
ATOM   5435  C  CB    . VAL B 1 277 ? -21.337 79.549 -55.931 1.00 182.31 ? 277 VAL B CB    1 
ATOM   5436  C  CG1   . VAL B 1 277 ? -21.876 78.746 -57.112 1.00 184.67 ? 277 VAL B CG1   1 
ATOM   5437  C  CG2   . VAL B 1 277 ? -19.914 79.140 -55.581 1.00 188.61 ? 277 VAL B CG2   1 
ATOM   5438  N  N     . ASN B 1 278 ? -23.729 81.217 -56.879 1.00 187.68 ? 278 ASN B N     1 
ATOM   5439  C  CA    . ASN B 1 278 ? -24.824 81.581 -57.761 1.00 190.02 ? 278 ASN B CA    1 
ATOM   5440  C  C     . ASN B 1 278 ? -24.770 83.066 -58.139 1.00 201.78 ? 278 ASN B C     1 
ATOM   5441  O  O     . ASN B 1 278 ? -25.592 83.543 -58.922 1.00 220.41 ? 278 ASN B O     1 
ATOM   5442  C  CB    . ASN B 1 278 ? -26.163 81.240 -57.104 1.00 187.56 ? 278 ASN B CB    1 
ATOM   5443  N  N     . ASN B 1 279 ? -23.793 83.787 -57.588 1.00 194.20 ? 279 ASN B N     1 
ATOM   5444  C  CA    . ASN B 1 279 ? -23.703 85.242 -57.750 1.00 198.49 ? 279 ASN B CA    1 
ATOM   5445  C  C     . ASN B 1 279 ? -25.080 85.893 -57.782 1.00 205.64 ? 279 ASN B C     1 
ATOM   5446  O  O     . ASN B 1 279 ? -25.372 86.709 -58.657 1.00 197.48 ? 279 ASN B O     1 
ATOM   5447  C  CB    . ASN B 1 279 ? -22.900 85.623 -58.996 1.00 192.43 ? 279 ASN B CB    1 
ATOM   5448  N  N     . LYS B 1 280 ? -25.920 85.510 -56.823 1.00 208.69 ? 280 LYS B N     1 
ATOM   5449  C  CA    . LYS B 1 280 ? -27.291 85.998 -56.749 1.00 200.65 ? 280 LYS B CA    1 
ATOM   5450  C  C     . LYS B 1 280 ? -27.319 87.461 -56.318 1.00 203.89 ? 280 LYS B C     1 
ATOM   5451  O  O     . LYS B 1 280 ? -28.314 88.157 -56.526 1.00 207.19 ? 280 LYS B O     1 
ATOM   5452  C  CB    . LYS B 1 280 ? -28.133 85.126 -55.812 1.00 186.23 ? 280 LYS B CB    1 
ATOM   5453  N  N     . VAL B 1 281 ? -26.225 87.928 -55.722 1.00 198.19 ? 281 VAL B N     1 
ATOM   5454  C  CA    . VAL B 1 281 ? -26.110 89.344 -55.388 1.00 195.56 ? 281 VAL B CA    1 
ATOM   5455  C  C     . VAL B 1 281 ? -24.726 89.903 -55.697 1.00 201.01 ? 281 VAL B C     1 
ATOM   5456  O  O     . VAL B 1 281 ? -23.772 89.152 -55.920 1.00 202.64 ? 281 VAL B O     1 
ATOM   5457  C  CB    . VAL B 1 281 ? -26.449 89.639 -53.926 1.00 184.72 ? 281 VAL B CB    1 
ATOM   5458  C  CG1   . VAL B 1 281 ? -25.176 89.693 -53.093 1.00 178.91 ? 281 VAL B CG1   1 
ATOM   5459  C  CG2   . VAL B 1 281 ? -27.193 90.957 -53.834 1.00 184.83 ? 281 VAL B CG2   1 
ATOM   5460  N  N     . ALA B 1 282 ? -24.639 91.231 -55.695 1.00 197.45 ? 282 ALA B N     1 
ATOM   5461  C  CA    . ALA B 1 282 ? -23.441 91.961 -56.101 1.00 189.98 ? 282 ALA B CA    1 
ATOM   5462  C  C     . ALA B 1 282 ? -22.143 91.505 -55.429 1.00 199.76 ? 282 ALA B C     1 
ATOM   5463  O  O     . ALA B 1 282 ? -21.579 90.462 -55.770 1.00 197.39 ? 282 ALA B O     1 
ATOM   5464  C  CB    . ALA B 1 282 ? -23.652 93.462 -55.877 1.00 176.78 ? 282 ALA B CB    1 
ATOM   5465  N  N     . GLY B 1 283 ? -21.675 92.304 -54.475 1.00 208.78 ? 283 GLY B N     1 
ATOM   5466  C  CA    . GLY B 1 283 ? -20.341 92.154 -53.919 1.00 218.06 ? 283 GLY B CA    1 
ATOM   5467  C  C     . GLY B 1 283 ? -19.993 90.870 -53.182 1.00 223.09 ? 283 GLY B C     1 
ATOM   5468  O  O     . GLY B 1 283 ? -18.960 90.811 -52.507 1.00 219.94 ? 283 GLY B O     1 
ATOM   5469  N  N     . ILE B 1 284 ? -20.842 89.849 -53.293 1.00 233.42 ? 284 ILE B N     1 
ATOM   5470  C  CA    . ILE B 1 284 ? -20.533 88.545 -52.709 1.00 230.46 ? 284 ILE B CA    1 
ATOM   5471  C  C     . ILE B 1 284 ? -19.091 88.254 -53.046 1.00 213.48 ? 284 ILE B C     1 
ATOM   5472  O  O     . ILE B 1 284 ? -18.678 88.432 -54.188 1.00 236.07 ? 284 ILE B O     1 
ATOM   5473  C  CB    . ILE B 1 284 ? -21.416 87.418 -53.272 1.00 238.49 ? 284 ILE B CB    1 
ATOM   5474  N  N     . ALA B 1 285 ? -18.309 87.829 -52.066 1.00 169.09 ? 285 ALA B N     1 
ATOM   5475  C  CA    . ALA B 1 285 ? -16.878 87.720 -52.301 1.00 161.93 ? 285 ALA B CA    1 
ATOM   5476  C  C     . ALA B 1 285 ? -16.286 86.374 -51.898 1.00 180.56 ? 285 ALA B C     1 
ATOM   5477  O  O     . ALA B 1 285 ? -15.116 86.096 -52.164 1.00 186.20 ? 285 ALA B O     1 
ATOM   5478  C  CB    . ALA B 1 285 ? -16.170 88.843 -51.594 1.00 152.11 ? 285 ALA B CB    1 
ATOM   5479  N  N     . VAL B 1 287 ? -17.016 83.725 -48.351 1.00 142.99 ? 287 VAL B N     1 
ATOM   5480  C  CA    . VAL B 1 287 ? -17.599 83.321 -47.065 1.00 146.94 ? 287 VAL B CA    1 
ATOM   5481  C  C     . VAL B 1 287 ? -16.788 82.218 -46.351 1.00 130.75 ? 287 VAL B C     1 
ATOM   5482  O  O     . VAL B 1 287 ? -16.628 81.114 -46.871 1.00 130.15 ? 287 VAL B O     1 
ATOM   5483  C  CB    . VAL B 1 287 ? -19.079 82.868 -47.235 1.00 127.65 ? 287 VAL B CB    1 
ATOM   5484  N  N     . ARG B 1 288 ? -16.285 82.525 -45.157 1.00 120.49 ? 288 ARG B N     1 
ATOM   5485  C  CA    . ARG B 1 288 ? -15.460 81.583 -44.383 1.00 124.78 ? 288 ARG B CA    1 
ATOM   5486  C  C     . ARG B 1 288 ? -15.970 81.427 -42.938 1.00 140.20 ? 288 ARG B C     1 
ATOM   5487  O  O     . ARG B 1 288 ? -16.444 82.390 -42.333 1.00 155.52 ? 288 ARG B O     1 
ATOM   5488  C  CB    . ARG B 1 288 ? -13.970 82.004 -44.376 1.00 99.64  ? 288 ARG B CB    1 
ATOM   5489  N  N     . ASP B 1 289 ? -15.881 80.225 -42.381 1.00 122.34 ? 289 ASP B N     1 
ATOM   5490  C  CA    . ASP B 1 289 ? -16.244 80.059 -40.988 1.00 141.76 ? 289 ASP B CA    1 
ATOM   5491  C  C     . ASP B 1 289 ? -14.973 79.761 -40.220 1.00 157.81 ? 289 ASP B C     1 
ATOM   5492  O  O     . ASP B 1 289 ? -14.294 78.771 -40.485 1.00 176.75 ? 289 ASP B O     1 
ATOM   5493  C  CB    . ASP B 1 289 ? -17.290 78.954 -40.778 1.00 160.40 ? 289 ASP B CB    1 
ATOM   5494  C  CG    . ASP B 1 289 ? -17.552 78.644 -39.276 1.00 188.26 ? 289 ASP B CG    1 
ATOM   5495  O  OD1   . ASP B 1 289 ? -18.424 77.793 -38.981 1.00 184.93 ? 289 ASP B OD1   1 
ATOM   5496  O  OD2   . ASP B 1 289 ? -16.893 79.238 -38.391 1.00 181.50 ? 289 ASP B OD2   1 
ATOM   5497  N  N     . GLU B 1 290 ? -14.646 80.629 -39.271 1.00 154.27 ? 290 GLU B N     1 
ATOM   5498  C  CA    . GLU B 1 290 ? -13.471 80.422 -38.447 1.00 156.96 ? 290 GLU B CA    1 
ATOM   5499  C  C     . GLU B 1 290 ? -13.893 80.410 -36.989 1.00 146.18 ? 290 GLU B C     1 
ATOM   5500  O  O     . GLU B 1 290 ? -13.648 81.361 -36.251 1.00 147.01 ? 290 GLU B O     1 
ATOM   5501  C  CB    . GLU B 1 290 ? -12.464 81.547 -38.696 1.00 173.47 ? 290 GLU B CB    1 
ATOM   5502  N  N     . SER B 1 291 ? -14.482 79.300 -36.563 1.00 146.55 ? 291 SER B N     1 
ATOM   5503  C  CA    . SER B 1 291 ? -15.022 79.197 -35.212 1.00 148.12 ? 291 SER B CA    1 
ATOM   5504  C  C     . SER B 1 291 ? -14.331 78.078 -34.448 1.00 154.94 ? 291 SER B C     1 
ATOM   5505  O  O     . SER B 1 291 ? -14.125 76.983 -34.974 1.00 158.90 ? 291 SER B O     1 
ATOM   5506  C  CB    . SER B 1 291 ? -16.532 78.951 -35.254 1.00 133.97 ? 291 SER B CB    1 
ATOM   5507  O  OG    . SER B 1 291 ? -17.263 80.101 -35.638 1.00 120.51 ? 291 SER B OG    1 
ATOM   5508  N  N     . ASP B 1 292 ? -13.956 78.362 -33.209 1.00 158.55 ? 292 ASP B N     1 
ATOM   5509  C  CA    . ASP B 1 292 ? -13.316 77.360 -32.376 1.00 182.92 ? 292 ASP B CA    1 
ATOM   5510  C  C     . ASP B 1 292 ? -13.951 77.300 -30.996 1.00 188.51 ? 292 ASP B C     1 
ATOM   5511  O  O     . ASP B 1 292 ? -14.672 78.210 -30.593 1.00 191.22 ? 292 ASP B O     1 
ATOM   5512  C  CB    . ASP B 1 292 ? -11.824 77.659 -32.242 1.00 205.59 ? 292 ASP B CB    1 
ATOM   5513  C  CG    . ASP B 1 292 ? -11.553 78.967 -31.522 1.00 215.53 ? 292 ASP B CG    1 
ATOM   5514  O  OD1   . ASP B 1 292 ? -12.025 79.136 -30.374 1.00 209.58 ? 292 ASP B OD1   1 
ATOM   5515  O  OD2   . ASP B 1 292 ? -10.854 79.822 -32.105 1.00 223.22 ? 292 ASP B OD2   1 
ATOM   5516  N  N     . ARG B 1 293 ? -13.674 76.217 -30.280 1.00 197.22 ? 293 ARG B N     1 
ATOM   5517  C  CA    . ARG B 1 293 ? -14.093 76.062 -28.891 1.00 209.31 ? 293 ARG B CA    1 
ATOM   5518  C  C     . ARG B 1 293 ? -13.880 77.362 -28.093 1.00 218.41 ? 293 ARG B C     1 
ATOM   5519  O  O     . ARG B 1 293 ? -12.784 77.629 -27.613 1.00 231.16 ? 293 ARG B O     1 
ATOM   5520  C  CB    . ARG B 1 293 ? -13.427 74.812 -28.245 1.00 184.43 ? 293 ARG B CB    1 
ATOM   5521  C  CG    . ARG B 1 293 ? -12.356 75.039 -27.156 1.00 178.64 ? 293 ARG B CG    1 
ATOM   5522  C  CD    . ARG B 1 293 ? -11.034 74.288 -27.432 1.00 172.45 ? 293 ARG B CD    1 
ATOM   5523  N  NE    . ARG B 1 293 ? -10.190 75.027 -28.379 1.00 180.34 ? 293 ARG B NE    1 
ATOM   5524  C  CZ    . ARG B 1 293 ? -9.712  74.541 -29.524 1.00 175.89 ? 293 ARG B CZ    1 
ATOM   5525  N  NH1   . ARG B 1 293 ? -9.955  73.283 -29.865 1.00 188.78 ? 293 ARG B NH1   1 
ATOM   5526  N  NH2   . ARG B 1 293 ? -8.972  75.308 -30.323 1.00 146.75 ? 293 ARG B NH2   1 
ATOM   5527  N  N     . ASP B 1 294 ? -14.942 78.169 -28.009 1.00 210.01 ? 294 ASP B N     1 
ATOM   5528  C  CA    . ASP B 1 294 ? -14.989 79.465 -27.295 1.00 205.79 ? 294 ASP B CA    1 
ATOM   5529  C  C     . ASP B 1 294 ? -15.129 80.715 -28.196 1.00 191.62 ? 294 ASP B C     1 
ATOM   5530  O  O     . ASP B 1 294 ? -14.263 81.597 -28.224 1.00 183.67 ? 294 ASP B O     1 
ATOM   5531  C  CB    . ASP B 1 294 ? -13.845 79.629 -26.277 1.00 216.09 ? 294 ASP B CB    1 
ATOM   5532  C  CG    . ASP B 1 294 ? -12.498 79.924 -26.930 1.00 231.69 ? 294 ASP B CG    1 
ATOM   5533  O  OD1   . ASP B 1 294 ? -11.475 79.823 -26.220 1.00 240.89 ? 294 ASP B OD1   1 
ATOM   5534  O  OD2   . ASP B 1 294 ? -12.449 80.238 -28.139 1.00 231.96 ? 294 ASP B OD2   1 
ATOM   5535  N  N     . GLY B 1 295 ? -16.245 80.789 -28.915 1.00 181.39 ? 295 GLY B N     1 
ATOM   5536  C  CA    . GLY B 1 295 ? -16.545 81.949 -29.732 1.00 169.75 ? 295 GLY B CA    1 
ATOM   5537  C  C     . GLY B 1 295 ? -17.089 81.597 -31.101 1.00 158.77 ? 295 GLY B C     1 
ATOM   5538  O  O     . GLY B 1 295 ? -16.611 80.670 -31.748 1.00 164.59 ? 295 GLY B O     1 
ATOM   5539  N  N     . LEU B 1 296 ? -18.071 82.362 -31.560 1.00 144.08 ? 296 LEU B N     1 
ATOM   5540  C  CA    . LEU B 1 296 ? -18.622 82.160 -32.890 1.00 129.62 ? 296 LEU B CA    1 
ATOM   5541  C  C     . LEU B 1 296 ? -18.130 83.273 -33.795 1.00 142.08 ? 296 LEU B C     1 
ATOM   5542  O  O     . LEU B 1 296 ? -18.177 84.449 -33.428 1.00 150.29 ? 296 LEU B O     1 
ATOM   5543  C  CB    . LEU B 1 296 ? -20.150 82.141 -32.843 1.00 130.54 ? 296 LEU B CB    1 
ATOM   5544  C  CG    . LEU B 1 296 ? -20.864 81.714 -34.132 1.00 126.00 ? 296 LEU B CG    1 
ATOM   5545  C  CD1   . LEU B 1 296 ? -22.296 81.199 -33.858 1.00 113.83 ? 296 LEU B CD1   1 
ATOM   5546  C  CD2   . LEU B 1 296 ? -20.852 82.831 -35.182 1.00 122.34 ? 296 LEU B CD2   1 
ATOM   5547  N  N     . ARG B 1 297 ? -17.612 82.890 -34.958 1.00 151.92 ? 297 ARG B N     1 
ATOM   5548  C  CA    . ARG B 1 297 ? -17.101 83.850 -35.936 1.00 153.59 ? 297 ARG B CA    1 
ATOM   5549  C  C     . ARG B 1 297 ? -17.379 83.389 -37.363 1.00 144.83 ? 297 ARG B C     1 
ATOM   5550  O  O     . ARG B 1 297 ? -16.877 82.355 -37.793 1.00 149.51 ? 297 ARG B O     1 
ATOM   5551  C  CB    . ARG B 1 297 ? -15.601 84.136 -35.699 1.00 151.70 ? 297 ARG B CB    1 
ATOM   5552  C  CG    . ARG B 1 297 ? -14.816 84.709 -36.890 1.00 152.80 ? 297 ARG B CG    1 
ATOM   5553  C  CD    . ARG B 1 297 ? -13.452 85.291 -36.454 1.00 158.70 ? 297 ARG B CD    1 
ATOM   5554  N  NE    . ARG B 1 297 ? -13.488 86.747 -36.326 1.00 161.79 ? 297 ARG B NE    1 
ATOM   5555  C  CZ    . ARG B 1 297 ? -13.135 87.588 -37.296 1.00 167.26 ? 297 ARG B CZ    1 
ATOM   5556  N  NH1   . ARG B 1 297 ? -12.703 87.117 -38.461 1.00 167.29 ? 297 ARG B NH1   1 
ATOM   5557  N  NH2   . ARG B 1 297 ? -13.211 88.900 -37.106 1.00 175.03 ? 297 ARG B NH2   1 
ATOM   5558  N  N     . ILE B 1 298 ? -18.167 84.160 -38.104 1.00 141.83 ? 298 ILE B N     1 
ATOM   5559  C  CA    . ILE B 1 298 ? -18.373 83.875 -39.520 1.00 142.23 ? 298 ILE B CA    1 
ATOM   5560  C  C     . ILE B 1 298 ? -18.007 85.114 -40.285 1.00 156.40 ? 298 ILE B C     1 
ATOM   5561  O  O     . ILE B 1 298 ? -18.575 86.182 -40.048 1.00 165.34 ? 298 ILE B O     1 
ATOM   5562  C  CB    . ILE B 1 298 ? -19.820 83.522 -39.891 1.00 134.43 ? 298 ILE B CB    1 
ATOM   5563  C  CG1   . ILE B 1 298 ? -20.338 82.349 -39.052 1.00 144.93 ? 298 ILE B CG1   1 
ATOM   5564  C  CG2   . ILE B 1 298 ? -19.891 83.172 -41.356 1.00 113.42 ? 298 ILE B CG2   1 
ATOM   5565  C  CD1   . ILE B 1 298 ? -21.805 82.058 -39.277 1.00 145.03 ? 298 ILE B CD1   1 
ATOM   5566  N  N     . ALA B 1 299 ? -17.073 84.958 -41.218 1.00 155.47 ? 299 ALA B N     1 
ATOM   5567  C  CA    . ALA B 1 299 ? -16.502 86.089 -41.930 1.00 151.89 ? 299 ALA B CA    1 
ATOM   5568  C  C     . ALA B 1 299 ? -16.988 86.135 -43.370 1.00 155.22 ? 299 ALA B C     1 
ATOM   5569  O  O     . ALA B 1 299 ? -16.798 85.193 -44.142 1.00 156.49 ? 299 ALA B O     1 
ATOM   5570  N  N     . ILE B 1 300 ? -17.611 87.252 -43.720 1.00 148.75 ? 300 ILE B N     1 
ATOM   5571  C  CA    . ILE B 1 300 ? -18.026 87.500 -45.080 1.00 156.97 ? 300 ILE B CA    1 
ATOM   5572  C  C     . ILE B 1 300 ? -17.217 88.695 -45.534 1.00 175.96 ? 300 ILE B C     1 
ATOM   5573  O  O     . ILE B 1 300 ? -17.564 89.837 -45.246 1.00 182.79 ? 300 ILE B O     1 
ATOM   5574  C  CB    . ILE B 1 300 ? -19.517 87.838 -45.143 1.00 165.20 ? 300 ILE B CB    1 
ATOM   5575  C  CG1   . ILE B 1 300 ? -20.356 86.639 -44.716 1.00 176.40 ? 300 ILE B CG1   1 
ATOM   5576  C  CG2   . ILE B 1 300 ? -19.909 88.239 -46.539 1.00 166.48 ? 300 ILE B CG2   1 
ATOM   5577  C  CD1   . ILE B 1 300 ? -21.820 86.773 -45.076 1.00 177.14 ? 300 ILE B CD1   1 
ATOM   5578  N  N     . GLU B 1 301 ? -16.158 88.426 -46.288 1.00 182.66 ? 301 GLU B N     1 
ATOM   5579  C  CA    . GLU B 1 301 ? -15.192 89.456 -46.639 1.00 186.22 ? 301 GLU B CA    1 
ATOM   5580  C  C     . GLU B 1 301 ? -15.443 89.867 -48.078 1.00 189.19 ? 301 GLU B C     1 
ATOM   5581  O  O     . GLU B 1 301 ? -15.532 89.019 -48.960 1.00 193.61 ? 301 GLU B O     1 
ATOM   5582  C  CB    . GLU B 1 301 ? -13.763 88.934 -46.445 1.00 173.62 ? 301 GLU B CB    1 
ATOM   5583  N  N     . LEU B 1 302 ? -15.533 91.170 -48.314 1.00 179.19 ? 302 LEU B N     1 
ATOM   5584  C  CA    . LEU B 1 302 ? -16.166 91.665 -49.528 1.00 179.61 ? 302 LEU B CA    1 
ATOM   5585  C  C     . LEU B 1 302 ? -15.168 92.161 -50.562 1.00 194.08 ? 302 LEU B C     1 
ATOM   5586  O  O     . LEU B 1 302 ? -13.985 92.327 -50.265 1.00 202.31 ? 302 LEU B O     1 
ATOM   5587  C  CB    . LEU B 1 302 ? -17.219 92.715 -49.184 1.00 172.51 ? 302 LEU B CB    1 
ATOM   5588  C  CG    . LEU B 1 302 ? -18.365 92.071 -48.405 1.00 167.80 ? 302 LEU B CG    1 
ATOM   5589  C  CD1   . LEU B 1 302 ? -19.544 93.023 -48.181 1.00 154.15 ? 302 LEU B CD1   1 
ATOM   5590  C  CD2   . LEU B 1 302 ? -18.804 90.826 -49.166 1.00 173.36 ? 302 LEU B CD2   1 
ATOM   5591  N  N     . LYS B 1 303 ? -15.653 92.401 -51.777 1.00 196.38 ? 303 LYS B N     1 
ATOM   5592  C  CA    . LYS B 1 303 ? -14.772 92.550 -52.930 1.00 186.59 ? 303 LYS B CA    1 
ATOM   5593  C  C     . LYS B 1 303 ? -14.424 94.016 -53.215 1.00 207.20 ? 303 LYS B C     1 
ATOM   5594  O  O     . LYS B 1 303 ? -13.671 94.631 -52.458 1.00 213.47 ? 303 LYS B O     1 
ATOM   5595  C  CB    . LYS B 1 303 ? -15.370 91.840 -54.157 1.00 157.79 ? 303 LYS B CB    1 
ATOM   5596  N  N     . LYS B 1 304 ? -14.957 94.573 -54.299 1.00 209.31 ? 304 LYS B N     1 
ATOM   5597  C  CA    . LYS B 1 304 ? -14.608 95.934 -54.701 1.00 202.14 ? 304 LYS B CA    1 
ATOM   5598  C  C     . LYS B 1 304 ? -15.725 96.915 -54.360 1.00 217.27 ? 304 LYS B C     1 
ATOM   5599  O  O     . LYS B 1 304 ? -15.648 97.632 -53.358 1.00 217.56 ? 304 LYS B O     1 
ATOM   5600  C  CB    . LYS B 1 304 ? -14.302 95.975 -56.201 1.00 187.75 ? 304 LYS B CB    1 
ATOM   5601  N  N     . ASP B 1 305 ? -16.755 96.946 -55.203 1.00 227.42 ? 305 ASP B N     1 
ATOM   5602  C  CA    . ASP B 1 305 ? -17.952 97.735 -54.932 1.00 221.49 ? 305 ASP B CA    1 
ATOM   5603  C  C     . ASP B 1 305 ? -18.566 97.299 -53.601 1.00 221.87 ? 305 ASP B C     1 
ATOM   5604  O  O     . ASP B 1 305 ? -19.378 96.368 -53.546 1.00 201.68 ? 305 ASP B O     1 
ATOM   5605  C  CB    . ASP B 1 305 ? -18.965 97.610 -56.077 1.00 205.98 ? 305 ASP B CB    1 
ATOM   5606  N  N     . ALA B 1 306 ? -18.160 97.977 -52.531 1.00 234.46 ? 306 ALA B N     1 
ATOM   5607  C  CA    . ALA B 1 306 ? -18.617 97.648 -51.187 1.00 235.28 ? 306 ALA B CA    1 
ATOM   5608  C  C     . ALA B 1 306 ? -20.075 98.048 -50.978 1.00 238.15 ? 306 ALA B C     1 
ATOM   5609  O  O     . ALA B 1 306 ? -20.409 98.773 -50.040 1.00 239.98 ? 306 ALA B O     1 
ATOM   5610  C  CB    . ALA B 1 306 ? -17.716 98.284 -50.133 1.00 235.28 ? 306 ALA B CB    1 
ATOM   5611  N  N     . ASN B 1 307 ? -20.932 97.577 -51.878 1.00 235.28 ? 307 ASN B N     1 
ATOM   5612  C  CA    . ASN B 1 307 ? -22.376 97.653 -51.715 1.00 234.68 ? 307 ASN B CA    1 
ATOM   5613  C  C     . ASN B 1 307 ? -22.801 96.905 -50.462 1.00 246.41 ? 307 ASN B C     1 
ATOM   5614  O  O     . ASN B 1 307 ? -23.872 96.313 -50.432 1.00 254.56 ? 307 ASN B O     1 
ATOM   5615  C  CB    . ASN B 1 307 ? -23.095 97.076 -52.934 1.00 226.50 ? 307 ASN B CB    1 
ATOM   5616  N  N     . THR B 1 308 ? -21.923 96.877 -49.461 1.00 243.85 ? 308 THR B N     1 
ATOM   5617  C  CA    . THR B 1 308 ? -22.104 96.054 -48.265 1.00 229.83 ? 308 THR B CA    1 
ATOM   5618  C  C     . THR B 1 308 ? -23.508 96.131 -47.664 1.00 216.74 ? 308 THR B C     1 
ATOM   5619  O  O     . THR B 1 308 ? -24.083 95.107 -47.327 1.00 216.31 ? 308 THR B O     1 
ATOM   5620  C  CB    . THR B 1 308 ? -21.043 96.371 -47.177 1.00 170.09 ? 308 THR B CB    1 
ATOM   5621  O  OG1   . THR B 1 308 ? -21.559 97.348 -46.269 1.00 179.94 ? 308 THR B OG1   1 
ATOM   5622  C  CG2   . THR B 1 308 ? -19.747 96.894 -47.808 1.00 167.09 ? 308 THR B CG2   1 
ATOM   5623  N  N     . GLU B 1 309 ? -24.053 97.335 -47.523 1.00 210.85 ? 309 GLU B N     1 
ATOM   5624  C  CA    . GLU B 1 309 ? -25.391 97.504 -46.954 1.00 213.18 ? 309 GLU B CA    1 
ATOM   5625  C  C     . GLU B 1 309 ? -26.466 96.764 -47.752 1.00 208.91 ? 309 GLU B C     1 
ATOM   5626  O  O     . GLU B 1 309 ? -27.352 96.132 -47.182 1.00 211.40 ? 309 GLU B O     1 
ATOM   5627  C  CB    . GLU B 1 309 ? -25.744 98.987 -46.845 1.00 227.11 ? 309 GLU B CB    1 
ATOM   5628  C  CG    . GLU B 1 309 ? -25.055 99.699 -45.699 1.00 235.69 ? 309 GLU B CG    1 
ATOM   5629  C  CD    . GLU B 1 309 ? -25.610 99.284 -44.355 1.00 240.57 ? 309 GLU B CD    1 
ATOM   5630  O  OE1   . GLU B 1 309 ? -26.825 98.991 -44.282 1.00 242.44 ? 309 GLU B OE1   1 
ATOM   5631  O  OE2   . GLU B 1 309 ? -24.834 99.255 -43.374 1.00 242.04 ? 309 GLU B OE2   1 
ATOM   5632  N  N     . LEU B 1 310 ? -26.399 96.879 -49.073 1.00 208.92 ? 310 LEU B N     1 
ATOM   5633  C  CA    . LEU B 1 310 ? -27.246 96.106 -49.974 1.00 202.52 ? 310 LEU B CA    1 
ATOM   5634  C  C     . LEU B 1 310 ? -26.992 94.600 -49.830 1.00 205.17 ? 310 LEU B C     1 
ATOM   5635  O  O     . LEU B 1 310 ? -27.936 93.812 -49.837 1.00 208.58 ? 310 LEU B O     1 
ATOM   5636  C  CB    . LEU B 1 310 ? -27.042 96.557 -51.428 1.00 192.41 ? 310 LEU B CB    1 
ATOM   5637  N  N     . VAL B 1 311 ? -25.722 94.206 -49.717 1.00 204.14 ? 311 VAL B N     1 
ATOM   5638  C  CA    . VAL B 1 311 ? -25.349 92.794 -49.549 1.00 201.06 ? 311 VAL B CA    1 
ATOM   5639  C  C     . VAL B 1 311 ? -25.879 92.203 -48.241 1.00 190.20 ? 311 VAL B C     1 
ATOM   5640  O  O     . VAL B 1 311 ? -26.454 91.118 -48.227 1.00 181.82 ? 311 VAL B O     1 
ATOM   5641  C  CB    . VAL B 1 311 ? -23.806 92.562 -49.625 1.00 140.72 ? 311 VAL B CB    1 
ATOM   5642  N  N     . LEU B 1 312 ? -25.660 92.923 -47.147 1.00 185.52 ? 312 LEU B N     1 
ATOM   5643  C  CA    . LEU B 1 312 ? -26.146 92.542 -45.828 1.00 182.14 ? 312 LEU B CA    1 
ATOM   5644  C  C     . LEU B 1 312 ? -27.673 92.496 -45.807 1.00 178.88 ? 312 LEU B C     1 
ATOM   5645  O  O     . LEU B 1 312 ? -28.270 91.511 -45.367 1.00 178.34 ? 312 LEU B O     1 
ATOM   5646  C  CB    . LEU B 1 312 ? -25.651 93.548 -44.783 1.00 179.36 ? 312 LEU B CB    1 
ATOM   5647  C  CG    . LEU B 1 312 ? -25.455 93.096 -43.328 1.00 173.30 ? 312 LEU B CG    1 
ATOM   5648  C  CD1   . LEU B 1 312 ? -25.335 94.315 -42.425 1.00 175.85 ? 312 LEU B CD1   1 
ATOM   5649  C  CD2   . LEU B 1 312 ? -26.573 92.176 -42.840 1.00 159.49 ? 312 LEU B CD2   1 
ATOM   5650  N  N     . ASN B 1 313 ? -28.297 93.576 -46.269 1.00 175.64 ? 313 ASN B N     1 
ATOM   5651  C  CA    . ASN B 1 313 ? -29.754 93.663 -46.332 1.00 166.86 ? 313 ASN B CA    1 
ATOM   5652  C  C     . ASN B 1 313 ? -30.334 92.524 -47.170 1.00 179.37 ? 313 ASN B C     1 
ATOM   5653  O  O     . ASN B 1 313 ? -31.401 91.996 -46.859 1.00 179.23 ? 313 ASN B O     1 
ATOM   5654  C  CB    . ASN B 1 313 ? -30.222 95.046 -46.835 1.00 137.15 ? 313 ASN B CB    1 
ATOM   5655  N  N     . TYR B 1 314 ? -29.635 92.157 -48.240 1.00 186.78 ? 314 TYR B N     1 
ATOM   5656  C  CA    . TYR B 1 314 ? -30.044 91.011 -49.045 1.00 186.38 ? 314 TYR B CA    1 
ATOM   5657  C  C     . TYR B 1 314 ? -29.920 89.721 -48.244 1.00 175.94 ? 314 TYR B C     1 
ATOM   5658  O  O     . TYR B 1 314 ? -30.874 88.954 -48.139 1.00 169.86 ? 314 TYR B O     1 
ATOM   5659  C  CB    . TYR B 1 314 ? -29.236 90.909 -50.347 1.00 186.23 ? 314 TYR B CB    1 
ATOM   5660  C  CG    . TYR B 1 314 ? -29.586 89.683 -51.167 1.00 180.36 ? 314 TYR B CG    1 
ATOM   5661  C  CD1   . TYR B 1 314 ? -28.710 88.608 -51.251 1.00 182.83 ? 314 TYR B CD1   1 
ATOM   5662  C  CD2   . TYR B 1 314 ? -30.803 89.590 -51.831 1.00 172.53 ? 314 TYR B CD2   1 
ATOM   5663  C  CE1   . TYR B 1 314 ? -29.029 87.482 -51.985 1.00 184.76 ? 314 TYR B CE1   1 
ATOM   5664  C  CE2   . TYR B 1 314 ? -31.132 88.467 -52.567 1.00 174.58 ? 314 TYR B CE2   1 
ATOM   5665  C  CZ    . TYR B 1 314 ? -30.241 87.418 -52.641 1.00 186.43 ? 314 TYR B CZ    1 
ATOM   5666  O  OH    . TYR B 1 314 ? -30.557 86.297 -53.372 1.00 194.82 ? 314 TYR B OH    1 
ATOM   5667  N  N     . LEU B 1 315 ? -28.743 89.491 -47.670 1.00 168.91 ? 315 LEU B N     1 
ATOM   5668  C  CA    . LEU B 1 315 ? -28.508 88.282 -46.892 1.00 156.47 ? 315 LEU B CA    1 
ATOM   5669  C  C     . LEU B 1 315 ? -29.611 88.073 -45.864 1.00 161.01 ? 315 LEU B C     1 
ATOM   5670  O  O     . LEU B 1 315 ? -30.114 86.962 -45.720 1.00 160.63 ? 315 LEU B O     1 
ATOM   5671  C  CB    . LEU B 1 315 ? -27.143 88.320 -46.205 1.00 140.63 ? 315 LEU B CB    1 
ATOM   5672  C  CG    . LEU B 1 315 ? -25.938 87.873 -47.036 1.00 132.77 ? 315 LEU B CG    1 
ATOM   5673  C  CD1   . LEU B 1 315 ? -24.690 87.874 -46.166 1.00 130.09 ? 315 LEU B CD1   1 
ATOM   5674  C  CD2   . LEU B 1 315 ? -26.141 86.491 -47.677 1.00 126.66 ? 315 LEU B CD2   1 
ATOM   5675  N  N     . PHE B 1 316 ? -29.992 89.137 -45.161 1.00 163.61 ? 316 PHE B N     1 
ATOM   5676  C  CA    . PHE B 1 316 ? -31.081 89.045 -44.195 1.00 161.68 ? 316 PHE B CA    1 
ATOM   5677  C  C     . PHE B 1 316 ? -32.343 88.475 -44.837 1.00 165.44 ? 316 PHE B C     1 
ATOM   5678  O  O     . PHE B 1 316 ? -32.919 87.505 -44.339 1.00 167.92 ? 316 PHE B O     1 
ATOM   5679  C  CB    . PHE B 1 316 ? -31.381 90.401 -43.568 1.00 168.39 ? 316 PHE B CB    1 
ATOM   5680  C  CG    . PHE B 1 316 ? -30.445 90.782 -42.462 1.00 186.47 ? 316 PHE B CG    1 
ATOM   5681  C  CD1   . PHE B 1 316 ? -30.261 92.111 -42.122 1.00 196.12 ? 316 PHE B CD1   1 
ATOM   5682  C  CD2   . PHE B 1 316 ? -29.749 89.817 -41.762 1.00 197.09 ? 316 PHE B CD2   1 
ATOM   5683  C  CE1   . PHE B 1 316 ? -29.408 92.473 -41.098 1.00 201.34 ? 316 PHE B CE1   1 
ATOM   5684  C  CE2   . PHE B 1 316 ? -28.891 90.173 -40.739 1.00 204.57 ? 316 PHE B CE2   1 
ATOM   5685  C  CZ    . PHE B 1 316 ? -28.720 91.506 -40.408 1.00 205.05 ? 316 PHE B CZ    1 
ATOM   5686  N  N     . LYS B 1 317 ? -32.770 89.075 -45.945 1.00 164.50 ? 317 LYS B N     1 
ATOM   5687  C  CA    . LYS B 1 317 ? -33.962 88.610 -46.644 1.00 158.53 ? 317 LYS B CA    1 
ATOM   5688  C  C     . LYS B 1 317 ? -33.796 87.173 -47.156 1.00 164.57 ? 317 LYS B C     1 
ATOM   5689  O  O     . LYS B 1 317 ? -34.513 86.263 -46.728 1.00 159.20 ? 317 LYS B O     1 
ATOM   5690  C  CB    . LYS B 1 317 ? -34.320 89.563 -47.796 1.00 140.77 ? 317 LYS B CB    1 
ATOM   5691  N  N     . TYR B 1 318 ? -32.834 86.987 -48.058 1.00 172.79 ? 318 TYR B N     1 
ATOM   5692  C  CA    . TYR B 1 318 ? -32.628 85.727 -48.783 1.00 177.87 ? 318 TYR B CA    1 
ATOM   5693  C  C     . TYR B 1 318 ? -32.065 84.512 -48.006 1.00 167.56 ? 318 TYR B C     1 
ATOM   5694  O  O     . TYR B 1 318 ? -32.150 83.385 -48.500 1.00 153.99 ? 318 TYR B O     1 
ATOM   5695  C  CB    . TYR B 1 318 ? -31.778 85.982 -50.034 1.00 181.13 ? 318 TYR B CB    1 
ATOM   5696  N  N     . THR B 1 319 ? -31.474 84.729 -46.828 1.00 167.98 ? 319 THR B N     1 
ATOM   5697  C  CA    . THR B 1 319 ? -30.993 83.608 -46.000 1.00 160.48 ? 319 THR B CA    1 
ATOM   5698  C  C     . THR B 1 319 ? -31.483 83.656 -44.557 1.00 154.26 ? 319 THR B C     1 
ATOM   5699  O  O     . THR B 1 319 ? -32.211 84.572 -44.152 1.00 149.07 ? 319 THR B O     1 
ATOM   5700  C  CB    . THR B 1 319 ? -29.447 83.479 -45.955 1.00 162.78 ? 319 THR B CB    1 
ATOM   5701  O  OG1   . THR B 1 319 ? -28.900 84.401 -45.001 1.00 158.46 ? 319 THR B OG1   1 
ATOM   5702  C  CG2   . THR B 1 319 ? -28.836 83.719 -47.322 1.00 171.50 ? 319 THR B CG2   1 
ATOM   5703  N  N     . ASP B 1 320 ? -31.067 82.659 -43.782 1.00 148.24 ? 320 ASP B N     1 
ATOM   5704  C  CA    . ASP B 1 320 ? -31.548 82.520 -42.413 1.00 141.16 ? 320 ASP B CA    1 
ATOM   5705  C  C     . ASP B 1 320 ? -30.694 83.292 -41.408 1.00 148.60 ? 320 ASP B C     1 
ATOM   5706  O  O     . ASP B 1 320 ? -30.669 82.945 -40.231 1.00 152.20 ? 320 ASP B O     1 
ATOM   5707  C  CB    . ASP B 1 320 ? -31.674 81.043 -42.016 1.00 118.43 ? 320 ASP B CB    1 
ATOM   5708  N  N     . LEU B 1 321 ? -30.002 84.333 -41.875 1.00 143.19 ? 321 LEU B N     1 
ATOM   5709  C  CA    . LEU B 1 321 ? -29.327 85.276 -40.981 1.00 135.02 ? 321 LEU B CA    1 
ATOM   5710  C  C     . LEU B 1 321 ? -30.358 86.106 -40.223 1.00 135.41 ? 321 LEU B C     1 
ATOM   5711  O  O     . LEU B 1 321 ? -30.117 86.575 -39.109 1.00 141.47 ? 321 LEU B O     1 
ATOM   5712  C  CB    . LEU B 1 321 ? -28.404 86.201 -41.762 1.00 136.86 ? 321 LEU B CB    1 
ATOM   5713  C  CG    . LEU B 1 321 ? -26.951 85.767 -41.830 1.00 139.16 ? 321 LEU B CG    1 
ATOM   5714  C  CD1   . LEU B 1 321 ? -26.109 86.940 -42.261 1.00 135.04 ? 321 LEU B CD1   1 
ATOM   5715  C  CD2   . LEU B 1 321 ? -26.507 85.267 -40.470 1.00 146.76 ? 321 LEU B CD2   1 
ATOM   5716  N  N     . GLN B 1 322 ? -31.506 86.303 -40.854 1.00 127.13 ? 322 GLN B N     1 
ATOM   5717  C  CA    . GLN B 1 322 ? -32.657 86.872 -40.184 1.00 136.06 ? 322 GLN B CA    1 
ATOM   5718  C  C     . GLN B 1 322 ? -33.844 85.985 -40.510 1.00 141.15 ? 322 GLN B C     1 
ATOM   5719  O  O     . GLN B 1 322 ? -34.110 85.680 -41.678 1.00 153.69 ? 322 GLN B O     1 
ATOM   5720  C  CB    . GLN B 1 322 ? -32.920 88.311 -40.643 1.00 150.66 ? 322 GLN B CB    1 
ATOM   5721  N  N     . ILE B 1 323 ? -34.531 85.544 -39.467 1.00 131.51 ? 323 ILE B N     1 
ATOM   5722  C  CA    . ILE B 1 323 ? -35.721 84.720 -39.606 1.00 129.69 ? 323 ILE B CA    1 
ATOM   5723  C  C     . ILE B 1 323 ? -36.762 85.295 -38.690 1.00 134.38 ? 323 ILE B C     1 
ATOM   5724  O  O     . ILE B 1 323 ? -36.519 86.292 -38.006 1.00 145.46 ? 323 ILE B O     1 
ATOM   5725  C  CB    . ILE B 1 323 ? -35.487 83.288 -39.150 1.00 126.67 ? 323 ILE B CB    1 
ATOM   5726  C  CG1   . ILE B 1 323 ? -35.427 83.243 -37.616 1.00 119.53 ? 323 ILE B CG1   1 
ATOM   5727  C  CG2   . ILE B 1 323 ? -34.229 82.714 -39.822 1.00 127.55 ? 323 ILE B CG2   1 
ATOM   5728  C  CD1   . ILE B 1 323 ? -34.784 82.006 -37.069 1.00 122.19 ? 323 ILE B CD1   1 
ATOM   5729  N  N     . ASN B 1 324 ? -37.934 84.684 -38.687 1.00 134.62 ? 324 ASN B N     1 
ATOM   5730  C  CA    . ASN B 1 324 ? -38.889 84.991 -37.638 1.00 153.25 ? 324 ASN B CA    1 
ATOM   5731  C  C     . ASN B 1 324 ? -39.142 83.807 -36.737 1.00 152.63 ? 324 ASN B C     1 
ATOM   5732  O  O     . ASN B 1 324 ? -39.109 82.654 -37.167 1.00 162.73 ? 324 ASN B O     1 
ATOM   5733  C  CB    . ASN B 1 324 ? -40.233 85.453 -38.198 1.00 162.59 ? 324 ASN B CB    1 
ATOM   5734  C  CG    . ASN B 1 324 ? -40.148 85.876 -39.625 1.00 163.08 ? 324 ASN B CG    1 
ATOM   5735  O  OD1   . ASN B 1 324 ? -40.003 87.058 -39.919 1.00 154.54 ? 324 ASN B OD1   1 
ATOM   5736  N  ND2   . ASN B 1 324 ? -40.233 84.911 -40.533 1.00 168.57 ? 324 ASN B ND2   1 
ATOM   5737  N  N     . TYR B 1 325 ? -39.376 84.112 -35.471 1.00 140.84 ? 325 TYR B N     1 
ATOM   5738  C  CA    . TYR B 1 325 ? -39.660 83.087 -34.503 1.00 132.65 ? 325 TYR B CA    1 
ATOM   5739  C  C     . TYR B 1 325 ? -41.119 83.205 -34.160 1.00 134.98 ? 325 TYR B C     1 
ATOM   5740  O  O     . TYR B 1 325 ? -41.648 84.305 -34.004 1.00 123.75 ? 325 TYR B O     1 
ATOM   5741  C  CB    . TYR B 1 325 ? -38.806 83.263 -33.259 1.00 127.06 ? 325 TYR B CB    1 
ATOM   5742  C  CG    . TYR B 1 325 ? -39.139 82.239 -32.219 1.00 119.69 ? 325 TYR B CG    1 
ATOM   5743  C  CD1   . TYR B 1 325 ? -40.181 82.452 -31.324 1.00 108.21 ? 325 TYR B CD1   1 
ATOM   5744  C  CD2   . TYR B 1 325 ? -38.436 81.040 -32.154 1.00 125.35 ? 325 TYR B CD2   1 
ATOM   5745  C  CE1   . TYR B 1 325 ? -40.508 81.515 -30.381 1.00 119.11 ? 325 TYR B CE1   1 
ATOM   5746  C  CE2   . TYR B 1 325 ? -38.752 80.087 -31.214 1.00 137.97 ? 325 TYR B CE2   1 
ATOM   5747  C  CZ    . TYR B 1 325 ? -39.791 80.326 -30.322 1.00 140.33 ? 325 TYR B CZ    1 
ATOM   5748  O  OH    . TYR B 1 325 ? -40.112 79.375 -29.373 1.00 146.72 ? 325 TYR B OH    1 
ATOM   5749  N  N     . ASN B 1 326 ? -41.775 82.063 -34.043 1.00 145.37 ? 326 ASN B N     1 
ATOM   5750  C  CA    . ASN B 1 326 ? -43.205 82.063 -33.837 1.00 138.21 ? 326 ASN B CA    1 
ATOM   5751  C  C     . ASN B 1 326 ? -43.568 81.579 -32.473 1.00 136.29 ? 326 ASN B C     1 
ATOM   5752  O  O     . ASN B 1 326 ? -42.966 80.654 -31.947 1.00 153.56 ? 326 ASN B O     1 
ATOM   5753  C  CB    . ASN B 1 326 ? -43.903 81.250 -34.901 1.00 136.32 ? 326 ASN B CB    1 
ATOM   5754  C  CG    . ASN B 1 326 ? -44.221 82.078 -36.106 1.00 143.31 ? 326 ASN B CG    1 
ATOM   5755  O  OD1   . ASN B 1 326 ? -44.996 83.038 -36.025 1.00 138.06 ? 326 ASN B OD1   1 
ATOM   5756  N  ND2   . ASN B 1 326 ? -43.608 81.739 -37.234 1.00 143.19 ? 326 ASN B ND2   1 
ATOM   5757  N  N     . PHE B 1 327 ? -44.577 82.211 -31.907 1.00 126.32 ? 327 PHE B N     1 
ATOM   5758  C  CA    . PHE B 1 327 ? -44.998 81.886 -30.575 1.00 123.62 ? 327 PHE B CA    1 
ATOM   5759  C  C     . PHE B 1 327 ? -46.230 81.047 -30.723 1.00 124.76 ? 327 PHE B C     1 
ATOM   5760  O  O     . PHE B 1 327 ? -47.185 81.422 -31.406 1.00 134.98 ? 327 PHE B O     1 
ATOM   5761  C  CB    . PHE B 1 327 ? -45.333 83.140 -29.789 1.00 124.78 ? 327 PHE B CB    1 
ATOM   5762  C  CG    . PHE B 1 327 ? -44.140 83.919 -29.341 1.00 129.93 ? 327 PHE B CG    1 
ATOM   5763  C  CD1   . PHE B 1 327 ? -43.935 84.173 -27.992 1.00 137.51 ? 327 PHE B CD1   1 
ATOM   5764  C  CD2   . PHE B 1 327 ? -43.238 84.418 -30.259 1.00 142.04 ? 327 PHE B CD2   1 
ATOM   5765  C  CE1   . PHE B 1 327 ? -42.850 84.910 -27.562 1.00 143.32 ? 327 PHE B CE1   1 
ATOM   5766  C  CE2   . PHE B 1 327 ? -42.149 85.157 -29.837 1.00 153.70 ? 327 PHE B CE2   1 
ATOM   5767  C  CZ    . PHE B 1 327 ? -41.956 85.404 -28.483 1.00 151.38 ? 327 PHE B CZ    1 
ATOM   5768  N  N     . ASN B 1 328 ? -46.175 79.873 -30.122 1.00 110.33 ? 328 ASN B N     1 
ATOM   5769  C  CA    . ASN B 1 328 ? -47.350 79.059 -29.995 1.00 120.76 ? 328 ASN B CA    1 
ATOM   5770  C  C     . ASN B 1 328 ? -47.330 78.467 -28.615 1.00 130.68 ? 328 ASN B C     1 
ATOM   5771  O  O     . ASN B 1 328 ? -46.952 77.306 -28.426 1.00 127.13 ? 328 ASN B O     1 
ATOM   5772  C  CB    . ASN B 1 328 ? -47.308 77.950 -31.009 1.00 115.29 ? 328 ASN B CB    1 
ATOM   5773  C  CG    . ASN B 1 328 ? -48.655 77.410 -31.280 1.00 118.52 ? 328 ASN B CG    1 
ATOM   5774  O  OD1   . ASN B 1 328 ? -48.799 76.282 -31.732 1.00 130.67 ? 328 ASN B OD1   1 
ATOM   5775  N  ND2   . ASN B 1 328 ? -49.677 78.214 -31.000 1.00 116.44 ? 328 ASN B ND2   1 
ATOM   5776  N  N     . MET B 1 329 ? -47.802 79.231 -27.645 1.00 129.72 ? 329 MET B N     1 
ATOM   5777  C  CA    . MET B 1 329 ? -47.562 78.816 -26.288 1.00 128.84 ? 329 MET B CA    1 
ATOM   5778  C  C     . MET B 1 329 ? -48.748 78.012 -25.838 1.00 123.88 ? 329 MET B C     1 
ATOM   5779  O  O     . MET B 1 329 ? -49.842 78.517 -25.608 1.00 125.57 ? 329 MET B O     1 
ATOM   5780  C  CB    . MET B 1 329 ? -47.221 79.994 -25.379 1.00 127.68 ? 329 MET B CB    1 
ATOM   5781  N  N     . VAL B 1 330 ? -48.489 76.720 -25.758 1.00 115.42 ? 330 VAL B N     1 
ATOM   5782  C  CA    . VAL B 1 330 ? -49.490 75.739 -25.464 1.00 108.76 ? 330 VAL B CA    1 
ATOM   5783  C  C     . VAL B 1 330 ? -48.927 74.808 -24.423 1.00 109.30 ? 330 VAL B C     1 
ATOM   5784  O  O     . VAL B 1 330 ? -47.907 74.158 -24.636 1.00 115.13 ? 330 VAL B O     1 
ATOM   5785  C  CB    . VAL B 1 330 ? -49.730 74.920 -26.680 1.00 104.29 ? 330 VAL B CB    1 
ATOM   5786  C  CG1   . VAL B 1 330 ? -50.646 73.760 -26.339 1.00 103.00 ? 330 VAL B CG1   1 
ATOM   5787  C  CG2   . VAL B 1 330 ? -50.286 75.812 -27.752 1.00 108.77 ? 330 VAL B CG2   1 
ATOM   5788  N  N     . ALA B 1 331 ? -49.594 74.737 -23.289 1.00 106.43 ? 331 ALA B N     1 
ATOM   5789  C  CA    . ALA B 1 331 ? -49.167 73.813 -22.263 1.00 117.36 ? 331 ALA B CA    1 
ATOM   5790  C  C     . ALA B 1 331 ? -50.332 72.996 -21.726 1.00 116.84 ? 331 ALA B C     1 
ATOM   5791  O  O     . ALA B 1 331 ? -51.498 73.242 -22.032 1.00 107.92 ? 331 ALA B O     1 
ATOM   5792  C  CB    . ALA B 1 331 ? -48.459 74.547 -21.135 1.00 129.65 ? 331 ALA B CB    1 
ATOM   5793  N  N     . ILE B 1 332 ? -50.009 72.035 -20.885 1.00 116.76 ? 332 ILE B N     1 
ATOM   5794  C  CA    . ILE B 1 332 ? -51.041 71.261 -20.265 1.00 110.91 ? 332 ILE B CA    1 
ATOM   5795  C  C     . ILE B 1 332 ? -51.376 71.850 -18.910 1.00 127.44 ? 332 ILE B C     1 
ATOM   5796  O  O     . ILE B 1 332 ? -50.539 71.849 -18.000 1.00 130.38 ? 332 ILE B O     1 
ATOM   5797  C  CB    . ILE B 1 332 ? -50.566 69.871 -20.076 1.00 103.52 ? 332 ILE B CB    1 
ATOM   5798  C  CG1   . ILE B 1 332 ? -50.399 69.220 -21.441 1.00 104.55 ? 332 ILE B CG1   1 
ATOM   5799  C  CG2   . ILE B 1 332 ? -51.553 69.141 -19.211 1.00 109.17 ? 332 ILE B CG2   1 
ATOM   5800  C  CD1   . ILE B 1 332 ? -51.663 69.220 -22.256 1.00 105.23 ? 332 ILE B CD1   1 
ATOM   5801  N  N     . ASP B 1 333 ? -52.600 72.371 -18.796 1.00 137.83 ? 333 ASP B N     1 
ATOM   5802  C  CA    . ASP B 1 333 ? -53.159 72.812 -17.514 1.00 135.99 ? 333 ASP B CA    1 
ATOM   5803  C  C     . ASP B 1 333 ? -54.422 72.005 -17.261 1.00 138.50 ? 333 ASP B C     1 
ATOM   5804  O  O     . ASP B 1 333 ? -55.198 71.750 -18.181 1.00 129.90 ? 333 ASP B O     1 
ATOM   5805  C  CB    . ASP B 1 333 ? -53.469 74.326 -17.470 1.00 104.02 ? 333 ASP B CB    1 
ATOM   5806  N  N     . ASN B 1 334 ? -54.605 71.575 -16.019 1.00 145.23 ? 334 ASN B N     1 
ATOM   5807  C  CA    . ASN B 1 334 ? -55.774 70.794 -15.660 1.00 139.22 ? 334 ASN B CA    1 
ATOM   5808  C  C     . ASN B 1 334 ? -55.935 69.560 -16.550 1.00 129.50 ? 334 ASN B C     1 
ATOM   5809  O  O     . ASN B 1 334 ? -57.039 69.229 -16.990 1.00 123.61 ? 334 ASN B O     1 
ATOM   5810  C  CB    . ASN B 1 334 ? -57.014 71.670 -15.734 1.00 141.26 ? 334 ASN B CB    1 
ATOM   5811  C  CG    . ASN B 1 334 ? -58.130 71.139 -14.897 1.00 144.17 ? 334 ASN B CG    1 
ATOM   5812  O  OD1   . ASN B 1 334 ? -59.304 71.384 -15.187 1.00 153.38 ? 334 ASN B OD1   1 
ATOM   5813  N  ND2   . ASN B 1 334 ? -57.779 70.388 -13.845 1.00 130.30 ? 334 ASN B ND2   1 
ATOM   5814  N  N     . PHE B 1 335 ? -54.824 68.881 -16.814 1.00 118.56 ? 335 PHE B N     1 
ATOM   5815  C  CA    . PHE B 1 335 ? -54.851 67.663 -17.614 1.00 111.01 ? 335 PHE B CA    1 
ATOM   5816  C  C     . PHE B 1 335 ? -55.256 67.921 -19.054 1.00 103.79 ? 335 PHE B C     1 
ATOM   5817  O  O     . PHE B 1 335 ? -55.549 66.974 -19.782 1.00 100.20 ? 335 PHE B O     1 
ATOM   5818  C  CB    . PHE B 1 335 ? -55.813 66.628 -17.023 1.00 115.03 ? 335 PHE B CB    1 
ATOM   5819  C  CG    . PHE B 1 335 ? -55.469 66.196 -15.636 1.00 127.55 ? 335 PHE B CG    1 
ATOM   5820  C  CD1   . PHE B 1 335 ? -56.299 66.499 -14.583 1.00 125.35 ? 335 PHE B CD1   1 
ATOM   5821  C  CD2   . PHE B 1 335 ? -54.309 65.484 -15.386 1.00 148.24 ? 335 PHE B CD2   1 
ATOM   5822  C  CE1   . PHE B 1 335 ? -55.974 66.105 -13.298 1.00 133.94 ? 335 PHE B CE1   1 
ATOM   5823  C  CE2   . PHE B 1 335 ? -53.978 65.082 -14.097 1.00 146.42 ? 335 PHE B CE2   1 
ATOM   5824  C  CZ    . PHE B 1 335 ? -54.810 65.396 -13.052 1.00 134.08 ? 335 PHE B CZ    1 
ATOM   5825  N  N     . THR B 1 336 ? -55.272 69.185 -19.473 1.00 108.74 ? 336 THR B N     1 
ATOM   5826  C  CA    . THR B 1 336 ? -55.717 69.514 -20.836 1.00 113.92 ? 336 THR B CA    1 
ATOM   5827  C  C     . THR B 1 336 ? -54.913 70.595 -21.584 1.00 116.59 ? 336 THR B C     1 
ATOM   5828  O  O     . THR B 1 336 ? -54.290 71.459 -20.968 1.00 125.44 ? 336 THR B O     1 
ATOM   5829  C  CB    . THR B 1 336 ? -57.204 69.891 -20.851 1.00 109.65 ? 336 THR B CB    1 
ATOM   5830  O  OG1   . THR B 1 336 ? -57.357 71.153 -21.507 1.00 117.82 ? 336 THR B OG1   1 
ATOM   5831  C  CG2   . THR B 1 336 ? -57.732 70.007 -19.439 1.00 91.27  ? 336 THR B CG2   1 
ATOM   5832  N  N     . PRO B 1 337 ? -54.940 70.544 -22.926 1.00 107.03 ? 337 PRO B N     1 
ATOM   5833  C  CA    . PRO B 1 337 ? -54.232 71.497 -23.792 1.00 96.16  ? 337 PRO B CA    1 
ATOM   5834  C  C     . PRO B 1 337 ? -54.851 72.863 -23.708 1.00 103.19 ? 337 PRO B C     1 
ATOM   5835  O  O     . PRO B 1 337 ? -56.023 73.005 -24.027 1.00 110.54 ? 337 PRO B O     1 
ATOM   5836  C  CB    . PRO B 1 337 ? -54.493 70.977 -25.212 1.00 93.32  ? 337 PRO B CB    1 
ATOM   5837  C  CG    . PRO B 1 337 ? -55.040 69.596 -25.048 1.00 104.39 ? 337 PRO B CG    1 
ATOM   5838  C  CD    . PRO B 1 337 ? -55.681 69.529 -23.693 1.00 107.56 ? 337 PRO B CD    1 
ATOM   5839  N  N     . ARG B 1 338 ? -54.081 73.852 -23.283 1.00 118.81 ? 338 ARG B N     1 
ATOM   5840  C  CA    . ARG B 1 338 ? -54.507 75.242 -23.380 1.00 126.04 ? 338 ARG B CA    1 
ATOM   5841  C  C     . ARG B 1 338 ? -53.464 76.030 -24.168 1.00 121.21 ? 338 ARG B C     1 
ATOM   5842  O  O     . ARG B 1 338 ? -52.257 75.793 -24.054 1.00 121.09 ? 338 ARG B O     1 
ATOM   5843  C  CB    . ARG B 1 338 ? -54.754 75.880 -21.996 1.00 77.98  ? 338 ARG B CB    1 
ATOM   5844  N  N     . GLN B 1 339 ? -53.929 76.975 -24.968 1.00 113.16 ? 339 GLN B N     1 
ATOM   5845  C  CA    . GLN B 1 339 ? -53.009 77.935 -25.533 1.00 111.63 ? 339 GLN B CA    1 
ATOM   5846  C  C     . GLN B 1 339 ? -53.104 79.138 -24.627 1.00 117.97 ? 339 GLN B C     1 
ATOM   5847  O  O     . GLN B 1 339 ? -54.174 79.712 -24.439 1.00 119.10 ? 339 GLN B O     1 
ATOM   5848  C  CB    . GLN B 1 339 ? -53.350 78.291 -26.971 1.00 109.93 ? 339 GLN B CB    1 
ATOM   5849  C  CG    . GLN B 1 339 ? -53.098 79.758 -27.269 1.00 130.50 ? 339 GLN B CG    1 
ATOM   5850  C  CD    . GLN B 1 339 ? -53.014 80.058 -28.748 1.00 147.24 ? 339 GLN B CD    1 
ATOM   5851  O  OE1   . GLN B 1 339 ? -53.366 81.156 -29.190 1.00 152.26 ? 339 GLN B OE1   1 
ATOM   5852  N  NE2   . GLN B 1 339 ? -52.539 79.083 -29.525 1.00 146.96 ? 339 GLN B NE2   1 
ATOM   5853  N  N     . VAL B 1 340 ? -51.976 79.493 -24.034 1.00 127.91 ? 340 VAL B N     1 
ATOM   5854  C  CA    . VAL B 1 340 ? -51.976 80.420 -22.921 1.00 134.77 ? 340 VAL B CA    1 
ATOM   5855  C  C     . VAL B 1 340 ? -50.967 81.540 -23.106 1.00 127.43 ? 340 VAL B C     1 
ATOM   5856  O  O     . VAL B 1 340 ? -49.945 81.366 -23.767 1.00 125.83 ? 340 VAL B O     1 
ATOM   5857  C  CB    . VAL B 1 340 ? -51.659 79.671 -21.633 1.00 138.51 ? 340 VAL B CB    1 
ATOM   5858  C  CG1   . VAL B 1 340 ? -52.772 78.679 -21.335 1.00 145.14 ? 340 VAL B CG1   1 
ATOM   5859  C  CG2   . VAL B 1 340 ? -50.329 78.954 -21.778 1.00 127.06 ? 340 VAL B CG2   1 
ATOM   5860  N  N     . GLY B 1 341 ? -51.270 82.691 -22.515 1.00 132.31 ? 341 GLY B N     1 
ATOM   5861  C  CA    . GLY B 1 341 ? -50.351 83.811 -22.511 1.00 142.69 ? 341 GLY B CA    1 
ATOM   5862  C  C     . GLY B 1 341 ? -49.426 83.792 -21.308 1.00 132.80 ? 341 GLY B C     1 
ATOM   5863  O  O     . GLY B 1 341 ? -49.295 82.781 -20.617 1.00 124.46 ? 341 GLY B O     1 
ATOM   5864  N  N     . ILE B 1 342 ? -48.770 84.914 -21.053 1.00 124.22 ? 342 ILE B N     1 
ATOM   5865  C  CA    . ILE B 1 342 ? -47.861 84.977 -19.934 1.00 127.52 ? 342 ILE B CA    1 
ATOM   5866  C  C     . ILE B 1 342 ? -48.629 84.912 -18.628 1.00 130.63 ? 342 ILE B C     1 
ATOM   5867  O  O     . ILE B 1 342 ? -48.230 84.209 -17.702 1.00 129.50 ? 342 ILE B O     1 
ATOM   5868  C  CB    . ILE B 1 342 ? -47.004 86.232 -19.989 1.00 136.30 ? 342 ILE B CB    1 
ATOM   5869  C  CG1   . ILE B 1 342 ? -45.601 85.855 -20.467 1.00 151.48 ? 342 ILE B CG1   1 
ATOM   5870  C  CG2   . ILE B 1 342 ? -46.945 86.898 -18.624 1.00 129.71 ? 342 ILE B CG2   1 
ATOM   5871  C  CD1   . ILE B 1 342 ? -44.513 86.834 -20.036 1.00 164.35 ? 342 ILE B CD1   1 
ATOM   5872  N  N     . VAL B 1 343 ? -49.741 85.636 -18.568 1.00 143.08 ? 343 VAL B N     1 
ATOM   5873  C  CA    . VAL B 1 343 ? -50.534 85.737 -17.344 1.00 140.48 ? 343 VAL B CA    1 
ATOM   5874  C  C     . VAL B 1 343 ? -51.017 84.398 -16.774 1.00 134.48 ? 343 VAL B C     1 
ATOM   5875  O  O     . VAL B 1 343 ? -50.886 84.146 -15.577 1.00 132.53 ? 343 VAL B O     1 
ATOM   5876  C  CB    . VAL B 1 343 ? -51.722 86.680 -17.549 1.00 130.90 ? 343 VAL B CB    1 
ATOM   5877  C  CG1   . VAL B 1 343 ? -52.784 86.405 -16.517 1.00 124.65 ? 343 VAL B CG1   1 
ATOM   5878  C  CG2   . VAL B 1 343 ? -51.247 88.127 -17.493 1.00 123.78 ? 343 VAL B CG2   1 
ATOM   5879  N  N     . PRO B 1 344 ? -51.601 83.548 -17.624 1.00 136.82 ? 344 PRO B N     1 
ATOM   5880  C  CA    . PRO B 1 344 ? -51.974 82.194 -17.203 1.00 138.18 ? 344 PRO B CA    1 
ATOM   5881  C  C     . PRO B 1 344 ? -50.769 81.376 -16.767 1.00 143.52 ? 344 PRO B C     1 
ATOM   5882  O  O     . PRO B 1 344 ? -50.861 80.682 -15.763 1.00 150.52 ? 344 PRO B O     1 
ATOM   5883  C  CB    . PRO B 1 344 ? -52.572 81.583 -18.472 1.00 138.88 ? 344 PRO B CB    1 
ATOM   5884  C  CG    . PRO B 1 344 ? -53.082 82.758 -19.231 1.00 155.29 ? 344 PRO B CG    1 
ATOM   5885  C  CD    . PRO B 1 344 ? -52.113 83.872 -18.965 1.00 150.39 ? 344 PRO B CD    1 
ATOM   5886  N  N     . ILE B 1 345 ? -49.669 81.436 -17.515 1.00 143.12 ? 345 ILE B N     1 
ATOM   5887  C  CA    . ILE B 1 345 ? -48.490 80.655 -17.164 1.00 134.39 ? 345 ILE B CA    1 
ATOM   5888  C  C     . ILE B 1 345 ? -48.003 81.073 -15.805 1.00 128.31 ? 345 ILE B C     1 
ATOM   5889  O  O     . ILE B 1 345 ? -47.896 80.254 -14.894 1.00 137.97 ? 345 ILE B O     1 
ATOM   5890  C  CB    . ILE B 1 345 ? -47.327 80.864 -18.125 1.00 130.70 ? 345 ILE B CB    1 
ATOM   5891  C  CG1   . ILE B 1 345 ? -47.724 80.458 -19.545 1.00 131.49 ? 345 ILE B CG1   1 
ATOM   5892  C  CG2   . ILE B 1 345 ? -46.122 80.050 -17.652 1.00 119.72 ? 345 ILE B CG2   1 
ATOM   5893  C  CD1   . ILE B 1 345 ? -46.806 81.017 -20.600 1.00 132.89 ? 345 ILE B CD1   1 
ATOM   5894  N  N     . LEU B 1 346 ? -47.714 82.363 -15.674 1.00 130.00 ? 346 LEU B N     1 
ATOM   5895  C  CA    . LEU B 1 346 ? -47.215 82.909 -14.419 1.00 140.19 ? 346 LEU B CA    1 
ATOM   5896  C  C     . LEU B 1 346 ? -48.155 82.580 -13.269 1.00 134.47 ? 346 LEU B C     1 
ATOM   5897  O  O     . LEU B 1 346 ? -47.741 82.037 -12.240 1.00 138.89 ? 346 LEU B O     1 
ATOM   5898  C  CB    . LEU B 1 346 ? -47.015 84.419 -14.534 1.00 140.69 ? 346 LEU B CB    1 
ATOM   5899  C  CG    . LEU B 1 346 ? -45.722 84.830 -15.237 1.00 139.83 ? 346 LEU B CG    1 
ATOM   5900  C  CD1   . LEU B 1 346 ? -45.637 86.342 -15.331 1.00 139.26 ? 346 LEU B CD1   1 
ATOM   5901  C  CD2   . LEU B 1 346 ? -44.514 84.263 -14.498 1.00 134.72 ? 346 LEU B CD2   1 
ATOM   5902  N  N     . SER B 1 347 ? -49.431 82.884 -13.452 1.00 121.28 ? 347 SER B N     1 
ATOM   5903  C  CA    . SER B 1 347 ? -50.390 82.627 -12.399 1.00 125.89 ? 347 SER B CA    1 
ATOM   5904  C  C     . SER B 1 347 ? -50.404 81.170 -11.975 1.00 127.68 ? 347 SER B C     1 
ATOM   5905  O  O     . SER B 1 347 ? -50.288 80.862 -10.800 1.00 140.15 ? 347 SER B O     1 
ATOM   5906  C  CB    . SER B 1 347 ? -51.785 82.988 -12.837 1.00 138.12 ? 347 SER B CB    1 
ATOM   5907  O  OG    . SER B 1 347 ? -52.679 82.329 -11.962 1.00 157.88 ? 347 SER B OG    1 
ATOM   5908  N  N     . SER B 1 348 ? -50.580 80.279 -12.938 1.00 127.38 ? 348 SER B N     1 
ATOM   5909  C  CA    . SER B 1 348 ? -50.695 78.861 -12.643 1.00 132.43 ? 348 SER B CA    1 
ATOM   5910  C  C     . SER B 1 348 ? -49.440 78.351 -11.959 1.00 122.16 ? 348 SER B C     1 
ATOM   5911  O  O     . SER B 1 348 ? -49.517 77.459 -11.119 1.00 128.28 ? 348 SER B O     1 
ATOM   5912  C  CB    . SER B 1 348 ? -51.016 78.040 -13.902 1.00 147.78 ? 348 SER B CB    1 
ATOM   5913  O  OG    . SER B 1 348 ? -49.963 78.082 -14.849 1.00 153.43 ? 348 SER B OG    1 
ATOM   5914  N  N     . TYR B 1 349 ? -48.286 78.896 -12.332 1.00 118.95 ? 349 TYR B N     1 
ATOM   5915  C  CA    . TYR B 1 349 ? -47.043 78.532 -11.657 1.00 128.75 ? 349 TYR B CA    1 
ATOM   5916  C  C     . TYR B 1 349 ? -47.097 78.960 -10.190 1.00 111.26 ? 349 TYR B C     1 
ATOM   5917  O  O     . TYR B 1 349 ? -46.792 78.177 -9.276  1.00 99.18  ? 349 TYR B O     1 
ATOM   5918  C  CB    . TYR B 1 349 ? -45.813 79.144 -12.348 1.00 134.31 ? 349 TYR B CB    1 
ATOM   5919  C  CG    . TYR B 1 349 ? -44.588 79.062 -11.472 1.00 130.39 ? 349 TYR B CG    1 
ATOM   5920  C  CD1   . TYR B 1 349 ? -43.803 77.922 -11.443 1.00 133.17 ? 349 TYR B CD1   1 
ATOM   5921  C  CD2   . TYR B 1 349 ? -44.249 80.105 -10.639 1.00 118.52 ? 349 TYR B CD2   1 
ATOM   5922  C  CE1   . TYR B 1 349 ? -42.705 77.840 -10.618 1.00 132.81 ? 349 TYR B CE1   1 
ATOM   5923  C  CE2   . TYR B 1 349 ? -43.162 80.031 -9.815  1.00 110.93 ? 349 TYR B CE2   1 
ATOM   5924  C  CZ    . TYR B 1 349 ? -42.394 78.906 -9.803  1.00 128.50 ? 349 TYR B CZ    1 
ATOM   5925  O  OH    . TYR B 1 349 ? -41.306 78.859 -8.965  1.00 142.88 ? 349 TYR B OH    1 
ATOM   5926  N  N     . ILE B 1 350 ? -47.487 80.210 -9.978  1.00 98.42  ? 350 ILE B N     1 
ATOM   5927  C  CA    . ILE B 1 350 ? -47.637 80.745 -8.634  1.00 116.52 ? 350 ILE B CA    1 
ATOM   5928  C  C     . ILE B 1 350 ? -48.541 79.875 -7.756  1.00 114.43 ? 350 ILE B C     1 
ATOM   5929  O  O     . ILE B 1 350 ? -48.160 79.474 -6.646  1.00 106.12 ? 350 ILE B O     1 
ATOM   5930  C  CB    . ILE B 1 350 ? -48.214 82.165 -8.675  1.00 116.87 ? 350 ILE B CB    1 
ATOM   5931  C  CG1   . ILE B 1 350 ? -47.133 83.161 -9.088  1.00 121.63 ? 350 ILE B CG1   1 
ATOM   5932  C  CG2   . ILE B 1 350 ? -48.796 82.531 -7.321  1.00 111.79 ? 350 ILE B CG2   1 
ATOM   5933  C  CD1   . ILE B 1 350 ? -47.644 84.570 -9.248  1.00 124.37 ? 350 ILE B CD1   1 
ATOM   5934  N  N     . ALA B 1 351 ? -49.737 79.589 -8.258  1.00 107.90 ? 351 ALA B N     1 
ATOM   5935  C  CA    . ALA B 1 351 ? -50.705 78.802 -7.515  1.00 111.41 ? 351 ALA B CA    1 
ATOM   5936  C  C     . ALA B 1 351 ? -50.150 77.427 -7.198  1.00 115.84 ? 351 ALA B C     1 
ATOM   5937  O  O     . ALA B 1 351 ? -50.524 76.811 -6.187  1.00 118.37 ? 351 ALA B O     1 
ATOM   5938  C  CB    . ALA B 1 351 ? -51.986 78.682 -8.271  1.00 115.81 ? 351 ALA B CB    1 
ATOM   5939  N  N     . HIS B 1 352 ? -49.280 76.936 -8.078  1.00 116.55 ? 352 HIS B N     1 
ATOM   5940  C  CA    . HIS B 1 352 ? -48.618 75.656 -7.854  1.00 111.74 ? 352 HIS B CA    1 
ATOM   5941  C  C     . HIS B 1 352 ? -47.709 75.767 -6.662  1.00 112.75 ? 352 HIS B C     1 
ATOM   5942  O  O     . HIS B 1 352 ? -47.792 74.992 -5.714  1.00 114.26 ? 352 HIS B O     1 
ATOM   5943  C  CB    . HIS B 1 352 ? -47.750 75.290 -9.038  1.00 110.78 ? 352 HIS B CB    1 
ATOM   5944  C  CG    . HIS B 1 352 ? -47.096 73.956 -8.901  1.00 118.04 ? 352 HIS B CG    1 
ATOM   5945  N  ND1   . HIS B 1 352 ? -45.730 73.795 -8.887  1.00 121.87 ? 352 HIS B ND1   1 
ATOM   5946  C  CD2   . HIS B 1 352 ? -47.623 72.718 -8.760  1.00 127.00 ? 352 HIS B CD2   1 
ATOM   5947  C  CE1   . HIS B 1 352 ? -45.441 72.514 -8.747  1.00 124.76 ? 352 HIS B CE1   1 
ATOM   5948  N  NE2   . HIS B 1 352 ? -46.572 71.838 -8.676  1.00 123.69 ? 352 HIS B NE2   1 
ATOM   5949  N  N     . ARG B 1 353 ? -46.829 76.750 -6.720  1.00 116.27 ? 353 ARG B N     1 
ATOM   5950  C  CA    . ARG B 1 353 ? -45.902 76.951 -5.638  1.00 120.94 ? 353 ARG B CA    1 
ATOM   5951  C  C     . ARG B 1 353 ? -46.650 77.046 -4.318  1.00 110.77 ? 353 ARG B C     1 
ATOM   5952  O  O     . ARG B 1 353 ? -46.108 76.655 -3.284  1.00 117.37 ? 353 ARG B O     1 
ATOM   5953  C  CB    . ARG B 1 353 ? -45.023 78.172 -5.904  1.00 124.59 ? 353 ARG B CB    1 
ATOM   5954  C  CG    . ARG B 1 353 ? -43.992 77.953 -7.041  1.00 129.03 ? 353 ARG B CG    1 
ATOM   5955  C  CD    . ARG B 1 353 ? -42.902 76.933 -6.657  1.00 128.70 ? 353 ARG B CD    1 
ATOM   5956  N  NE    . ARG B 1 353 ? -42.361 77.213 -5.330  1.00 139.09 ? 353 ARG B NE    1 
ATOM   5957  C  CZ    . ARG B 1 353 ? -41.542 76.414 -4.654  1.00 137.52 ? 353 ARG B CZ    1 
ATOM   5958  N  NH1   . ARG B 1 353 ? -41.145 75.260 -5.176  1.00 125.99 ? 353 ARG B NH1   1 
ATOM   5959  N  NH2   . ARG B 1 353 ? -41.120 76.784 -3.449  1.00 140.93 ? 353 ARG B NH2   1 
ATOM   5960  N  N     . ARG B 1 354 ? -47.883 77.555 -4.345  1.00 88.69  ? 354 ARG B N     1 
ATOM   5961  C  CA    . ARG B 1 354 ? -48.676 77.662 -3.114  1.00 113.83 ? 354 ARG B CA    1 
ATOM   5962  C  C     . ARG B 1 354 ? -49.014 76.295 -2.548  1.00 122.23 ? 354 ARG B C     1 
ATOM   5963  O  O     . ARG B 1 354 ? -48.812 76.026 -1.359  1.00 124.00 ? 354 ARG B O     1 
ATOM   5964  C  CB    . ARG B 1 354 ? -49.974 78.437 -3.319  1.00 111.17 ? 354 ARG B CB    1 
ATOM   5965  C  CG    . ARG B 1 354 ? -50.932 78.390 -2.101  1.00 112.29 ? 354 ARG B CG    1 
ATOM   5966  C  CD    . ARG B 1 354 ? -52.199 79.234 -2.326  1.00 115.22 ? 354 ARG B CD    1 
ATOM   5967  N  NE    . ARG B 1 354 ? -53.265 78.966 -1.359  1.00 121.26 ? 354 ARG B NE    1 
ATOM   5968  C  CZ    . ARG B 1 354 ? -54.187 78.013 -1.497  1.00 134.85 ? 354 ARG B CZ    1 
ATOM   5969  N  NH1   . ARG B 1 354 ? -54.176 77.216 -2.559  1.00 142.69 ? 354 ARG B NH1   1 
ATOM   5970  N  NH2   . ARG B 1 354 ? -55.123 77.851 -0.571  1.00 133.02 ? 354 ARG B NH2   1 
ATOM   5971  N  N     . GLU B 1 355 ? -49.546 75.434 -3.402  1.00 121.82 ? 355 GLU B N     1 
ATOM   5972  C  CA    . GLU B 1 355 ? -49.830 74.073 -2.984  1.00 133.02 ? 355 GLU B CA    1 
ATOM   5973  C  C     . GLU B 1 355 ? -48.546 73.445 -2.459  1.00 118.64 ? 355 GLU B C     1 
ATOM   5974  O  O     . GLU B 1 355 ? -48.548 72.768 -1.440  1.00 112.11 ? 355 GLU B O     1 
ATOM   5975  C  CB    . GLU B 1 355 ? -50.392 73.253 -4.147  1.00 149.18 ? 355 GLU B CB    1 
ATOM   5976  C  CG    . GLU B 1 355 ? -51.714 73.769 -4.691  1.00 165.64 ? 355 GLU B CG    1 
ATOM   5977  C  CD    . GLU B 1 355 ? -52.867 73.551 -3.733  1.00 174.69 ? 355 GLU B CD    1 
ATOM   5978  O  OE1   . GLU B 1 355 ? -53.984 74.023 -4.038  1.00 180.57 ? 355 GLU B OE1   1 
ATOM   5979  O  OE2   . GLU B 1 355 ? -52.655 72.912 -2.679  1.00 172.99 ? 355 GLU B OE2   1 
ATOM   5980  N  N     . VAL B 1 356 ? -47.442 73.679 -3.154  1.00 115.66 ? 356 VAL B N     1 
ATOM   5981  C  CA    . VAL B 1 356 ? -46.195 73.053 -2.754  1.00 120.56 ? 356 VAL B CA    1 
ATOM   5982  C  C     . VAL B 1 356 ? -45.830 73.482 -1.354  1.00 113.05 ? 356 VAL B C     1 
ATOM   5983  O  O     . VAL B 1 356 ? -45.629 72.653 -0.476  1.00 114.90 ? 356 VAL B O     1 
ATOM   5984  C  CB    . VAL B 1 356 ? -45.032 73.419 -3.670  1.00 118.06 ? 356 VAL B CB    1 
ATOM   5985  C  CG1   . VAL B 1 356 ? -43.781 72.654 -3.229  1.00 100.19 ? 356 VAL B CG1   1 
ATOM   5986  C  CG2   . VAL B 1 356 ? -45.390 73.087 -5.109  1.00 130.15 ? 356 VAL B CG2   1 
ATOM   5987  N  N     . ILE B 1 357 ? -45.759 74.787 -1.149  1.00 109.41 ? 357 ILE B N     1 
ATOM   5988  C  CA    . ILE B 1 357 ? -45.362 75.325 0.137   1.00 112.20 ? 357 ILE B CA    1 
ATOM   5989  C  C     . ILE B 1 357 ? -46.240 74.806 1.269   1.00 114.52 ? 357 ILE B C     1 
ATOM   5990  O  O     . ILE B 1 357 ? -45.728 74.313 2.275   1.00 112.47 ? 357 ILE B O     1 
ATOM   5991  C  CB    . ILE B 1 357 ? -45.422 76.834 0.124   1.00 115.96 ? 357 ILE B CB    1 
ATOM   5992  C  CG1   . ILE B 1 357 ? -44.334 77.376 -0.794  1.00 121.05 ? 357 ILE B CG1   1 
ATOM   5993  C  CG2   . ILE B 1 357 ? -45.246 77.367 1.526   1.00 118.44 ? 357 ILE B CG2   1 
ATOM   5994  C  CD1   . ILE B 1 357 ? -43.785 78.680 -0.306  1.00 134.59 ? 357 ILE B CD1   1 
ATOM   5995  N  N     . LEU B 1 358 ? -47.557 74.914 1.100   1.00 107.23 ? 358 LEU B N     1 
ATOM   5996  C  CA    . LEU B 1 358 ? -48.494 74.405 2.097   1.00 102.64 ? 358 LEU B CA    1 
ATOM   5997  C  C     . LEU B 1 358 ? -48.310 72.908 2.371   1.00 109.48 ? 358 LEU B C     1 
ATOM   5998  O  O     . LEU B 1 358 ? -48.264 72.477 3.514   1.00 129.51 ? 358 LEU B O     1 
ATOM   5999  C  CB    . LEU B 1 358 ? -49.937 74.693 1.689   1.00 104.88 ? 358 LEU B CB    1 
ATOM   6000  C  CG    . LEU B 1 358 ? -50.366 76.154 1.541   1.00 112.86 ? 358 LEU B CG    1 
ATOM   6001  C  CD1   . LEU B 1 358 ? -51.885 76.270 1.465   1.00 108.86 ? 358 LEU B CD1   1 
ATOM   6002  C  CD2   . LEU B 1 358 ? -49.845 76.986 2.694   1.00 123.63 ? 358 LEU B CD2   1 
ATOM   6003  N  N     . ALA B 1 359 ? -48.219 72.111 1.319   1.00 112.95 ? 359 ALA B N     1 
ATOM   6004  C  CA    . ALA B 1 359 ? -48.058 70.673 1.480   1.00 122.41 ? 359 ALA B CA    1 
ATOM   6005  C  C     . ALA B 1 359 ? -46.755 70.370 2.199   1.00 124.12 ? 359 ALA B C     1 
ATOM   6006  O  O     . ALA B 1 359 ? -46.695 69.507 3.072   1.00 131.76 ? 359 ALA B O     1 
ATOM   6007  C  CB    . ALA B 1 359 ? -48.090 69.998 0.146   1.00 131.72 ? 359 ALA B CB    1 
ATOM   6008  N  N     . ARG B 1 360 ? -45.709 71.084 1.818   1.00 123.59 ? 360 ARG B N     1 
ATOM   6009  C  CA    . ARG B 1 360 ? -44.416 70.923 2.453   1.00 124.11 ? 360 ARG B CA    1 
ATOM   6010  C  C     . ARG B 1 360 ? -44.543 71.170 3.945   1.00 121.75 ? 360 ARG B C     1 
ATOM   6011  O  O     . ARG B 1 360 ? -44.199 70.324 4.762   1.00 119.63 ? 360 ARG B O     1 
ATOM   6012  C  CB    . ARG B 1 360 ? -43.435 71.930 1.871   1.00 118.53 ? 360 ARG B CB    1 
ATOM   6013  C  CG    . ARG B 1 360 ? -42.054 71.777 2.419   1.00 124.13 ? 360 ARG B CG    1 
ATOM   6014  C  CD    . ARG B 1 360 ? -41.488 73.119 2.798   1.00 142.54 ? 360 ARG B CD    1 
ATOM   6015  N  NE    . ARG B 1 360 ? -41.162 73.935 1.640   1.00 142.50 ? 360 ARG B NE    1 
ATOM   6016  C  CZ    . ARG B 1 360 ? -41.164 75.259 1.659   1.00 150.55 ? 360 ARG B CZ    1 
ATOM   6017  N  NH1   . ARG B 1 360 ? -41.495 75.911 2.777   1.00 147.94 ? 360 ARG B NH1   1 
ATOM   6018  N  NH2   . ARG B 1 360 ? -40.848 75.922 0.557   1.00 154.35 ? 360 ARG B NH2   1 
ATOM   6019  N  N     . SER B 1 361 ? -45.040 72.347 4.296   1.00 127.20 ? 361 SER B N     1 
ATOM   6020  C  CA    . SER B 1 361 ? -45.144 72.723 5.695   1.00 128.90 ? 361 SER B CA    1 
ATOM   6021  C  C     . SER B 1 361 ? -45.969 71.708 6.474   1.00 133.53 ? 361 SER B C     1 
ATOM   6022  O  O     . SER B 1 361 ? -45.590 71.326 7.569   1.00 143.71 ? 361 SER B O     1 
ATOM   6023  C  CB    . SER B 1 361 ? -45.697 74.138 5.820   1.00 124.00 ? 361 SER B CB    1 
ATOM   6024  O  OG    . SER B 1 361 ? -44.795 75.040 5.195   1.00 126.41 ? 361 SER B OG    1 
ATOM   6025  N  N     . ARG B 1 362 ? -47.080 71.250 5.906   1.00 124.09 ? 362 ARG B N     1 
ATOM   6026  C  CA    . ARG B 1 362 ? -47.899 70.251 6.582   1.00 112.78 ? 362 ARG B CA    1 
ATOM   6027  C  C     . ARG B 1 362 ? -47.074 69.024 6.950   1.00 123.02 ? 362 ARG B C     1 
ATOM   6028  O  O     . ARG B 1 362 ? -47.183 68.506 8.061   1.00 133.54 ? 362 ARG B O     1 
ATOM   6029  C  CB    . ARG B 1 362 ? -49.113 69.868 5.744   1.00 104.21 ? 362 ARG B CB    1 
ATOM   6030  C  CG    . ARG B 1 362 ? -50.324 70.713 6.048   1.00 121.78 ? 362 ARG B CG    1 
ATOM   6031  C  CD    . ARG B 1 362 ? -51.571 70.276 5.295   1.00 133.45 ? 362 ARG B CD    1 
ATOM   6032  N  NE    . ARG B 1 362 ? -51.775 71.026 4.061   1.00 135.28 ? 362 ARG B NE    1 
ATOM   6033  C  CZ    . ARG B 1 362 ? -51.580 70.521 2.850   1.00 149.92 ? 362 ARG B CZ    1 
ATOM   6034  N  NH1   . ARG B 1 362 ? -51.173 69.258 2.709   1.00 143.74 ? 362 ARG B NH1   1 
ATOM   6035  N  NH2   . ARG B 1 362 ? -51.792 71.280 1.779   1.00 161.40 ? 362 ARG B NH2   1 
ATOM   6036  N  N     . PHE B 1 363 ? -46.253 68.562 6.013   1.00 111.70 ? 363 PHE B N     1 
ATOM   6037  C  CA    . PHE B 1 363 ? -45.360 67.434 6.254   1.00 111.07 ? 363 PHE B CA    1 
ATOM   6038  C  C     . PHE B 1 363 ? -44.336 67.743 7.330   1.00 106.69 ? 363 PHE B C     1 
ATOM   6039  O  O     . PHE B 1 363 ? -44.081 66.914 8.191   1.00 110.20 ? 363 PHE B O     1 
ATOM   6040  C  CB    . PHE B 1 363 ? -44.623 67.069 4.975   1.00 116.43 ? 363 PHE B CB    1 
ATOM   6041  C  CG    . PHE B 1 363 ? -43.665 65.906 5.113   1.00 120.92 ? 363 PHE B CG    1 
ATOM   6042  C  CD1   . PHE B 1 363 ? -44.113 64.603 5.011   1.00 143.61 ? 363 PHE B CD1   1 
ATOM   6043  C  CD2   . PHE B 1 363 ? -42.313 66.118 5.280   1.00 103.02 ? 363 PHE B CD2   1 
ATOM   6044  C  CE1   . PHE B 1 363 ? -43.229 63.542 5.094   1.00 147.09 ? 363 PHE B CE1   1 
ATOM   6045  C  CE2   . PHE B 1 363 ? -41.434 65.062 5.367   1.00 112.04 ? 363 PHE B CE2   1 
ATOM   6046  C  CZ    . PHE B 1 363 ? -41.890 63.780 5.273   1.00 135.78 ? 363 PHE B CZ    1 
ATOM   6047  N  N     . ASP B 1 364 ? -43.736 68.928 7.261   1.00 110.81 ? 364 ASP B N     1 
ATOM   6048  C  CA    . ASP B 1 364 ? -42.723 69.353 8.229   1.00 129.17 ? 364 ASP B CA    1 
ATOM   6049  C  C     . ASP B 1 364 ? -43.281 69.414 9.650   1.00 125.46 ? 364 ASP B C     1 
ATOM   6050  O  O     . ASP B 1 364 ? -42.604 69.063 10.631  1.00 103.90 ? 364 ASP B O     1 
ATOM   6051  C  CB    . ASP B 1 364 ? -42.196 70.740 7.853   1.00 154.86 ? 364 ASP B CB    1 
ATOM   6052  C  CG    . ASP B 1 364 ? -40.881 70.688 7.094   1.00 181.79 ? 364 ASP B CG    1 
ATOM   6053  O  OD1   . ASP B 1 364 ? -40.192 69.643 7.140   1.00 188.22 ? 364 ASP B OD1   1 
ATOM   6054  O  OD2   . ASP B 1 364 ? -40.532 71.710 6.461   1.00 191.81 ? 364 ASP B OD2   1 
ATOM   6055  N  N     . LYS B 1 365 ? -44.515 69.900 9.741   1.00 131.11 ? 365 LYS B N     1 
ATOM   6056  C  CA    . LYS B 1 365 ? -45.207 70.065 11.007  1.00 124.52 ? 365 LYS B CA    1 
ATOM   6057  C  C     . LYS B 1 365 ? -45.420 68.710 11.661  1.00 128.08 ? 365 LYS B C     1 
ATOM   6058  O  O     . LYS B 1 365 ? -45.035 68.522 12.805  1.00 133.59 ? 365 LYS B O     1 
ATOM   6059  C  CB    . LYS B 1 365 ? -46.527 70.814 10.798  1.00 120.26 ? 365 LYS B CB    1 
ATOM   6060  C  CG    . LYS B 1 365 ? -47.292 71.146 12.066  1.00 123.54 ? 365 LYS B CG    1 
ATOM   6061  C  CD    . LYS B 1 365 ? -48.226 72.339 11.869  1.00 118.45 ? 365 LYS B CD    1 
ATOM   6062  C  CE    . LYS B 1 365 ? -49.669 72.021 12.284  1.00 123.11 ? 365 LYS B CE    1 
ATOM   6063  N  NZ    . LYS B 1 365 ? -49.853 71.726 13.730  1.00 121.87 ? 365 LYS B NZ    1 
ATOM   6064  N  N     . GLU B 1 366 ? -45.994 67.754 10.932  1.00 126.00 ? 366 GLU B N     1 
ATOM   6065  C  CA    . GLU B 1 366 ? -46.191 66.413 11.488  1.00 124.91 ? 366 GLU B CA    1 
ATOM   6066  C  C     . GLU B 1 366 ? -44.875 65.874 12.046  1.00 125.74 ? 366 GLU B C     1 
ATOM   6067  O  O     . GLU B 1 366 ? -44.816 65.433 13.195  1.00 121.01 ? 366 GLU B O     1 
ATOM   6068  C  CB    . GLU B 1 366 ? -46.778 65.432 10.450  1.00 102.26 ? 366 GLU B CB    1 
ATOM   6069  N  N     . LYS B 1 367 ? -43.818 65.929 11.241  1.00 123.30 ? 367 LYS B N     1 
ATOM   6070  C  CA    . LYS B 1 367 ? -42.512 65.444 11.677  1.00 113.62 ? 367 LYS B CA    1 
ATOM   6071  C  C     . LYS B 1 367 ? -42.099 66.136 12.965  1.00 118.84 ? 367 LYS B C     1 
ATOM   6072  O  O     . LYS B 1 367 ? -41.674 65.480 13.914  1.00 122.31 ? 367 LYS B O     1 
ATOM   6073  C  CB    . LYS B 1 367 ? -41.430 65.614 10.596  1.00 96.93  ? 367 LYS B CB    1 
ATOM   6074  N  N     . ALA B 1 368 ? -42.236 67.458 13.000  1.00 120.86 ? 368 ALA B N     1 
ATOM   6075  C  CA    . ALA B 1 368 ? -41.921 68.209 14.211  1.00 120.84 ? 368 ALA B CA    1 
ATOM   6076  C  C     . ALA B 1 368 ? -42.709 67.653 15.400  1.00 125.62 ? 368 ALA B C     1 
ATOM   6077  O  O     . ALA B 1 368 ? -42.134 67.241 16.400  1.00 132.18 ? 368 ALA B O     1 
ATOM   6078  C  CB    . ALA B 1 368 ? -42.216 69.692 14.010  1.00 104.16 ? 368 ALA B CB    1 
ATOM   6079  N  N     . GLU B 1 369 ? -44.025 67.615 15.265  1.00 124.22 ? 369 GLU B N     1 
ATOM   6080  C  CA    . GLU B 1 369 ? -44.895 67.161 16.333  1.00 121.73 ? 369 GLU B CA    1 
ATOM   6081  C  C     . GLU B 1 369 ? -44.540 65.771 16.841  1.00 124.52 ? 369 GLU B C     1 
ATOM   6082  O  O     . GLU B 1 369 ? -44.647 65.511 18.034  1.00 129.84 ? 369 GLU B O     1 
ATOM   6083  C  CB    . GLU B 1 369 ? -46.347 67.226 15.881  1.00 123.03 ? 369 GLU B CB    1 
ATOM   6084  N  N     . LYS B 1 370 ? -44.127 64.874 15.949  1.00 116.94 ? 370 LYS B N     1 
ATOM   6085  C  CA    . LYS B 1 370 ? -43.755 63.516 16.368  1.00 119.47 ? 370 LYS B CA    1 
ATOM   6086  C  C     . LYS B 1 370 ? -42.535 63.510 17.283  1.00 130.45 ? 370 LYS B C     1 
ATOM   6087  O  O     . LYS B 1 370 ? -42.619 63.039 18.416  1.00 134.81 ? 370 LYS B O     1 
ATOM   6088  C  CB    . LYS B 1 370 ? -43.514 62.561 15.179  1.00 99.25  ? 370 LYS B CB    1 
ATOM   6089  N  N     . ARG B 1 371 ? -41.408 64.030 16.798  1.00 129.70 ? 371 ARG B N     1 
ATOM   6090  C  CA    . ARG B 1 371 ? -40.188 64.064 17.605  1.00 120.10 ? 371 ARG B CA    1 
ATOM   6091  C  C     . ARG B 1 371 ? -40.447 64.831 18.873  1.00 123.00 ? 371 ARG B C     1 
ATOM   6092  O  O     . ARG B 1 371 ? -39.910 64.491 19.916  1.00 127.59 ? 371 ARG B O     1 
ATOM   6093  C  CB    . ARG B 1 371 ? -39.066 64.754 16.855  1.00 111.32 ? 371 ARG B CB    1 
ATOM   6094  C  CG    . ARG B 1 371 ? -37.869 65.063 17.705  1.00 120.04 ? 371 ARG B CG    1 
ATOM   6095  C  CD    . ARG B 1 371 ? -36.944 63.864 17.862  1.00 133.83 ? 371 ARG B CD    1 
ATOM   6096  N  NE    . ARG B 1 371 ? -35.742 64.227 18.611  1.00 149.04 ? 371 ARG B NE    1 
ATOM   6097  C  CZ    . ARG B 1 371 ? -34.884 63.354 19.128  1.00 162.60 ? 371 ARG B CZ    1 
ATOM   6098  N  NH1   . ARG B 1 371 ? -35.097 62.053 18.981  1.00 174.92 ? 371 ARG B NH1   1 
ATOM   6099  N  NH2   . ARG B 1 371 ? -33.818 63.784 19.798  1.00 156.48 ? 371 ARG B NH2   1 
ATOM   6100  N  N     . LEU B 1 372 ? -41.260 65.880 18.768  1.00 123.98 ? 372 LEU B N     1 
ATOM   6101  C  CA    . LEU B 1 372 ? -41.637 66.700 19.917  1.00 113.21 ? 372 LEU B CA    1 
ATOM   6102  C  C     . LEU B 1 372 ? -42.302 65.848 20.982  1.00 123.58 ? 372 LEU B C     1 
ATOM   6103  O  O     . LEU B 1 372 ? -41.909 65.894 22.143  1.00 130.44 ? 372 LEU B O     1 
ATOM   6104  C  CB    . LEU B 1 372 ? -42.536 67.865 19.493  1.00 111.33 ? 372 LEU B CB    1 
ATOM   6105  C  CG    . LEU B 1 372 ? -43.325 68.742 20.482  1.00 126.47 ? 372 LEU B CG    1 
ATOM   6106  C  CD1   . LEU B 1 372 ? -44.681 68.105 20.834  1.00 139.71 ? 372 LEU B CD1   1 
ATOM   6107  C  CD2   . LEU B 1 372 ? -42.542 69.083 21.725  1.00 95.18  ? 372 LEU B CD2   1 
ATOM   6108  N  N     . HIS B 1 373 ? -43.299 65.064 20.584  1.00 124.55 ? 373 HIS B N     1 
ATOM   6109  C  CA    . HIS B 1 373 ? -43.957 64.136 21.499  1.00 131.90 ? 373 HIS B CA    1 
ATOM   6110  C  C     . HIS B 1 373 ? -42.941 63.172 22.121  1.00 138.73 ? 373 HIS B C     1 
ATOM   6111  O  O     . HIS B 1 373 ? -42.996 62.884 23.315  1.00 147.02 ? 373 HIS B O     1 
ATOM   6112  C  CB    . HIS B 1 373 ? -45.057 63.381 20.771  1.00 134.65 ? 373 HIS B CB    1 
ATOM   6113  C  CG    . HIS B 1 373 ? -45.751 62.342 21.595  1.00 142.18 ? 373 HIS B CG    1 
ATOM   6114  N  ND1   . HIS B 1 373 ? -46.567 62.658 22.660  1.00 153.11 ? 373 HIS B ND1   1 
ATOM   6115  C  CD2   . HIS B 1 373 ? -45.802 60.992 21.468  1.00 136.93 ? 373 HIS B CD2   1 
ATOM   6116  C  CE1   . HIS B 1 373 ? -47.071 61.545 23.168  1.00 153.50 ? 373 HIS B CE1   1 
ATOM   6117  N  NE2   . HIS B 1 373 ? -46.625 60.521 22.462  1.00 141.48 ? 373 HIS B NE2   1 
ATOM   6118  N  N     . ILE B 1 374 ? -42.016 62.679 21.303  1.00 131.98 ? 374 ILE B N     1 
ATOM   6119  C  CA    . ILE B 1 374 ? -40.929 61.822 21.778  1.00 127.87 ? 374 ILE B CA    1 
ATOM   6120  C  C     . ILE B 1 374 ? -39.954 62.517 22.757  1.00 126.50 ? 374 ILE B C     1 
ATOM   6121  O  O     . ILE B 1 374 ? -39.599 61.963 23.794  1.00 119.38 ? 374 ILE B O     1 
ATOM   6122  C  CB    . ILE B 1 374 ? -40.181 61.195 20.584  1.00 111.56 ? 374 ILE B CB    1 
ATOM   6123  C  CG1   . ILE B 1 374 ? -41.117 60.211 19.886  1.00 136.04 ? 374 ILE B CG1   1 
ATOM   6124  C  CG2   . ILE B 1 374 ? -38.891 60.502 21.017  1.00 99.06  ? 374 ILE B CG2   1 
ATOM   6125  C  CD1   . ILE B 1 374 ? -40.415 59.079 19.149  1.00 156.44 ? 374 ILE B CD1   1 
ATOM   6126  N  N     . VAL B 1 375 ? -39.529 63.728 22.420  1.00 126.67 ? 375 VAL B N     1 
ATOM   6127  C  CA    . VAL B 1 375 ? -38.690 64.546 23.289  1.00 133.41 ? 375 VAL B CA    1 
ATOM   6128  C  C     . VAL B 1 375 ? -39.392 64.872 24.601  1.00 127.32 ? 375 VAL B C     1 
ATOM   6129  O  O     . VAL B 1 375 ? -38.794 64.829 25.683  1.00 124.69 ? 375 VAL B O     1 
ATOM   6130  C  CB    . VAL B 1 375 ? -38.366 65.878 22.612  1.00 136.02 ? 375 VAL B CB    1 
ATOM   6131  C  CG1   . VAL B 1 375 ? -37.752 66.876 23.623  1.00 131.51 ? 375 VAL B CG1   1 
ATOM   6132  C  CG2   . VAL B 1 375 ? -37.477 65.644 21.394  1.00 130.26 ? 375 VAL B CG2   1 
ATOM   6133  N  N     . GLU B 1 376 ? -40.663 65.231 24.490  1.00 109.45 ? 376 GLU B N     1 
ATOM   6134  C  CA    . GLU B 1 376 ? -41.461 65.498 25.658  1.00 120.18 ? 376 GLU B CA    1 
ATOM   6135  C  C     . GLU B 1 376 ? -41.306 64.270 26.542  1.00 137.16 ? 376 GLU B C     1 
ATOM   6136  O  O     . GLU B 1 376 ? -41.176 64.382 27.768  1.00 137.85 ? 376 GLU B O     1 
ATOM   6137  C  CB    . GLU B 1 376 ? -42.927 65.765 25.266  1.00 109.27 ? 376 GLU B CB    1 
ATOM   6138  N  N     . GLY B 1 377 ? -41.284 63.103 25.894  1.00 140.21 ? 377 GLY B N     1 
ATOM   6139  C  CA    . GLY B 1 377 ? -41.183 61.817 26.568  1.00 138.56 ? 377 GLY B CA    1 
ATOM   6140  C  C     . GLY B 1 377 ? -39.875 61.545 27.291  1.00 142.06 ? 377 GLY B C     1 
ATOM   6141  O  O     . GLY B 1 377 ? -39.872 61.282 28.496  1.00 154.89 ? 377 GLY B O     1 
ATOM   6142  N  N     . LEU B 1 378 ? -38.762 61.604 26.566  1.00 123.49 ? 378 LEU B N     1 
ATOM   6143  C  CA    . LEU B 1 378 ? -37.449 61.405 27.170  1.00 115.36 ? 378 LEU B CA    1 
ATOM   6144  C  C     . LEU B 1 378 ? -37.212 62.356 28.342  1.00 136.37 ? 378 LEU B C     1 
ATOM   6145  O  O     . LEU B 1 378 ? -36.622 61.979 29.354  1.00 138.89 ? 378 LEU B O     1 
ATOM   6146  C  CB    . LEU B 1 378 ? -36.361 61.593 26.131  1.00 111.14 ? 378 LEU B CB    1 
ATOM   6147  C  CG    . LEU B 1 378 ? -36.511 60.598 24.995  1.00 126.19 ? 378 LEU B CG    1 
ATOM   6148  C  CD1   . LEU B 1 378 ? -35.285 60.610 24.116  1.00 110.00 ? 378 LEU B CD1   1 
ATOM   6149  C  CD2   . LEU B 1 378 ? -36.765 59.208 25.573  1.00 142.77 ? 378 LEU B CD2   1 
ATOM   6150  N  N     . ILE B 1 379 ? -37.664 63.596 28.200  1.00 144.68 ? 379 ILE B N     1 
ATOM   6151  C  CA    . ILE B 1 379 ? -37.555 64.555 29.290  1.00 149.63 ? 379 ILE B CA    1 
ATOM   6152  C  C     . ILE B 1 379 ? -38.199 64.022 30.567  1.00 159.31 ? 379 ILE B C     1 
ATOM   6153  O  O     . ILE B 1 379 ? -37.627 64.143 31.656  1.00 168.23 ? 379 ILE B O     1 
ATOM   6154  C  CB    . ILE B 1 379 ? -38.153 65.916 28.905  1.00 134.47 ? 379 ILE B CB    1 
ATOM   6155  C  CG1   . ILE B 1 379 ? -37.097 66.745 28.171  1.00 128.31 ? 379 ILE B CG1   1 
ATOM   6156  C  CG2   . ILE B 1 379 ? -38.611 66.659 30.142  1.00 118.63 ? 379 ILE B CG2   1 
ATOM   6157  C  CD1   . ILE B 1 379 ? -37.660 67.847 27.314  1.00 125.16 ? 379 ILE B CD1   1 
ATOM   6158  N  N     . ARG B 1 380 ? -39.382 63.433 30.442  1.00 154.35 ? 380 ARG B N     1 
ATOM   6159  C  CA    . ARG B 1 380 ? -40.009 62.803 31.599  1.00 168.14 ? 380 ARG B CA    1 
ATOM   6160  C  C     . ARG B 1 380 ? -39.116 61.680 32.128  1.00 168.17 ? 380 ARG B C     1 
ATOM   6161  O  O     . ARG B 1 380 ? -38.829 61.619 33.322  1.00 172.36 ? 380 ARG B O     1 
ATOM   6162  C  CB    . ARG B 1 380 ? -41.393 62.238 31.256  1.00 168.65 ? 380 ARG B CB    1 
ATOM   6163  C  CG    . ARG B 1 380 ? -42.477 62.555 32.286  1.00 158.44 ? 380 ARG B CG    1 
ATOM   6164  C  CD    . ARG B 1 380 ? -43.357 61.340 32.620  1.00 154.86 ? 380 ARG B CD    1 
ATOM   6165  N  NE    . ARG B 1 380 ? -44.168 60.832 31.513  1.00 162.81 ? 380 ARG B NE    1 
ATOM   6166  C  CZ    . ARG B 1 380 ? -44.989 59.787 31.624  1.00 172.36 ? 380 ARG B CZ    1 
ATOM   6167  N  NH1   . ARG B 1 380 ? -45.092 59.157 32.787  1.00 172.54 ? 380 ARG B NH1   1 
ATOM   6168  N  NH2   . ARG B 1 380 ? -45.704 59.367 30.583  1.00 169.66 ? 380 ARG B NH2   1 
ATOM   6169  N  N     . VAL B 1 381 ? -38.667 60.803 31.232  1.00 151.36 ? 381 VAL B N     1 
ATOM   6170  C  CA    . VAL B 1 381 ? -37.867 59.646 31.632  1.00 144.95 ? 381 VAL B CA    1 
ATOM   6171  C  C     . VAL B 1 381 ? -36.603 59.993 32.401  1.00 145.51 ? 381 VAL B C     1 
ATOM   6172  O  O     . VAL B 1 381 ? -36.294 59.360 33.405  1.00 141.94 ? 381 VAL B O     1 
ATOM   6173  C  CB    . VAL B 1 381 ? -37.416 58.794 30.452  1.00 148.21 ? 381 VAL B CB    1 
ATOM   6174  C  CG1   . VAL B 1 381 ? -36.223 57.929 30.879  1.00 138.26 ? 381 VAL B CG1   1 
ATOM   6175  C  CG2   . VAL B 1 381 ? -38.558 57.937 29.950  1.00 155.69 ? 381 VAL B CG2   1 
ATOM   6176  N  N     . ILE B 1 382 ? -35.855 60.976 31.917  1.00 162.82 ? 382 ILE B N     1 
ATOM   6177  C  CA    . ILE B 1 382 ? -34.582 61.317 32.542  1.00 171.65 ? 382 ILE B CA    1 
ATOM   6178  C  C     . ILE B 1 382 ? -34.756 61.518 34.062  1.00 171.80 ? 382 ILE B C     1 
ATOM   6179  O  O     . ILE B 1 382 ? -33.817 61.310 34.829  1.00 170.84 ? 382 ILE B O     1 
ATOM   6180  C  CB    . ILE B 1 382 ? -33.834 62.507 31.809  1.00 108.92 ? 382 ILE B CB    1 
ATOM   6181  N  N     . SER B 1 383 ? -35.955 61.918 34.488  1.00 162.19 ? 383 SER B N     1 
ATOM   6182  C  CA    . SER B 1 383 ? -36.289 62.045 35.917  1.00 165.35 ? 383 SER B CA    1 
ATOM   6183  C  C     . SER B 1 383 ? -36.517 60.721 36.669  1.00 165.00 ? 383 SER B C     1 
ATOM   6184  O  O     . SER B 1 383 ? -36.288 60.637 37.877  1.00 160.61 ? 383 SER B O     1 
ATOM   6185  C  CB    . SER B 1 383 ? -37.539 62.898 36.080  1.00 163.38 ? 383 SER B CB    1 
ATOM   6186  O  OG    . SER B 1 383 ? -38.685 62.169 35.670  1.00 160.78 ? 383 SER B OG    1 
ATOM   6187  N  N     . ILE B 1 384 ? -37.005 59.711 35.954  1.00 173.59 ? 384 ILE B N     1 
ATOM   6188  C  CA    . ILE B 1 384 ? -37.331 58.399 36.526  1.00 172.13 ? 384 ILE B CA    1 
ATOM   6189  C  C     . ILE B 1 384 ? -36.306 57.318 36.134  1.00 157.17 ? 384 ILE B C     1 
ATOM   6190  O  O     . ILE B 1 384 ? -36.535 56.130 36.367  1.00 141.75 ? 384 ILE B O     1 
ATOM   6191  C  CB    . ILE B 1 384 ? -38.793 57.939 36.164  1.00 100.35 ? 384 ILE B CB    1 
ATOM   6192  N  N     . LEU B 1 385 ? -35.196 57.733 35.518  1.00 147.18 ? 385 LEU B N     1 
ATOM   6193  C  CA    . LEU B 1 385 ? -34.247 56.795 34.910  1.00 144.50 ? 385 LEU B CA    1 
ATOM   6194  C  C     . LEU B 1 385 ? -33.988 55.569 35.754  1.00 148.61 ? 385 LEU B C     1 
ATOM   6195  O  O     . LEU B 1 385 ? -34.068 54.444 35.265  1.00 161.04 ? 385 LEU B O     1 
ATOM   6196  C  CB    . LEU B 1 385 ? -32.903 57.461 34.604  1.00 139.54 ? 385 LEU B CB    1 
ATOM   6197  C  CG    . LEU B 1 385 ? -32.525 57.771 33.148  1.00 138.39 ? 385 LEU B CG    1 
ATOM   6198  C  CD1   . LEU B 1 385 ? -31.156 58.446 33.155  1.00 120.13 ? 385 LEU B CD1   1 
ATOM   6199  C  CD2   . LEU B 1 385 ? -32.564 56.520 32.188  1.00 111.92 ? 385 LEU B CD2   1 
ATOM   6200  N  N     . ASP B 1 386 ? -33.676 55.780 37.021  1.00 150.37 ? 386 ASP B N     1 
ATOM   6201  C  CA    . ASP B 1 386 ? -33.360 54.654 37.869  1.00 148.19 ? 386 ASP B CA    1 
ATOM   6202  C  C     . ASP B 1 386 ? -34.486 53.617 37.781  1.00 155.40 ? 386 ASP B C     1 
ATOM   6203  O  O     . ASP B 1 386 ? -34.290 52.535 37.216  1.00 143.19 ? 386 ASP B O     1 
ATOM   6204  C  CB    . ASP B 1 386 ? -33.106 55.129 39.301  1.00 127.54 ? 386 ASP B CB    1 
ATOM   6205  N  N     . GLU B 1 387 ? -35.669 53.968 38.290  1.00 166.70 ? 387 GLU B N     1 
ATOM   6206  C  CA    . GLU B 1 387 ? -36.823 53.056 38.326  1.00 166.04 ? 387 GLU B CA    1 
ATOM   6207  C  C     . GLU B 1 387 ? -37.204 52.492 36.944  1.00 171.45 ? 387 GLU B C     1 
ATOM   6208  O  O     . GLU B 1 387 ? -37.644 51.340 36.821  1.00 175.57 ? 387 GLU B O     1 
ATOM   6209  C  CB    . GLU B 1 387 ? -38.034 53.715 39.027  1.00 139.59 ? 387 GLU B CB    1 
ATOM   6210  N  N     . VAL B 1 388 ? -37.046 53.313 35.911  1.00 164.55 ? 388 VAL B N     1 
ATOM   6211  C  CA    . VAL B 1 388 ? -37.337 52.887 34.545  1.00 160.82 ? 388 VAL B CA    1 
ATOM   6212  C  C     . VAL B 1 388 ? -36.471 51.703 34.109  1.00 155.47 ? 388 VAL B C     1 
ATOM   6213  O  O     . VAL B 1 388 ? -36.984 50.663 33.692  1.00 153.15 ? 388 VAL B O     1 
ATOM   6214  C  CB    . VAL B 1 388 ? -37.170 54.060 33.557  1.00 143.40 ? 388 VAL B CB    1 
ATOM   6215  C  CG1   . VAL B 1 388 ? -37.415 53.594 32.109  1.00 106.03 ? 388 VAL B CG1   1 
ATOM   6216  C  CG2   . VAL B 1 388 ? -38.107 55.214 33.969  1.00 145.73 ? 388 VAL B CG2   1 
ATOM   6217  N  N     . ILE B 1 389 ? -35.156 51.866 34.207  1.00 143.93 ? 389 ILE B N     1 
ATOM   6218  C  CA    . ILE B 1 389 ? -34.243 50.787 33.865  1.00 132.88 ? 389 ILE B CA    1 
ATOM   6219  C  C     . ILE B 1 389 ? -34.585 49.552 34.688  1.00 141.32 ? 389 ILE B C     1 
ATOM   6220  O  O     . ILE B 1 389 ? -34.710 48.451 34.144  1.00 142.17 ? 389 ILE B O     1 
ATOM   6221  C  CB    . ILE B 1 389 ? -32.767 51.184 34.107  1.00 125.87 ? 389 ILE B CB    1 
ATOM   6222  C  CG1   . ILE B 1 389 ? -32.469 52.564 33.498  1.00 127.27 ? 389 ILE B CG1   1 
ATOM   6223  C  CG2   . ILE B 1 389 ? -31.815 50.113 33.560  1.00 118.23 ? 389 ILE B CG2   1 
ATOM   6224  C  CD1   . ILE B 1 389 ? -30.987 52.958 33.517  1.00 121.40 ? 389 ILE B CD1   1 
ATOM   6225  N  N     . ALA B 1 390 ? -34.752 49.748 35.995  1.00 136.17 ? 390 ALA B N     1 
ATOM   6226  C  CA    . ALA B 1 390 ? -35.069 48.655 36.907  1.00 140.99 ? 390 ALA B CA    1 
ATOM   6227  C  C     . ALA B 1 390 ? -36.260 47.850 36.405  1.00 148.69 ? 390 ALA B C     1 
ATOM   6228  O  O     . ALA B 1 390 ? -36.252 46.616 36.448  1.00 154.46 ? 390 ALA B O     1 
ATOM   6229  C  CB    . ALA B 1 390 ? -35.357 49.194 38.276  1.00 155.85 ? 390 ALA B CB    1 
ATOM   6230  N  N     . LEU B 1 391 ? -37.288 48.559 35.947  1.00 147.23 ? 391 LEU B N     1 
ATOM   6231  C  CA    . LEU B 1 391 ? -38.441 47.926 35.321  1.00 150.47 ? 391 LEU B CA    1 
ATOM   6232  C  C     . LEU B 1 391 ? -38.026 47.100 34.104  1.00 149.12 ? 391 LEU B C     1 
ATOM   6233  O  O     . LEU B 1 391 ? -38.392 45.931 33.984  1.00 147.29 ? 391 LEU B O     1 
ATOM   6234  C  CB    . LEU B 1 391 ? -39.477 48.978 34.911  1.00 151.62 ? 391 LEU B CB    1 
ATOM   6235  C  CG    . LEU B 1 391 ? -40.507 48.551 33.847  1.00 151.50 ? 391 LEU B CG    1 
ATOM   6236  C  CD1   . LEU B 1 391 ? -41.818 49.313 34.004  1.00 149.66 ? 391 LEU B CD1   1 
ATOM   6237  C  CD2   . LEU B 1 391 ? -39.977 48.687 32.405  1.00 141.01 ? 391 LEU B CD2   1 
ATOM   6238  N  N     . ILE B 1 392 ? -37.260 47.711 33.204  1.00 147.76 ? 392 ILE B N     1 
ATOM   6239  C  CA    . ILE B 1 392 ? -36.889 47.055 31.954  1.00 148.31 ? 392 ILE B CA    1 
ATOM   6240  C  C     . ILE B 1 392 ? -36.194 45.728 32.215  1.00 149.99 ? 392 ILE B C     1 
ATOM   6241  O  O     . ILE B 1 392 ? -36.414 44.750 31.500  1.00 147.26 ? 392 ILE B O     1 
ATOM   6242  C  CB    . ILE B 1 392 ? -35.939 47.927 31.109  1.00 138.70 ? 392 ILE B CB    1 
ATOM   6243  C  CG1   . ILE B 1 392 ? -36.326 49.409 31.202  1.00 140.68 ? 392 ILE B CG1   1 
ATOM   6244  C  CG2   . ILE B 1 392 ? -35.862 47.395 29.659  1.00 113.43 ? 392 ILE B CG2   1 
ATOM   6245  C  CD1   . ILE B 1 392 ? -37.229 49.896 30.107  1.00 145.07 ? 392 ILE B CD1   1 
ATOM   6246  N  N     . ARG B 1 393 ? -35.322 45.724 33.219  1.00 146.29 ? 393 ARG B N     1 
ATOM   6247  C  CA    . ARG B 1 393 ? -34.606 44.522 33.628  1.00 148.64 ? 393 ARG B CA    1 
ATOM   6248  C  C     . ARG B 1 393 ? -35.572 43.460 34.172  1.00 151.88 ? 393 ARG B C     1 
ATOM   6249  O  O     . ARG B 1 393 ? -35.499 42.275 33.817  1.00 145.04 ? 393 ARG B O     1 
ATOM   6250  C  CB    . ARG B 1 393 ? -33.560 44.900 34.674  1.00 153.00 ? 393 ARG B CB    1 
ATOM   6251  C  CG    . ARG B 1 393 ? -32.734 46.142 34.304  1.00 151.26 ? 393 ARG B CG    1 
ATOM   6252  C  CD    . ARG B 1 393 ? -31.318 45.807 33.816  1.00 161.40 ? 393 ARG B CD    1 
ATOM   6253  N  NE    . ARG B 1 393 ? -30.558 44.980 34.765  1.00 173.54 ? 393 ARG B NE    1 
ATOM   6254  C  CZ    . ARG B 1 393 ? -29.632 45.430 35.614  1.00 166.75 ? 393 ARG B CZ    1 
ATOM   6255  N  NH1   . ARG B 1 393 ? -29.331 46.722 35.659  1.00 164.38 ? 393 ARG B NH1   1 
ATOM   6256  N  NH2   . ARG B 1 393 ? -29.008 44.579 36.425  1.00 160.16 ? 393 ARG B NH2   1 
ATOM   6257  N  N     . ALA B 1 394 ? -36.470 43.890 35.051  1.00 156.58 ? 394 ALA B N     1 
ATOM   6258  C  CA    . ALA B 1 394 ? -37.529 43.022 35.554  1.00 160.88 ? 394 ALA B CA    1 
ATOM   6259  C  C     . ALA B 1 394 ? -38.543 42.614 34.473  1.00 156.55 ? 394 ALA B C     1 
ATOM   6260  O  O     . ALA B 1 394 ? -39.584 42.035 34.774  1.00 156.75 ? 394 ALA B O     1 
ATOM   6261  C  CB    . ALA B 1 394 ? -38.237 43.685 36.723  1.00 163.74 ? 394 ALA B CB    1 
ATOM   6262  N  N     . SER B 1 395 ? -38.252 42.919 33.215  1.00 158.05 ? 395 SER B N     1 
ATOM   6263  C  CA    . SER B 1 395 ? -39.180 42.583 32.137  1.00 154.06 ? 395 SER B CA    1 
ATOM   6264  C  C     . SER B 1 395 ? -38.717 41.366 31.337  1.00 152.86 ? 395 SER B C     1 
ATOM   6265  O  O     . SER B 1 395 ? -37.526 41.066 31.267  1.00 145.23 ? 395 SER B O     1 
ATOM   6266  C  CB    . SER B 1 395 ? -39.406 43.784 31.213  1.00 140.53 ? 395 SER B CB    1 
ATOM   6267  O  OG    . SER B 1 395 ? -40.263 44.742 31.809  1.00 132.17 ? 395 SER B OG    1 
ATOM   6268  N  N     . GLU B 1 396 ? -39.670 40.662 30.737  1.00 156.12 ? 396 GLU B N     1 
ATOM   6269  C  CA    . GLU B 1 396 ? -39.368 39.392 30.096  1.00 153.41 ? 396 GLU B CA    1 
ATOM   6270  C  C     . GLU B 1 396 ? -38.863 39.562 28.661  1.00 146.73 ? 396 GLU B C     1 
ATOM   6271  O  O     . GLU B 1 396 ? -37.769 39.116 28.333  1.00 134.77 ? 396 GLU B O     1 
ATOM   6272  C  CB    . GLU B 1 396 ? -40.589 38.467 30.161  1.00 148.99 ? 396 GLU B CB    1 
ATOM   6273  N  N     . ASN B 1 397 ? -39.666 40.220 27.826  1.00 152.65 ? 397 ASN B N     1 
ATOM   6274  C  CA    . ASN B 1 397 ? -39.389 40.408 26.404  1.00 149.61 ? 397 ASN B CA    1 
ATOM   6275  C  C     . ASN B 1 397 ? -39.226 41.898 26.072  1.00 147.29 ? 397 ASN B C     1 
ATOM   6276  O  O     . ASN B 1 397 ? -39.624 42.744 26.871  1.00 137.00 ? 397 ASN B O     1 
ATOM   6277  C  CB    . ASN B 1 397 ? -40.562 39.821 25.613  1.00 100.79 ? 397 ASN B CB    1 
ATOM   6278  N  N     . LYS B 1 398 ? -38.644 42.240 24.917  1.00 154.36 ? 398 LYS B N     1 
ATOM   6279  C  CA    . LYS B 1 398 ? -38.612 43.654 24.521  1.00 145.70 ? 398 LYS B CA    1 
ATOM   6280  C  C     . LYS B 1 398 ? -40.029 44.193 24.560  1.00 135.54 ? 398 LYS B C     1 
ATOM   6281  O  O     . LYS B 1 398 ? -40.305 45.236 25.165  1.00 111.92 ? 398 LYS B O     1 
ATOM   6282  C  CB    . LYS B 1 398 ? -38.065 43.885 23.111  1.00 129.56 ? 398 LYS B CB    1 
ATOM   6283  C  CG    . LYS B 1 398 ? -38.715 45.132 22.427  1.00 118.74 ? 398 LYS B CG    1 
ATOM   6284  C  CD    . LYS B 1 398 ? -37.916 45.715 21.229  1.00 126.16 ? 398 LYS B CD    1 
ATOM   6285  C  CE    . LYS B 1 398 ? -38.742 46.767 20.441  1.00 144.63 ? 398 LYS B CE    1 
ATOM   6286  N  NZ    . LYS B 1 398 ? -38.274 47.097 19.036  1.00 127.29 ? 398 LYS B NZ    1 
ATOM   6287  N  N     . ALA B 1 399 ? -40.916 43.461 23.893  1.00 137.41 ? 399 ALA B N     1 
ATOM   6288  C  CA    . ALA B 1 399 ? -42.333 43.780 23.869  1.00 132.20 ? 399 ALA B CA    1 
ATOM   6289  C  C     . ALA B 1 399 ? -42.937 43.869 25.280  1.00 130.23 ? 399 ALA B C     1 
ATOM   6290  O  O     . ALA B 1 399 ? -43.613 44.848 25.607  1.00 130.81 ? 399 ALA B O     1 
ATOM   6291  C  CB    . ALA B 1 399 ? -43.068 42.765 23.025  1.00 130.27 ? 399 ALA B CB    1 
ATOM   6292  N  N     . ASP B 1 400 ? -42.695 42.862 26.118  1.00 131.15 ? 400 ASP B N     1 
ATOM   6293  C  CA    . ASP B 1 400 ? -43.161 42.930 27.505  1.00 150.98 ? 400 ASP B CA    1 
ATOM   6294  C  C     . ASP B 1 400 ? -42.590 44.172 28.175  1.00 146.81 ? 400 ASP B C     1 
ATOM   6295  O  O     . ASP B 1 400 ? -43.284 44.881 28.900  1.00 145.59 ? 400 ASP B O     1 
ATOM   6296  C  CB    . ASP B 1 400 ? -42.777 41.682 28.313  1.00 161.34 ? 400 ASP B CB    1 
ATOM   6297  N  N     . ALA B 1 401 ? -41.317 44.434 27.918  1.00 147.04 ? 401 ALA B N     1 
ATOM   6298  C  CA    . ALA B 1 401 ? -40.664 45.624 28.436  1.00 147.73 ? 401 ALA B CA    1 
ATOM   6299  C  C     . ALA B 1 401 ? -41.525 46.849 28.145  1.00 149.24 ? 401 ALA B C     1 
ATOM   6300  O  O     . ALA B 1 401 ? -41.919 47.570 29.071  1.00 132.26 ? 401 ALA B O     1 
ATOM   6301  C  CB    . ALA B 1 401 ? -39.283 45.775 27.807  1.00 137.86 ? 401 ALA B CB    1 
ATOM   6302  N  N     . LYS B 1 402 ? -41.836 47.049 26.860  1.00 151.24 ? 402 LYS B N     1 
ATOM   6303  C  CA    . LYS B 1 402 ? -42.673 48.160 26.408  1.00 137.59 ? 402 LYS B CA    1 
ATOM   6304  C  C     . LYS B 1 402 ? -44.022 48.194 27.131  1.00 145.55 ? 402 LYS B C     1 
ATOM   6305  O  O     . LYS B 1 402 ? -44.392 49.217 27.716  1.00 142.64 ? 402 LYS B O     1 
ATOM   6306  C  CB    . LYS B 1 402 ? -42.909 48.083 24.903  1.00 119.11 ? 402 LYS B CB    1 
ATOM   6307  C  CG    . LYS B 1 402 ? -41.686 48.343 24.013  1.00 122.43 ? 402 LYS B CG    1 
ATOM   6308  C  CD    . LYS B 1 402 ? -42.002 48.115 22.490  1.00 103.02 ? 402 LYS B CD    1 
ATOM   6309  N  N     . GLU B 1 403 ? -44.743 47.071 27.095  1.00 148.30 ? 403 GLU B N     1 
ATOM   6310  C  CA    . GLU B 1 403 ? -46.077 46.967 27.704  1.00 148.10 ? 403 GLU B CA    1 
ATOM   6311  C  C     . GLU B 1 403 ? -46.104 47.313 29.198  1.00 155.89 ? 403 GLU B C     1 
ATOM   6312  O  O     . GLU B 1 403 ? -47.116 47.804 29.711  1.00 149.38 ? 403 GLU B O     1 
ATOM   6313  C  CB    . GLU B 1 403 ? -46.707 45.585 27.467  1.00 127.51 ? 403 GLU B CB    1 
ATOM   6314  N  N     . ASN B 1 404 ? -45.013 47.019 29.901  1.00 158.85 ? 404 ASN B N     1 
ATOM   6315  C  CA    . ASN B 1 404 ? -44.910 47.368 31.317  1.00 149.32 ? 404 ASN B CA    1 
ATOM   6316  C  C     . ASN B 1 404 ? -44.780 48.878 31.569  1.00 157.37 ? 404 ASN B C     1 
ATOM   6317  O  O     . ASN B 1 404 ? -45.375 49.385 32.519  1.00 162.52 ? 404 ASN B O     1 
ATOM   6318  C  CB    . ASN B 1 404 ? -43.815 46.567 32.035  1.00 133.39 ? 404 ASN B CB    1 
ATOM   6319  N  N     . LEU B 1 405 ? -44.002 49.590 30.745  1.00 153.49 ? 405 LEU B N     1 
ATOM   6320  C  CA    . LEU B 1 405 ? -43.880 51.050 30.900  1.00 148.13 ? 405 LEU B CA    1 
ATOM   6321  C  C     . LEU B 1 405 ? -45.192 51.754 30.601  1.00 152.53 ? 405 LEU B C     1 
ATOM   6322  O  O     . LEU B 1 405 ? -45.576 52.696 31.300  1.00 158.30 ? 405 LEU B O     1 
ATOM   6323  C  CB    . LEU B 1 405 ? -42.824 51.666 29.997  1.00 135.30 ? 405 LEU B CB    1 
ATOM   6324  C  CG    . LEU B 1 405 ? -41.391 51.178 30.033  1.00 134.93 ? 405 LEU B CG    1 
ATOM   6325  C  CD1   . LEU B 1 405 ? -41.135 50.407 28.744  1.00 132.73 ? 405 LEU B CD1   1 
ATOM   6326  C  CD2   . LEU B 1 405 ? -40.432 52.362 30.165  1.00 123.37 ? 405 LEU B CD2   1 
ATOM   6327  N  N     . LYS B 1 406 ? -45.856 51.319 29.535  1.00 145.88 ? 406 LYS B N     1 
ATOM   6328  C  CA    . LYS B 1 406 ? -47.156 51.872 29.188  1.00 150.50 ? 406 LYS B CA    1 
ATOM   6329  C  C     . LYS B 1 406 ? -48.153 51.695 30.349  1.00 156.44 ? 406 LYS B C     1 
ATOM   6330  O  O     . LYS B 1 406 ? -48.830 52.649 30.744  1.00 161.13 ? 406 LYS B O     1 
ATOM   6331  C  CB    . LYS B 1 406 ? -47.668 51.280 27.869  1.00 141.84 ? 406 LYS B CB    1 
ATOM   6332  N  N     . VAL B 1 407 ? -48.225 50.487 30.909  1.00 153.07 ? 407 VAL B N     1 
ATOM   6333  C  CA    . VAL B 1 407 ? -49.093 50.226 32.067  1.00 149.87 ? 407 VAL B CA    1 
ATOM   6334  C  C     . VAL B 1 407 ? -48.741 51.076 33.290  1.00 160.14 ? 407 VAL B C     1 
ATOM   6335  O  O     . VAL B 1 407 ? -49.596 51.790 33.808  1.00 166.61 ? 407 VAL B O     1 
ATOM   6336  C  CB    . VAL B 1 407 ? -49.073 48.748 32.504  1.00 126.70 ? 407 VAL B CB    1 
ATOM   6337  N  N     . SER B 1 408 ? -47.488 50.988 33.746  1.00 156.95 ? 408 SER B N     1 
ATOM   6338  C  CA    . SER B 1 408 ? -47.025 51.692 34.953  1.00 154.22 ? 408 SER B CA    1 
ATOM   6339  C  C     . SER B 1 408 ? -46.944 53.224 34.853  1.00 169.43 ? 408 SER B C     1 
ATOM   6340  O  O     . SER B 1 408 ? -47.722 53.931 35.492  1.00 179.68 ? 408 SER B O     1 
ATOM   6341  C  CB    . SER B 1 408 ? -45.665 51.148 35.401  1.00 139.57 ? 408 SER B CB    1 
ATOM   6342  N  N     . TYR B 1 409 ? -45.976 53.730 34.091  1.00 171.34 ? 409 TYR B N     1 
ATOM   6343  C  CA    . TYR B 1 409 ? -45.780 55.176 33.912  1.00 166.09 ? 409 TYR B CA    1 
ATOM   6344  C  C     . TYR B 1 409 ? -46.600 55.804 32.779  1.00 159.44 ? 409 TYR B C     1 
ATOM   6345  O  O     . TYR B 1 409 ? -46.231 56.863 32.262  1.00 144.16 ? 409 TYR B O     1 
ATOM   6346  C  CB    . TYR B 1 409 ? -44.301 55.465 33.651  1.00 161.31 ? 409 TYR B CB    1 
ATOM   6347  C  CG    . TYR B 1 409 ? -43.379 55.044 34.780  1.00 156.12 ? 409 TYR B CG    1 
ATOM   6348  C  CD1   . TYR B 1 409 ? -42.272 55.815 35.127  1.00 164.72 ? 409 TYR B CD1   1 
ATOM   6349  C  CD2   . TYR B 1 409 ? -43.611 53.880 35.492  1.00 144.09 ? 409 TYR B CD2   1 
ATOM   6350  C  CE1   . TYR B 1 409 ? -41.424 55.434 36.140  1.00 167.93 ? 409 TYR B CE1   1 
ATOM   6351  C  CE2   . TYR B 1 409 ? -42.772 53.494 36.503  1.00 156.54 ? 409 TYR B CE2   1 
ATOM   6352  C  CZ    . TYR B 1 409 ? -41.681 54.270 36.832  1.00 164.85 ? 409 TYR B CZ    1 
ATOM   6353  O  OH    . TYR B 1 409 ? -40.848 53.875 37.861  1.00 162.01 ? 409 TYR B OH    1 
ATOM   6354  N  N     . ASP B 1 410 ? -47.691 55.146 32.394  1.00 168.87 ? 410 ASP B N     1 
ATOM   6355  C  CA    . ASP B 1 410 ? -48.523 55.583 31.269  1.00 169.82 ? 410 ASP B CA    1 
ATOM   6356  C  C     . ASP B 1 410 ? -47.770 56.414 30.209  1.00 158.87 ? 410 ASP B C     1 
ATOM   6357  O  O     . ASP B 1 410 ? -48.166 57.533 29.881  1.00 159.23 ? 410 ASP B O     1 
ATOM   6358  C  CB    . ASP B 1 410 ? -49.792 56.290 31.774  1.00 167.45 ? 410 ASP B CB    1 
ATOM   6359  N  N     . PHE B 1 411 ? -46.672 55.864 29.698  1.00 140.43 ? 411 PHE B N     1 
ATOM   6360  C  CA    . PHE B 1 411 ? -46.010 56.414 28.527  1.00 136.02 ? 411 PHE B CA    1 
ATOM   6361  C  C     . PHE B 1 411 ? -46.840 55.988 27.326  1.00 144.18 ? 411 PHE B C     1 
ATOM   6362  O  O     . PHE B 1 411 ? -47.703 55.111 27.468  1.00 141.02 ? 411 PHE B O     1 
ATOM   6363  C  CB    . PHE B 1 411 ? -44.614 55.816 28.385  1.00 133.69 ? 411 PHE B CB    1 
ATOM   6364  C  CG    . PHE B 1 411 ? -43.545 56.551 29.129  1.00 134.34 ? 411 PHE B CG    1 
ATOM   6365  C  CD1   . PHE B 1 411 ? -43.165 57.830 28.748  1.00 132.92 ? 411 PHE B CD1   1 
ATOM   6366  C  CD2   . PHE B 1 411 ? -42.887 55.950 30.184  1.00 141.76 ? 411 PHE B CD2   1 
ATOM   6367  C  CE1   . PHE B 1 411 ? -42.159 58.517 29.427  1.00 130.12 ? 411 PHE B CE1   1 
ATOM   6368  C  CE2   . PHE B 1 411 ? -41.879 56.628 30.859  1.00 147.64 ? 411 PHE B CE2   1 
ATOM   6369  C  CZ    . PHE B 1 411 ? -41.517 57.918 30.479  1.00 133.48 ? 411 PHE B CZ    1 
ATOM   6370  N  N     . THR B 1 412 ? -46.587 56.573 26.149  1.00 145.03 ? 412 THR B N     1 
ATOM   6371  C  CA    . THR B 1 412 ? -47.334 56.160 24.958  1.00 145.72 ? 412 THR B CA    1 
ATOM   6372  C  C     . THR B 1 412 ? -46.644 55.008 24.243  1.00 165.40 ? 412 THR B C     1 
ATOM   6373  O  O     . THR B 1 412 ? -45.661 54.460 24.739  1.00 180.68 ? 412 THR B O     1 
ATOM   6374  C  CB    . THR B 1 412 ? -47.465 57.296 23.921  1.00 129.64 ? 412 THR B CB    1 
ATOM   6375  O  OG1   . THR B 1 412 ? -46.236 57.440 23.186  1.00 126.42 ? 412 THR B OG1   1 
ATOM   6376  C  CG2   . THR B 1 412 ? -47.820 58.597 24.592  1.00 122.31 ? 412 THR B CG2   1 
ATOM   6377  N  N     . GLU B 1 413 ? -47.110 54.697 23.039  1.00 162.24 ? 413 GLU B N     1 
ATOM   6378  C  CA    . GLU B 1 413 ? -46.565 53.574 22.295  1.00 161.74 ? 413 GLU B CA    1 
ATOM   6379  C  C     . GLU B 1 413 ? -45.195 53.935 21.725  1.00 157.99 ? 413 GLU B C     1 
ATOM   6380  O  O     . GLU B 1 413 ? -44.192 53.291 22.037  1.00 150.25 ? 413 GLU B O     1 
ATOM   6381  C  CB    . GLU B 1 413 ? -47.532 53.142 21.188  1.00 177.81 ? 413 GLU B CB    1 
ATOM   6382  C  CG    . GLU B 1 413 ? -46.906 52.313 20.061  1.00 193.64 ? 413 GLU B CG    1 
ATOM   6383  C  CD    . GLU B 1 413 ? -46.251 51.037 20.556  1.00 199.22 ? 413 GLU B CD    1 
ATOM   6384  O  OE1   . GLU B 1 413 ? -45.316 50.550 19.878  1.00 198.68 ? 413 GLU B OE1   1 
ATOM   6385  O  OE2   . GLU B 1 413 ? -46.671 50.529 21.622  1.00 196.92 ? 413 GLU B OE2   1 
ATOM   6386  N  N     . GLU B 1 414 ? -45.163 54.974 20.891  1.00 156.98 ? 414 GLU B N     1 
ATOM   6387  C  CA    . GLU B 1 414 ? -43.926 55.428 20.258  1.00 154.30 ? 414 GLU B CA    1 
ATOM   6388  C  C     . GLU B 1 414 ? -42.917 55.885 21.301  1.00 153.44 ? 414 GLU B C     1 
ATOM   6389  O  O     . GLU B 1 414 ? -41.720 55.644 21.149  1.00 152.57 ? 414 GLU B O     1 
ATOM   6390  C  CB    . GLU B 1 414 ? -44.157 56.515 19.191  1.00 148.57 ? 414 GLU B CB    1 
ATOM   6391  N  N     . GLN B 1 415 ? -43.401 56.544 22.355  1.00 144.64 ? 415 GLN B N     1 
ATOM   6392  C  CA    . GLN B 1 415 ? -42.533 56.985 23.443  1.00 140.88 ? 415 GLN B CA    1 
ATOM   6393  C  C     . GLN B 1 415 ? -41.780 55.783 23.992  1.00 140.75 ? 415 GLN B C     1 
ATOM   6394  O  O     . GLN B 1 415 ? -40.573 55.846 24.223  1.00 128.22 ? 415 GLN B O     1 
ATOM   6395  C  CB    . GLN B 1 415 ? -43.343 57.660 24.551  1.00 148.51 ? 415 GLN B CB    1 
ATOM   6396  C  CG    . GLN B 1 415 ? -43.615 59.142 24.336  1.00 147.12 ? 415 GLN B CG    1 
ATOM   6397  C  CD    . GLN B 1 415 ? -44.584 59.737 25.369  1.00 147.59 ? 415 GLN B CD    1 
ATOM   6398  O  OE1   . GLN B 1 415 ? -45.278 59.018 26.107  1.00 146.51 ? 415 GLN B OE1   1 
ATOM   6399  N  NE2   . GLN B 1 415 ? -44.637 61.064 25.413  1.00 142.03 ? 415 GLN B NE2   1 
ATOM   6400  N  N     . ALA B 1 416 ? -42.509 54.688 24.188  1.00 149.64 ? 416 ALA B N     1 
ATOM   6401  C  CA    . ALA B 1 416 ? -41.934 53.424 24.646  1.00 150.90 ? 416 ALA B CA    1 
ATOM   6402  C  C     . ALA B 1 416 ? -40.857 52.851 23.711  1.00 144.20 ? 416 ALA B C     1 
ATOM   6403  O  O     . ALA B 1 416 ? -39.738 52.572 24.145  1.00 136.16 ? 416 ALA B O     1 
ATOM   6404  C  CB    . ALA B 1 416 ? -43.036 52.403 24.870  1.00 146.95 ? 416 ALA B CB    1 
ATOM   6405  N  N     . GLU B 1 417 ? -41.182 52.662 22.436  1.00 139.85 ? 417 GLU B N     1 
ATOM   6406  C  CA    . GLU B 1 417 ? -40.173 52.143 21.518  1.00 147.06 ? 417 GLU B CA    1 
ATOM   6407  C  C     . GLU B 1 417 ? -38.919 53.010 21.639  1.00 141.25 ? 417 GLU B C     1 
ATOM   6408  O  O     . GLU B 1 417 ? -37.818 52.490 21.762  1.00 145.38 ? 417 GLU B O     1 
ATOM   6409  C  CB    . GLU B 1 417 ? -40.667 51.995 20.044  1.00 95.22  ? 417 GLU B CB    1 
ATOM   6410  N  N     . ALA B 1 418 ? -39.094 54.329 21.640  1.00 131.65 ? 418 ALA B N     1 
ATOM   6411  C  CA    . ALA B 1 418 ? -37.958 55.250 21.719  1.00 125.52 ? 418 ALA B CA    1 
ATOM   6412  C  C     . ALA B 1 418 ? -37.114 55.082 22.988  1.00 129.04 ? 418 ALA B C     1 
ATOM   6413  O  O     . ALA B 1 418 ? -35.886 55.066 22.921  1.00 132.73 ? 418 ALA B O     1 
ATOM   6414  C  CB    . ALA B 1 418 ? -38.398 56.699 21.549  1.00 116.56 ? 418 ALA B CB    1 
ATOM   6415  N  N     . ILE B 1 419 ? -37.757 54.975 24.144  1.00 124.34 ? 419 ILE B N     1 
ATOM   6416  C  CA    . ILE B 1 419 ? -37.006 54.738 25.360  1.00 126.20 ? 419 ILE B CA    1 
ATOM   6417  C  C     . ILE B 1 419 ? -36.310 53.391 25.285  1.00 127.08 ? 419 ILE B C     1 
ATOM   6418  O  O     . ILE B 1 419 ? -35.115 53.283 25.524  1.00 143.71 ? 419 ILE B O     1 
ATOM   6419  C  CB    . ILE B 1 419 ? -37.896 54.743 26.585  1.00 127.67 ? 419 ILE B CB    1 
ATOM   6420  C  CG1   . ILE B 1 419 ? -38.951 55.830 26.458  1.00 132.23 ? 419 ILE B CG1   1 
ATOM   6421  C  CG2   . ILE B 1 419 ? -37.053 54.992 27.826  1.00 121.04 ? 419 ILE B CG2   1 
ATOM   6422  C  CD1   . ILE B 1 419 ? -40.030 55.724 27.502  1.00 139.06 ? 419 ILE B CD1   1 
ATOM   6423  N  N     . VAL B 1 420 ? -37.072 52.362 24.957  1.00 125.15 ? 420 VAL B N     1 
ATOM   6424  C  CA    . VAL B 1 420 ? -36.558 50.998 24.915  1.00 134.85 ? 420 VAL B CA    1 
ATOM   6425  C  C     . VAL B 1 420 ? -35.402 50.757 23.932  1.00 123.35 ? 420 VAL B C     1 
ATOM   6426  O  O     . VAL B 1 420 ? -34.450 50.056 24.256  1.00 127.11 ? 420 VAL B O     1 
ATOM   6427  C  CB    . VAL B 1 420 ? -37.683 50.013 24.592  1.00 134.12 ? 420 VAL B CB    1 
ATOM   6428  C  CG1   . VAL B 1 420 ? -37.101 48.695 24.152  1.00 118.14 ? 420 VAL B CG1   1 
ATOM   6429  C  CG2   . VAL B 1 420 ? -38.572 49.837 25.811  1.00 144.02 ? 420 VAL B CG2   1 
ATOM   6430  N  N     . THR B 1 421 ? -35.510 51.289 22.721  1.00 113.72 ? 421 THR B N     1 
ATOM   6431  C  CA    . THR B 1 421 ? -34.472 51.107 21.711  1.00 119.08 ? 421 THR B CA    1 
ATOM   6432  C  C     . THR B 1 421 ? -33.238 51.982 21.917  1.00 135.17 ? 421 THR B C     1 
ATOM   6433  O  O     . THR B 1 421 ? -32.196 51.726 21.320  1.00 140.07 ? 421 THR B O     1 
ATOM   6434  C  CB    . THR B 1 421 ? -34.991 51.353 20.292  1.00 127.26 ? 421 THR B CB    1 
ATOM   6435  O  OG1   . THR B 1 421 ? -35.688 52.601 20.237  1.00 133.84 ? 421 THR B OG1   1 
ATOM   6436  C  CG2   . THR B 1 421 ? -35.919 50.239 19.868  1.00 136.75 ? 421 THR B CG2   1 
ATOM   6437  N  N     . LEU B 1 422 ? -33.357 53.027 22.731  1.00 146.84 ? 422 LEU B N     1 
ATOM   6438  C  CA    . LEU B 1 422 ? -32.196 53.833 23.103  1.00 146.92 ? 422 LEU B CA    1 
ATOM   6439  C  C     . LEU B 1 422 ? -31.011 52.911 23.309  1.00 141.04 ? 422 LEU B C     1 
ATOM   6440  O  O     . LEU B 1 422 ? -31.137 51.906 24.015  1.00 125.03 ? 422 LEU B O     1 
ATOM   6441  C  CB    . LEU B 1 422 ? -32.446 54.549 24.432  1.00 138.63 ? 422 LEU B CB    1 
ATOM   6442  C  CG    . LEU B 1 422 ? -33.401 55.733 24.505  1.00 127.69 ? 422 LEU B CG    1 
ATOM   6443  C  CD1   . LEU B 1 422 ? -33.851 55.936 25.936  1.00 128.61 ? 422 LEU B CD1   1 
ATOM   6444  C  CD2   . LEU B 1 422 ? -32.710 56.961 23.965  1.00 121.14 ? 422 LEU B CD2   1 
ATOM   6445  N  N     . GLN B 1 423 ? -29.859 53.234 22.723  1.00 142.03 ? 423 GLN B N     1 
ATOM   6446  C  CA    . GLN B 1 423 ? -28.697 52.400 22.985  1.00 138.09 ? 423 GLN B CA    1 
ATOM   6447  C  C     . GLN B 1 423 ? -28.203 52.711 24.407  1.00 146.99 ? 423 GLN B C     1 
ATOM   6448  O  O     . GLN B 1 423 ? -28.884 53.413 25.150  1.00 161.43 ? 423 GLN B O     1 
ATOM   6449  C  CB    . GLN B 1 423 ? -27.623 52.680 21.940  1.00 130.26 ? 423 GLN B CB    1 
ATOM   6450  C  CG    . GLN B 1 423 ? -28.172 53.153 20.592  1.00 129.06 ? 423 GLN B CG    1 
ATOM   6451  C  CD    . GLN B 1 423 ? -27.117 53.090 19.496  1.00 137.23 ? 423 GLN B CD    1 
ATOM   6452  O  OE1   . GLN B 1 423 ? -26.624 54.117 19.026  1.00 141.14 ? 423 GLN B OE1   1 
ATOM   6453  N  NE2   . GLN B 1 423 ? -26.747 51.877 19.104  1.00 131.99 ? 423 GLN B NE2   1 
ATOM   6454  N  N     . LEU B 1 424 ? -27.003 52.274 24.773  1.00 136.20 ? 424 LEU B N     1 
ATOM   6455  C  CA    . LEU B 1 424 ? -26.575 52.418 26.167  1.00 129.35 ? 424 LEU B CA    1 
ATOM   6456  C  C     . LEU B 1 424 ? -25.802 53.691 26.442  1.00 137.12 ? 424 LEU B C     1 
ATOM   6457  O  O     . LEU B 1 424 ? -26.025 54.347 27.450  1.00 143.83 ? 424 LEU B O     1 
ATOM   6458  C  CB    . LEU B 1 424 ? -25.770 51.213 26.642  1.00 123.65 ? 424 LEU B CB    1 
ATOM   6459  C  CG    . LEU B 1 424 ? -26.619 50.149 27.313  1.00 128.70 ? 424 LEU B CG    1 
ATOM   6460  C  CD1   . LEU B 1 424 ? -25.775 48.933 27.658  1.00 125.31 ? 424 LEU B CD1   1 
ATOM   6461  C  CD2   . LEU B 1 424 ? -27.305 50.735 28.543  1.00 130.25 ? 424 LEU B CD2   1 
ATOM   6462  N  N     . TYR B 1 425 ? -24.874 54.027 25.554  1.00 134.12 ? 425 TYR B N     1 
ATOM   6463  C  CA    . TYR B 1 425 ? -24.079 55.227 25.737  1.00 127.33 ? 425 TYR B CA    1 
ATOM   6464  C  C     . TYR B 1 425 ? -24.985 56.443 25.741  1.00 130.49 ? 425 TYR B C     1 
ATOM   6465  O  O     . TYR B 1 425 ? -24.560 57.538 26.094  1.00 147.95 ? 425 TYR B O     1 
ATOM   6466  C  CB    . TYR B 1 425 ? -23.004 55.371 24.657  1.00 120.48 ? 425 TYR B CB    1 
ATOM   6467  C  CG    . TYR B 1 425 ? -23.535 55.687 23.277  1.00 123.79 ? 425 TYR B CG    1 
ATOM   6468  C  CD1   . TYR B 1 425 ? -23.768 54.679 22.353  1.00 136.01 ? 425 TYR B CD1   1 
ATOM   6469  C  CD2   . TYR B 1 425 ? -23.800 56.984 22.897  1.00 119.73 ? 425 TYR B CD2   1 
ATOM   6470  C  CE1   . TYR B 1 425 ? -24.252 54.957 21.086  1.00 138.69 ? 425 TYR B CE1   1 
ATOM   6471  C  CE2   . TYR B 1 425 ? -24.293 57.270 21.631  1.00 133.79 ? 425 TYR B CE2   1 
ATOM   6472  C  CZ    . TYR B 1 425 ? -24.516 56.254 20.729  1.00 137.03 ? 425 TYR B CZ    1 
ATOM   6473  O  OH    . TYR B 1 425 ? -25.002 56.536 19.468  1.00 129.99 ? 425 TYR B OH    1 
ATOM   6474  N  N     . ARG B 1 426 ? -26.228 56.265 25.318  1.00 117.68 ? 426 ARG B N     1 
ATOM   6475  C  CA    . ARG B 1 426 ? -27.170 57.369 25.366  1.00 133.10 ? 426 ARG B CA    1 
ATOM   6476  C  C     . ARG B 1 426 ? -27.437 57.798 26.813  1.00 142.06 ? 426 ARG B C     1 
ATOM   6477  O  O     . ARG B 1 426 ? -27.795 58.946 27.072  1.00 143.38 ? 426 ARG B O     1 
ATOM   6478  C  CB    . ARG B 1 426 ? -28.453 57.000 24.624  1.00 136.32 ? 426 ARG B CB    1 
ATOM   6479  C  CG    . ARG B 1 426 ? -28.319 57.073 23.117  1.00 140.36 ? 426 ARG B CG    1 
ATOM   6480  C  CD    . ARG B 1 426 ? -27.819 58.436 22.701  1.00 138.38 ? 426 ARG B CD    1 
ATOM   6481  N  NE    . ARG B 1 426 ? -27.877 58.635 21.258  1.00 143.35 ? 426 ARG B NE    1 
ATOM   6482  C  CZ    . ARG B 1 426 ? -28.964 59.031 20.597  1.00 160.07 ? 426 ARG B CZ    1 
ATOM   6483  N  NH1   . ARG B 1 426 ? -30.108 59.263 21.234  1.00 155.40 ? 426 ARG B NH1   1 
ATOM   6484  N  NH2   . ARG B 1 426 ? -28.911 59.188 19.284  1.00 174.94 ? 426 ARG B NH2   1 
ATOM   6485  N  N     . LEU B 1 427 ? -27.276 56.859 27.743  1.00 145.28 ? 427 LEU B N     1 
ATOM   6486  C  CA    . LEU B 1 427 ? -27.364 57.135 29.178  1.00 145.21 ? 427 LEU B CA    1 
ATOM   6487  C  C     . LEU B 1 427 ? -26.199 58.006 29.654  1.00 149.86 ? 427 LEU B C     1 
ATOM   6488  O  O     . LEU B 1 427 ? -26.268 58.644 30.706  1.00 150.77 ? 427 LEU B O     1 
ATOM   6489  C  CB    . LEU B 1 427 ? -27.379 55.834 29.984  1.00 143.12 ? 427 LEU B CB    1 
ATOM   6490  C  CG    . LEU B 1 427 ? -28.559 54.897 29.770  1.00 142.73 ? 427 LEU B CG    1 
ATOM   6491  C  CD1   . LEU B 1 427 ? -28.689 53.974 30.963  1.00 144.89 ? 427 LEU B CD1   1 
ATOM   6492  C  CD2   . LEU B 1 427 ? -29.819 55.709 29.576  1.00 139.37 ? 427 LEU B CD2   1 
ATOM   6493  N  N     . THR B 1 428 ? -25.116 58.000 28.886  1.00 149.52 ? 428 THR B N     1 
ATOM   6494  C  CA    . THR B 1 428 ? -23.976 58.863 29.153  1.00 153.08 ? 428 THR B CA    1 
ATOM   6495  C  C     . THR B 1 428 ? -24.414 60.327 29.122  1.00 164.49 ? 428 THR B C     1 
ATOM   6496  O  O     . THR B 1 428 ? -23.795 61.187 29.749  1.00 176.48 ? 428 THR B O     1 
ATOM   6497  C  CB    . THR B 1 428 ? -22.866 58.639 28.102  1.00 154.92 ? 428 THR B CB    1 
ATOM   6498  O  OG1   . THR B 1 428 ? -21.601 58.472 28.753  1.00 159.82 ? 428 THR B OG1   1 
ATOM   6499  C  CG2   . THR B 1 428 ? -22.809 59.802 27.097  1.00 150.22 ? 428 THR B CG2   1 
ATOM   6500  N  N     . ASN B 1 429 ? -25.489 60.599 28.387  1.00 167.68 ? 429 ASN B N     1 
ATOM   6501  C  CA    . ASN B 1 429 ? -26.037 61.947 28.272  1.00 172.87 ? 429 ASN B CA    1 
ATOM   6502  C  C     . ASN B 1 429 ? -27.412 62.099 28.947  1.00 167.90 ? 429 ASN B C     1 
ATOM   6503  O  O     . ASN B 1 429 ? -28.452 62.099 28.285  1.00 167.46 ? 429 ASN B O     1 
ATOM   6504  C  CB    . ASN B 1 429 ? -26.084 62.361 26.793  1.00 179.26 ? 429 ASN B CB    1 
ATOM   6505  C  CG    . ASN B 1 429 ? -26.901 63.627 26.547  1.00 186.05 ? 429 ASN B CG    1 
ATOM   6506  O  OD1   . ASN B 1 429 ? -27.233 64.369 27.476  1.00 190.59 ? 429 ASN B OD1   1 
ATOM   6507  N  ND2   . ASN B 1 429 ? -27.228 63.874 25.280  1.00 182.84 ? 429 ASN B ND2   1 
ATOM   6508  N  N     . THR B 1 430 ? -27.406 62.221 30.271  1.00 186.15 ? 430 THR B N     1 
ATOM   6509  C  CA    . THR B 1 430 ? -28.623 62.513 31.014  1.00 167.98 ? 430 THR B CA    1 
ATOM   6510  C  C     . THR B 1 430 ? -28.624 63.994 31.353  1.00 176.42 ? 430 THR B C     1 
ATOM   6511  O  O     . THR B 1 430 ? -27.901 64.433 32.246  1.00 181.25 ? 430 THR B O     1 
ATOM   6512  C  CB    . THR B 1 430 ? -28.694 61.700 32.298  1.00 139.91 ? 430 THR B CB    1 
ATOM   6513  N  N     . ASP B 1 431 ? -29.438 64.762 30.635  1.00 182.60 ? 431 ASP B N     1 
ATOM   6514  C  CA    . ASP B 1 431 ? -29.369 66.220 30.702  1.00 188.65 ? 431 ASP B CA    1 
ATOM   6515  C  C     . ASP B 1 431 ? -30.585 66.944 30.144  1.00 183.33 ? 431 ASP B C     1 
ATOM   6516  O  O     . ASP B 1 431 ? -30.556 67.401 29.009  1.00 176.36 ? 431 ASP B O     1 
ATOM   6517  C  CB    . ASP B 1 431 ? -28.113 66.776 30.044  1.00 197.38 ? 431 ASP B CB    1 
ATOM   6518  C  CG    . ASP B 1 431 ? -27.872 68.232 30.417  1.00 207.11 ? 431 ASP B CG    1 
ATOM   6519  O  OD1   . ASP B 1 431 ? -27.552 69.042 29.515  1.00 202.71 ? 431 ASP B OD1   1 
ATOM   6520  O  OD2   . ASP B 1 431 ? -28.023 68.565 31.620  1.00 211.78 ? 431 ASP B OD2   1 
ATOM   6521  N  N     . VAL B 1 432 ? -31.669 66.970 30.907  1.00 179.77 ? 432 VAL B N     1 
ATOM   6522  C  CA    . VAL B 1 432 ? -32.884 67.683 30.511  1.00 174.10 ? 432 VAL B CA    1 
ATOM   6523  C  C     . VAL B 1 432 ? -32.705 69.094 29.902  1.00 180.47 ? 432 VAL B C     1 
ATOM   6524  O  O     . VAL B 1 432 ? -33.598 69.587 29.214  1.00 193.83 ? 432 VAL B O     1 
ATOM   6525  C  CB    . VAL B 1 432 ? -33.905 67.716 31.661  1.00 158.77 ? 432 VAL B CB    1 
ATOM   6526  C  CG1   . VAL B 1 432 ? -34.883 68.890 31.513  1.00 145.45 ? 432 VAL B CG1   1 
ATOM   6527  C  CG2   . VAL B 1 432 ? -34.645 66.390 31.722  1.00 165.81 ? 432 VAL B CG2   1 
ATOM   6528  N  N     . VAL B 1 433 ? -31.577 69.751 30.146  1.00 158.04 ? 433 VAL B N     1 
ATOM   6529  C  CA    . VAL B 1 433 ? -31.306 71.025 29.469  1.00 145.88 ? 433 VAL B CA    1 
ATOM   6530  C  C     . VAL B 1 433 ? -31.265 70.907 27.939  1.00 136.55 ? 433 VAL B C     1 
ATOM   6531  O  O     . VAL B 1 433 ? -31.921 71.666 27.231  1.00 131.99 ? 433 VAL B O     1 
ATOM   6532  C  CB    . VAL B 1 433 ? -29.955 71.625 29.863  1.00 157.44 ? 433 VAL B CB    1 
ATOM   6533  C  CG1   . VAL B 1 433 ? -29.686 72.892 29.043  1.00 104.88 ? 433 VAL B CG1   1 
ATOM   6534  C  CG2   . VAL B 1 433 ? -29.914 71.910 31.339  1.00 162.04 ? 433 VAL B CG2   1 
ATOM   6535  N  N     . VAL B 1 434 ? -30.467 69.970 27.436  1.00 140.50 ? 434 VAL B N     1 
ATOM   6536  C  CA    . VAL B 1 434 ? -30.297 69.783 26.000  1.00 150.69 ? 434 VAL B CA    1 
ATOM   6537  C  C     . VAL B 1 434 ? -31.607 69.460 25.301  1.00 161.47 ? 434 VAL B C     1 
ATOM   6538  O  O     . VAL B 1 434 ? -31.936 70.045 24.266  1.00 163.49 ? 434 VAL B O     1 
ATOM   6539  C  CB    . VAL B 1 434 ? -29.389 68.614 25.705  1.00 148.67 ? 434 VAL B CB    1 
ATOM   6540  C  CG1   . VAL B 1 434 ? -28.560 68.926 24.476  1.00 130.19 ? 434 VAL B CG1   1 
ATOM   6541  C  CG2   . VAL B 1 434 ? -28.520 68.318 26.913  1.00 165.11 ? 434 VAL B CG2   1 
ATOM   6542  N  N     . LEU B 1 435 ? -32.336 68.500 25.857  1.00 156.20 ? 435 LEU B N     1 
ATOM   6543  C  CA    . LEU B 1 435 ? -33.623 68.124 25.309  1.00 150.12 ? 435 LEU B CA    1 
ATOM   6544  C  C     . LEU B 1 435 ? -34.545 69.331 25.297  1.00 152.39 ? 435 LEU B C     1 
ATOM   6545  O  O     . LEU B 1 435 ? -35.234 69.579 24.313  1.00 151.86 ? 435 LEU B O     1 
ATOM   6546  C  CB    . LEU B 1 435 ? -34.236 66.988 26.119  1.00 157.15 ? 435 LEU B CB    1 
ATOM   6547  C  CG    . LEU B 1 435 ? -33.396 65.717 26.242  1.00 152.47 ? 435 LEU B CG    1 
ATOM   6548  C  CD1   . LEU B 1 435 ? -34.275 64.535 26.620  1.00 157.37 ? 435 LEU B CD1   1 
ATOM   6549  C  CD2   . LEU B 1 435 ? -32.653 65.433 24.954  1.00 139.24 ? 435 LEU B CD2   1 
ATOM   6550  N  N     . GLN B 1 436 ? -34.560 70.077 26.398  1.00 153.03 ? 436 GLN B N     1 
ATOM   6551  C  CA    . GLN B 1 436 ? -35.377 71.286 26.495  1.00 149.70 ? 436 GLN B CA    1 
ATOM   6552  C  C     . GLN B 1 436 ? -35.017 72.285 25.398  1.00 131.90 ? 436 GLN B C     1 
ATOM   6553  O  O     . GLN B 1 436 ? -35.884 72.985 24.883  1.00 134.87 ? 436 GLN B O     1 
ATOM   6554  C  CB    . GLN B 1 436 ? -35.270 71.934 27.887  1.00 155.41 ? 436 GLN B CB    1 
ATOM   6555  N  N     . GLU B 1 437 ? -33.735 72.355 25.054  1.00 119.28 ? 437 GLU B N     1 
ATOM   6556  C  CA    . GLU B 1 437 ? -33.286 73.217 23.965  1.00 132.99 ? 437 GLU B CA    1 
ATOM   6557  C  C     . GLU B 1 437 ? -33.962 72.848 22.645  1.00 132.32 ? 437 GLU B C     1 
ATOM   6558  O  O     . GLU B 1 437 ? -34.507 73.719 21.962  1.00 122.14 ? 437 GLU B O     1 
ATOM   6559  C  CB    . GLU B 1 437 ? -31.766 73.160 23.819  1.00 146.16 ? 437 GLU B CB    1 
ATOM   6560  C  CG    . GLU B 1 437 ? -31.030 74.322 24.455  1.00 153.34 ? 437 GLU B CG    1 
ATOM   6561  C  CD    . GLU B 1 437 ? -29.703 73.906 25.067  1.00 160.19 ? 437 GLU B CD    1 
ATOM   6562  O  OE1   . GLU B 1 437 ? -28.681 74.579 24.803  1.00 159.32 ? 437 GLU B OE1   1 
ATOM   6563  O  OE2   . GLU B 1 437 ? -29.686 72.903 25.815  1.00 159.61 ? 437 GLU B OE2   1 
ATOM   6564  N  N     . GLU B 1 438 ? -33.917 71.562 22.288  1.00 136.50 ? 438 GLU B N     1 
ATOM   6565  C  CA    . GLU B 1 438 ? -34.617 71.071 21.098  1.00 136.86 ? 438 GLU B CA    1 
ATOM   6566  C  C     . GLU B 1 438 ? -36.116 71.290 21.231  1.00 144.98 ? 438 GLU B C     1 
ATOM   6567  O  O     . GLU B 1 438 ? -36.767 71.673 20.268  1.00 152.67 ? 438 GLU B O     1 
ATOM   6568  C  CB    . GLU B 1 438 ? -34.337 69.584 20.784  1.00 98.91  ? 438 GLU B CB    1 
ATOM   6569  N  N     . GLU B 1 439 ? -36.662 71.047 22.420  1.00 133.58 ? 439 GLU B N     1 
ATOM   6570  C  CA    . GLU B 1 439 ? -38.095 71.214 22.629  1.00 137.41 ? 439 GLU B CA    1 
ATOM   6571  C  C     . GLU B 1 439 ? -38.530 72.628 22.250  1.00 146.51 ? 439 GLU B C     1 
ATOM   6572  O  O     . GLU B 1 439 ? -39.526 72.816 21.551  1.00 155.82 ? 439 GLU B O     1 
ATOM   6573  C  CB    . GLU B 1 439 ? -38.508 70.867 24.060  1.00 137.63 ? 439 GLU B CB    1 
ATOM   6574  C  CG    . GLU B 1 439 ? -40.011 71.019 24.334  1.00 148.48 ? 439 GLU B CG    1 
ATOM   6575  C  CD    . GLU B 1 439 ? -40.339 71.213 25.819  1.00 180.10 ? 439 GLU B CD    1 
ATOM   6576  O  OE1   . GLU B 1 439 ? -41.420 71.755 26.127  1.00 189.98 ? 439 GLU B OE1   1 
ATOM   6577  O  OE2   . GLU B 1 439 ? -39.518 70.836 26.684  1.00 191.52 ? 439 GLU B OE2   1 
ATOM   6578  N  N     . ALA B 1 440 ? -37.772 73.624 22.693  1.00 138.60 ? 440 ALA B N     1 
ATOM   6579  C  CA    . ALA B 1 440 ? -38.047 74.999 22.298  1.00 130.87 ? 440 ALA B CA    1 
ATOM   6580  C  C     . ALA B 1 440 ? -38.035 75.075 20.790  1.00 135.36 ? 440 ALA B C     1 
ATOM   6581  O  O     . ALA B 1 440 ? -38.970 75.579 20.166  1.00 141.80 ? 440 ALA B O     1 
ATOM   6582  C  CB    . ALA B 1 440 ? -36.995 75.913 22.836  1.00 123.67 ? 440 ALA B CB    1 
ATOM   6583  N  N     . GLU B 1 441 ? -36.964 74.546 20.210  1.00 128.05 ? 441 GLU B N     1 
ATOM   6584  C  CA    . GLU B 1 441 ? -36.736 74.659 18.781  1.00 124.80 ? 441 GLU B CA    1 
ATOM   6585  C  C     . GLU B 1 441 ? -37.958 74.155 18.042  1.00 130.60 ? 441 GLU B C     1 
ATOM   6586  O  O     . GLU B 1 441 ? -38.496 74.833 17.170  1.00 134.29 ? 441 GLU B O     1 
ATOM   6587  C  CB    . GLU B 1 441 ? -35.510 73.847 18.383  1.00 126.04 ? 441 GLU B CB    1 
ATOM   6588  C  CG    . GLU B 1 441 ? -34.583 74.571 17.428  1.00 135.39 ? 441 GLU B CG    1 
ATOM   6589  C  CD    . GLU B 1 441 ? -33.999 73.643 16.395  1.00 155.73 ? 441 GLU B CD    1 
ATOM   6590  O  OE1   . GLU B 1 441 ? -34.577 72.550 16.186  1.00 166.83 ? 441 GLU B OE1   1 
ATOM   6591  O  OE2   . GLU B 1 441 ? -32.970 74.004 15.786  1.00 159.93 ? 441 GLU B OE2   1 
ATOM   6592  N  N     . LEU B 1 442 ? -38.408 72.967 18.420  1.00 136.41 ? 442 LEU B N     1 
ATOM   6593  C  CA    . LEU B 1 442 ? -39.556 72.360 17.779  1.00 143.32 ? 442 LEU B CA    1 
ATOM   6594  C  C     . LEU B 1 442 ? -40.779 73.244 17.942  1.00 137.17 ? 442 LEU B C     1 
ATOM   6595  O  O     . LEU B 1 442 ? -41.427 73.598 16.965  1.00 139.27 ? 442 LEU B O     1 
ATOM   6596  C  CB    . LEU B 1 442 ? -39.830 70.972 18.363  1.00 153.81 ? 442 LEU B CB    1 
ATOM   6597  C  CG    . LEU B 1 442 ? -38.725 69.925 18.194  1.00 151.08 ? 442 LEU B CG    1 
ATOM   6598  C  CD1   . LEU B 1 442 ? -39.289 68.524 18.324  1.00 149.59 ? 442 LEU B CD1   1 
ATOM   6599  C  CD2   . LEU B 1 442 ? -38.011 70.084 16.856  1.00 137.12 ? 442 LEU B CD2   1 
ATOM   6600  N  N     . ARG B 1 443 ? -41.087 73.620 19.175  1.00 132.16 ? 443 ARG B N     1 
ATOM   6601  C  CA    . ARG B 1 443 ? -42.309 74.374 19.417  1.00 139.85 ? 443 ARG B CA    1 
ATOM   6602  C  C     . ARG B 1 443 ? -42.343 75.638 18.561  1.00 143.41 ? 443 ARG B C     1 
ATOM   6603  O  O     . ARG B 1 443 ? -43.369 75.962 17.957  1.00 140.50 ? 443 ARG B O     1 
ATOM   6604  C  CB    . ARG B 1 443 ? -42.452 74.704 20.893  1.00 138.07 ? 443 ARG B CB    1 
ATOM   6605  C  CG    . ARG B 1 443 ? -43.773 74.268 21.477  1.00 138.06 ? 443 ARG B CG    1 
ATOM   6606  C  CD    . ARG B 1 443 ? -43.605 73.721 22.896  1.00 154.52 ? 443 ARG B CD    1 
ATOM   6607  N  NE    . ARG B 1 443 ? -44.508 72.593 23.094  1.00 173.64 ? 443 ARG B NE    1 
ATOM   6608  C  CZ    . ARG B 1 443 ? -44.445 71.744 24.109  1.00 171.79 ? 443 ARG B CZ    1 
ATOM   6609  N  NH1   . ARG B 1 443 ? -43.510 71.909 25.030  1.00 158.81 ? 443 ARG B NH1   1 
ATOM   6610  N  NH2   . ARG B 1 443 ? -45.315 70.734 24.191  1.00 170.78 ? 443 ARG B NH2   1 
ATOM   6611  N  N     . GLU B 1 444 ? -41.211 76.337 18.503  1.00 148.39 ? 444 GLU B N     1 
ATOM   6612  C  CA    . GLU B 1 444 ? -41.071 77.508 17.639  1.00 149.67 ? 444 GLU B CA    1 
ATOM   6613  C  C     . GLU B 1 444 ? -41.271 77.191 16.144  1.00 122.95 ? 444 GLU B C     1 
ATOM   6614  O  O     . GLU B 1 444 ? -41.956 77.943 15.455  1.00 129.35 ? 444 GLU B O     1 
ATOM   6615  C  CB    . GLU B 1 444 ? -39.748 78.241 17.902  1.00 108.58 ? 444 GLU B CB    1 
ATOM   6616  N  N     . LYS B 1 445 ? -40.686 76.100 15.637  1.00 112.25 ? 445 LYS B N     1 
ATOM   6617  C  CA    . LYS B 1 445 ? -40.945 75.691 14.239  1.00 133.11 ? 445 LYS B CA    1 
ATOM   6618  C  C     . LYS B 1 445 ? -42.429 75.391 14.004  1.00 126.74 ? 445 LYS B C     1 
ATOM   6619  O  O     . LYS B 1 445 ? -43.018 75.874 13.048  1.00 125.62 ? 445 LYS B O     1 
ATOM   6620  C  CB    . LYS B 1 445 ? -40.064 74.503 13.729  1.00 99.06  ? 445 LYS B CB    1 
ATOM   6621  N  N     . ILE B 1 446 ? -43.033 74.602 14.881  1.00 115.91 ? 446 ILE B N     1 
ATOM   6622  C  CA    . ILE B 1 446 ? -44.422 74.227 14.708  1.00 121.44 ? 446 ILE B CA    1 
ATOM   6623  C  C     . ILE B 1 446 ? -45.287 75.462 14.598  1.00 141.12 ? 446 ILE B C     1 
ATOM   6624  O  O     . ILE B 1 446 ? -46.080 75.586 13.672  1.00 143.00 ? 446 ILE B O     1 
ATOM   6625  C  CB    . ILE B 1 446 ? -44.920 73.384 15.887  1.00 127.20 ? 446 ILE B CB    1 
ATOM   6626  C  CG1   . ILE B 1 446 ? -44.116 72.097 15.980  1.00 128.36 ? 446 ILE B CG1   1 
ATOM   6627  C  CG2   . ILE B 1 446 ? -46.400 73.064 15.740  1.00 131.49 ? 446 ILE B CG2   1 
ATOM   6628  C  CD1   . ILE B 1 446 ? -44.593 71.170 17.033  1.00 119.73 ? 446 ILE B CD1   1 
ATOM   6629  N  N     . ALA B 1 447 ? -45.133 76.378 15.548  1.00 147.06 ? 447 ALA B N     1 
ATOM   6630  C  CA    . ALA B 1 447 ? -45.927 77.602 15.561  1.00 141.07 ? 447 ALA B CA    1 
ATOM   6631  C  C     . ALA B 1 447 ? -45.679 78.481 14.331  1.00 147.05 ? 447 ALA B C     1 
ATOM   6632  O  O     . ALA B 1 447 ? -46.604 79.091 13.798  1.00 162.39 ? 447 ALA B O     1 
ATOM   6633  C  CB    . ALA B 1 447 ? -45.672 78.339 16.776  1.00 139.84 ? 447 ALA B CB    1 
ATOM   6634  N  N     . MET B 1 448 ? -44.429 78.561 13.892  1.00 135.99 ? 448 MET B N     1 
ATOM   6635  C  CA    . MET B 1 448 ? -44.121 79.241 12.644  1.00 137.85 ? 448 MET B CA    1 
ATOM   6636  C  C     . MET B 1 448 ? -44.913 78.619 11.493  1.00 140.33 ? 448 MET B C     1 
ATOM   6637  O  O     . MET B 1 448 ? -45.588 79.322 10.743  1.00 144.12 ? 448 MET B O     1 
ATOM   6638  C  CB    . MET B 1 448 ? -42.618 79.178 12.355  1.00 139.62 ? 448 MET B CB    1 
ATOM   6639  C  CG    . MET B 1 448 ? -42.258 79.121 10.873  1.00 131.20 ? 448 MET B CG    1 
ATOM   6640  N  N     . LEU B 1 449 ? -44.833 77.296 11.369  1.00 134.95 ? 449 LEU B N     1 
ATOM   6641  C  CA    . LEU B 1 449 ? -45.503 76.553 10.298  1.00 122.61 ? 449 LEU B CA    1 
ATOM   6642  C  C     . LEU B 1 449 ? -47.003 76.731 10.322  1.00 131.87 ? 449 LEU B C     1 
ATOM   6643  O  O     . LEU B 1 449 ? -47.613 77.021 9.300   1.00 140.35 ? 449 LEU B O     1 
ATOM   6644  C  CB    . LEU B 1 449 ? -45.218 75.058 10.413  1.00 109.41 ? 449 LEU B CB    1 
ATOM   6645  C  CG    . LEU B 1 449 ? -43.792 74.634 10.092  1.00 111.53 ? 449 LEU B CG    1 
ATOM   6646  C  CD1   . LEU B 1 449 ? -43.634 73.141 10.237  1.00 111.44 ? 449 LEU B CD1   1 
ATOM   6647  C  CD2   . LEU B 1 449 ? -43.439 75.073 8.701   1.00 108.91 ? 449 LEU B CD2   1 
ATOM   6648  N  N     . ALA B 1 450 ? -47.598 76.535 11.491  1.00 141.28 ? 450 ALA B N     1 
ATOM   6649  C  CA    . ALA B 1 450 ? -49.039 76.620 11.629  1.00 156.41 ? 450 ALA B CA    1 
ATOM   6650  C  C     . ALA B 1 450 ? -49.511 77.947 11.063  1.00 165.61 ? 450 ALA B C     1 
ATOM   6651  O  O     . ALA B 1 450 ? -50.592 78.031 10.472  1.00 172.05 ? 450 ALA B O     1 
ATOM   6652  C  CB    . ALA B 1 450 ? -49.436 76.482 13.070  1.00 159.28 ? 450 ALA B CB    1 
ATOM   6653  N  N     . ALA B 1 451 ? -48.689 78.979 11.244  1.00 152.95 ? 451 ALA B N     1 
ATOM   6654  C  CA    . ALA B 1 451 ? -48.943 80.269 10.619  1.00 150.81 ? 451 ALA B CA    1 
ATOM   6655  C  C     . ALA B 1 451 ? -49.063 80.125 9.097   1.00 153.35 ? 451 ALA B C     1 
ATOM   6656  O  O     . ALA B 1 451 ? -50.148 80.275 8.544   1.00 167.00 ? 451 ALA B O     1 
ATOM   6657  C  CB    . ALA B 1 451 ? -47.850 81.215 10.954  1.00 147.58 ? 451 ALA B CB    1 
ATOM   6658  N  N     . ILE B 1 452 ? -47.968 79.774 8.430   1.00 132.45 ? 452 ILE B N     1 
ATOM   6659  C  CA    . ILE B 1 452 ? -47.979 79.637 6.973   1.00 125.81 ? 452 ILE B CA    1 
ATOM   6660  C  C     . ILE B 1 452 ? -49.203 78.886 6.482   1.00 132.52 ? 452 ILE B C     1 
ATOM   6661  O  O     . ILE B 1 452 ? -49.860 79.297 5.534   1.00 143.59 ? 452 ILE B O     1 
ATOM   6662  C  CB    . ILE B 1 452 ? -46.760 78.848 6.468   1.00 123.70 ? 452 ILE B CB    1 
ATOM   6663  C  CG1   . ILE B 1 452 ? -45.546 79.122 7.359   1.00 124.60 ? 452 ILE B CG1   1 
ATOM   6664  C  CG2   . ILE B 1 452 ? -46.495 79.145 4.980   1.00 116.73 ? 452 ILE B CG2   1 
ATOM   6665  C  CD1   . ILE B 1 452 ? -44.282 78.473 6.878   1.00 105.65 ? 452 ILE B CD1   1 
ATOM   6666  N  N     . ILE B 1 453 ? -49.490 77.773 7.136   1.00 142.14 ? 453 ILE B N     1 
ATOM   6667  C  CA    . ILE B 1 453 ? -50.616 76.929 6.777   1.00 154.14 ? 453 ILE B CA    1 
ATOM   6668  C  C     . ILE B 1 453 ? -51.951 77.679 6.726   1.00 168.41 ? 453 ILE B C     1 
ATOM   6669  O  O     . ILE B 1 453 ? -52.713 77.516 5.775   1.00 182.23 ? 453 ILE B O     1 
ATOM   6670  C  CB    . ILE B 1 453 ? -50.684 75.716 7.723   1.00 158.48 ? 453 ILE B CB    1 
ATOM   6671  C  CG1   . ILE B 1 453 ? -49.889 74.559 7.119   1.00 155.40 ? 453 ILE B CG1   1 
ATOM   6672  C  CG2   . ILE B 1 453 ? -52.122 75.323 8.024   1.00 164.05 ? 453 ILE B CG2   1 
ATOM   6673  C  CD1   . ILE B 1 453 ? -49.628 73.445 8.081   1.00 166.98 ? 453 ILE B CD1   1 
ATOM   6674  N  N     . GLY B 1 454 ? -52.236 78.503 7.731   1.00 159.04 ? 454 GLY B N     1 
ATOM   6675  C  CA    . GLY B 1 454 ? -53.490 79.239 7.751   1.00 163.65 ? 454 GLY B CA    1 
ATOM   6676  C  C     . GLY B 1 454 ? -53.344 80.748 7.855   1.00 178.80 ? 454 GLY B C     1 
ATOM   6677  O  O     . GLY B 1 454 ? -54.072 81.396 8.613   1.00 190.19 ? 454 GLY B O     1 
ATOM   6678  N  N     . ASP B 1 455 ? -52.422 81.315 7.080   1.00 181.44 ? 455 ASP B N     1 
ATOM   6679  C  CA    . ASP B 1 455 ? -52.058 82.728 7.225   1.00 199.27 ? 455 ASP B CA    1 
ATOM   6680  C  C     . ASP B 1 455 ? -51.922 83.451 5.900   1.00 194.51 ? 455 ASP B C     1 
ATOM   6681  O  O     . ASP B 1 455 ? -51.233 84.449 5.816   1.00 202.93 ? 455 ASP B O     1 
ATOM   6682  C  CB    . ASP B 1 455 ? -50.769 82.906 8.033   1.00 209.63 ? 455 ASP B CB    1 
ATOM   6683  N  N     . GLU B 1 456 ? -52.635 82.973 4.894   1.00 146.03 ? 456 GLU B N     1 
ATOM   6684  C  CA    . GLU B 1 456 ? -52.363 83.246 3.479   1.00 153.37 ? 456 GLU B CA    1 
ATOM   6685  C  C     . GLU B 1 456 ? -51.276 84.266 3.065   1.00 159.78 ? 456 GLU B C     1 
ATOM   6686  O  O     . GLU B 1 456 ? -50.510 83.983 2.152   1.00 152.88 ? 456 GLU B O     1 
ATOM   6687  C  CB    . GLU B 1 456 ? -53.683 83.489 2.726   1.00 144.33 ? 456 GLU B CB    1 
ATOM   6688  C  CG    . GLU B 1 456 ? -53.603 83.227 1.218   1.00 163.74 ? 456 GLU B CG    1 
ATOM   6689  C  CD    . GLU B 1 456 ? -53.786 81.750 0.800   1.00 165.90 ? 456 GLU B CD    1 
ATOM   6690  O  OE1   . GLU B 1 456 ? -53.843 81.477 -0.432  1.00 156.18 ? 456 GLU B OE1   1 
ATOM   6691  O  OE2   . GLU B 1 456 ? -53.879 80.871 1.689   1.00 160.92 ? 456 GLU B OE2   1 
ATOM   6692  N  N     . ARG B 1 457 ? -51.203 85.441 3.677   1.00 178.59 ? 457 ARG B N     1 
ATOM   6693  C  CA    . ARG B 1 457 ? -50.124 86.370 3.310   1.00 177.78 ? 457 ARG B CA    1 
ATOM   6694  C  C     . ARG B 1 457 ? -48.745 85.908 3.817   1.00 158.45 ? 457 ARG B C     1 
ATOM   6695  O  O     . ARG B 1 457 ? -47.746 86.041 3.113   1.00 163.40 ? 457 ARG B O     1 
ATOM   6696  C  CB    . ARG B 1 457 ? -50.438 87.824 3.721   1.00 182.11 ? 457 ARG B CB    1 
ATOM   6697  C  CG    . ARG B 1 457 ? -49.736 88.939 2.874   1.00 159.31 ? 457 ARG B CG    1 
ATOM   6698  C  CD    . ARG B 1 457 ? -49.010 88.411 1.620   1.00 161.99 ? 457 ARG B CD    1 
ATOM   6699  N  NE    . ARG B 1 457 ? -49.475 88.870 0.298   1.00 169.18 ? 457 ARG B NE    1 
ATOM   6700  C  CZ    . ARG B 1 457 ? -50.740 89.066 -0.088  1.00 166.27 ? 457 ARG B CZ    1 
ATOM   6701  N  NH1   . ARG B 1 457 ? -51.745 88.854 0.759   1.00 171.33 ? 457 ARG B NH1   1 
ATOM   6702  N  NH2   . ARG B 1 457 ? -50.998 89.474 -1.341  1.00 139.43 ? 457 ARG B NH2   1 
ATOM   6703  N  N     . THR B 1 458 ? -48.688 85.367 5.028   1.00 144.61 ? 458 THR B N     1 
ATOM   6704  C  CA    . THR B 1 458 ? -47.442 84.797 5.542   1.00 157.73 ? 458 THR B CA    1 
ATOM   6705  C  C     . THR B 1 458 ? -46.934 83.734 4.557   1.00 152.36 ? 458 THR B C     1 
ATOM   6706  O  O     . THR B 1 458 ? -45.726 83.605 4.334   1.00 150.30 ? 458 THR B O     1 
ATOM   6707  C  CB    . THR B 1 458 ? -47.552 84.265 7.058   1.00 88.08  ? 458 THR B CB    1 
ATOM   6708  N  N     . MET B 1 459 ? -47.863 82.985 3.963   1.00 142.60 ? 459 MET B N     1 
ATOM   6709  C  CA    . MET B 1 459 ? -47.521 81.983 2.949   1.00 136.28 ? 459 MET B CA    1 
ATOM   6710  C  C     . MET B 1 459 ? -46.886 82.626 1.713   1.00 141.28 ? 459 MET B C     1 
ATOM   6711  O  O     . MET B 1 459 ? -45.806 82.216 1.282   1.00 147.13 ? 459 MET B O     1 
ATOM   6712  C  CB    . MET B 1 459 ? -48.773 81.200 2.536   1.00 136.42 ? 459 MET B CB    1 
ATOM   6713  C  CG    . MET B 1 459 ? -48.541 79.952 1.689   1.00 135.19 ? 459 MET B CG    1 
ATOM   6714  S  SD    . MET B 1 459 ? -48.175 80.165 -0.083  1.00 192.06 ? 459 MET B SD    1 
ATOM   6715  C  CE    . MET B 1 459 ? -49.577 81.110 -0.631  1.00 94.75  ? 459 MET B CE    1 
ATOM   6716  N  N     . TYR B 1 460 ? -47.570 83.625 1.148   1.00 133.79 ? 460 TYR B N     1 
ATOM   6717  C  CA    . TYR B 1 460 ? -47.119 84.318 -0.063  1.00 119.78 ? 460 TYR B CA    1 
ATOM   6718  C  C     . TYR B 1 460 ? -45.771 84.996 0.093   1.00 124.24 ? 460 TYR B C     1 
ATOM   6719  O  O     . TYR B 1 460 ? -44.969 85.021 -0.842  1.00 117.87 ? 460 TYR B O     1 
ATOM   6720  C  CB    . TYR B 1 460 ? -48.160 85.329 -0.527  1.00 118.23 ? 460 TYR B CB    1 
ATOM   6721  C  CG    . TYR B 1 460 ? -49.323 84.650 -1.200  1.00 136.09 ? 460 TYR B CG    1 
ATOM   6722  C  CD1   . TYR B 1 460 ? -49.231 84.188 -2.509  1.00 129.39 ? 460 TYR B CD1   1 
ATOM   6723  C  CD2   . TYR B 1 460 ? -50.502 84.430 -0.514  1.00 146.92 ? 460 TYR B CD2   1 
ATOM   6724  C  CE1   . TYR B 1 460 ? -50.302 83.544 -3.115  1.00 126.86 ? 460 TYR B CE1   1 
ATOM   6725  C  CE2   . TYR B 1 460 ? -51.569 83.791 -1.112  1.00 146.54 ? 460 TYR B CE2   1 
ATOM   6726  C  CZ    . TYR B 1 460 ? -51.469 83.349 -2.403  1.00 131.57 ? 460 TYR B CZ    1 
ATOM   6727  O  OH    . TYR B 1 460 ? -52.550 82.707 -2.955  1.00 127.01 ? 460 TYR B OH    1 
ATOM   6728  N  N     . ASN B 1 461 ? -45.533 85.558 1.274   1.00 134.92 ? 461 ASN B N     1 
ATOM   6729  C  CA    . ASN B 1 461 ? -44.238 86.144 1.586   1.00 139.01 ? 461 ASN B CA    1 
ATOM   6730  C  C     . ASN B 1 461 ? -43.103 85.126 1.483   1.00 139.47 ? 461 ASN B C     1 
ATOM   6731  O  O     . ASN B 1 461 ? -42.120 85.364 0.785   1.00 140.29 ? 461 ASN B O     1 
ATOM   6732  C  CB    . ASN B 1 461 ? -44.269 86.786 2.960   1.00 143.76 ? 461 ASN B CB    1 
ATOM   6733  C  CG    . ASN B 1 461 ? -45.129 88.034 2.995   1.00 154.51 ? 461 ASN B CG    1 
ATOM   6734  O  OD1   . ASN B 1 461 ? -45.530 88.564 1.950   1.00 149.50 ? 461 ASN B OD1   1 
ATOM   6735  N  ND2   . ASN B 1 461 ? -45.412 88.519 4.207   1.00 166.71 ? 461 ASN B ND2   1 
ATOM   6736  N  N     . LEU B 1 462 ? -43.253 83.986 2.154   1.00 136.80 ? 462 LEU B N     1 
ATOM   6737  C  CA    . LEU B 1 462 ? -42.296 82.883 2.025   1.00 125.82 ? 462 LEU B CA    1 
ATOM   6738  C  C     . LEU B 1 462 ? -42.044 82.525 0.550   1.00 122.28 ? 462 LEU B C     1 
ATOM   6739  O  O     . LEU B 1 462 ? -40.903 82.287 0.149   1.00 128.52 ? 462 LEU B O     1 
ATOM   6740  C  CB    . LEU B 1 462 ? -42.793 81.654 2.774   1.00 119.29 ? 462 LEU B CB    1 
ATOM   6741  C  CG    . LEU B 1 462 ? -41.774 80.775 3.491   1.00 125.21 ? 462 LEU B CG    1 
ATOM   6742  C  CD1   . LEU B 1 462 ? -42.504 79.595 4.097   1.00 132.07 ? 462 LEU B CD1   1 
ATOM   6743  C  CD2   . LEU B 1 462 ? -40.638 80.294 2.597   1.00 129.42 ? 462 LEU B CD2   1 
ATOM   6744  N  N     . MET B 1 463 ? -43.103 82.480 -0.257  1.00 112.15 ? 463 MET B N     1 
ATOM   6745  C  CA    . MET B 1 463 ? -42.932 82.281 -1.688  1.00 123.28 ? 463 MET B CA    1 
ATOM   6746  C  C     . MET B 1 463 ? -41.995 83.325 -2.251  1.00 139.17 ? 463 MET B C     1 
ATOM   6747  O  O     . MET B 1 463 ? -41.009 83.000 -2.917  1.00 138.37 ? 463 MET B O     1 
ATOM   6748  C  CB    . MET B 1 463 ? -44.268 82.352 -2.403  1.00 133.81 ? 463 MET B CB    1 
ATOM   6749  C  CG    . MET B 1 463 ? -44.474 81.210 -3.365  1.00 143.20 ? 463 MET B CG    1 
ATOM   6750  S  SD    . MET B 1 463 ? -46.015 81.400 -4.252  1.00 145.09 ? 463 MET B SD    1 
ATOM   6751  C  CE    . MET B 1 463 ? -45.488 82.638 -5.417  1.00 114.44 ? 463 MET B CE    1 
ATOM   6752  N  N     . LYS B 1 464 ? -42.317 84.586 -1.985  1.00 149.36 ? 464 LYS B N     1 
ATOM   6753  C  CA    . LYS B 1 464 ? -41.546 85.687 -2.541  1.00 141.17 ? 464 LYS B CA    1 
ATOM   6754  C  C     . LYS B 1 464 ? -40.076 85.534 -2.137  1.00 136.32 ? 464 LYS B C     1 
ATOM   6755  O  O     . LYS B 1 464 ? -39.180 85.653 -2.976  1.00 135.30 ? 464 LYS B O     1 
ATOM   6756  C  CB    . LYS B 1 464 ? -42.162 87.050 -2.158  1.00 113.63 ? 464 LYS B CB    1 
ATOM   6757  N  N     . LYS B 1 465 ? -39.831 85.229 -0.866  1.00 123.13 ? 465 LYS B N     1 
ATOM   6758  C  CA    . LYS B 1 465 ? -38.457 85.068 -0.398  1.00 139.17 ? 465 LYS B CA    1 
ATOM   6759  C  C     . LYS B 1 465 ? -37.739 83.975 -1.201  1.00 136.98 ? 465 LYS B C     1 
ATOM   6760  O  O     . LYS B 1 465 ? -36.751 84.244 -1.887  1.00 142.51 ? 465 LYS B O     1 
ATOM   6761  C  CB    . LYS B 1 465 ? -38.358 84.815 1.138   1.00 95.32  ? 465 LYS B CB    1 
ATOM   6762  N  N     . GLU B 1 466 ? -38.245 82.752 -1.145  1.00 124.62 ? 466 GLU B N     1 
ATOM   6763  C  CA    . GLU B 1 466 ? -37.552 81.669 -1.809  1.00 141.94 ? 466 GLU B CA    1 
ATOM   6764  C  C     . GLU B 1 466 ? -37.271 82.056 -3.259  1.00 139.29 ? 466 GLU B C     1 
ATOM   6765  O  O     . GLU B 1 466 ? -36.177 81.819 -3.774  1.00 142.28 ? 466 GLU B O     1 
ATOM   6766  C  CB    . GLU B 1 466 ? -38.361 80.381 -1.714  1.00 167.79 ? 466 GLU B CB    1 
ATOM   6767  C  CG    . GLU B 1 466 ? -38.691 80.002 -0.282  1.00 183.36 ? 466 GLU B CG    1 
ATOM   6768  C  CD    . GLU B 1 466 ? -39.326 78.628 -0.159  1.00 200.42 ? 466 GLU B CD    1 
ATOM   6769  O  OE1   . GLU B 1 466 ? -39.755 78.059 -1.195  1.00 198.53 ? 466 GLU B OE1   1 
ATOM   6770  O  OE2   . GLU B 1 466 ? -39.392 78.124 0.988   1.00 208.76 ? 466 GLU B OE2   1 
ATOM   6771  N  N     . LEU B 1 467 ? -38.253 82.672 -3.908  1.00 121.93 ? 467 LEU B N     1 
ATOM   6772  C  CA    . LEU B 1 467 ? -38.091 83.059 -5.300  1.00 117.98 ? 467 LEU B CA    1 
ATOM   6773  C  C     . LEU B 1 467 ? -36.934 84.016 -5.476  1.00 119.94 ? 467 LEU B C     1 
ATOM   6774  O  O     . LEU B 1 467 ? -36.121 83.862 -6.391  1.00 117.61 ? 467 LEU B O     1 
ATOM   6775  C  CB    . LEU B 1 467 ? -39.368 83.683 -5.841  1.00 124.63 ? 467 LEU B CB    1 
ATOM   6776  C  CG    . LEU B 1 467 ? -40.321 82.716 -6.546  1.00 122.66 ? 467 LEU B CG    1 
ATOM   6777  C  CD1   . LEU B 1 467 ? -41.588 83.437 -6.967  1.00 135.66 ? 467 LEU B CD1   1 
ATOM   6778  C  CD2   . LEU B 1 467 ? -39.638 82.079 -7.740  1.00 110.99 ? 467 LEU B CD2   1 
ATOM   6779  N  N     . ARG B 1 468 ? -36.873 85.018 -4.606  1.00 123.34 ? 468 ARG B N     1 
ATOM   6780  C  CA    . ARG B 1 468 ? -35.779 85.980 -4.642  1.00 122.77 ? 468 ARG B CA    1 
ATOM   6781  C  C     . ARG B 1 468 ? -34.435 85.301 -4.417  1.00 135.73 ? 468 ARG B C     1 
ATOM   6782  O  O     . ARG B 1 468 ? -33.466 85.603 -5.115  1.00 142.22 ? 468 ARG B O     1 
ATOM   6783  C  CB    . ARG B 1 468 ? -35.990 87.115 -3.646  1.00 121.86 ? 468 ARG B CB    1 
ATOM   6784  C  CG    . ARG B 1 468 ? -37.145 88.021 -4.027  1.00 137.24 ? 468 ARG B CG    1 
ATOM   6785  C  CD    . ARG B 1 468 ? -36.800 89.507 -3.897  1.00 154.45 ? 468 ARG B CD    1 
ATOM   6786  N  NE    . ARG B 1 468 ? -37.989 90.349 -4.029  1.00 157.44 ? 468 ARG B NE    1 
ATOM   6787  C  CZ    . ARG B 1 468 ? -38.924 90.475 -3.087  1.00 153.16 ? 468 ARG B CZ    1 
ATOM   6788  N  NH1   . ARG B 1 468 ? -38.822 89.808 -1.924  1.00 134.41 ? 468 ARG B NH1   1 
ATOM   6789  N  NH2   . ARG B 1 468 ? -39.969 91.267 -3.313  1.00 147.68 ? 468 ARG B NH2   1 
ATOM   6790  N  N     . GLU B 1 469 ? -34.387 84.381 -3.451  1.00 137.50 ? 469 GLU B N     1 
ATOM   6791  C  CA    . GLU B 1 469 ? -33.174 83.607 -3.170  1.00 128.48 ? 469 GLU B CA    1 
ATOM   6792  C  C     . GLU B 1 469 ? -32.705 82.844 -4.416  1.00 124.97 ? 469 GLU B C     1 
ATOM   6793  O  O     . GLU B 1 469 ? -31.503 82.772 -4.699  1.00 128.62 ? 469 GLU B O     1 
ATOM   6794  C  CB    . GLU B 1 469 ? -33.362 82.670 -1.965  1.00 97.85  ? 469 GLU B CB    1 
ATOM   6795  N  N     . VAL B 1 470 ? -33.657 82.274 -5.152  1.00 102.40 ? 470 VAL B N     1 
ATOM   6796  C  CA    . VAL B 1 470 ? -33.347 81.577 -6.396  1.00 125.23 ? 470 VAL B CA    1 
ATOM   6797  C  C     . VAL B 1 470 ? -32.824 82.519 -7.491  1.00 142.38 ? 470 VAL B C     1 
ATOM   6798  O  O     . VAL B 1 470 ? -31.900 82.168 -8.244  1.00 142.64 ? 470 VAL B O     1 
ATOM   6799  C  CB    . VAL B 1 470 ? -34.557 80.780 -6.909  1.00 131.79 ? 470 VAL B CB    1 
ATOM   6800  C  CG1   . VAL B 1 470 ? -34.535 80.704 -8.419  1.00 124.47 ? 470 VAL B CG1   1 
ATOM   6801  C  CG2   . VAL B 1 470 ? -34.556 79.391 -6.298  1.00 131.53 ? 470 VAL B CG2   1 
ATOM   6802  N  N     . LYS B 1 471 ? -33.426 83.704 -7.592  1.00 145.20 ? 471 LYS B N     1 
ATOM   6803  C  CA    . LYS B 1 471 ? -32.949 84.710 -8.537  1.00 140.12 ? 471 LYS B CA    1 
ATOM   6804  C  C     . LYS B 1 471 ? -31.500 85.089 -8.219  1.00 135.97 ? 471 LYS B C     1 
ATOM   6805  O  O     . LYS B 1 471 ? -30.647 85.117 -9.106  1.00 124.88 ? 471 LYS B O     1 
ATOM   6806  C  CB    . LYS B 1 471 ? -33.851 85.950 -8.553  1.00 131.98 ? 471 LYS B CB    1 
ATOM   6807  N  N     . LYS B 1 472 ? -31.217 85.360 -6.947  1.00 142.44 ? 472 LYS B N     1 
ATOM   6808  C  CA    . LYS B 1 472 ? -29.862 85.731 -6.545  1.00 147.32 ? 472 LYS B CA    1 
ATOM   6809  C  C     . LYS B 1 472 ? -28.854 84.660 -6.940  1.00 151.07 ? 472 LYS B C     1 
ATOM   6810  O  O     . LYS B 1 472 ? -27.833 84.970 -7.548  1.00 166.76 ? 472 LYS B O     1 
ATOM   6811  C  CB    . LYS B 1 472 ? -29.757 86.056 -5.048  1.00 138.42 ? 472 LYS B CB    1 
ATOM   6812  N  N     . LYS B 1 473 ? -29.141 83.403 -6.605  1.00 138.72 ? 473 LYS B N     1 
ATOM   6813  C  CA    . LYS B 1 473 ? -28.235 82.306 -6.948  1.00 139.67 ? 473 LYS B CA    1 
ATOM   6814  C  C     . LYS B 1 473 ? -28.033 82.204 -8.467  1.00 130.95 ? 473 LYS B C     1 
ATOM   6815  O  O     . LYS B 1 473 ? -26.920 82.345 -8.967  1.00 130.07 ? 473 LYS B O     1 
ATOM   6816  C  CB    . LYS B 1 473 ? -28.746 80.959 -6.369  1.00 155.14 ? 473 LYS B CB    1 
ATOM   6817  C  CG    . LYS B 1 473 ? -27.681 79.826 -6.098  1.00 86.43  ? 473 LYS B CG    1 
ATOM   6818  N  N     . PHE B 1 474 ? -29.104 81.947 -9.204  1.00 129.71 ? 474 PHE B N     1 
ATOM   6819  C  CA    . PHE B 1 474 ? -28.943 81.582 -10.606 1.00 144.83 ? 474 PHE B CA    1 
ATOM   6820  C  C     . PHE B 1 474 ? -29.038 82.666 -11.684 1.00 144.58 ? 474 PHE B C     1 
ATOM   6821  O  O     . PHE B 1 474 ? -28.954 82.352 -12.870 1.00 148.97 ? 474 PHE B O     1 
ATOM   6822  C  CB    . PHE B 1 474 ? -29.908 80.457 -10.932 1.00 153.57 ? 474 PHE B CB    1 
ATOM   6823  C  CG    . PHE B 1 474 ? -29.661 79.217 -10.130 1.00 144.63 ? 474 PHE B CG    1 
ATOM   6824  C  CD1   . PHE B 1 474 ? -28.787 78.250 -10.580 1.00 149.62 ? 474 PHE B CD1   1 
ATOM   6825  C  CD2   . PHE B 1 474 ? -30.296 79.024 -8.922  1.00 123.11 ? 474 PHE B CD2   1 
ATOM   6826  C  CE1   . PHE B 1 474 ? -28.568 77.116 -9.844  1.00 146.92 ? 474 PHE B CE1   1 
ATOM   6827  C  CE2   . PHE B 1 474 ? -30.083 77.889 -8.196  1.00 114.95 ? 474 PHE B CE2   1 
ATOM   6828  C  CZ    . PHE B 1 474 ? -29.217 76.939 -8.651  1.00 134.23 ? 474 PHE B CZ    1 
ATOM   6829  N  N     . ALA B 1 475 ? -29.211 83.924 -11.297 1.00 135.72 ? 475 ALA B N     1 
ATOM   6830  C  CA    . ALA B 1 475 ? -29.481 84.967 -12.289 1.00 129.30 ? 475 ALA B CA    1 
ATOM   6831  C  C     . ALA B 1 475 ? -28.285 85.247 -13.182 1.00 127.64 ? 475 ALA B C     1 
ATOM   6832  O  O     . ALA B 1 475 ? -27.149 85.217 -12.717 1.00 135.06 ? 475 ALA B O     1 
ATOM   6833  C  CB    . ALA B 1 475 ? -29.911 86.235 -11.603 1.00 133.48 ? 475 ALA B CB    1 
ATOM   6834  N  N     . THR B 1 476 ? -28.545 85.524 -14.461 1.00 129.44 ? 476 THR B N     1 
ATOM   6835  C  CA    . THR B 1 476 ? -27.486 85.902 -15.406 1.00 138.82 ? 476 THR B CA    1 
ATOM   6836  C  C     . THR B 1 476 ? -27.917 86.993 -16.369 1.00 135.85 ? 476 THR B C     1 
ATOM   6837  O  O     . THR B 1 476 ? -29.090 87.084 -16.710 1.00 146.69 ? 476 THR B O     1 
ATOM   6838  C  CB    . THR B 1 476 ? -27.043 84.731 -16.265 1.00 146.22 ? 476 THR B CB    1 
ATOM   6839  O  OG1   . THR B 1 476 ? -28.028 83.697 -16.177 1.00 155.24 ? 476 THR B OG1   1 
ATOM   6840  C  CG2   . THR B 1 476 ? -25.701 84.205 -15.783 1.00 148.09 ? 476 THR B CG2   1 
ATOM   6841  N  N     . PRO B 1 477 ? -26.958 87.814 -16.819 1.00 131.72 ? 477 PRO B N     1 
ATOM   6842  C  CA    . PRO B 1 477 ? -27.199 88.927 -17.743 1.00 146.03 ? 477 PRO B CA    1 
ATOM   6843  C  C     . PRO B 1 477 ? -28.012 88.481 -18.950 1.00 152.66 ? 477 PRO B C     1 
ATOM   6844  O  O     . PRO B 1 477 ? -28.057 87.283 -19.221 1.00 153.54 ? 477 PRO B O     1 
ATOM   6845  C  CB    . PRO B 1 477 ? -25.788 89.293 -18.193 1.00 146.48 ? 477 PRO B CB    1 
ATOM   6846  C  CG    . PRO B 1 477 ? -24.927 88.927 -17.031 1.00 137.23 ? 477 PRO B CG    1 
ATOM   6847  C  CD    . PRO B 1 477 ? -25.551 87.737 -16.395 1.00 131.99 ? 477 PRO B CD    1 
ATOM   6848  N  N     . ARG B 1 478 ? -28.645 89.418 -19.655 1.00 153.12 ? 478 ARG B N     1 
ATOM   6849  C  CA    . ARG B 1 478 ? -29.360 89.079 -20.885 1.00 141.40 ? 478 ARG B CA    1 
ATOM   6850  C  C     . ARG B 1 478 ? -28.389 88.726 -21.984 1.00 132.06 ? 478 ARG B C     1 
ATOM   6851  O  O     . ARG B 1 478 ? -27.299 89.284 -22.072 1.00 148.43 ? 478 ARG B O     1 
ATOM   6852  C  CB    . ARG B 1 478 ? -30.218 90.231 -21.377 1.00 146.37 ? 478 ARG B CB    1 
ATOM   6853  C  CG    . ARG B 1 478 ? -31.631 90.180 -20.895 1.00 149.43 ? 478 ARG B CG    1 
ATOM   6854  C  CD    . ARG B 1 478 ? -32.478 91.133 -21.697 1.00 148.01 ? 478 ARG B CD    1 
ATOM   6855  N  NE    . ARG B 1 478 ? -32.890 90.561 -22.968 1.00 134.20 ? 478 ARG B NE    1 
ATOM   6856  C  CZ    . ARG B 1 478 ? -34.088 90.028 -23.176 1.00 142.11 ? 478 ARG B CZ    1 
ATOM   6857  N  NH1   . ARG B 1 478 ? -34.990 89.992 -22.193 1.00 133.43 ? 478 ARG B NH1   1 
ATOM   6858  N  NH2   . ARG B 1 478 ? -34.381 89.531 -24.367 1.00 152.21 ? 478 ARG B NH2   1 
ATOM   6859  N  N     . LEU B 1 479 ? -28.788 87.801 -22.836 1.00 119.10 ? 479 LEU B N     1 
ATOM   6860  C  CA    . LEU B 1 479 ? -27.926 87.408 -23.931 1.00 135.24 ? 479 LEU B CA    1 
ATOM   6861  C  C     . LEU B 1 479 ? -28.492 88.017 -25.221 1.00 134.35 ? 479 LEU B C     1 
ATOM   6862  O  O     . LEU B 1 479 ? -27.742 88.494 -26.083 1.00 125.60 ? 479 LEU B O     1 
ATOM   6863  C  CB    . LEU B 1 479 ? -27.742 85.860 -23.949 1.00 94.14  ? 479 LEU B CB    1 
ATOM   6864  N  N     . SER B 1 480 ? -29.822 88.040 -25.311 1.00 139.64 ? 480 SER B N     1 
ATOM   6865  C  CA    . SER B 1 480 ? -30.539 88.573 -26.474 1.00 139.78 ? 480 SER B CA    1 
ATOM   6866  C  C     . SER B 1 480 ? -30.964 90.046 -26.276 1.00 149.41 ? 480 SER B C     1 
ATOM   6867  O  O     . SER B 1 480 ? -31.341 90.452 -25.172 1.00 147.07 ? 480 SER B O     1 
ATOM   6868  C  CB    . SER B 1 480 ? -31.740 87.670 -26.838 1.00 109.12 ? 480 SER B CB    1 
ATOM   6869  N  N     . SER B 1 481 ? -30.921 90.829 -27.354 1.00 144.03 ? 481 SER B N     1 
ATOM   6870  C  CA    . SER B 1 481 ? -31.163 92.272 -27.284 1.00 148.08 ? 481 SER B CA    1 
ATOM   6871  C  C     . SER B 1 481 ? -32.486 92.649 -27.940 1.00 156.16 ? 481 SER B C     1 
ATOM   6872  O  O     . SER B 1 481 ? -32.995 91.916 -28.782 1.00 162.09 ? 481 SER B O     1 
ATOM   6873  C  CB    . SER B 1 481 ? -30.022 93.042 -27.956 1.00 150.28 ? 481 SER B CB    1 
ATOM   6874  O  OG    . SER B 1 481 ? -29.948 92.748 -29.347 1.00 141.24 ? 481 SER B OG    1 
ATOM   6875  N  N     . LEU B 1 482 ? -33.045 93.793 -27.559 1.00 153.28 ? 482 LEU B N     1 
ATOM   6876  C  CA    . LEU B 1 482 ? -34.379 94.148 -28.023 1.00 153.52 ? 482 LEU B CA    1 
ATOM   6877  C  C     . LEU B 1 482 ? -34.429 95.441 -28.839 1.00 183.54 ? 482 LEU B C     1 
ATOM   6878  O  O     . LEU B 1 482 ? -33.997 96.496 -28.380 1.00 203.26 ? 482 LEU B O     1 
ATOM   6879  C  CB    . LEU B 1 482 ? -35.330 94.207 -26.832 1.00 148.54 ? 482 LEU B CB    1 
ATOM   6880  C  CG    . LEU B 1 482 ? -35.148 93.002 -25.896 1.00 150.42 ? 482 LEU B CG    1 
ATOM   6881  C  CD1   . LEU B 1 482 ? -36.127 92.988 -24.717 1.00 145.27 ? 482 LEU B CD1   1 
ATOM   6882  C  CD2   . LEU B 1 482 ? -35.266 91.713 -26.677 1.00 153.87 ? 482 LEU B CD2   1 
ATOM   6883  N  N     . GLU B 1 483 ? -34.961 95.336 -30.057 1.00 161.90 ? 483 GLU B N     1 
ATOM   6884  C  CA    . GLU B 1 483 ? -35.137 96.475 -30.961 1.00 155.77 ? 483 GLU B CA    1 
ATOM   6885  C  C     . GLU B 1 483 ? -36.566 96.520 -31.507 1.00 154.73 ? 483 GLU B C     1 
ATOM   6886  O  O     . GLU B 1 483 ? -37.372 97.364 -31.111 1.00 153.87 ? 483 GLU B O     1 
ATOM   6887  C  CB    . GLU B 1 483 ? -34.132 96.408 -32.119 1.00 141.55 ? 483 GLU B CB    1 
ATOM   6888  N  N     . LYS C 2 36  ? -18.239 61.127 -46.128 1.00 144.70 ? 415 LYS C N     1 
ATOM   6889  C  CA    . LYS C 2 36  ? -18.136 62.581 -46.024 1.00 158.66 ? 415 LYS C CA    1 
ATOM   6890  C  C     . LYS C 2 36  ? -17.152 63.013 -44.927 1.00 157.48 ? 415 LYS C C     1 
ATOM   6891  O  O     . LYS C 2 36  ? -17.129 62.459 -43.821 1.00 136.94 ? 415 LYS C O     1 
ATOM   6892  C  CB    . LYS C 2 36  ? -19.516 63.244 -45.848 1.00 156.23 ? 415 LYS C CB    1 
ATOM   6893  N  N     . LEU C 2 37  ? -16.370 64.036 -45.254 1.00 153.97 ? 416 LEU C N     1 
ATOM   6894  C  CA    . LEU C 2 37  ? -15.214 64.460 -44.483 1.00 135.52 ? 416 LEU C CA    1 
ATOM   6895  C  C     . LEU C 2 37  ? -15.400 65.888 -43.977 1.00 139.66 ? 416 LEU C C     1 
ATOM   6896  O  O     . LEU C 2 37  ? -16.249 66.620 -44.472 1.00 148.07 ? 416 LEU C O     1 
ATOM   6897  C  CB    . LEU C 2 37  ? -13.988 64.406 -45.404 1.00 131.18 ? 416 LEU C CB    1 
ATOM   6898  C  CG    . LEU C 2 37  ? -12.978 65.563 -45.310 1.00 130.01 ? 416 LEU C CG    1 
ATOM   6899  C  CD1   . LEU C 2 37  ? -11.866 65.188 -44.351 1.00 142.40 ? 416 LEU C CD1   1 
ATOM   6900  C  CD2   . LEU C 2 37  ? -12.388 65.972 -46.659 1.00 112.04 ? 416 LEU C CD2   1 
ATOM   6901  N  N     . THR C 2 38  ? -14.610 66.281 -42.985 1.00 140.82 ? 417 THR C N     1 
ATOM   6902  C  CA    . THR C 2 38  ? -14.592 67.668 -42.524 1.00 141.05 ? 417 THR C CA    1 
ATOM   6903  C  C     . THR C 2 38  ? -13.229 68.308 -42.796 1.00 143.74 ? 417 THR C C     1 
ATOM   6904  O  O     . THR C 2 38  ? -12.307 68.191 -41.986 1.00 150.66 ? 417 THR C O     1 
ATOM   6905  C  CB    . THR C 2 38  ? -14.903 67.773 -41.021 1.00 144.26 ? 417 THR C CB    1 
ATOM   6906  O  OG1   . THR C 2 38  ? -16.302 67.547 -40.791 1.00 139.31 ? 417 THR C OG1   1 
ATOM   6907  C  CG2   . THR C 2 38  ? -14.528 69.154 -40.506 1.00 156.46 ? 417 THR C CG2   1 
ATOM   6908  N  N     . PRO C 2 39  ? -13.107 69.004 -43.937 1.00 139.04 ? 418 PRO C N     1 
ATOM   6909  C  CA    . PRO C 2 39  ? -11.837 69.479 -44.501 1.00 141.51 ? 418 PRO C CA    1 
ATOM   6910  C  C     . PRO C 2 39  ? -11.383 70.792 -43.892 1.00 140.90 ? 418 PRO C C     1 
ATOM   6911  O  O     . PRO C 2 39  ? -12.195 71.484 -43.286 1.00 154.31 ? 418 PRO C O     1 
ATOM   6912  C  CB    . PRO C 2 39  ? -12.180 69.712 -45.974 1.00 147.39 ? 418 PRO C CB    1 
ATOM   6913  C  CG    . PRO C 2 39  ? -13.669 69.340 -46.122 1.00 145.99 ? 418 PRO C CG    1 
ATOM   6914  C  CD    . PRO C 2 39  ? -14.246 69.422 -44.758 1.00 136.79 ? 418 PRO C CD    1 
ATOM   6915  N  N     . ALA C 2 40  ? -10.111 71.136 -44.067 1.00 136.24 ? 419 ALA C N     1 
ATOM   6916  C  CA    . ALA C 2 40  ? -9.579  72.381 -43.514 1.00 145.01 ? 419 ALA C CA    1 
ATOM   6917  C  C     . ALA C 2 40  ? -9.882  73.565 -44.419 1.00 156.18 ? 419 ALA C C     1 
ATOM   6918  O  O     . ALA C 2 40  ? -10.121 73.396 -45.617 1.00 160.55 ? 419 ALA C O     1 
ATOM   6919  C  CB    . ALA C 2 40  ? -8.087  72.275 -43.285 1.00 146.73 ? 419 ALA C CB    1 
ATOM   6920  N  N     . GLN C 2 41  ? -9.858  74.765 -43.850 1.00 158.03 ? 420 GLN C N     1 
ATOM   6921  C  CA    . GLN C 2 41  ? -10.147 75.966 -44.623 1.00 162.36 ? 420 GLN C CA    1 
ATOM   6922  C  C     . GLN C 2 41  ? -9.219  76.049 -45.840 1.00 181.50 ? 420 GLN C C     1 
ATOM   6923  O  O     . GLN C 2 41  ? -9.663  75.913 -46.982 1.00 193.36 ? 420 GLN C O     1 
ATOM   6924  C  CB    . GLN C 2 41  ? -10.021 77.220 -43.747 1.00 148.55 ? 420 GLN C CB    1 
ATOM   6925  C  CG    . GLN C 2 41  ? -11.176 78.200 -43.897 1.00 148.14 ? 420 GLN C CG    1 
ATOM   6926  C  CD    . GLN C 2 41  ? -12.468 77.671 -43.294 1.00 175.20 ? 420 GLN C CD    1 
ATOM   6927  O  OE1   . GLN C 2 41  ? -12.451 76.878 -42.347 1.00 187.25 ? 420 GLN C OE1   1 
ATOM   6928  N  NE2   . GLN C 2 41  ? -13.600 78.109 -43.838 1.00 183.58 ? 420 GLN C NE2   1 
ATOM   6929  N  N     . SER C 2 42  ? -7.928  76.249 -45.589 1.00 175.65 ? 421 SER C N     1 
ATOM   6930  C  CA    . SER C 2 42  ? -6.943  76.361 -46.660 1.00 166.08 ? 421 SER C CA    1 
ATOM   6931  C  C     . SER C 2 42  ? -6.627  75.014 -47.299 1.00 166.08 ? 421 SER C C     1 
ATOM   6932  O  O     . SER C 2 42  ? -6.498  74.009 -46.601 1.00 166.91 ? 421 SER C O     1 
ATOM   6933  C  CB    . SER C 2 42  ? -5.645  76.966 -46.116 1.00 162.75 ? 421 SER C CB    1 
ATOM   6934  N  N     . LYS C 2 43  ? -6.466  75.005 -48.622 1.00 169.32 ? 422 LYS C N     1 
ATOM   6935  C  CA    . LYS C 2 43  ? -5.999  73.805 -49.318 1.00 165.36 ? 422 LYS C CA    1 
ATOM   6936  C  C     . LYS C 2 43  ? -4.527  73.999 -49.663 1.00 166.85 ? 422 LYS C C     1 
ATOM   6937  O  O     . LYS C 2 43  ? -4.174  74.536 -50.711 1.00 159.82 ? 422 LYS C O     1 
ATOM   6938  C  CB    . LYS C 2 43  ? -6.845  73.485 -50.561 1.00 152.93 ? 422 LYS C CB    1 
ATOM   6939  N  N     . ASN C 2 44  ? -3.686  73.534 -48.746 1.00 179.67 ? 423 ASN C N     1 
ATOM   6940  C  CA    . ASN C 2 44  ? -2.253  73.778 -48.751 1.00 185.24 ? 423 ASN C CA    1 
ATOM   6941  C  C     . ASN C 2 44  ? -1.500  72.502 -48.363 1.00 184.97 ? 423 ASN C C     1 
ATOM   6942  O  O     . ASN C 2 44  ? -1.207  72.285 -47.190 1.00 185.39 ? 423 ASN C O     1 
ATOM   6943  C  CB    . ASN C 2 44  ? -1.945  74.918 -47.759 1.00 185.97 ? 423 ASN C CB    1 
ATOM   6944  C  CG    . ASN C 2 44  ? -0.538  74.835 -47.159 1.00 184.75 ? 423 ASN C CG    1 
ATOM   6945  O  OD1   . ASN C 2 44  ? 0.373   74.259 -47.756 1.00 189.26 ? 423 ASN C OD1   1 
ATOM   6946  N  ND2   . ASN C 2 44  ? -0.359  75.421 -45.971 1.00 172.70 ? 423 ASN C ND2   1 
ATOM   6947  N  N     . PRO C 2 45  ? -1.205  71.640 -49.349 1.00 183.77 ? 424 PRO C N     1 
ATOM   6948  C  CA    . PRO C 2 45  ? -0.525  70.359 -49.120 1.00 180.11 ? 424 PRO C CA    1 
ATOM   6949  C  C     . PRO C 2 45  ? 0.842   70.476 -48.461 1.00 177.87 ? 424 PRO C C     1 
ATOM   6950  O  O     . PRO C 2 45  ? 1.544   69.476 -48.378 1.00 173.16 ? 424 PRO C O     1 
ATOM   6951  C  CB    . PRO C 2 45  ? -0.363  69.798 -50.534 1.00 179.16 ? 424 PRO C CB    1 
ATOM   6952  C  CG    . PRO C 2 45  ? -1.527  70.327 -51.255 1.00 182.15 ? 424 PRO C CG    1 
ATOM   6953  C  CD    . PRO C 2 45  ? -1.738  71.725 -50.718 1.00 188.09 ? 424 PRO C CD    1 
ATOM   6954  N  N     . ALA C 2 46  ? 1.211   71.664 -48.000 1.00 183.20 ? 425 ALA C N     1 
ATOM   6955  C  CA    . ALA C 2 46  ? 2.502   71.852 -47.346 1.00 189.15 ? 425 ALA C CA    1 
ATOM   6956  C  C     . ALA C 2 46  ? 2.411   71.716 -45.822 1.00 190.46 ? 425 ALA C C     1 
ATOM   6957  O  O     . ALA C 2 46  ? 3.271   71.094 -45.198 1.00 183.68 ? 425 ALA C O     1 
ATOM   6958  C  CB    . ALA C 2 46  ? 3.101   73.195 -47.733 1.00 197.17 ? 425 ALA C CB    1 
ATOM   6959  N  N     . LYS C 2 47  ? 1.373   72.305 -45.229 1.00 199.22 ? 426 LYS C N     1 
ATOM   6960  C  CA    . LYS C 2 47  ? 1.119   72.185 -43.791 1.00 193.58 ? 426 LYS C CA    1 
ATOM   6961  C  C     . LYS C 2 47  ? -0.379  72.041 -43.538 1.00 183.50 ? 426 LYS C C     1 
ATOM   6962  O  O     . LYS C 2 47  ? -1.071  73.003 -43.203 1.00 196.22 ? 426 LYS C O     1 
ATOM   6963  C  CB    . LYS C 2 47  ? 1.647   73.424 -43.055 1.00 198.28 ? 426 LYS C CB    1 
ATOM   6964  C  CG    . LYS C 2 47  ? 1.110   73.608 -41.637 1.00 193.29 ? 426 LYS C CG    1 
ATOM   6965  C  CD    . LYS C 2 47  ? 0.966   75.089 -41.277 1.00 185.46 ? 426 LYS C CD    1 
ATOM   6966  C  CE    . LYS C 2 47  ? 0.200   75.268 -39.968 1.00 170.41 ? 426 LYS C CE    1 
ATOM   6967  N  NZ    . LYS C 2 47  ? 0.095   76.694 -39.554 1.00 166.19 ? 426 LYS C NZ    1 
ATOM   6968  N  N     . ASN C 2 48  ? -0.882  70.832 -43.720 1.00 157.78 ? 427 ASN C N     1 
ATOM   6969  C  CA    . ASN C 2 48  ? -2.270  70.539 -43.419 1.00 144.71 ? 427 ASN C CA    1 
ATOM   6970  C  C     . ASN C 2 48  ? -2.360  69.045 -43.096 1.00 152.17 ? 427 ASN C C     1 
ATOM   6971  O  O     . ASN C 2 48  ? -1.773  68.216 -43.800 1.00 149.33 ? 427 ASN C O     1 
ATOM   6972  C  CB    . ASN C 2 48  ? -3.199  70.980 -44.567 1.00 118.01 ? 427 ASN C CB    1 
ATOM   6973  N  N     . GLU C 2 49  ? -3.085  68.704 -42.033 1.00 145.55 ? 428 GLU C N     1 
ATOM   6974  C  CA    . GLU C 2 49  ? -3.062  67.350 -41.496 1.00 127.04 ? 428 GLU C CA    1 
ATOM   6975  C  C     . GLU C 2 49  ? -4.422  66.681 -41.660 1.00 131.87 ? 428 GLU C C     1 
ATOM   6976  O  O     . GLU C 2 49  ? -5.461  67.334 -41.564 1.00 122.18 ? 428 GLU C O     1 
ATOM   6977  C  CB    . GLU C 2 49  ? -2.653  67.356 -40.016 1.00 120.71 ? 428 GLU C CB    1 
ATOM   6978  C  CG    . GLU C 2 49  ? -1.337  68.057 -39.683 1.00 128.24 ? 428 GLU C CG    1 
ATOM   6979  C  CD    . GLU C 2 49  ? -1.168  68.369 -38.174 1.00 163.55 ? 428 GLU C CD    1 
ATOM   6980  O  OE1   . GLU C 2 49  ? -2.178  68.433 -37.429 1.00 156.19 ? 428 GLU C OE1   1 
ATOM   6981  O  OE2   . GLU C 2 49  ? -0.013  68.564 -37.735 1.00 158.97 ? 428 GLU C OE2   1 
ATOM   6982  N  N     . LEU C 2 50  ? -4.402  65.373 -41.905 1.00 139.62 ? 429 LEU C N     1 
ATOM   6983  C  CA    . LEU C 2 50  ? -5.622  64.597 -42.071 1.00 128.13 ? 429 LEU C CA    1 
ATOM   6984  C  C     . LEU C 2 50  ? -5.715  63.639 -40.917 1.00 127.63 ? 429 LEU C C     1 
ATOM   6985  O  O     . LEU C 2 50  ? -4.882  62.752 -40.761 1.00 134.33 ? 429 LEU C O     1 
ATOM   6986  C  CB    . LEU C 2 50  ? -5.575  63.767 -43.340 1.00 126.08 ? 429 LEU C CB    1 
ATOM   6987  C  CG    . LEU C 2 50  ? -6.918  63.330 -43.921 1.00 124.05 ? 429 LEU C CG    1 
ATOM   6988  C  CD1   . LEU C 2 50  ? -6.772  61.938 -44.490 1.00 133.09 ? 429 LEU C CD1   1 
ATOM   6989  C  CD2   . LEU C 2 50  ? -8.028  63.377 -42.907 1.00 110.40 ? 429 LEU C CD2   1 
ATOM   6990  N  N     . TYR C 2 51  ? -6.773  63.783 -40.140 1.00 127.76 ? 430 TYR C N     1 
ATOM   6991  C  CA    . TYR C 2 51  ? -6.915  63.025 -38.922 1.00 124.34 ? 430 TYR C CA    1 
ATOM   6992  C  C     . TYR C 2 51  ? -7.917  61.918 -39.164 1.00 123.94 ? 430 TYR C C     1 
ATOM   6993  O  O     . TYR C 2 51  ? -9.098  62.172 -39.393 1.00 119.33 ? 430 TYR C O     1 
ATOM   6994  C  CB    . TYR C 2 51  ? -7.396  63.944 -37.802 1.00 131.77 ? 430 TYR C CB    1 
ATOM   6995  C  CG    . TYR C 2 51  ? -6.289  64.662 -37.072 1.00 141.27 ? 430 TYR C CG    1 
ATOM   6996  C  CD1   . TYR C 2 51  ? -5.547  64.016 -36.095 1.00 147.61 ? 430 TYR C CD1   1 
ATOM   6997  C  CD2   . TYR C 2 51  ? -5.997  65.985 -37.340 1.00 142.09 ? 430 TYR C CD2   1 
ATOM   6998  C  CE1   . TYR C 2 51  ? -4.542  64.666 -35.409 1.00 147.76 ? 430 TYR C CE1   1 
ATOM   6999  C  CE2   . TYR C 2 51  ? -4.984  66.641 -36.667 1.00 147.16 ? 430 TYR C CE2   1 
ATOM   7000  C  CZ    . TYR C 2 51  ? -4.262  65.975 -35.701 1.00 149.89 ? 430 TYR C CZ    1 
ATOM   7001  O  OH    . TYR C 2 51  ? -3.253  66.614 -35.020 1.00 152.35 ? 430 TYR C OH    1 
ATOM   7002  N  N     . LEU C 2 52  ? -7.439  60.684 -39.064 1.00 126.51 ? 431 LEU C N     1 
ATOM   7003  C  CA    . LEU C 2 52  ? -8.254  59.518 -39.347 1.00 112.46 ? 431 LEU C CA    1 
ATOM   7004  C  C     . LEU C 2 52  ? -8.737  58.979 -38.023 1.00 110.13 ? 431 LEU C C     1 
ATOM   7005  O  O     . LEU C 2 52  ? -7.969  58.782 -37.090 1.00 115.22 ? 431 LEU C O     1 
ATOM   7006  C  CB    . LEU C 2 52  ? -7.471  58.466 -40.132 1.00 116.76 ? 431 LEU C CB    1 
ATOM   7007  C  CG    . LEU C 2 52  ? -7.185  58.799 -41.603 1.00 127.43 ? 431 LEU C CG    1 
ATOM   7008  C  CD1   . LEU C 2 52  ? -6.283  57.747 -42.205 1.00 134.77 ? 431 LEU C CD1   1 
ATOM   7009  C  CD2   . LEU C 2 52  ? -8.455  58.931 -42.438 1.00 122.61 ? 431 LEU C CD2   1 
ATOM   7010  N  N     . VAL C 2 53  ? -10.040 58.776 -37.954 1.00 115.00 ? 432 VAL C N     1 
ATOM   7011  C  CA    . VAL C 2 53  ? -10.721 58.565 -36.699 1.00 115.01 ? 432 VAL C CA    1 
ATOM   7012  C  C     . VAL C 2 53  ? -11.626 57.348 -36.802 1.00 120.73 ? 432 VAL C C     1 
ATOM   7013  O  O     . VAL C 2 53  ? -11.975 56.911 -37.901 1.00 126.54 ? 432 VAL C O     1 
ATOM   7014  C  CB    . VAL C 2 53  ? -11.510 59.822 -36.336 1.00 120.71 ? 432 VAL C CB    1 
ATOM   7015  C  CG1   . VAL C 2 53  ? -12.736 59.480 -35.521 1.00 134.15 ? 432 VAL C CG1   1 
ATOM   7016  C  CG2   . VAL C 2 53  ? -10.603 60.795 -35.602 1.00 112.22 ? 432 VAL C CG2   1 
ATOM   7017  N  N     . GLU C 2 54  ? -12.034 56.824 -35.655 1.00 111.79 ? 433 GLU C N     1 
ATOM   7018  C  CA    . GLU C 2 54  ? -12.548 55.474 -35.578 1.00 99.37  ? 433 GLU C CA    1 
ATOM   7019  C  C     . GLU C 2 54  ? -14.046 55.467 -35.827 1.00 102.54 ? 433 GLU C C     1 
ATOM   7020  O  O     . GLU C 2 54  ? -14.629 54.413 -36.076 1.00 109.17 ? 433 GLU C O     1 
ATOM   7021  C  CB    . GLU C 2 54  ? -12.231 54.914 -34.200 1.00 118.47 ? 433 GLU C CB    1 
ATOM   7022  C  CG    . GLU C 2 54  ? -12.010 53.416 -34.139 1.00 150.93 ? 433 GLU C CG    1 
ATOM   7023  C  CD    . GLU C 2 54  ? -12.035 52.896 -32.704 1.00 174.93 ? 433 GLU C CD    1 
ATOM   7024  O  OE1   . GLU C 2 54  ? -13.143 52.785 -32.144 1.00 189.54 ? 433 GLU C OE1   1 
ATOM   7025  O  OE2   . GLU C 2 54  ? -10.958 52.600 -32.133 1.00 177.23 ? 433 GLU C OE2   1 
ATOM   7026  N  N     . GLY C 2 55  ? -14.661 56.652 -35.802 1.00 112.51 ? 434 GLY C N     1 
ATOM   7027  C  CA    . GLY C 2 55  ? -16.104 56.775 -35.977 1.00 112.91 ? 434 GLY C CA    1 
ATOM   7028  C  C     . GLY C 2 55  ? -16.688 58.181 -35.905 1.00 119.73 ? 434 GLY C C     1 
ATOM   7029  O  O     . GLY C 2 55  ? -15.980 59.154 -35.661 1.00 117.95 ? 434 GLY C O     1 
ATOM   7030  N  N     . ASP C 2 56  ? -17.997 58.281 -36.122 1.00 134.64 ? 435 ASP C N     1 
ATOM   7031  C  CA    . ASP C 2 56  ? -18.696 59.568 -36.129 1.00 129.10 ? 435 ASP C CA    1 
ATOM   7032  C  C     . ASP C 2 56  ? -18.703 60.214 -34.752 1.00 125.05 ? 435 ASP C C     1 
ATOM   7033  O  O     . ASP C 2 56  ? -18.506 61.419 -34.629 1.00 130.20 ? 435 ASP C O     1 
ATOM   7034  C  CB    . ASP C 2 56  ? -20.131 59.427 -36.672 1.00 133.96 ? 435 ASP C CB    1 
ATOM   7035  C  CG    . ASP C 2 56  ? -20.171 59.215 -38.205 1.00 151.36 ? 435 ASP C CG    1 
ATOM   7036  O  OD1   . ASP C 2 56  ? -20.190 60.206 -38.971 1.00 142.31 ? 435 ASP C OD1   1 
ATOM   7037  O  OD2   . ASP C 2 56  ? -20.196 58.050 -38.652 1.00 164.39 ? 435 ASP C OD2   1 
ATOM   7038  N  N     . SER C 2 57  ? -18.931 59.414 -33.715 1.00 128.74 ? 436 SER C N     1 
ATOM   7039  C  CA    . SER C 2 57  ? -18.940 59.938 -32.349 1.00 122.96 ? 436 SER C CA    1 
ATOM   7040  C  C     . SER C 2 57  ? -17.591 60.597 -32.001 1.00 119.78 ? 436 SER C C     1 
ATOM   7041  O  O     . SER C 2 57  ? -17.552 61.719 -31.494 1.00 116.64 ? 436 SER C O     1 
ATOM   7042  C  CB    . SER C 2 57  ? -19.387 58.868 -31.330 1.00 82.35  ? 436 SER C CB    1 
ATOM   7043  N  N     . ALA C 2 58  ? -16.491 59.908 -32.283 1.00 110.64 ? 437 ALA C N     1 
ATOM   7044  C  CA    . ALA C 2 58  ? -15.172 60.499 -32.091 1.00 114.31 ? 437 ALA C CA    1 
ATOM   7045  C  C     . ALA C 2 58  ? -14.978 61.667 -33.042 1.00 117.13 ? 437 ALA C C     1 
ATOM   7046  O  O     . ALA C 2 58  ? -14.314 62.646 -32.715 1.00 122.98 ? 437 ALA C O     1 
ATOM   7047  C  CB    . ALA C 2 58  ? -14.097 59.474 -32.332 1.00 116.48 ? 437 ALA C CB    1 
ATOM   7048  N  N     . GLY C 2 59  ? -15.536 61.537 -34.239 1.00 106.17 ? 438 GLY C N     1 
ATOM   7049  C  CA    . GLY C 2 59  ? -15.406 62.565 -35.246 1.00 103.57 ? 438 GLY C CA    1 
ATOM   7050  C  C     . GLY C 2 59  ? -15.865 63.898 -34.707 1.00 116.36 ? 438 GLY C C     1 
ATOM   7051  O  O     . GLY C 2 59  ? -15.247 64.927 -34.965 1.00 116.75 ? 438 GLY C O     1 
ATOM   7052  N  N     . GLY C 2 60  ? -16.957 63.876 -33.953 1.00 117.59 ? 439 GLY C N     1 
ATOM   7053  C  CA    . GLY C 2 60  ? -17.489 65.090 -33.368 1.00 122.63 ? 439 GLY C CA    1 
ATOM   7054  C  C     . GLY C 2 60  ? -16.463 65.749 -32.474 1.00 119.66 ? 439 GLY C C     1 
ATOM   7055  O  O     . GLY C 2 60  ? -16.140 66.931 -32.616 1.00 116.46 ? 439 GLY C O     1 
ATOM   7056  N  N     . SER C 2 61  ? -15.939 64.962 -31.548 1.00 114.71 ? 440 SER C N     1 
ATOM   7057  C  CA    . SER C 2 61  ? -14.936 65.447 -30.624 1.00 119.36 ? 440 SER C CA    1 
ATOM   7058  C  C     . SER C 2 61  ? -13.785 66.068 -31.389 1.00 118.18 ? 440 SER C C     1 
ATOM   7059  O  O     . SER C 2 61  ? -13.334 67.159 -31.062 1.00 116.80 ? 440 SER C O     1 
ATOM   7060  C  CB    . SER C 2 61  ? -14.468 64.300 -29.743 1.00 129.55 ? 440 SER C CB    1 
ATOM   7061  O  OG    . SER C 2 61  ? -15.515 63.926 -28.865 1.00 140.16 ? 440 SER C OG    1 
ATOM   7062  N  N     . ALA C 2 62  ? -13.325 65.376 -32.422 1.00 122.11 ? 441 ALA C N     1 
ATOM   7063  C  CA    . ALA C 2 62  ? -12.234 65.881 -33.240 1.00 117.83 ? 441 ALA C CA    1 
ATOM   7064  C  C     . ALA C 2 62  ? -12.611 67.205 -33.884 1.00 128.88 ? 441 ALA C C     1 
ATOM   7065  O  O     . ALA C 2 62  ? -11.953 68.218 -33.655 1.00 136.97 ? 441 ALA C O     1 
ATOM   7066  C  CB    . ALA C 2 62  ? -11.873 64.879 -34.290 1.00 115.15 ? 441 ALA C CB    1 
ATOM   7067  N  N     . LYS C 2 63  ? -13.686 67.207 -34.667 1.00 129.59 ? 442 LYS C N     1 
ATOM   7068  C  CA    . LYS C 2 63  ? -14.068 68.409 -35.400 1.00 131.85 ? 442 LYS C CA    1 
ATOM   7069  C  C     . LYS C 2 63  ? -14.119 69.587 -34.444 1.00 137.51 ? 442 LYS C C     1 
ATOM   7070  O  O     . LYS C 2 63  ? -13.652 70.680 -34.761 1.00 155.63 ? 442 LYS C O     1 
ATOM   7071  C  CB    . LYS C 2 63  ? -15.413 68.249 -36.120 1.00 110.62 ? 442 LYS C CB    1 
ATOM   7072  N  N     . GLN C 2 64  ? -14.681 69.357 -33.267 1.00 112.33 ? 443 GLN C N     1 
ATOM   7073  C  CA    . GLN C 2 64  ? -14.885 70.435 -32.320 1.00 124.18 ? 443 GLN C CA    1 
ATOM   7074  C  C     . GLN C 2 64  ? -13.575 71.025 -31.801 1.00 137.25 ? 443 GLN C C     1 
ATOM   7075  O  O     . GLN C 2 64  ? -13.273 72.195 -32.045 1.00 155.19 ? 443 GLN C O     1 
ATOM   7076  C  CB    . GLN C 2 64  ? -15.798 69.961 -31.189 1.00 129.90 ? 443 GLN C CB    1 
ATOM   7077  C  CG    . GLN C 2 64  ? -17.254 69.896 -31.608 1.00 129.39 ? 443 GLN C CG    1 
ATOM   7078  C  CD    . GLN C 2 64  ? -18.053 68.909 -30.804 1.00 142.35 ? 443 GLN C CD    1 
ATOM   7079  O  OE1   . GLN C 2 64  ? -17.907 68.812 -29.586 1.00 154.04 ? 443 GLN C OE1   1 
ATOM   7080  N  NE2   . GLN C 2 64  ? -18.918 68.166 -31.481 1.00 147.45 ? 443 GLN C NE2   1 
ATOM   7081  N  N     . GLY C 2 65  ? -12.797 70.222 -31.089 1.00 138.63 ? 444 GLY C N     1 
ATOM   7082  C  CA    . GLY C 2 65  ? -11.499 70.669 -30.618 1.00 147.86 ? 444 GLY C CA    1 
ATOM   7083  C  C     . GLY C 2 65  ? -10.497 70.490 -31.738 1.00 148.85 ? 444 GLY C C     1 
ATOM   7084  O  O     . GLY C 2 65  ? -10.111 69.372 -32.048 1.00 166.84 ? 444 GLY C O     1 
ATOM   7085  N  N     . ARG C 2 66  ? -10.076 71.583 -32.355 1.00 136.36 ? 445 ARG C N     1 
ATOM   7086  C  CA    . ARG C 2 66  ? -9.326  71.474 -33.593 1.00 140.54 ? 445 ARG C CA    1 
ATOM   7087  C  C     . ARG C 2 66  ? -9.145  72.843 -34.218 1.00 163.74 ? 445 ARG C C     1 
ATOM   7088  O  O     . ARG C 2 66  ? -10.014 73.710 -34.083 1.00 179.09 ? 445 ARG C O     1 
ATOM   7089  C  CB    . ARG C 2 66  ? -10.075 70.548 -34.553 1.00 122.71 ? 445 ARG C CB    1 
ATOM   7090  C  CG    . ARG C 2 66  ? -9.955  70.894 -36.020 1.00 117.63 ? 445 ARG C CG    1 
ATOM   7091  C  CD    . ARG C 2 66  ? -11.342 70.968 -36.609 1.00 131.03 ? 445 ARG C CD    1 
ATOM   7092  N  NE    . ARG C 2 66  ? -11.371 70.969 -38.070 1.00 146.86 ? 445 ARG C NE    1 
ATOM   7093  C  CZ    . ARG C 2 66  ? -12.371 71.471 -38.794 1.00 145.50 ? 445 ARG C CZ    1 
ATOM   7094  N  NH1   . ARG C 2 66  ? -13.416 72.037 -38.193 1.00 142.84 ? 445 ARG C NH1   1 
ATOM   7095  N  NH2   . ARG C 2 66  ? -12.324 71.419 -40.117 1.00 139.34 ? 445 ARG C NH2   1 
ATOM   7096  N  N     . ASP C 2 67  ? -8.012  73.032 -34.893 1.00 158.67 ? 446 ASP C N     1 
ATOM   7097  C  CA    . ASP C 2 67  ? -7.729  74.268 -35.621 1.00 158.48 ? 446 ASP C CA    1 
ATOM   7098  C  C     . ASP C 2 67  ? -8.128  74.100 -37.092 1.00 151.68 ? 446 ASP C C     1 
ATOM   7099  O  O     . ASP C 2 67  ? -7.415  73.464 -37.870 1.00 148.67 ? 446 ASP C O     1 
ATOM   7100  C  CB    . ASP C 2 67  ? -6.246  74.625 -35.482 1.00 157.31 ? 446 ASP C CB    1 
ATOM   7101  C  CG    . ASP C 2 67  ? -5.906  75.979 -36.076 1.00 160.34 ? 446 ASP C CG    1 
ATOM   7102  O  OD1   . ASP C 2 67  ? -4.885  76.570 -35.659 1.00 160.84 ? 446 ASP C OD1   1 
ATOM   7103  O  OD2   . ASP C 2 67  ? -6.651  76.449 -36.961 1.00 162.54 ? 446 ASP C OD2   1 
ATOM   7104  N  N     . ARG C 2 68  ? -9.273  74.663 -37.470 1.00 144.96 ? 447 ARG C N     1 
ATOM   7105  C  CA    . ARG C 2 68  ? -9.843  74.392 -38.789 1.00 145.14 ? 447 ARG C CA    1 
ATOM   7106  C  C     . ARG C 2 68  ? -9.032  74.983 -39.941 1.00 165.79 ? 447 ARG C C     1 
ATOM   7107  O  O     . ARG C 2 68  ? -9.376  74.790 -41.111 1.00 177.94 ? 447 ARG C O     1 
ATOM   7108  C  CB    . ARG C 2 68  ? -11.299 74.861 -38.868 1.00 129.92 ? 447 ARG C CB    1 
ATOM   7109  C  CG    . ARG C 2 68  ? -11.536 76.268 -38.375 1.00 129.66 ? 447 ARG C CG    1 
ATOM   7110  C  CD    . ARG C 2 68  ? -13.013 76.533 -38.193 1.00 135.71 ? 447 ARG C CD    1 
ATOM   7111  N  NE    . ARG C 2 68  ? -13.824 75.764 -39.130 1.00 142.30 ? 447 ARG C NE    1 
ATOM   7112  C  CZ    . ARG C 2 68  ? -15.065 75.366 -38.872 1.00 154.31 ? 447 ARG C CZ    1 
ATOM   7113  N  NH1   . ARG C 2 68  ? -15.633 75.672 -37.710 1.00 156.09 ? 447 ARG C NH1   1 
ATOM   7114  N  NH2   . ARG C 2 68  ? -15.739 74.657 -39.767 1.00 156.48 ? 447 ARG C NH2   1 
ATOM   7115  N  N     . LYS C 2 69  ? -7.955  75.692 -39.609 1.00 162.71 ? 448 LYS C N     1 
ATOM   7116  C  CA    . LYS C 2 69  ? -7.098  76.295 -40.624 1.00 152.46 ? 448 LYS C CA    1 
ATOM   7117  C  C     . LYS C 2 69  ? -6.351  75.214 -41.397 1.00 158.37 ? 448 LYS C C     1 
ATOM   7118  O  O     . LYS C 2 69  ? -6.316  75.241 -42.626 1.00 168.70 ? 448 LYS C O     1 
ATOM   7119  C  CB    . LYS C 2 69  ? -6.127  77.313 -40.007 1.00 136.09 ? 448 LYS C CB    1 
ATOM   7120  N  N     . PHE C 2 70  ? -5.774  74.254 -40.677 1.00 149.85 ? 449 PHE C N     1 
ATOM   7121  C  CA    . PHE C 2 70  ? -5.016  73.180 -41.309 1.00 147.79 ? 449 PHE C CA    1 
ATOM   7122  C  C     . PHE C 2 70  ? -5.213  71.850 -40.588 1.00 152.21 ? 449 PHE C C     1 
ATOM   7123  O  O     . PHE C 2 70  ? -4.245  71.177 -40.243 1.00 150.84 ? 449 PHE C O     1 
ATOM   7124  C  CB    . PHE C 2 70  ? -3.544  73.522 -41.214 1.00 148.70 ? 449 PHE C CB    1 
ATOM   7125  C  CG    . PHE C 2 70  ? -3.016  73.436 -39.811 1.00 160.46 ? 449 PHE C CG    1 
ATOM   7126  C  CD1   . PHE C 2 70  ? -3.710  74.018 -38.766 1.00 161.70 ? 449 PHE C CD1   1 
ATOM   7127  C  CD2   . PHE C 2 70  ? -1.848  72.756 -39.528 1.00 166.99 ? 449 PHE C CD2   1 
ATOM   7128  C  CE1   . PHE C 2 70  ? -3.243  73.933 -37.469 1.00 161.34 ? 449 PHE C CE1   1 
ATOM   7129  C  CE2   . PHE C 2 70  ? -1.375  72.672 -38.229 1.00 167.08 ? 449 PHE C CE2   1 
ATOM   7130  C  CZ    . PHE C 2 70  ? -2.075  73.258 -37.200 1.00 161.67 ? 449 PHE C CZ    1 
ATOM   7131  N  N     . GLN C 2 71  ? -6.463  71.454 -40.387 1.00 152.95 ? 450 GLN C N     1 
ATOM   7132  C  CA    . GLN C 2 71  ? -6.764  70.150 -39.806 1.00 134.17 ? 450 GLN C CA    1 
ATOM   7133  C  C     . GLN C 2 71  ? -8.075  69.592 -40.341 1.00 135.04 ? 450 GLN C C     1 
ATOM   7134  O  O     . GLN C 2 71  ? -9.151  70.159 -40.135 1.00 136.40 ? 450 GLN C O     1 
ATOM   7135  C  CB    . GLN C 2 71  ? -6.780  70.212 -38.279 1.00 110.76 ? 450 GLN C CB    1 
ATOM   7136  C  CG    . GLN C 2 71  ? -5.399  70.006 -37.679 1.00 117.97 ? 450 GLN C CG    1 
ATOM   7137  C  CD    . GLN C 2 71  ? -5.367  70.163 -36.167 1.00 144.04 ? 450 GLN C CD    1 
ATOM   7138  O  OE1   . GLN C 2 71  ? -4.388  69.787 -35.522 1.00 156.75 ? 450 GLN C OE1   1 
ATOM   7139  N  NE2   . GLN C 2 71  ? -6.436  70.723 -35.593 1.00 143.68 ? 450 GLN C NE2   1 
ATOM   7140  N  N     . ALA C 2 72  ? -7.971  68.449 -40.999 1.00 126.08 ? 451 ALA C N     1 
ATOM   7141  C  CA    . ALA C 2 72  ? -9.106  67.818 -41.631 1.00 117.85 ? 451 ALA C CA    1 
ATOM   7142  C  C     . ALA C 2 72  ? -9.400  66.552 -40.864 1.00 123.27 ? 451 ALA C C     1 
ATOM   7143  O  O     . ALA C 2 72  ? -8.527  65.998 -40.197 1.00 130.03 ? 451 ALA C O     1 
ATOM   7144  C  CB    . ALA C 2 72  ? -8.794  67.505 -43.063 1.00 124.42 ? 451 ALA C CB    1 
ATOM   7145  N  N     . ILE C 2 73  ? -10.647 66.118 -40.918 1.00 116.21 ? 452 ILE C N     1 
ATOM   7146  C  CA    . ILE C 2 73  ? -11.071 65.003 -40.104 1.00 110.53 ? 452 ILE C CA    1 
ATOM   7147  C  C     . ILE C 2 73  ? -11.932 64.024 -40.900 1.00 121.34 ? 452 ILE C C     1 
ATOM   7148  O  O     . ILE C 2 73  ? -12.951 64.385 -41.482 1.00 124.98 ? 452 ILE C O     1 
ATOM   7149  C  CB    . ILE C 2 73  ? -11.782 65.534 -38.868 1.00 103.63 ? 452 ILE C CB    1 
ATOM   7150  C  CG1   . ILE C 2 73  ? -10.737 66.142 -37.938 1.00 112.90 ? 452 ILE C CG1   1 
ATOM   7151  C  CG2   . ILE C 2 73  ? -12.595 64.451 -38.191 1.00 89.16  ? 452 ILE C CG2   1 
ATOM   7152  C  CD1   . ILE C 2 73  ? -11.275 67.271 -37.088 1.00 122.05 ? 452 ILE C CD1   1 
ATOM   7153  N  N     . LEU C 2 74  ? -11.506 62.771 -40.917 1.00 131.51 ? 453 LEU C N     1 
ATOM   7154  C  CA    . LEU C 2 74  ? -12.143 61.769 -41.748 1.00 126.31 ? 453 LEU C CA    1 
ATOM   7155  C  C     . LEU C 2 74  ? -12.469 60.529 -40.921 1.00 128.98 ? 453 LEU C C     1 
ATOM   7156  O  O     . LEU C 2 74  ? -11.572 59.810 -40.486 1.00 135.96 ? 453 LEU C O     1 
ATOM   7157  C  CB    . LEU C 2 74  ? -11.217 61.421 -42.914 1.00 119.61 ? 453 LEU C CB    1 
ATOM   7158  C  CG    . LEU C 2 74  ? -11.866 60.653 -44.051 1.00 106.12 ? 453 LEU C CG    1 
ATOM   7159  C  CD1   . LEU C 2 74  ? -11.648 59.189 -43.873 1.00 107.47 ? 453 LEU C CD1   1 
ATOM   7160  C  CD2   . LEU C 2 74  ? -13.324 60.975 -44.038 1.00 110.69 ? 453 LEU C CD2   1 
ATOM   7161  N  N     . PRO C 2 75  ? -13.762 60.297 -40.674 1.00 126.61 ? 454 PRO C N     1 
ATOM   7162  C  CA    . PRO C 2 75  ? -14.284 59.151 -39.924 1.00 123.16 ? 454 PRO C CA    1 
ATOM   7163  C  C     . PRO C 2 75  ? -14.271 57.859 -40.717 1.00 124.48 ? 454 PRO C C     1 
ATOM   7164  O  O     . PRO C 2 75  ? -14.494 57.854 -41.928 1.00 129.87 ? 454 PRO C O     1 
ATOM   7165  C  CB    . PRO C 2 75  ? -15.736 59.536 -39.662 1.00 124.60 ? 454 PRO C CB    1 
ATOM   7166  C  CG    . PRO C 2 75  ? -15.769 60.997 -39.798 1.00 134.11 ? 454 PRO C CG    1 
ATOM   7167  C  CD    . PRO C 2 75  ? -14.792 61.316 -40.886 1.00 133.51 ? 454 PRO C CD    1 
ATOM   7168  N  N     . LEU C 2 76  ? -14.009 56.767 -40.011 1.00 118.76 ? 455 LEU C N     1 
ATOM   7169  C  CA    . LEU C 2 76  ? -14.115 55.431 -40.572 1.00 120.50 ? 455 LEU C CA    1 
ATOM   7170  C  C     . LEU C 2 76  ? -15.207 54.711 -39.816 1.00 123.69 ? 455 LEU C C     1 
ATOM   7171  O  O     . LEU C 2 76  ? -15.523 55.067 -38.689 1.00 127.43 ? 455 LEU C O     1 
ATOM   7172  C  CB    . LEU C 2 76  ? -12.795 54.679 -40.425 1.00 109.39 ? 455 LEU C CB    1 
ATOM   7173  C  CG    . LEU C 2 76  ? -11.672 55.587 -40.913 1.00 108.37 ? 455 LEU C CG    1 
ATOM   7174  C  CD1   . LEU C 2 76  ? -10.305 54.910 -40.815 1.00 104.27 ? 455 LEU C CD1   1 
ATOM   7175  C  CD2   . LEU C 2 76  ? -11.993 56.070 -42.345 1.00 100.17 ? 455 LEU C CD2   1 
ATOM   7176  N  N     . ARG C 2 77  ? -15.796 53.701 -40.434 1.00 124.50 ? 456 ARG C N     1 
ATOM   7177  C  CA    . ARG C 2 77  ? -16.846 52.952 -39.771 1.00 117.24 ? 456 ARG C CA    1 
ATOM   7178  C  C     . ARG C 2 77  ? -16.234 51.728 -39.083 1.00 120.18 ? 456 ARG C C     1 
ATOM   7179  O  O     . ARG C 2 77  ? -16.296 50.613 -39.599 1.00 133.55 ? 456 ARG C O     1 
ATOM   7180  C  CB    . ARG C 2 77  ? -18.012 52.623 -40.735 1.00 97.53  ? 456 ARG C CB    1 
ATOM   7181  N  N     . GLY C 2 78  ? -15.615 51.960 -37.927 1.00 104.68 ? 457 GLY C N     1 
ATOM   7182  C  CA    . GLY C 2 78  ? -15.066 50.890 -37.109 1.00 103.61 ? 457 GLY C CA    1 
ATOM   7183  C  C     . GLY C 2 78  ? -13.850 50.172 -37.672 1.00 108.99 ? 457 GLY C C     1 
ATOM   7184  O  O     . GLY C 2 78  ? -13.021 50.772 -38.352 1.00 121.57 ? 457 GLY C O     1 
ATOM   7185  N  N     . LYS C 2 79  ? -13.754 48.875 -37.386 1.00 103.33 ? 458 LYS C N     1 
ATOM   7186  C  CA    . LYS C 2 79  ? -12.610 48.059 -37.805 1.00 107.42 ? 458 LYS C CA    1 
ATOM   7187  C  C     . LYS C 2 79  ? -12.436 48.044 -39.319 1.00 115.40 ? 458 LYS C C     1 
ATOM   7188  O  O     . LYS C 2 79  ? -13.371 47.747 -40.056 1.00 133.04 ? 458 LYS C O     1 
ATOM   7189  C  CB    . LYS C 2 79  ? -12.731 46.624 -37.248 1.00 93.13  ? 458 LYS C CB    1 
ATOM   7190  C  CG    . LYS C 2 79  ? -12.632 46.543 -35.709 1.00 94.17  ? 458 LYS C CG    1 
ATOM   7191  C  CD    . LYS C 2 79  ? -12.324 45.132 -35.207 1.00 107.32 ? 458 LYS C CD    1 
ATOM   7192  C  CE    . LYS C 2 79  ? -12.476 44.995 -33.667 1.00 101.88 ? 458 LYS C CE    1 
ATOM   7193  N  NZ    . LYS C 2 79  ? -11.269 45.364 -32.857 1.00 94.42  ? 458 LYS C NZ    1 
ATOM   7194  N  N     . VAL C 2 80  ? -11.230 48.369 -39.774 1.00 112.16 ? 459 VAL C N     1 
ATOM   7195  C  CA    . VAL C 2 80  ? -10.937 48.482 -41.203 1.00 126.83 ? 459 VAL C CA    1 
ATOM   7196  C  C     . VAL C 2 80  ? -10.567 47.146 -41.855 1.00 128.44 ? 459 VAL C C     1 
ATOM   7197  O  O     . VAL C 2 80  ? -9.967  46.281 -41.212 1.00 120.88 ? 459 VAL C O     1 
ATOM   7198  C  CB    . VAL C 2 80  ? -9.767  49.451 -41.446 1.00 126.72 ? 459 VAL C CB    1 
ATOM   7199  C  CG1   . VAL C 2 80  ? -9.511  49.582 -42.933 1.00 127.23 ? 459 VAL C CG1   1 
ATOM   7200  C  CG2   . VAL C 2 80  ? -10.043 50.810 -40.804 1.00 126.08 ? 459 VAL C CG2   1 
ATOM   7201  N  N     . ILE C 2 81  ? -10.908 46.994 -43.136 1.00 112.05 ? 460 ILE C N     1 
ATOM   7202  C  CA    . ILE C 2 81  ? -10.604 45.776 -43.888 1.00 111.18 ? 460 ILE C CA    1 
ATOM   7203  C  C     . ILE C 2 81  ? -9.135  45.387 -43.781 1.00 119.79 ? 460 ILE C C     1 
ATOM   7204  O  O     . ILE C 2 81  ? -8.241  46.216 -43.984 1.00 114.84 ? 460 ILE C O     1 
ATOM   7205  C  CB    . ILE C 2 81  ? -10.899 45.976 -45.374 1.00 123.79 ? 460 ILE C CB    1 
ATOM   7206  C  CG1   . ILE C 2 81  ? -11.915 47.118 -45.550 1.00 160.82 ? 460 ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C 2 81  ? -11.374 44.673 -46.007 1.00 93.64  ? 460 ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C 2 81  ? -11.895 47.831 -46.911 1.00 160.67 ? 460 ILE C CD1   1 
ATOM   7209  N  N     . ASN C 2 82  ? -8.882  44.120 -43.471 1.00 118.11 ? 461 ASN C N     1 
ATOM   7210  C  CA    . ASN C 2 82  ? -7.519  43.623 -43.519 1.00 112.67 ? 461 ASN C CA    1 
ATOM   7211  C  C     . ASN C 2 82  ? -7.093  43.540 -44.965 1.00 131.92 ? 461 ASN C C     1 
ATOM   7212  O  O     . ASN C 2 82  ? -7.479  42.621 -45.690 1.00 134.26 ? 461 ASN C O     1 
ATOM   7213  C  CB    . ASN C 2 82  ? -7.374  42.267 -42.852 1.00 104.77 ? 461 ASN C CB    1 
ATOM   7214  C  CG    . ASN C 2 82  ? -5.931  41.822 -42.780 1.00 118.93 ? 461 ASN C CG    1 
ATOM   7215  O  OD1   . ASN C 2 82  ? -5.102  42.269 -43.573 1.00 123.79 ? 461 ASN C OD1   1 
ATOM   7216  N  ND2   . ASN C 2 82  ? -5.615  40.946 -41.830 1.00 125.45 ? 461 ASN C ND2   1 
ATOM   7217  N  N     . THR C 2 83  ? -6.297  44.520 -45.373 1.00 138.33 ? 462 THR C N     1 
ATOM   7218  C  CA    . THR C 2 83  ? -5.881  44.673 -46.759 1.00 136.71 ? 462 THR C CA    1 
ATOM   7219  C  C     . THR C 2 83  ? -4.860  43.622 -47.174 1.00 131.03 ? 462 THR C C     1 
ATOM   7220  O  O     . THR C 2 83  ? -4.446  43.558 -48.330 1.00 137.05 ? 462 THR C O     1 
ATOM   7221  C  CB    . THR C 2 83  ? -5.272  46.062 -46.941 1.00 148.36 ? 462 THR C CB    1 
ATOM   7222  O  OG1   . THR C 2 83  ? -4.226  46.255 -45.975 1.00 145.93 ? 462 THR C OG1   1 
ATOM   7223  C  CG2   . THR C 2 83  ? -6.344  47.117 -46.725 1.00 156.12 ? 462 THR C CG2   1 
ATOM   7224  N  N     . ALA C 2 84  ? -4.448  42.797 -46.223 1.00 119.95 ? 463 ALA C N     1 
ATOM   7225  C  CA    . ALA C 2 84  ? -3.445  41.788 -46.498 1.00 114.67 ? 463 ALA C CA    1 
ATOM   7226  C  C     . ALA C 2 84  ? -4.041  40.396 -46.392 1.00 120.46 ? 463 ALA C C     1 
ATOM   7227  O  O     . ALA C 2 84  ? -3.325  39.401 -46.389 1.00 134.60 ? 463 ALA C O     1 
ATOM   7228  C  CB    . ALA C 2 84  ? -2.296  41.950 -45.558 1.00 106.94 ? 463 ALA C CB    1 
ATOM   7229  N  N     . LYS C 2 85  ? -5.360  40.329 -46.312 1.00 119.00 ? 464 LYS C N     1 
ATOM   7230  C  CA    . LYS C 2 85  ? -6.034  39.056 -46.141 1.00 124.57 ? 464 LYS C CA    1 
ATOM   7231  C  C     . LYS C 2 85  ? -7.144  38.920 -47.183 1.00 136.14 ? 464 LYS C C     1 
ATOM   7232  O  O     . LYS C 2 85  ? -7.651  37.824 -47.425 1.00 141.40 ? 464 LYS C O     1 
ATOM   7233  C  CB    . LYS C 2 85  ? -6.582  38.945 -44.704 1.00 119.86 ? 464 LYS C CB    1 
ATOM   7234  C  CG    . LYS C 2 85  ? -6.777  37.518 -44.174 1.00 114.80 ? 464 LYS C CG    1 
ATOM   7235  C  CD    . LYS C 2 85  ? -7.285  37.498 -42.724 1.00 114.60 ? 464 LYS C CD    1 
ATOM   7236  C  CE    . LYS C 2 85  ? -6.180  37.817 -41.694 1.00 124.07 ? 464 LYS C CE    1 
ATOM   7237  N  NZ    . LYS C 2 85  ? -6.573  37.661 -40.245 1.00 119.27 ? 464 LYS C NZ    1 
ATOM   7238  N  N     . ALA C 2 86  ? -7.509  40.038 -47.807 1.00 137.68 ? 465 ALA C N     1 
ATOM   7239  C  CA    . ALA C 2 86  ? -8.531  40.031 -48.849 1.00 157.56 ? 465 ALA C CA    1 
ATOM   7240  C  C     . ALA C 2 86  ? -7.880  40.299 -50.193 1.00 182.97 ? 465 ALA C C     1 
ATOM   7241  O  O     . ALA C 2 86  ? -6.691  40.622 -50.242 1.00 195.14 ? 465 ALA C O     1 
ATOM   7242  C  CB    . ALA C 2 86  ? -9.569  41.067 -48.564 1.00 165.49 ? 465 ALA C CB    1 
ATOM   7243  N  N     . LYS C 2 87  ? -8.642  40.179 -51.282 1.00 190.93 ? 466 LYS C N     1 
ATOM   7244  C  CA    . LYS C 2 87  ? -8.044  40.366 -52.602 1.00 193.00 ? 466 LYS C CA    1 
ATOM   7245  C  C     . LYS C 2 87  ? -7.990  41.841 -53.003 1.00 202.38 ? 466 LYS C C     1 
ATOM   7246  O  O     . LYS C 2 87  ? -7.883  42.718 -52.152 1.00 212.32 ? 466 LYS C O     1 
ATOM   7247  C  CB    . LYS C 2 87  ? -8.810  39.560 -53.655 1.00 183.59 ? 466 LYS C CB    1 
ATOM   7248  N  N     . MET C 2 88  ? -8.087  42.116 -54.297 1.00 198.25 ? 467 MET C N     1 
ATOM   7249  C  CA    . MET C 2 88  ? -8.045  43.491 -54.777 1.00 193.24 ? 467 MET C CA    1 
ATOM   7250  C  C     . MET C 2 88  ? -9.447  44.070 -54.863 1.00 191.43 ? 467 MET C C     1 
ATOM   7251  O  O     . MET C 2 88  ? -9.718  45.149 -54.341 1.00 191.19 ? 467 MET C O     1 
ATOM   7252  C  CB    . MET C 2 88  ? -7.380  43.546 -56.150 1.00 199.67 ? 467 MET C CB    1 
ATOM   7253  C  CG    . MET C 2 88  ? -6.976  44.941 -56.602 1.00 204.76 ? 467 MET C CG    1 
ATOM   7254  S  SD    . MET C 2 88  ? -5.868  45.788 -55.456 1.00 236.35 ? 467 MET C SD    1 
ATOM   7255  C  CE    . MET C 2 88  ? -5.197  47.074 -56.526 1.00 151.13 ? 467 MET C CE    1 
ATOM   7256  N  N     . ALA C 2 89  ? -10.328 43.344 -55.548 1.00 193.72 ? 468 ALA C N     1 
ATOM   7257  C  CA    . ALA C 2 89  ? -11.703 43.777 -55.766 1.00 196.19 ? 468 ALA C CA    1 
ATOM   7258  C  C     . ALA C 2 89  ? -12.436 43.934 -54.444 1.00 188.19 ? 468 ALA C C     1 
ATOM   7259  O  O     . ALA C 2 89  ? -13.103 44.945 -54.205 1.00 185.05 ? 468 ALA C O     1 
ATOM   7260  C  CB    . ALA C 2 89  ? -12.435 42.797 -56.672 1.00 200.51 ? 468 ALA C CB    1 
ATOM   7261  N  N     . ASP C 2 90  ? -12.303 42.930 -53.584 1.00 178.27 ? 469 ASP C N     1 
ATOM   7262  C  CA    . ASP C 2 90  ? -12.915 42.992 -52.268 1.00 169.41 ? 469 ASP C CA    1 
ATOM   7263  C  C     . ASP C 2 90  ? -12.530 44.317 -51.611 1.00 158.37 ? 469 ASP C C     1 
ATOM   7264  O  O     . ASP C 2 90  ? -13.390 45.033 -51.094 1.00 147.67 ? 469 ASP C O     1 
ATOM   7265  C  CB    . ASP C 2 90  ? -12.475 41.796 -51.416 1.00 163.65 ? 469 ASP C CB    1 
ATOM   7266  N  N     . ILE C 2 91  ? -11.238 44.641 -51.666 1.00 151.01 ? 470 ILE C N     1 
ATOM   7267  C  CA    . ILE C 2 91  ? -10.700 45.878 -51.096 1.00 139.10 ? 470 ILE C CA    1 
ATOM   7268  C  C     . ILE C 2 91  ? -11.260 47.160 -51.712 1.00 134.80 ? 470 ILE C C     1 
ATOM   7269  O  O     . ILE C 2 91  ? -11.979 47.913 -51.054 1.00 116.54 ? 470 ILE C O     1 
ATOM   7270  C  CB    . ILE C 2 91  ? -9.162  45.947 -51.248 1.00 126.38 ? 470 ILE C CB    1 
ATOM   7271  C  CG1   . ILE C 2 91  ? -8.491  44.987 -50.290 1.00 124.47 ? 470 ILE C CG1   1 
ATOM   7272  C  CG2   . ILE C 2 91  ? -8.637  47.354 -50.973 1.00 114.30 ? 470 ILE C CG2   1 
ATOM   7273  C  CD1   . ILE C 2 91  ? -7.070  45.384 -49.992 1.00 131.99 ? 470 ILE C CD1   1 
ATOM   7274  N  N     . LEU C 2 92  ? -10.919 47.409 -52.973 1.00 144.88 ? 471 LEU C N     1 
ATOM   7275  C  CA    . LEU C 2 92  ? -11.261 48.674 -53.610 1.00 149.65 ? 471 LEU C CA    1 
ATOM   7276  C  C     . LEU C 2 92  ? -12.765 48.906 -53.589 1.00 155.31 ? 471 LEU C C     1 
ATOM   7277  O  O     . LEU C 2 92  ? -13.221 50.052 -53.617 1.00 162.90 ? 471 LEU C O     1 
ATOM   7278  C  CB    . LEU C 2 92  ? -10.695 48.761 -55.030 1.00 155.05 ? 471 LEU C CB    1 
ATOM   7279  C  CG    . LEU C 2 92  ? -9.163  48.641 -55.124 1.00 150.94 ? 471 LEU C CG    1 
ATOM   7280  C  CD1   . LEU C 2 92  ? -8.606  49.332 -56.383 1.00 152.10 ? 471 LEU C CD1   1 
ATOM   7281  C  CD2   . LEU C 2 92  ? -8.488  49.190 -53.874 1.00 129.91 ? 471 LEU C CD2   1 
ATOM   7282  N  N     . LYS C 2 93  ? -13.523 47.810 -53.557 1.00 146.95 ? 472 LYS C N     1 
ATOM   7283  C  CA    . LYS C 2 93  ? -14.981 47.863 -53.414 1.00 139.13 ? 472 LYS C CA    1 
ATOM   7284  C  C     . LYS C 2 93  ? -15.494 48.304 -52.024 1.00 143.84 ? 472 LYS C C     1 
ATOM   7285  O  O     . LYS C 2 93  ? -16.653 48.702 -51.888 1.00 150.05 ? 472 LYS C O     1 
ATOM   7286  C  CB    . LYS C 2 93  ? -15.609 46.524 -53.818 1.00 120.95 ? 472 LYS C CB    1 
ATOM   7287  N  N     . ASN C 2 94  ? -14.650 48.229 -50.996 1.00 136.17 ? 473 ASN C N     1 
ATOM   7288  C  CA    . ASN C 2 94  ? -15.068 48.638 -49.647 1.00 143.99 ? 473 ASN C CA    1 
ATOM   7289  C  C     . ASN C 2 94  ? -15.020 50.148 -49.431 1.00 146.33 ? 473 ASN C C     1 
ATOM   7290  O  O     . ASN C 2 94  ? -13.990 50.788 -49.642 1.00 143.46 ? 473 ASN C O     1 
ATOM   7291  C  CB    . ASN C 2 94  ? -14.288 47.914 -48.533 1.00 132.83 ? 473 ASN C CB    1 
ATOM   7292  N  N     . GLU C 2 95  ? -16.144 50.700 -48.989 1.00 143.50 ? 474 GLU C N     1 
ATOM   7293  C  CA    . GLU C 2 95  ? -16.312 52.142 -48.899 1.00 139.24 ? 474 GLU C CA    1 
ATOM   7294  C  C     . GLU C 2 95  ? -15.181 52.832 -48.168 1.00 141.02 ? 474 GLU C C     1 
ATOM   7295  O  O     . GLU C 2 95  ? -14.618 53.798 -48.671 1.00 141.40 ? 474 GLU C O     1 
ATOM   7296  C  CB    . GLU C 2 95  ? -17.651 52.491 -48.258 1.00 146.88 ? 474 GLU C CB    1 
ATOM   7297  C  CG    . GLU C 2 95  ? -18.827 52.159 -49.162 1.00 181.81 ? 474 GLU C CG    1 
ATOM   7298  C  CD    . GLU C 2 95  ? -20.169 52.553 -48.577 1.00 206.31 ? 474 GLU C CD    1 
ATOM   7299  O  OE1   . GLU C 2 95  ? -21.111 52.796 -49.371 1.00 210.51 ? 474 GLU C OE1   1 
ATOM   7300  O  OE2   . GLU C 2 95  ? -20.282 52.615 -47.331 1.00 213.70 ? 474 GLU C OE2   1 
ATOM   7301  N  N     . GLU C 2 96  ? -14.841 52.337 -46.984 1.00 144.99 ? 475 GLU C N     1 
ATOM   7302  C  CA    . GLU C 2 96  ? -13.890 53.051 -46.137 1.00 142.15 ? 475 GLU C CA    1 
ATOM   7303  C  C     . GLU C 2 96  ? -12.508 53.216 -46.746 1.00 141.94 ? 475 GLU C C     1 
ATOM   7304  O  O     . GLU C 2 96  ? -11.925 54.299 -46.675 1.00 137.40 ? 475 GLU C O     1 
ATOM   7305  C  CB    . GLU C 2 96  ? -13.804 52.426 -44.756 1.00 140.15 ? 475 GLU C CB    1 
ATOM   7306  C  CG    . GLU C 2 96  ? -14.357 53.341 -43.683 1.00 161.95 ? 475 GLU C CG    1 
ATOM   7307  C  CD    . GLU C 2 96  ? -15.656 53.992 -44.103 1.00 181.89 ? 475 GLU C CD    1 
ATOM   7308  O  OE1   . GLU C 2 96  ? -16.692 53.285 -44.119 1.00 185.76 ? 475 GLU C OE1   1 
ATOM   7309  O  OE2   . GLU C 2 96  ? -15.636 55.207 -44.414 1.00 189.97 ? 475 GLU C OE2   1 
ATOM   7310  N  N     . ILE C 2 97  ? -11.975 52.153 -47.335 1.00 138.95 ? 476 ILE C N     1 
ATOM   7311  C  CA    . ILE C 2 97  ? -10.712 52.293 -48.045 1.00 133.49 ? 476 ILE C CA    1 
ATOM   7312  C  C     . ILE C 2 97  ? -10.849 53.274 -49.213 1.00 129.10 ? 476 ILE C C     1 
ATOM   7313  O  O     . ILE C 2 97  ? -10.006 54.160 -49.383 1.00 125.76 ? 476 ILE C O     1 
ATOM   7314  C  CB    . ILE C 2 97  ? -10.152 50.943 -48.517 1.00 130.12 ? 476 ILE C CB    1 
ATOM   7315  C  CG1   . ILE C 2 97  ? -9.563  50.190 -47.329 1.00 144.76 ? 476 ILE C CG1   1 
ATOM   7316  C  CG2   . ILE C 2 97  ? -9.042  51.151 -49.526 1.00 116.73 ? 476 ILE C CG2   1 
ATOM   7317  C  CD1   . ILE C 2 97  ? -8.421  50.929 -46.641 1.00 144.85 ? 476 ILE C CD1   1 
ATOM   7318  N  N     . ASN C 2 98  ? -11.909 53.127 -50.009 1.00 127.71 ? 477 ASN C N     1 
ATOM   7319  C  CA    . ASN C 2 98  ? -12.081 53.982 -51.186 1.00 131.02 ? 477 ASN C CA    1 
ATOM   7320  C  C     . ASN C 2 98  ? -12.140 55.467 -50.808 1.00 136.59 ? 477 ASN C C     1 
ATOM   7321  O  O     . ASN C 2 98  ? -11.469 56.301 -51.416 1.00 139.21 ? 477 ASN C O     1 
ATOM   7322  C  CB    . ASN C 2 98  ? -13.261 53.538 -52.081 1.00 102.52 ? 477 ASN C CB    1 
ATOM   7323  N  N     . THR C 2 99  ? -12.920 55.796 -49.789 1.00 130.57 ? 478 THR C N     1 
ATOM   7324  C  CA    . THR C 2 99  ? -13.004 57.178 -49.344 1.00 133.60 ? 478 THR C CA    1 
ATOM   7325  C  C     . THR C 2 99  ? -11.628 57.714 -48.980 1.00 136.42 ? 478 THR C C     1 
ATOM   7326  O  O     . THR C 2 99  ? -11.300 58.847 -49.310 1.00 134.72 ? 478 THR C O     1 
ATOM   7327  C  CB    . THR C 2 99  ? -13.956 57.345 -48.154 1.00 134.33 ? 478 THR C CB    1 
ATOM   7328  O  OG1   . THR C 2 99  ? -13.705 56.299 -47.210 1.00 145.40 ? 478 THR C OG1   1 
ATOM   7329  C  CG2   . THR C 2 99  ? -15.419 57.274 -48.616 1.00 127.23 ? 478 THR C CG2   1 
ATOM   7330  N  N     . MET C 2 100 ? -10.825 56.900 -48.300 1.00 138.35 ? 479 MET C N     1 
ATOM   7331  C  CA    . MET C 2 100 ? -9.467  57.298 -47.933 1.00 128.24 ? 479 MET C CA    1 
ATOM   7332  C  C     . MET C 2 100 ? -8.694  57.666 -49.167 1.00 127.25 ? 479 MET C C     1 
ATOM   7333  O  O     . MET C 2 100 ? -8.129  58.758 -49.273 1.00 122.76 ? 479 MET C O     1 
ATOM   7334  C  CB    . MET C 2 100 ? -8.723  56.158 -47.265 1.00 118.61 ? 479 MET C CB    1 
ATOM   7335  C  CG    . MET C 2 100 ? -8.602  56.261 -45.778 1.00 121.60 ? 479 MET C CG    1 
ATOM   7336  S  SD    . MET C 2 100 ? -7.894  54.726 -45.142 1.00 182.00 ? 479 MET C SD    1 
ATOM   7337  C  CE    . MET C 2 100 ? -8.547  54.760 -43.470 1.00 100.38 ? 479 MET C CE    1 
ATOM   7338  N  N     . ILE C 2 101 ? -8.677  56.731 -50.106 1.00 132.61 ? 480 ILE C N     1 
ATOM   7339  C  CA    . ILE C 2 101 ? -7.889  56.894 -51.313 1.00 140.70 ? 480 ILE C CA    1 
ATOM   7340  C  C     . ILE C 2 101 ? -8.235  58.223 -51.983 1.00 138.94 ? 480 ILE C C     1 
ATOM   7341  O  O     . ILE C 2 101 ? -7.342  59.009 -52.299 1.00 130.22 ? 480 ILE C O     1 
ATOM   7342  C  CB    . ILE C 2 101 ? -8.075  55.676 -52.242 1.00 138.23 ? 480 ILE C CB    1 
ATOM   7343  C  CG1   . ILE C 2 101 ? -8.040  54.390 -51.403 1.00 136.81 ? 480 ILE C CG1   1 
ATOM   7344  C  CG2   . ILE C 2 101 ? -6.985  55.630 -53.279 1.00 135.37 ? 480 ILE C CG2   1 
ATOM   7345  C  CD1   . ILE C 2 101 ? -7.917  53.108 -52.197 1.00 133.42 ? 480 ILE C CD1   1 
ATOM   7346  N  N     . TYR C 2 102 ? -9.531  58.487 -52.148 1.00 137.10 ? 481 TYR C N     1 
ATOM   7347  C  CA    . TYR C 2 102 ? -9.992  59.745 -52.730 1.00 136.84 ? 481 TYR C CA    1 
ATOM   7348  C  C     . TYR C 2 102 ? -9.515  60.983 -51.967 1.00 150.67 ? 481 TYR C C     1 
ATOM   7349  O  O     . TYR C 2 102 ? -8.863  61.847 -52.548 1.00 164.95 ? 481 TYR C O     1 
ATOM   7350  C  CB    . TYR C 2 102 ? -11.517 59.782 -52.891 1.00 125.72 ? 481 TYR C CB    1 
ATOM   7351  N  N     . THR C 2 103 ? -9.829  61.084 -50.678 1.00 140.94 ? 482 THR C N     1 
ATOM   7352  C  CA    . THR C 2 103 ? -9.515  62.319 -49.949 1.00 147.34 ? 482 THR C CA    1 
ATOM   7353  C  C     . THR C 2 103 ? -8.019  62.592 -49.829 1.00 153.26 ? 482 THR C C     1 
ATOM   7354  O  O     . THR C 2 103 ? -7.613  63.703 -49.489 1.00 158.99 ? 482 THR C O     1 
ATOM   7355  C  CB    . THR C 2 103 ? -10.120 62.385 -48.542 1.00 134.82 ? 482 THR C CB    1 
ATOM   7356  O  OG1   . THR C 2 103 ? -9.210  61.788 -47.611 1.00 129.62 ? 482 THR C OG1   1 
ATOM   7357  C  CG2   . THR C 2 103 ? -11.491 61.715 -48.500 1.00 135.30 ? 482 THR C CG2   1 
ATOM   7358  N  N     . ILE C 2 104 ? -7.200  61.585 -50.101 1.00 147.37 ? 483 ILE C N     1 
ATOM   7359  C  CA    . ILE C 2 104 ? -5.759  61.748 -49.962 1.00 144.02 ? 483 ILE C CA    1 
ATOM   7360  C  C     . ILE C 2 104 ? -5.105  62.193 -51.264 1.00 149.49 ? 483 ILE C C     1 
ATOM   7361  O  O     . ILE C 2 104 ? -4.079  62.877 -51.258 1.00 140.02 ? 483 ILE C O     1 
ATOM   7362  C  CB    . ILE C 2 104 ? -5.107  60.466 -49.441 1.00 128.94 ? 483 ILE C CB    1 
ATOM   7363  C  CG1   . ILE C 2 104 ? -5.492  60.276 -47.973 1.00 133.00 ? 483 ILE C CG1   1 
ATOM   7364  C  CG2   . ILE C 2 104 ? -3.606  60.546 -49.576 1.00 111.83 ? 483 ILE C CG2   1 
ATOM   7365  C  CD1   . ILE C 2 104 ? -5.338  58.859 -47.468 1.00 130.52 ? 483 ILE C CD1   1 
ATOM   7366  N  N     . GLY C 2 105 ? -5.710  61.807 -52.381 1.00 164.88 ? 484 GLY C N     1 
ATOM   7367  C  CA    . GLY C 2 105 ? -5.194  62.169 -53.689 1.00 177.50 ? 484 GLY C CA    1 
ATOM   7368  C  C     . GLY C 2 105 ? -4.398  61.062 -54.357 1.00 182.70 ? 484 GLY C C     1 
ATOM   7369  O  O     . GLY C 2 105 ? -4.974  60.160 -54.965 1.00 189.82 ? 484 GLY C O     1 
ATOM   7370  N  N     . ALA C 2 106 ? -3.075  61.144 -54.237 1.00 173.09 ? 485 ALA C N     1 
ATOM   7371  C  CA    . ALA C 2 106 ? -2.136  60.202 -54.856 1.00 174.30 ? 485 ALA C CA    1 
ATOM   7372  C  C     . ALA C 2 106 ? -2.738  58.972 -55.560 1.00 182.76 ? 485 ALA C C     1 
ATOM   7373  O  O     . ALA C 2 106 ? -2.523  58.774 -56.756 1.00 198.24 ? 485 ALA C O     1 
ATOM   7374  C  CB    . ALA C 2 106 ? -1.107  59.783 -53.854 1.00 173.45 ? 485 ALA C CB    1 
ATOM   7375  N  N     . GLY C 2 107 ? -3.475  58.144 -54.828 1.00 172.79 ? 486 GLY C N     1 
ATOM   7376  C  CA    . GLY C 2 107 ? -4.084  56.962 -55.414 1.00 165.20 ? 486 GLY C CA    1 
ATOM   7377  C  C     . GLY C 2 107 ? -3.255  55.737 -55.096 1.00 169.30 ? 486 GLY C C     1 
ATOM   7378  O  O     . GLY C 2 107 ? -2.141  55.869 -54.606 1.00 176.35 ? 486 GLY C O     1 
ATOM   7379  N  N     . VAL C 2 108 ? -3.788  54.550 -55.372 1.00 166.40 ? 487 VAL C N     1 
ATOM   7380  C  CA    . VAL C 2 108 ? -3.090  53.297 -55.061 1.00 162.21 ? 487 VAL C CA    1 
ATOM   7381  C  C     . VAL C 2 108 ? -1.872  53.043 -55.974 1.00 153.44 ? 487 VAL C C     1 
ATOM   7382  O  O     . VAL C 2 108 ? -1.160  52.032 -55.864 1.00 126.58 ? 487 VAL C O     1 
ATOM   7383  C  CB    . VAL C 2 108 ? -4.089  52.118 -55.095 1.00 155.01 ? 487 VAL C CB    1 
ATOM   7384  C  CG1   . VAL C 2 108 ? -5.187  52.353 -54.085 1.00 135.68 ? 487 VAL C CG1   1 
ATOM   7385  C  CG2   . VAL C 2 108 ? -4.705  51.970 -56.481 1.00 159.16 ? 487 VAL C CG2   1 
ATOM   7386  N  N     . ASP C 2 111 ? 0.550   53.524 -60.513 1.00 162.37 ? 490 ASP C N     1 
ATOM   7387  C  CA    . ASP C 2 111 ? -0.036  53.249 -59.206 1.00 157.51 ? 490 ASP C CA    1 
ATOM   7388  C  C     . ASP C 2 111 ? -0.120  54.524 -58.353 1.00 170.79 ? 490 ASP C C     1 
ATOM   7389  O  O     . ASP C 2 111 ? -0.826  55.469 -58.704 1.00 162.76 ? 490 ASP C O     1 
ATOM   7390  C  CB    . ASP C 2 111 ? 0.708   52.107 -58.485 1.00 137.34 ? 490 ASP C CB    1 
ATOM   7391  N  N     . PHE C 2 112 ? 0.613   54.542 -57.242 1.00 185.18 ? 491 PHE C N     1 
ATOM   7392  C  CA    . PHE C 2 112 ? 0.538   55.621 -56.251 1.00 181.12 ? 491 PHE C CA    1 
ATOM   7393  C  C     . PHE C 2 112 ? 0.677   57.025 -56.849 1.00 176.34 ? 491 PHE C C     1 
ATOM   7394  O  O     . PHE C 2 112 ? -0.323  57.638 -57.212 1.00 174.34 ? 491 PHE C O     1 
ATOM   7395  C  CB    . PHE C 2 112 ? 1.560   55.381 -55.116 1.00 184.44 ? 491 PHE C CB    1 
ATOM   7396  C  CG    . PHE C 2 112 ? 1.300   56.180 -53.841 1.00 179.18 ? 491 PHE C CG    1 
ATOM   7397  C  CD1   . PHE C 2 112 ? 2.360   56.565 -53.014 1.00 173.49 ? 491 PHE C CD1   1 
ATOM   7398  C  CD2   . PHE C 2 112 ? 0.016   56.539 -53.465 1.00 168.92 ? 491 PHE C CD2   1 
ATOM   7399  C  CE1   . PHE C 2 112 ? 2.147   57.290 -51.845 1.00 157.00 ? 491 PHE C CE1   1 
ATOM   7400  C  CE2   . PHE C 2 112 ? -0.206  57.263 -52.297 1.00 156.65 ? 491 PHE C CE2   1 
ATOM   7401  C  CZ    . PHE C 2 112 ? 0.863   57.641 -51.489 1.00 150.33 ? 491 PHE C CZ    1 
ATOM   7402  N  N     . SER C 2 113 ? 1.912   57.515 -56.960 1.00 174.99 ? 492 SER C N     1 
ATOM   7403  C  CA    . SER C 2 113 ? 2.184   58.928 -57.255 1.00 175.37 ? 492 SER C CA    1 
ATOM   7404  C  C     . SER C 2 113 ? 1.996   59.729 -55.970 1.00 173.73 ? 492 SER C C     1 
ATOM   7405  O  O     . SER C 2 113 ? 1.484   59.203 -54.995 1.00 171.20 ? 492 SER C O     1 
ATOM   7406  C  CB    . SER C 2 113 ? 1.298   59.463 -58.388 1.00 166.72 ? 492 SER C CB    1 
ATOM   7407  N  N     . ILE C 2 114 ? 2.411   60.990 -55.950 1.00 178.73 ? 493 ILE C N     1 
ATOM   7408  C  CA    . ILE C 2 114 ? 2.392   61.748 -54.699 1.00 182.64 ? 493 ILE C CA    1 
ATOM   7409  C  C     . ILE C 2 114 ? 2.038   63.225 -54.890 1.00 184.39 ? 493 ILE C C     1 
ATOM   7410  O  O     . ILE C 2 114 ? 1.059   63.575 -55.562 1.00 177.75 ? 493 ILE C O     1 
ATOM   7411  C  CB    . ILE C 2 114 ? 3.760   61.659 -53.974 1.00 148.52 ? 493 ILE C CB    1 
ATOM   7412  C  CG1   . ILE C 2 114 ? 4.365   60.261 -54.153 1.00 158.78 ? 493 ILE C CG1   1 
ATOM   7413  C  CG2   . ILE C 2 114 ? 3.631   62.046 -52.493 1.00 109.77 ? 493 ILE C CG2   1 
ATOM   7414  C  CD1   . ILE C 2 114 ? 5.382   59.894 -53.107 1.00 156.14 ? 493 ILE C CD1   1 
ATOM   7415  N  N     . GLU C 2 115 ? 2.830   64.084 -54.258 1.00 183.16 ? 494 GLU C N     1 
ATOM   7416  C  CA    . GLU C 2 115 ? 2.773   65.511 -54.515 1.00 175.02 ? 494 GLU C CA    1 
ATOM   7417  C  C     . GLU C 2 115 ? 3.673   65.770 -55.708 1.00 170.61 ? 494 GLU C C     1 
ATOM   7418  O  O     . GLU C 2 115 ? 4.361   64.859 -56.177 1.00 161.13 ? 494 GLU C O     1 
ATOM   7419  C  CB    . GLU C 2 115 ? 3.271   66.307 -53.310 1.00 170.49 ? 494 GLU C CB    1 
ATOM   7420  N  N     . ALA C 2 117 ? -0.703  65.876 -54.163 1.00 167.05 ? 496 ALA C N     1 
ATOM   7421  C  CA    . ALA C 2 117 ? -1.678  65.875 -53.073 1.00 168.27 ? 496 ALA C CA    1 
ATOM   7422  C  C     . ALA C 2 117 ? -1.150  65.078 -51.868 1.00 158.24 ? 496 ALA C C     1 
ATOM   7423  O  O     . ALA C 2 117 ? -0.250  64.251 -52.023 1.00 152.34 ? 496 ALA C O     1 
ATOM   7424  C  CB    . ALA C 2 117 ? -3.009  65.318 -53.572 1.00 167.29 ? 496 ALA C CB    1 
ATOM   7425  N  N     . ASN C 2 118 ? -1.682  65.317 -50.671 1.00 152.58 ? 497 ASN C N     1 
ATOM   7426  C  CA    . ASN C 2 118 ? -2.772  66.252 -50.418 1.00 157.47 ? 497 ASN C CA    1 
ATOM   7427  C  C     . ASN C 2 118 ? -2.664  66.795 -48.983 1.00 149.19 ? 497 ASN C C     1 
ATOM   7428  O  O     . ASN C 2 118 ? -3.319  67.780 -48.615 1.00 132.22 ? 497 ASN C O     1 
ATOM   7429  C  CB    . ASN C 2 118 ? -4.098  65.516 -50.611 1.00 165.13 ? 497 ASN C CB    1 
ATOM   7430  C  CG    . ASN C 2 118 ? -5.231  66.431 -50.988 1.00 175.15 ? 497 ASN C CG    1 
ATOM   7431  O  OD1   . ASN C 2 118 ? -5.223  67.616 -50.664 1.00 184.10 ? 497 ASN C OD1   1 
ATOM   7432  N  ND2   . ASN C 2 118 ? -6.230  65.880 -51.666 1.00 174.91 ? 497 ASN C ND2   1 
ATOM   7433  N  N     . TYR C 2 119 ? -1.834  66.123 -48.183 1.00 149.98 ? 498 TYR C N     1 
ATOM   7434  C  CA    . TYR C 2 119 ? -1.576  66.473 -46.788 1.00 142.81 ? 498 TYR C CA    1 
ATOM   7435  C  C     . TYR C 2 119 ? -0.134  66.075 -46.459 1.00 144.26 ? 498 TYR C C     1 
ATOM   7436  O  O     . TYR C 2 119 ? 0.360   65.059 -46.956 1.00 127.17 ? 498 TYR C O     1 
ATOM   7437  C  CB    . TYR C 2 119 ? -2.537  65.712 -45.855 1.00 134.47 ? 498 TYR C CB    1 
ATOM   7438  C  CG    . TYR C 2 119 ? -4.025  65.879 -46.153 1.00 141.31 ? 498 TYR C CG    1 
ATOM   7439  C  CD1   . TYR C 2 119 ? -4.829  66.696 -45.361 1.00 141.74 ? 498 TYR C CD1   1 
ATOM   7440  C  CD2   . TYR C 2 119 ? -4.631  65.207 -47.215 1.00 142.79 ? 498 TYR C CD2   1 
ATOM   7441  C  CE1   . TYR C 2 119 ? -6.199  66.854 -45.626 1.00 143.01 ? 498 TYR C CE1   1 
ATOM   7442  C  CE2   . TYR C 2 119 ? -6.000  65.362 -47.491 1.00 147.72 ? 498 TYR C CE2   1 
ATOM   7443  C  CZ    . TYR C 2 119 ? -6.780  66.189 -46.692 1.00 145.44 ? 498 TYR C CZ    1 
ATOM   7444  O  OH    . TYR C 2 119 ? -8.133  66.355 -46.949 1.00 139.09 ? 498 TYR C OH    1 
ATOM   7445  N  N     . ASP C 2 120 ? 0.549   66.858 -45.629 1.00 158.39 ? 499 ASP C N     1 
ATOM   7446  C  CA    . ASP C 2 120 ? 1.916   66.508 -45.258 1.00 164.69 ? 499 ASP C CA    1 
ATOM   7447  C  C     . ASP C 2 120 ? 1.905   65.749 -43.936 1.00 162.57 ? 499 ASP C C     1 
ATOM   7448  O  O     . ASP C 2 120 ? 2.935   65.581 -43.279 1.00 169.08 ? 499 ASP C O     1 
ATOM   7449  C  CB    . ASP C 2 120 ? 2.738   67.801 -45.121 1.00 178.95 ? 499 ASP C CB    1 
ATOM   7450  C  CG    . ASP C 2 120 ? 4.071   67.594 -44.409 1.00 193.45 ? 499 ASP C CG    1 
ATOM   7451  O  OD1   . ASP C 2 120 ? 4.941   66.895 -44.965 1.00 209.79 ? 499 ASP C OD1   1 
ATOM   7452  O  OD2   . ASP C 2 120 ? 4.257   68.149 -43.301 1.00 185.78 ? 499 ASP C OD2   1 
ATOM   7453  N  N     . LYS C 2 121 ? 0.732   65.242 -43.579 1.00 153.42 ? 500 LYS C N     1 
ATOM   7454  C  CA    . LYS C 2 121 ? 0.573   64.397 -42.406 1.00 144.80 ? 500 LYS C CA    1 
ATOM   7455  C  C     . LYS C 2 121 ? -0.728  63.627 -42.510 1.00 149.39 ? 500 LYS C C     1 
ATOM   7456  O  O     . LYS C 2 121 ? -1.804  64.206 -42.652 1.00 156.53 ? 500 LYS C O     1 
ATOM   7457  C  CB    . LYS C 2 121 ? 0.571   65.225 -41.117 1.00 133.48 ? 500 LYS C CB    1 
ATOM   7458  C  CG    . LYS C 2 121 ? 1.898   65.207 -40.380 1.00 125.52 ? 500 LYS C CG    1 
ATOM   7459  C  CD    . LYS C 2 121 ? 2.116   66.465 -39.556 1.00 131.14 ? 500 LYS C CD    1 
ATOM   7460  C  CE    . LYS C 2 121 ? 3.600   66.672 -39.286 1.00 143.17 ? 500 LYS C CE    1 
ATOM   7461  N  NZ    . LYS C 2 121 ? 3.917   67.909 -38.515 1.00 150.31 ? 500 LYS C NZ    1 
ATOM   7462  N  N     . ILE C 2 122 ? -0.630  62.315 -42.416 1.00 143.94 ? 501 ILE C N     1 
ATOM   7463  C  CA    . ILE C 2 122 ? -1.819  61.505 -42.266 1.00 136.40 ? 501 ILE C CA    1 
ATOM   7464  C  C     . ILE C 2 122 ? -1.719  60.841 -40.899 1.00 140.97 ? 501 ILE C C     1 
ATOM   7465  O  O     . ILE C 2 122 ? -0.815  60.048 -40.640 1.00 154.59 ? 501 ILE C O     1 
ATOM   7466  C  CB    . ILE C 2 122 ? -1.937  60.526 -43.419 1.00 117.72 ? 501 ILE C CB    1 
ATOM   7467  C  CG1   . ILE C 2 122 ? -2.174  61.333 -44.695 1.00 128.08 ? 501 ILE C CG1   1 
ATOM   7468  C  CG2   . ILE C 2 122 ? -3.066  59.557 -43.173 1.00 96.76  ? 501 ILE C CG2   1 
ATOM   7469  C  CD1   . ILE C 2 122 ? -2.005  60.557 -45.974 1.00 142.88 ? 501 ILE C CD1   1 
ATOM   7470  N  N     . ILE C 2 123 ? -2.651  61.189 -40.021 1.00 122.57 ? 502 ILE C N     1 
ATOM   7471  C  CA    . ILE C 2 123 ? -2.508  60.906 -38.606 1.00 112.42 ? 502 ILE C CA    1 
ATOM   7472  C  C     . ILE C 2 123 ? -3.580  59.964 -38.112 1.00 116.08 ? 502 ILE C C     1 
ATOM   7473  O  O     . ILE C 2 123 ? -4.767  60.250 -38.203 1.00 122.32 ? 502 ILE C O     1 
ATOM   7474  C  CB    . ILE C 2 123 ? -2.632  62.172 -37.799 1.00 114.11 ? 502 ILE C CB    1 
ATOM   7475  C  CG1   . ILE C 2 123 ? -1.627  63.207 -38.285 1.00 116.05 ? 502 ILE C CG1   1 
ATOM   7476  C  CG2   . ILE C 2 123 ? -2.413  61.858 -36.347 1.00 127.62 ? 502 ILE C CG2   1 
ATOM   7477  C  CD1   . ILE C 2 123 ? -1.636  64.477 -37.463 1.00 117.39 ? 502 ILE C CD1   1 
ATOM   7478  N  N     . ILE C 2 124 ? -3.156  58.863 -37.520 1.00 110.23 ? 503 ILE C N     1 
ATOM   7479  C  CA    . ILE C 2 124 ? -4.094  57.838 -37.159 1.00 107.59 ? 503 ILE C CA    1 
ATOM   7480  C  C     . ILE C 2 124 ? -4.390  58.056 -35.712 1.00 121.26 ? 503 ILE C C     1 
ATOM   7481  O  O     . ILE C 2 124 ? -3.518  57.913 -34.866 1.00 144.40 ? 503 ILE C O     1 
ATOM   7482  C  CB    . ILE C 2 124 ? -3.478  56.480 -37.323 1.00 114.14 ? 503 ILE C CB    1 
ATOM   7483  C  CG1   . ILE C 2 124 ? -3.254  56.196 -38.806 1.00 117.34 ? 503 ILE C CG1   1 
ATOM   7484  C  CG2   . ILE C 2 124 ? -4.358  55.422 -36.652 1.00 111.90 ? 503 ILE C CG2   1 
ATOM   7485  C  CD1   . ILE C 2 124 ? -2.420  54.948 -39.037 1.00 127.66 ? 503 ILE C CD1   1 
ATOM   7486  N  N     . MET C 2 125 ? -5.629  58.418 -35.430 1.00 121.93 ? 504 MET C N     1 
ATOM   7487  C  CA    . MET C 2 125 ? -6.024  58.743 -34.078 1.00 127.33 ? 504 MET C CA    1 
ATOM   7488  C  C     . MET C 2 125 ? -7.197  57.859 -33.698 1.00 137.40 ? 504 MET C C     1 
ATOM   7489  O  O     . MET C 2 125 ? -8.334  58.087 -34.114 1.00 145.86 ? 504 MET C O     1 
ATOM   7490  C  CB    . MET C 2 125 ? -6.386  60.224 -33.989 1.00 125.94 ? 504 MET C CB    1 
ATOM   7491  C  CG    . MET C 2 125 ? -6.904  60.650 -32.636 1.00 132.93 ? 504 MET C CG    1 
ATOM   7492  S  SD    . MET C 2 125 ? -7.006  62.444 -32.481 1.00 116.18 ? 504 MET C SD    1 
ATOM   7493  C  CE    . MET C 2 125 ? -7.842  62.850 -34.004 1.00 165.49 ? 504 MET C CE    1 
ATOM   7494  N  N     . THR C 2 126 ? -6.914  56.857 -32.882 1.00 136.86 ? 505 THR C N     1 
ATOM   7495  C  CA    . THR C 2 126 ? -7.908  55.863 -32.534 1.00 134.19 ? 505 THR C CA    1 
ATOM   7496  C  C     . THR C 2 126 ? -8.185  55.989 -31.057 1.00 139.21 ? 505 THR C C     1 
ATOM   7497  O  O     . THR C 2 126 ? -7.394  56.586 -30.326 1.00 148.65 ? 505 THR C O     1 
ATOM   7498  C  CB    . THR C 2 126 ? -7.400  54.436 -32.812 1.00 128.42 ? 505 THR C CB    1 
ATOM   7499  O  OG1   . THR C 2 126 ? -6.001  54.364 -32.521 1.00 134.17 ? 505 THR C OG1   1 
ATOM   7500  C  CG2   . THR C 2 126 ? -7.612  54.055 -34.260 1.00 126.00 ? 505 THR C CG2   1 
ATOM   7501  N  N     . ASP C 2 127 ? -9.310  55.440 -30.616 1.00 136.39 ? 506 ASP C N     1 
ATOM   7502  C  CA    . ASP C 2 127 ? -9.597  55.397 -29.194 1.00 143.10 ? 506 ASP C CA    1 
ATOM   7503  C  C     . ASP C 2 127 ? -8.363  54.836 -28.489 1.00 127.42 ? 506 ASP C C     1 
ATOM   7504  O  O     . ASP C 2 127 ? -7.494  54.226 -29.119 1.00 117.82 ? 506 ASP C O     1 
ATOM   7505  C  CB    . ASP C 2 127 ? -10.887 54.621 -28.903 1.00 168.62 ? 506 ASP C CB    1 
ATOM   7506  C  CG    . ASP C 2 127 ? -12.127 55.313 -29.483 1.00 174.14 ? 506 ASP C CG    1 
ATOM   7507  O  OD1   . ASP C 2 127 ? -11.958 56.299 -30.234 1.00 157.02 ? 506 ASP C OD1   1 
ATOM   7508  O  OD2   . ASP C 2 127 ? -13.265 54.873 -29.194 1.00 187.35 ? 506 ASP C OD2   1 
ATOM   7509  N  N     . ALA C 2 128 ? -8.285  55.054 -27.184 1.00 126.21 ? 507 ALA C N     1 
ATOM   7510  C  CA    . ALA C 2 128 ? -7.057  54.802 -26.442 1.00 128.50 ? 507 ALA C CA    1 
ATOM   7511  C  C     . ALA C 2 128 ? -6.872  53.348 -26.035 1.00 134.56 ? 507 ALA C C     1 
ATOM   7512  O  O     . ALA C 2 128 ? -5.776  52.950 -25.641 1.00 136.04 ? 507 ALA C O     1 
ATOM   7513  C  CB    . ALA C 2 128 ? -7.013  55.690 -25.210 1.00 132.74 ? 507 ALA C CB    1 
ATOM   7514  N  N     . ASP C 2 129 ? -7.934  52.552 -26.127 1.00 142.58 ? 508 ASP C N     1 
ATOM   7515  C  CA    . ASP C 2 129 ? -7.859  51.191 -25.624 1.00 146.04 ? 508 ASP C CA    1 
ATOM   7516  C  C     . ASP C 2 129 ? -7.166  50.262 -26.613 1.00 134.81 ? 508 ASP C C     1 
ATOM   7517  O  O     . ASP C 2 129 ? -6.435  50.701 -27.497 1.00 139.67 ? 508 ASP C O     1 
ATOM   7518  C  CB    . ASP C 2 129 ? -9.274  50.664 -25.348 1.00 159.23 ? 508 ASP C CB    1 
ATOM   7519  C  CG    . ASP C 2 129 ? -10.171 50.687 -26.594 1.00 169.48 ? 508 ASP C CG    1 
ATOM   7520  O  OD1   . ASP C 2 129 ? -9.648  50.581 -27.722 1.00 177.07 ? 508 ASP C OD1   1 
ATOM   7521  O  OD2   . ASP C 2 129 ? -11.407 50.806 -26.448 1.00 168.64 ? 508 ASP C OD2   1 
ATOM   7522  N  N     . THR C 2 130 ? -7.459  48.977 -26.491 1.00 114.15 ? 509 THR C N     1 
ATOM   7523  C  CA    . THR C 2 130 ? -6.769  47.958 -27.253 1.00 102.84 ? 509 THR C CA    1 
ATOM   7524  C  C     . THR C 2 130 ? -7.417  47.708 -28.598 1.00 114.87 ? 509 THR C C     1 
ATOM   7525  O  O     . THR C 2 130 ? -6.750  47.333 -29.562 1.00 126.84 ? 509 THR C O     1 
ATOM   7526  C  CB    . THR C 2 130 ? -6.663  46.675 -26.451 1.00 111.97 ? 509 THR C CB    1 
ATOM   7527  O  OG1   . THR C 2 130 ? -7.776  46.591 -25.553 1.00 135.60 ? 509 THR C OG1   1 
ATOM   7528  C  CG2   . THR C 2 130 ? -5.394  46.715 -25.630 1.00 105.12 ? 509 THR C CG2   1 
ATOM   7529  N  N     . ASP C 2 131 ? -8.728  47.872 -28.657 1.00 118.50 ? 510 ASP C N     1 
ATOM   7530  C  CA    . ASP C 2 131 ? -9.422  47.807 -29.936 1.00 125.54 ? 510 ASP C CA    1 
ATOM   7531  C  C     . ASP C 2 131 ? -8.920  48.923 -30.860 1.00 135.33 ? 510 ASP C C     1 
ATOM   7532  O  O     . ASP C 2 131 ? -8.922  48.781 -32.084 1.00 145.36 ? 510 ASP C O     1 
ATOM   7533  C  CB    . ASP C 2 131 ? -10.932 47.853 -29.723 1.00 127.45 ? 510 ASP C CB    1 
ATOM   7534  C  CG    . ASP C 2 131 ? -11.465 46.553 -29.140 1.00 126.39 ? 510 ASP C CG    1 
ATOM   7535  O  OD1   . ASP C 2 131 ? -11.453 45.562 -29.901 1.00 118.18 ? 510 ASP C OD1   1 
ATOM   7536  O  OD2   . ASP C 2 131 ? -11.873 46.517 -27.943 1.00 125.67 ? 510 ASP C OD2   1 
ATOM   7537  N  N     . GLY C 2 132 ? -8.490  50.032 -30.263 1.00 128.29 ? 511 GLY C N     1 
ATOM   7538  C  CA    . GLY C 2 132 ? -7.804  51.080 -30.997 1.00 129.08 ? 511 GLY C CA    1 
ATOM   7539  C  C     . GLY C 2 132 ? -6.492  50.590 -31.584 1.00 123.72 ? 511 GLY C C     1 
ATOM   7540  O  O     . GLY C 2 132 ? -6.195  50.809 -32.761 1.00 123.64 ? 511 GLY C O     1 
ATOM   7541  N  N     . ALA C 2 133 ? -5.698  49.924 -30.757 1.00 113.94 ? 512 ALA C N     1 
ATOM   7542  C  CA    . ALA C 2 133 ? -4.440  49.341 -31.213 1.00 110.21 ? 512 ALA C CA    1 
ATOM   7543  C  C     . ALA C 2 133 ? -4.619  48.345 -32.347 1.00 113.66 ? 512 ALA C C     1 
ATOM   7544  O  O     . ALA C 2 133 ? -3.722  48.188 -33.169 1.00 112.20 ? 512 ALA C O     1 
ATOM   7545  C  CB    . ALA C 2 133 ? -3.673  48.699 -30.071 1.00 92.61  ? 512 ALA C CB    1 
ATOM   7546  N  N     . HIS C 2 134 ? -5.742  47.635 -32.378 1.00 111.54 ? 513 HIS C N     1 
ATOM   7547  C  CA    . HIS C 2 134 ? -5.988  46.734 -33.503 1.00 102.99 ? 513 HIS C CA    1 
ATOM   7548  C  C     . HIS C 2 134 ? -6.181  47.522 -34.784 1.00 103.66 ? 513 HIS C C     1 
ATOM   7549  O  O     . HIS C 2 134 ? -5.602  47.201 -35.818 1.00 96.28  ? 513 HIS C O     1 
ATOM   7550  C  CB    . HIS C 2 134 ? -7.200  45.831 -33.279 1.00 91.09  ? 513 HIS C CB    1 
ATOM   7551  C  CG    . HIS C 2 134 ? -7.375  44.797 -34.348 1.00 93.48  ? 513 HIS C CG    1 
ATOM   7552  N  ND1   . HIS C 2 134 ? -8.556  44.123 -34.546 1.00 105.62 ? 513 HIS C ND1   1 
ATOM   7553  C  CD2   . HIS C 2 134 ? -6.513  44.326 -35.279 1.00 108.29 ? 513 HIS C CD2   1 
ATOM   7554  C  CE1   . HIS C 2 134 ? -8.415  43.279 -35.555 1.00 119.39 ? 513 HIS C CE1   1 
ATOM   7555  N  NE2   . HIS C 2 134 ? -7.184  43.380 -36.015 1.00 112.87 ? 513 HIS C NE2   1 
ATOM   7556  N  N     . ILE C 2 135 ? -7.012  48.554 -34.710 1.00 107.42 ? 514 ILE C N     1 
ATOM   7557  C  CA    . ILE C 2 135 ? -7.270  49.383 -35.867 1.00 104.30 ? 514 ILE C CA    1 
ATOM   7558  C  C     . ILE C 2 135 ? -5.981  50.024 -36.349 1.00 113.86 ? 514 ILE C C     1 
ATOM   7559  O  O     . ILE C 2 135 ? -5.740  50.092 -37.544 1.00 118.80 ? 514 ILE C O     1 
ATOM   7560  C  CB    . ILE C 2 135 ? -8.303  50.456 -35.585 1.00 109.16 ? 514 ILE C CB    1 
ATOM   7561  C  CG1   . ILE C 2 135 ? -9.654  49.796 -35.333 1.00 119.51 ? 514 ILE C CG1   1 
ATOM   7562  C  CG2   . ILE C 2 135 ? -8.383  51.428 -36.750 1.00 96.75  ? 514 ILE C CG2   1 
ATOM   7563  C  CD1   . ILE C 2 135 ? -10.834 50.634 -35.784 1.00 129.46 ? 514 ILE C CD1   1 
ATOM   7564  N  N     . GLN C 2 136 ? -5.143  50.491 -35.431 1.00 112.68 ? 515 GLN C N     1 
ATOM   7565  C  CA    . GLN C 2 136 ? -3.855  51.029 -35.855 1.00 116.27 ? 515 GLN C CA    1 
ATOM   7566  C  C     . GLN C 2 136 ? -3.117  49.991 -36.699 1.00 112.24 ? 515 GLN C C     1 
ATOM   7567  O  O     . GLN C 2 136 ? -2.609  50.292 -37.770 1.00 107.36 ? 515 GLN C O     1 
ATOM   7568  C  CB    . GLN C 2 136 ? -3.009  51.446 -34.655 1.00 109.58 ? 515 GLN C CB    1 
ATOM   7569  C  CG    . GLN C 2 136 ? -3.494  52.679 -33.959 1.00 109.98 ? 515 GLN C CG    1 
ATOM   7570  C  CD    . GLN C 2 136 ? -2.770  52.904 -32.666 1.00 122.86 ? 515 GLN C CD    1 
ATOM   7571  O  OE1   . GLN C 2 136 ? -1.773  52.244 -32.378 1.00 122.22 ? 515 GLN C OE1   1 
ATOM   7572  N  NE2   . GLN C 2 136 ? -3.263  53.837 -31.871 1.00 133.99 ? 515 GLN C NE2   1 
ATOM   7573  N  N     . THR C 2 137 ? -3.093  48.760 -36.206 1.00 111.75 ? 516 THR C N     1 
ATOM   7574  C  CA    . THR C 2 137 ? -2.453  47.636 -36.875 1.00 96.00  ? 516 THR C CA    1 
ATOM   7575  C  C     . THR C 2 137 ? -2.984  47.444 -38.285 1.00 100.55 ? 516 THR C C     1 
ATOM   7576  O  O     . THR C 2 137 ? -2.227  47.257 -39.229 1.00 111.85 ? 516 THR C O     1 
ATOM   7577  C  CB    . THR C 2 137 ? -2.769  46.355 -36.130 1.00 103.00 ? 516 THR C CB    1 
ATOM   7578  O  OG1   . THR C 2 137 ? -1.852  46.186 -35.048 1.00 111.05 ? 516 THR C OG1   1 
ATOM   7579  C  CG2   . THR C 2 137 ? -2.635  45.196 -37.046 1.00 115.09 ? 516 THR C CG2   1 
ATOM   7580  N  N     . LEU C 2 138 ? -4.302  47.461 -38.413 1.00 97.03  ? 517 LEU C N     1 
ATOM   7581  C  CA    . LEU C 2 138 ? -4.949  47.344 -39.702 1.00 105.89 ? 517 LEU C CA    1 
ATOM   7582  C  C     . LEU C 2 138 ? -4.668  48.529 -40.640 1.00 119.53 ? 517 LEU C C     1 
ATOM   7583  O  O     . LEU C 2 138 ? -4.384  48.339 -41.822 1.00 128.17 ? 517 LEU C O     1 
ATOM   7584  C  CB    . LEU C 2 138 ? -6.449  47.173 -39.497 1.00 107.21 ? 517 LEU C CB    1 
ATOM   7585  C  CG    . LEU C 2 138 ? -6.813  45.861 -38.818 1.00 109.63 ? 517 LEU C CG    1 
ATOM   7586  C  CD1   . LEU C 2 138 ? -8.125  45.945 -38.062 1.00 111.81 ? 517 LEU C CD1   1 
ATOM   7587  C  CD2   . LEU C 2 138 ? -6.876  44.771 -39.847 1.00 119.37 ? 517 LEU C CD2   1 
ATOM   7588  N  N     . LEU C 2 139 ? -4.772  49.749 -40.127 1.00 120.71 ? 518 LEU C N     1 
ATOM   7589  C  CA    . LEU C 2 139 ? -4.549  50.926 -40.963 1.00 128.78 ? 518 LEU C CA    1 
ATOM   7590  C  C     . LEU C 2 139 ? -3.123  50.963 -41.478 1.00 134.22 ? 518 LEU C C     1 
ATOM   7591  O  O     . LEU C 2 139 ? -2.887  51.295 -42.636 1.00 136.73 ? 518 LEU C O     1 
ATOM   7592  C  CB    . LEU C 2 139 ? -4.880  52.226 -40.230 1.00 126.44 ? 518 LEU C CB    1 
ATOM   7593  C  CG    . LEU C 2 139 ? -6.375  52.527 -40.155 1.00 119.07 ? 518 LEU C CG    1 
ATOM   7594  C  CD1   . LEU C 2 139 ? -6.635  53.750 -39.311 1.00 119.82 ? 518 LEU C CD1   1 
ATOM   7595  C  CD2   . LEU C 2 139 ? -6.941  52.693 -41.524 1.00 82.48  ? 518 LEU C CD2   1 
ATOM   7596  N  N     . LEU C 2 140 ? -2.173  50.632 -40.610 1.00 129.89 ? 519 LEU C N     1 
ATOM   7597  C  CA    . LEU C 2 140 ? -0.774  50.617 -41.009 1.00 119.62 ? 519 LEU C CA    1 
ATOM   7598  C  C     . LEU C 2 140 ? -0.501  49.619 -42.120 1.00 125.35 ? 519 LEU C C     1 
ATOM   7599  O  O     . LEU C 2 140 ? 0.226   49.933 -43.056 1.00 133.86 ? 519 LEU C O     1 
ATOM   7600  C  CB    . LEU C 2 140 ? 0.162   50.366 -39.833 1.00 103.33 ? 519 LEU C CB    1 
ATOM   7601  C  CG    . LEU C 2 140 ? 0.382   51.600 -38.954 1.00 111.95 ? 519 LEU C CG    1 
ATOM   7602  C  CD1   . LEU C 2 140 ? 1.259   51.222 -37.772 1.00 124.03 ? 519 LEU C CD1   1 
ATOM   7603  C  CD2   . LEU C 2 140 ? 0.982   52.787 -39.715 1.00 98.39  ? 519 LEU C CD2   1 
ATOM   7604  N  N     . THR C 2 141 ? -1.057  48.416 -42.033 1.00 114.26 ? 520 THR C N     1 
ATOM   7605  C  CA    . THR C 2 141 ? -0.793  47.460 -43.104 1.00 114.64 ? 520 THR C CA    1 
ATOM   7606  C  C     . THR C 2 141 ? -1.332  47.961 -44.433 1.00 110.25 ? 520 THR C C     1 
ATOM   7607  O  O     . THR C 2 141 ? -0.717  47.740 -45.457 1.00 118.66 ? 520 THR C O     1 
ATOM   7608  C  CB    . THR C 2 141 ? -1.316  46.043 -42.847 1.00 112.43 ? 520 THR C CB    1 
ATOM   7609  O  OG1   . THR C 2 141 ? -2.699  45.977 -43.204 1.00 138.18 ? 520 THR C OG1   1 
ATOM   7610  C  CG2   . THR C 2 141 ? -1.114  45.647 -41.408 1.00 91.50  ? 520 THR C CG2   1 
ATOM   7611  N  N     . PHE C 2 142 ? -2.483  48.623 -44.426 1.00 106.63 ? 521 PHE C N     1 
ATOM   7612  C  CA    . PHE C 2 142 ? -3.014  49.179 -45.663 1.00 109.76 ? 521 PHE C CA    1 
ATOM   7613  C  C     . PHE C 2 142 ? -2.046  50.180 -46.289 1.00 124.67 ? 521 PHE C C     1 
ATOM   7614  O  O     . PHE C 2 142 ? -1.707  50.085 -47.470 1.00 132.70 ? 521 PHE C O     1 
ATOM   7615  C  CB    . PHE C 2 142 ? -4.349  49.870 -45.434 1.00 111.52 ? 521 PHE C CB    1 
ATOM   7616  C  CG    . PHE C 2 142 ? -4.777  50.720 -46.588 1.00 117.82 ? 521 PHE C CG    1 
ATOM   7617  C  CD1   . PHE C 2 142 ? -4.860  52.086 -46.461 1.00 123.76 ? 521 PHE C CD1   1 
ATOM   7618  C  CD2   . PHE C 2 142 ? -5.061  50.147 -47.814 1.00 122.95 ? 521 PHE C CD2   1 
ATOM   7619  C  CE1   . PHE C 2 142 ? -5.240  52.860 -47.529 1.00 134.40 ? 521 PHE C CE1   1 
ATOM   7620  C  CE2   . PHE C 2 142 ? -5.440  50.917 -48.887 1.00 129.51 ? 521 PHE C CE2   1 
ATOM   7621  C  CZ    . PHE C 2 142 ? -5.531  52.275 -48.751 1.00 133.22 ? 521 PHE C CZ    1 
ATOM   7622  N  N     . PHE C 2 143 ? -1.609  51.146 -45.495 1.00 122.34 ? 522 PHE C N     1 
ATOM   7623  C  CA    . PHE C 2 143 ? -0.609  52.082 -45.964 1.00 127.39 ? 522 PHE C CA    1 
ATOM   7624  C  C     . PHE C 2 143 ? 0.658   51.363 -46.398 1.00 131.58 ? 522 PHE C C     1 
ATOM   7625  O  O     . PHE C 2 143 ? 1.154   51.586 -47.498 1.00 120.50 ? 522 PHE C O     1 
ATOM   7626  C  CB    . PHE C 2 143 ? -0.317  53.110 -44.885 1.00 122.34 ? 522 PHE C CB    1 
ATOM   7627  C  CG    . PHE C 2 143 ? -1.443  54.049 -44.669 1.00 138.75 ? 522 PHE C CG    1 
ATOM   7628  C  CD1   . PHE C 2 143 ? -2.369  54.262 -45.679 1.00 143.25 ? 522 PHE C CD1   1 
ATOM   7629  C  CD2   . PHE C 2 143 ? -1.589  54.726 -43.483 1.00 147.08 ? 522 PHE C CD2   1 
ATOM   7630  C  CE1   . PHE C 2 143 ? -3.433  55.131 -45.505 1.00 144.15 ? 522 PHE C CE1   1 
ATOM   7631  C  CE2   . PHE C 2 143 ? -2.651  55.601 -43.306 1.00 156.31 ? 522 PHE C CE2   1 
ATOM   7632  C  CZ    . PHE C 2 143 ? -3.575  55.801 -44.325 1.00 151.72 ? 522 PHE C CZ    1 
ATOM   7633  N  N     . TYR C 2 144 ? 1.174   50.485 -45.549 1.00 131.30 ? 523 TYR C N     1 
ATOM   7634  C  CA    . TYR C 2 144 ? 2.372   49.742 -45.900 1.00 127.99 ? 523 TYR C CA    1 
ATOM   7635  C  C     . TYR C 2 144 ? 2.235   48.967 -47.220 1.00 130.34 ? 523 TYR C C     1 
ATOM   7636  O  O     . TYR C 2 144 ? 3.173   48.927 -48.017 1.00 119.31 ? 523 TYR C O     1 
ATOM   7637  C  CB    . TYR C 2 144 ? 2.784   48.775 -44.779 1.00 114.50 ? 523 TYR C CB    1 
ATOM   7638  C  CG    . TYR C 2 144 ? 3.904   47.892 -45.260 1.00 135.28 ? 523 TYR C CG    1 
ATOM   7639  C  CD1   . TYR C 2 144 ? 5.216   48.351 -45.267 1.00 146.60 ? 523 TYR C CD1   1 
ATOM   7640  C  CD2   . TYR C 2 144 ? 3.648   46.631 -45.788 1.00 143.99 ? 523 TYR C CD2   1 
ATOM   7641  C  CE1   . TYR C 2 144 ? 6.245   47.566 -45.752 1.00 150.17 ? 523 TYR C CE1   1 
ATOM   7642  C  CE2   . TYR C 2 144 ? 4.671   45.838 -46.271 1.00 150.53 ? 523 TYR C CE2   1 
ATOM   7643  C  CZ    . TYR C 2 144 ? 5.965   46.311 -46.250 1.00 152.71 ? 523 TYR C CZ    1 
ATOM   7644  O  OH    . TYR C 2 144 ? 6.982   45.526 -46.732 1.00 157.95 ? 523 TYR C OH    1 
ATOM   7645  N  N     . ARG C 2 145 ? 1.091   48.317 -47.426 1.00 127.41 ? 524 ARG C N     1 
ATOM   7646  C  CA    . ARG C 2 145 ? 0.897   47.471 -48.600 1.00 120.24 ? 524 ARG C CA    1 
ATOM   7647  C  C     . ARG C 2 145 ? 0.751   48.289 -49.868 1.00 134.09 ? 524 ARG C C     1 
ATOM   7648  O  O     . ARG C 2 145 ? 1.511   48.101 -50.816 1.00 157.78 ? 524 ARG C O     1 
ATOM   7649  C  CB    . ARG C 2 145 ? -0.305  46.532 -48.456 1.00 125.83 ? 524 ARG C CB    1 
ATOM   7650  C  CG    . ARG C 2 145 ? -0.201  45.507 -47.312 1.00 146.35 ? 524 ARG C CG    1 
ATOM   7651  C  CD    . ARG C 2 145 ? 1.034   44.601 -47.419 1.00 156.47 ? 524 ARG C CD    1 
ATOM   7652  N  NE    . ARG C 2 145 ? 0.765   43.234 -47.879 1.00 156.78 ? 524 ARG C NE    1 
ATOM   7653  C  CZ    . ARG C 2 145 ? -0.355  42.806 -48.466 1.00 149.96 ? 524 ARG C CZ    1 
ATOM   7654  N  NH1   . ARG C 2 145 ? -1.385  43.614 -48.707 1.00 124.67 ? 524 ARG C NH1   1 
ATOM   7655  N  NH2   . ARG C 2 145 ? -0.438  41.537 -48.824 1.00 159.62 ? 524 ARG C NH2   1 
ATOM   7656  N  N     . TYR C 2 146 ? -0.235  49.179 -49.902 1.00 130.93 ? 525 TYR C N     1 
ATOM   7657  C  CA    . TYR C 2 146 ? -0.455  50.009 -51.092 1.00 142.25 ? 525 TYR C CA    1 
ATOM   7658  C  C     . TYR C 2 146 ? 0.343   51.318 -51.115 1.00 153.81 ? 525 TYR C C     1 
ATOM   7659  O  O     . TYR C 2 146 ? 1.369   51.415 -51.785 1.00 174.62 ? 525 TYR C O     1 
ATOM   7660  C  CB    . TYR C 2 146 ? -1.942  50.259 -51.276 1.00 138.83 ? 525 TYR C CB    1 
ATOM   7661  C  CG    . TYR C 2 146 ? -2.671  48.946 -51.425 1.00 143.00 ? 525 TYR C CG    1 
ATOM   7662  C  CD1   . TYR C 2 146 ? -2.289  47.834 -50.689 1.00 135.36 ? 525 TYR C CD1   1 
ATOM   7663  C  CD2   . TYR C 2 146 ? -3.719  48.806 -52.309 1.00 158.58 ? 525 TYR C CD2   1 
ATOM   7664  C  CE1   . TYR C 2 146 ? -2.931  46.631 -50.825 1.00 138.09 ? 525 TYR C CE1   1 
ATOM   7665  C  CE2   . TYR C 2 146 ? -4.374  47.598 -52.450 1.00 159.63 ? 525 TYR C CE2   1 
ATOM   7666  C  CZ    . TYR C 2 146 ? -3.973  46.518 -51.708 1.00 149.79 ? 525 TYR C CZ    1 
ATOM   7667  O  OH    . TYR C 2 146 ? -4.627  45.323 -51.859 1.00 157.67 ? 525 TYR C OH    1 
ATOM   7668  N  N     . MET C 2 147 ? -0.118  52.307 -50.361 1.00 138.59 ? 526 MET C N     1 
ATOM   7669  C  CA    . MET C 2 147 ? 0.560   53.600 -50.238 1.00 130.14 ? 526 MET C CA    1 
ATOM   7670  C  C     . MET C 2 147 ? 2.007   53.587 -49.711 1.00 130.28 ? 526 MET C C     1 
ATOM   7671  O  O     . MET C 2 147 ? 2.402   54.515 -49.007 1.00 128.32 ? 526 MET C O     1 
ATOM   7672  C  CB    . MET C 2 147 ? -0.295  54.572 -49.423 1.00 130.29 ? 526 MET C CB    1 
ATOM   7673  C  CG    . MET C 2 147 ? -1.642  54.838 -50.081 1.00 135.93 ? 526 MET C CG    1 
ATOM   7674  S  SD    . MET C 2 147 ? -2.695  56.030 -49.234 1.00 151.97 ? 526 MET C SD    1 
ATOM   7675  C  CE    . MET C 2 147 ? -2.137  57.578 -49.931 1.00 400.15 ? 526 MET C CE    1 
ATOM   7676  N  N     . ARG C 2 148 ? 2.781   52.542 -50.019 1.00 127.48 ? 527 ARG C N     1 
ATOM   7677  C  CA    . ARG C 2 148 ? 4.125   52.383 -49.442 1.00 127.40 ? 527 ARG C CA    1 
ATOM   7678  C  C     . ARG C 2 148 ? 5.008   53.636 -49.461 1.00 133.34 ? 527 ARG C C     1 
ATOM   7679  O  O     . ARG C 2 148 ? 5.595   54.001 -48.439 1.00 124.98 ? 527 ARG C O     1 
ATOM   7680  C  CB    . ARG C 2 148 ? 4.897   51.206 -50.066 1.00 117.87 ? 527 ARG C CB    1 
ATOM   7681  C  CG    . ARG C 2 148 ? 6.215   50.878 -49.290 1.00 132.67 ? 527 ARG C CG    1 
ATOM   7682  C  CD    . ARG C 2 148 ? 7.067   49.795 -49.953 1.00 148.84 ? 527 ARG C CD    1 
ATOM   7683  N  NE    . ARG C 2 148 ? 6.229   48.863 -50.709 1.00 173.50 ? 527 ARG C NE    1 
ATOM   7684  C  CZ    . ARG C 2 148 ? 5.582   47.822 -50.187 1.00 171.05 ? 527 ARG C CZ    1 
ATOM   7685  N  NH1   . ARG C 2 148 ? 5.685   47.561 -48.890 1.00 173.46 ? 527 ARG C NH1   1 
ATOM   7686  N  NH2   . ARG C 2 148 ? 4.834   47.039 -50.967 1.00 155.43 ? 527 ARG C NH2   1 
ATOM   7687  N  N     . PRO C 2 149 ? 5.111   54.297 -50.621 1.00 137.26 ? 528 PRO C N     1 
ATOM   7688  C  CA    . PRO C 2 149 ? 5.963   55.485 -50.716 1.00 137.86 ? 528 PRO C CA    1 
ATOM   7689  C  C     . PRO C 2 149 ? 5.610   56.471 -49.618 1.00 141.84 ? 528 PRO C C     1 
ATOM   7690  O  O     . PRO C 2 149 ? 6.490   57.112 -49.048 1.00 144.07 ? 528 PRO C O     1 
ATOM   7691  C  CB    . PRO C 2 149 ? 5.554   56.084 -52.047 1.00 141.00 ? 528 PRO C CB    1 
ATOM   7692  C  CG    . PRO C 2 149 ? 4.960   54.955 -52.798 1.00 140.60 ? 528 PRO C CG    1 
ATOM   7693  C  CD    . PRO C 2 149 ? 4.275   54.118 -51.814 1.00 128.08 ? 528 PRO C CD    1 
ATOM   7694  N  N     . LEU C 2 150 ? 4.316   56.578 -49.332 1.00 135.45 ? 529 LEU C N     1 
ATOM   7695  C  CA    . LEU C 2 150 ? 3.819   57.440 -48.272 1.00 124.97 ? 529 LEU C CA    1 
ATOM   7696  C  C     . LEU C 2 150 ? 4.525   57.106 -46.971 1.00 122.76 ? 529 LEU C C     1 
ATOM   7697  O  O     . LEU C 2 150 ? 5.095   57.980 -46.324 1.00 125.37 ? 529 LEU C O     1 
ATOM   7698  C  CB    . LEU C 2 150 ? 2.314   57.244 -48.099 1.00 129.49 ? 529 LEU C CB    1 
ATOM   7699  C  CG    . LEU C 2 150 ? 1.457   58.506 -48.013 1.00 134.26 ? 529 LEU C CG    1 
ATOM   7700  C  CD1   . LEU C 2 150 ? 0.087   58.178 -47.443 1.00 145.18 ? 529 LEU C CD1   1 
ATOM   7701  C  CD2   . LEU C 2 150 ? 2.149   59.541 -47.172 1.00 125.05 ? 529 LEU C CD2   1 
ATOM   7702  N  N     . VAL C 2 151 ? 4.481   55.833 -46.592 1.00 121.16 ? 530 VAL C N     1 
ATOM   7703  C  CA    . VAL C 2 151 ? 5.090   55.379 -45.347 1.00 125.44 ? 530 VAL C CA    1 
ATOM   7704  C  C     . VAL C 2 151 ? 6.602   55.542 -45.367 1.00 139.00 ? 530 VAL C C     1 
ATOM   7705  O  O     . VAL C 2 151 ? 7.190   56.005 -44.395 1.00 155.57 ? 530 VAL C O     1 
ATOM   7706  C  CB    . VAL C 2 151 ? 4.796   53.904 -45.049 1.00 115.94 ? 530 VAL C CB    1 
ATOM   7707  C  CG1   . VAL C 2 151 ? 5.454   53.507 -43.745 1.00 107.35 ? 530 VAL C CG1   1 
ATOM   7708  C  CG2   . VAL C 2 151 ? 3.298   53.645 -45.008 1.00 109.71 ? 530 VAL C CG2   1 
ATOM   7709  N  N     . GLU C 2 152 ? 7.232   55.133 -46.464 1.00 137.64 ? 531 GLU C N     1 
ATOM   7710  C  CA    . GLU C 2 152 ? 8.683   55.238 -46.597 1.00 141.34 ? 531 GLU C CA    1 
ATOM   7711  C  C     . GLU C 2 152 ? 9.094   56.700 -46.477 1.00 150.42 ? 531 GLU C C     1 
ATOM   7712  O  O     . GLU C 2 152 ? 10.137  57.020 -45.909 1.00 153.30 ? 531 GLU C O     1 
ATOM   7713  C  CB    . GLU C 2 152 ? 9.160   54.642 -47.937 1.00 129.33 ? 531 GLU C CB    1 
ATOM   7714  N  N     . ALA C 2 153 ? 8.253   57.577 -47.020 1.00 150.99 ? 532 ALA C N     1 
ATOM   7715  C  CA    . ALA C 2 153 ? 8.487   59.019 -47.010 1.00 150.99 ? 532 ALA C CA    1 
ATOM   7716  C  C     . ALA C 2 153 ? 8.578   59.610 -45.604 1.00 158.64 ? 532 ALA C C     1 
ATOM   7717  O  O     . ALA C 2 153 ? 9.406   60.480 -45.340 1.00 169.26 ? 532 ALA C O     1 
ATOM   7718  C  CB    . ALA C 2 153 ? 7.399   59.718 -47.787 1.00 148.85 ? 532 ALA C CB    1 
ATOM   7719  N  N     . GLY C 2 154 ? 7.712   59.148 -44.710 1.00 156.31 ? 533 GLY C N     1 
ATOM   7720  C  CA    . GLY C 2 154 ? 7.676   59.663 -43.353 1.00 149.54 ? 533 GLY C CA    1 
ATOM   7721  C  C     . GLY C 2 154 ? 6.488   60.576 -43.135 1.00 144.51 ? 533 GLY C C     1 
ATOM   7722  O  O     . GLY C 2 154 ? 6.605   61.600 -42.457 1.00 143.73 ? 533 GLY C O     1 
ATOM   7723  N  N     . HIS C 2 155 ? 5.347   60.191 -43.707 1.00 146.25 ? 534 HIS C N     1 
ATOM   7724  C  CA    . HIS C 2 155 ? 4.125   60.995 -43.662 1.00 154.82 ? 534 HIS C CA    1 
ATOM   7725  C  C     . HIS C 2 155 ? 2.999   60.366 -42.838 1.00 154.54 ? 534 HIS C C     1 
ATOM   7726  O  O     . HIS C 2 155 ? 1.963   60.996 -42.608 1.00 153.96 ? 534 HIS C O     1 
ATOM   7727  C  CB    . HIS C 2 155 ? 3.607   61.249 -45.072 1.00 153.08 ? 534 HIS C CB    1 
ATOM   7728  C  CG    . HIS C 2 155 ? 4.237   62.422 -45.752 1.00 161.67 ? 534 HIS C CG    1 
ATOM   7729  N  ND1   . HIS C 2 155 ? 5.572   62.734 -45.614 1.00 163.09 ? 534 HIS C ND1   1 
ATOM   7730  C  CD2   . HIS C 2 155 ? 3.718   63.339 -46.603 1.00 165.65 ? 534 HIS C CD2   1 
ATOM   7731  C  CE1   . HIS C 2 155 ? 5.846   63.803 -46.341 1.00 167.05 ? 534 HIS C CE1   1 
ATOM   7732  N  NE2   . HIS C 2 155 ? 4.739   64.189 -46.951 1.00 167.49 ? 534 HIS C NE2   1 
ATOM   7733  N  N     . VAL C 2 156 ? 3.192   59.124 -42.409 1.00 145.12 ? 535 VAL C N     1 
ATOM   7734  C  CA    . VAL C 2 156 ? 2.186   58.449 -41.599 1.00 128.92 ? 535 VAL C CA    1 
ATOM   7735  C  C     . VAL C 2 156 ? 2.504   58.558 -40.112 1.00 128.78 ? 535 VAL C C     1 
ATOM   7736  O  O     . VAL C 2 156 ? 3.570   58.140 -39.648 1.00 131.68 ? 535 VAL C O     1 
ATOM   7737  C  CB    . VAL C 2 156 ? 2.055   56.971 -41.973 1.00 120.28 ? 535 VAL C CB    1 
ATOM   7738  C  CG1   . VAL C 2 156 ? 1.176   56.254 -40.959 1.00 93.60  ? 535 VAL C CG1   1 
ATOM   7739  C  CG2   . VAL C 2 156 ? 1.509   56.826 -43.387 1.00 128.24 ? 535 VAL C CG2   1 
ATOM   7740  N  N     . TYR C 2 157 ? 1.551   59.096 -39.365 1.00 126.57 ? 536 TYR C N     1 
ATOM   7741  C  CA    . TYR C 2 157 ? 1.747   59.358 -37.952 1.00 123.86 ? 536 TYR C CA    1 
ATOM   7742  C  C     . TYR C 2 157 ? 0.734   58.577 -37.115 1.00 130.23 ? 536 TYR C C     1 
ATOM   7743  O  O     . TYR C 2 157 ? -0.331  58.183 -37.591 1.00 139.70 ? 536 TYR C O     1 
ATOM   7744  C  CB    . TYR C 2 157 ? 1.630   60.863 -37.685 1.00 122.81 ? 536 TYR C CB    1 
ATOM   7745  C  CG    . TYR C 2 157 ? 2.752   61.704 -38.285 1.00 132.18 ? 536 TYR C CG    1 
ATOM   7746  C  CD1   . TYR C 2 157 ? 3.799   62.167 -37.495 1.00 128.40 ? 536 TYR C CD1   1 
ATOM   7747  C  CD2   . TYR C 2 157 ? 2.763   62.043 -39.639 1.00 130.42 ? 536 TYR C CD2   1 
ATOM   7748  C  CE1   . TYR C 2 157 ? 4.830   62.936 -38.032 1.00 122.23 ? 536 TYR C CE1   1 
ATOM   7749  C  CE2   . TYR C 2 157 ? 3.793   62.812 -40.182 1.00 120.60 ? 536 TYR C CE2   1 
ATOM   7750  C  CZ    . TYR C 2 157 ? 4.823   63.254 -39.370 1.00 122.21 ? 536 TYR C CZ    1 
ATOM   7751  O  OH    . TYR C 2 157 ? 5.856   64.007 -39.887 1.00 125.02 ? 536 TYR C OH    1 
ATOM   7752  N  N     . ILE C 2 158 ? 1.084   58.325 -35.866 1.00 121.80 ? 537 ILE C N     1 
ATOM   7753  C  CA    . ILE C 2 158 ? 0.119   57.788 -34.933 1.00 123.73 ? 537 ILE C CA    1 
ATOM   7754  C  C     . ILE C 2 158 ? -0.031  58.796 -33.808 1.00 129.17 ? 537 ILE C C     1 
ATOM   7755  O  O     . ILE C 2 158 ? 0.957   59.244 -33.234 1.00 139.10 ? 537 ILE C O     1 
ATOM   7756  C  CB    . ILE C 2 158 ? 0.577   56.449 -34.369 1.00 126.18 ? 537 ILE C CB    1 
ATOM   7757  C  CG1   . ILE C 2 158 ? 0.945   55.497 -35.493 1.00 128.38 ? 537 ILE C CG1   1 
ATOM   7758  C  CG2   . ILE C 2 158 ? -0.523  55.829 -33.546 1.00 122.87 ? 537 ILE C CG2   1 
ATOM   7759  C  CD1   . ILE C 2 158 ? 1.226   54.111 -34.994 1.00 130.74 ? 537 ILE C CD1   1 
ATOM   7760  N  N     . ALA C 2 159 ? -1.267  59.145 -33.480 1.00 125.60 ? 538 ALA C N     1 
ATOM   7761  C  CA    . ALA C 2 159 ? -1.510  60.134 -32.443 1.00 123.89 ? 538 ALA C CA    1 
ATOM   7762  C  C     . ALA C 2 159 ? -1.872  59.386 -31.181 1.00 122.72 ? 538 ALA C C     1 
ATOM   7763  O  O     . ALA C 2 159 ? -2.515  58.333 -31.236 1.00 120.32 ? 538 ALA C O     1 
ATOM   7764  C  CB    . ALA C 2 159 ? -2.601  61.113 -32.849 1.00 126.51 ? 538 ALA C CB    1 
ATOM   7765  N  N     . LEU C 2 160 ? -1.433  59.912 -30.046 1.00 141.41 ? 539 LEU C N     1 
ATOM   7766  C  CA    . LEU C 2 160 ? -1.417  59.123 -28.830 1.00 139.47 ? 539 LEU C CA    1 
ATOM   7767  C  C     . LEU C 2 160 ? -2.294  59.751 -27.739 1.00 132.31 ? 539 LEU C C     1 
ATOM   7768  O  O     . LEU C 2 160 ? -1.785  60.342 -26.799 1.00 138.28 ? 539 LEU C O     1 
ATOM   7769  C  CB    . LEU C 2 160 ? 0.047   58.911 -28.386 1.00 95.33  ? 539 LEU C CB    1 
ATOM   7770  N  N     . PRO C 2 161 ? -3.627  59.607 -27.856 1.00 132.39 ? 540 PRO C N     1 
ATOM   7771  C  CA    . PRO C 2 161 ? -4.573  60.256 -26.946 1.00 119.44 ? 540 PRO C CA    1 
ATOM   7772  C  C     . PRO C 2 161 ? -4.718  59.442 -25.686 1.00 116.62 ? 540 PRO C C     1 
ATOM   7773  O  O     . PRO C 2 161 ? -4.653  58.220 -25.770 1.00 128.30 ? 540 PRO C O     1 
ATOM   7774  C  CB    . PRO C 2 161 ? -5.895  60.184 -27.707 1.00 120.65 ? 540 PRO C CB    1 
ATOM   7775  C  CG    . PRO C 2 161 ? -5.642  59.343 -28.922 1.00 133.12 ? 540 PRO C CG    1 
ATOM   7776  C  CD    . PRO C 2 161 ? -4.330  58.655 -28.721 1.00 141.99 ? 540 PRO C CD    1 
ATOM   7777  N  N     . PRO C 2 162 ? -4.933  60.105 -24.541 1.00 114.79 ? 541 PRO C N     1 
ATOM   7778  C  CA    . PRO C 2 162 ? -5.010  59.526 -23.194 1.00 116.87 ? 541 PRO C CA    1 
ATOM   7779  C  C     . PRO C 2 162 ? -6.080  58.467 -23.066 1.00 126.62 ? 541 PRO C C     1 
ATOM   7780  O  O     . PRO C 2 162 ? -7.087  58.489 -23.785 1.00 126.19 ? 541 PRO C O     1 
ATOM   7781  C  CB    . PRO C 2 162 ? -5.435  60.704 -22.321 1.00 116.11 ? 541 PRO C CB    1 
ATOM   7782  C  CG    . PRO C 2 162 ? -5.048  61.873 -23.050 1.00 131.91 ? 541 PRO C CG    1 
ATOM   7783  C  CD    . PRO C 2 162 ? -5.091  61.560 -24.517 1.00 128.76 ? 541 PRO C CD    1 
ATOM   7784  N  N     . LEU C 2 163 ? -5.861  57.552 -22.131 1.00 121.42 ? 542 LEU C N     1 
ATOM   7785  C  CA    . LEU C 2 163 ? -6.866  56.566 -21.791 1.00 118.94 ? 542 LEU C CA    1 
ATOM   7786  C  C     . LEU C 2 163 ? -7.500  56.956 -20.468 1.00 119.95 ? 542 LEU C C     1 
ATOM   7787  O  O     . LEU C 2 163 ? -8.718  57.049 -20.358 1.00 113.58 ? 542 LEU C O     1 
ATOM   7788  C  CB    . LEU C 2 163 ? -6.216  55.199 -21.670 1.00 116.84 ? 542 LEU C CB    1 
ATOM   7789  C  CG    . LEU C 2 163 ? -7.090  53.985 -21.950 1.00 108.79 ? 542 LEU C CG    1 
ATOM   7790  C  CD1   . LEU C 2 163 ? -6.825  53.023 -20.826 1.00 111.19 ? 542 LEU C CD1   1 
ATOM   7791  C  CD2   . LEU C 2 163 ? -8.585  54.323 -22.044 1.00 103.11 ? 542 LEU C CD2   1 
ATOM   7792  N  N     . TYR C 2 164 ? -6.648  57.185 -19.471 1.00 129.47 ? 543 TYR C N     1 
ATOM   7793  C  CA    . TYR C 2 164 ? -7.074  57.521 -18.115 1.00 124.96 ? 543 TYR C CA    1 
ATOM   7794  C  C     . TYR C 2 164 ? -6.747  58.970 -17.733 1.00 126.99 ? 543 TYR C C     1 
ATOM   7795  O  O     . TYR C 2 164 ? -5.672  59.475 -18.042 1.00 132.90 ? 543 TYR C O     1 
ATOM   7796  C  CB    . TYR C 2 164 ? -6.387  56.580 -17.126 1.00 121.42 ? 543 TYR C CB    1 
ATOM   7797  C  CG    . TYR C 2 164 ? -6.738  55.131 -17.300 1.00 116.86 ? 543 TYR C CG    1 
ATOM   7798  C  CD1   . TYR C 2 164 ? -8.034  54.702 -17.158 1.00 120.06 ? 543 TYR C CD1   1 
ATOM   7799  C  CD2   . TYR C 2 164 ? -5.770  54.195 -17.591 1.00 130.80 ? 543 TYR C CD2   1 
ATOM   7800  C  CE1   . TYR C 2 164 ? -8.367  53.376 -17.315 1.00 137.67 ? 543 TYR C CE1   1 
ATOM   7801  C  CE2   . TYR C 2 164 ? -6.093  52.859 -17.745 1.00 145.80 ? 543 TYR C CE2   1 
ATOM   7802  C  CZ    . TYR C 2 164 ? -7.398  52.454 -17.604 1.00 145.00 ? 543 TYR C CZ    1 
ATOM   7803  O  OH    . TYR C 2 164 ? -7.749  51.128 -17.760 1.00 144.12 ? 543 TYR C OH    1 
ATOM   7804  N  N     . LYS C 2 165 ? -7.681  59.638 -17.065 1.00 118.47 ? 544 LYS C N     1 
ATOM   7805  C  CA    . LYS C 2 165 ? -7.388  60.918 -16.430 1.00 122.01 ? 544 LYS C CA    1 
ATOM   7806  C  C     . LYS C 2 165 ? -7.759  60.865 -14.954 1.00 119.15 ? 544 LYS C C     1 
ATOM   7807  O  O     . LYS C 2 165 ? -8.883  60.510 -14.597 1.00 116.52 ? 544 LYS C O     1 
ATOM   7808  C  CB    . LYS C 2 165 ? -8.107  62.084 -17.120 1.00 127.79 ? 544 LYS C CB    1 
ATOM   7809  C  CG    . LYS C 2 165 ? -7.626  63.451 -16.623 1.00 143.93 ? 544 LYS C CG    1 
ATOM   7810  C  CD    . LYS C 2 165 ? -8.433  64.617 -17.179 1.00 145.78 ? 544 LYS C CD    1 
ATOM   7811  C  CE    . LYS C 2 165 ? -9.504  65.047 -16.212 1.00 147.20 ? 544 LYS C CE    1 
ATOM   7812  N  NZ    . LYS C 2 165 ? -10.388 63.896 -15.889 1.00 155.11 ? 544 LYS C NZ    1 
ATOM   7813  N  N     . MET C 2 166 ? -6.814  61.248 -14.102 1.00 124.61 ? 545 MET C N     1 
ATOM   7814  C  CA    . MET C 2 166 ? -6.999  61.141 -12.662 1.00 135.07 ? 545 MET C CA    1 
ATOM   7815  C  C     . MET C 2 166 ? -7.000  62.539 -12.065 1.00 143.79 ? 545 MET C C     1 
ATOM   7816  O  O     . MET C 2 166 ? -6.241  63.399 -12.507 1.00 145.50 ? 545 MET C O     1 
ATOM   7817  C  CB    . MET C 2 166 ? -5.887  60.287 -12.055 1.00 129.81 ? 545 MET C CB    1 
ATOM   7818  C  CG    . MET C 2 166 ? -6.288  59.532 -10.806 1.00 129.02 ? 545 MET C CG    1 
ATOM   7819  S  SD    . MET C 2 166 ? -5.238  58.077 -10.600 1.00 166.69 ? 545 MET C SD    1 
ATOM   7820  C  CE    . MET C 2 166 ? -6.109  57.196 -9.296  1.00 181.06 ? 545 MET C CE    1 
ATOM   7821  N  N     . SER C 2 167 ? -7.880  62.786 -11.099 1.00 141.07 ? 546 SER C N     1 
ATOM   7822  C  CA    . SER C 2 167 ? -8.009  64.129 -10.542 1.00 146.38 ? 546 SER C CA    1 
ATOM   7823  C  C     . SER C 2 167 ? -8.235  64.133 -9.034  1.00 143.08 ? 546 SER C C     1 
ATOM   7824  O  O     . SER C 2 167 ? -8.993  63.312 -8.532  1.00 145.86 ? 546 SER C O     1 
ATOM   7825  C  CB    . SER C 2 167 ? -9.129  64.894 -11.249 1.00 153.38 ? 546 SER C CB    1 
ATOM   7826  O  OG    . SER C 2 167 ? -10.329 64.148 -11.265 1.00 163.62 ? 546 SER C OG    1 
ATOM   7827  N  N     . LYS C 2 168 ? -7.578  65.064 -8.330  1.00 154.11 ? 547 LYS C N     1 
ATOM   7828  C  CA    . LYS C 2 168 ? -7.687  65.209 -6.866  1.00 153.74 ? 547 LYS C CA    1 
ATOM   7829  C  C     . LYS C 2 168 ? -8.076  66.627 -6.416  1.00 152.73 ? 547 LYS C C     1 
ATOM   7830  O  O     . LYS C 2 168 ? -9.078  67.200 -6.862  1.00 146.01 ? 547 LYS C O     1 
ATOM   7831  C  CB    . LYS C 2 168 ? -6.375  64.795 -6.168  1.00 137.85 ? 547 LYS C CB    1 
ATOM   7832  N  N     . LYS C 2 172 ? -11.599 75.062 -7.164  1.00 198.75 ? 551 LYS C N     1 
ATOM   7833  C  CA    . LYS C 2 172 ? -10.624 76.013 -7.689  1.00 211.87 ? 551 LYS C CA    1 
ATOM   7834  C  C     . LYS C 2 172 ? -9.228  75.401 -7.720  1.00 216.08 ? 551 LYS C C     1 
ATOM   7835  O  O     . LYS C 2 172 ? -8.431  75.685 -8.618  1.00 203.61 ? 551 LYS C O     1 
ATOM   7836  C  CB    . LYS C 2 172 ? -10.627 77.290 -6.845  1.00 214.70 ? 551 LYS C CB    1 
ATOM   7837  N  N     . LYS C 2 173 ? -8.939  74.566 -6.725  1.00 222.83 ? 552 LYS C N     1 
ATOM   7838  C  CA    . LYS C 2 173 ? -7.682  73.832 -6.679  1.00 218.30 ? 552 LYS C CA    1 
ATOM   7839  C  C     . LYS C 2 173 ? -7.917  72.394 -7.121  1.00 209.49 ? 552 LYS C C     1 
ATOM   7840  O  O     . LYS C 2 173 ? -8.589  71.625 -6.433  1.00 208.20 ? 552 LYS C O     1 
ATOM   7841  C  CB    . LYS C 2 173 ? -7.093  73.859 -5.268  1.00 215.20 ? 552 LYS C CB    1 
ATOM   7842  N  N     . GLU C 2 174 ? -7.365  72.043 -8.278  1.00 196.61 ? 553 GLU C N     1 
ATOM   7843  C  CA    . GLU C 2 174 ? -7.494  70.700 -8.826  1.00 192.80 ? 553 GLU C CA    1 
ATOM   7844  C  C     . GLU C 2 174 ? -6.151  70.235 -9.354  1.00 206.51 ? 553 GLU C C     1 
ATOM   7845  O  O     . GLU C 2 174 ? -5.441  70.993 -10.007 1.00 219.46 ? 553 GLU C O     1 
ATOM   7846  C  CB    . GLU C 2 174 ? -8.493  70.689 -9.984  1.00 178.19 ? 553 GLU C CB    1 
ATOM   7847  N  N     . GLU C 2 175 ? -5.808  68.984 -9.084  1.00 209.33 ? 554 GLU C N     1 
ATOM   7848  C  CA    . GLU C 2 175 ? -4.595  68.399 -9.640  1.00 210.21 ? 554 GLU C CA    1 
ATOM   7849  C  C     . GLU C 2 175 ? -4.991  67.265 -10.578 1.00 199.27 ? 554 GLU C C     1 
ATOM   7850  O  O     . GLU C 2 175 ? -5.782  66.397 -10.223 1.00 206.52 ? 554 GLU C O     1 
ATOM   7851  C  CB    . GLU C 2 175 ? -3.645  67.913 -8.540  1.00 214.58 ? 554 GLU C CB    1 
ATOM   7852  N  N     . VAL C 2 176 ? -4.458  67.297 -11.791 1.00 176.60 ? 555 VAL C N     1 
ATOM   7853  C  CA    . VAL C 2 176 ? -4.886  66.381 -12.834 1.00 152.54 ? 555 VAL C CA    1 
ATOM   7854  C  C     . VAL C 2 176 ? -3.715  65.814 -13.641 1.00 157.26 ? 555 VAL C C     1 
ATOM   7855  O  O     . VAL C 2 176 ? -2.857  66.545 -14.147 1.00 161.20 ? 555 VAL C O     1 
ATOM   7856  C  CB    . VAL C 2 176 ? -5.887  67.093 -13.768 1.00 139.41 ? 555 VAL C CB    1 
ATOM   7857  C  CG1   . VAL C 2 176 ? -6.080  66.323 -15.097 1.00 129.02 ? 555 VAL C CG1   1 
ATOM   7858  C  CG2   . VAL C 2 176 ? -7.209  67.360 -13.023 1.00 120.14 ? 555 VAL C CG2   1 
ATOM   7859  N  N     . ALA C 2 177 ? -3.698  64.497 -13.759 1.00 154.19 ? 556 ALA C N     1 
ATOM   7860  C  CA    . ALA C 2 177 ? -2.689  63.810 -14.543 1.00 149.17 ? 556 ALA C CA    1 
ATOM   7861  C  C     . ALA C 2 177 ? -3.359  62.869 -15.551 1.00 142.69 ? 556 ALA C C     1 
ATOM   7862  O  O     . ALA C 2 177 ? -4.555  62.583 -15.452 1.00 126.77 ? 556 ALA C O     1 
ATOM   7863  C  CB    . ALA C 2 177 ? -1.727  63.065 -13.627 1.00 138.38 ? 556 ALA C CB    1 
ATOM   7864  N  N     . TYR C 2 178 ? -2.587  62.424 -16.536 1.00 140.84 ? 557 TYR C N     1 
ATOM   7865  C  CA    . TYR C 2 178 ? -3.083  61.518 -17.556 1.00 128.46 ? 557 TYR C CA    1 
ATOM   7866  C  C     . TYR C 2 178 ? -2.225  60.258 -17.648 1.00 131.97 ? 557 TYR C C     1 
ATOM   7867  O  O     . TYR C 2 178 ? -1.007  60.305 -17.487 1.00 138.61 ? 557 TYR C O     1 
ATOM   7868  C  CB    . TYR C 2 178 ? -3.085  62.221 -18.901 1.00 124.60 ? 557 TYR C CB    1 
ATOM   7869  C  CG    . TYR C 2 178 ? -4.106  63.320 -19.034 1.00 132.33 ? 557 TYR C CG    1 
ATOM   7870  C  CD1   . TYR C 2 178 ? -3.805  64.626 -18.677 1.00 139.36 ? 557 TYR C CD1   1 
ATOM   7871  C  CD2   . TYR C 2 178 ? -5.365  63.057 -19.549 1.00 140.88 ? 557 TYR C CD2   1 
ATOM   7872  C  CE1   . TYR C 2 178 ? -4.737  65.642 -18.825 1.00 143.37 ? 557 TYR C CE1   1 
ATOM   7873  C  CE2   . TYR C 2 178 ? -6.303  64.061 -19.697 1.00 143.09 ? 557 TYR C CE2   1 
ATOM   7874  C  CZ    . TYR C 2 178 ? -5.986  65.352 -19.333 1.00 144.46 ? 557 TYR C CZ    1 
ATOM   7875  O  OH    . TYR C 2 178 ? -6.930  66.344 -19.479 1.00 144.98 ? 557 TYR C OH    1 
ATOM   7876  N  N     . ALA C 2 179 ? -2.873  59.135 -17.921 1.00 120.04 ? 558 ALA C N     1 
ATOM   7877  C  CA    . ALA C 2 179 ? -2.193  57.862 -18.098 1.00 129.06 ? 558 ALA C CA    1 
ATOM   7878  C  C     . ALA C 2 179 ? -2.521  57.298 -19.475 1.00 127.54 ? 558 ALA C C     1 
ATOM   7879  O  O     . ALA C 2 179 ? -3.544  57.645 -20.067 1.00 126.11 ? 558 ALA C O     1 
ATOM   7880  C  CB    . ALA C 2 179 ? -2.642  56.893 -17.027 1.00 141.05 ? 558 ALA C CB    1 
ATOM   7881  N  N     . TRP C 2 180 ? -1.660  56.428 -19.992 1.00 134.51 ? 559 TRP C N     1 
ATOM   7882  C  CA    . TRP C 2 180 ? -1.886  55.870 -21.327 1.00 147.40 ? 559 TRP C CA    1 
ATOM   7883  C  C     . TRP C 2 180 ? -2.037  54.351 -21.337 1.00 159.69 ? 559 TRP C C     1 
ATOM   7884  O  O     . TRP C 2 180 ? -2.500  53.775 -22.327 1.00 149.74 ? 559 TRP C O     1 
ATOM   7885  C  CB    . TRP C 2 180 ? -0.774  56.301 -22.289 1.00 149.26 ? 559 TRP C CB    1 
ATOM   7886  C  CG    . TRP C 2 180 ? -1.003  57.636 -22.888 1.00 139.90 ? 559 TRP C CG    1 
ATOM   7887  C  CD1   . TRP C 2 180 ? -1.423  57.895 -24.146 1.00 134.23 ? 559 TRP C CD1   1 
ATOM   7888  C  CD2   . TRP C 2 180 ? -0.840  58.903 -22.247 1.00 148.42 ? 559 TRP C CD2   1 
ATOM   7889  N  NE1   . TRP C 2 180 ? -1.533  59.246 -24.339 1.00 138.20 ? 559 TRP C NE1   1 
ATOM   7890  C  CE2   . TRP C 2 180 ? -1.180  59.888 -23.185 1.00 146.99 ? 559 TRP C CE2   1 
ATOM   7891  C  CE3   . TRP C 2 180 ? -0.447  59.298 -20.970 1.00 158.72 ? 559 TRP C CE3   1 
ATOM   7892  C  CZ2   . TRP C 2 180 ? -1.134  61.250 -22.889 1.00 150.66 ? 559 TRP C CZ2   1 
ATOM   7893  C  CZ3   . TRP C 2 180 ? -0.406  60.651 -20.676 1.00 155.86 ? 559 TRP C CZ3   1 
ATOM   7894  C  CH2   . TRP C 2 180 ? -0.746  61.608 -21.632 1.00 150.71 ? 559 TRP C CH2   1 
ATOM   7895  N  N     . THR C 2 181 ? -1.642  53.712 -20.236 1.00 172.49 ? 560 THR C N     1 
ATOM   7896  C  CA    . THR C 2 181 ? -1.790  52.267 -20.084 1.00 165.11 ? 560 THR C CA    1 
ATOM   7897  C  C     . THR C 2 181 ? -1.472  51.802 -18.669 1.00 177.77 ? 560 THR C C     1 
ATOM   7898  O  O     . THR C 2 181 ? -0.437  52.152 -18.102 1.00 184.44 ? 560 THR C O     1 
ATOM   7899  C  CB    . THR C 2 181 ? -0.925  51.472 -21.090 1.00 151.48 ? 560 THR C CB    1 
ATOM   7900  N  N     . ASP C 2 182 ? -2.395  51.022 -18.118 1.00 183.89 ? 561 ASP C N     1 
ATOM   7901  C  CA    . ASP C 2 182 ? -2.216  50.257 -16.879 1.00 192.58 ? 561 ASP C CA    1 
ATOM   7902  C  C     . ASP C 2 182 ? -1.050  50.659 -15.973 1.00 189.13 ? 561 ASP C C     1 
ATOM   7903  O  O     . ASP C 2 182 ? -1.263  51.195 -14.885 1.00 190.84 ? 561 ASP C O     1 
ATOM   7904  C  CB    . ASP C 2 182 ? -2.137  48.770 -17.228 1.00 204.78 ? 561 ASP C CB    1 
ATOM   7905  C  CG    . ASP C 2 182 ? -2.935  48.430 -18.479 1.00 216.19 ? 561 ASP C CG    1 
ATOM   7906  O  OD1   . ASP C 2 182 ? -4.101  48.876 -18.592 1.00 212.39 ? 561 ASP C OD1   1 
ATOM   7907  O  OD2   . ASP C 2 182 ? -2.389  47.732 -19.360 1.00 225.96 ? 561 ASP C OD2   1 
ATOM   7908  N  N     . GLY C 2 183 ? 0.173   50.368 -16.403 1.00 184.09 ? 562 GLY C N     1 
ATOM   7909  C  CA    . GLY C 2 183 ? 1.342   50.692 -15.604 1.00 194.57 ? 562 GLY C CA    1 
ATOM   7910  C  C     . GLY C 2 183 ? 1.355   52.146 -15.163 1.00 197.61 ? 562 GLY C C     1 
ATOM   7911  O  O     . GLY C 2 183 ? 1.552   52.455 -13.982 1.00 189.00 ? 562 GLY C O     1 
ATOM   7912  N  N     . GLU C 2 184 ? 1.149   53.040 -16.127 1.00 203.96 ? 563 GLU C N     1 
ATOM   7913  C  CA    . GLU C 2 184 ? 1.102   54.474 -15.864 1.00 198.08 ? 563 GLU C CA    1 
ATOM   7914  C  C     . GLU C 2 184 ? 0.071   54.768 -14.779 1.00 185.09 ? 563 GLU C C     1 
ATOM   7915  O  O     . GLU C 2 184 ? 0.275   55.631 -13.917 1.00 179.11 ? 563 GLU C O     1 
ATOM   7916  C  CB    . GLU C 2 184 ? 0.786   55.237 -17.160 1.00 192.38 ? 563 GLU C CB    1 
ATOM   7917  N  N     . LEU C 2 185 ? -1.035  54.032 -14.832 1.00 179.66 ? 564 LEU C N     1 
ATOM   7918  C  CA    . LEU C 2 185 ? -2.121  54.183 -13.873 1.00 166.92 ? 564 LEU C CA    1 
ATOM   7919  C  C     . LEU C 2 185 ? -1.652  53.969 -12.442 1.00 158.12 ? 564 LEU C C     1 
ATOM   7920  O  O     . LEU C 2 185 ? -1.938  54.791 -11.579 1.00 155.63 ? 564 LEU C O     1 
ATOM   7921  C  CB    . LEU C 2 185 ? -3.263  53.210 -14.188 1.00 153.47 ? 564 LEU C CB    1 
ATOM   7922  C  CG    . LEU C 2 185 ? -4.623  53.573 -13.592 1.00 132.92 ? 564 LEU C CG    1 
ATOM   7923  C  CD1   . LEU C 2 185 ? -4.679  55.060 -13.259 1.00 119.32 ? 564 LEU C CD1   1 
ATOM   7924  C  CD2   . LEU C 2 185 ? -5.766  53.180 -14.529 1.00 121.51 ? 564 LEU C CD2   1 
ATOM   7925  N  N     . GLU C 2 186 ? -0.932  52.875 -12.194 1.00 155.91 ? 565 GLU C N     1 
ATOM   7926  C  CA    . GLU C 2 186 ? -0.453  52.567 -10.844 1.00 169.79 ? 565 GLU C CA    1 
ATOM   7927  C  C     . GLU C 2 186 ? 0.357   53.721 -10.241 1.00 186.71 ? 565 GLU C C     1 
ATOM   7928  O  O     . GLU C 2 186 ? 0.111   54.130 -9.098  1.00 182.10 ? 565 GLU C O     1 
ATOM   7929  C  CB    . GLU C 2 186 ? 0.354   51.260 -10.819 1.00 159.49 ? 565 GLU C CB    1 
ATOM   7930  N  N     . GLU C 2 187 ? 1.316   54.235 -11.015 1.00 199.94 ? 566 GLU C N     1 
ATOM   7931  C  CA    . GLU C 2 187 ? 2.152   55.365 -10.596 1.00 202.63 ? 566 GLU C CA    1 
ATOM   7932  C  C     . GLU C 2 187 ? 1.321   56.622 -10.325 1.00 198.31 ? 566 GLU C C     1 
ATOM   7933  O  O     . GLU C 2 187 ? 1.543   57.323 -9.330  1.00 192.49 ? 566 GLU C O     1 
ATOM   7934  C  CB    . GLU C 2 187 ? 3.252   55.652 -11.626 1.00 196.02 ? 566 GLU C CB    1 
ATOM   7935  N  N     . LEU C 2 188 ? 0.376   56.907 -11.222 1.00 192.02 ? 567 LEU C N     1 
ATOM   7936  C  CA    . LEU C 2 188 ? -0.554  58.023 -11.044 1.00 177.72 ? 567 LEU C CA    1 
ATOM   7937  C  C     . LEU C 2 188 ? -1.355  57.882 -9.736  1.00 187.93 ? 567 LEU C C     1 
ATOM   7938  O  O     . LEU C 2 188 ? -1.497  58.846 -8.970  1.00 187.38 ? 567 LEU C O     1 
ATOM   7939  C  CB    . LEU C 2 188 ? -1.472  58.166 -12.271 1.00 139.64 ? 567 LEU C CB    1 
ATOM   7940  N  N     . ARG C 2 189 ? -1.863  56.673 -9.489  1.00 186.14 ? 568 ARG C N     1 
ATOM   7941  C  CA    . ARG C 2 189 ? -2.602  56.348 -8.265  1.00 170.44 ? 568 ARG C CA    1 
ATOM   7942  C  C     . ARG C 2 189 ? -1.758  56.579 -7.013  1.00 179.20 ? 568 ARG C C     1 
ATOM   7943  O  O     . ARG C 2 189 ? -2.241  57.136 -6.027  1.00 176.29 ? 568 ARG C O     1 
ATOM   7944  C  CB    . ARG C 2 189 ? -3.115  54.899 -8.294  1.00 146.79 ? 568 ARG C CB    1 
ATOM   7945  N  N     . LYS C 2 190 ? -0.501  56.142 -7.051  1.00 188.30 ? 569 LYS C N     1 
ATOM   7946  C  CA    . LYS C 2 190 ? 0.418   56.382 -5.940  1.00 192.98 ? 569 LYS C CA    1 
ATOM   7947  C  C     . LYS C 2 190 ? 0.552   57.880 -5.666  1.00 201.65 ? 569 LYS C C     1 
ATOM   7948  O  O     . LYS C 2 190 ? 0.458   58.322 -4.518  1.00 196.81 ? 569 LYS C O     1 
ATOM   7949  C  CB    . LYS C 2 190 ? 1.791   55.753 -6.211  1.00 184.05 ? 569 LYS C CB    1 
ATOM   7950  N  N     . GLN C 2 191 ? 0.759   58.658 -6.729  1.00 208.98 ? 570 GLN C N     1 
ATOM   7951  C  CA    . GLN C 2 191 ? 0.913   60.107 -6.604  1.00 210.20 ? 570 GLN C CA    1 
ATOM   7952  C  C     . GLN C 2 191 ? -0.303  60.768 -5.942  1.00 209.45 ? 570 GLN C C     1 
ATOM   7953  O  O     . GLN C 2 191 ? -0.199  61.359 -4.865  1.00 214.45 ? 570 GLN C O     1 
ATOM   7954  C  CB    . GLN C 2 191 ? 1.187   60.734 -7.977  1.00 196.96 ? 570 GLN C CB    1 
ATOM   7955  N  N     . PHE C 2 192 ? -1.457  60.650 -6.585  1.00 192.64 ? 571 PHE C N     1 
ATOM   7956  C  CA    . PHE C 2 192 ? -2.680  61.276 -6.095  1.00 183.09 ? 571 PHE C CA    1 
ATOM   7957  C  C     . PHE C 2 192 ? -3.144  60.829 -4.704  1.00 196.70 ? 571 PHE C C     1 
ATOM   7958  O  O     . PHE C 2 192 ? -4.060  61.429 -4.131  1.00 193.65 ? 571 PHE C O     1 
ATOM   7959  C  CB    . PHE C 2 192 ? -3.793  61.031 -7.081  1.00 166.00 ? 571 PHE C CB    1 
ATOM   7960  C  CG    . PHE C 2 192 ? -3.725  61.903 -8.271  1.00 168.08 ? 571 PHE C CG    1 
ATOM   7961  C  CD1   . PHE C 2 192 ? -2.759  61.695 -9.238  1.00 174.79 ? 571 PHE C CD1   1 
ATOM   7962  C  CD2   . PHE C 2 192 ? -4.633  62.938 -8.433  1.00 168.43 ? 571 PHE C CD2   1 
ATOM   7963  C  CE1   . PHE C 2 192 ? -2.700  62.503 -10.359 1.00 182.85 ? 571 PHE C CE1   1 
ATOM   7964  C  CE2   . PHE C 2 192 ? -4.584  63.750 -9.548  1.00 174.84 ? 571 PHE C CE2   1 
ATOM   7965  C  CZ    . PHE C 2 192 ? -3.615  63.536 -10.516 1.00 182.14 ? 571 PHE C CZ    1 
ATOM   7966  N  N     . GLY C 2 193 ? -2.489  59.808 -4.157  1.00 207.89 ? 572 GLY C N     1 
ATOM   7967  C  CA    . GLY C 2 193 ? -3.043  58.994 -3.085  1.00 208.11 ? 572 GLY C CA    1 
ATOM   7968  C  C     . GLY C 2 193 ? -4.543  59.114 -2.871  1.00 199.84 ? 572 GLY C C     1 
ATOM   7969  O  O     . GLY C 2 193 ? -5.306  59.191 -3.835  1.00 199.43 ? 572 GLY C O     1 
ATOM   7970  N  N     . LYS C 2 194 ? -4.976  59.102 -1.614  1.00 193.82 ? 573 LYS C N     1 
ATOM   7971  C  CA    . LYS C 2 194 ? -6.407  59.074 -1.302  1.00 184.80 ? 573 LYS C CA    1 
ATOM   7972  C  C     . LYS C 2 194 ? -7.216  60.133 -2.066  1.00 182.35 ? 573 LYS C C     1 
ATOM   7973  O  O     . LYS C 2 194 ? -6.661  61.100 -2.596  1.00 187.84 ? 573 LYS C O     1 
ATOM   7974  C  CB    . LYS C 2 194 ? -6.639  59.201 0.211   1.00 174.84 ? 573 LYS C CB    1 
ATOM   7975  N  N     . GLY C 2 195 ? -8.528  59.926 -2.139  1.00 173.06 ? 574 GLY C N     1 
ATOM   7976  C  CA    . GLY C 2 195 ? -9.442  60.942 -2.633  1.00 170.87 ? 574 GLY C CA    1 
ATOM   7977  C  C     . GLY C 2 195 ? -9.649  61.006 -4.135  1.00 176.64 ? 574 GLY C C     1 
ATOM   7978  O  O     . GLY C 2 195 ? -10.723 61.386 -4.604  1.00 180.36 ? 574 GLY C O     1 
ATOM   7979  N  N     . ALA C 2 196 ? -8.626  60.635 -4.895  1.00 178.12 ? 575 ALA C N     1 
ATOM   7980  C  CA    . ALA C 2 196 ? -8.656  60.791 -6.349  1.00 178.32 ? 575 ALA C CA    1 
ATOM   7981  C  C     . ALA C 2 196 ? -9.812  60.077 -7.055  1.00 159.63 ? 575 ALA C C     1 
ATOM   7982  O  O     . ALA C 2 196 ? -10.152 58.946 -6.728  1.00 161.93 ? 575 ALA C O     1 
ATOM   7983  C  CB    . ALA C 2 196 ? -7.336  60.335 -6.943  1.00 193.29 ? 575 ALA C CB    1 
ATOM   7984  N  N     . THR C 2 197 ? -10.411 60.748 -8.031  1.00 151.51 ? 576 THR C N     1 
ATOM   7985  C  CA    . THR C 2 197 ? -11.311 60.072 -8.961  1.00 156.10 ? 576 THR C CA    1 
ATOM   7986  C  C     . THR C 2 197 ? -10.590 59.805 -10.285 1.00 155.01 ? 576 THR C C     1 
ATOM   7987  O  O     . THR C 2 197 ? -9.766  60.602 -10.741 1.00 153.28 ? 576 THR C O     1 
ATOM   7988  C  CB    . THR C 2 197 ? -12.649 60.845 -9.207  1.00 156.51 ? 576 THR C CB    1 
ATOM   7989  O  OG1   . THR C 2 197 ? -12.381 62.222 -9.487  1.00 150.93 ? 576 THR C OG1   1 
ATOM   7990  C  CG2   . THR C 2 197 ? -13.585 60.743 -7.992  1.00 154.60 ? 576 THR C CG2   1 
ATOM   7991  N  N     . LEU C 2 198 ? -10.894 58.662 -10.885 1.00 143.31 ? 577 LEU C N     1 
ATOM   7992  C  CA    . LEU C 2 198 ? -10.239 58.237 -12.109 1.00 119.48 ? 577 LEU C CA    1 
ATOM   7993  C  C     . LEU C 2 198 ? -11.290 58.065 -13.175 1.00 112.74 ? 577 LEU C C     1 
ATOM   7994  O  O     . LEU C 2 198 ? -12.354 57.491 -12.931 1.00 115.91 ? 577 LEU C O     1 
ATOM   7995  C  CB    . LEU C 2 198 ? -9.494  56.924 -11.902 1.00 117.27 ? 577 LEU C CB    1 
ATOM   7996  C  CG    . LEU C 2 198 ? -9.363  55.999 -13.108 1.00 108.76 ? 577 LEU C CG    1 
ATOM   7997  C  CD1   . LEU C 2 198 ? -8.454  56.615 -14.130 1.00 114.73 ? 577 LEU C CD1   1 
ATOM   7998  C  CD2   . LEU C 2 198 ? -8.820  54.664 -12.679 1.00 108.14 ? 577 LEU C CD2   1 
ATOM   7999  N  N     . GLN C 2 199 ? -10.984 58.571 -14.360 1.00 104.12 ? 578 GLN C N     1 
ATOM   8000  C  CA    . GLN C 2 199 ? -11.916 58.569 -15.463 1.00 102.46 ? 578 GLN C CA    1 
ATOM   8001  C  C     . GLN C 2 199 ? -11.225 57.846 -16.599 1.00 113.83 ? 578 GLN C C     1 
ATOM   8002  O  O     . GLN C 2 199 ? -10.028 58.005 -16.797 1.00 116.97 ? 578 GLN C O     1 
ATOM   8003  C  CB    . GLN C 2 199 ? -12.215 60.004 -15.854 1.00 118.41 ? 578 GLN C CB    1 
ATOM   8004  C  CG    . GLN C 2 199 ? -13.552 60.225 -16.515 1.00 144.33 ? 578 GLN C CG    1 
ATOM   8005  C  CD    . GLN C 2 199 ? -13.660 61.634 -17.067 1.00 166.61 ? 578 GLN C CD    1 
ATOM   8006  O  OE1   . GLN C 2 199 ? -12.936 62.531 -16.633 1.00 176.62 ? 578 GLN C OE1   1 
ATOM   8007  N  NE2   . GLN C 2 199 ? -14.554 61.837 -18.034 1.00 168.98 ? 578 GLN C NE2   1 
ATOM   8008  N  N     . ARG C 2 200 ? -11.963 57.018 -17.325 1.00 116.11 ? 579 ARG C N     1 
ATOM   8009  C  CA    . ARG C 2 200 ? -11.365 56.259 -18.407 1.00 108.91 ? 579 ARG C CA    1 
ATOM   8010  C  C     . ARG C 2 200 ? -12.125 56.511 -19.680 1.00 109.81 ? 579 ARG C C     1 
ATOM   8011  O  O     . ARG C 2 200 ? -13.324 56.231 -19.755 1.00 121.11 ? 579 ARG C O     1 
ATOM   8012  C  CB    . ARG C 2 200 ? -11.376 54.769 -18.112 1.00 112.05 ? 579 ARG C CB    1 
ATOM   8013  C  CG    . ARG C 2 200 ? -10.861 53.950 -19.269 1.00 115.02 ? 579 ARG C CG    1 
ATOM   8014  C  CD    . ARG C 2 200 ? -11.292 52.525 -19.130 1.00 118.89 ? 579 ARG C CD    1 
ATOM   8015  N  NE    . ARG C 2 200 ? -11.908 52.056 -20.360 1.00 123.46 ? 579 ARG C NE    1 
ATOM   8016  C  CZ    . ARG C 2 200 ? -11.428 51.051 -21.076 1.00 118.41 ? 579 ARG C CZ    1 
ATOM   8017  N  NH1   . ARG C 2 200 ? -10.333 50.424 -20.636 1.00 109.19 ? 579 ARG C NH1   1 
ATOM   8018  N  NH2   . ARG C 2 200 ? -12.051 50.672 -22.205 1.00 94.92  ? 579 ARG C NH2   1 
ATOM   8019  N  N     . TYR C 2 201 ? -11.421 57.041 -20.679 1.00 108.09 ? 580 TYR C N     1 
ATOM   8020  C  CA    . TYR C 2 201 ? -12.037 57.384 -21.948 1.00 96.02  ? 580 TYR C CA    1 
ATOM   8021  C  C     . TYR C 2 201 ? -12.149 56.122 -22.760 1.00 112.55 ? 580 TYR C C     1 
ATOM   8022  O  O     . TYR C 2 201 ? -11.229 55.729 -23.470 1.00 124.90 ? 580 TYR C O     1 
ATOM   8023  C  CB    . TYR C 2 201 ? -11.266 58.489 -22.687 1.00 99.64  ? 580 TYR C CB    1 
ATOM   8024  C  CG    . TYR C 2 201 ? -11.061 59.710 -21.832 1.00 108.92 ? 580 TYR C CG    1 
ATOM   8025  C  CD1   . TYR C 2 201 ? -12.119 60.247 -21.119 1.00 116.44 ? 580 TYR C CD1   1 
ATOM   8026  C  CD2   . TYR C 2 201 ? -9.816  60.303 -21.705 1.00 126.19 ? 580 TYR C CD2   1 
ATOM   8027  C  CE1   . TYR C 2 201 ? -11.958 61.337 -20.305 1.00 128.38 ? 580 TYR C CE1   1 
ATOM   8028  C  CE2   . TYR C 2 201 ? -9.641  61.407 -20.894 1.00 143.79 ? 580 TYR C CE2   1 
ATOM   8029  C  CZ    . TYR C 2 201 ? -10.725 61.922 -20.193 1.00 143.34 ? 580 TYR C CZ    1 
ATOM   8030  O  OH    . TYR C 2 201 ? -10.593 63.026 -19.374 1.00 148.87 ? 580 TYR C OH    1 
ATOM   8031  N  N     . LYS C 2 202 ? -13.290 55.468 -22.611 1.00 129.47 ? 581 LYS C N     1 
ATOM   8032  C  CA    . LYS C 2 202 ? -13.548 54.227 -23.303 1.00 145.11 ? 581 LYS C CA    1 
ATOM   8033  C  C     . LYS C 2 202 ? -14.095 54.601 -24.655 1.00 123.37 ? 581 LYS C C     1 
ATOM   8034  O  O     . LYS C 2 202 ? -15.233 54.276 -24.971 1.00 139.73 ? 581 LYS C O     1 
ATOM   8035  C  CB    . LYS C 2 202 ? -14.574 53.398 -22.523 1.00 161.07 ? 581 LYS C CB    1 
ATOM   8036  N  N     . GLY C 2 203 ? -13.282 55.298 -25.440 1.00 97.89  ? 582 GLY C N     1 
ATOM   8037  C  CA    . GLY C 2 203 ? -13.753 55.909 -26.674 1.00 121.16 ? 582 GLY C CA    1 
ATOM   8038  C  C     . GLY C 2 203 ? -13.535 57.415 -26.700 1.00 123.67 ? 582 GLY C C     1 
ATOM   8039  O  O     . GLY C 2 203 ? -13.653 58.082 -25.679 1.00 123.41 ? 582 GLY C O     1 
ATOM   8040  N  N     . LEU C 2 204 ? -13.229 57.958 -27.874 1.00 123.30 ? 583 LEU C N     1 
ATOM   8041  C  CA    . LEU C 2 204 ? -12.782 59.348 -27.976 1.00 116.80 ? 583 LEU C CA    1 
ATOM   8042  C  C     . LEU C 2 204 ? -13.902 60.372 -27.737 1.00 121.22 ? 583 LEU C C     1 
ATOM   8043  O  O     . LEU C 2 204 ? -13.679 61.418 -27.114 1.00 116.85 ? 583 LEU C O     1 
ATOM   8044  C  CB    . LEU C 2 204 ? -12.109 59.586 -29.327 1.00 99.68  ? 583 LEU C CB    1 
ATOM   8045  C  CG    . LEU C 2 204 ? -10.806 60.358 -29.276 1.00 101.68 ? 583 LEU C CG    1 
ATOM   8046  C  CD1   . LEU C 2 204 ? -9.989  60.117 -30.529 1.00 103.38 ? 583 LEU C CD1   1 
ATOM   8047  C  CD2   . LEU C 2 204 ? -11.139 61.800 -29.132 1.00 114.31 ? 583 LEU C CD2   1 
ATOM   8048  N  N     . GLY C 2 205 ? -15.105 60.065 -28.216 1.00 115.79 ? 584 GLY C N     1 
ATOM   8049  C  CA    . GLY C 2 205 ? -16.250 60.930 -27.985 1.00 122.64 ? 584 GLY C CA    1 
ATOM   8050  C  C     . GLY C 2 205 ? -16.598 61.128 -26.510 1.00 126.91 ? 584 GLY C C     1 
ATOM   8051  O  O     . GLY C 2 205 ? -17.589 61.788 -26.171 1.00 114.76 ? 584 GLY C O     1 
ATOM   8052  N  N     . GLU C 2 206 ? -15.787 60.556 -25.624 1.00 118.12 ? 585 GLU C N     1 
ATOM   8053  C  CA    . GLU C 2 206 ? -16.087 60.607 -24.207 1.00 110.51 ? 585 GLU C CA    1 
ATOM   8054  C  C     . GLU C 2 206 ? -15.311 61.717 -23.522 1.00 120.77 ? 585 GLU C C     1 
ATOM   8055  O  O     . GLU C 2 206 ? -15.640 62.091 -22.399 1.00 143.85 ? 585 GLU C O     1 
ATOM   8056  C  CB    . GLU C 2 206 ? -15.865 59.250 -23.526 1.00 128.52 ? 585 GLU C CB    1 
ATOM   8057  C  CG    . GLU C 2 206 ? -16.248 59.197 -22.027 1.00 143.90 ? 585 GLU C CG    1 
ATOM   8058  C  CD    . GLU C 2 206 ? -16.189 57.779 -21.440 1.00 158.57 ? 585 GLU C CD    1 
ATOM   8059  O  OE1   . GLU C 2 206 ? -16.238 57.626 -20.196 1.00 163.90 ? 585 GLU C OE1   1 
ATOM   8060  O  OE2   . GLU C 2 206 ? -16.093 56.811 -22.227 1.00 156.93 ? 585 GLU C OE2   1 
ATOM   8061  N  N     . MET C 2 207 ? -14.288 62.256 -24.181 1.00 107.45 ? 586 MET C N     1 
ATOM   8062  C  CA    . MET C 2 207 ? -13.607 63.429 -23.617 1.00 119.91 ? 586 MET C CA    1 
ATOM   8063  C  C     . MET C 2 207 ? -14.053 64.688 -24.326 1.00 123.26 ? 586 MET C C     1 
ATOM   8064  O  O     . MET C 2 207 ? -14.594 64.608 -25.430 1.00 116.74 ? 586 MET C O     1 
ATOM   8065  C  CB    . MET C 2 207 ? -12.088 63.308 -23.671 1.00 119.31 ? 586 MET C CB    1 
ATOM   8066  C  CG    . MET C 2 207 ? -11.536 63.053 -25.033 1.00 114.46 ? 586 MET C CG    1 
ATOM   8067  S  SD    . MET C 2 207 ? -9.821  62.572 -24.860 1.00 134.60 ? 586 MET C SD    1 
ATOM   8068  C  CE    . MET C 2 207 ? -9.763  61.148 -25.957 1.00 142.07 ? 586 MET C CE    1 
ATOM   8069  N  N     . ASN C 2 208 ? -13.836 65.845 -23.699 1.00 134.48 ? 587 ASN C N     1 
ATOM   8070  C  CA    . ASN C 2 208 ? -14.357 67.086 -24.261 1.00 141.35 ? 587 ASN C CA    1 
ATOM   8071  C  C     . ASN C 2 208 ? -13.428 67.706 -25.290 1.00 138.87 ? 587 ASN C C     1 
ATOM   8072  O  O     . ASN C 2 208 ? -12.354 67.180 -25.564 1.00 136.84 ? 587 ASN C O     1 
ATOM   8073  C  CB    . ASN C 2 208 ? -14.585 68.108 -23.141 1.00 145.43 ? 587 ASN C CB    1 
ATOM   8074  C  CG    . ASN C 2 208 ? -15.892 67.891 -22.400 1.00 144.78 ? 587 ASN C CG    1 
ATOM   8075  O  OD1   . ASN C 2 208 ? -16.979 68.036 -22.967 1.00 146.13 ? 587 ASN C OD1   1 
ATOM   8076  N  ND2   . ASN C 2 208 ? -15.793 67.565 -21.118 1.00 138.16 ? 587 ASN C ND2   1 
ATOM   8077  N  N     . ALA C 2 209 ? -13.805 68.880 -25.782 1.00 138.75 ? 588 ALA C N     1 
ATOM   8078  C  CA    . ALA C 2 209 ? -13.098 69.504 -26.891 1.00 138.58 ? 588 ALA C CA    1 
ATOM   8079  C  C     . ALA C 2 209 ? -11.756 70.013 -26.419 1.00 138.14 ? 588 ALA C C     1 
ATOM   8080  O  O     . ALA C 2 209 ? -10.704 69.654 -26.963 1.00 130.34 ? 588 ALA C O     1 
ATOM   8081  C  CB    . ALA C 2 209 ? -13.918 70.650 -27.441 1.00 149.28 ? 588 ALA C CB    1 
ATOM   8082  N  N     . ASP C 2 210 ? -11.819 70.852 -25.388 1.00 142.85 ? 589 ASP C N     1 
ATOM   8083  C  CA    . ASP C 2 210 ? -10.643 71.476 -24.813 1.00 142.74 ? 589 ASP C CA    1 
ATOM   8084  C  C     . ASP C 2 210 ? -9.613  70.402 -24.478 1.00 143.15 ? 589 ASP C C     1 
ATOM   8085  O  O     . ASP C 2 210 ? -8.426  70.552 -24.778 1.00 130.19 ? 589 ASP C O     1 
ATOM   8086  C  CB    . ASP C 2 210 ? -11.046 72.272 -23.565 1.00 140.17 ? 589 ASP C CB    1 
ATOM   8087  N  N     . GLN C 2 211 ? -10.082 69.312 -23.871 1.00 145.61 ? 590 GLN C N     1 
ATOM   8088  C  CA    . GLN C 2 211 ? -9.216  68.196 -23.502 1.00 136.00 ? 590 GLN C CA    1 
ATOM   8089  C  C     . GLN C 2 211 ? -8.491  67.588 -24.706 1.00 130.02 ? 590 GLN C C     1 
ATOM   8090  O  O     . GLN C 2 211 ? -7.268  67.533 -24.724 1.00 127.53 ? 590 GLN C O     1 
ATOM   8091  C  CB    . GLN C 2 211 ? -10.014 67.119 -22.766 1.00 134.25 ? 590 GLN C CB    1 
ATOM   8092  C  CG    . GLN C 2 211 ? -10.480 67.522 -21.396 1.00 141.62 ? 590 GLN C CG    1 
ATOM   8093  C  CD    . GLN C 2 211 ? -11.412 66.501 -20.811 1.00 154.66 ? 590 GLN C CD    1 
ATOM   8094  O  OE1   . GLN C 2 211 ? -11.545 65.398 -21.342 1.00 145.82 ? 590 GLN C OE1   1 
ATOM   8095  N  NE2   . GLN C 2 211 ? -12.076 66.860 -19.715 1.00 165.95 ? 590 GLN C NE2   1 
ATOM   8096  N  N     . LEU C 2 212 ? -9.245  67.148 -25.712 1.00 127.66 ? 591 LEU C N     1 
ATOM   8097  C  CA    . LEU C 2 212 ? -8.663  66.511 -26.886 1.00 114.91 ? 591 LEU C CA    1 
ATOM   8098  C  C     . LEU C 2 212 ? -7.625  67.430 -27.486 1.00 121.26 ? 591 LEU C C     1 
ATOM   8099  O  O     . LEU C 2 212 ? -6.550  66.994 -27.904 1.00 126.46 ? 591 LEU C O     1 
ATOM   8100  C  CB    . LEU C 2 212 ? -9.728  66.244 -27.943 1.00 111.44 ? 591 LEU C CB    1 
ATOM   8101  C  CG    . LEU C 2 212 ? -9.676  64.937 -28.744 1.00 109.91 ? 591 LEU C CG    1 
ATOM   8102  C  CD1   . LEU C 2 212 ? -10.446 65.109 -30.029 1.00 109.49 ? 591 LEU C CD1   1 
ATOM   8103  C  CD2   . LEU C 2 212 ? -8.274  64.501 -29.045 1.00 113.71 ? 591 LEU C CD2   1 
ATOM   8104  N  N     . TRP C 2 213 ? -7.955  68.712 -27.548 1.00 128.58 ? 592 TRP C N     1 
ATOM   8105  C  CA    . TRP C 2 213 ? -7.013  69.679 -28.088 1.00 135.90 ? 592 TRP C CA    1 
ATOM   8106  C  C     . TRP C 2 213 ? -5.748  69.748 -27.230 1.00 132.91 ? 592 TRP C C     1 
ATOM   8107  O  O     . TRP C 2 213 ? -4.668  69.372 -27.682 1.00 124.42 ? 592 TRP C O     1 
ATOM   8108  C  CB    . TRP C 2 213 ? -7.671  71.054 -28.236 1.00 133.61 ? 592 TRP C CB    1 
ATOM   8109  C  CG    . TRP C 2 213 ? -6.720  72.115 -28.666 1.00 135.39 ? 592 TRP C CG    1 
ATOM   8110  C  CD1   . TRP C 2 213 ? -6.201  73.110 -27.894 1.00 136.54 ? 592 TRP C CD1   1 
ATOM   8111  C  CD2   . TRP C 2 213 ? -6.150  72.280 -29.964 1.00 145.72 ? 592 TRP C CD2   1 
ATOM   8112  N  NE1   . TRP C 2 213 ? -5.344  73.885 -28.630 1.00 132.28 ? 592 TRP C NE1   1 
ATOM   8113  C  CE2   . TRP C 2 213 ? -5.301  73.402 -29.909 1.00 137.68 ? 592 TRP C CE2   1 
ATOM   8114  C  CE3   . TRP C 2 213 ? -6.276  71.589 -31.172 1.00 160.48 ? 592 TRP C CE3   1 
ATOM   8115  C  CZ2   . TRP C 2 213 ? -4.584  73.853 -31.015 1.00 138.90 ? 592 TRP C CZ2   1 
ATOM   8116  C  CZ3   . TRP C 2 213 ? -5.556  72.039 -32.276 1.00 156.67 ? 592 TRP C CZ3   1 
ATOM   8117  C  CH2   . TRP C 2 213 ? -4.724  73.160 -32.185 1.00 146.38 ? 592 TRP C CH2   1 
ATOM   8118  N  N     . GLU C 2 214 ? -5.900  70.182 -25.981 1.00 136.57 ? 593 GLU C N     1 
ATOM   8119  C  CA    . GLU C 2 214 ? -4.759  70.436 -25.096 1.00 137.43 ? 593 GLU C CA    1 
ATOM   8120  C  C     . GLU C 2 214 ? -3.810  69.243 -24.994 1.00 136.07 ? 593 GLU C C     1 
ATOM   8121  O  O     . GLU C 2 214 ? -2.597  69.410 -24.914 1.00 141.22 ? 593 GLU C O     1 
ATOM   8122  C  CB    . GLU C 2 214 ? -5.214  70.883 -23.693 1.00 123.18 ? 593 GLU C CB    1 
ATOM   8123  N  N     . THR C 2 215 ? -4.369  68.042 -24.954 1.00 130.17 ? 594 THR C N     1 
ATOM   8124  C  CA    . THR C 2 215 ? -3.560  66.837 -24.834 1.00 127.25 ? 594 THR C CA    1 
ATOM   8125  C  C     . THR C 2 215 ? -2.966  66.323 -26.136 1.00 132.18 ? 594 THR C C     1 
ATOM   8126  O  O     . THR C 2 215 ? -1.761  66.100 -26.213 1.00 145.62 ? 594 THR C O     1 
ATOM   8127  C  CB    . THR C 2 215 ? -4.343  65.684 -24.225 1.00 122.53 ? 594 THR C CB    1 
ATOM   8128  O  OG1   . THR C 2 215 ? -5.399  65.308 -25.117 1.00 132.42 ? 594 THR C OG1   1 
ATOM   8129  C  CG2   . THR C 2 215 ? -4.916  66.096 -22.871 1.00 110.58 ? 594 THR C CG2   1 
ATOM   8130  N  N     . THR C 2 216 ? -3.799  66.115 -27.156 1.00 129.74 ? 595 THR C N     1 
ATOM   8131  C  CA    . THR C 2 216 ? -3.356  65.288 -28.281 1.00 136.20 ? 595 THR C CA    1 
ATOM   8132  C  C     . THR C 2 216 ? -3.431  65.854 -29.702 1.00 134.59 ? 595 THR C C     1 
ATOM   8133  O  O     . THR C 2 216 ? -3.076  65.152 -30.644 1.00 141.66 ? 595 THR C O     1 
ATOM   8134  C  CB    . THR C 2 216 ? -4.042  63.884 -28.251 1.00 125.07 ? 595 THR C CB    1 
ATOM   8135  O  OG1   . THR C 2 216 ? -5.080  63.811 -29.235 1.00 116.44 ? 595 THR C OG1   1 
ATOM   8136  C  CG2   . THR C 2 216 ? -4.603  63.573 -26.856 1.00 99.06  ? 595 THR C CG2   1 
ATOM   8137  N  N     . MET C 2 217 ? -3.871  67.096 -29.878 1.00 135.20 ? 596 MET C N     1 
ATOM   8138  C  CA    . MET C 2 217 ? -3.918  67.658 -31.236 1.00 144.63 ? 596 MET C CA    1 
ATOM   8139  C  C     . MET C 2 217 ? -3.091  68.934 -31.443 1.00 147.93 ? 596 MET C C     1 
ATOM   8140  O  O     . MET C 2 217 ? -2.437  69.105 -32.473 1.00 148.70 ? 596 MET C O     1 
ATOM   8141  C  CB    . MET C 2 217 ? -5.359  67.866 -31.697 1.00 141.67 ? 596 MET C CB    1 
ATOM   8142  C  CG    . MET C 2 217 ? -6.027  66.581 -32.094 1.00 138.97 ? 596 MET C CG    1 
ATOM   8143  S  SD    . MET C 2 217 ? -7.790  66.761 -32.336 1.00 132.80 ? 596 MET C SD    1 
ATOM   8144  C  CE    . MET C 2 217 ? -7.821  67.396 -34.001 1.00 100.84 ? 596 MET C CE    1 
ATOM   8145  N  N     . ASN C 2 218 ? -3.127  69.824 -30.462 1.00 144.10 ? 597 ASN C N     1 
ATOM   8146  C  CA    . ASN C 2 218 ? -2.341  71.048 -30.507 1.00 138.33 ? 597 ASN C CA    1 
ATOM   8147  C  C     . ASN C 2 218 ? -0.843  70.754 -30.584 1.00 129.16 ? 597 ASN C C     1 
ATOM   8148  O  O     . ASN C 2 218 ? -0.268  70.243 -29.627 1.00 125.11 ? 597 ASN C O     1 
ATOM   8149  C  CB    . ASN C 2 218 ? -2.645  71.881 -29.271 1.00 143.44 ? 597 ASN C CB    1 
ATOM   8150  C  CG    . ASN C 2 218 ? -1.711  73.032 -29.113 1.00 152.88 ? 597 ASN C CG    1 
ATOM   8151  O  OD1   . ASN C 2 218 ? -1.057  73.466 -30.068 1.00 158.58 ? 597 ASN C OD1   1 
ATOM   8152  N  ND2   . ASN C 2 218 ? -1.631  73.545 -27.897 1.00 157.43 ? 597 ASN C ND2   1 
ATOM   8153  N  N     . PRO C 2 219 ? -0.206  71.099 -31.717 1.00 122.36 ? 598 PRO C N     1 
ATOM   8154  C  CA    . PRO C 2 219 ? 1.204   70.802 -31.991 1.00 114.82 ? 598 PRO C CA    1 
ATOM   8155  C  C     . PRO C 2 219 ? 2.153   71.325 -30.919 1.00 130.82 ? 598 PRO C C     1 
ATOM   8156  O  O     . PRO C 2 219 ? 3.196   70.719 -30.689 1.00 135.96 ? 598 PRO C O     1 
ATOM   8157  C  CB    . PRO C 2 219 ? 1.467   71.555 -33.294 1.00 108.47 ? 598 PRO C CB    1 
ATOM   8158  C  CG    . PRO C 2 219 ? 0.142   71.716 -33.919 1.00 107.07 ? 598 PRO C CG    1 
ATOM   8159  C  CD    . PRO C 2 219 ? -0.794  71.925 -32.781 1.00 120.50 ? 598 PRO C CD    1 
ATOM   8160  N  N     . GLU C 2 220 ? 1.810   72.438 -30.281 1.00 142.65 ? 599 GLU C N     1 
ATOM   8161  C  CA    . GLU C 2 220 ? 2.680   73.007 -29.258 1.00 145.26 ? 599 GLU C CA    1 
ATOM   8162  C  C     . GLU C 2 220 ? 2.901   72.041 -28.088 1.00 142.52 ? 599 GLU C C     1 
ATOM   8163  O  O     . GLU C 2 220 ? 4.030   71.862 -27.632 1.00 146.86 ? 599 GLU C O     1 
ATOM   8164  C  CB    . GLU C 2 220 ? 2.143   74.356 -28.767 1.00 143.47 ? 599 GLU C CB    1 
ATOM   8165  N  N     . THR C 2 221 ? 1.831   71.396 -27.627 1.00 134.21 ? 600 THR C N     1 
ATOM   8166  C  CA    . THR C 2 221 ? 1.901   70.555 -26.430 1.00 137.52 ? 600 THR C CA    1 
ATOM   8167  C  C     . THR C 2 221 ? 1.620   69.075 -26.676 1.00 133.50 ? 600 THR C C     1 
ATOM   8168  O  O     . THR C 2 221 ? 1.668   68.271 -25.750 1.00 122.50 ? 600 THR C O     1 
ATOM   8169  C  CB    . THR C 2 221 ? 0.897   71.014 -25.398 1.00 148.27 ? 600 THR C CB    1 
ATOM   8170  O  OG1   . THR C 2 221 ? -0.418  70.827 -25.928 1.00 146.29 ? 600 THR C OG1   1 
ATOM   8171  C  CG2   . THR C 2 221 ? 1.113   72.484 -25.076 1.00 162.96 ? 600 THR C CG2   1 
ATOM   8172  N  N     . ARG C 2 222 ? 1.315   68.727 -27.921 1.00 138.75 ? 601 ARG C N     1 
ATOM   8173  C  CA    . ARG C 2 222 ? 1.034   67.349 -28.310 1.00 128.64 ? 601 ARG C CA    1 
ATOM   8174  C  C     . ARG C 2 222 ? 2.323   66.612 -28.572 1.00 129.84 ? 601 ARG C C     1 
ATOM   8175  O  O     . ARG C 2 222 ? 3.390   67.213 -28.622 1.00 130.70 ? 601 ARG C O     1 
ATOM   8176  C  CB    . ARG C 2 222 ? 0.219   67.293 -29.589 1.00 117.60 ? 601 ARG C CB    1 
ATOM   8177  C  CG    . ARG C 2 222 ? 1.043   67.004 -30.850 1.00 97.95  ? 601 ARG C CG    1 
ATOM   8178  C  CD    . ARG C 2 222 ? 0.240   67.413 -32.081 1.00 102.70 ? 601 ARG C CD    1 
ATOM   8179  N  NE    . ARG C 2 222 ? 1.025   67.412 -33.304 1.00 122.00 ? 601 ARG C NE    1 
ATOM   8180  C  CZ    . ARG C 2 222 ? 0.550   67.768 -34.492 1.00 133.39 ? 601 ARG C CZ    1 
ATOM   8181  N  NH1   . ARG C 2 222 ? -0.709  68.160 -34.623 1.00 131.22 ? 601 ARG C NH1   1 
ATOM   8182  N  NH2   . ARG C 2 222 ? 1.337   67.729 -35.553 1.00 137.74 ? 601 ARG C NH2   1 
ATOM   8183  N  N     . THR C 2 223 ? 2.229   65.298 -28.694 1.00 135.27 ? 602 THR C N     1 
ATOM   8184  C  CA    . THR C 2 223 ? 3.328   64.530 -29.251 1.00 135.04 ? 602 THR C CA    1 
ATOM   8185  C  C     . THR C 2 223 ? 2.829   63.421 -30.179 1.00 134.54 ? 602 THR C C     1 
ATOM   8186  O  O     . THR C 2 223 ? 1.851   62.738 -29.875 1.00 142.19 ? 602 THR C O     1 
ATOM   8187  C  CB    . THR C 2 223 ? 4.265   63.984 -28.183 1.00 136.18 ? 602 THR C CB    1 
ATOM   8188  O  OG1   . THR C 2 223 ? 5.084   62.970 -28.777 1.00 127.17 ? 602 THR C OG1   1 
ATOM   8189  C  CG2   . THR C 2 223 ? 3.476   63.440 -26.962 1.00 103.46 ? 602 THR C CG2   1 
ATOM   8190  N  N     . LEU C 2 224 ? 3.513   63.254 -31.308 1.00 138.34 ? 603 LEU C N     1 
ATOM   8191  C  CA    . LEU C 2 224 ? 3.091   62.331 -32.361 1.00 126.55 ? 603 LEU C CA    1 
ATOM   8192  C  C     . LEU C 2 224 ? 4.126   61.256 -32.594 1.00 124.95 ? 603 LEU C C     1 
ATOM   8193  O  O     . LEU C 2 224 ? 5.305   61.455 -32.350 1.00 131.20 ? 603 LEU C O     1 
ATOM   8194  C  CB    . LEU C 2 224 ? 2.884   63.049 -33.696 1.00 111.38 ? 603 LEU C CB    1 
ATOM   8195  C  CG    . LEU C 2 224 ? 1.847   64.158 -33.783 1.00 113.72 ? 603 LEU C CG    1 
ATOM   8196  C  CD1   . LEU C 2 224 ? 1.166   64.138 -35.141 1.00 114.65 ? 603 LEU C CD1   1 
ATOM   8197  C  CD2   . LEU C 2 224 ? 0.834   63.970 -32.697 1.00 114.26 ? 603 LEU C CD2   1 
ATOM   8198  N  N     . ILE C 2 225 ? 3.684   60.125 -33.112 1.00 121.65 ? 604 ILE C N     1 
ATOM   8199  C  CA    . ILE C 2 225 ? 4.605   59.069 -33.471 1.00 120.08 ? 604 ILE C CA    1 
ATOM   8200  C  C     . ILE C 2 225 ? 4.780   59.091 -34.974 1.00 134.54 ? 604 ILE C C     1 
ATOM   8201  O  O     . ILE C 2 225 ? 3.813   59.242 -35.728 1.00 140.54 ? 604 ILE C O     1 
ATOM   8202  C  CB    . ILE C 2 225 ? 4.080   57.702 -33.053 1.00 106.68 ? 604 ILE C CB    1 
ATOM   8203  C  CG1   . ILE C 2 225 ? 4.252   57.502 -31.555 1.00 106.08 ? 604 ILE C CG1   1 
ATOM   8204  C  CG2   . ILE C 2 225 ? 4.824   56.630 -33.786 1.00 107.05 ? 604 ILE C CG2   1 
ATOM   8205  C  CD1   . ILE C 2 225 ? 3.933   56.091 -31.106 1.00 117.53 ? 604 ILE C CD1   1 
ATOM   8206  N  N     . ARG C 2 226 ? 6.019   58.943 -35.415 1.00 135.16 ? 605 ARG C N     1 
ATOM   8207  C  CA    . ARG C 2 226 ? 6.305   59.062 -36.830 1.00 141.00 ? 605 ARG C CA    1 
ATOM   8208  C  C     . ARG C 2 226 ? 6.768   57.712 -37.334 1.00 139.20 ? 605 ARG C C     1 
ATOM   8209  O  O     . ARG C 2 226 ? 7.796   57.194 -36.903 1.00 144.67 ? 605 ARG C O     1 
ATOM   8210  C  CB    . ARG C 2 226 ? 7.374   60.123 -37.066 1.00 143.41 ? 605 ARG C CB    1 
ATOM   8211  C  CG    . ARG C 2 226 ? 7.437   60.646 -38.483 1.00 146.53 ? 605 ARG C CG    1 
ATOM   8212  C  CD    . ARG C 2 226 ? 8.665   61.498 -38.650 1.00 154.20 ? 605 ARG C CD    1 
ATOM   8213  N  NE    . ARG C 2 226 ? 8.915   61.861 -40.036 1.00 159.31 ? 605 ARG C NE    1 
ATOM   8214  C  CZ    . ARG C 2 226 ? 10.118  61.820 -40.596 1.00 169.04 ? 605 ARG C CZ    1 
ATOM   8215  N  NH1   . ARG C 2 226 ? 11.174  61.406 -39.890 1.00 155.37 ? 605 ARG C NH1   1 
ATOM   8216  N  NH2   . ARG C 2 226 ? 10.260  62.176 -41.866 1.00 184.23 ? 605 ARG C NH2   1 
ATOM   8217  N  N     . VAL C 2 227 ? 6.026   57.154 -38.279 1.00 124.35 ? 606 VAL C N     1 
ATOM   8218  C  CA    . VAL C 2 227 ? 6.244   55.767 -38.632 1.00 118.17 ? 606 VAL C CA    1 
ATOM   8219  C  C     . VAL C 2 227 ? 7.104   55.712 -39.864 1.00 138.14 ? 606 VAL C C     1 
ATOM   8220  O  O     . VAL C 2 227 ? 6.782   56.295 -40.903 1.00 145.51 ? 606 VAL C O     1 
ATOM   8221  C  CB    . VAL C 2 227 ? 4.934   55.011 -38.917 1.00 111.98 ? 606 VAL C CB    1 
ATOM   8222  C  CG1   . VAL C 2 227 ? 5.221   53.546 -39.152 1.00 109.54 ? 606 VAL C CG1   1 
ATOM   8223  C  CG2   . VAL C 2 227 ? 3.972   55.176 -37.792 1.00 116.08 ? 606 VAL C CG2   1 
ATOM   8224  N  N     . THR C 2 228 ? 8.213   55.006 -39.730 1.00 135.23 ? 607 THR C N     1 
ATOM   8225  C  CA    . THR C 2 228 ? 9.161   54.860 -40.808 1.00 133.43 ? 607 THR C CA    1 
ATOM   8226  C  C     . THR C 2 228 ? 9.449   53.391 -40.932 1.00 135.70 ? 607 THR C C     1 
ATOM   8227  O  O     . THR C 2 228 ? 9.252   52.642 -39.990 1.00 146.11 ? 607 THR C O     1 
ATOM   8228  C  CB    . THR C 2 228 ? 10.447  55.567 -40.476 1.00 132.73 ? 607 THR C CB    1 
ATOM   8229  O  OG1   . THR C 2 228 ? 10.559  55.644 -39.044 1.00 147.61 ? 607 THR C OG1   1 
ATOM   8230  C  CG2   . THR C 2 228 ? 10.460  56.974 -41.094 1.00 111.94 ? 607 THR C CG2   1 
ATOM   8231  N  N     . ILE C 2 229 ? 9.903   52.970 -42.099 1.00 138.65 ? 608 ILE C N     1 
ATOM   8232  C  CA    . ILE C 2 229 ? 10.298  51.585 -42.263 1.00 142.49 ? 608 ILE C CA    1 
ATOM   8233  C  C     . ILE C 2 229 ? 11.822  51.511 -42.442 1.00 152.53 ? 608 ILE C C     1 
ATOM   8234  O  O     . ILE C 2 229 ? 12.402  52.202 -43.280 1.00 152.62 ? 608 ILE C O     1 
ATOM   8235  C  CB    . ILE C 2 229 ? 9.448   50.830 -43.347 1.00 152.59 ? 608 ILE C CB    1 
ATOM   8236  C  CG1   . ILE C 2 229 ? 10.235  49.678 -43.955 1.00 166.14 ? 608 ILE C CG1   1 
ATOM   8237  C  CG2   . ILE C 2 229 ? 8.928   51.752 -44.406 1.00 91.52  ? 608 ILE C CG2   1 
ATOM   8238  C  CD1   . ILE C 2 229 ? 10.598  48.597 -42.929 1.00 182.58 ? 608 ILE C CD1   1 
ATOM   8239  N  N     . GLU C 2 230 ? 12.461  50.683 -41.620 1.00 160.99 ? 609 GLU C N     1 
ATOM   8240  C  CA    . GLU C 2 230 ? 13.916  50.682 -41.501 1.00 155.67 ? 609 GLU C CA    1 
ATOM   8241  C  C     . GLU C 2 230 ? 14.530  49.406 -42.048 1.00 155.88 ? 609 GLU C C     1 
ATOM   8242  O  O     . GLU C 2 230 ? 15.746  49.238 -42.030 1.00 161.97 ? 609 GLU C O     1 
ATOM   8243  C  CB    . GLU C 2 230 ? 14.349  50.883 -40.048 1.00 151.94 ? 609 GLU C CB    1 
ATOM   8244  N  N     . ASP C 2 231 ? 13.685  48.495 -42.509 1.00 173.98 ? 610 ASP C N     1 
ATOM   8245  C  CA    . ASP C 2 231 ? 14.130  47.528 -43.485 1.00 175.08 ? 610 ASP C CA    1 
ATOM   8246  C  C     . ASP C 2 231 ? 13.134  47.657 -44.612 1.00 188.81 ? 610 ASP C C     1 
ATOM   8247  O  O     . ASP C 2 231 ? 12.593  48.734 -44.818 1.00 210.40 ? 610 ASP C O     1 
ATOM   8248  C  CB    . ASP C 2 231 ? 14.082  46.127 -42.912 1.00 170.74 ? 610 ASP C CB    1 
ATOM   8249  C  CG    . ASP C 2 231 ? 15.415  45.417 -43.022 1.00 194.87 ? 610 ASP C CG    1 
ATOM   8250  O  OD1   . ASP C 2 231 ? 15.460  44.307 -43.602 1.00 207.59 ? 610 ASP C OD1   1 
ATOM   8251  O  OD2   . ASP C 2 231 ? 16.425  45.980 -42.535 1.00 200.63 ? 610 ASP C OD2   1 
ATOM   8252  N  N     . LEU C 2 232 ? 12.919  46.602 -45.381 1.00 178.52 ? 611 LEU C N     1 
ATOM   8253  C  CA    . LEU C 2 232 ? 11.669  46.439 -46.094 1.00 164.94 ? 611 LEU C CA    1 
ATOM   8254  C  C     . LEU C 2 232 ? 11.329  45.003 -45.812 1.00 165.52 ? 611 LEU C C     1 
ATOM   8255  O  O     . LEU C 2 232 ? 10.195  44.658 -45.512 1.00 170.03 ? 611 LEU C O     1 
ATOM   8256  C  CB    . LEU C 2 232 ? 11.842  46.611 -47.598 1.00 165.32 ? 611 LEU C CB    1 
ATOM   8257  C  CG    . LEU C 2 232 ? 10.633  47.266 -48.278 1.00 175.33 ? 611 LEU C CG    1 
ATOM   8258  C  CD1   . LEU C 2 232 ? 10.899  48.744 -48.551 1.00 172.07 ? 611 LEU C CD1   1 
ATOM   8259  C  CD2   . LEU C 2 232 ? 10.259  46.559 -49.575 1.00 187.59 ? 611 LEU C CD2   1 
ATOM   8260  N  N     . ALA C 2 233 ? 12.359  44.169 -45.933 1.00 162.01 ? 612 ALA C N     1 
ATOM   8261  C  CA    . ALA C 2 233 ? 12.260  42.726 -45.764 1.00 148.23 ? 612 ALA C CA    1 
ATOM   8262  C  C     . ALA C 2 233 ? 11.685  42.360 -44.405 1.00 155.34 ? 612 ALA C C     1 
ATOM   8263  O  O     . ALA C 2 233 ? 10.835  41.481 -44.313 1.00 154.93 ? 612 ALA C O     1 
ATOM   8264  C  CB    . ALA C 2 233 ? 13.621  42.101 -45.927 1.00 134.57 ? 612 ALA C CB    1 
ATOM   8265  N  N     . ARG C 2 234 ? 12.169  43.027 -43.357 1.00 157.17 ? 613 ARG C N     1 
ATOM   8266  C  CA    . ARG C 2 234 ? 11.686  42.810 -41.997 1.00 146.73 ? 613 ARG C CA    1 
ATOM   8267  C  C     . ARG C 2 234 ? 10.214  43.175 -41.899 1.00 153.81 ? 613 ARG C C     1 
ATOM   8268  O  O     . ARG C 2 234 ? 9.413   42.430 -41.333 1.00 161.44 ? 613 ARG C O     1 
ATOM   8269  C  CB    . ARG C 2 234 ? 12.473  43.646 -40.992 1.00 140.27 ? 613 ARG C CB    1 
ATOM   8270  C  CG    . ARG C 2 234 ? 13.962  43.376 -40.966 1.00 154.12 ? 613 ARG C CG    1 
ATOM   8271  C  CD    . ARG C 2 234 ? 14.362  42.543 -39.780 1.00 170.32 ? 613 ARG C CD    1 
ATOM   8272  N  NE    . ARG C 2 234 ? 15.784  42.659 -39.454 1.00 181.80 ? 613 ARG C NE    1 
ATOM   8273  C  CZ    . ARG C 2 234 ? 16.353  43.737 -38.916 1.00 184.90 ? 613 ARG C CZ    1 
ATOM   8274  N  NH1   . ARG C 2 234 ? 15.635  44.827 -38.662 1.00 181.54 ? 613 ARG C NH1   1 
ATOM   8275  N  NH2   . ARG C 2 234 ? 17.649  43.727 -38.641 1.00 189.04 ? 613 ARG C NH2   1 
ATOM   8276  N  N     . ALA C 2 235 ? 9.859   44.335 -42.439 1.00 147.48 ? 614 ALA C N     1 
ATOM   8277  C  CA    . ALA C 2 235 ? 8.473   44.776 -42.411 1.00 147.18 ? 614 ALA C CA    1 
ATOM   8278  C  C     . ALA C 2 235 ? 7.575   43.749 -43.081 1.00 132.74 ? 614 ALA C C     1 
ATOM   8279  O  O     . ALA C 2 235 ? 6.609   43.280 -42.488 1.00 134.25 ? 614 ALA C O     1 
ATOM   8280  C  CB    . ALA C 2 235 ? 8.330   46.104 -43.084 1.00 161.17 ? 614 ALA C CB    1 
ATOM   8281  N  N     . GLU C 2 236 ? 7.910   43.394 -44.313 1.00 110.37 ? 615 GLU C N     1 
ATOM   8282  C  CA    . GLU C 2 236 ? 7.153   42.397 -45.045 1.00 134.31 ? 615 GLU C CA    1 
ATOM   8283  C  C     . GLU C 2 236 ? 7.024   41.140 -44.195 1.00 143.60 ? 615 GLU C C     1 
ATOM   8284  O  O     . GLU C 2 236 ? 5.918   40.632 -43.983 1.00 148.45 ? 615 GLU C O     1 
ATOM   8285  C  CB    . GLU C 2 236 ? 7.864   42.079 -46.369 1.00 149.56 ? 615 GLU C CB    1 
ATOM   8286  C  CG    . GLU C 2 236 ? 7.088   41.194 -47.337 1.00 158.45 ? 615 GLU C CG    1 
ATOM   8287  C  CD    . GLU C 2 236 ? 5.857   41.872 -47.899 1.00 169.81 ? 615 GLU C CD    1 
ATOM   8288  O  OE1   . GLU C 2 236 ? 5.715   43.103 -47.737 1.00 173.92 ? 615 GLU C OE1   1 
ATOM   8289  O  OE2   . GLU C 2 236 ? 5.024   41.169 -48.503 1.00 177.41 ? 615 GLU C OE2   1 
ATOM   8290  N  N     . ARG C 2 237 ? 8.159   40.665 -43.684 1.00 140.59 ? 616 ARG C N     1 
ATOM   8291  C  CA    . ARG C 2 237 ? 8.204   39.440 -42.888 1.00 131.20 ? 616 ARG C CA    1 
ATOM   8292  C  C     . ARG C 2 237 ? 7.210   39.537 -41.767 1.00 117.93 ? 616 ARG C C     1 
ATOM   8293  O  O     . ARG C 2 237 ? 6.354   38.663 -41.612 1.00 121.15 ? 616 ARG C O     1 
ATOM   8294  C  CB    . ARG C 2 237 ? 9.578   39.219 -42.258 1.00 110.45 ? 616 ARG C CB    1 
ATOM   8295  C  CG    . ARG C 2 237 ? 9.998   37.763 -42.202 1.00 113.85 ? 616 ARG C CG    1 
ATOM   8296  C  CD    . ARG C 2 237 ? 11.344  37.586 -41.520 1.00 141.28 ? 616 ARG C CD    1 
ATOM   8297  N  NE    . ARG C 2 237 ? 12.363  38.500 -42.030 1.00 138.56 ? 616 ARG C NE    1 
ATOM   8298  C  CZ    . ARG C 2 237 ? 12.961  38.358 -43.207 1.00 155.90 ? 616 ARG C CZ    1 
ATOM   8299  N  NH1   . ARG C 2 237 ? 12.627  37.345 -43.985 1.00 157.95 ? 616 ARG C NH1   1 
ATOM   8300  N  NH2   . ARG C 2 237 ? 13.881  39.228 -43.610 1.00 173.07 ? 616 ARG C NH2   1 
ATOM   8301  N  N     . ARG C 2 238 ? 7.324   40.613 -40.994 1.00 104.20 ? 617 ARG C N     1 
ATOM   8302  C  CA    . ARG C 2 238 ? 6.475   40.792 -39.830 1.00 130.56 ? 617 ARG C CA    1 
ATOM   8303  C  C     . ARG C 2 238 ? 5.003   40.946 -40.172 1.00 128.86 ? 617 ARG C C     1 
ATOM   8304  O  O     . ARG C 2 238 ? 4.161   40.235 -39.631 1.00 114.65 ? 617 ARG C O     1 
ATOM   8305  C  CB    . ARG C 2 238 ? 6.914   42.003 -39.030 1.00 139.57 ? 617 ARG C CB    1 
ATOM   8306  C  CG    . ARG C 2 238 ? 5.995   42.268 -37.856 1.00 133.19 ? 617 ARG C CG    1 
ATOM   8307  C  CD    . ARG C 2 238 ? 6.771   42.758 -36.669 1.00 126.33 ? 617 ARG C CD    1 
ATOM   8308  N  NE    . ARG C 2 238 ? 7.285   41.653 -35.884 1.00 122.48 ? 617 ARG C NE    1 
ATOM   8309  C  CZ    . ARG C 2 238 ? 8.086   41.814 -34.843 1.00 137.46 ? 617 ARG C CZ    1 
ATOM   8310  N  NH1   . ARG C 2 238 ? 8.457   43.036 -34.488 1.00 138.56 ? 617 ARG C NH1   1 
ATOM   8311  N  NH2   . ARG C 2 238 ? 8.516   40.760 -34.162 1.00 141.59 ? 617 ARG C NH2   1 
ATOM   8312  N  N     . VAL C 2 239 ? 4.692   41.880 -41.059 1.00 138.22 ? 618 VAL C N     1 
ATOM   8313  C  CA    . VAL C 2 239 ? 3.305   42.129 -41.413 1.00 142.40 ? 618 VAL C CA    1 
ATOM   8314  C  C     . VAL C 2 239 ? 2.633   40.831 -41.851 1.00 137.31 ? 618 VAL C C     1 
ATOM   8315  O  O     . VAL C 2 239 ? 1.558   40.483 -41.370 1.00 125.17 ? 618 VAL C O     1 
ATOM   8316  C  CB    . VAL C 2 239 ? 3.168   43.220 -42.495 1.00 134.36 ? 618 VAL C CB    1 
ATOM   8317  C  CG1   . VAL C 2 239 ? 1.730   43.323 -42.945 1.00 128.53 ? 618 VAL C CG1   1 
ATOM   8318  C  CG2   . VAL C 2 239 ? 3.639   44.564 -41.947 1.00 123.17 ? 618 VAL C CG2   1 
ATOM   8319  N  N     . ASN C 2 240 ? 3.280   40.100 -42.747 1.00 132.27 ? 619 ASN C N     1 
ATOM   8320  C  CA    . ASN C 2 240 ? 2.690   38.867 -43.245 1.00 133.01 ? 619 ASN C CA    1 
ATOM   8321  C  C     . ASN C 2 240 ? 2.378   37.813 -42.183 1.00 141.30 ? 619 ASN C C     1 
ATOM   8322  O  O     . ASN C 2 240 ? 1.467   37.016 -42.375 1.00 157.61 ? 619 ASN C O     1 
ATOM   8323  C  CB    . ASN C 2 240 ? 3.492   38.298 -44.401 1.00 135.23 ? 619 ASN C CB    1 
ATOM   8324  C  CG    . ASN C 2 240 ? 3.662   39.300 -45.501 1.00 154.89 ? 619 ASN C CG    1 
ATOM   8325  O  OD1   . ASN C 2 240 ? 2.870   40.240 -45.631 1.00 156.41 ? 619 ASN C OD1   1 
ATOM   8326  N  ND2   . ASN C 2 240 ? 4.711   39.133 -46.292 1.00 173.85 ? 619 ASN C ND2   1 
ATOM   8327  N  N     . VAL C 2 241 ? 3.138   37.771 -41.090 1.00 128.71 ? 620 VAL C N     1 
ATOM   8328  C  CA    . VAL C 2 241 ? 2.819   36.828 -40.015 1.00 116.98 ? 620 VAL C CA    1 
ATOM   8329  C  C     . VAL C 2 241 ? 1.613   37.281 -39.228 1.00 114.42 ? 620 VAL C C     1 
ATOM   8330  O  O     . VAL C 2 241 ? 0.613   36.572 -39.122 1.00 123.13 ? 620 VAL C O     1 
ATOM   8331  C  CB    . VAL C 2 241 ? 3.937   36.669 -38.995 1.00 106.64 ? 620 VAL C CB    1 
ATOM   8332  C  CG1   . VAL C 2 241 ? 4.035   35.201 -38.603 1.00 100.84 ? 620 VAL C CG1   1 
ATOM   8333  C  CG2   . VAL C 2 241 ? 5.239   37.158 -39.561 1.00 106.01 ? 620 VAL C CG2   1 
ATOM   8334  N  N     . LEU C 2 242 ? 1.726   38.467 -38.654 1.00 105.09 ? 621 LEU C N     1 
ATOM   8335  C  CA    . LEU C 2 242 ? 0.675   38.982 -37.810 1.00 112.77 ? 621 LEU C CA    1 
ATOM   8336  C  C     . LEU C 2 242 ? -0.598  39.124 -38.615 1.00 123.58 ? 621 LEU C C     1 
ATOM   8337  O  O     . LEU C 2 242 ? -1.606  38.488 -38.316 1.00 136.57 ? 621 LEU C O     1 
ATOM   8338  C  CB    . LEU C 2 242 ? 1.088   40.339 -37.255 1.00 125.42 ? 621 LEU C CB    1 
ATOM   8339  C  CG    . LEU C 2 242 ? 2.553   40.489 -36.830 1.00 134.41 ? 621 LEU C CG    1 
ATOM   8340  C  CD1   . LEU C 2 242 ? 2.822   41.913 -36.344 1.00 137.31 ? 621 LEU C CD1   1 
ATOM   8341  C  CD2   . LEU C 2 242 ? 2.951   39.461 -35.772 1.00 121.38 ? 621 LEU C CD2   1 
ATOM   8342  N  N     . MET C 2 243 ? -0.534  39.980 -39.629 1.00 122.78 ? 622 MET C N     1 
ATOM   8343  C  CA    . MET C 2 243 ? -1.679  40.330 -40.468 1.00 125.72 ? 622 MET C CA    1 
ATOM   8344  C  C     . MET C 2 243 ? -2.013  39.312 -41.547 1.00 128.65 ? 622 MET C C     1 
ATOM   8345  O  O     . MET C 2 243 ? -3.017  39.452 -42.245 1.00 130.95 ? 622 MET C O     1 
ATOM   8346  C  CB    . MET C 2 243 ? -1.426  41.678 -41.134 1.00 121.28 ? 622 MET C CB    1 
ATOM   8347  C  CG    . MET C 2 243 ? -0.949  42.715 -40.153 1.00 129.41 ? 622 MET C CG    1 
ATOM   8348  S  SD    . MET C 2 243 ? -1.990  42.716 -38.689 1.00 136.82 ? 622 MET C SD    1 
ATOM   8349  C  CE    . MET C 2 243 ? -3.533  43.252 -39.418 1.00 126.98 ? 622 MET C CE    1 
ATOM   8350  N  N     . GLY C 2 244 ? -1.164  38.299 -41.683 1.00 126.87 ? 623 GLY C N     1 
ATOM   8351  C  CA    . GLY C 2 244 ? -1.239  37.375 -42.801 1.00 128.01 ? 623 GLY C CA    1 
ATOM   8352  C  C     . GLY C 2 244 ? -2.536  36.616 -42.960 1.00 129.89 ? 623 GLY C C     1 
ATOM   8353  O  O     . GLY C 2 244 ? -3.589  37.064 -42.534 1.00 138.97 ? 623 GLY C O     1 
ATOM   8354  N  N     . ASP C 2 245 ? -2.455  35.454 -43.588 1.00 136.56 ? 624 ASP C N     1 
ATOM   8355  C  CA    . ASP C 2 245 ? -3.635  34.639 -43.805 1.00 140.27 ? 624 ASP C CA    1 
ATOM   8356  C  C     . ASP C 2 245 ? -3.429  33.234 -43.229 1.00 148.09 ? 624 ASP C C     1 
ATOM   8357  O  O     . ASP C 2 245 ? -4.359  32.425 -43.170 1.00 145.07 ? 624 ASP C O     1 
ATOM   8358  C  CB    . ASP C 2 245 ? -3.937  34.587 -45.314 1.00 119.02 ? 624 ASP C CB    1 
ATOM   8359  N  N     . LYS C 2 246 ? -2.209  32.966 -42.773 1.00 143.17 ? 625 LYS C N     1 
ATOM   8360  C  CA    . LYS C 2 246 ? -1.780  31.597 -42.507 1.00 140.02 ? 625 LYS C CA    1 
ATOM   8361  C  C     . LYS C 2 246 ? -2.059  31.048 -41.086 1.00 150.41 ? 625 LYS C C     1 
ATOM   8362  O  O     . LYS C 2 246 ? -2.158  29.832 -40.893 1.00 169.71 ? 625 LYS C O     1 
ATOM   8363  C  CB    . LYS C 2 246 ? -0.316  31.401 -42.954 1.00 122.22 ? 625 LYS C CB    1 
ATOM   8364  N  N     . VAL C 2 247 ? -2.204  31.930 -40.104 1.00 134.66 ? 626 VAL C N     1 
ATOM   8365  C  CA    . VAL C 2 247 ? -2.516  31.513 -38.725 1.00 135.97 ? 626 VAL C CA    1 
ATOM   8366  C  C     . VAL C 2 247 ? -1.390  30.735 -38.049 1.00 130.17 ? 626 VAL C C     1 
ATOM   8367  O  O     . VAL C 2 247 ? -0.802  31.203 -37.077 1.00 125.50 ? 626 VAL C O     1 
ATOM   8368  C  CB    . VAL C 2 247 ? -3.828  30.657 -38.600 1.00 120.06 ? 626 VAL C CB    1 
ATOM   8369  C  CG1   . VAL C 2 247 ? -4.011  30.190 -37.170 1.00 125.36 ? 626 VAL C CG1   1 
ATOM   8370  C  CG2   . VAL C 2 247 ? -5.044  31.451 -38.974 1.00 118.82 ? 626 VAL C CG2   1 
ATOM   8371  N  N     . GLU C 2 248 ? -1.112  29.539 -38.555 1.00 133.26 ? 627 GLU C N     1 
ATOM   8372  C  CA    . GLU C 2 248 ? -0.135  28.646 -37.937 1.00 134.91 ? 627 GLU C CA    1 
ATOM   8373  C  C     . GLU C 2 248 ? 1.128   29.359 -37.416 1.00 142.02 ? 627 GLU C C     1 
ATOM   8374  O  O     . GLU C 2 248 ? 1.589   29.070 -36.309 1.00 144.06 ? 627 GLU C O     1 
ATOM   8375  C  CB    . GLU C 2 248 ? 0.202   27.487 -38.882 1.00 122.48 ? 627 GLU C CB    1 
ATOM   8376  N  N     . PRO C 2 249 ? 1.697   30.283 -38.211 1.00 135.58 ? 628 PRO C N     1 
ATOM   8377  C  CA    . PRO C 2 249 ? 2.857   31.091 -37.798 1.00 135.72 ? 628 PRO C CA    1 
ATOM   8378  C  C     . PRO C 2 249 ? 2.509   32.169 -36.778 1.00 131.37 ? 628 PRO C C     1 
ATOM   8379  O  O     . PRO C 2 249 ? 3.204   32.334 -35.775 1.00 125.94 ? 628 PRO C O     1 
ATOM   8380  C  CB    . PRO C 2 249 ? 3.275   31.774 -39.096 1.00 135.12 ? 628 PRO C CB    1 
ATOM   8381  C  CG    . PRO C 2 249 ? 2.783   30.861 -40.158 1.00 139.01 ? 628 PRO C CG    1 
ATOM   8382  C  CD    . PRO C 2 249 ? 1.466   30.382 -39.658 1.00 130.12 ? 628 PRO C CD    1 
ATOM   8383  N  N     . ARG C 2 250 ? 1.449   32.914 -37.058 1.00 132.33 ? 629 ARG C N     1 
ATOM   8384  C  CA    . ARG C 2 250 ? 0.911   33.865 -36.100 1.00 121.55 ? 629 ARG C CA    1 
ATOM   8385  C  C     . ARG C 2 250 ? 0.839   33.224 -34.716 1.00 124.81 ? 629 ARG C C     1 
ATOM   8386  O  O     . ARG C 2 250 ? 1.429   33.729 -33.769 1.00 120.25 ? 629 ARG C O     1 
ATOM   8387  C  CB    . ARG C 2 250 ? -0.477  34.298 -36.547 1.00 104.82 ? 629 ARG C CB    1 
ATOM   8388  C  CG    . ARG C 2 250 ? -0.995  35.576 -35.941 1.00 96.99  ? 629 ARG C CG    1 
ATOM   8389  C  CD    . ARG C 2 250 ? -2.337  35.878 -36.560 1.00 105.49 ? 629 ARG C CD    1 
ATOM   8390  N  NE    . ARG C 2 250 ? -2.441  35.223 -37.857 1.00 115.20 ? 629 ARG C NE    1 
ATOM   8391  C  CZ    . ARG C 2 250 ? -3.247  35.626 -38.829 1.00 138.50 ? 629 ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C 2 250 ? -4.023  36.688 -38.637 1.00 155.74 ? 629 ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C 2 250 ? -3.268  34.977 -39.990 1.00 135.55 ? 629 ARG C NH2   1 
ATOM   8394  N  N     . ARG C 2 251 ? 0.143   32.095 -34.601 1.00 124.21 ? 630 ARG C N     1 
ATOM   8395  C  CA    . ARG C 2 251 ? 0.010   31.434 -33.303 1.00 123.84 ? 630 ARG C CA    1 
ATOM   8396  C  C     . ARG C 2 251 ? 1.364   31.289 -32.613 1.00 117.53 ? 630 ARG C C     1 
ATOM   8397  O  O     . ARG C 2 251 ? 1.517   31.638 -31.444 1.00 112.84 ? 630 ARG C O     1 
ATOM   8398  C  CB    . ARG C 2 251 ? -0.666  30.062 -33.442 1.00 126.32 ? 630 ARG C CB    1 
ATOM   8399  C  CG    . ARG C 2 251 ? -0.383  29.115 -32.284 1.00 137.44 ? 630 ARG C CG    1 
ATOM   8400  C  CD    . ARG C 2 251 ? -0.822  27.688 -32.593 1.00 169.31 ? 630 ARG C CD    1 
ATOM   8401  N  NE    . ARG C 2 251 ? -1.993  27.257 -31.823 1.00 192.20 ? 630 ARG C NE    1 
ATOM   8402  C  CZ    . ARG C 2 251 ? -3.155  26.877 -32.352 1.00 196.86 ? 630 ARG C CZ    1 
ATOM   8403  N  NH1   . ARG C 2 251 ? -3.324  26.873 -33.673 1.00 198.38 ? 630 ARG C NH1   1 
ATOM   8404  N  NH2   . ARG C 2 251 ? -4.150  26.495 -31.556 1.00 187.69 ? 630 ARG C NH2   1 
ATOM   8405  N  N     . LYS C 2 252 ? 2.342   30.762 -33.340 1.00 121.20 ? 631 LYS C N     1 
ATOM   8406  C  CA    . LYS C 2 252 ? 3.656   30.534 -32.763 1.00 131.20 ? 631 LYS C CA    1 
ATOM   8407  C  C     . LYS C 2 252 ? 4.216   31.862 -32.269 1.00 135.81 ? 631 LYS C C     1 
ATOM   8408  O  O     . LYS C 2 252 ? 4.692   31.974 -31.140 1.00 130.70 ? 631 LYS C O     1 
ATOM   8409  C  CB    . LYS C 2 252 ? 4.607   29.895 -33.784 1.00 137.93 ? 631 LYS C CB    1 
ATOM   8410  C  CG    . LYS C 2 252 ? 5.500   28.809 -33.201 1.00 146.87 ? 631 LYS C CG    1 
ATOM   8411  C  CD    . LYS C 2 252 ? 6.905   28.818 -33.788 1.00 158.48 ? 631 LYS C CD    1 
ATOM   8412  C  CE    . LYS C 2 252 ? 7.673   27.598 -33.306 1.00 169.97 ? 631 LYS C CE    1 
ATOM   8413  N  NZ    . LYS C 2 252 ? 7.164   27.138 -31.970 1.00 169.90 ? 631 LYS C NZ    1 
ATOM   8414  N  N     . TRP C 2 253 ? 4.140   32.872 -33.126 1.00 143.57 ? 632 TRP C N     1 
ATOM   8415  C  CA    . TRP C 2 253 ? 4.625   34.199 -32.791 1.00 135.10 ? 632 TRP C CA    1 
ATOM   8416  C  C     . TRP C 2 253 ? 4.017   34.688 -31.483 1.00 125.76 ? 632 TRP C C     1 
ATOM   8417  O  O     . TRP C 2 253 ? 4.695   35.325 -30.680 1.00 124.77 ? 632 TRP C O     1 
ATOM   8418  C  CB    . TRP C 2 253 ? 4.322   35.175 -33.918 1.00 124.25 ? 632 TRP C CB    1 
ATOM   8419  C  CG    . TRP C 2 253 ? 5.086   36.446 -33.787 1.00 130.49 ? 632 TRP C CG    1 
ATOM   8420  C  CD1   . TRP C 2 253 ? 6.294   36.743 -34.354 1.00 133.74 ? 632 TRP C CD1   1 
ATOM   8421  C  CD2   . TRP C 2 253 ? 4.707   37.594 -33.021 1.00 129.71 ? 632 TRP C CD2   1 
ATOM   8422  N  NE1   . TRP C 2 253 ? 6.684   38.012 -33.995 1.00 136.82 ? 632 TRP C NE1   1 
ATOM   8423  C  CE2   . TRP C 2 253 ? 5.723   38.556 -33.180 1.00 141.10 ? 632 TRP C CE2   1 
ATOM   8424  C  CE3   . TRP C 2 253 ? 3.604   37.905 -32.225 1.00 116.07 ? 632 TRP C CE3   1 
ATOM   8425  C  CZ2   . TRP C 2 253 ? 5.665   39.805 -32.570 1.00 138.87 ? 632 TRP C CZ2   1 
ATOM   8426  C  CZ3   . TRP C 2 253 ? 3.551   39.137 -31.629 1.00 123.60 ? 632 TRP C CZ3   1 
ATOM   8427  C  CH2   . TRP C 2 253 ? 4.578   40.074 -31.800 1.00 130.37 ? 632 TRP C CH2   1 
ATOM   8428  N  N     . ILE C 2 254 ? 2.737   34.398 -31.280 1.00 121.25 ? 633 ILE C N     1 
ATOM   8429  C  CA    . ILE C 2 254 ? 2.089   34.669 -30.009 1.00 96.35  ? 633 ILE C CA    1 
ATOM   8430  C  C     . ILE C 2 254 ? 2.746   33.907 -28.876 1.00 113.11 ? 633 ILE C C     1 
ATOM   8431  O  O     . ILE C 2 254 ? 3.276   34.517 -27.961 1.00 112.77 ? 633 ILE C O     1 
ATOM   8432  C  CB    . ILE C 2 254 ? 0.654   34.231 -30.012 1.00 104.31 ? 633 ILE C CB    1 
ATOM   8433  C  CG1   . ILE C 2 254 ? -0.222  35.390 -30.401 1.00 93.21  ? 633 ILE C CG1   1 
ATOM   8434  C  CG2   . ILE C 2 254 ? 0.246   33.738 -28.625 1.00 113.26 ? 633 ILE C CG2   1 
ATOM   8435  C  CD1   . ILE C 2 254 ? -0.390  35.491 -31.858 1.00 108.73 ? 633 ILE C CD1   1 
ATOM   8436  N  N     . GLU C 2 255 ? 2.722   32.576 -28.944 1.00 114.92 ? 634 GLU C N     1 
ATOM   8437  C  CA    . GLU C 2 255 ? 3.229   31.754 -27.853 1.00 106.10 ? 634 GLU C CA    1 
ATOM   8438  C  C     . GLU C 2 255 ? 4.601   32.240 -27.409 1.00 156.16 ? 634 GLU C C     1 
ATOM   8439  O  O     . GLU C 2 255 ? 4.841   32.497 -26.227 1.00 150.48 ? 634 GLU C O     1 
ATOM   8440  C  CB    . GLU C 2 255 ? 3.373   30.310 -28.300 1.00 136.41 ? 634 GLU C CB    1 
ATOM   8441  C  CG    . GLU C 2 255 ? 2.174   29.739 -29.001 1.00 153.70 ? 634 GLU C CG    1 
ATOM   8442  C  CD    . GLU C 2 255 ? 2.288   28.228 -29.146 1.00 185.47 ? 634 GLU C CD    1 
ATOM   8443  O  OE1   . GLU C 2 255 ? 3.429   27.706 -29.041 1.00 196.42 ? 634 GLU C OE1   1 
ATOM   8444  O  OE2   . GLU C 2 255 ? 1.240   27.567 -29.355 1.00 192.03 ? 634 GLU C OE2   1 
ATOM   8445  N  N     . ASP C 2 256 ? 5.497   32.359 -28.379 1.00 132.08 ? 635 ASP C N     1 
ATOM   8446  C  CA    . ASP C 2 256 ? 6.893   32.682 -28.129 1.00 137.58 ? 635 ASP C CA    1 
ATOM   8447  C  C     . ASP C 2 256 ? 7.132   34.099 -27.617 1.00 133.12 ? 635 ASP C C     1 
ATOM   8448  O  O     . ASP C 2 256 ? 8.126   34.357 -26.944 1.00 143.93 ? 635 ASP C O     1 
ATOM   8449  C  CB    . ASP C 2 256 ? 7.699   32.467 -29.407 1.00 154.95 ? 635 ASP C CB    1 
ATOM   8450  C  CG    . ASP C 2 256 ? 7.525   31.068 -29.979 1.00 176.21 ? 635 ASP C CG    1 
ATOM   8451  O  OD1   . ASP C 2 256 ? 7.265   30.124 -29.193 1.00 184.09 ? 635 ASP C OD1   1 
ATOM   8452  O  OD2   . ASP C 2 256 ? 7.650   30.914 -31.218 1.00 179.50 ? 635 ASP C OD2   1 
ATOM   8453  N  N     . ASN C 2 257 ? 6.232   35.022 -27.930 1.00 128.83 ? 636 ASN C N     1 
ATOM   8454  C  CA    . ASN C 2 257 ? 6.528   36.435 -27.715 1.00 133.55 ? 636 ASN C CA    1 
ATOM   8455  C  C     . ASN C 2 257 ? 5.504   37.191 -26.885 1.00 129.70 ? 636 ASN C C     1 
ATOM   8456  O  O     . ASN C 2 257 ? 5.841   38.167 -26.225 1.00 132.27 ? 636 ASN C O     1 
ATOM   8457  C  CB    . ASN C 2 257 ? 6.741   37.131 -29.058 1.00 143.35 ? 636 ASN C CB    1 
ATOM   8458  C  CG    . ASN C 2 257 ? 7.719   36.385 -29.936 1.00 155.18 ? 636 ASN C CG    1 
ATOM   8459  O  OD1   . ASN C 2 257 ? 8.850   36.121 -29.530 1.00 161.46 ? 636 ASN C OD1   1 
ATOM   8460  N  ND2   . ASN C 2 257 ? 7.286   36.025 -31.138 1.00 156.15 ? 636 ASN C ND2   1 
ATOM   8461  N  N     . VAL C 2 258 ? 4.247   36.769 -26.952 1.00 130.03 ? 637 VAL C N     1 
ATOM   8462  C  CA    . VAL C 2 258 ? 3.226   37.332 -26.081 1.00 123.76 ? 637 VAL C CA    1 
ATOM   8463  C  C     . VAL C 2 258 ? 3.510   36.864 -24.670 1.00 115.12 ? 637 VAL C C     1 
ATOM   8464  O  O     . VAL C 2 258 ? 3.478   35.659 -24.381 1.00 101.46 ? 637 VAL C O     1 
ATOM   8465  C  CB    . VAL C 2 258 ? 1.806   36.915 -26.470 1.00 127.40 ? 637 VAL C CB    1 
ATOM   8466  C  CG1   . VAL C 2 258 ? 0.812   37.557 -25.500 1.00 121.82 ? 637 VAL C CG1   1 
ATOM   8467  C  CG2   . VAL C 2 258 ? 1.509   37.292 -27.950 1.00 103.66 ? 637 VAL C CG2   1 
ATOM   8468  N  N     . LYS C 2 259 ? 3.827   37.815 -23.800 1.00 120.60 ? 638 LYS C N     1 
ATOM   8469  C  CA    . LYS C 2 259 ? 4.131   37.492 -22.414 1.00 124.74 ? 638 LYS C CA    1 
ATOM   8470  C  C     . LYS C 2 259 ? 2.843   37.499 -21.577 1.00 136.29 ? 638 LYS C C     1 
ATOM   8471  O  O     . LYS C 2 259 ? 2.404   38.546 -21.116 1.00 138.18 ? 638 LYS C O     1 
ATOM   8472  C  CB    . LYS C 2 259 ? 5.192   38.459 -21.877 1.00 109.51 ? 638 LYS C CB    1 
ATOM   8473  N  N     . PHE C 2 260 ? 2.226   36.330 -21.403 1.00 140.10 ? 639 PHE C N     1 
ATOM   8474  C  CA    . PHE C 2 260 ? 0.995   36.225 -20.622 1.00 127.99 ? 639 PHE C CA    1 
ATOM   8475  C  C     . PHE C 2 260 ? 1.349   36.227 -19.150 1.00 142.60 ? 639 PHE C C     1 
ATOM   8476  O  O     . PHE C 2 260 ? 0.634   35.641 -18.348 1.00 143.64 ? 639 PHE C O     1 
ATOM   8477  C  CB    . PHE C 2 260 ? 0.256   34.912 -20.933 1.00 115.92 ? 639 PHE C CB    1 
ATOM   8478  C  CG    . PHE C 2 260 ? -0.160  34.756 -22.372 1.00 112.50 ? 639 PHE C CG    1 
ATOM   8479  C  CD1   . PHE C 2 260 ? -1.370  35.256 -22.818 1.00 119.71 ? 639 PHE C CD1   1 
ATOM   8480  C  CD2   . PHE C 2 260 ? 0.646   34.089 -23.274 1.00 119.67 ? 639 PHE C CD2   1 
ATOM   8481  C  CE1   . PHE C 2 260 ? -1.764  35.110 -24.144 1.00 119.03 ? 639 PHE C CE1   1 
ATOM   8482  C  CE2   . PHE C 2 260 ? 0.256   33.949 -24.610 1.00 123.44 ? 639 PHE C CE2   1 
ATOM   8483  C  CZ    . PHE C 2 260 ? -0.949  34.459 -25.040 1.00 111.49 ? 639 PHE C CZ    1 
ATOM   8484  N  N     . THR C 2 261 ? 2.458   36.883 -18.807 1.00 160.47 ? 640 THR C N     1 
ATOM   8485  C  CA    . THR C 2 261 ? 3.088   36.764 -17.480 1.00 157.66 ? 640 THR C CA    1 
ATOM   8486  C  C     . THR C 2 261 ? 2.511   35.655 -16.600 1.00 138.57 ? 640 THR C C     1 
ATOM   8487  O  O     . THR C 2 261 ? 2.747   34.469 -16.848 1.00 126.50 ? 640 THR C O     1 
ATOM   8488  C  CB    . THR C 2 261 ? 3.142   38.112 -16.695 1.00 177.04 ? 640 THR C CB    1 
ATOM   8489  O  OG1   . THR C 2 261 ? 2.897   37.863 -15.297 1.00 167.28 ? 640 THR C OG1   1 
ATOM   8490  C  CG2   . THR C 2 261 ? 2.130   39.136 -17.256 1.00 171.95 ? 640 THR C CG2   1 
ATOM   8491  N  N     . LYS D 2 36  ? -40.192 40.129 -46.119 1.00 144.20 ? 415 LYS D N     1 
ATOM   8492  C  CA    . LYS D 2 36  ? -40.296 38.674 -46.028 1.00 157.59 ? 415 LYS D CA    1 
ATOM   8493  C  C     . LYS D 2 36  ? -41.276 38.237 -44.931 1.00 157.31 ? 415 LYS D C     1 
ATOM   8494  O  O     . LYS D 2 36  ? -41.293 38.786 -43.824 1.00 138.25 ? 415 LYS D O     1 
ATOM   8495  C  CB    . LYS D 2 36  ? -38.918 38.006 -45.863 1.00 154.25 ? 415 LYS D CB    1 
ATOM   8496  N  N     . LEU D 2 37  ? -42.063 37.217 -45.260 1.00 154.15 ? 416 LEU D N     1 
ATOM   8497  C  CA    . LEU D 2 37  ? -43.223 36.794 -44.490 1.00 136.14 ? 416 LEU D CA    1 
ATOM   8498  C  C     . LEU D 2 37  ? -43.038 35.364 -43.984 1.00 140.65 ? 416 LEU D C     1 
ATOM   8499  O  O     . LEU D 2 37  ? -42.189 34.632 -44.483 1.00 149.98 ? 416 LEU D O     1 
ATOM   8500  C  CB    . LEU D 2 37  ? -44.451 36.854 -45.408 1.00 131.05 ? 416 LEU D CB    1 
ATOM   8501  C  CG    . LEU D 2 37  ? -45.464 35.700 -45.314 1.00 130.48 ? 416 LEU D CG    1 
ATOM   8502  C  CD1   . LEU D 2 37  ? -46.581 36.092 -44.363 1.00 143.74 ? 416 LEU D CD1   1 
ATOM   8503  C  CD2   . LEU D 2 37  ? -46.054 35.282 -46.659 1.00 111.86 ? 416 LEU D CD2   1 
ATOM   8504  N  N     . THR D 2 38  ? -43.825 34.970 -42.988 1.00 140.66 ? 417 THR D N     1 
ATOM   8505  C  CA    . THR D 2 38  ? -43.847 33.581 -42.528 1.00 139.80 ? 417 THR D CA    1 
ATOM   8506  C  C     . THR D 2 38  ? -45.211 32.938 -42.799 1.00 142.87 ? 417 THR D C     1 
ATOM   8507  O  O     . THR D 2 38  ? -46.132 33.043 -41.986 1.00 149.54 ? 417 THR D O     1 
ATOM   8508  C  CB    . THR D 2 38  ? -43.531 33.472 -41.034 1.00 143.64 ? 417 THR D CB    1 
ATOM   8509  O  OG1   . THR D 2 38  ? -42.130 33.680 -40.815 1.00 139.14 ? 417 THR D OG1   1 
ATOM   8510  C  CG2   . THR D 2 38  ? -43.915 32.098 -40.524 1.00 156.02 ? 417 THR D CG2   1 
ATOM   8511  N  N     . PRO D 2 39  ? -45.336 32.253 -43.948 1.00 139.47 ? 418 PRO D N     1 
ATOM   8512  C  CA    . PRO D 2 39  ? -46.604 31.775 -44.511 1.00 141.75 ? 418 PRO D CA    1 
ATOM   8513  C  C     . PRO D 2 39  ? -47.054 30.464 -43.896 1.00 142.62 ? 418 PRO D C     1 
ATOM   8514  O  O     . PRO D 2 39  ? -46.242 29.774 -43.283 1.00 154.58 ? 418 PRO D O     1 
ATOM   8515  C  CB    . PRO D 2 39  ? -46.259 31.532 -45.982 1.00 145.88 ? 418 PRO D CB    1 
ATOM   8516  C  CG    . PRO D 2 39  ? -44.786 31.916 -46.137 1.00 144.85 ? 418 PRO D CG    1 
ATOM   8517  C  CD    . PRO D 2 39  ? -44.201 31.846 -44.780 1.00 138.08 ? 418 PRO D CD    1 
ATOM   8518  N  N     . ALA D 2 40  ? -48.327 30.118 -44.074 1.00 138.21 ? 419 ALA D N     1 
ATOM   8519  C  CA    . ALA D 2 40  ? -48.864 28.874 -43.524 1.00 145.81 ? 419 ALA D CA    1 
ATOM   8520  C  C     . ALA D 2 40  ? -48.557 27.688 -44.431 1.00 155.88 ? 419 ALA D C     1 
ATOM   8521  O  O     . ALA D 2 40  ? -48.305 27.856 -45.624 1.00 159.90 ? 419 ALA D O     1 
ATOM   8522  C  CB    . ALA D 2 40  ? -50.358 28.987 -43.299 1.00 146.54 ? 419 ALA D CB    1 
ATOM   8523  N  N     . GLN D 2 41  ? -48.585 26.488 -43.863 1.00 156.17 ? 420 GLN D N     1 
ATOM   8524  C  CA    . GLN D 2 41  ? -48.286 25.292 -44.633 1.00 161.18 ? 420 GLN D CA    1 
ATOM   8525  C  C     . GLN D 2 41  ? -49.212 25.209 -45.849 1.00 181.59 ? 420 GLN D C     1 
ATOM   8526  O  O     . GLN D 2 41  ? -48.765 25.344 -46.989 1.00 193.35 ? 420 GLN D O     1 
ATOM   8527  C  CB    . GLN D 2 41  ? -48.412 24.040 -43.757 1.00 148.58 ? 420 GLN D CB    1 
ATOM   8528  C  CG    . GLN D 2 41  ? -47.261 23.054 -43.909 1.00 148.07 ? 420 GLN D CG    1 
ATOM   8529  C  CD    . GLN D 2 41  ? -45.969 23.573 -43.301 1.00 175.16 ? 420 GLN D CD    1 
ATOM   8530  O  OE1   . GLN D 2 41  ? -45.987 24.355 -42.345 1.00 187.97 ? 420 GLN D OE1   1 
ATOM   8531  N  NE2   . GLN D 2 41  ? -44.835 23.141 -43.851 1.00 183.69 ? 420 GLN D NE2   1 
ATOM   8532  N  N     . SER D 2 42  ? -50.504 25.008 -45.600 1.00 176.27 ? 421 SER D N     1 
ATOM   8533  C  CA    . SER D 2 42  ? -51.490 24.900 -46.671 1.00 165.63 ? 421 SER D CA    1 
ATOM   8534  C  C     . SER D 2 42  ? -51.810 26.248 -47.310 1.00 165.81 ? 421 SER D C     1 
ATOM   8535  O  O     . SER D 2 42  ? -51.945 27.252 -46.613 1.00 165.85 ? 421 SER D O     1 
ATOM   8536  C  CB    . SER D 2 42  ? -52.785 24.294 -46.124 1.00 162.43 ? 421 SER D CB    1 
ATOM   8537  N  N     . LYS D 2 43  ? -51.966 26.263 -48.632 1.00 170.66 ? 422 LYS D N     1 
ATOM   8538  C  CA    . LYS D 2 43  ? -52.436 27.463 -49.325 1.00 165.46 ? 422 LYS D CA    1 
ATOM   8539  C  C     . LYS D 2 43  ? -53.910 27.263 -49.675 1.00 166.67 ? 422 LYS D C     1 
ATOM   8540  O  O     . LYS D 2 43  ? -54.263 26.730 -50.722 1.00 158.88 ? 422 LYS D O     1 
ATOM   8541  C  CB    . LYS D 2 43  ? -51.581 27.798 -50.557 1.00 152.52 ? 422 LYS D CB    1 
ATOM   8542  N  N     . ASN D 2 44  ? -54.754 27.719 -48.757 1.00 180.74 ? 423 ASN D N     1 
ATOM   8543  C  CA    . ASN D 2 44  ? -56.187 27.472 -48.768 1.00 185.64 ? 423 ASN D CA    1 
ATOM   8544  C  C     . ASN D 2 44  ? -56.941 28.749 -48.374 1.00 185.44 ? 423 ASN D C     1 
ATOM   8545  O  O     . ASN D 2 44  ? -57.229 28.967 -47.198 1.00 185.04 ? 423 ASN D O     1 
ATOM   8546  C  CB    . ASN D 2 44  ? -56.498 26.321 -47.792 1.00 185.91 ? 423 ASN D CB    1 
ATOM   8547  C  CG    . ASN D 2 44  ? -57.899 26.406 -47.186 1.00 184.58 ? 423 ASN D CG    1 
ATOM   8548  O  OD1   . ASN D 2 44  ? -58.809 26.985 -47.777 1.00 188.62 ? 423 ASN D OD1   1 
ATOM   8549  N  ND2   . ASN D 2 44  ? -58.072 25.820 -45.999 1.00 173.79 ? 423 ASN D ND2   1 
ATOM   8550  N  N     . PRO D 2 45  ? -57.238 29.612 -49.359 1.00 184.24 ? 424 PRO D N     1 
ATOM   8551  C  CA    . PRO D 2 45  ? -57.914 30.896 -49.128 1.00 179.87 ? 424 PRO D CA    1 
ATOM   8552  C  C     . PRO D 2 45  ? -59.278 30.781 -48.463 1.00 177.93 ? 424 PRO D C     1 
ATOM   8553  O  O     . PRO D 2 45  ? -59.981 31.781 -48.377 1.00 173.62 ? 424 PRO D O     1 
ATOM   8554  C  CB    . PRO D 2 45  ? -58.081 31.459 -50.541 1.00 178.93 ? 424 PRO D CB    1 
ATOM   8555  C  CG    . PRO D 2 45  ? -56.919 30.921 -51.272 1.00 182.71 ? 424 PRO D CG    1 
ATOM   8556  C  CD    . PRO D 2 45  ? -56.711 29.521 -50.731 1.00 188.74 ? 424 PRO D CD    1 
ATOM   8557  N  N     . ALA D 2 46  ? -59.646 29.594 -47.999 1.00 183.37 ? 425 ALA D N     1 
ATOM   8558  C  CA    . ALA D 2 46  ? -60.940 29.408 -47.353 1.00 188.85 ? 425 ALA D CA    1 
ATOM   8559  C  C     . ALA D 2 46  ? -60.854 29.542 -45.834 1.00 189.46 ? 425 ALA D C     1 
ATOM   8560  O  O     . ALA D 2 46  ? -61.720 30.159 -45.216 1.00 182.93 ? 425 ALA D O     1 
ATOM   8561  C  CB    . ALA D 2 46  ? -61.537 28.065 -47.737 1.00 197.94 ? 425 ALA D CB    1 
ATOM   8562  N  N     . LYS D 2 47  ? -59.816 28.954 -45.241 1.00 198.84 ? 426 LYS D N     1 
ATOM   8563  C  CA    . LYS D 2 47  ? -59.562 29.069 -43.802 1.00 193.42 ? 426 LYS D CA    1 
ATOM   8564  C  C     . LYS D 2 47  ? -58.065 29.217 -43.546 1.00 183.49 ? 426 LYS D C     1 
ATOM   8565  O  O     . LYS D 2 47  ? -57.373 28.254 -43.214 1.00 196.79 ? 426 LYS D O     1 
ATOM   8566  C  CB    . LYS D 2 47  ? -60.086 27.824 -43.072 1.00 197.81 ? 426 LYS D CB    1 
ATOM   8567  C  CG    . LYS D 2 47  ? -59.547 27.641 -41.654 1.00 193.22 ? 426 LYS D CG    1 
ATOM   8568  C  CD    . LYS D 2 47  ? -59.400 26.162 -41.294 1.00 185.81 ? 426 LYS D CD    1 
ATOM   8569  C  CE    . LYS D 2 47  ? -58.649 25.987 -39.980 1.00 170.47 ? 426 LYS D CE    1 
ATOM   8570  N  NZ    . LYS D 2 47  ? -58.543 24.561 -39.573 1.00 166.29 ? 426 LYS D NZ    1 
ATOM   8571  N  N     . ASN D 2 48  ? -57.563 30.427 -43.720 1.00 157.68 ? 427 ASN D N     1 
ATOM   8572  C  CA    . ASN D 2 48  ? -56.173 30.715 -43.420 1.00 145.10 ? 427 ASN D CA    1 
ATOM   8573  C  C     . ASN D 2 48  ? -56.086 32.206 -43.102 1.00 151.54 ? 427 ASN D C     1 
ATOM   8574  O  O     . ASN D 2 48  ? -56.678 33.030 -43.806 1.00 149.03 ? 427 ASN D O     1 
ATOM   8575  C  CB    . ASN D 2 48  ? -55.246 30.280 -44.577 1.00 121.57 ? 427 ASN D CB    1 
ATOM   8576  N  N     . GLU D 2 49  ? -55.357 32.550 -42.043 1.00 145.86 ? 428 GLU D N     1 
ATOM   8577  C  CA    . GLU D 2 49  ? -55.376 33.905 -41.507 1.00 127.71 ? 428 GLU D CA    1 
ATOM   8578  C  C     . GLU D 2 49  ? -54.019 34.576 -41.663 1.00 131.76 ? 428 GLU D C     1 
ATOM   8579  O  O     . GLU D 2 49  ? -52.979 33.929 -41.547 1.00 122.94 ? 428 GLU D O     1 
ATOM   8580  C  CB    . GLU D 2 49  ? -55.790 33.899 -40.032 1.00 121.41 ? 428 GLU D CB    1 
ATOM   8581  C  CG    . GLU D 2 49  ? -57.114 33.196 -39.706 1.00 128.92 ? 428 GLU D CG    1 
ATOM   8582  C  CD    . GLU D 2 49  ? -57.294 32.889 -38.197 1.00 164.02 ? 428 GLU D CD    1 
ATOM   8583  O  OE1   . GLU D 2 49  ? -56.288 32.836 -37.443 1.00 158.09 ? 428 GLU D OE1   1 
ATOM   8584  O  OE2   . GLU D 2 49  ? -58.455 32.686 -37.771 1.00 158.70 ? 428 GLU D OE2   1 
ATOM   8585  N  N     . LEU D 2 50  ? -54.043 35.882 -41.916 1.00 139.38 ? 429 LEU D N     1 
ATOM   8586  C  CA    . LEU D 2 50  ? -52.824 36.664 -42.081 1.00 128.95 ? 429 LEU D CA    1 
ATOM   8587  C  C     . LEU D 2 50  ? -52.728 37.625 -40.930 1.00 127.74 ? 429 LEU D C     1 
ATOM   8588  O  O     . LEU D 2 50  ? -53.558 38.515 -40.785 1.00 133.25 ? 429 LEU D O     1 
ATOM   8589  C  CB    . LEU D 2 50  ? -52.871 37.499 -43.346 1.00 126.34 ? 429 LEU D CB    1 
ATOM   8590  C  CG    . LEU D 2 50  ? -51.523 37.941 -43.917 1.00 124.81 ? 429 LEU D CG    1 
ATOM   8591  C  CD1   . LEU D 2 50  ? -51.662 39.339 -44.482 1.00 132.28 ? 429 LEU D CD1   1 
ATOM   8592  C  CD2   . LEU D 2 50  ? -50.405 37.879 -42.905 1.00 110.08 ? 429 LEU D CD2   1 
ATOM   8593  N  N     . TYR D 2 51  ? -51.672 37.482 -40.147 1.00 128.42 ? 430 TYR D N     1 
ATOM   8594  C  CA    . TYR D 2 51  ? -51.534 38.237 -38.925 1.00 123.44 ? 430 TYR D CA    1 
ATOM   8595  C  C     . TYR D 2 51  ? -50.529 39.336 -39.167 1.00 124.30 ? 430 TYR D C     1 
ATOM   8596  O  O     . TYR D 2 51  ? -49.351 39.073 -39.407 1.00 120.33 ? 430 TYR D O     1 
ATOM   8597  C  CB    . TYR D 2 51  ? -51.055 37.321 -37.805 1.00 131.21 ? 430 TYR D CB    1 
ATOM   8598  C  CG    . TYR D 2 51  ? -52.161 36.596 -37.075 1.00 141.31 ? 430 TYR D CG    1 
ATOM   8599  C  CD1   . TYR D 2 51  ? -52.903 37.238 -36.095 1.00 147.47 ? 430 TYR D CD1   1 
ATOM   8600  C  CD2   . TYR D 2 51  ? -52.449 35.269 -37.346 1.00 142.73 ? 430 TYR D CD2   1 
ATOM   8601  C  CE1   . TYR D 2 51  ? -53.908 36.585 -35.407 1.00 147.31 ? 430 TYR D CE1   1 
ATOM   8602  C  CE2   . TYR D 2 51  ? -53.460 34.608 -36.667 1.00 147.74 ? 430 TYR D CE2   1 
ATOM   8603  C  CZ    . TYR D 2 51  ? -54.186 35.274 -35.697 1.00 149.47 ? 430 TYR D CZ    1 
ATOM   8604  O  OH    . TYR D 2 51  ? -55.195 34.632 -35.014 1.00 150.12 ? 430 TYR D OH    1 
ATOM   8605  N  N     . LEU D 2 52  ? -50.999 40.574 -39.063 1.00 126.81 ? 431 LEU D N     1 
ATOM   8606  C  CA    . LEU D 2 52  ? -50.180 41.736 -39.353 1.00 111.67 ? 431 LEU D CA    1 
ATOM   8607  C  C     . LEU D 2 52  ? -49.701 42.272 -38.031 1.00 108.83 ? 431 LEU D C     1 
ATOM   8608  O  O     . LEU D 2 52  ? -50.468 42.447 -37.093 1.00 115.59 ? 431 LEU D O     1 
ATOM   8609  C  CB    . LEU D 2 52  ? -50.955 42.790 -40.137 1.00 116.87 ? 431 LEU D CB    1 
ATOM   8610  C  CG    . LEU D 2 52  ? -51.249 42.463 -41.608 1.00 127.62 ? 431 LEU D CG    1 
ATOM   8611  C  CD1   . LEU D 2 52  ? -52.169 43.503 -42.220 1.00 133.10 ? 431 LEU D CD1   1 
ATOM   8612  C  CD2   . LEU D 2 52  ? -49.970 42.346 -42.430 1.00 123.43 ? 431 LEU D CD2   1 
ATOM   8613  N  N     . VAL D 2 53  ? -48.401 42.486 -37.962 1.00 114.83 ? 432 VAL D N     1 
ATOM   8614  C  CA    . VAL D 2 53  ? -47.721 42.687 -36.705 1.00 115.42 ? 432 VAL D CA    1 
ATOM   8615  C  C     . VAL D 2 53  ? -46.822 43.905 -36.807 1.00 121.42 ? 432 VAL D C     1 
ATOM   8616  O  O     . VAL D 2 53  ? -46.477 44.343 -37.909 1.00 126.86 ? 432 VAL D O     1 
ATOM   8617  C  CB    . VAL D 2 53  ? -46.936 41.425 -36.337 1.00 119.89 ? 432 VAL D CB    1 
ATOM   8618  C  CG1   . VAL D 2 53  ? -45.703 41.756 -35.529 1.00 132.58 ? 432 VAL D CG1   1 
ATOM   8619  C  CG2   . VAL D 2 53  ? -47.846 40.463 -35.600 1.00 111.12 ? 432 VAL D CG2   1 
ATOM   8620  N  N     . GLU D 2 54  ? -46.419 44.429 -35.655 1.00 111.83 ? 433 GLU D N     1 
ATOM   8621  C  CA    . GLU D 2 54  ? -45.900 45.778 -35.571 1.00 101.24 ? 433 GLU D CA    1 
ATOM   8622  C  C     . GLU D 2 54  ? -44.401 45.781 -35.826 1.00 104.02 ? 433 GLU D C     1 
ATOM   8623  O  O     . GLU D 2 54  ? -43.814 46.833 -36.080 1.00 109.44 ? 433 GLU D O     1 
ATOM   8624  C  CB    . GLU D 2 54  ? -46.215 46.341 -34.193 1.00 119.08 ? 433 GLU D CB    1 
ATOM   8625  C  CG    . GLU D 2 54  ? -46.436 47.834 -34.150 1.00 150.52 ? 433 GLU D CG    1 
ATOM   8626  C  CD    . GLU D 2 54  ? -46.405 48.366 -32.735 1.00 174.22 ? 433 GLU D CD    1 
ATOM   8627  O  OE1   . GLU D 2 54  ? -45.292 48.480 -32.193 1.00 189.87 ? 433 GLU D OE1   1 
ATOM   8628  O  OE2   . GLU D 2 54  ? -47.478 48.665 -32.162 1.00 177.33 ? 433 GLU D OE2   1 
ATOM   8629  N  N     . GLY D 2 55  ? -43.793 44.592 -35.805 1.00 112.57 ? 434 GLY D N     1 
ATOM   8630  C  CA    . GLY D 2 55  ? -42.359 44.457 -36.018 1.00 112.37 ? 434 GLY D CA    1 
ATOM   8631  C  C     . GLY D 2 55  ? -41.769 43.056 -35.919 1.00 118.03 ? 434 GLY D C     1 
ATOM   8632  O  O     . GLY D 2 55  ? -42.472 42.085 -35.658 1.00 115.09 ? 434 GLY D O     1 
ATOM   8633  N  N     . ASP D 2 56  ? -40.458 42.960 -36.128 1.00 133.63 ? 435 ASP D N     1 
ATOM   8634  C  CA    . ASP D 2 56  ? -39.754 41.680 -36.131 1.00 127.15 ? 435 ASP D CA    1 
ATOM   8635  C  C     . ASP D 2 56  ? -39.747 41.043 -34.755 1.00 122.22 ? 435 ASP D C     1 
ATOM   8636  O  O     . ASP D 2 56  ? -39.938 39.836 -34.628 1.00 129.31 ? 435 ASP D O     1 
ATOM   8637  C  CB    . ASP D 2 56  ? -38.321 41.834 -36.670 1.00 135.23 ? 435 ASP D CB    1 
ATOM   8638  C  CG    . ASP D 2 56  ? -38.278 42.029 -38.205 1.00 153.56 ? 435 ASP D CG    1 
ATOM   8639  O  OD1   . ASP D 2 56  ? -38.260 41.027 -38.957 1.00 140.36 ? 435 ASP D OD1   1 
ATOM   8640  O  OD2   . ASP D 2 56  ? -38.250 43.193 -38.666 1.00 168.78 ? 435 ASP D OD2   1 
ATOM   8641  N  N     . SER D 2 57  ? -39.524 41.850 -33.723 1.00 129.48 ? 436 SER D N     1 
ATOM   8642  C  CA    . SER D 2 57  ? -39.512 41.332 -32.351 1.00 127.89 ? 436 SER D CA    1 
ATOM   8643  C  C     . SER D 2 57  ? -40.856 40.660 -32.001 1.00 119.54 ? 436 SER D C     1 
ATOM   8644  O  O     . SER D 2 57  ? -40.892 39.535 -31.494 1.00 113.05 ? 436 SER D O     1 
ATOM   8645  C  CB    . SER D 2 57  ? -39.063 42.412 -31.328 1.00 78.07  ? 436 SER D CB    1 
ATOM   8646  N  N     . ALA D 2 58  ? -41.958 41.346 -32.287 1.00 110.58 ? 437 ALA D N     1 
ATOM   8647  C  CA    . ALA D 2 58  ? -43.276 40.757 -32.095 1.00 115.59 ? 437 ALA D CA    1 
ATOM   8648  C  C     . ALA D 2 58  ? -43.477 39.582 -33.043 1.00 118.06 ? 437 ALA D C     1 
ATOM   8649  O  O     . ALA D 2 58  ? -44.138 38.600 -32.707 1.00 121.41 ? 437 ALA D O     1 
ATOM   8650  C  CB    . ALA D 2 58  ? -44.349 41.794 -32.333 1.00 117.92 ? 437 ALA D CB    1 
ATOM   8651  N  N     . GLY D 2 59  ? -42.927 39.712 -34.245 1.00 108.08 ? 438 GLY D N     1 
ATOM   8652  C  CA    . GLY D 2 59  ? -43.051 38.682 -35.251 1.00 102.94 ? 438 GLY D CA    1 
ATOM   8653  C  C     . GLY D 2 59  ? -42.585 37.353 -34.708 1.00 115.78 ? 438 GLY D C     1 
ATOM   8654  O  O     . GLY D 2 59  ? -43.199 36.321 -34.964 1.00 114.93 ? 438 GLY D O     1 
ATOM   8655  N  N     . GLY D 2 60  ? -41.492 37.382 -33.953 1.00 118.31 ? 439 GLY D N     1 
ATOM   8656  C  CA    . GLY D 2 60  ? -40.952 36.171 -33.367 1.00 123.52 ? 439 GLY D CA    1 
ATOM   8657  C  C     . GLY D 2 60  ? -41.975 35.503 -32.474 1.00 120.10 ? 439 GLY D C     1 
ATOM   8658  O  O     . GLY D 2 60  ? -42.280 34.317 -32.611 1.00 116.32 ? 439 GLY D O     1 
ATOM   8659  N  N     . SER D 2 61  ? -42.513 36.287 -31.552 1.00 115.62 ? 440 SER D N     1 
ATOM   8660  C  CA    . SER D 2 61  ? -43.515 35.796 -30.629 1.00 119.08 ? 440 SER D CA    1 
ATOM   8661  C  C     . SER D 2 61  ? -44.678 35.186 -31.391 1.00 117.38 ? 440 SER D C     1 
ATOM   8662  O  O     . SER D 2 61  ? -45.152 34.102 -31.064 1.00 114.27 ? 440 SER D O     1 
ATOM   8663  C  CB    . SER D 2 61  ? -43.973 36.940 -29.743 1.00 129.84 ? 440 SER D CB    1 
ATOM   8664  O  OG    . SER D 2 61  ? -42.919 37.306 -28.869 1.00 140.78 ? 440 SER D OG    1 
ATOM   8665  N  N     . ALA D 2 62  ? -45.131 35.883 -32.422 1.00 121.54 ? 441 ALA D N     1 
ATOM   8666  C  CA    . ALA D 2 62  ? -46.214 35.373 -33.243 1.00 118.69 ? 441 ALA D CA    1 
ATOM   8667  C  C     . ALA D 2 62  ? -45.831 34.048 -33.884 1.00 129.69 ? 441 ALA D C     1 
ATOM   8668  O  O     . ALA D 2 62  ? -46.485 33.033 -33.656 1.00 137.72 ? 441 ALA D O     1 
ATOM   8669  C  CB    . ALA D 2 62  ? -46.568 36.373 -34.305 1.00 116.57 ? 441 ALA D CB    1 
ATOM   8670  N  N     . LYS D 2 63  ? -44.757 34.050 -34.668 1.00 129.12 ? 442 LYS D N     1 
ATOM   8671  C  CA    . LYS D 2 63  ? -44.371 32.851 -35.399 1.00 131.17 ? 442 LYS D CA    1 
ATOM   8672  C  C     . LYS D 2 63  ? -44.320 31.669 -34.446 1.00 136.68 ? 442 LYS D C     1 
ATOM   8673  O  O     . LYS D 2 63  ? -44.800 30.584 -34.760 1.00 156.61 ? 442 LYS D O     1 
ATOM   8674  C  CB    . LYS D 2 63  ? -43.027 33.024 -36.119 1.00 111.14 ? 442 LYS D CB    1 
ATOM   8675  N  N     . GLN D 2 64  ? -43.745 31.889 -33.274 1.00 110.72 ? 443 GLN D N     1 
ATOM   8676  C  CA    . GLN D 2 64  ? -43.549 30.809 -32.327 1.00 123.07 ? 443 GLN D CA    1 
ATOM   8677  C  C     . GLN D 2 64  ? -44.864 30.226 -31.804 1.00 137.46 ? 443 GLN D C     1 
ATOM   8678  O  O     . GLN D 2 64  ? -45.169 29.055 -32.041 1.00 155.93 ? 443 GLN D O     1 
ATOM   8679  C  CB    . GLN D 2 64  ? -42.639 31.275 -31.194 1.00 129.72 ? 443 GLN D CB    1 
ATOM   8680  C  CG    . GLN D 2 64  ? -41.187 31.349 -31.610 1.00 130.38 ? 443 GLN D CG    1 
ATOM   8681  C  CD    . GLN D 2 64  ? -40.389 32.349 -30.810 1.00 142.82 ? 443 GLN D CD    1 
ATOM   8682  O  OE1   . GLN D 2 64  ? -40.534 32.455 -29.589 1.00 153.66 ? 443 GLN D OE1   1 
ATOM   8683  N  NE2   . GLN D 2 64  ? -39.526 33.089 -31.497 1.00 146.85 ? 443 GLN D NE2   1 
ATOM   8684  N  N     . GLY D 2 65  ? -45.641 31.031 -31.093 1.00 139.74 ? 444 GLY D N     1 
ATOM   8685  C  CA    . GLY D 2 65  ? -46.940 30.581 -30.623 1.00 148.65 ? 444 GLY D CA    1 
ATOM   8686  C  C     . GLY D 2 65  ? -47.944 30.757 -31.741 1.00 148.94 ? 444 GLY D C     1 
ATOM   8687  O  O     . GLY D 2 65  ? -48.333 31.877 -32.050 1.00 166.75 ? 444 GLY D O     1 
ATOM   8688  N  N     . ARG D 2 66  ? -48.366 29.663 -32.358 1.00 136.14 ? 445 ARG D N     1 
ATOM   8689  C  CA    . ARG D 2 66  ? -49.114 29.773 -33.599 1.00 141.70 ? 445 ARG D CA    1 
ATOM   8690  C  C     . ARG D 2 66  ? -49.296 28.407 -34.226 1.00 163.74 ? 445 ARG D C     1 
ATOM   8691  O  O     . ARG D 2 66  ? -48.430 27.539 -34.089 1.00 178.92 ? 445 ARG D O     1 
ATOM   8692  C  CB    . ARG D 2 66  ? -48.364 30.705 -34.560 1.00 123.94 ? 445 ARG D CB    1 
ATOM   8693  C  CG    . ARG D 2 66  ? -48.479 30.366 -36.025 1.00 117.55 ? 445 ARG D CG    1 
ATOM   8694  C  CD    . ARG D 2 66  ? -47.085 30.300 -36.612 1.00 130.91 ? 445 ARG D CD    1 
ATOM   8695  N  NE    . ARG D 2 66  ? -47.048 30.291 -38.073 1.00 147.25 ? 445 ARG D NE    1 
ATOM   8696  C  CZ    . ARG D 2 66  ? -46.051 29.777 -38.794 1.00 145.36 ? 445 ARG D CZ    1 
ATOM   8697  N  NH1   . ARG D 2 66  ? -45.014 29.205 -38.191 1.00 140.22 ? 445 ARG D NH1   1 
ATOM   8698  N  NH2   . ARG D 2 66  ? -46.097 29.823 -40.119 1.00 141.61 ? 445 ARG D NH2   1 
ATOM   8699  N  N     . ASP D 2 67  ? -50.426 28.222 -34.905 1.00 158.61 ? 446 ASP D N     1 
ATOM   8700  C  CA    . ASP D 2 67  ? -50.709 26.984 -35.628 1.00 158.22 ? 446 ASP D CA    1 
ATOM   8701  C  C     . ASP D 2 67  ? -50.310 27.149 -37.097 1.00 151.58 ? 446 ASP D C     1 
ATOM   8702  O  O     . ASP D 2 67  ? -51.023 27.780 -37.876 1.00 148.56 ? 446 ASP D O     1 
ATOM   8703  C  CB    . ASP D 2 67  ? -52.192 26.632 -35.485 1.00 156.93 ? 446 ASP D CB    1 
ATOM   8704  C  CG    . ASP D 2 67  ? -52.536 25.284 -36.076 1.00 160.39 ? 446 ASP D CG    1 
ATOM   8705  O  OD1   . ASP D 2 67  ? -53.560 24.698 -35.656 1.00 160.72 ? 446 ASP D OD1   1 
ATOM   8706  O  OD2   . ASP D 2 67  ? -51.791 24.814 -36.961 1.00 163.55 ? 446 ASP D OD2   1 
ATOM   8707  N  N     . ARG D 2 68  ? -49.163 26.590 -37.471 1.00 144.69 ? 447 ARG D N     1 
ATOM   8708  C  CA    . ARG D 2 68  ? -48.596 26.861 -38.790 1.00 144.87 ? 447 ARG D CA    1 
ATOM   8709  C  C     . ARG D 2 68  ? -49.405 26.267 -39.943 1.00 165.63 ? 447 ARG D C     1 
ATOM   8710  O  O     . ARG D 2 68  ? -49.061 26.462 -41.112 1.00 178.26 ? 447 ARG D O     1 
ATOM   8711  C  CB    . ARG D 2 68  ? -47.138 26.402 -38.864 1.00 130.03 ? 447 ARG D CB    1 
ATOM   8712  C  CG    . ARG D 2 68  ? -46.902 24.989 -38.387 1.00 130.86 ? 447 ARG D CG    1 
ATOM   8713  C  CD    . ARG D 2 68  ? -45.423 24.723 -38.195 1.00 135.87 ? 447 ARG D CD    1 
ATOM   8714  N  NE    . ARG D 2 68  ? -44.612 25.491 -39.129 1.00 141.95 ? 447 ARG D NE    1 
ATOM   8715  C  CZ    . ARG D 2 68  ? -43.372 25.887 -38.867 1.00 154.04 ? 447 ARG D CZ    1 
ATOM   8716  N  NH1   . ARG D 2 68  ? -42.812 25.578 -37.703 1.00 155.75 ? 447 ARG D NH1   1 
ATOM   8717  N  NH2   . ARG D 2 68  ? -42.694 26.594 -39.762 1.00 156.36 ? 447 ARG D NH2   1 
ATOM   8718  N  N     . LYS D 2 69  ? -50.480 25.554 -39.612 1.00 162.44 ? 448 LYS D N     1 
ATOM   8719  C  CA    . LYS D 2 69  ? -51.339 24.954 -40.627 1.00 152.48 ? 448 LYS D CA    1 
ATOM   8720  C  C     . LYS D 2 69  ? -52.090 26.035 -41.405 1.00 158.93 ? 448 LYS D C     1 
ATOM   8721  O  O     . LYS D 2 69  ? -52.127 26.005 -42.633 1.00 169.21 ? 448 LYS D O     1 
ATOM   8722  C  CB    . LYS D 2 69  ? -52.308 23.934 -40.010 1.00 135.38 ? 448 LYS D CB    1 
ATOM   8723  N  N     . PHE D 2 70  ? -52.669 26.997 -40.689 1.00 150.36 ? 449 PHE D N     1 
ATOM   8724  C  CA    . PHE D 2 70  ? -53.425 28.071 -41.326 1.00 148.07 ? 449 PHE D CA    1 
ATOM   8725  C  C     . PHE D 2 70  ? -53.226 29.405 -40.606 1.00 153.77 ? 449 PHE D C     1 
ATOM   8726  O  O     . PHE D 2 70  ? -54.197 30.081 -40.263 1.00 152.59 ? 449 PHE D O     1 
ATOM   8727  C  CB    . PHE D 2 70  ? -54.898 27.727 -41.232 1.00 148.27 ? 449 PHE D CB    1 
ATOM   8728  C  CG    . PHE D 2 70  ? -55.427 27.809 -39.828 1.00 160.01 ? 449 PHE D CG    1 
ATOM   8729  C  CD1   . PHE D 2 70  ? -54.736 27.222 -38.784 1.00 161.96 ? 449 PHE D CD1   1 
ATOM   8730  C  CD2   . PHE D 2 70  ? -56.592 28.495 -39.545 1.00 166.35 ? 449 PHE D CD2   1 
ATOM   8731  C  CE1   . PHE D 2 70  ? -55.202 27.308 -37.486 1.00 161.91 ? 449 PHE D CE1   1 
ATOM   8732  C  CE2   . PHE D 2 70  ? -57.064 28.580 -38.245 1.00 167.26 ? 449 PHE D CE2   1 
ATOM   8733  C  CZ    . PHE D 2 70  ? -56.365 27.988 -37.216 1.00 162.21 ? 449 PHE D CZ    1 
ATOM   8734  N  N     . GLN D 2 71  ? -51.974 29.800 -40.400 1.00 153.11 ? 450 GLN D N     1 
ATOM   8735  C  CA    . GLN D 2 71  ? -51.677 31.105 -39.815 1.00 133.80 ? 450 GLN D CA    1 
ATOM   8736  C  C     . GLN D 2 71  ? -50.367 31.665 -40.344 1.00 135.29 ? 450 GLN D C     1 
ATOM   8737  O  O     . GLN D 2 71  ? -49.294 31.094 -40.136 1.00 136.84 ? 450 GLN D O     1 
ATOM   8738  C  CB    . GLN D 2 71  ? -51.662 31.041 -38.291 1.00 113.06 ? 450 GLN D CB    1 
ATOM   8739  C  CG    . GLN D 2 71  ? -53.042 31.241 -37.685 1.00 119.11 ? 450 GLN D CG    1 
ATOM   8740  C  CD    . GLN D 2 71  ? -53.061 31.083 -36.166 1.00 143.92 ? 450 GLN D CD    1 
ATOM   8741  O  OE1   . GLN D 2 71  ? -54.035 31.459 -35.511 1.00 157.08 ? 450 GLN D OE1   1 
ATOM   8742  N  NE2   . GLN D 2 71  ? -51.987 30.522 -35.601 1.00 141.58 ? 450 GLN D NE2   1 
ATOM   8743  N  N     . ALA D 2 72  ? -50.467 32.812 -40.999 1.00 126.94 ? 451 ALA D N     1 
ATOM   8744  C  CA    . ALA D 2 72  ? -49.330 33.439 -41.638 1.00 117.65 ? 451 ALA D CA    1 
ATOM   8745  C  C     . ALA D 2 72  ? -49.041 34.698 -40.870 1.00 122.97 ? 451 ALA D C     1 
ATOM   8746  O  O     . ALA D 2 72  ? -49.919 35.254 -40.214 1.00 129.64 ? 451 ALA D O     1 
ATOM   8747  C  CB    . ALA D 2 72  ? -49.635 33.761 -43.066 1.00 123.02 ? 451 ALA D CB    1 
ATOM   8748  N  N     . ILE D 2 73  ? -47.792 35.127 -40.915 1.00 116.84 ? 452 ILE D N     1 
ATOM   8749  C  CA    . ILE D 2 73  ? -47.370 36.248 -40.107 1.00 110.31 ? 452 ILE D CA    1 
ATOM   8750  C  C     . ILE D 2 73  ? -46.514 37.231 -40.904 1.00 121.41 ? 452 ILE D C     1 
ATOM   8751  O  O     . ILE D 2 73  ? -45.507 36.867 -41.509 1.00 125.33 ? 452 ILE D O     1 
ATOM   8752  C  CB    . ILE D 2 73  ? -46.656 35.727 -38.877 1.00 104.26 ? 452 ILE D CB    1 
ATOM   8753  C  CG1   . ILE D 2 73  ? -47.701 35.096 -37.953 1.00 113.98 ? 452 ILE D CG1   1 
ATOM   8754  C  CG2   . ILE D 2 73  ? -45.863 36.841 -38.205 1.00 90.47  ? 452 ILE D CG2   1 
ATOM   8755  C  CD1   . ILE D 2 73  ? -47.174 33.960 -37.090 1.00 121.59 ? 452 ILE D CD1   1 
ATOM   8756  N  N     . LEU D 2 74  ? -46.932 38.487 -40.905 1.00 131.66 ? 453 LEU D N     1 
ATOM   8757  C  CA    . LEU D 2 74  ? -46.301 39.489 -41.745 1.00 127.49 ? 453 LEU D CA    1 
ATOM   8758  C  C     . LEU D 2 74  ? -45.970 40.727 -40.922 1.00 127.68 ? 453 LEU D C     1 
ATOM   8759  O  O     . LEU D 2 74  ? -46.864 41.447 -40.485 1.00 135.04 ? 453 LEU D O     1 
ATOM   8760  C  CB    . LEU D 2 74  ? -47.232 39.838 -42.909 1.00 120.94 ? 453 LEU D CB    1 
ATOM   8761  C  CG    . LEU D 2 74  ? -46.585 40.608 -44.042 1.00 106.02 ? 453 LEU D CG    1 
ATOM   8762  C  CD1   . LEU D 2 74  ? -46.812 42.073 -43.870 1.00 105.75 ? 453 LEU D CD1   1 
ATOM   8763  C  CD2   . LEU D 2 74  ? -45.131 40.285 -44.005 1.00 110.97 ? 453 LEU D CD2   1 
ATOM   8764  N  N     . PRO D 2 75  ? -44.676 40.957 -40.685 1.00 124.73 ? 454 PRO D N     1 
ATOM   8765  C  CA    . PRO D 2 75  ? -44.156 42.099 -39.933 1.00 123.54 ? 454 PRO D CA    1 
ATOM   8766  C  C     . PRO D 2 75  ? -44.172 43.391 -40.722 1.00 124.63 ? 454 PRO D C     1 
ATOM   8767  O  O     . PRO D 2 75  ? -43.933 43.398 -41.931 1.00 128.99 ? 454 PRO D O     1 
ATOM   8768  C  CB    . PRO D 2 75  ? -42.699 41.712 -39.678 1.00 124.70 ? 454 PRO D CB    1 
ATOM   8769  C  CG    . PRO D 2 75  ? -42.665 40.258 -39.808 1.00 132.69 ? 454 PRO D CG    1 
ATOM   8770  C  CD    . PRO D 2 75  ? -43.642 39.944 -40.896 1.00 131.95 ? 454 PRO D CD    1 
ATOM   8771  N  N     . LEU D 2 76  ? -44.452 44.481 -40.017 1.00 118.49 ? 455 LEU D N     1 
ATOM   8772  C  CA    . LEU D 2 76  ? -44.336 45.820 -40.569 1.00 121.14 ? 455 LEU D CA    1 
ATOM   8773  C  C     . LEU D 2 76  ? -43.237 46.540 -39.810 1.00 123.46 ? 455 LEU D C     1 
ATOM   8774  O  O     . LEU D 2 76  ? -42.919 46.178 -38.682 1.00 125.02 ? 455 LEU D O     1 
ATOM   8775  C  CB    . LEU D 2 76  ? -45.655 46.569 -40.421 1.00 109.72 ? 455 LEU D CB    1 
ATOM   8776  C  CG    . LEU D 2 76  ? -46.783 45.665 -40.902 1.00 107.10 ? 455 LEU D CG    1 
ATOM   8777  C  CD1   . LEU D 2 76  ? -48.142 46.361 -40.834 1.00 101.98 ? 455 LEU D CD1   1 
ATOM   8778  C  CD2   . LEU D 2 76  ? -46.460 45.181 -42.323 1.00 101.80 ? 455 LEU D CD2   1 
ATOM   8779  N  N     . ARG D 2 77  ? -42.643 47.549 -40.431 1.00 124.69 ? 456 ARG D N     1 
ATOM   8780  C  CA    . ARG D 2 77  ? -41.592 48.302 -39.774 1.00 115.45 ? 456 ARG D CA    1 
ATOM   8781  C  C     . ARG D 2 77  ? -42.207 49.528 -39.089 1.00 119.34 ? 456 ARG D C     1 
ATOM   8782  O  O     . ARG D 2 77  ? -42.143 50.642 -39.603 1.00 130.35 ? 456 ARG D O     1 
ATOM   8783  C  CB    . ARG D 2 77  ? -40.435 48.622 -40.754 1.00 92.19  ? 456 ARG D CB    1 
ATOM   8784  N  N     . GLY D 2 78  ? -42.836 49.297 -37.939 1.00 107.21 ? 457 GLY D N     1 
ATOM   8785  C  CA    . GLY D 2 78  ? -43.382 50.364 -37.116 1.00 105.54 ? 457 GLY D CA    1 
ATOM   8786  C  C     . GLY D 2 78  ? -44.599 51.086 -37.667 1.00 110.88 ? 457 GLY D C     1 
ATOM   8787  O  O     . GLY D 2 78  ? -45.427 50.493 -38.358 1.00 123.15 ? 457 GLY D O     1 
ATOM   8788  N  N     . LYS D 2 79  ? -44.702 52.379 -37.359 1.00 103.73 ? 458 LYS D N     1 
ATOM   8789  C  CA    . LYS D 2 79  ? -45.836 53.198 -37.796 1.00 108.50 ? 458 LYS D CA    1 
ATOM   8790  C  C     . LYS D 2 79  ? -46.006 53.208 -39.314 1.00 115.40 ? 458 LYS D C     1 
ATOM   8791  O  O     . LYS D 2 79  ? -45.067 53.501 -40.048 1.00 130.16 ? 458 LYS D O     1 
ATOM   8792  C  CB    . LYS D 2 79  ? -45.712 54.628 -37.242 1.00 91.41  ? 458 LYS D CB    1 
ATOM   8793  C  CG    . LYS D 2 79  ? -45.855 54.701 -35.718 1.00 93.21  ? 458 LYS D CG    1 
ATOM   8794  C  CD    . LYS D 2 79  ? -46.117 56.125 -35.207 1.00 107.05 ? 458 LYS D CD    1 
ATOM   8795  C  CE    . LYS D 2 79  ? -45.941 56.264 -33.671 1.00 101.71 ? 458 LYS D CE    1 
ATOM   8796  N  NZ    . LYS D 2 79  ? -47.156 55.878 -32.890 1.00 95.54  ? 458 LYS D NZ    1 
ATOM   8797  N  N     . VAL D 2 80  ? -47.213 52.887 -39.773 1.00 112.05 ? 459 VAL D N     1 
ATOM   8798  C  CA    . VAL D 2 80  ? -47.508 52.775 -41.203 1.00 126.86 ? 459 VAL D CA    1 
ATOM   8799  C  C     . VAL D 2 80  ? -47.885 54.110 -41.855 1.00 129.33 ? 459 VAL D C     1 
ATOM   8800  O  O     . VAL D 2 80  ? -48.492 54.970 -41.211 1.00 122.67 ? 459 VAL D O     1 
ATOM   8801  C  CB    . VAL D 2 80  ? -48.667 51.802 -41.445 1.00 126.23 ? 459 VAL D CB    1 
ATOM   8802  C  CG1   . VAL D 2 80  ? -48.929 51.678 -42.933 1.00 126.73 ? 459 VAL D CG1   1 
ATOM   8803  C  CG2   . VAL D 2 80  ? -48.369 50.441 -40.810 1.00 125.36 ? 459 VAL D CG2   1 
ATOM   8804  N  N     . ILE D 2 81  ? -47.536 54.268 -43.135 1.00 111.50 ? 460 ILE D N     1 
ATOM   8805  C  CA    . ILE D 2 81  ? -47.842 55.484 -43.891 1.00 109.85 ? 460 ILE D CA    1 
ATOM   8806  C  C     . ILE D 2 81  ? -49.309 55.875 -43.771 1.00 119.89 ? 460 ILE D C     1 
ATOM   8807  O  O     . ILE D 2 81  ? -50.208 55.048 -43.974 1.00 115.20 ? 460 ILE D O     1 
ATOM   8808  C  CB    . ILE D 2 81  ? -47.564 55.274 -45.384 1.00 123.84 ? 460 ILE D CB    1 
ATOM   8809  C  CG1   . ILE D 2 81  ? -46.537 54.140 -45.560 1.00 161.04 ? 460 ILE D CG1   1 
ATOM   8810  C  CG2   . ILE D 2 81  ? -47.129 56.583 -46.048 1.00 92.72  ? 460 ILE D CG2   1 
ATOM   8811  C  CD1   . ILE D 2 81  ? -46.550 53.418 -46.910 1.00 159.37 ? 460 ILE D CD1   1 
ATOM   8812  N  N     . ASN D 2 82  ? -49.560 57.138 -43.446 1.00 117.05 ? 461 ASN D N     1 
ATOM   8813  C  CA    . ASN D 2 82  ? -50.921 57.634 -43.506 1.00 112.72 ? 461 ASN D CA    1 
ATOM   8814  C  C     . ASN D 2 82  ? -51.353 57.718 -44.960 1.00 132.70 ? 461 ASN D C     1 
ATOM   8815  O  O     . ASN D 2 82  ? -50.974 58.641 -45.687 1.00 134.04 ? 461 ASN D O     1 
ATOM   8816  C  CB    . ASN D 2 82  ? -51.071 58.979 -42.818 1.00 103.10 ? 461 ASN D CB    1 
ATOM   8817  C  CG    . ASN D 2 82  ? -52.520 59.432 -42.762 1.00 116.84 ? 461 ASN D CG    1 
ATOM   8818  O  OD1   . ASN D 2 82  ? -53.344 58.989 -43.553 1.00 122.92 ? 461 ASN D OD1   1 
ATOM   8819  N  ND2   . ASN D 2 82  ? -52.836 60.308 -41.826 1.00 124.28 ? 461 ASN D ND2   1 
ATOM   8820  N  N     . THR D 2 83  ? -52.144 56.734 -45.372 1.00 138.74 ? 462 THR D N     1 
ATOM   8821  C  CA    . THR D 2 83  ? -52.566 56.584 -46.758 1.00 136.82 ? 462 THR D CA    1 
ATOM   8822  C  C     . THR D 2 83  ? -53.594 57.626 -47.172 1.00 128.78 ? 462 THR D C     1 
ATOM   8823  O  O     . THR D 2 83  ? -54.016 57.680 -48.322 1.00 133.25 ? 462 THR D O     1 
ATOM   8824  C  CB    . THR D 2 83  ? -53.180 55.199 -46.943 1.00 149.10 ? 462 THR D CB    1 
ATOM   8825  O  OG1   . THR D 2 83  ? -54.234 55.014 -45.984 1.00 146.50 ? 462 THR D OG1   1 
ATOM   8826  C  CG2   . THR D 2 83  ? -52.114 54.132 -46.723 1.00 157.18 ? 462 THR D CG2   1 
ATOM   8827  N  N     . ALA D 2 84  ? -53.999 58.454 -46.222 1.00 119.38 ? 463 ALA D N     1 
ATOM   8828  C  CA    . ALA D 2 84  ? -55.000 59.468 -46.491 1.00 114.34 ? 463 ALA D CA    1 
ATOM   8829  C  C     . ALA D 2 84  ? -54.404 60.861 -46.378 1.00 119.31 ? 463 ALA D C     1 
ATOM   8830  O  O     . ALA D 2 84  ? -55.119 61.854 -46.368 1.00 132.24 ? 463 ALA D O     1 
ATOM   8831  C  CB    . ALA D 2 84  ? -56.150 59.306 -45.558 1.00 104.05 ? 463 ALA D CB    1 
ATOM   8832  N  N     . LYS D 2 85  ? -53.085 60.928 -46.303 1.00 119.70 ? 464 LYS D N     1 
ATOM   8833  C  CA    . LYS D 2 85  ? -52.410 62.202 -46.133 1.00 125.42 ? 464 LYS D CA    1 
ATOM   8834  C  C     . LYS D 2 85  ? -51.299 62.340 -47.177 1.00 136.93 ? 464 LYS D C     1 
ATOM   8835  O  O     . LYS D 2 85  ? -50.795 63.439 -47.417 1.00 141.75 ? 464 LYS D O     1 
ATOM   8836  C  CB    . LYS D 2 85  ? -51.859 62.315 -44.696 1.00 118.83 ? 464 LYS D CB    1 
ATOM   8837  C  CG    . LYS D 2 85  ? -51.677 63.740 -44.172 1.00 112.82 ? 464 LYS D CG    1 
ATOM   8838  C  CD    . LYS D 2 85  ? -51.168 63.767 -42.730 1.00 115.10 ? 464 LYS D CD    1 
ATOM   8839  C  CE    . LYS D 2 85  ? -52.269 63.445 -41.691 1.00 124.85 ? 464 LYS D CE    1 
ATOM   8840  N  NZ    . LYS D 2 85  ? -51.863 63.600 -40.238 1.00 118.03 ? 464 LYS D NZ    1 
ATOM   8841  N  N     . ALA D 2 86  ? -50.929 61.222 -47.802 1.00 137.98 ? 465 ALA D N     1 
ATOM   8842  C  CA    . ALA D 2 86  ? -49.909 61.231 -48.847 1.00 157.62 ? 465 ALA D CA    1 
ATOM   8843  C  C     . ALA D 2 86  ? -50.558 60.959 -50.195 1.00 182.95 ? 465 ALA D C     1 
ATOM   8844  O  O     . ALA D 2 86  ? -51.748 60.633 -50.248 1.00 194.78 ? 465 ALA D O     1 
ATOM   8845  C  CB    . ALA D 2 86  ? -48.864 60.200 -48.558 1.00 165.48 ? 465 ALA D CB    1 
ATOM   8846  N  N     . LYS D 2 87  ? -49.796 61.080 -51.283 1.00 190.79 ? 466 LYS D N     1 
ATOM   8847  C  CA    . LYS D 2 87  ? -50.393 60.892 -52.602 1.00 193.00 ? 466 LYS D CA    1 
ATOM   8848  C  C     . LYS D 2 87  ? -50.443 59.418 -53.003 1.00 202.19 ? 466 LYS D C     1 
ATOM   8849  O  O     . LYS D 2 87  ? -50.549 58.539 -52.153 1.00 212.62 ? 466 LYS D O     1 
ATOM   8850  C  CB    . LYS D 2 87  ? -49.631 61.700 -53.656 1.00 183.80 ? 466 LYS D CB    1 
ATOM   8851  N  N     . MET D 2 88  ? -50.346 59.144 -54.297 1.00 197.25 ? 467 MET D N     1 
ATOM   8852  C  CA    . MET D 2 88  ? -50.396 57.770 -54.773 1.00 192.40 ? 467 MET D CA    1 
ATOM   8853  C  C     . MET D 2 88  ? -48.993 57.197 -54.854 1.00 191.25 ? 467 MET D C     1 
ATOM   8854  O  O     . MET D 2 88  ? -48.720 56.121 -54.329 1.00 191.93 ? 467 MET D O     1 
ATOM   8855  C  CB    . MET D 2 88  ? -51.064 57.716 -56.146 1.00 199.55 ? 467 MET D CB    1 
ATOM   8856  C  CG    . MET D 2 88  ? -51.466 56.322 -56.602 1.00 204.67 ? 467 MET D CG    1 
ATOM   8857  S  SD    . MET D 2 88  ? -52.570 55.477 -55.454 1.00 236.72 ? 467 MET D SD    1 
ATOM   8858  C  CE    . MET D 2 88  ? -53.233 54.192 -56.527 1.00 152.51 ? 467 MET D CE    1 
ATOM   8859  N  N     . ALA D 2 89  ? -48.112 57.924 -55.536 1.00 193.59 ? 468 ALA D N     1 
ATOM   8860  C  CA    . ALA D 2 89  ? -46.739 57.486 -55.759 1.00 196.42 ? 468 ALA D CA    1 
ATOM   8861  C  C     . ALA D 2 89  ? -46.008 57.323 -54.438 1.00 188.03 ? 468 ALA D C     1 
ATOM   8862  O  O     . ALA D 2 89  ? -45.345 56.310 -54.201 1.00 184.08 ? 468 ALA D O     1 
ATOM   8863  C  CB    . ALA D 2 89  ? -46.003 58.470 -56.662 1.00 200.73 ? 468 ALA D CB    1 
ATOM   8864  N  N     . ASP D 2 90  ? -46.139 58.326 -53.578 1.00 178.94 ? 469 ASP D N     1 
ATOM   8865  C  CA    . ASP D 2 90  ? -45.523 58.269 -52.267 1.00 168.56 ? 469 ASP D CA    1 
ATOM   8866  C  C     . ASP D 2 90  ? -45.908 56.947 -51.609 1.00 157.28 ? 469 ASP D C     1 
ATOM   8867  O  O     . ASP D 2 90  ? -45.050 56.231 -51.092 1.00 147.23 ? 469 ASP D O     1 
ATOM   8868  C  CB    . ASP D 2 90  ? -45.969 59.466 -51.427 1.00 162.92 ? 469 ASP D CB    1 
ATOM   8869  N  N     . ILE D 2 91  ? -47.200 56.624 -51.662 1.00 150.10 ? 470 ILE D N     1 
ATOM   8870  C  CA    . ILE D 2 91  ? -47.733 55.386 -51.090 1.00 138.39 ? 470 ILE D CA    1 
ATOM   8871  C  C     . ILE D 2 91  ? -47.178 54.105 -51.709 1.00 134.14 ? 470 ILE D C     1 
ATOM   8872  O  O     . ILE D 2 91  ? -46.462 53.353 -51.050 1.00 114.89 ? 470 ILE D O     1 
ATOM   8873  C  CB    . ILE D 2 91  ? -49.267 55.311 -51.232 1.00 128.05 ? 470 ILE D CB    1 
ATOM   8874  C  CG1   . ILE D 2 91  ? -49.938 56.273 -50.271 1.00 124.83 ? 470 ILE D CG1   1 
ATOM   8875  C  CG2   . ILE D 2 91  ? -49.783 53.894 -50.956 1.00 115.87 ? 470 ILE D CG2   1 
ATOM   8876  C  CD1   . ILE D 2 91  ? -51.370 55.886 -49.991 1.00 132.55 ? 470 ILE D CD1   1 
ATOM   8877  N  N     . LEU D 2 92  ? -47.520 53.854 -52.970 1.00 145.20 ? 471 LEU D N     1 
ATOM   8878  C  CA    . LEU D 2 92  ? -47.176 52.589 -53.611 1.00 150.40 ? 471 LEU D CA    1 
ATOM   8879  C  C     . LEU D 2 92  ? -45.668 52.353 -53.595 1.00 155.48 ? 471 LEU D C     1 
ATOM   8880  O  O     . LEU D 2 92  ? -45.212 51.205 -53.626 1.00 161.75 ? 471 LEU D O     1 
ATOM   8881  C  CB    . LEU D 2 92  ? -47.749 52.501 -55.030 1.00 156.41 ? 471 LEU D CB    1 
ATOM   8882  C  CG    . LEU D 2 92  ? -49.282 52.610 -55.115 1.00 152.02 ? 471 LEU D CG    1 
ATOM   8883  C  CD1   . LEU D 2 92  ? -49.827 51.927 -56.386 1.00 152.23 ? 471 LEU D CD1   1 
ATOM   8884  C  CD2   . LEU D 2 92  ? -49.967 52.057 -53.863 1.00 126.86 ? 471 LEU D CD2   1 
ATOM   8885  N  N     . LYS D 2 93  ? -44.907 53.447 -53.568 1.00 147.29 ? 472 LYS D N     1 
ATOM   8886  C  CA    . LYS D 2 93  ? -43.450 53.391 -53.418 1.00 139.23 ? 472 LYS D CA    1 
ATOM   8887  C  C     . LYS D 2 93  ? -42.942 52.961 -52.020 1.00 144.24 ? 472 LYS D C     1 
ATOM   8888  O  O     . LYS D 2 93  ? -41.785 52.569 -51.880 1.00 150.80 ? 472 LYS D O     1 
ATOM   8889  C  CB    . LYS D 2 93  ? -42.811 54.723 -53.832 1.00 119.59 ? 472 LYS D CB    1 
ATOM   8890  N  N     . ASN D 2 94  ? -43.785 53.039 -50.991 1.00 134.15 ? 473 ASN D N     1 
ATOM   8891  C  CA    . ASN D 2 94  ? -43.365 52.629 -49.647 1.00 142.59 ? 473 ASN D CA    1 
ATOM   8892  C  C     . ASN D 2 94  ? -43.419 51.119 -49.434 1.00 145.18 ? 473 ASN D C     1 
ATOM   8893  O  O     . ASN D 2 94  ? -44.447 50.481 -49.648 1.00 140.88 ? 473 ASN D O     1 
ATOM   8894  C  CB    . ASN D 2 94  ? -44.142 53.356 -48.535 1.00 134.08 ? 473 ASN D CB    1 
ATOM   8895  N  N     . GLU D 2 95  ? -42.299 50.564 -48.985 1.00 144.91 ? 474 GLU D N     1 
ATOM   8896  C  CA    . GLU D 2 95  ? -42.131 49.121 -48.899 1.00 141.01 ? 474 GLU D CA    1 
ATOM   8897  C  C     . GLU D 2 95  ? -43.262 48.426 -48.165 1.00 142.38 ? 474 GLU D C     1 
ATOM   8898  O  O     . GLU D 2 95  ? -43.815 47.448 -48.663 1.00 142.66 ? 474 GLU D O     1 
ATOM   8899  C  CB    . GLU D 2 95  ? -40.787 48.769 -48.262 1.00 147.33 ? 474 GLU D CB    1 
ATOM   8900  C  CG    . GLU D 2 95  ? -39.611 49.112 -49.159 1.00 181.40 ? 474 GLU D CG    1 
ATOM   8901  C  CD    . GLU D 2 95  ? -38.271 48.717 -48.569 1.00 206.54 ? 474 GLU D CD    1 
ATOM   8902  O  OE1   . GLU D 2 95  ? -37.326 48.476 -49.360 1.00 211.96 ? 474 GLU D OE1   1 
ATOM   8903  O  OE2   . GLU D 2 95  ? -38.161 48.649 -47.323 1.00 213.41 ? 474 GLU D OE2   1 
ATOM   8904  N  N     . GLU D 2 96  ? -43.610 48.926 -46.985 1.00 145.09 ? 475 GLU D N     1 
ATOM   8905  C  CA    . GLU D 2 96  ? -44.551 48.208 -46.136 1.00 141.56 ? 475 GLU D CA    1 
ATOM   8906  C  C     . GLU D 2 96  ? -45.933 48.043 -46.735 1.00 142.53 ? 475 GLU D C     1 
ATOM   8907  O  O     . GLU D 2 96  ? -46.520 46.965 -46.648 1.00 138.59 ? 475 GLU D O     1 
ATOM   8908  C  CB    . GLU D 2 96  ? -44.636 48.832 -44.758 1.00 135.48 ? 475 GLU D CB    1 
ATOM   8909  N  N     . ILE D 2 97  ? -46.464 49.104 -47.330 1.00 139.55 ? 476 ILE D N     1 
ATOM   8910  C  CA    . ILE D 2 97  ? -47.727 48.964 -48.047 1.00 133.78 ? 476 ILE D CA    1 
ATOM   8911  C  C     . ILE D 2 97  ? -47.592 47.977 -49.217 1.00 128.91 ? 476 ILE D C     1 
ATOM   8912  O  O     . ILE D 2 97  ? -48.435 47.092 -49.389 1.00 124.41 ? 476 ILE D O     1 
ATOM   8913  C  CB    . ILE D 2 97  ? -48.286 50.324 -48.519 1.00 129.13 ? 476 ILE D CB    1 
ATOM   8914  C  CG1   . ILE D 2 97  ? -48.862 51.081 -47.329 1.00 144.39 ? 476 ILE D CG1   1 
ATOM   8915  C  CG2   . ILE D 2 97  ? -49.405 50.125 -49.505 1.00 114.55 ? 476 ILE D CG2   1 
ATOM   8916  C  CD1   . ILE D 2 97  ? -49.994 50.344 -46.627 1.00 145.55 ? 476 ILE D CD1   1 
ATOM   8917  N  N     . ASN D 2 98  ? -46.532 48.119 -50.013 1.00 129.08 ? 477 ASN D N     1 
ATOM   8918  C  CA    . ASN D 2 98  ? -46.362 47.266 -51.191 1.00 131.16 ? 477 ASN D CA    1 
ATOM   8919  C  C     . ASN D 2 98  ? -46.295 45.783 -50.810 1.00 136.26 ? 477 ASN D C     1 
ATOM   8920  O  O     . ASN D 2 98  ? -46.944 44.942 -51.431 1.00 139.17 ? 477 ASN D O     1 
ATOM   8921  C  CB    . ASN D 2 98  ? -45.187 47.716 -52.096 1.00 102.41 ? 477 ASN D CB    1 
ATOM   8922  N  N     . THR D 2 99  ? -45.529 45.464 -49.779 1.00 130.86 ? 478 THR D N     1 
ATOM   8923  C  CA    . THR D 2 99  ? -45.436 44.082 -49.336 1.00 134.81 ? 478 THR D CA    1 
ATOM   8924  C  C     . THR D 2 99  ? -46.811 43.540 -48.969 1.00 136.41 ? 478 THR D C     1 
ATOM   8925  O  O     . THR D 2 99  ? -47.135 42.400 -49.278 1.00 134.25 ? 478 THR D O     1 
ATOM   8926  C  CB    . THR D 2 99  ? -44.479 43.924 -48.145 1.00 133.45 ? 478 THR D CB    1 
ATOM   8927  O  OG1   . THR D 2 99  ? -44.729 44.975 -47.206 1.00 143.30 ? 478 THR D OG1   1 
ATOM   8928  C  CG2   . THR D 2 99  ? -43.014 44.000 -48.606 1.00 126.26 ? 478 THR D CG2   1 
ATOM   8929  N  N     . MET D 2 100 ? -47.619 44.360 -48.306 1.00 137.47 ? 479 MET D N     1 
ATOM   8930  C  CA    . MET D 2 100 ? -48.975 43.958 -47.942 1.00 128.09 ? 479 MET D CA    1 
ATOM   8931  C  C     . MET D 2 100 ? -49.747 43.586 -49.177 1.00 126.63 ? 479 MET D C     1 
ATOM   8932  O  O     . MET D 2 100 ? -50.303 42.490 -49.289 1.00 122.03 ? 479 MET D O     1 
ATOM   8933  C  CB    . MET D 2 100 ? -49.721 45.099 -47.270 1.00 119.54 ? 479 MET D CB    1 
ATOM   8934  C  CG    . MET D 2 100 ? -49.821 45.009 -45.776 1.00 122.30 ? 479 MET D CG    1 
ATOM   8935  S  SD    . MET D 2 100 ? -50.506 46.550 -45.138 1.00 180.39 ? 479 MET D SD    1 
ATOM   8936  C  CE    . MET D 2 100 ? -49.870 46.498 -43.468 1.00 100.06 ? 479 MET D CE    1 
ATOM   8937  N  N     . ILE D 2 101 ? -49.772 44.523 -50.111 1.00 132.60 ? 480 ILE D N     1 
ATOM   8938  C  CA    . ILE D 2 101 ? -50.553 44.358 -51.321 1.00 140.26 ? 480 ILE D CA    1 
ATOM   8939  C  C     . ILE D 2 101 ? -50.204 43.034 -51.998 1.00 137.56 ? 480 ILE D C     1 
ATOM   8940  O  O     . ILE D 2 101 ? -51.098 42.255 -52.331 1.00 130.08 ? 480 ILE D O     1 
ATOM   8941  C  CB    . ILE D 2 101 ? -50.370 45.578 -52.242 1.00 138.45 ? 480 ILE D CB    1 
ATOM   8942  C  CG1   . ILE D 2 101 ? -50.411 46.860 -51.392 1.00 135.79 ? 480 ILE D CG1   1 
ATOM   8943  C  CG2   . ILE D 2 101 ? -51.456 45.620 -53.289 1.00 136.09 ? 480 ILE D CG2   1 
ATOM   8944  C  CD1   . ILE D 2 101 ? -50.518 48.145 -52.182 1.00 133.31 ? 480 ILE D CD1   1 
ATOM   8945  N  N     . TYR D 2 102 ? -48.908 42.768 -52.155 1.00 135.26 ? 481 TYR D N     1 
ATOM   8946  C  CA    . TYR D 2 102 ? -48.446 41.508 -52.735 1.00 136.26 ? 481 TYR D CA    1 
ATOM   8947  C  C     . TYR D 2 102 ? -48.924 40.272 -51.975 1.00 150.15 ? 481 TYR D C     1 
ATOM   8948  O  O     . TYR D 2 102 ? -49.563 39.401 -52.558 1.00 165.45 ? 481 TYR D O     1 
ATOM   8949  C  CB    . TYR D 2 102 ? -46.920 41.460 -52.890 1.00 125.20 ? 481 TYR D CB    1 
ATOM   8950  N  N     . THR D 2 103 ? -48.620 40.179 -50.683 1.00 141.13 ? 482 THR D N     1 
ATOM   8951  C  CA    . THR D 2 103 ? -48.927 38.948 -49.948 1.00 147.74 ? 482 THR D CA    1 
ATOM   8952  C  C     . THR D 2 103 ? -50.423 38.675 -49.821 1.00 152.77 ? 482 THR D C     1 
ATOM   8953  O  O     . THR D 2 103 ? -50.829 37.570 -49.457 1.00 158.71 ? 482 THR D O     1 
ATOM   8954  C  CB    . THR D 2 103 ? -48.307 38.894 -48.536 1.00 135.38 ? 482 THR D CB    1 
ATOM   8955  O  OG1   . THR D 2 103 ? -49.202 39.503 -47.605 1.00 131.27 ? 482 THR D OG1   1 
ATOM   8956  C  CG2   . THR D 2 103 ? -46.940 39.572 -48.491 1.00 134.92 ? 482 THR D CG2   1 
ATOM   8957  N  N     . ILE D 2 104 ? -51.242 39.676 -50.109 1.00 145.75 ? 483 ILE D N     1 
ATOM   8958  C  CA    . ILE D 2 104 ? -52.680 39.511 -49.969 1.00 143.29 ? 483 ILE D CA    1 
ATOM   8959  C  C     . ILE D 2 104 ? -53.331 39.071 -51.274 1.00 149.42 ? 483 ILE D C     1 
ATOM   8960  O  O     . ILE D 2 104 ? -54.354 38.386 -51.273 1.00 139.92 ? 483 ILE D O     1 
ATOM   8961  C  CB    . ILE D 2 104 ? -53.331 40.793 -49.445 1.00 128.90 ? 483 ILE D CB    1 
ATOM   8962  C  CG1   . ILE D 2 104 ? -52.942 40.986 -47.980 1.00 132.75 ? 483 ILE D CG1   1 
ATOM   8963  C  CG2   . ILE D 2 104 ? -54.834 40.708 -49.559 1.00 112.52 ? 483 ILE D CG2   1 
ATOM   8964  C  CD1   . ILE D 2 104 ? -53.081 42.393 -47.484 1.00 128.76 ? 483 ILE D CD1   1 
ATOM   8965  N  N     . GLY D 2 105 ? -52.725 39.460 -52.387 1.00 164.07 ? 484 GLY D N     1 
ATOM   8966  C  CA    . GLY D 2 105 ? -53.240 39.091 -53.692 1.00 176.94 ? 484 GLY D CA    1 
ATOM   8967  C  C     . GLY D 2 105 ? -54.039 40.193 -54.364 1.00 182.56 ? 484 GLY D C     1 
ATOM   8968  O  O     . GLY D 2 105 ? -53.464 41.100 -54.965 1.00 190.22 ? 484 GLY D O     1 
ATOM   8969  N  N     . ALA D 2 106 ? -55.362 40.101 -54.258 1.00 172.14 ? 485 ALA D N     1 
ATOM   8970  C  CA    . ALA D 2 106 ? -56.300 41.047 -54.872 1.00 173.41 ? 485 ALA D CA    1 
ATOM   8971  C  C     . ALA D 2 106 ? -55.697 42.278 -55.577 1.00 182.32 ? 485 ALA D C     1 
ATOM   8972  O  O     . ALA D 2 106 ? -55.912 42.476 -56.771 1.00 197.73 ? 485 ALA D O     1 
ATOM   8973  C  CB    . ALA D 2 106 ? -57.327 41.467 -53.864 1.00 173.49 ? 485 ALA D CB    1 
ATOM   8974  N  N     . GLY D 2 107 ? -54.960 43.109 -54.845 1.00 173.73 ? 486 GLY D N     1 
ATOM   8975  C  CA    . GLY D 2 107 ? -54.356 44.296 -55.430 1.00 165.00 ? 486 GLY D CA    1 
ATOM   8976  C  C     . GLY D 2 107 ? -55.181 45.521 -55.096 1.00 169.90 ? 486 GLY D C     1 
ATOM   8977  O  O     . GLY D 2 107 ? -56.291 45.392 -54.591 1.00 176.61 ? 486 GLY D O     1 
ATOM   8978  N  N     . VAL D 2 108 ? -54.650 46.707 -55.375 1.00 167.63 ? 487 VAL D N     1 
ATOM   8979  C  CA    . VAL D 2 108 ? -55.348 47.958 -55.062 1.00 162.70 ? 487 VAL D CA    1 
ATOM   8980  C  C     . VAL D 2 108 ? -56.556 48.210 -55.985 1.00 153.01 ? 487 VAL D C     1 
ATOM   8981  O  O     . VAL D 2 108 ? -57.261 49.223 -55.886 1.00 127.96 ? 487 VAL D O     1 
ATOM   8982  C  CB    . VAL D 2 108 ? -54.352 49.133 -55.094 1.00 155.78 ? 487 VAL D CB    1 
ATOM   8983  C  CG1   . VAL D 2 108 ? -53.256 48.899 -54.074 1.00 134.52 ? 487 VAL D CG1   1 
ATOM   8984  C  CG2   . VAL D 2 108 ? -53.741 49.288 -56.491 1.00 158.98 ? 487 VAL D CG2   1 
ATOM   8985  N  N     . ASP D 2 111 ? -58.979 47.745 -60.515 1.00 163.06 ? 490 ASP D N     1 
ATOM   8986  C  CA    . ASP D 2 111 ? -58.406 48.016 -59.204 1.00 157.67 ? 490 ASP D CA    1 
ATOM   8987  C  C     . ASP D 2 111 ? -58.326 46.734 -58.362 1.00 171.04 ? 490 ASP D C     1 
ATOM   8988  O  O     . ASP D 2 111 ? -57.621 45.785 -58.717 1.00 162.50 ? 490 ASP D O     1 
ATOM   8989  C  CB    . ASP D 2 111 ? -59.162 49.154 -58.481 1.00 134.37 ? 490 ASP D CB    1 
ATOM   8990  N  N     . PHE D 2 112 ? -59.060 46.714 -57.254 1.00 185.40 ? 491 PHE D N     1 
ATOM   8991  C  CA    . PHE D 2 112 ? -58.980 45.636 -56.266 1.00 181.69 ? 491 PHE D CA    1 
ATOM   8992  C  C     . PHE D 2 112 ? -59.115 44.234 -56.875 1.00 176.49 ? 491 PHE D C     1 
ATOM   8993  O  O     . PHE D 2 112 ? -58.115 43.631 -57.258 1.00 173.47 ? 491 PHE D O     1 
ATOM   8994  C  CB    . PHE D 2 112 ? -60.003 45.873 -55.130 1.00 183.96 ? 491 PHE D CB    1 
ATOM   8995  C  CG    . PHE D 2 112 ? -59.741 45.072 -53.858 1.00 178.62 ? 491 PHE D CG    1 
ATOM   8996  C  CD1   . PHE D 2 112 ? -60.800 44.680 -53.036 1.00 173.26 ? 491 PHE D CD1   1 
ATOM   8997  C  CD2   . PHE D 2 112 ? -58.454 44.717 -53.482 1.00 168.00 ? 491 PHE D CD2   1 
ATOM   8998  C  CE1   . PHE D 2 112 ? -60.582 43.955 -51.873 1.00 157.38 ? 491 PHE D CE1   1 
ATOM   8999  C  CE2   . PHE D 2 112 ? -58.229 43.992 -52.322 1.00 155.53 ? 491 PHE D CE2   1 
ATOM   9000  C  CZ    . PHE D 2 112 ? -59.296 43.609 -51.519 1.00 150.75 ? 491 PHE D CZ    1 
ATOM   9001  N  N     . SER D 2 113 ? -60.348 43.739 -56.974 1.00 174.98 ? 492 SER D N     1 
ATOM   9002  C  CA    . SER D 2 113 ? -60.617 42.326 -57.267 1.00 174.73 ? 492 SER D CA    1 
ATOM   9003  C  C     . SER D 2 113 ? -60.439 41.525 -55.982 1.00 173.45 ? 492 SER D C     1 
ATOM   9004  O  O     . SER D 2 113 ? -59.944 42.053 -55.000 1.00 173.20 ? 492 SER D O     1 
ATOM   9005  C  CB    . SER D 2 113 ? -59.712 41.789 -58.382 1.00 167.00 ? 492 SER D CB    1 
ATOM   9006  N  N     . ILE D 2 114 ? -60.843 40.262 -55.970 1.00 177.26 ? 493 ILE D N     1 
ATOM   9007  C  CA    . ILE D 2 114 ? -60.827 39.506 -54.719 1.00 182.41 ? 493 ILE D CA    1 
ATOM   9008  C  C     . ILE D 2 114 ? -60.468 38.028 -54.912 1.00 183.98 ? 493 ILE D C     1 
ATOM   9009  O  O     . ILE D 2 114 ? -59.489 37.681 -55.589 1.00 176.33 ? 493 ILE D O     1 
ATOM   9010  C  CB    . ILE D 2 114 ? -62.202 39.608 -53.998 1.00 148.99 ? 493 ILE D CB    1 
ATOM   9011  C  CG1   . ILE D 2 114 ? -62.792 41.015 -54.165 1.00 158.26 ? 493 ILE D CG1   1 
ATOM   9012  C  CG2   . ILE D 2 114 ? -62.100 39.194 -52.522 1.00 110.30 ? 493 ILE D CG2   1 
ATOM   9013  C  CD1   . ILE D 2 114 ? -63.814 41.375 -53.119 1.00 155.31 ? 493 ILE D CD1   1 
ATOM   9014  N  N     . GLU D 2 115 ? -61.256 37.167 -54.277 1.00 183.41 ? 494 GLU D N     1 
ATOM   9015  C  CA    . GLU D 2 115 ? -61.206 35.740 -54.535 1.00 175.39 ? 494 GLU D CA    1 
ATOM   9016  C  C     . GLU D 2 115 ? -62.109 35.481 -55.727 1.00 169.92 ? 494 GLU D C     1 
ATOM   9017  O  O     . GLU D 2 115 ? -62.806 36.389 -56.188 1.00 159.81 ? 494 GLU D O     1 
ATOM   9018  C  CB    . GLU D 2 115 ? -61.708 34.950 -53.328 1.00 171.44 ? 494 GLU D CB    1 
ATOM   9019  N  N     . ALA D 2 117 ? -57.728 35.391 -54.175 1.00 167.78 ? 496 ALA D N     1 
ATOM   9020  C  CA    . ALA D 2 117 ? -56.759 35.385 -53.080 1.00 167.96 ? 496 ALA D CA    1 
ATOM   9021  C  C     . ALA D 2 117 ? -57.287 36.184 -51.873 1.00 157.72 ? 496 ALA D C     1 
ATOM   9022  O  O     . ALA D 2 117 ? -58.188 37.008 -52.024 1.00 151.42 ? 496 ALA D O     1 
ATOM   9023  C  CB    . ALA D 2 117 ? -55.424 35.934 -53.578 1.00 167.60 ? 496 ALA D CB    1 
ATOM   9024  N  N     . ASN D 2 118 ? -56.750 35.952 -50.676 1.00 152.90 ? 497 ASN D N     1 
ATOM   9025  C  CA    . ASN D 2 118 ? -55.661 35.014 -50.419 1.00 157.96 ? 497 ASN D CA    1 
ATOM   9026  C  C     . ASN D 2 118 ? -55.763 34.479 -48.979 1.00 148.22 ? 497 ASN D C     1 
ATOM   9027  O  O     . ASN D 2 118 ? -55.099 33.507 -48.601 1.00 130.48 ? 497 ASN D O     1 
ATOM   9028  C  CB    . ASN D 2 118 ? -54.334 35.741 -50.618 1.00 164.77 ? 497 ASN D CB    1 
ATOM   9029  C  CG    . ASN D 2 118 ? -53.212 34.820 -51.019 1.00 174.50 ? 497 ASN D CG    1 
ATOM   9030  O  OD1   . ASN D 2 118 ? -53.222 33.636 -50.700 1.00 183.07 ? 497 ASN D OD1   1 
ATOM   9031  N  ND2   . ASN D 2 118 ? -52.223 35.366 -51.716 1.00 174.51 ? 497 ASN D ND2   1 
ATOM   9032  N  N     . TYR D 2 119 ? -56.601 35.141 -48.186 1.00 148.20 ? 498 TYR D N     1 
ATOM   9033  C  CA    . TYR D 2 119 ? -56.861 34.772 -46.802 1.00 142.46 ? 498 TYR D CA    1 
ATOM   9034  C  C     . TYR D 2 119 ? -58.311 35.162 -46.485 1.00 145.13 ? 498 TYR D C     1 
ATOM   9035  O  O     . TYR D 2 119 ? -58.818 36.157 -47.010 1.00 128.00 ? 498 TYR D O     1 
ATOM   9036  C  CB    . TYR D 2 119 ? -55.904 35.520 -45.860 1.00 135.13 ? 498 TYR D CB    1 
ATOM   9037  C  CG    . TYR D 2 119 ? -54.413 35.369 -46.159 1.00 142.00 ? 498 TYR D CG    1 
ATOM   9038  C  CD1   . TYR D 2 119 ? -53.601 34.566 -45.358 1.00 141.60 ? 498 TYR D CD1   1 
ATOM   9039  C  CD2   . TYR D 2 119 ? -53.810 36.049 -47.224 1.00 143.59 ? 498 TYR D CD2   1 
ATOM   9040  C  CE1   . TYR D 2 119 ? -52.227 34.423 -45.620 1.00 143.04 ? 498 TYR D CE1   1 
ATOM   9041  C  CE2   . TYR D 2 119 ? -52.434 35.912 -47.493 1.00 147.29 ? 498 TYR D CE2   1 
ATOM   9042  C  CZ    . TYR D 2 119 ? -51.650 35.095 -46.687 1.00 145.03 ? 498 TYR D CZ    1 
ATOM   9043  O  OH    . TYR D 2 119 ? -50.299 34.946 -46.942 1.00 138.95 ? 498 TYR D OH    1 
ATOM   9044  N  N     . ASP D 2 120 ? -58.988 34.392 -45.639 1.00 159.40 ? 499 ASP D N     1 
ATOM   9045  C  CA    . ASP D 2 120 ? -60.355 34.745 -45.271 1.00 164.88 ? 499 ASP D CA    1 
ATOM   9046  C  C     . ASP D 2 120 ? -60.344 35.501 -43.946 1.00 161.21 ? 499 ASP D C     1 
ATOM   9047  O  O     . ASP D 2 120 ? -61.372 35.667 -43.288 1.00 167.77 ? 499 ASP D O     1 
ATOM   9048  C  CB    . ASP D 2 120 ? -61.176 33.455 -45.137 1.00 179.27 ? 499 ASP D CB    1 
ATOM   9049  C  CG    . ASP D 2 120 ? -62.506 33.663 -44.426 1.00 193.51 ? 499 ASP D CG    1 
ATOM   9050  O  OD1   . ASP D 2 120 ? -63.377 34.363 -44.982 1.00 209.78 ? 499 ASP D OD1   1 
ATOM   9051  O  OD2   . ASP D 2 120 ? -62.690 33.109 -43.318 1.00 186.51 ? 499 ASP D OD2   1 
ATOM   9052  N  N     . LYS D 2 121 ? -59.172 36.007 -43.590 1.00 150.93 ? 500 LYS D N     1 
ATOM   9053  C  CA    . LYS D 2 121 ? -59.017 36.853 -42.419 1.00 144.66 ? 500 LYS D CA    1 
ATOM   9054  C  C     . LYS D 2 121 ? -57.717 37.624 -42.518 1.00 150.42 ? 500 LYS D C     1 
ATOM   9055  O  O     . LYS D 2 121 ? -56.639 37.045 -42.662 1.00 157.89 ? 500 LYS D O     1 
ATOM   9056  C  CB    . LYS D 2 121 ? -59.018 36.025 -41.133 1.00 134.14 ? 500 LYS D CB    1 
ATOM   9057  C  CG    . LYS D 2 121 ? -60.343 36.048 -40.399 1.00 124.99 ? 500 LYS D CG    1 
ATOM   9058  C  CD    . LYS D 2 121 ? -60.557 34.797 -39.574 1.00 130.66 ? 500 LYS D CD    1 
ATOM   9059  C  CE    . LYS D 2 121 ? -62.040 34.582 -39.327 1.00 143.93 ? 500 LYS D CE    1 
ATOM   9060  N  NZ    . LYS D 2 121 ? -62.352 33.347 -38.552 1.00 153.21 ? 500 LYS D NZ    1 
ATOM   9061  N  N     . ILE D 2 122 ? -57.814 38.936 -42.418 1.00 143.84 ? 501 ILE D N     1 
ATOM   9062  C  CA    . ILE D 2 122 ? -56.622 39.740 -42.271 1.00 136.63 ? 501 ILE D CA    1 
ATOM   9063  C  C     . ILE D 2 122 ? -56.723 40.404 -40.905 1.00 141.24 ? 501 ILE D C     1 
ATOM   9064  O  O     . ILE D 2 122 ? -57.629 41.194 -40.648 1.00 155.63 ? 501 ILE D O     1 
ATOM   9065  C  CB    . ILE D 2 122 ? -56.492 40.714 -43.432 1.00 117.78 ? 501 ILE D CB    1 
ATOM   9066  C  CG1   . ILE D 2 122 ? -56.250 39.903 -44.698 1.00 127.25 ? 501 ILE D CG1   1 
ATOM   9067  C  CG2   . ILE D 2 122 ? -55.357 41.695 -43.188 1.00 98.61  ? 501 ILE D CG2   1 
ATOM   9068  C  CD1   . ILE D 2 122 ? -56.436 40.677 -45.974 1.00 144.86 ? 501 ILE D CD1   1 
ATOM   9069  N  N     . ILE D 2 123 ? -55.789 40.062 -40.028 1.00 122.61 ? 502 ILE D N     1 
ATOM   9070  C  CA    . ILE D 2 123 ? -55.932 40.349 -38.615 1.00 112.94 ? 502 ILE D CA    1 
ATOM   9071  C  C     . ILE D 2 123 ? -54.858 41.290 -38.119 1.00 116.62 ? 502 ILE D C     1 
ATOM   9072  O  O     . ILE D 2 123 ? -53.670 40.998 -38.197 1.00 122.11 ? 502 ILE D O     1 
ATOM   9073  C  CB    . ILE D 2 123 ? -55.813 39.080 -37.807 1.00 114.61 ? 502 ILE D CB    1 
ATOM   9074  C  CG1   . ILE D 2 123 ? -56.823 38.050 -38.293 1.00 115.34 ? 502 ILE D CG1   1 
ATOM   9075  C  CG2   . ILE D 2 123 ? -56.020 39.387 -36.351 1.00 127.15 ? 502 ILE D CG2   1 
ATOM   9076  C  CD1   . ILE D 2 123 ? -56.820 36.786 -37.462 1.00 117.63 ? 502 ILE D CD1   1 
ATOM   9077  N  N     . ILE D 2 124 ? -55.281 42.395 -37.536 1.00 111.26 ? 503 ILE D N     1 
ATOM   9078  C  CA    . ILE D 2 124 ? -54.344 43.416 -37.177 1.00 106.06 ? 503 ILE D CA    1 
ATOM   9079  C  C     . ILE D 2 124 ? -54.059 43.197 -35.725 1.00 121.60 ? 503 ILE D C     1 
ATOM   9080  O  O     . ILE D 2 124 ? -54.935 43.337 -34.882 1.00 143.96 ? 503 ILE D O     1 
ATOM   9081  C  CB    . ILE D 2 124 ? -54.951 44.770 -37.349 1.00 112.84 ? 503 ILE D CB    1 
ATOM   9082  C  CG1   . ILE D 2 124 ? -55.152 45.067 -38.829 1.00 113.53 ? 503 ILE D CG1   1 
ATOM   9083  C  CG2   . ILE D 2 124 ? -54.065 45.808 -36.672 1.00 115.43 ? 503 ILE D CG2   1 
ATOM   9084  C  CD1   . ILE D 2 124 ? -55.994 46.305 -39.070 1.00 124.58 ? 503 ILE D CD1   1 
ATOM   9085  N  N     . MET D 2 125 ? -52.820 42.837 -35.438 1.00 122.38 ? 504 MET D N     1 
ATOM   9086  C  CA    . MET D 2 125 ? -52.427 42.514 -34.088 1.00 126.30 ? 504 MET D CA    1 
ATOM   9087  C  C     . MET D 2 125 ? -51.255 43.398 -33.718 1.00 136.98 ? 504 MET D C     1 
ATOM   9088  O  O     . MET D 2 125 ? -50.123 43.179 -34.149 1.00 145.31 ? 504 MET D O     1 
ATOM   9089  C  CB    . MET D 2 125 ? -52.062 41.037 -33.999 1.00 124.94 ? 504 MET D CB    1 
ATOM   9090  C  CG    . MET D 2 125 ? -51.537 40.617 -32.655 1.00 132.20 ? 504 MET D CG    1 
ATOM   9091  S  SD    . MET D 2 125 ? -51.444 38.832 -32.513 1.00 118.22 ? 504 MET D SD    1 
ATOM   9092  C  CE    . MET D 2 125 ? -50.594 38.396 -34.021 1.00 164.47 ? 504 MET D CE    1 
ATOM   9093  N  N     . THR D 2 126 ? -51.537 44.393 -32.891 1.00 138.02 ? 505 THR D N     1 
ATOM   9094  C  CA    . THR D 2 126 ? -50.543 45.383 -32.534 1.00 135.68 ? 505 THR D CA    1 
ATOM   9095  C  C     . THR D 2 126 ? -50.265 45.257 -31.054 1.00 138.58 ? 505 THR D C     1 
ATOM   9096  O  O     . THR D 2 126 ? -51.058 44.668 -30.319 1.00 146.61 ? 505 THR D O     1 
ATOM   9097  C  CB    . THR D 2 126 ? -51.055 46.810 -32.816 1.00 130.94 ? 505 THR D CB    1 
ATOM   9098  O  OG1   . THR D 2 126 ? -52.454 46.880 -32.513 1.00 136.12 ? 505 THR D OG1   1 
ATOM   9099  C  CG2   . THR D 2 126 ? -50.840 47.188 -34.276 1.00 128.44 ? 505 THR D CG2   1 
ATOM   9100  N  N     . ASP D 2 127 ? -49.136 45.802 -30.616 1.00 135.93 ? 506 ASP D N     1 
ATOM   9101  C  CA    . ASP D 2 127 ? -48.847 45.852 -29.197 1.00 143.12 ? 506 ASP D CA    1 
ATOM   9102  C  C     . ASP D 2 127 ? -50.076 46.417 -28.492 1.00 127.82 ? 506 ASP D C     1 
ATOM   9103  O  O     . ASP D 2 127 ? -50.947 47.023 -29.122 1.00 117.40 ? 506 ASP D O     1 
ATOM   9104  C  CB    . ASP D 2 127 ? -47.556 46.629 -28.910 1.00 168.44 ? 506 ASP D CB    1 
ATOM   9105  C  CG    . ASP D 2 127 ? -46.311 45.934 -29.490 1.00 173.98 ? 506 ASP D CG    1 
ATOM   9106  O  OD1   . ASP D 2 127 ? -46.474 44.959 -30.256 1.00 157.55 ? 506 ASP D OD1   1 
ATOM   9107  O  OD2   . ASP D 2 127 ? -45.172 46.364 -29.185 1.00 186.74 ? 506 ASP D OD2   1 
ATOM   9108  N  N     . ALA D 2 128 ? -50.147 46.208 -27.185 1.00 126.31 ? 507 ALA D N     1 
ATOM   9109  C  CA    . ALA D 2 128 ? -51.378 46.453 -26.447 1.00 129.48 ? 507 ALA D CA    1 
ATOM   9110  C  C     . ALA D 2 128 ? -51.569 47.908 -26.051 1.00 135.09 ? 507 ALA D C     1 
ATOM   9111  O  O     . ALA D 2 128 ? -52.665 48.308 -25.663 1.00 137.89 ? 507 ALA D O     1 
ATOM   9112  C  CB    . ALA D 2 128 ? -51.422 45.567 -25.206 1.00 133.75 ? 507 ALA D CB    1 
ATOM   9113  N  N     . ASP D 2 129 ? -50.510 48.704 -26.147 1.00 141.87 ? 508 ASP D N     1 
ATOM   9114  C  CA    . ASP D 2 129 ? -50.588 50.059 -25.633 1.00 145.51 ? 508 ASP D CA    1 
ATOM   9115  C  C     . ASP D 2 129 ? -51.283 50.987 -26.615 1.00 133.94 ? 508 ASP D C     1 
ATOM   9116  O  O     . ASP D 2 129 ? -52.017 50.542 -27.494 1.00 139.87 ? 508 ASP D O     1 
ATOM   9117  C  CB    . ASP D 2 129 ? -49.175 50.587 -25.357 1.00 160.01 ? 508 ASP D CB    1 
ATOM   9118  C  CG    . ASP D 2 129 ? -48.278 50.562 -26.598 1.00 169.85 ? 508 ASP D CG    1 
ATOM   9119  O  OD1   . ASP D 2 129 ? -48.803 50.669 -27.727 1.00 176.92 ? 508 ASP D OD1   1 
ATOM   9120  O  OD2   . ASP D 2 129 ? -47.042 50.439 -26.445 1.00 169.70 ? 508 ASP D OD2   1 
ATOM   9121  N  N     . THR D 2 130 ? -50.993 52.273 -26.495 1.00 112.94 ? 509 THR D N     1 
ATOM   9122  C  CA    . THR D 2 130 ? -51.683 53.292 -27.258 1.00 103.73 ? 509 THR D CA    1 
ATOM   9123  C  C     . THR D 2 130 ? -51.034 53.541 -28.606 1.00 116.51 ? 509 THR D C     1 
ATOM   9124  O  O     . THR D 2 130 ? -51.699 53.918 -29.572 1.00 125.80 ? 509 THR D O     1 
ATOM   9125  C  CB    . THR D 2 130 ? -51.788 54.569 -26.462 1.00 112.07 ? 509 THR D CB    1 
ATOM   9126  O  OG1   . THR D 2 130 ? -50.669 54.656 -25.568 1.00 134.81 ? 509 THR D OG1   1 
ATOM   9127  C  CG2   . THR D 2 130 ? -53.067 54.527 -25.648 1.00 105.17 ? 509 THR D CG2   1 
ATOM   9128  N  N     . ASP D 2 131 ? -49.722 53.378 -28.664 1.00 120.01 ? 510 ASP D N     1 
ATOM   9129  C  CA    . ASP D 2 131 ? -49.032 53.452 -29.941 1.00 125.10 ? 510 ASP D CA    1 
ATOM   9130  C  C     . ASP D 2 131 ? -49.539 52.339 -30.858 1.00 134.76 ? 510 ASP D C     1 
ATOM   9131  O  O     . ASP D 2 131 ? -49.540 52.485 -32.078 1.00 146.25 ? 510 ASP D O     1 
ATOM   9132  C  CB    . ASP D 2 131 ? -47.524 53.400 -29.735 1.00 127.52 ? 510 ASP D CB    1 
ATOM   9133  C  CG    . ASP D 2 131 ? -46.989 54.690 -29.144 1.00 125.91 ? 510 ASP D CG    1 
ATOM   9134  O  OD1   . ASP D 2 131 ? -46.981 55.685 -29.900 1.00 117.66 ? 510 ASP D OD1   1 
ATOM   9135  O  OD2   . ASP D 2 131 ? -46.603 54.713 -27.941 1.00 127.32 ? 510 ASP D OD2   1 
ATOM   9136  N  N     . GLY D 2 132 ? -49.967 51.230 -30.259 1.00 127.94 ? 511 GLY D N     1 
ATOM   9137  C  CA    . GLY D 2 132 ? -50.643 50.174 -30.994 1.00 129.97 ? 511 GLY D CA    1 
ATOM   9138  C  C     . GLY D 2 132 ? -51.949 50.664 -31.592 1.00 123.75 ? 511 GLY D C     1 
ATOM   9139  O  O     . GLY D 2 132 ? -52.235 50.456 -32.772 1.00 121.77 ? 511 GLY D O     1 
ATOM   9140  N  N     . ALA D 2 133 ? -52.745 51.325 -30.766 1.00 113.42 ? 512 ALA D N     1 
ATOM   9141  C  CA    . ALA D 2 133 ? -53.996 51.919 -31.217 1.00 111.44 ? 512 ALA D CA    1 
ATOM   9142  C  C     . ALA D 2 133 ? -53.815 52.907 -32.350 1.00 114.33 ? 512 ALA D C     1 
ATOM   9143  O  O     . ALA D 2 133 ? -54.710 53.060 -33.176 1.00 112.59 ? 512 ALA D O     1 
ATOM   9144  C  CB    . ALA D 2 133 ? -54.740 52.585 -30.072 1.00 94.33  ? 512 ALA D CB    1 
ATOM   9145  N  N     . HIS D 2 134 ? -52.695 53.622 -32.372 1.00 110.94 ? 513 HIS D N     1 
ATOM   9146  C  CA    . HIS D 2 134 ? -52.453 54.523 -33.493 1.00 102.08 ? 513 HIS D CA    1 
ATOM   9147  C  C     . HIS D 2 134 ? -52.260 53.729 -34.769 1.00 102.73 ? 513 HIS D C     1 
ATOM   9148  O  O     . HIS D 2 134 ? -52.840 54.046 -35.800 1.00 95.08  ? 513 HIS D O     1 
ATOM   9149  C  CB    . HIS D 2 134 ? -51.245 55.423 -33.267 1.00 90.53  ? 513 HIS D CB    1 
ATOM   9150  C  CG    . HIS D 2 134 ? -51.070 56.461 -34.332 1.00 95.72  ? 513 HIS D CG    1 
ATOM   9151  N  ND1   . HIS D 2 134 ? -49.894 57.151 -34.514 1.00 105.83 ? 513 HIS D ND1   1 
ATOM   9152  C  CD2   . HIS D 2 134 ? -51.927 56.926 -35.273 1.00 109.92 ? 513 HIS D CD2   1 
ATOM   9153  C  CE1   . HIS D 2 134 ? -50.036 57.998 -35.521 1.00 120.16 ? 513 HIS D CE1   1 
ATOM   9154  N  NE2   . HIS D 2 134 ? -51.260 57.884 -35.999 1.00 113.24 ? 513 HIS D NE2   1 
ATOM   9155  N  N     . ILE D 2 135 ? -51.434 52.693 -34.693 1.00 107.08 ? 514 ILE D N     1 
ATOM   9156  C  CA    . ILE D 2 135 ? -51.174 51.868 -35.851 1.00 105.77 ? 514 ILE D CA    1 
ATOM   9157  C  C     . ILE D 2 135 ? -52.462 51.235 -36.343 1.00 114.48 ? 514 ILE D C     1 
ATOM   9158  O  O     . ILE D 2 135 ? -52.699 51.178 -37.542 1.00 118.35 ? 514 ILE D O     1 
ATOM   9159  C  CB    . ILE D 2 135 ? -50.137 50.797 -35.570 1.00 108.84 ? 514 ILE D CB    1 
ATOM   9160  C  CG1   . ILE D 2 135 ? -48.789 51.465 -35.349 1.00 119.80 ? 514 ILE D CG1   1 
ATOM   9161  C  CG2   . ILE D 2 135 ? -50.055 49.827 -36.729 1.00 97.36  ? 514 ILE D CG2   1 
ATOM   9162  C  CD1   . ILE D 2 135 ? -47.614 50.631 -35.810 1.00 130.30 ? 514 ILE D CD1   1 
ATOM   9163  N  N     . GLN D 2 136 ? -53.305 50.765 -35.430 1.00 111.69 ? 515 GLN D N     1 
ATOM   9164  C  CA    . GLN D 2 136 ? -54.591 50.225 -35.860 1.00 115.69 ? 515 GLN D CA    1 
ATOM   9165  C  C     . GLN D 2 136 ? -55.329 51.261 -36.705 1.00 112.45 ? 515 GLN D C     1 
ATOM   9166  O  O     . GLN D 2 136 ? -55.846 50.955 -37.771 1.00 105.97 ? 515 GLN D O     1 
ATOM   9167  C  CB    . GLN D 2 136 ? -55.444 49.808 -34.669 1.00 110.32 ? 515 GLN D CB    1 
ATOM   9168  C  CG    . GLN D 2 136 ? -54.989 48.544 -34.000 1.00 112.07 ? 515 GLN D CG    1 
ATOM   9169  C  CD    . GLN D 2 136 ? -55.689 48.336 -32.686 1.00 125.29 ? 515 GLN D CD    1 
ATOM   9170  O  OE1   . GLN D 2 136 ? -56.683 49.000 -32.392 1.00 123.32 ? 515 GLN D OE1   1 
ATOM   9171  N  NE2   . GLN D 2 136 ? -55.172 47.419 -31.876 1.00 136.10 ? 515 GLN D NE2   1 
ATOM   9172  N  N     . THR D 2 137 ? -55.346 52.494 -36.217 1.00 113.23 ? 516 THR D N     1 
ATOM   9173  C  CA    . THR D 2 137 ? -55.989 53.618 -36.883 1.00 96.13  ? 516 THR D CA    1 
ATOM   9174  C  C     . THR D 2 137 ? -55.456 53.808 -38.288 1.00 100.34 ? 516 THR D C     1 
ATOM   9175  O  O     . THR D 2 137 ? -56.211 53.985 -39.233 1.00 114.15 ? 516 THR D O     1 
ATOM   9176  C  CB    . THR D 2 137 ? -55.689 54.903 -36.136 1.00 102.28 ? 516 THR D CB    1 
ATOM   9177  O  OG1   . THR D 2 137 ? -56.607 55.056 -35.052 1.00 110.91 ? 516 THR D OG1   1 
ATOM   9178  C  CG2   . THR D 2 137 ? -55.829 56.061 -37.051 1.00 113.32 ? 516 THR D CG2   1 
ATOM   9179  N  N     . LEU D 2 138 ? -54.141 53.794 -38.414 1.00 96.50  ? 517 LEU D N     1 
ATOM   9180  C  CA    . LEU D 2 138 ? -53.496 53.910 -39.707 1.00 105.97 ? 517 LEU D CA    1 
ATOM   9181  C  C     . LEU D 2 138 ? -53.783 52.723 -40.646 1.00 119.60 ? 517 LEU D C     1 
ATOM   9182  O  O     . LEU D 2 138 ? -54.073 52.915 -41.827 1.00 126.81 ? 517 LEU D O     1 
ATOM   9183  C  CB    . LEU D 2 138 ? -51.993 54.084 -39.508 1.00 106.82 ? 517 LEU D CB    1 
ATOM   9184  C  CG    . LEU D 2 138 ? -51.628 55.395 -38.828 1.00 109.79 ? 517 LEU D CG    1 
ATOM   9185  C  CD1   . LEU D 2 138 ? -50.315 55.308 -38.071 1.00 111.65 ? 517 LEU D CD1   1 
ATOM   9186  C  CD2   . LEU D 2 138 ? -51.572 56.481 -39.852 1.00 119.02 ? 517 LEU D CD2   1 
ATOM   9187  N  N     . LEU D 2 139 ? -53.676 51.501 -40.135 1.00 121.75 ? 518 LEU D N     1 
ATOM   9188  C  CA    . LEU D 2 139 ? -53.898 50.322 -40.967 1.00 128.95 ? 518 LEU D CA    1 
ATOM   9189  C  C     . LEU D 2 139 ? -55.322 50.283 -41.478 1.00 133.85 ? 518 LEU D C     1 
ATOM   9190  O  O     . LEU D 2 139 ? -55.562 49.945 -42.633 1.00 137.91 ? 518 LEU D O     1 
ATOM   9191  C  CB    . LEU D 2 139 ? -53.577 49.025 -40.228 1.00 125.24 ? 518 LEU D CB    1 
ATOM   9192  C  CG    . LEU D 2 139 ? -52.081 48.739 -40.146 1.00 115.67 ? 518 LEU D CG    1 
ATOM   9193  C  CD1   . LEU D 2 139 ? -51.826 47.521 -39.305 1.00 120.78 ? 518 LEU D CD1   1 
ATOM   9194  C  CD2   . LEU D 2 139 ? -51.502 48.567 -41.519 1.00 80.19  ? 518 LEU D CD2   1 
ATOM   9195  N  N     . LEU D 2 140 ? -56.268 50.617 -40.611 1.00 128.33 ? 519 LEU D N     1 
ATOM   9196  C  CA    . LEU D 2 140 ? -57.664 50.631 -41.012 1.00 119.39 ? 519 LEU D CA    1 
ATOM   9197  C  C     . LEU D 2 140 ? -57.931 51.629 -42.126 1.00 125.37 ? 519 LEU D C     1 
ATOM   9198  O  O     . LEU D 2 140 ? -58.649 51.312 -43.069 1.00 132.99 ? 519 LEU D O     1 
ATOM   9199  C  CB    . LEU D 2 140 ? -58.595 50.892 -39.833 1.00 104.72 ? 519 LEU D CB    1 
ATOM   9200  C  CG    . LEU D 2 140 ? -58.821 49.667 -38.942 1.00 113.82 ? 519 LEU D CG    1 
ATOM   9201  C  CD1   . LEU D 2 140 ? -59.688 50.051 -37.740 1.00 123.44 ? 519 LEU D CD1   1 
ATOM   9202  C  CD2   . LEU D 2 140 ? -59.422 48.471 -39.718 1.00 99.73  ? 519 LEU D CD2   1 
ATOM   9203  N  N     . THR D 2 141 ? -57.381 52.834 -42.034 1.00 114.75 ? 520 THR D N     1 
ATOM   9204  C  CA    . THR D 2 141 ? -57.647 53.791 -43.104 1.00 114.82 ? 520 THR D CA    1 
ATOM   9205  C  C     . THR D 2 141 ? -57.115 53.290 -44.434 1.00 110.73 ? 520 THR D C     1 
ATOM   9206  O  O     . THR D 2 141 ? -57.741 53.510 -45.456 1.00 119.83 ? 520 THR D O     1 
ATOM   9207  C  CB    . THR D 2 141 ? -57.121 55.205 -42.849 1.00 112.60 ? 520 THR D CB    1 
ATOM   9208  O  OG1   . THR D 2 141 ? -55.733 55.265 -43.194 1.00 137.02 ? 520 THR D OG1   1 
ATOM   9209  C  CG2   . THR D 2 141 ? -57.345 55.609 -41.417 1.00 90.33  ? 520 THR D CG2   1 
ATOM   9210  N  N     . PHE D 2 142 ? -55.961 52.631 -44.431 1.00 107.82 ? 521 PHE D N     1 
ATOM   9211  C  CA    . PHE D 2 142 ? -55.428 52.079 -45.673 1.00 108.82 ? 521 PHE D CA    1 
ATOM   9212  C  C     . PHE D 2 142 ? -56.396 51.075 -46.300 1.00 125.04 ? 521 PHE D C     1 
ATOM   9213  O  O     . PHE D 2 142 ? -56.733 51.165 -47.484 1.00 133.74 ? 521 PHE D O     1 
ATOM   9214  C  CB    . PHE D 2 142 ? -54.086 51.402 -45.455 1.00 109.13 ? 521 PHE D CB    1 
ATOM   9215  C  CG    . PHE D 2 142 ? -53.664 50.548 -46.605 1.00 115.96 ? 521 PHE D CG    1 
ATOM   9216  C  CD1   . PHE D 2 142 ? -53.608 49.178 -46.485 1.00 122.68 ? 521 PHE D CD1   1 
ATOM   9217  C  CD2   . PHE D 2 142 ? -53.359 51.119 -47.821 1.00 122.67 ? 521 PHE D CD2   1 
ATOM   9218  C  CE1   . PHE D 2 142 ? -53.230 48.402 -47.547 1.00 132.16 ? 521 PHE D CE1   1 
ATOM   9219  C  CE2   . PHE D 2 142 ? -52.985 50.345 -48.889 1.00 128.54 ? 521 PHE D CE2   1 
ATOM   9220  C  CZ    . PHE D 2 142 ? -52.919 48.986 -48.757 1.00 131.70 ? 521 PHE D CZ    1 
ATOM   9221  N  N     . PHE D 2 143 ? -56.838 50.112 -45.504 1.00 122.54 ? 522 PHE D N     1 
ATOM   9222  C  CA    . PHE D 2 143 ? -57.832 49.171 -45.977 1.00 126.56 ? 522 PHE D CA    1 
ATOM   9223  C  C     . PHE D 2 143 ? -59.098 49.892 -46.412 1.00 131.28 ? 522 PHE D C     1 
ATOM   9224  O  O     . PHE D 2 143 ? -59.596 49.666 -47.508 1.00 120.81 ? 522 PHE D O     1 
ATOM   9225  C  CB    . PHE D 2 143 ? -58.126 48.141 -44.899 1.00 122.48 ? 522 PHE D CB    1 
ATOM   9226  C  CG    . PHE D 2 143 ? -56.995 47.211 -44.674 1.00 138.49 ? 522 PHE D CG    1 
ATOM   9227  C  CD1   . PHE D 2 143 ? -56.067 47.001 -45.679 1.00 142.29 ? 522 PHE D CD1   1 
ATOM   9228  C  CD2   . PHE D 2 143 ? -56.848 46.541 -43.481 1.00 147.25 ? 522 PHE D CD2   1 
ATOM   9229  C  CE1   . PHE D 2 143 ? -55.000 46.145 -45.499 1.00 143.64 ? 522 PHE D CE1   1 
ATOM   9230  C  CE2   . PHE D 2 143 ? -55.783 45.676 -43.298 1.00 156.92 ? 522 PHE D CE2   1 
ATOM   9231  C  CZ    . PHE D 2 143 ? -54.856 45.479 -44.315 1.00 152.14 ? 522 PHE D CZ    1 
ATOM   9232  N  N     . TYR D 2 144 ? -59.612 50.774 -45.566 1.00 131.36 ? 523 TYR D N     1 
ATOM   9233  C  CA    . TYR D 2 144 ? -60.815 51.509 -45.918 1.00 128.16 ? 523 TYR D CA    1 
ATOM   9234  C  C     . TYR D 2 144 ? -60.672 52.287 -47.224 1.00 129.57 ? 523 TYR D C     1 
ATOM   9235  O  O     . TYR D 2 144 ? -61.600 52.316 -48.029 1.00 119.51 ? 523 TYR D O     1 
ATOM   9236  C  CB    . TYR D 2 144 ? -61.236 52.473 -44.804 1.00 116.98 ? 523 TYR D CB    1 
ATOM   9237  C  CG    . TYR D 2 144 ? -62.359 53.351 -45.280 1.00 134.82 ? 523 TYR D CG    1 
ATOM   9238  C  CD1   . TYR D 2 144 ? -63.669 52.895 -45.270 1.00 145.07 ? 523 TYR D CD1   1 
ATOM   9239  C  CD2   . TYR D 2 144 ? -62.104 54.609 -45.810 1.00 144.98 ? 523 TYR D CD2   1 
ATOM   9240  C  CE1   . TYR D 2 144 ? -64.699 53.680 -45.744 1.00 150.04 ? 523 TYR D CE1   1 
ATOM   9241  C  CE2   . TYR D 2 144 ? -63.128 55.404 -46.285 1.00 151.69 ? 523 TYR D CE2   1 
ATOM   9242  C  CZ    . TYR D 2 144 ? -64.423 54.933 -46.248 1.00 153.73 ? 523 TYR D CZ    1 
ATOM   9243  O  OH    . TYR D 2 144 ? -65.445 55.714 -46.724 1.00 159.51 ? 523 TYR D OH    1 
ATOM   9244  N  N     . ARG D 2 145 ? -59.533 52.951 -47.415 1.00 126.82 ? 524 ARG D N     1 
ATOM   9245  C  CA    . ARG D 2 145 ? -59.330 53.787 -48.596 1.00 121.79 ? 524 ARG D CA    1 
ATOM   9246  C  C     . ARG D 2 145 ? -59.188 52.963 -49.867 1.00 134.30 ? 524 ARG D C     1 
ATOM   9247  O  O     . ARG D 2 145 ? -59.949 53.149 -50.815 1.00 157.05 ? 524 ARG D O     1 
ATOM   9248  C  CB    . ARG D 2 145 ? -58.130 54.728 -48.456 1.00 124.77 ? 524 ARG D CB    1 
ATOM   9249  C  CG    . ARG D 2 145 ? -58.241 55.744 -47.317 1.00 145.56 ? 524 ARG D CG    1 
ATOM   9250  C  CD    . ARG D 2 145 ? -59.479 56.645 -47.420 1.00 155.80 ? 524 ARG D CD    1 
ATOM   9251  N  NE    . ARG D 2 145 ? -59.213 58.012 -47.876 1.00 156.58 ? 524 ARG D NE    1 
ATOM   9252  C  CZ    . ARG D 2 145 ? -58.104 58.431 -48.488 1.00 150.99 ? 524 ARG D CZ    1 
ATOM   9253  N  NH1   . ARG D 2 145 ? -57.089 57.610 -48.756 1.00 126.23 ? 524 ARG D NH1   1 
ATOM   9254  N  NH2   . ARG D 2 145 ? -58.017 59.702 -48.843 1.00 160.93 ? 524 ARG D NH2   1 
ATOM   9255  N  N     . TYR D 2 146 ? -58.202 52.075 -49.903 1.00 130.70 ? 525 TYR D N     1 
ATOM   9256  C  CA    . TYR D 2 146 ? -57.985 51.242 -51.090 1.00 142.62 ? 525 TYR D CA    1 
ATOM   9257  C  C     . TYR D 2 146 ? -58.786 49.933 -51.110 1.00 153.24 ? 525 TYR D C     1 
ATOM   9258  O  O     . TYR D 2 146 ? -59.813 49.838 -51.776 1.00 174.25 ? 525 TYR D O     1 
ATOM   9259  C  CB    . TYR D 2 146 ? -56.497 50.991 -51.274 1.00 139.26 ? 525 TYR D CB    1 
ATOM   9260  C  CG    . TYR D 2 146 ? -55.766 52.303 -51.422 1.00 142.69 ? 525 TYR D CG    1 
ATOM   9261  C  CD1   . TYR D 2 146 ? -56.151 53.418 -50.690 1.00 133.67 ? 525 TYR D CD1   1 
ATOM   9262  C  CD2   . TYR D 2 146 ? -54.715 52.440 -52.305 1.00 159.17 ? 525 TYR D CD2   1 
ATOM   9263  C  CE1   . TYR D 2 146 ? -55.509 54.621 -50.830 1.00 137.31 ? 525 TYR D CE1   1 
ATOM   9264  C  CE2   . TYR D 2 146 ? -54.057 53.651 -52.448 1.00 160.03 ? 525 TYR D CE2   1 
ATOM   9265  C  CZ    . TYR D 2 146 ? -54.460 54.733 -51.710 1.00 148.72 ? 525 TYR D CZ    1 
ATOM   9266  O  OH    . TYR D 2 146 ? -53.802 55.927 -51.867 1.00 155.83 ? 525 TYR D OH    1 
ATOM   9267  N  N     . MET D 2 147 ? -58.325 48.941 -50.362 1.00 137.33 ? 526 MET D N     1 
ATOM   9268  C  CA    . MET D 2 147 ? -59.006 47.650 -50.244 1.00 128.43 ? 526 MET D CA    1 
ATOM   9269  C  C     . MET D 2 147 ? -60.452 47.663 -49.715 1.00 129.93 ? 526 MET D C     1 
ATOM   9270  O  O     . MET D 2 147 ? -60.851 46.729 -49.019 1.00 128.33 ? 526 MET D O     1 
ATOM   9271  C  CB    . MET D 2 147 ? -58.158 46.681 -49.425 1.00 130.02 ? 526 MET D CB    1 
ATOM   9272  C  CG    . MET D 2 147 ? -56.819 46.411 -50.075 1.00 136.28 ? 526 MET D CG    1 
ATOM   9273  S  SD    . MET D 2 147 ? -55.798 45.210 -49.213 1.00 151.58 ? 526 MET D SD    1 
ATOM   9274  C  CE    . MET D 2 147 ? -56.312 43.670 -49.949 1.00 400.19 ? 526 MET D CE    1 
ATOM   9275  N  N     . ARG D 2 148 ? -61.221 48.713 -50.012 1.00 128.20 ? 527 ARG D N     1 
ATOM   9276  C  CA    . ARG D 2 148 ? -62.568 48.870 -49.437 1.00 128.30 ? 527 ARG D CA    1 
ATOM   9277  C  C     . ARG D 2 148 ? -63.450 47.619 -49.466 1.00 132.47 ? 527 ARG D C     1 
ATOM   9278  O  O     . ARG D 2 148 ? -64.048 47.254 -48.452 1.00 121.92 ? 527 ARG D O     1 
ATOM   9279  C  CB    . ARG D 2 148 ? -63.348 50.042 -50.060 1.00 119.54 ? 527 ARG D CB    1 
ATOM   9280  C  CG    . ARG D 2 148 ? -64.663 50.363 -49.284 1.00 132.21 ? 527 ARG D CG    1 
ATOM   9281  C  CD    . ARG D 2 148 ? -65.500 51.457 -49.938 1.00 148.79 ? 527 ARG D CD    1 
ATOM   9282  N  NE    . ARG D 2 148 ? -64.656 52.380 -50.700 1.00 173.33 ? 527 ARG D NE    1 
ATOM   9283  C  CZ    . ARG D 2 148 ? -64.018 53.429 -50.184 1.00 171.26 ? 527 ARG D CZ    1 
ATOM   9284  N  NH1   . ARG D 2 148 ? -64.138 53.702 -48.891 1.00 173.88 ? 527 ARG D NH1   1 
ATOM   9285  N  NH2   . ARG D 2 148 ? -63.263 54.210 -50.962 1.00 155.43 ? 527 ARG D NH2   1 
ATOM   9286  N  N     . PRO D 2 149 ? -63.546 46.965 -50.629 1.00 138.46 ? 528 PRO D N     1 
ATOM   9287  C  CA    . PRO D 2 149 ? -64.394 45.774 -50.723 1.00 141.08 ? 528 PRO D CA    1 
ATOM   9288  C  C     . PRO D 2 149 ? -64.041 44.788 -49.616 1.00 142.76 ? 528 PRO D C     1 
ATOM   9289  O  O     . PRO D 2 149 ? -64.922 44.151 -49.035 1.00 143.93 ? 528 PRO D O     1 
ATOM   9290  C  CB    . PRO D 2 149 ? -63.995 45.181 -52.066 1.00 141.59 ? 528 PRO D CB    1 
ATOM   9291  C  CG    . PRO D 2 149 ? -63.409 46.318 -52.820 1.00 140.06 ? 528 PRO D CG    1 
ATOM   9292  C  CD    . PRO D 2 149 ? -62.725 47.161 -51.832 1.00 128.77 ? 528 PRO D CD    1 
ATOM   9293  N  N     . LEU D 2 150 ? -62.746 44.681 -49.336 1.00 133.25 ? 529 LEU D N     1 
ATOM   9294  C  CA    . LEU D 2 150 ? -62.250 43.814 -48.288 1.00 123.43 ? 529 LEU D CA    1 
ATOM   9295  C  C     . LEU D 2 150 ? -62.958 44.142 -46.985 1.00 123.84 ? 529 LEU D C     1 
ATOM   9296  O  O     . LEU D 2 150 ? -63.521 43.261 -46.335 1.00 126.83 ? 529 LEU D O     1 
ATOM   9297  C  CB    . LEU D 2 150 ? -60.748 44.015 -48.123 1.00 128.37 ? 529 LEU D CB    1 
ATOM   9298  C  CG    . LEU D 2 150 ? -59.893 42.754 -48.036 1.00 133.54 ? 529 LEU D CG    1 
ATOM   9299  C  CD1   . LEU D 2 150 ? -58.531 43.082 -47.457 1.00 144.22 ? 529 LEU D CD1   1 
ATOM   9300  C  CD2   . LEU D 2 150 ? -60.584 41.719 -47.200 1.00 126.45 ? 529 LEU D CD2   1 
ATOM   9301  N  N     . VAL D 2 151 ? -62.918 45.416 -46.606 1.00 122.74 ? 530 VAL D N     1 
ATOM   9302  C  CA    . VAL D 2 151 ? -63.526 45.870 -45.356 1.00 126.73 ? 530 VAL D CA    1 
ATOM   9303  C  C     . VAL D 2 151 ? -65.041 45.710 -45.372 1.00 140.43 ? 530 VAL D C     1 
ATOM   9304  O  O     . VAL D 2 151 ? -65.627 45.257 -44.390 1.00 155.37 ? 530 VAL D O     1 
ATOM   9305  C  CB    . VAL D 2 151 ? -63.233 47.353 -45.048 1.00 116.64 ? 530 VAL D CB    1 
ATOM   9306  C  CG1   . VAL D 2 151 ? -63.913 47.749 -43.749 1.00 107.44 ? 530 VAL D CG1   1 
ATOM   9307  C  CG2   . VAL D 2 151 ? -61.734 47.623 -45.003 1.00 108.85 ? 530 VAL D CG2   1 
ATOM   9308  N  N     . GLU D 2 152 ? -65.672 46.111 -46.477 1.00 139.21 ? 531 GLU D N     1 
ATOM   9309  C  CA    . GLU D 2 152 ? -67.123 46.012 -46.613 1.00 140.81 ? 531 GLU D CA    1 
ATOM   9310  C  C     . GLU D 2 152 ? -67.537 44.553 -46.501 1.00 150.16 ? 531 GLU D C     1 
ATOM   9311  O  O     . GLU D 2 152 ? -68.580 44.234 -45.933 1.00 154.44 ? 531 GLU D O     1 
ATOM   9312  C  CB    . GLU D 2 152 ? -67.590 46.614 -47.946 1.00 127.59 ? 531 GLU D CB    1 
ATOM   9313  N  N     . ALA D 2 153 ? -66.699 43.676 -47.046 1.00 150.21 ? 532 ALA D N     1 
ATOM   9314  C  CA    . ALA D 2 153 ? -66.925 42.232 -47.024 1.00 150.71 ? 532 ALA D CA    1 
ATOM   9315  C  C     . ALA D 2 153 ? -67.018 41.643 -45.616 1.00 158.18 ? 532 ALA D C     1 
ATOM   9316  O  O     . ALA D 2 153 ? -67.849 40.776 -45.350 1.00 169.21 ? 532 ALA D O     1 
ATOM   9317  C  CB    . ALA D 2 153 ? -65.831 41.536 -47.800 1.00 148.76 ? 532 ALA D CB    1 
ATOM   9318  N  N     . GLY D 2 154 ? -66.149 42.099 -44.721 1.00 155.57 ? 533 GLY D N     1 
ATOM   9319  C  CA    . GLY D 2 154 ? -66.114 41.581 -43.367 1.00 149.20 ? 533 GLY D CA    1 
ATOM   9320  C  C     . GLY D 2 154 ? -64.925 40.669 -43.156 1.00 144.07 ? 533 GLY D C     1 
ATOM   9321  O  O     . GLY D 2 154 ? -65.035 39.640 -42.490 1.00 143.40 ? 533 GLY D O     1 
ATOM   9322  N  N     . HIS D 2 155 ? -63.786 41.059 -43.725 1.00 146.20 ? 534 HIS D N     1 
ATOM   9323  C  CA    . HIS D 2 155 ? -62.566 40.255 -43.674 1.00 154.77 ? 534 HIS D CA    1 
ATOM   9324  C  C     . HIS D 2 155 ? -61.440 40.881 -42.838 1.00 155.73 ? 534 HIS D C     1 
ATOM   9325  O  O     . HIS D 2 155 ? -60.407 40.247 -42.598 1.00 155.57 ? 534 HIS D O     1 
ATOM   9326  C  CB    . HIS D 2 155 ? -62.048 40.000 -45.084 1.00 151.97 ? 534 HIS D CB    1 
ATOM   9327  C  CG    . HIS D 2 155 ? -62.679 38.828 -45.765 1.00 162.16 ? 534 HIS D CG    1 
ATOM   9328  N  ND1   . HIS D 2 155 ? -64.013 38.510 -45.621 1.00 164.18 ? 534 HIS D ND1   1 
ATOM   9329  C  CD2   . HIS D 2 155 ? -62.166 37.914 -46.622 1.00 166.15 ? 534 HIS D CD2   1 
ATOM   9330  C  CE1   . HIS D 2 155 ? -64.289 37.445 -46.351 1.00 166.34 ? 534 HIS D CE1   1 
ATOM   9331  N  NE2   . HIS D 2 155 ? -63.185 37.062 -46.968 1.00 166.05 ? 534 HIS D NE2   1 
ATOM   9332  N  N     . VAL D 2 156 ? -61.628 42.123 -42.405 1.00 145.49 ? 535 VAL D N     1 
ATOM   9333  C  CA    . VAL D 2 156 ? -60.615 42.794 -41.603 1.00 126.02 ? 535 VAL D CA    1 
ATOM   9334  C  C     . VAL D 2 156 ? -60.937 42.683 -40.131 1.00 125.54 ? 535 VAL D C     1 
ATOM   9335  O  O     . VAL D 2 156 ? -62.002 43.091 -39.676 1.00 130.60 ? 535 VAL D O     1 
ATOM   9336  C  CB    . VAL D 2 156 ? -60.494 44.270 -41.961 1.00 119.22 ? 535 VAL D CB    1 
ATOM   9337  C  CG1   . VAL D 2 156 ? -59.625 44.977 -40.951 1.00 89.51  ? 535 VAL D CG1   1 
ATOM   9338  C  CG2   . VAL D 2 156 ? -59.947 44.431 -43.385 1.00 129.13 ? 535 VAL D CG2   1 
ATOM   9339  N  N     . TYR D 2 157 ? -59.987 42.151 -39.380 1.00 126.77 ? 536 TYR D N     1 
ATOM   9340  C  CA    . TYR D 2 157 ? -60.182 41.895 -37.962 1.00 124.80 ? 536 TYR D CA    1 
ATOM   9341  C  C     . TYR D 2 157 ? -59.172 42.677 -37.117 1.00 129.75 ? 536 TYR D C     1 
ATOM   9342  O  O     . TYR D 2 157 ? -58.105 43.073 -37.586 1.00 139.38 ? 536 TYR D O     1 
ATOM   9343  C  CB    . TYR D 2 157 ? -60.073 40.388 -37.682 1.00 122.57 ? 536 TYR D CB    1 
ATOM   9344  C  CG    . TYR D 2 157 ? -61.197 39.546 -38.288 1.00 131.96 ? 536 TYR D CG    1 
ATOM   9345  C  CD1   . TYR D 2 157 ? -62.239 39.070 -37.495 1.00 127.59 ? 536 TYR D CD1   1 
ATOM   9346  C  CD2   . TYR D 2 157 ? -61.215 39.222 -39.646 1.00 131.07 ? 536 TYR D CD2   1 
ATOM   9347  C  CE1   . TYR D 2 157 ? -63.269 38.302 -38.029 1.00 120.57 ? 536 TYR D CE1   1 
ATOM   9348  C  CE2   . TYR D 2 157 ? -62.246 38.455 -40.185 1.00 122.30 ? 536 TYR D CE2   1 
ATOM   9349  C  CZ    . TYR D 2 157 ? -63.270 38.001 -39.366 1.00 122.22 ? 536 TYR D CZ    1 
ATOM   9350  O  OH    . TYR D 2 157 ? -64.309 37.247 -39.874 1.00 125.60 ? 536 TYR D OH    1 
ATOM   9351  N  N     . ILE D 2 158 ? -59.527 42.931 -35.872 1.00 121.07 ? 537 ILE D N     1 
ATOM   9352  C  CA    . ILE D 2 158 ? -58.561 43.464 -34.940 1.00 123.53 ? 537 ILE D CA    1 
ATOM   9353  C  C     . ILE D 2 158 ? -58.414 42.454 -33.819 1.00 128.87 ? 537 ILE D C     1 
ATOM   9354  O  O     . ILE D 2 158 ? -59.402 42.005 -33.245 1.00 138.37 ? 537 ILE D O     1 
ATOM   9355  C  CB    . ILE D 2 158 ? -59.017 44.802 -34.378 1.00 127.66 ? 537 ILE D CB    1 
ATOM   9356  C  CG1   . ILE D 2 158 ? -59.395 45.749 -35.509 1.00 131.25 ? 537 ILE D CG1   1 
ATOM   9357  C  CG2   . ILE D 2 158 ? -57.917 45.429 -33.561 1.00 122.02 ? 537 ILE D CG2   1 
ATOM   9358  C  CD1   . ILE D 2 158 ? -59.673 47.153 -35.009 1.00 132.16 ? 537 ILE D CD1   1 
ATOM   9359  N  N     . ALA D 2 159 ? -57.177 42.105 -33.497 1.00 125.49 ? 538 ALA D N     1 
ATOM   9360  C  CA    . ALA D 2 159 ? -56.924 41.122 -32.458 1.00 124.47 ? 538 ALA D CA    1 
ATOM   9361  C  C     . ALA D 2 159 ? -56.562 41.874 -31.186 1.00 122.55 ? 538 ALA D C     1 
ATOM   9362  O  O     . ALA D 2 159 ? -55.911 42.924 -31.235 1.00 121.25 ? 538 ALA D O     1 
ATOM   9363  C  CB    . ALA D 2 159 ? -55.829 40.152 -32.877 1.00 126.13 ? 538 ALA D CB    1 
ATOM   9364  N  N     . LEU D 2 160 ? -57.008 41.352 -30.050 1.00 145.03 ? 539 LEU D N     1 
ATOM   9365  C  CA    . LEU D 2 160 ? -57.024 42.135 -28.831 1.00 139.39 ? 539 LEU D CA    1 
ATOM   9366  C  C     . LEU D 2 160 ? -56.149 41.497 -27.754 1.00 131.96 ? 539 LEU D C     1 
ATOM   9367  O  O     . LEU D 2 160 ? -56.659 40.898 -26.821 1.00 138.69 ? 539 LEU D O     1 
ATOM   9368  C  CB    . LEU D 2 160 ? -58.475 42.330 -28.365 1.00 120.63 ? 539 LEU D CB    1 
ATOM   9369  N  N     . PRO D 2 161 ? -54.817 41.642 -27.871 1.00 132.28 ? 540 PRO D N     1 
ATOM   9370  C  CA    . PRO D 2 161 ? -53.872 40.997 -26.956 1.00 120.82 ? 540 PRO D CA    1 
ATOM   9371  C  C     . PRO D 2 161 ? -53.736 41.809 -25.690 1.00 115.99 ? 540 PRO D C     1 
ATOM   9372  O  O     . PRO D 2 161 ? -53.803 43.029 -25.770 1.00 126.94 ? 540 PRO D O     1 
ATOM   9373  C  CB    . PRO D 2 161 ? -52.547 41.074 -27.711 1.00 122.00 ? 540 PRO D CB    1 
ATOM   9374  C  CG    . PRO D 2 161 ? -52.806 41.917 -28.935 1.00 133.21 ? 540 PRO D CG    1 
ATOM   9375  C  CD    . PRO D 2 161 ? -54.117 42.597 -28.737 1.00 141.63 ? 540 PRO D CD    1 
ATOM   9376  N  N     . PRO D 2 162 ? -53.525 41.146 -24.548 1.00 114.90 ? 541 PRO D N     1 
ATOM   9377  C  CA    . PRO D 2 162 ? -53.434 41.723 -23.202 1.00 118.40 ? 541 PRO D CA    1 
ATOM   9378  C  C     . PRO D 2 162 ? -52.359 42.782 -23.076 1.00 127.50 ? 541 PRO D C     1 
ATOM   9379  O  O     . PRO D 2 162 ? -51.352 42.753 -23.791 1.00 127.01 ? 541 PRO D O     1 
ATOM   9380  C  CB    . PRO D 2 162 ? -52.998 40.541 -22.332 1.00 117.76 ? 541 PRO D CB    1 
ATOM   9381  C  CG    . PRO D 2 162 ? -53.393 39.369 -23.057 1.00 133.47 ? 541 PRO D CG    1 
ATOM   9382  C  CD    . PRO D 2 162 ? -53.369 39.691 -24.531 1.00 130.60 ? 541 PRO D CD    1 
ATOM   9383  N  N     . LEU D 2 163 ? -52.574 43.700 -22.143 1.00 122.46 ? 542 LEU D N     1 
ATOM   9384  C  CA    . LEU D 2 163 ? -51.568 44.684 -21.804 1.00 118.60 ? 542 LEU D CA    1 
ATOM   9385  C  C     . LEU D 2 163 ? -50.946 44.297 -20.476 1.00 118.60 ? 542 LEU D C     1 
ATOM   9386  O  O     . LEU D 2 163 ? -49.731 44.208 -20.360 1.00 113.22 ? 542 LEU D O     1 
ATOM   9387  C  CB    . LEU D 2 163 ? -52.213 46.054 -21.702 1.00 119.63 ? 542 LEU D CB    1 
ATOM   9388  C  CG    . LEU D 2 163 ? -51.333 47.272 -21.951 1.00 110.55 ? 542 LEU D CG    1 
ATOM   9389  C  CD1   . LEU D 2 163 ? -51.606 48.223 -20.803 1.00 110.30 ? 542 LEU D CD1   1 
ATOM   9390  C  CD2   . LEU D 2 163 ? -49.846 46.926 -22.035 1.00 101.04 ? 542 LEU D CD2   1 
ATOM   9391  N  N     . TYR D 2 164 ? -51.801 44.068 -19.481 1.00 128.06 ? 543 TYR D N     1 
ATOM   9392  C  CA    . TYR D 2 164 ? -51.379 43.726 -18.125 1.00 125.81 ? 543 TYR D CA    1 
ATOM   9393  C  C     . TYR D 2 164 ? -51.705 42.277 -17.741 1.00 128.88 ? 543 TYR D C     1 
ATOM   9394  O  O     . TYR D 2 164 ? -52.780 41.771 -18.056 1.00 133.46 ? 543 TYR D O     1 
ATOM   9395  C  CB    . TYR D 2 164 ? -52.061 44.661 -17.128 1.00 122.20 ? 543 TYR D CB    1 
ATOM   9396  C  CG    . TYR D 2 164 ? -51.707 46.105 -17.309 1.00 119.03 ? 543 TYR D CG    1 
ATOM   9397  C  CD1   . TYR D 2 164 ? -50.410 46.536 -17.155 1.00 121.34 ? 543 TYR D CD1   1 
ATOM   9398  C  CD2   . TYR D 2 164 ? -52.675 47.039 -17.618 1.00 134.80 ? 543 TYR D CD2   1 
ATOM   9399  C  CE1   . TYR D 2 164 ? -50.077 47.860 -17.318 1.00 138.78 ? 543 TYR D CE1   1 
ATOM   9400  C  CE2   . TYR D 2 164 ? -52.353 48.376 -17.777 1.00 149.23 ? 543 TYR D CE2   1 
ATOM   9401  C  CZ    . TYR D 2 164 ? -51.047 48.782 -17.629 1.00 147.53 ? 543 TYR D CZ    1 
ATOM   9402  O  OH    . TYR D 2 164 ? -50.702 50.110 -17.799 1.00 146.86 ? 543 TYR D OH    1 
ATOM   9403  N  N     . LYS D 2 165 ? -50.772 41.613 -17.063 1.00 119.96 ? 544 LYS D N     1 
ATOM   9404  C  CA    . LYS D 2 165 ? -51.058 40.329 -16.428 1.00 123.69 ? 544 LYS D CA    1 
ATOM   9405  C  C     . LYS D 2 165 ? -50.686 40.379 -14.953 1.00 118.50 ? 544 LYS D C     1 
ATOM   9406  O  O     . LYS D 2 165 ? -49.561 40.724 -14.596 1.00 116.63 ? 544 LYS D O     1 
ATOM   9407  C  CB    . LYS D 2 165 ? -50.334 39.165 -17.117 1.00 130.24 ? 544 LYS D CB    1 
ATOM   9408  C  CG    . LYS D 2 165 ? -50.821 37.793 -16.631 1.00 145.07 ? 544 LYS D CG    1 
ATOM   9409  C  CD    . LYS D 2 165 ? -50.009 36.631 -17.192 1.00 146.81 ? 544 LYS D CD    1 
ATOM   9410  C  CE    . LYS D 2 165 ? -48.925 36.203 -16.238 1.00 147.50 ? 544 LYS D CE    1 
ATOM   9411  N  NZ    . LYS D 2 165 ? -48.053 37.353 -15.912 1.00 154.08 ? 544 LYS D NZ    1 
ATOM   9412  N  N     . MET D 2 166 ? -51.629 39.999 -14.101 1.00 123.75 ? 545 MET D N     1 
ATOM   9413  C  CA    . MET D 2 166 ? -51.444 40.111 -12.665 1.00 134.39 ? 545 MET D CA    1 
ATOM   9414  C  C     . MET D 2 166 ? -51.439 38.709 -12.082 1.00 145.35 ? 545 MET D C     1 
ATOM   9415  O  O     . MET D 2 166 ? -52.190 37.850 -12.542 1.00 146.00 ? 545 MET D O     1 
ATOM   9416  C  CB    . MET D 2 166 ? -52.563 40.958 -12.063 1.00 129.85 ? 545 MET D CB    1 
ATOM   9417  C  CG    . MET D 2 166 ? -52.162 41.726 -10.827 1.00 128.08 ? 545 MET D CG    1 
ATOM   9418  S  SD    . MET D 2 166 ? -53.194 43.194 -10.642 1.00 164.32 ? 545 MET D SD    1 
ATOM   9419  C  CE    . MET D 2 166 ? -52.337 44.055 -9.313  1.00 180.72 ? 545 MET D CE    1 
ATOM   9420  N  N     . SER D 2 167 ? -50.562 38.457 -11.113 1.00 144.33 ? 546 SER D N     1 
ATOM   9421  C  CA    . SER D 2 167 ? -50.438 37.112 -10.552 1.00 148.01 ? 546 SER D CA    1 
ATOM   9422  C  C     . SER D 2 167 ? -50.217 37.114 -9.044  1.00 142.60 ? 546 SER D C     1 
ATOM   9423  O  O     . SER D 2 167 ? -49.458 37.938 -8.545  1.00 143.91 ? 546 SER D O     1 
ATOM   9424  C  CB    . SER D 2 167 ? -49.320 36.333 -11.253 1.00 153.50 ? 546 SER D CB    1 
ATOM   9425  O  OG    . SER D 2 167 ? -48.113 37.064 -11.274 1.00 162.44 ? 546 SER D OG    1 
ATOM   9426  N  N     . LYS D 2 168 ? -50.880 36.186 -8.338  1.00 155.26 ? 547 LYS D N     1 
ATOM   9427  C  CA    . LYS D 2 168 ? -50.765 36.033 -6.871  1.00 155.32 ? 547 LYS D CA    1 
ATOM   9428  C  C     . LYS D 2 168 ? -50.377 34.614 -6.425  1.00 153.65 ? 547 LYS D C     1 
ATOM   9429  O  O     . LYS D 2 168 ? -49.383 34.038 -6.881  1.00 147.49 ? 547 LYS D O     1 
ATOM   9430  C  CB    . LYS D 2 168 ? -52.069 36.444 -6.153  1.00 139.16 ? 547 LYS D CB    1 
ATOM   9431  N  N     . GLU D 2 174 ? -51.086 29.205 -8.282  1.00 193.58 ? 553 GLU D N     1 
ATOM   9432  C  CA    . GLU D 2 174 ? -50.955 30.549 -8.829  1.00 193.45 ? 553 GLU D CA    1 
ATOM   9433  C  C     . GLU D 2 174 ? -52.300 31.011 -9.350  1.00 208.20 ? 553 GLU D C     1 
ATOM   9434  O  O     . GLU D 2 174 ? -53.013 30.249 -9.996  1.00 221.03 ? 553 GLU D O     1 
ATOM   9435  C  CB    . GLU D 2 174 ? -49.964 30.562 -9.997  1.00 179.25 ? 553 GLU D CB    1 
ATOM   9436  N  N     . GLU D 2 175 ? -52.643 32.263 -9.080  1.00 210.60 ? 554 GLU D N     1 
ATOM   9437  C  CA    . GLU D 2 175 ? -53.855 32.848 -9.641  1.00 211.21 ? 554 GLU D CA    1 
ATOM   9438  C  C     . GLU D 2 175 ? -53.461 33.982 -10.583 1.00 199.66 ? 554 GLU D C     1 
ATOM   9439  O  O     . GLU D 2 175 ? -52.668 34.849 -10.228 1.00 206.13 ? 554 GLU D O     1 
ATOM   9440  C  CB    . GLU D 2 175 ? -54.808 33.330 -8.542  1.00 214.34 ? 554 GLU D CB    1 
ATOM   9441  N  N     . VAL D 2 176 ? -53.995 33.949 -11.797 1.00 176.24 ? 555 VAL D N     1 
ATOM   9442  C  CA    . VAL D 2 176 ? -53.567 34.865 -12.842 1.00 151.92 ? 555 VAL D CA    1 
ATOM   9443  C  C     . VAL D 2 176 ? -54.732 35.432 -13.659 1.00 157.61 ? 555 VAL D C     1 
ATOM   9444  O  O     . VAL D 2 176 ? -55.580 34.700 -14.181 1.00 162.76 ? 555 VAL D O     1 
ATOM   9445  C  CB    . VAL D 2 176 ? -52.561 34.156 -13.763 1.00 141.24 ? 555 VAL D CB    1 
ATOM   9446  C  CG1   . VAL D 2 176 ? -52.384 34.910 -15.120 1.00 128.10 ? 555 VAL D CG1   1 
ATOM   9447  C  CG2   . VAL D 2 176 ? -51.239 33.907 -12.999 1.00 121.30 ? 555 VAL D CG2   1 
ATOM   9448  N  N     . ALA D 2 177 ? -54.754 36.750 -13.771 1.00 154.36 ? 556 ALA D N     1 
ATOM   9449  C  CA    . ALA D 2 177 ? -55.763 37.437 -14.555 1.00 149.34 ? 556 ALA D CA    1 
ATOM   9450  C  C     . ALA D 2 177 ? -55.090 38.373 -15.559 1.00 143.14 ? 556 ALA D C     1 
ATOM   9451  O  O     . ALA D 2 177 ? -53.892 38.647 -15.470 1.00 127.61 ? 556 ALA D O     1 
ATOM   9452  C  CB    . ALA D 2 177 ? -56.722 38.190 -13.649 1.00 139.17 ? 556 ALA D CB    1 
ATOM   9453  N  N     . TYR D 2 178 ? -55.863 38.828 -16.536 1.00 141.18 ? 557 TYR D N     1 
ATOM   9454  C  CA    . TYR D 2 178 ? -55.360 39.729 -17.554 1.00 129.31 ? 557 TYR D CA    1 
ATOM   9455  C  C     . TYR D 2 178 ? -56.222 40.984 -17.649 1.00 135.11 ? 557 TYR D C     1 
ATOM   9456  O  O     . TYR D 2 178 ? -57.441 40.932 -17.483 1.00 140.82 ? 557 TYR D O     1 
ATOM   9457  C  CB    . TYR D 2 178 ? -55.358 39.026 -18.899 1.00 126.83 ? 557 TYR D CB    1 
ATOM   9458  C  CG    . TYR D 2 178 ? -54.336 37.928 -19.038 1.00 134.46 ? 557 TYR D CG    1 
ATOM   9459  C  CD1   . TYR D 2 178 ? -54.636 36.619 -18.690 1.00 141.36 ? 557 TYR D CD1   1 
ATOM   9460  C  CD2   . TYR D 2 178 ? -53.076 38.194 -19.554 1.00 143.09 ? 557 TYR D CD2   1 
ATOM   9461  C  CE1   . TYR D 2 178 ? -53.700 35.601 -18.847 1.00 145.16 ? 557 TYR D CE1   1 
ATOM   9462  C  CE2   . TYR D 2 178 ? -52.135 37.187 -19.710 1.00 144.95 ? 557 TYR D CE2   1 
ATOM   9463  C  CZ    . TYR D 2 178 ? -52.450 35.894 -19.356 1.00 146.36 ? 557 TYR D CZ    1 
ATOM   9464  O  OH    . TYR D 2 178 ? -51.503 34.905 -19.513 1.00 146.67 ? 557 TYR D OH    1 
ATOM   9465  N  N     . ALA D 2 179 ? -55.576 42.107 -17.934 1.00 125.96 ? 558 ALA D N     1 
ATOM   9466  C  CA    . ALA D 2 179 ? -56.257 43.380 -18.106 1.00 131.89 ? 558 ALA D CA    1 
ATOM   9467  C  C     . ALA D 2 179 ? -55.932 43.941 -19.482 1.00 127.35 ? 558 ALA D C     1 
ATOM   9468  O  O     . ALA D 2 179 ? -54.907 43.595 -20.069 1.00 123.99 ? 558 ALA D O     1 
ATOM   9469  C  CB    . ALA D 2 179 ? -55.800 44.354 -17.022 1.00 141.18 ? 558 ALA D CB    1 
ATOM   9470  N  N     . TRP D 2 180 ? -56.796 44.808 -19.999 1.00 134.96 ? 559 TRP D N     1 
ATOM   9471  C  CA    . TRP D 2 180 ? -56.568 45.373 -21.332 1.00 148.43 ? 559 TRP D CA    1 
ATOM   9472  C  C     . TRP D 2 180 ? -56.411 46.892 -21.340 1.00 160.77 ? 559 TRP D C     1 
ATOM   9473  O  O     . TRP D 2 180 ? -55.941 47.465 -22.332 1.00 150.28 ? 559 TRP D O     1 
ATOM   9474  C  CB    . TRP D 2 180 ? -57.676 44.950 -22.304 1.00 149.52 ? 559 TRP D CB    1 
ATOM   9475  C  CG    . TRP D 2 180 ? -57.448 43.612 -22.897 1.00 141.80 ? 559 TRP D CG    1 
ATOM   9476  C  CD1   . TRP D 2 180 ? -57.023 43.348 -24.154 1.00 136.60 ? 559 TRP D CD1   1 
ATOM   9477  C  CD2   . TRP D 2 180 ? -57.607 42.344 -22.248 1.00 151.35 ? 559 TRP D CD2   1 
ATOM   9478  N  NE1   . TRP D 2 180 ? -56.905 41.993 -24.340 1.00 140.36 ? 559 TRP D NE1   1 
ATOM   9479  C  CE2   . TRP D 2 180 ? -57.264 41.353 -23.184 1.00 149.09 ? 559 TRP D CE2   1 
ATOM   9480  C  CE3   . TRP D 2 180 ? -58.002 41.952 -20.963 1.00 158.95 ? 559 TRP D CE3   1 
ATOM   9481  C  CZ2   . TRP D 2 180 ? -57.308 39.994 -22.886 1.00 151.74 ? 559 TRP D CZ2   1 
ATOM   9482  C  CZ3   . TRP D 2 180 ? -58.043 40.602 -20.665 1.00 155.70 ? 559 TRP D CZ3   1 
ATOM   9483  C  CH2   . TRP D 2 180 ? -57.699 39.640 -21.624 1.00 152.46 ? 559 TRP D CH2   1 
ATOM   9484  N  N     . THR D 2 181 ? -56.812 47.531 -20.239 1.00 172.96 ? 560 THR D N     1 
ATOM   9485  C  CA    . THR D 2 181 ? -56.668 48.976 -20.087 1.00 165.28 ? 560 THR D CA    1 
ATOM   9486  C  C     . THR D 2 181 ? -56.983 49.440 -18.674 1.00 177.79 ? 560 THR D C     1 
ATOM   9487  O  O     . THR D 2 181 ? -58.021 49.089 -18.112 1.00 184.56 ? 560 THR D O     1 
ATOM   9488  C  CB    . THR D 2 181 ? -57.549 49.767 -21.086 1.00 152.64 ? 560 THR D CB    1 
ATOM   9489  N  N     . ASP D 2 182 ? -56.057 50.219 -18.121 1.00 183.99 ? 561 ASP D N     1 
ATOM   9490  C  CA    . ASP D 2 182 ? -56.236 50.987 -16.884 1.00 193.02 ? 561 ASP D CA    1 
ATOM   9491  C  C     . ASP D 2 182 ? -57.407 50.589 -15.979 1.00 189.33 ? 561 ASP D C     1 
ATOM   9492  O  O     . ASP D 2 182 ? -57.201 50.051 -14.891 1.00 190.95 ? 561 ASP D O     1 
ATOM   9493  C  CB    . ASP D 2 182 ? -56.316 52.472 -17.236 1.00 205.15 ? 561 ASP D CB    1 
ATOM   9494  C  CG    . ASP D 2 182 ? -55.524 52.805 -18.488 1.00 216.68 ? 561 ASP D CG    1 
ATOM   9495  O  OD1   . ASP D 2 182 ? -54.363 52.349 -18.601 1.00 213.06 ? 561 ASP D OD1   1 
ATOM   9496  O  OD2   . ASP D 2 182 ? -56.071 53.503 -19.370 1.00 225.72 ? 561 ASP D OD2   1 
ATOM   9497  N  N     . GLY D 2 183 ? -58.628 50.887 -16.410 1.00 183.74 ? 562 GLY D N     1 
ATOM   9498  C  CA    . GLY D 2 183 ? -59.795 50.557 -15.615 1.00 194.50 ? 562 GLY D CA    1 
ATOM   9499  C  C     . GLY D 2 183 ? -59.803 49.103 -15.176 1.00 198.16 ? 562 GLY D C     1 
ATOM   9500  O  O     . GLY D 2 183 ? -59.998 48.792 -13.995 1.00 189.55 ? 562 GLY D O     1 
ATOM   9501  N  N     . GLU D 2 184 ? -59.597 48.209 -16.141 1.00 204.88 ? 563 GLU D N     1 
ATOM   9502  C  CA    . GLU D 2 184 ? -59.548 46.774 -15.879 1.00 199.54 ? 563 GLU D CA    1 
ATOM   9503  C  C     . GLU D 2 184 ? -58.518 46.478 -14.788 1.00 185.52 ? 563 GLU D C     1 
ATOM   9504  O  O     . GLU D 2 184 ? -58.723 45.614 -13.923 1.00 178.80 ? 563 GLU D O     1 
ATOM   9505  C  CB    . GLU D 2 184 ? -59.240 46.014 -17.182 1.00 192.88 ? 563 GLU D CB    1 
ATOM   9506  N  N     . LEU D 2 185 ? -57.412 47.215 -14.840 1.00 179.12 ? 564 LEU D N     1 
ATOM   9507  C  CA    . LEU D 2 185 ? -56.330 47.064 -13.877 1.00 167.09 ? 564 LEU D CA    1 
ATOM   9508  C  C     . LEU D 2 185 ? -56.808 47.275 -12.449 1.00 158.75 ? 564 LEU D C     1 
ATOM   9509  O  O     . LEU D 2 185 ? -56.533 46.447 -11.589 1.00 158.31 ? 564 LEU D O     1 
ATOM   9510  C  CB    . LEU D 2 185 ? -55.188 48.038 -14.188 1.00 153.99 ? 564 LEU D CB    1 
ATOM   9511  C  CG    . LEU D 2 185 ? -53.827 47.683 -13.592 1.00 132.07 ? 564 LEU D CG    1 
ATOM   9512  C  CD1   . LEU D 2 185 ? -53.776 46.204 -13.251 1.00 123.88 ? 564 LEU D CD1   1 
ATOM   9513  C  CD2   . LEU D 2 185 ? -52.691 48.064 -14.540 1.00 120.67 ? 564 LEU D CD2   1 
ATOM   9514  N  N     . GLU D 2 186 ? -57.526 48.369 -12.200 1.00 156.33 ? 565 GLU D N     1 
ATOM   9515  C  CA    . GLU D 2 186 ? -58.006 48.678 -10.848 1.00 169.62 ? 565 GLU D CA    1 
ATOM   9516  C  C     . GLU D 2 186 ? -58.814 47.526 -10.246 1.00 186.22 ? 565 GLU D C     1 
ATOM   9517  O  O     . GLU D 2 186 ? -58.567 47.117 -9.107  1.00 180.92 ? 565 GLU D O     1 
ATOM   9518  C  CB    . GLU D 2 186 ? -58.818 49.982 -10.823 1.00 158.81 ? 565 GLU D CB    1 
ATOM   9519  N  N     . GLU D 2 187 ? -59.774 47.014 -11.017 1.00 199.84 ? 566 GLU D N     1 
ATOM   9520  C  CA    . GLU D 2 187 ? -60.605 45.882 -10.598 1.00 202.99 ? 566 GLU D CA    1 
ATOM   9521  C  C     . GLU D 2 187 ? -59.775 44.621 -10.335 1.00 198.64 ? 566 GLU D C     1 
ATOM   9522  O  O     . GLU D 2 187 ? -60.000 43.913 -9.347  1.00 193.18 ? 566 GLU D O     1 
ATOM   9523  C  CB    . GLU D 2 187 ? -61.715 45.604 -11.620 1.00 196.44 ? 566 GLU D CB    1 
ATOM   9524  N  N     . LEU D 2 188 ? -58.829 44.340 -11.233 1.00 191.55 ? 567 LEU D N     1 
ATOM   9525  C  CA    . LEU D 2 188 ? -57.900 43.224 -11.055 1.00 177.75 ? 567 LEU D CA    1 
ATOM   9526  C  C     . LEU D 2 188 ? -57.099 43.364 -9.744  1.00 188.41 ? 567 LEU D C     1 
ATOM   9527  O  O     . LEU D 2 188 ? -56.955 42.400 -8.976  1.00 187.95 ? 567 LEU D O     1 
ATOM   9528  C  CB    . LEU D 2 188 ? -56.980 43.092 -12.282 1.00 140.53 ? 567 LEU D CB    1 
ATOM   9529  N  N     . ARG D 2 189 ? -56.590 44.572 -9.497  1.00 186.07 ? 568 ARG D N     1 
ATOM   9530  C  CA    . ARG D 2 189 ? -55.849 44.897 -8.275  1.00 169.49 ? 568 ARG D CA    1 
ATOM   9531  C  C     . ARG D 2 189 ? -56.693 44.662 -7.019  1.00 179.29 ? 568 ARG D C     1 
ATOM   9532  O  O     . ARG D 2 189 ? -56.209 44.103 -6.034  1.00 175.92 ? 568 ARG D O     1 
ATOM   9533  C  CB    . ARG D 2 189 ? -55.333 46.348 -8.323  1.00 144.38 ? 568 ARG D CB    1 
ATOM   9534  N  N     . LYS D 2 190 ? -57.951 45.097 -7.055  1.00 188.65 ? 569 LYS D N     1 
ATOM   9535  C  CA    . LYS D 2 190 ? -58.872 44.859 -5.946  1.00 191.90 ? 569 LYS D CA    1 
ATOM   9536  C  C     . LYS D 2 190 ? -59.007 43.362 -5.678  1.00 200.87 ? 569 LYS D C     1 
ATOM   9537  O  O     . LYS D 2 190 ? -58.916 42.919 -4.532  1.00 197.42 ? 569 LYS D O     1 
ATOM   9538  C  CB    . LYS D 2 190 ? -60.245 45.486 -6.221  1.00 183.18 ? 569 LYS D CB    1 
ATOM   9539  N  N     . GLN D 2 191 ? -59.213 42.586 -6.741  1.00 208.47 ? 570 GLN D N     1 
ATOM   9540  C  CA    . GLN D 2 191 ? -59.364 41.136 -6.618  1.00 210.09 ? 570 GLN D CA    1 
ATOM   9541  C  C     . GLN D 2 191 ? -58.147 40.475 -5.955  1.00 209.76 ? 570 GLN D C     1 
ATOM   9542  O  O     . GLN D 2 191 ? -58.251 39.883 -4.878  1.00 215.58 ? 570 GLN D O     1 
ATOM   9543  C  CB    . GLN D 2 191 ? -59.646 40.509 -7.992  1.00 196.99 ? 570 GLN D CB    1 
ATOM   9544  N  N     . PHE D 2 192 ? -56.992 40.594 -6.595  1.00 192.18 ? 571 PHE D N     1 
ATOM   9545  C  CA    . PHE D 2 192 ? -55.770 39.967 -6.104  1.00 182.25 ? 571 PHE D CA    1 
ATOM   9546  C  C     . PHE D 2 192 ? -55.307 40.413 -4.715  1.00 195.77 ? 571 PHE D C     1 
ATOM   9547  O  O     . PHE D 2 192 ? -54.392 39.813 -4.142  1.00 192.87 ? 571 PHE D O     1 
ATOM   9548  C  CB    . PHE D 2 192 ? -54.658 40.216 -7.088  1.00 166.36 ? 571 PHE D CB    1 
ATOM   9549  C  CG    . PHE D 2 192 ? -54.721 39.340 -8.277  1.00 168.30 ? 571 PHE D CG    1 
ATOM   9550  C  CD1   . PHE D 2 192 ? -55.688 39.543 -9.238  1.00 174.90 ? 571 PHE D CD1   1 
ATOM   9551  C  CD2   . PHE D 2 192 ? -53.808 38.308 -8.438  1.00 167.65 ? 571 PHE D CD2   1 
ATOM   9552  C  CE1   . PHE D 2 192 ? -55.743 38.734 -10.352 1.00 183.67 ? 571 PHE D CE1   1 
ATOM   9553  C  CE2   . PHE D 2 192 ? -53.856 37.495 -9.541  1.00 173.30 ? 571 PHE D CE2   1 
ATOM   9554  C  CZ    . PHE D 2 192 ? -54.826 37.704 -10.506 1.00 182.46 ? 571 PHE D CZ    1 
ATOM   9555  N  N     . GLY D 2 193 ? -55.960 41.435 -4.169  1.00 207.80 ? 572 GLY D N     1 
ATOM   9556  C  CA    . GLY D 2 193 ? -55.405 42.248 -3.098  1.00 208.08 ? 572 GLY D CA    1 
ATOM   9557  C  C     . GLY D 2 193 ? -53.906 42.126 -2.883  1.00 199.83 ? 572 GLY D C     1 
ATOM   9558  O  O     . GLY D 2 193 ? -53.139 42.063 -3.842  1.00 198.15 ? 572 GLY D O     1 
ATOM   9559  N  N     . LYS D 2 194 ? -53.478 42.121 -1.626  1.00 194.87 ? 573 LYS D N     1 
ATOM   9560  C  CA    . LYS D 2 194 ? -52.052 42.158 -1.312  1.00 184.68 ? 573 LYS D CA    1 
ATOM   9561  C  C     . LYS D 2 194 ? -51.245 41.105 -2.077  1.00 180.99 ? 573 LYS D C     1 
ATOM   9562  O  O     . LYS D 2 194 ? -51.800 40.137 -2.596  1.00 186.46 ? 573 LYS D O     1 
ATOM   9563  C  CB    . LYS D 2 194 ? -51.831 42.020 0.204   1.00 174.42 ? 573 LYS D CB    1 
ATOM   9564  N  N     . GLY D 2 195 ? -49.935 41.318 -2.161  1.00 171.85 ? 574 GLY D N     1 
ATOM   9565  C  CA    . GLY D 2 195 ? -49.016 40.300 -2.641  1.00 170.69 ? 574 GLY D CA    1 
ATOM   9566  C  C     . GLY D 2 195 ? -48.803 40.231 -4.142  1.00 176.62 ? 574 GLY D C     1 
ATOM   9567  O  O     . GLY D 2 195 ? -47.731 39.842 -4.607  1.00 179.01 ? 574 GLY D O     1 
ATOM   9568  N  N     . ALA D 2 196 ? -49.821 40.609 -4.903  1.00 178.33 ? 575 ALA D N     1 
ATOM   9569  C  CA    . ALA D 2 196 ? -49.792 40.453 -6.355  1.00 178.14 ? 575 ALA D CA    1 
ATOM   9570  C  C     . ALA D 2 196 ? -48.635 41.167 -7.058  1.00 159.91 ? 575 ALA D C     1 
ATOM   9571  O  O     . ALA D 2 196 ? -48.294 42.295 -6.727  1.00 161.87 ? 575 ALA D O     1 
ATOM   9572  C  CB    . ALA D 2 196 ? -51.113 40.913 -6.949  1.00 193.35 ? 575 ALA D CB    1 
ATOM   9573  N  N     . THR D 2 197 ? -48.036 40.500 -8.037  1.00 150.78 ? 576 THR D N     1 
ATOM   9574  C  CA    . THR D 2 197 ? -47.138 41.181 -8.959  1.00 154.22 ? 576 THR D CA    1 
ATOM   9575  C  C     . THR D 2 197 ? -47.863 41.449 -10.281 1.00 155.55 ? 576 THR D C     1 
ATOM   9576  O  O     . THR D 2 197 ? -48.691 40.654 -10.735 1.00 153.33 ? 576 THR D O     1 
ATOM   9577  C  CB    . THR D 2 197 ? -45.801 40.416 -9.204  1.00 155.56 ? 576 THR D CB    1 
ATOM   9578  O  OG1   . THR D 2 197 ? -46.063 39.036 -9.467  1.00 150.08 ? 576 THR D OG1   1 
ATOM   9579  C  CG2   . THR D 2 197 ? -44.866 40.527 -7.996  1.00 154.48 ? 576 THR D CG2   1 
ATOM   9580  N  N     . LEU D 2 198 ? -47.557 42.591 -10.881 1.00 144.93 ? 577 LEU D N     1 
ATOM   9581  C  CA    . LEU D 2 198 ? -48.210 43.014 -12.107 1.00 120.72 ? 577 LEU D CA    1 
ATOM   9582  C  C     . LEU D 2 198 ? -47.156 43.176 -13.169 1.00 111.03 ? 577 LEU D C     1 
ATOM   9583  O  O     . LEU D 2 198 ? -46.090 43.738 -12.923 1.00 114.42 ? 577 LEU D O     1 
ATOM   9584  C  CB    . LEU D 2 198 ? -48.957 44.330 -11.901 1.00 117.77 ? 577 LEU D CB    1 
ATOM   9585  C  CG    . LEU D 2 198 ? -49.104 45.258 -13.101 1.00 109.12 ? 577 LEU D CG    1 
ATOM   9586  C  CD1   . LEU D 2 198 ? -49.971 44.636 -14.158 1.00 114.59 ? 577 LEU D CD1   1 
ATOM   9587  C  CD2   . LEU D 2 198 ? -49.681 46.580 -12.662 1.00 108.82 ? 577 LEU D CD2   1 
ATOM   9588  N  N     . GLN D 2 199 ? -47.463 42.676 -14.355 1.00 105.44 ? 578 GLN D N     1 
ATOM   9589  C  CA    . GLN D 2 199 ? -46.531 42.680 -15.460 1.00 105.03 ? 578 GLN D CA    1 
ATOM   9590  C  C     . GLN D 2 199 ? -47.221 43.406 -16.597 1.00 114.22 ? 578 GLN D C     1 
ATOM   9591  O  O     . GLN D 2 199 ? -48.420 43.254 -16.790 1.00 116.39 ? 578 GLN D O     1 
ATOM   9592  C  CB    . GLN D 2 199 ? -46.227 41.242 -15.855 1.00 120.42 ? 578 GLN D CB    1 
ATOM   9593  C  CG    . GLN D 2 199 ? -44.897 41.020 -16.536 1.00 144.06 ? 578 GLN D CG    1 
ATOM   9594  C  CD    . GLN D 2 199 ? -44.786 39.606 -17.079 1.00 166.16 ? 578 GLN D CD    1 
ATOM   9595  O  OE1   . GLN D 2 199 ? -45.510 38.712 -16.647 1.00 176.83 ? 578 GLN D OE1   1 
ATOM   9596  N  NE2   . GLN D 2 199 ? -43.888 39.399 -18.034 1.00 168.04 ? 578 GLN D NE2   1 
ATOM   9597  N  N     . ARG D 2 200 ? -46.483 44.230 -17.327 1.00 116.72 ? 579 ARG D N     1 
ATOM   9598  C  CA    . ARG D 2 200 ? -47.083 44.978 -18.415 1.00 109.58 ? 579 ARG D CA    1 
ATOM   9599  C  C     . ARG D 2 200 ? -46.320 44.728 -19.683 1.00 108.40 ? 579 ARG D C     1 
ATOM   9600  O  O     . ARG D 2 200 ? -45.124 45.005 -19.756 1.00 120.02 ? 579 ARG D O     1 
ATOM   9601  C  CB    . ARG D 2 200 ? -47.094 46.466 -18.130 1.00 113.12 ? 579 ARG D CB    1 
ATOM   9602  C  CG    . ARG D 2 200 ? -47.578 47.274 -19.315 1.00 115.68 ? 579 ARG D CG    1 
ATOM   9603  C  CD    . ARG D 2 200 ? -47.144 48.705 -19.176 1.00 120.06 ? 579 ARG D CD    1 
ATOM   9604  N  NE    . ARG D 2 200 ? -46.542 49.171 -20.413 1.00 124.38 ? 579 ARG D NE    1 
ATOM   9605  C  CZ    . ARG D 2 200 ? -47.008 50.197 -21.108 1.00 119.82 ? 579 ARG D CZ    1 
ATOM   9606  N  NH1   . ARG D 2 200 ? -48.079 50.848 -20.629 1.00 111.19 ? 579 ARG D NH1   1 
ATOM   9607  N  NH2   . ARG D 2 200 ? -46.398 50.569 -22.252 1.00 94.22  ? 579 ARG D NH2   1 
ATOM   9608  N  N     . TYR D 2 201 ? -47.022 44.201 -20.678 1.00 108.52 ? 580 TYR D N     1 
ATOM   9609  C  CA    . TYR D 2 201 ? -46.408 43.859 -21.949 1.00 98.20  ? 580 TYR D CA    1 
ATOM   9610  C  C     . TYR D 2 201 ? -46.293 45.123 -22.754 1.00 112.48 ? 580 TYR D C     1 
ATOM   9611  O  O     . TYR D 2 201 ? -47.217 45.521 -23.455 1.00 125.96 ? 580 TYR D O     1 
ATOM   9612  C  CB    . TYR D 2 201 ? -47.194 42.760 -22.697 1.00 100.63 ? 580 TYR D CB    1 
ATOM   9613  C  CG    . TYR D 2 201 ? -47.397 41.537 -21.842 1.00 109.73 ? 580 TYR D CG    1 
ATOM   9614  C  CD1   . TYR D 2 201 ? -46.344 41.017 -21.108 1.00 116.24 ? 580 TYR D CD1   1 
ATOM   9615  C  CD2   . TYR D 2 201 ? -48.638 40.938 -21.719 1.00 127.29 ? 580 TYR D CD2   1 
ATOM   9616  C  CE1   . TYR D 2 201 ? -46.503 39.928 -20.285 1.00 128.56 ? 580 TYR D CE1   1 
ATOM   9617  C  CE2   . TYR D 2 201 ? -48.812 39.833 -20.894 1.00 143.96 ? 580 TYR D CE2   1 
ATOM   9618  C  CZ    . TYR D 2 201 ? -47.730 39.332 -20.179 1.00 143.33 ? 580 TYR D CZ    1 
ATOM   9619  O  OH    . TYR D 2 201 ? -47.851 38.234 -19.350 1.00 148.41 ? 580 TYR D OH    1 
ATOM   9620  N  N     . LYS D 2 202 ? -45.149 45.772 -22.608 1.00 128.54 ? 581 LYS D N     1 
ATOM   9621  C  CA    . LYS D 2 202 ? -44.884 47.009 -23.308 1.00 146.30 ? 581 LYS D CA    1 
ATOM   9622  C  C     . LYS D 2 202 ? -44.329 46.637 -24.669 1.00 126.33 ? 581 LYS D C     1 
ATOM   9623  O  O     . LYS D 2 202 ? -43.188 46.965 -24.985 1.00 139.65 ? 581 LYS D O     1 
ATOM   9624  C  CB    . LYS D 2 202 ? -43.876 47.853 -22.515 1.00 161.82 ? 581 LYS D CB    1 
ATOM   9625  N  N     . GLY D 2 203 ? -45.143 45.947 -25.463 1.00 102.59 ? 582 GLY D N     1 
ATOM   9626  C  CA    . GLY D 2 203 ? -44.677 45.341 -26.698 1.00 121.05 ? 582 GLY D CA    1 
ATOM   9627  C  C     . GLY D 2 203 ? -44.902 43.837 -26.712 1.00 123.36 ? 582 GLY D C     1 
ATOM   9628  O  O     . GLY D 2 203 ? -44.787 43.178 -25.684 1.00 123.76 ? 582 GLY D O     1 
ATOM   9629  N  N     . LEU D 2 204 ? -45.209 43.287 -27.881 1.00 122.53 ? 583 LEU D N     1 
ATOM   9630  C  CA    . LEU D 2 204 ? -45.664 41.898 -27.976 1.00 114.99 ? 583 LEU D CA    1 
ATOM   9631  C  C     . LEU D 2 204 ? -44.549 40.870 -27.752 1.00 120.81 ? 583 LEU D C     1 
ATOM   9632  O  O     . LEU D 2 204 ? -44.781 39.812 -27.161 1.00 115.79 ? 583 LEU D O     1 
ATOM   9633  C  CB    . LEU D 2 204 ? -46.337 41.655 -29.315 1.00 96.94  ? 583 LEU D CB    1 
ATOM   9634  C  CG    . LEU D 2 204 ? -47.633 40.889 -29.246 1.00 101.77 ? 583 LEU D CG    1 
ATOM   9635  C  CD1   . LEU D 2 204 ? -48.446 41.120 -30.513 1.00 105.00 ? 583 LEU D CD1   1 
ATOM   9636  C  CD2   . LEU D 2 204 ? -47.290 39.455 -29.090 1.00 114.87 ? 583 LEU D CD2   1 
ATOM   9637  N  N     . GLY D 2 205 ? -43.341 41.187 -28.212 1.00 116.83 ? 584 GLY D N     1 
ATOM   9638  C  CA    . GLY D 2 205 ? -42.193 40.324 -27.988 1.00 123.03 ? 584 GLY D CA    1 
ATOM   9639  C  C     . GLY D 2 205 ? -41.840 40.126 -26.516 1.00 125.90 ? 584 GLY D C     1 
ATOM   9640  O  O     . GLY D 2 205 ? -40.851 39.460 -26.183 1.00 112.74 ? 584 GLY D O     1 
ATOM   9641  N  N     . GLU D 2 206 ? -42.648 40.701 -25.630 1.00 117.91 ? 585 GLU D N     1 
ATOM   9642  C  CA    . GLU D 2 206 ? -42.360 40.645 -24.208 1.00 112.10 ? 585 GLU D CA    1 
ATOM   9643  C  C     . GLU D 2 206 ? -43.138 39.534 -23.519 1.00 122.59 ? 585 GLU D C     1 
ATOM   9644  O  O     . GLU D 2 206 ? -42.812 39.172 -22.388 1.00 144.29 ? 585 GLU D O     1 
ATOM   9645  C  CB    . GLU D 2 206 ? -42.585 41.999 -23.523 1.00 128.59 ? 585 GLU D CB    1 
ATOM   9646  C  CG    . GLU D 2 206 ? -42.186 42.056 -22.027 1.00 142.87 ? 585 GLU D CG    1 
ATOM   9647  C  CD    . GLU D 2 206 ? -42.242 43.480 -21.442 1.00 158.92 ? 585 GLU D CD    1 
ATOM   9648  O  OE1   . GLU D 2 206 ? -42.187 43.639 -20.198 1.00 164.11 ? 585 GLU D OE1   1 
ATOM   9649  O  OE2   . GLU D 2 206 ? -42.342 44.449 -22.228 1.00 157.90 ? 585 GLU D OE2   1 
ATOM   9650  N  N     . MET D 2 207 ? -44.155 38.984 -24.180 1.00 107.22 ? 586 MET D N     1 
ATOM   9651  C  CA    . MET D 2 207 ? -44.837 37.818 -23.608 1.00 118.02 ? 586 MET D CA    1 
ATOM   9652  C  C     . MET D 2 207 ? -44.390 36.564 -24.318 1.00 122.19 ? 586 MET D C     1 
ATOM   9653  O  O     . MET D 2 207 ? -43.853 36.647 -25.419 1.00 116.37 ? 586 MET D O     1 
ATOM   9654  C  CB    . MET D 2 207 ? -46.358 37.941 -23.657 1.00 117.75 ? 586 MET D CB    1 
ATOM   9655  C  CG    . MET D 2 207 ? -46.913 38.232 -25.014 1.00 116.25 ? 586 MET D CG    1 
ATOM   9656  S  SD    . MET D 2 207 ? -48.641 38.688 -24.863 1.00 135.14 ? 586 MET D SD    1 
ATOM   9657  C  CE    . MET D 2 207 ? -48.703 40.100 -25.966 1.00 142.94 ? 586 MET D CE    1 
ATOM   9658  N  N     . ASN D 2 208 ? -44.601 35.406 -23.696 1.00 135.54 ? 587 ASN D N     1 
ATOM   9659  C  CA    . ASN D 2 208 ? -44.084 34.168 -24.269 1.00 141.53 ? 587 ASN D CA    1 
ATOM   9660  C  C     . ASN D 2 208 ? -45.014 33.547 -25.300 1.00 138.35 ? 587 ASN D C     1 
ATOM   9661  O  O     . ASN D 2 208 ? -46.086 34.074 -25.577 1.00 136.22 ? 587 ASN D O     1 
ATOM   9662  C  CB    . ASN D 2 208 ? -43.849 33.146 -23.155 1.00 145.56 ? 587 ASN D CB    1 
ATOM   9663  C  CG    . ASN D 2 208 ? -42.552 33.381 -22.408 1.00 144.47 ? 587 ASN D CG    1 
ATOM   9664  O  OD1   . ASN D 2 208 ? -41.462 33.240 -22.967 1.00 146.34 ? 587 ASN D OD1   1 
ATOM   9665  N  ND2   . ASN D 2 208 ? -42.661 33.725 -21.133 1.00 138.05 ? 587 ASN D ND2   1 
ATOM   9666  N  N     . ALA D 2 209 ? -44.639 32.370 -25.787 1.00 138.24 ? 588 ALA D N     1 
ATOM   9667  C  CA    . ALA D 2 209 ? -45.343 31.746 -26.897 1.00 137.78 ? 588 ALA D CA    1 
ATOM   9668  C  C     . ALA D 2 209 ? -46.681 31.233 -26.425 1.00 137.14 ? 588 ALA D C     1 
ATOM   9669  O  O     . ALA D 2 209 ? -47.730 31.583 -26.975 1.00 130.66 ? 588 ALA D O     1 
ATOM   9670  C  CB    . ALA D 2 209 ? -44.527 30.605 -27.442 1.00 148.98 ? 588 ALA D CB    1 
ATOM   9671  N  N     . ASP D 2 210 ? -46.620 30.401 -25.390 1.00 141.32 ? 589 ASP D N     1 
ATOM   9672  C  CA    . ASP D 2 210 ? -47.797 29.779 -24.816 1.00 141.37 ? 589 ASP D CA    1 
ATOM   9673  C  C     . ASP D 2 210 ? -48.824 30.854 -24.483 1.00 142.16 ? 589 ASP D C     1 
ATOM   9674  O  O     . ASP D 2 210 ? -50.011 30.706 -24.784 1.00 129.33 ? 589 ASP D O     1 
ATOM   9675  C  CB    . ASP D 2 210 ? -47.395 28.977 -23.573 1.00 138.92 ? 589 ASP D CB    1 
ATOM   9676  N  N     . GLN D 2 211 ? -48.355 31.944 -23.879 1.00 144.98 ? 590 GLN D N     1 
ATOM   9677  C  CA    . GLN D 2 211 ? -49.225 33.058 -23.512 1.00 135.70 ? 590 GLN D CA    1 
ATOM   9678  C  C     . GLN D 2 211 ? -49.953 33.671 -24.709 1.00 129.15 ? 590 GLN D C     1 
ATOM   9679  O  O     . GLN D 2 211 ? -51.177 33.723 -24.727 1.00 126.21 ? 590 GLN D O     1 
ATOM   9680  C  CB    . GLN D 2 211 ? -48.430 34.136 -22.785 1.00 134.21 ? 590 GLN D CB    1 
ATOM   9681  C  CG    . GLN D 2 211 ? -47.960 33.732 -21.412 1.00 142.88 ? 590 GLN D CG    1 
ATOM   9682  C  CD    . GLN D 2 211 ? -47.015 34.754 -20.823 1.00 156.12 ? 590 GLN D CD    1 
ATOM   9683  O  OE1   . GLN D 2 211 ? -46.877 35.862 -21.353 1.00 147.96 ? 590 GLN D OE1   1 
ATOM   9684  N  NE2   . GLN D 2 211 ? -46.348 34.389 -19.726 1.00 166.33 ? 590 GLN D NE2   1 
ATOM   9685  N  N     . LEU D 2 212 ? -49.199 34.125 -25.707 1.00 128.17 ? 591 LEU D N     1 
ATOM   9686  C  CA    . LEU D 2 212 ? -49.781 34.749 -26.891 1.00 116.58 ? 591 LEU D CA    1 
ATOM   9687  C  C     . LEU D 2 212 ? -50.818 33.825 -27.495 1.00 121.64 ? 591 LEU D C     1 
ATOM   9688  O  O     . LEU D 2 212 ? -51.887 34.264 -27.927 1.00 125.88 ? 591 LEU D O     1 
ATOM   9689  C  CB    . LEU D 2 212 ? -48.712 35.027 -27.944 1.00 110.98 ? 591 LEU D CB    1 
ATOM   9690  C  CG    . LEU D 2 212 ? -48.791 36.318 -28.765 1.00 109.55 ? 591 LEU D CG    1 
ATOM   9691  C  CD1   . LEU D 2 212 ? -48.025 36.146 -30.051 1.00 111.07 ? 591 LEU D CD1   1 
ATOM   9692  C  CD2   . LEU D 2 212 ? -50.196 36.709 -29.086 1.00 111.62 ? 591 LEU D CD2   1 
ATOM   9693  N  N     . TRP D 2 213 ? -50.492 32.539 -27.544 1.00 127.91 ? 592 TRP D N     1 
ATOM   9694  C  CA    . TRP D 2 213 ? -51.429 31.568 -28.089 1.00 136.33 ? 592 TRP D CA    1 
ATOM   9695  C  C     . TRP D 2 213 ? -52.696 31.502 -27.239 1.00 134.59 ? 592 TRP D C     1 
ATOM   9696  O  O     . TRP D 2 213 ? -53.778 31.881 -27.699 1.00 125.18 ? 592 TRP D O     1 
ATOM   9697  C  CB    . TRP D 2 213 ? -50.770 30.188 -28.234 1.00 133.76 ? 592 TRP D CB    1 
ATOM   9698  C  CG    . TRP D 2 213 ? -51.710 29.125 -28.672 1.00 133.14 ? 592 TRP D CG    1 
ATOM   9699  C  CD1   . TRP D 2 213 ? -52.220 28.127 -27.907 1.00 133.86 ? 592 TRP D CD1   1 
ATOM   9700  C  CD2   . TRP D 2 213 ? -52.281 28.965 -29.973 1.00 145.17 ? 592 TRP D CD2   1 
ATOM   9701  N  NE1   . TRP D 2 213 ? -53.070 27.349 -28.646 1.00 131.72 ? 592 TRP D NE1   1 
ATOM   9702  C  CE2   . TRP D 2 213 ? -53.123 27.838 -29.922 1.00 137.70 ? 592 TRP D CE2   1 
ATOM   9703  C  CE3   . TRP D 2 213 ? -52.162 29.662 -31.180 1.00 159.66 ? 592 TRP D CE3   1 
ATOM   9704  C  CZ2   . TRP D 2 213 ? -53.841 27.390 -31.030 1.00 139.07 ? 592 TRP D CZ2   1 
ATOM   9705  C  CZ3   . TRP D 2 213 ? -52.881 29.214 -32.286 1.00 155.17 ? 592 TRP D CZ3   1 
ATOM   9706  C  CH2   . TRP D 2 213 ? -53.705 28.090 -32.199 1.00 145.67 ? 592 TRP D CH2   1 
ATOM   9707  N  N     . GLU D 2 214 ? -52.544 31.069 -25.987 1.00 137.89 ? 593 GLU D N     1 
ATOM   9708  C  CA    . GLU D 2 214 ? -53.683 30.812 -25.102 1.00 137.56 ? 593 GLU D CA    1 
ATOM   9709  C  C     . GLU D 2 214 ? -54.631 32.006 -24.990 1.00 135.93 ? 593 GLU D C     1 
ATOM   9710  O  O     . GLU D 2 214 ? -55.843 31.840 -24.907 1.00 141.89 ? 593 GLU D O     1 
ATOM   9711  C  CB    . GLU D 2 214 ? -53.223 30.348 -23.709 1.00 122.53 ? 593 GLU D CB    1 
ATOM   9712  N  N     . THR D 2 215 ? -54.073 33.206 -24.950 1.00 130.50 ? 594 THR D N     1 
ATOM   9713  C  CA    . THR D 2 215 ? -54.882 34.413 -24.835 1.00 127.54 ? 594 THR D CA    1 
ATOM   9714  C  C     . THR D 2 215 ? -55.479 34.932 -26.138 1.00 131.93 ? 594 THR D C     1 
ATOM   9715  O  O     . THR D 2 215 ? -56.685 35.165 -26.209 1.00 145.32 ? 594 THR D O     1 
ATOM   9716  C  CB    . THR D 2 215 ? -54.091 35.562 -24.224 1.00 123.37 ? 594 THR D CB    1 
ATOM   9717  O  OG1   . THR D 2 215 ? -53.038 35.936 -25.119 1.00 132.61 ? 594 THR D OG1   1 
ATOM   9718  C  CG2   . THR D 2 215 ? -53.509 35.143 -22.865 1.00 111.57 ? 594 THR D CG2   1 
ATOM   9719  N  N     . THR D 2 216 ? -54.649 35.133 -27.161 1.00 128.26 ? 595 THR D N     1 
ATOM   9720  C  CA    . THR D 2 216 ? -55.092 35.958 -28.287 1.00 136.73 ? 595 THR D CA    1 
ATOM   9721  C  C     . THR D 2 216 ? -55.016 35.396 -29.707 1.00 135.23 ? 595 THR D C     1 
ATOM   9722  O  O     . THR D 2 216 ? -55.365 36.106 -30.648 1.00 140.48 ? 595 THR D O     1 
ATOM   9723  C  CB    . THR D 2 216 ? -54.406 37.357 -28.261 1.00 124.87 ? 595 THR D CB    1 
ATOM   9724  O  OG1   . THR D 2 216 ? -53.372 37.429 -29.250 1.00 115.53 ? 595 THR D OG1   1 
ATOM   9725  C  CG2   . THR D 2 216 ? -53.847 37.664 -26.863 1.00 99.25  ? 595 THR D CG2   1 
ATOM   9726  N  N     . MET D 2 217 ? -54.581 34.151 -29.885 1.00 135.51 ? 596 MET D N     1 
ATOM   9727  C  CA    . MET D 2 217 ? -54.527 33.589 -31.242 1.00 143.72 ? 596 MET D CA    1 
ATOM   9728  C  C     . MET D 2 217 ? -55.354 32.315 -31.449 1.00 148.18 ? 596 MET D C     1 
ATOM   9729  O  O     . MET D 2 217 ? -56.005 32.145 -32.481 1.00 149.62 ? 596 MET D O     1 
ATOM   9730  C  CB    . MET D 2 217 ? -53.085 33.370 -31.691 1.00 140.64 ? 596 MET D CB    1 
ATOM   9731  C  CG    . MET D 2 217 ? -52.407 34.644 -32.090 1.00 139.82 ? 596 MET D CG    1 
ATOM   9732  S  SD    . MET D 2 217 ? -50.650 34.439 -32.340 1.00 133.47 ? 596 MET D SD    1 
ATOM   9733  C  CE    . MET D 2 217 ? -50.642 33.867 -34.025 1.00 101.50 ? 596 MET D CE    1 
ATOM   9734  N  N     . ASN D 2 218 ? -55.320 31.424 -30.467 1.00 143.93 ? 597 ASN D N     1 
ATOM   9735  C  CA    . ASN D 2 218 ? -56.102 30.199 -30.515 1.00 137.26 ? 597 ASN D CA    1 
ATOM   9736  C  C     . ASN D 2 218 ? -57.596 30.488 -30.597 1.00 127.00 ? 597 ASN D C     1 
ATOM   9737  O  O     . ASN D 2 218 ? -58.174 30.988 -29.642 1.00 124.91 ? 597 ASN D O     1 
ATOM   9738  C  CB    . ASN D 2 218 ? -55.810 29.374 -29.271 1.00 142.85 ? 597 ASN D CB    1 
ATOM   9739  C  CG    . ASN D 2 218 ? -56.739 28.218 -29.122 1.00 152.18 ? 597 ASN D CG    1 
ATOM   9740  O  OD1   . ASN D 2 218 ? -57.377 27.784 -30.084 1.00 159.00 ? 597 ASN D OD1   1 
ATOM   9741  N  ND2   . ASN D 2 218 ? -56.831 27.702 -27.909 1.00 156.66 ? 597 ASN D ND2   1 
ATOM   9742  N  N     . PRO D 2 219 ? -58.230 30.146 -31.731 1.00 121.16 ? 598 PRO D N     1 
ATOM   9743  C  CA    . PRO D 2 219 ? -59.638 30.450 -32.003 1.00 115.29 ? 598 PRO D CA    1 
ATOM   9744  C  C     . PRO D 2 219 ? -60.585 29.925 -30.928 1.00 132.46 ? 598 PRO D C     1 
ATOM   9745  O  O     . PRO D 2 219 ? -61.618 30.541 -30.678 1.00 137.44 ? 598 PRO D O     1 
ATOM   9746  C  CB    . PRO D 2 219 ? -59.903 29.709 -33.313 1.00 107.50 ? 598 PRO D CB    1 
ATOM   9747  C  CG    . PRO D 2 219 ? -58.588 29.547 -33.931 1.00 106.97 ? 598 PRO D CG    1 
ATOM   9748  C  CD    . PRO D 2 219 ? -57.655 29.314 -32.793 1.00 120.58 ? 598 PRO D CD    1 
ATOM   9749  N  N     . GLU D 2 220 ? -60.250 28.801 -30.306 1.00 144.04 ? 599 GLU D N     1 
ATOM   9750  C  CA    . GLU D 2 220 ? -61.117 28.239 -29.277 1.00 145.80 ? 599 GLU D CA    1 
ATOM   9751  C  C     . GLU D 2 220 ? -61.338 29.212 -28.106 1.00 142.93 ? 599 GLU D C     1 
ATOM   9752  O  O     . GLU D 2 220 ? -62.466 29.396 -27.651 1.00 147.66 ? 599 GLU D O     1 
ATOM   9753  C  CB    . GLU D 2 220 ? -60.575 26.892 -28.790 1.00 143.46 ? 599 GLU D CB    1 
ATOM   9754  N  N     . THR D 2 221 ? -60.270 29.854 -27.642 1.00 134.17 ? 600 THR D N     1 
ATOM   9755  C  CA    . THR D 2 221 ? -60.343 30.691 -26.443 1.00 137.36 ? 600 THR D CA    1 
ATOM   9756  C  C     . THR D 2 221 ? -60.064 32.172 -26.688 1.00 134.57 ? 600 THR D C     1 
ATOM   9757  O  O     . THR D 2 221 ? -60.096 32.978 -25.756 1.00 125.08 ? 600 THR D O     1 
ATOM   9758  C  CB    . THR D 2 221 ? -59.334 30.232 -25.408 1.00 147.72 ? 600 THR D CB    1 
ATOM   9759  O  OG1   . THR D 2 221 ? -58.019 30.405 -25.943 1.00 144.71 ? 600 THR D OG1   1 
ATOM   9760  C  CG2   . THR D 2 221 ? -59.554 28.770 -25.078 1.00 163.25 ? 600 THR D CG2   1 
ATOM   9761  N  N     . ARG D 2 222 ? -59.774 32.520 -27.937 1.00 140.09 ? 601 ARG D N     1 
ATOM   9762  C  CA    . ARG D 2 222 ? -59.484 33.898 -28.325 1.00 130.27 ? 601 ARG D CA    1 
ATOM   9763  C  C     . ARG D 2 222 ? -60.770 34.634 -28.592 1.00 130.31 ? 601 ARG D C     1 
ATOM   9764  O  O     . ARG D 2 222 ? -61.835 34.031 -28.654 1.00 130.73 ? 601 ARG D O     1 
ATOM   9765  C  CB    . ARG D 2 222 ? -58.662 33.961 -29.606 1.00 118.96 ? 601 ARG D CB    1 
ATOM   9766  C  CG    . ARG D 2 222 ? -59.482 34.255 -30.870 1.00 98.36  ? 601 ARG D CG    1 
ATOM   9767  C  CD    . ARG D 2 222 ? -58.678 33.852 -32.087 1.00 102.39 ? 601 ARG D CD    1 
ATOM   9768  N  NE    . ARG D 2 222 ? -59.470 33.836 -33.302 1.00 121.75 ? 601 ARG D NE    1 
ATOM   9769  C  CZ    . ARG D 2 222 ? -58.996 33.479 -34.491 1.00 134.73 ? 601 ARG D CZ    1 
ATOM   9770  N  NH1   . ARG D 2 222 ? -57.728 33.101 -34.620 1.00 132.90 ? 601 ARG D NH1   1 
ATOM   9771  N  NH2   . ARG D 2 222 ? -59.794 33.504 -35.553 1.00 138.72 ? 601 ARG D NH2   1 
ATOM   9772  N  N     . THR D 2 223 ? -60.673 35.948 -28.711 1.00 135.80 ? 602 THR D N     1 
ATOM   9773  C  CA    . THR D 2 223 ? -61.770 36.716 -29.266 1.00 135.13 ? 602 THR D CA    1 
ATOM   9774  C  C     . THR D 2 223 ? -61.271 37.820 -30.199 1.00 133.84 ? 602 THR D C     1 
ATOM   9775  O  O     . THR D 2 223 ? -60.285 38.497 -29.906 1.00 141.78 ? 602 THR D O     1 
ATOM   9776  C  CB    . THR D 2 223 ? -62.711 37.265 -28.190 1.00 137.40 ? 602 THR D CB    1 
ATOM   9777  O  OG1   . THR D 2 223 ? -63.538 38.274 -28.784 1.00 129.75 ? 602 THR D OG1   1 
ATOM   9778  C  CG2   . THR D 2 223 ? -61.924 37.817 -26.959 1.00 102.79 ? 602 THR D CG2   1 
ATOM   9779  N  N     . LEU D 2 224 ? -61.964 37.990 -31.321 1.00 137.99 ? 603 LEU D N     1 
ATOM   9780  C  CA    . LEU D 2 224 ? -61.546 38.912 -32.375 1.00 127.83 ? 603 LEU D CA    1 
ATOM   9781  C  C     . LEU D 2 224 ? -62.582 39.988 -32.604 1.00 125.46 ? 603 LEU D C     1 
ATOM   9782  O  O     . LEU D 2 224 ? -63.761 39.792 -32.353 1.00 130.34 ? 603 LEU D O     1 
ATOM   9783  C  CB    . LEU D 2 224 ? -61.337 38.191 -33.710 1.00 111.61 ? 603 LEU D CB    1 
ATOM   9784  C  CG    . LEU D 2 224 ? -60.293 37.088 -33.790 1.00 113.87 ? 603 LEU D CG    1 
ATOM   9785  C  CD1   . LEU D 2 224 ? -59.600 37.127 -35.137 1.00 114.97 ? 603 LEU D CD1   1 
ATOM   9786  C  CD2   . LEU D 2 224 ? -59.288 37.268 -32.695 1.00 114.69 ? 603 LEU D CD2   1 
ATOM   9787  N  N     . ILE D 2 225 ? -62.139 41.120 -33.123 1.00 122.05 ? 604 ILE D N     1 
ATOM   9788  C  CA    . ILE D 2 225 ? -63.059 42.179 -33.476 1.00 121.03 ? 604 ILE D CA    1 
ATOM   9789  C  C     . ILE D 2 225 ? -63.228 42.158 -34.980 1.00 135.18 ? 604 ILE D C     1 
ATOM   9790  O  O     . ILE D 2 225 ? -62.257 42.014 -35.729 1.00 141.43 ? 604 ILE D O     1 
ATOM   9791  C  CB    . ILE D 2 225 ? -62.534 43.547 -33.060 1.00 106.72 ? 604 ILE D CB    1 
ATOM   9792  C  CG1   . ILE D 2 225 ? -62.709 43.748 -31.566 1.00 105.39 ? 604 ILE D CG1   1 
ATOM   9793  C  CG2   . ILE D 2 225 ? -63.285 44.623 -33.789 1.00 106.67 ? 604 ILE D CG2   1 
ATOM   9794  C  CD1   . ILE D 2 225 ? -62.367 45.153 -31.123 1.00 118.03 ? 604 ILE D CD1   1 
ATOM   9795  N  N     . ARG D 2 226 ? -64.467 42.300 -35.426 1.00 134.47 ? 605 ARG D N     1 
ATOM   9796  C  CA    . ARG D 2 226 ? -64.749 42.184 -36.840 1.00 139.85 ? 605 ARG D CA    1 
ATOM   9797  C  C     . ARG D 2 226 ? -65.210 43.534 -37.338 1.00 139.32 ? 605 ARG D C     1 
ATOM   9798  O  O     . ARG D 2 226 ? -66.234 44.051 -36.892 1.00 145.92 ? 605 ARG D O     1 
ATOM   9799  C  CB    . ARG D 2 226 ? -65.826 41.134 -37.081 1.00 143.25 ? 605 ARG D CB    1 
ATOM   9800  C  CG    . ARG D 2 226 ? -65.892 40.614 -38.504 1.00 146.59 ? 605 ARG D CG    1 
ATOM   9801  C  CD    . ARG D 2 226 ? -67.116 39.754 -38.671 1.00 153.46 ? 605 ARG D CD    1 
ATOM   9802  N  NE    . ARG D 2 226 ? -67.364 39.389 -40.054 1.00 157.90 ? 605 ARG D NE    1 
ATOM   9803  C  CZ    . ARG D 2 226 ? -68.564 39.434 -40.617 1.00 167.78 ? 605 ARG D CZ    1 
ATOM   9804  N  NH1   . ARG D 2 226 ? -69.615 39.855 -39.918 1.00 154.87 ? 605 ARG D NH1   1 
ATOM   9805  N  NH2   . ARG D 2 226 ? -68.709 39.079 -41.884 1.00 182.91 ? 605 ARG D NH2   1 
ATOM   9806  N  N     . VAL D 2 227 ? -64.474 44.096 -38.287 1.00 123.40 ? 606 VAL D N     1 
ATOM   9807  C  CA    . VAL D 2 227 ? -64.694 45.483 -38.639 1.00 116.48 ? 606 VAL D CA    1 
ATOM   9808  C  C     . VAL D 2 227 ? -65.552 45.538 -39.870 1.00 137.67 ? 606 VAL D C     1 
ATOM   9809  O  O     . VAL D 2 227 ? -65.232 44.955 -40.909 1.00 145.30 ? 606 VAL D O     1 
ATOM   9810  C  CB    . VAL D 2 227 ? -63.391 46.244 -38.908 1.00 111.49 ? 606 VAL D CB    1 
ATOM   9811  C  CG1   . VAL D 2 227 ? -63.684 47.703 -39.134 1.00 109.15 ? 606 VAL D CG1   1 
ATOM   9812  C  CG2   . VAL D 2 227 ? -62.430 46.081 -37.772 1.00 115.62 ? 606 VAL D CG2   1 
ATOM   9813  N  N     . THR D 2 228 ? -66.660 46.245 -39.735 1.00 135.92 ? 607 THR D N     1 
ATOM   9814  C  CA    . THR D 2 228 ? -67.610 46.393 -40.814 1.00 134.56 ? 607 THR D CA    1 
ATOM   9815  C  C     . THR D 2 228 ? -67.897 47.864 -40.942 1.00 135.10 ? 607 THR D C     1 
ATOM   9816  O  O     . THR D 2 228 ? -67.693 48.617 -40.008 1.00 146.11 ? 607 THR D O     1 
ATOM   9817  C  CB    . THR D 2 228 ? -68.900 45.672 -40.492 1.00 132.35 ? 607 THR D CB    1 
ATOM   9818  O  OG1   . THR D 2 228 ? -69.032 45.589 -39.062 1.00 145.20 ? 607 THR D OG1   1 
ATOM   9819  C  CG2   . THR D 2 228 ? -68.887 44.269 -41.103 1.00 111.94 ? 607 THR D CG2   1 
ATOM   9820  N  N     . ILE D 2 229 ? -68.352 48.284 -42.105 1.00 138.31 ? 608 ILE D N     1 
ATOM   9821  C  CA    . ILE D 2 229 ? -68.741 49.668 -42.267 1.00 142.07 ? 608 ILE D CA    1 
ATOM   9822  C  C     . ILE D 2 229 ? -70.266 49.738 -42.446 1.00 153.01 ? 608 ILE D C     1 
ATOM   9823  O  O     . ILE D 2 229 ? -70.847 49.041 -43.278 1.00 153.37 ? 608 ILE D O     1 
ATOM   9824  C  CB    . ILE D 2 229 ? -67.889 50.422 -43.350 1.00 154.73 ? 608 ILE D CB    1 
ATOM   9825  C  CG1   . ILE D 2 229 ? -68.671 51.578 -43.953 1.00 167.16 ? 608 ILE D CG1   1 
ATOM   9826  C  CG2   . ILE D 2 229 ? -67.400 49.510 -44.428 1.00 84.35  ? 608 ILE D CG2   1 
ATOM   9827  C  CD1   . ILE D 2 229 ? -69.043 52.651 -42.920 1.00 182.65 ? 608 ILE D CD1   1 
ATOM   9828  N  N     . GLU D 2 230 ? -70.906 50.567 -41.627 1.00 161.62 ? 609 GLU D N     1 
ATOM   9829  C  CA    . GLU D 2 230 ? -72.362 50.566 -41.510 1.00 155.79 ? 609 GLU D CA    1 
ATOM   9830  C  C     . GLU D 2 230 ? -72.978 51.844 -42.048 1.00 155.52 ? 609 GLU D C     1 
ATOM   9831  O  O     . GLU D 2 230 ? -74.193 52.019 -42.010 1.00 161.06 ? 609 GLU D O     1 
ATOM   9832  C  CB    . GLU D 2 230 ? -72.799 50.360 -40.061 1.00 151.37 ? 609 GLU D CB    1 
ATOM   9833  N  N     . ASP D 2 231 ? -72.132 52.752 -42.518 1.00 174.39 ? 610 ASP D N     1 
ATOM   9834  C  CA    . ASP D 2 231 ? -72.577 53.721 -43.494 1.00 175.50 ? 610 ASP D CA    1 
ATOM   9835  C  C     . ASP D 2 231 ? -71.580 53.592 -44.624 1.00 189.53 ? 610 ASP D C     1 
ATOM   9836  O  O     . ASP D 2 231 ? -71.036 52.517 -44.829 1.00 211.04 ? 610 ASP D O     1 
ATOM   9837  C  CB    . ASP D 2 231 ? -72.530 55.123 -42.911 1.00 170.72 ? 610 ASP D CB    1 
ATOM   9838  C  CG    . ASP D 2 231 ? -73.864 55.837 -43.026 1.00 194.79 ? 610 ASP D CG    1 
ATOM   9839  O  OD1   . ASP D 2 231 ? -73.910 56.949 -43.600 1.00 207.75 ? 610 ASP D OD1   1 
ATOM   9840  O  OD2   . ASP D 2 231 ? -74.877 55.273 -42.553 1.00 200.78 ? 610 ASP D OD2   1 
ATOM   9841  N  N     . LEU D 2 232 ? -71.366 54.645 -45.397 1.00 179.54 ? 611 LEU D N     1 
ATOM   9842  C  CA    . LEU D 2 232 ? -70.110 54.810 -46.102 1.00 165.11 ? 611 LEU D CA    1 
ATOM   9843  C  C     . LEU D 2 232 ? -69.766 56.246 -45.816 1.00 165.27 ? 611 LEU D C     1 
ATOM   9844  O  O     . LEU D 2 232 ? -68.631 56.588 -45.508 1.00 168.32 ? 611 LEU D O     1 
ATOM   9845  C  CB    . LEU D 2 232 ? -70.277 54.641 -47.604 1.00 166.09 ? 611 LEU D CB    1 
ATOM   9846  C  CG    . LEU D 2 232 ? -69.066 53.983 -48.279 1.00 176.24 ? 611 LEU D CG    1 
ATOM   9847  C  CD1   . LEU D 2 232 ? -69.325 52.500 -48.546 1.00 172.87 ? 611 LEU D CD1   1 
ATOM   9848  C  CD2   . LEU D 2 232 ? -68.695 54.686 -49.579 1.00 187.96 ? 611 LEU D CD2   1 
ATOM   9849  N  N     . ALA D 2 233 ? -70.794 57.081 -45.944 1.00 161.91 ? 612 ALA D N     1 
ATOM   9850  C  CA    . ALA D 2 233 ? -70.699 58.523 -45.770 1.00 147.65 ? 612 ALA D CA    1 
ATOM   9851  C  C     . ALA D 2 233 ? -70.131 58.887 -44.411 1.00 155.06 ? 612 ALA D C     1 
ATOM   9852  O  O     . ALA D 2 233 ? -69.287 59.773 -44.317 1.00 157.09 ? 612 ALA D O     1 
ATOM   9853  C  CB    . ALA D 2 233 ? -72.060 59.151 -45.939 1.00 135.97 ? 612 ALA D CB    1 
ATOM   9854  N  N     . ARG D 2 234 ? -70.613 58.216 -43.363 1.00 157.02 ? 613 ARG D N     1 
ATOM   9855  C  CA    . ARG D 2 234 ? -70.129 58.436 -42.001 1.00 147.90 ? 613 ARG D CA    1 
ATOM   9856  C  C     . ARG D 2 234 ? -68.657 58.075 -41.912 1.00 153.24 ? 613 ARG D C     1 
ATOM   9857  O  O     . ARG D 2 234 ? -67.857 58.825 -41.354 1.00 158.97 ? 613 ARG D O     1 
ATOM   9858  C  CB    . ARG D 2 234 ? -70.908 57.598 -40.988 1.00 140.73 ? 613 ARG D CB    1 
ATOM   9859  C  CG    . ARG D 2 234 ? -72.397 57.859 -40.957 1.00 155.02 ? 613 ARG D CG    1 
ATOM   9860  C  CD    . ARG D 2 234 ? -72.794 58.695 -39.768 1.00 170.69 ? 613 ARG D CD    1 
ATOM   9861  N  NE    . ARG D 2 234 ? -74.221 58.590 -39.456 1.00 182.33 ? 613 ARG D NE    1 
ATOM   9862  C  CZ    . ARG D 2 234 ? -74.796 57.519 -38.914 1.00 184.82 ? 613 ARG D CZ    1 
ATOM   9863  N  NH1   . ARG D 2 234 ? -74.075 56.436 -38.641 1.00 181.38 ? 613 ARG D NH1   1 
ATOM   9864  N  NH2   . ARG D 2 234 ? -76.097 57.528 -38.654 1.00 189.08 ? 613 ARG D NH2   1 
ATOM   9865  N  N     . ALA D 2 235 ? -68.304 56.917 -42.459 1.00 147.20 ? 614 ALA D N     1 
ATOM   9866  C  CA    . ALA D 2 235 ? -66.921 56.466 -42.430 1.00 147.38 ? 614 ALA D CA    1 
ATOM   9867  C  C     . ALA D 2 235 ? -66.021 57.489 -43.092 1.00 133.14 ? 614 ALA D C     1 
ATOM   9868  O  O     . ALA D 2 235 ? -65.053 57.954 -42.494 1.00 134.94 ? 614 ALA D O     1 
ATOM   9869  C  CB    . ALA D 2 235 ? -66.788 55.152 -43.127 1.00 161.19 ? 614 ALA D CB    1 
ATOM   9870  N  N     . GLU D 2 236 ? -66.353 57.843 -44.325 1.00 112.46 ? 615 GLU D N     1 
ATOM   9871  C  CA    . GLU D 2 236 ? -65.601 58.852 -45.054 1.00 134.89 ? 615 GLU D CA    1 
ATOM   9872  C  C     . GLU D 2 236 ? -65.469 60.112 -44.202 1.00 144.40 ? 615 GLU D C     1 
ATOM   9873  O  O     . GLU D 2 236 ? -64.360 60.616 -43.987 1.00 149.91 ? 615 GLU D O     1 
ATOM   9874  C  CB    . GLU D 2 236 ? -66.319 59.175 -46.372 1.00 149.91 ? 615 GLU D CB    1 
ATOM   9875  C  CG    . GLU D 2 236 ? -65.539 60.052 -47.343 1.00 160.44 ? 615 GLU D CG    1 
ATOM   9876  C  CD    . GLU D 2 236 ? -64.306 59.365 -47.913 1.00 171.84 ? 615 GLU D CD    1 
ATOM   9877  O  OE1   . GLU D 2 236 ? -64.153 58.133 -47.744 1.00 174.81 ? 615 GLU D OE1   1 
ATOM   9878  O  OE2   . GLU D 2 236 ? -63.485 60.067 -48.536 1.00 180.00 ? 615 GLU D OE2   1 
ATOM   9879  N  N     . ARG D 2 237 ? -66.604 60.591 -43.692 1.00 140.50 ? 616 ARG D N     1 
ATOM   9880  C  CA    . ARG D 2 237 ? -66.646 61.813 -42.897 1.00 131.04 ? 616 ARG D CA    1 
ATOM   9881  C  C     . ARG D 2 237 ? -65.643 61.712 -41.777 1.00 117.69 ? 616 ARG D C     1 
ATOM   9882  O  O     . ARG D 2 237 ? -64.780 62.582 -41.621 1.00 118.79 ? 616 ARG D O     1 
ATOM   9883  C  CB    . ARG D 2 237 ? -68.024 62.032 -42.276 1.00 114.46 ? 616 ARG D CB    1 
ATOM   9884  C  CG    . ARG D 2 237 ? -68.446 63.485 -42.235 1.00 119.14 ? 616 ARG D CG    1 
ATOM   9885  C  CD    . ARG D 2 237 ? -69.782 63.664 -41.545 1.00 140.37 ? 616 ARG D CD    1 
ATOM   9886  N  NE    . ARG D 2 237 ? -70.795 62.747 -42.045 1.00 135.96 ? 616 ARG D NE    1 
ATOM   9887  C  CZ    . ARG D 2 237 ? -71.402 62.895 -43.214 1.00 156.90 ? 616 ARG D CZ    1 
ATOM   9888  N  NH1   . ARG D 2 237 ? -71.075 63.920 -43.982 1.00 160.39 ? 616 ARG D NH1   1 
ATOM   9889  N  NH2   . ARG D 2 237 ? -72.325 62.025 -43.622 1.00 174.85 ? 616 ARG D NH2   1 
ATOM   9890  N  N     . ARG D 2 238 ? -65.756 60.636 -41.006 1.00 106.30 ? 617 ARG D N     1 
ATOM   9891  C  CA    . ARG D 2 238 ? -64.912 60.461 -39.833 1.00 130.99 ? 617 ARG D CA    1 
ATOM   9892  C  C     . ARG D 2 238 ? -63.444 60.304 -40.166 1.00 128.86 ? 617 ARG D C     1 
ATOM   9893  O  O     . ARG D 2 238 ? -62.602 61.003 -39.612 1.00 115.71 ? 617 ARG D O     1 
ATOM   9894  C  CB    . ARG D 2 238 ? -65.342 59.252 -39.030 1.00 138.33 ? 617 ARG D CB    1 
ATOM   9895  C  CG    . ARG D 2 238 ? -64.426 58.997 -37.866 1.00 131.24 ? 617 ARG D CG    1 
ATOM   9896  C  CD    . ARG D 2 238 ? -65.212 58.498 -36.692 1.00 127.24 ? 617 ARG D CD    1 
ATOM   9897  N  NE    . ARG D 2 238 ? -65.723 59.596 -35.893 1.00 123.49 ? 617 ARG D NE    1 
ATOM   9898  C  CZ    . ARG D 2 238 ? -66.516 59.426 -34.846 1.00 138.82 ? 617 ARG D CZ    1 
ATOM   9899  N  NH1   . ARG D 2 238 ? -66.892 58.200 -34.502 1.00 139.91 ? 617 ARG D NH1   1 
ATOM   9900  N  NH2   . ARG D 2 238 ? -66.940 60.477 -34.149 1.00 143.78 ? 617 ARG D NH2   1 
ATOM   9901  N  N     . VAL D 2 239 ? -63.136 59.374 -41.059 1.00 138.47 ? 618 VAL D N     1 
ATOM   9902  C  CA    . VAL D 2 239 ? -61.748 59.124 -41.413 1.00 143.00 ? 618 VAL D CA    1 
ATOM   9903  C  C     . VAL D 2 239 ? -61.078 60.422 -41.849 1.00 138.90 ? 618 VAL D C     1 
ATOM   9904  O  O     . VAL D 2 239 ? -59.996 60.764 -41.371 1.00 126.76 ? 618 VAL D O     1 
ATOM   9905  C  CB    . VAL D 2 239 ? -61.608 58.039 -42.504 1.00 134.49 ? 618 VAL D CB    1 
ATOM   9906  C  CG1   . VAL D 2 239 ? -60.161 57.919 -42.939 1.00 128.10 ? 618 VAL D CG1   1 
ATOM   9907  C  CG2   . VAL D 2 239 ? -62.100 56.700 -41.976 1.00 125.28 ? 618 VAL D CG2   1 
ATOM   9908  N  N     . ASN D 2 240 ? -61.730 61.157 -42.742 1.00 132.63 ? 619 ASN D N     1 
ATOM   9909  C  CA    . ASN D 2 240 ? -61.137 62.388 -43.246 1.00 132.67 ? 619 ASN D CA    1 
ATOM   9910  C  C     . ASN D 2 240 ? -60.826 63.445 -42.187 1.00 140.97 ? 619 ASN D C     1 
ATOM   9911  O  O     . ASN D 2 240 ? -59.916 64.243 -42.376 1.00 157.21 ? 619 ASN D O     1 
ATOM   9912  C  CB    . ASN D 2 240 ? -61.929 62.957 -44.408 1.00 135.65 ? 619 ASN D CB    1 
ATOM   9913  C  CG    . ASN D 2 240 ? -62.099 61.951 -45.514 1.00 154.96 ? 619 ASN D CG    1 
ATOM   9914  O  OD1   . ASN D 2 240 ? -61.301 61.017 -45.654 1.00 155.68 ? 619 ASN D OD1   1 
ATOM   9915  N  ND2   . ASN D 2 240 ? -63.153 62.117 -46.302 1.00 173.21 ? 619 ASN D ND2   1 
ATOM   9916  N  N     . VAL D 2 241 ? -61.588 63.486 -41.098 1.00 128.55 ? 620 VAL D N     1 
ATOM   9917  C  CA    . VAL D 2 241 ? -61.262 64.423 -40.024 1.00 116.30 ? 620 VAL D CA    1 
ATOM   9918  C  C     . VAL D 2 241 ? -60.056 63.966 -39.235 1.00 113.25 ? 620 VAL D C     1 
ATOM   9919  O  O     . VAL D 2 241 ? -59.056 64.673 -39.126 1.00 121.30 ? 620 VAL D O     1 
ATOM   9920  C  CB    . VAL D 2 241 ? -62.379 64.579 -39.013 1.00 107.28 ? 620 VAL D CB    1 
ATOM   9921  C  CG1   . VAL D 2 241 ? -62.477 66.052 -38.618 1.00 101.88 ? 620 VAL D CG1   1 
ATOM   9922  C  CG2   . VAL D 2 241 ? -63.681 64.072 -39.584 1.00 105.26 ? 620 VAL D CG2   1 
ATOM   9923  N  N     . LEU D 2 242 ? -60.169 62.779 -38.660 1.00 104.06 ? 621 LEU D N     1 
ATOM   9924  C  CA    . LEU D 2 242 ? -59.119 62.270 -37.812 1.00 113.65 ? 621 LEU D CA    1 
ATOM   9925  C  C     . LEU D 2 242 ? -57.845 62.130 -38.623 1.00 125.48 ? 621 LEU D C     1 
ATOM   9926  O  O     . LEU D 2 242 ? -56.836 62.773 -38.334 1.00 138.05 ? 621 LEU D O     1 
ATOM   9927  C  CB    . LEU D 2 242 ? -59.530 60.913 -37.252 1.00 125.62 ? 621 LEU D CB    1 
ATOM   9928  C  CG    . LEU D 2 242 ? -60.996 60.764 -36.830 1.00 134.93 ? 621 LEU D CG    1 
ATOM   9929  C  CD1   . LEU D 2 242 ? -61.277 59.342 -36.345 1.00 138.31 ? 621 LEU D CD1   1 
ATOM   9930  C  CD2   . LEU D 2 242 ? -61.386 61.784 -35.767 1.00 122.93 ? 621 LEU D CD2   1 
ATOM   9931  N  N     . MET D 2 243 ? -57.909 61.271 -39.634 1.00 123.44 ? 622 MET D N     1 
ATOM   9932  C  CA    . MET D 2 243 ? -56.764 60.921 -40.474 1.00 125.12 ? 622 MET D CA    1 
ATOM   9933  C  C     . MET D 2 243 ? -56.435 61.940 -41.552 1.00 128.38 ? 622 MET D C     1 
ATOM   9934  O  O     . MET D 2 243 ? -55.425 61.811 -42.240 1.00 132.46 ? 622 MET D O     1 
ATOM   9935  C  CB    . MET D 2 243 ? -57.015 59.574 -41.139 1.00 121.41 ? 622 MET D CB    1 
ATOM   9936  C  CG    . MET D 2 243 ? -57.488 58.542 -40.155 1.00 129.50 ? 622 MET D CG    1 
ATOM   9937  S  SD    . MET D 2 243 ? -56.451 58.540 -38.682 1.00 137.21 ? 622 MET D SD    1 
ATOM   9938  C  CE    . MET D 2 243 ? -54.917 57.980 -39.418 1.00 125.61 ? 622 MET D CE    1 
ATOM   9939  N  N     . GLY D 2 244 ? -57.293 62.941 -41.699 1.00 125.97 ? 623 GLY D N     1 
ATOM   9940  C  CA    . GLY D 2 244 ? -57.209 63.868 -42.812 1.00 127.93 ? 623 GLY D CA    1 
ATOM   9941  C  C     . GLY D 2 244 ? -55.912 64.631 -42.961 1.00 131.04 ? 623 GLY D C     1 
ATOM   9942  O  O     . GLY D 2 244 ? -54.860 64.191 -42.517 1.00 140.05 ? 623 GLY D O     1 
ATOM   9943  N  N     . ASP D 2 245 ? -55.993 65.789 -43.599 1.00 136.93 ? 624 ASP D N     1 
ATOM   9944  C  CA    . ASP D 2 245 ? -54.814 66.607 -43.814 1.00 139.94 ? 624 ASP D CA    1 
ATOM   9945  C  C     . ASP D 2 245 ? -55.020 68.011 -43.232 1.00 150.04 ? 624 ASP D C     1 
ATOM   9946  O  O     . ASP D 2 245 ? -54.083 68.814 -43.150 1.00 148.20 ? 624 ASP D O     1 
ATOM   9947  C  CB    . ASP D 2 245 ? -54.517 66.660 -45.319 1.00 116.25 ? 624 ASP D CB    1 
ATOM   9948  N  N     . LYS D 2 246 ? -56.246 68.281 -42.793 1.00 145.06 ? 625 LYS D N     1 
ATOM   9949  C  CA    . LYS D 2 246 ? -56.673 69.649 -42.515 1.00 140.12 ? 625 LYS D CA    1 
ATOM   9950  C  C     . LYS D 2 246 ? -56.395 70.196 -41.085 1.00 151.55 ? 625 LYS D C     1 
ATOM   9951  O  O     . LYS D 2 246 ? -56.298 71.410 -40.888 1.00 170.20 ? 625 LYS D O     1 
ATOM   9952  C  CB    . LYS D 2 246 ? -58.131 69.844 -42.981 1.00 122.83 ? 625 LYS D CB    1 
ATOM   9953  N  N     . VAL D 2 247 ? -56.248 69.315 -40.103 1.00 132.87 ? 626 VAL D N     1 
ATOM   9954  C  CA    . VAL D 2 247 ? -55.936 69.735 -38.729 1.00 136.08 ? 626 VAL D CA    1 
ATOM   9955  C  C     . VAL D 2 247 ? -57.061 70.512 -38.059 1.00 131.60 ? 626 VAL D C     1 
ATOM   9956  O  O     . VAL D 2 247 ? -57.646 70.044 -37.085 1.00 129.22 ? 626 VAL D O     1 
ATOM   9957  C  CB    . VAL D 2 247 ? -54.620 70.595 -38.597 1.00 120.70 ? 626 VAL D CB    1 
ATOM   9958  C  CG1   . VAL D 2 247 ? -54.438 71.061 -37.168 1.00 123.96 ? 626 VAL D CG1   1 
ATOM   9959  C  CG2   . VAL D 2 247 ? -53.398 69.803 -38.967 1.00 119.21 ? 626 VAL D CG2   1 
ATOM   9960  N  N     . GLU D 2 248 ? -57.341 71.708 -38.567 1.00 133.91 ? 627 GLU D N     1 
ATOM   9961  C  CA    . GLU D 2 248 ? -58.314 72.607 -37.943 1.00 135.61 ? 627 GLU D CA    1 
ATOM   9962  C  C     . GLU D 2 248 ? -59.576 71.893 -37.417 1.00 142.78 ? 627 GLU D C     1 
ATOM   9963  O  O     . GLU D 2 248 ? -60.038 72.180 -36.310 1.00 143.60 ? 627 GLU D O     1 
ATOM   9964  C  CB    . GLU D 2 248 ? -58.659 73.765 -38.893 1.00 121.04 ? 627 GLU D CB    1 
ATOM   9965  N  N     . PRO D 2 249 ? -60.141 70.965 -38.212 1.00 136.64 ? 628 PRO D N     1 
ATOM   9966  C  CA    . PRO D 2 249 ? -61.303 70.162 -37.797 1.00 136.73 ? 628 PRO D CA    1 
ATOM   9967  C  C     . PRO D 2 249 ? -60.953 69.090 -36.769 1.00 132.07 ? 628 PRO D C     1 
ATOM   9968  O  O     . PRO D 2 249 ? -61.631 68.937 -35.749 1.00 125.74 ? 628 PRO D O     1 
ATOM   9969  C  CB    . PRO D 2 249 ? -61.723 69.481 -39.097 1.00 134.55 ? 628 PRO D CB    1 
ATOM   9970  C  CG    . PRO D 2 249 ? -61.232 70.405 -40.153 1.00 138.85 ? 628 PRO D CG    1 
ATOM   9971  C  CD    . PRO D 2 249 ? -59.906 70.856 -39.657 1.00 129.12 ? 628 PRO D CD    1 
ATOM   9972  N  N     . ARG D 2 250 ? -59.903 68.335 -37.060 1.00 132.86 ? 629 ARG D N     1 
ATOM   9973  C  CA    . ARG D 2 250 ? -59.365 67.388 -36.105 1.00 122.19 ? 629 ARG D CA    1 
ATOM   9974  C  C     . ARG D 2 250 ? -59.297 68.038 -34.725 1.00 125.48 ? 629 ARG D C     1 
ATOM   9975  O  O     . ARG D 2 250 ? -59.881 67.535 -33.774 1.00 121.56 ? 629 ARG D O     1 
ATOM   9976  C  CB    . ARG D 2 250 ? -57.974 66.958 -36.551 1.00 104.58 ? 629 ARG D CB    1 
ATOM   9977  C  CG    . ARG D 2 250 ? -57.463 65.676 -35.954 1.00 97.29  ? 629 ARG D CG    1 
ATOM   9978  C  CD    . ARG D 2 250 ? -56.118 65.388 -36.568 1.00 106.61 ? 629 ARG D CD    1 
ATOM   9979  N  NE    . ARG D 2 250 ? -56.007 66.040 -37.864 1.00 115.83 ? 629 ARG D NE    1 
ATOM   9980  C  CZ    . ARG D 2 250 ? -55.204 65.628 -38.834 1.00 138.61 ? 629 ARG D CZ    1 
ATOM   9981  N  NH1   . ARG D 2 250 ? -54.435 64.559 -38.639 1.00 155.16 ? 629 ARG D NH1   1 
ATOM   9982  N  NH2   . ARG D 2 250 ? -55.177 66.274 -39.998 1.00 134.91 ? 629 ARG D NH2   1 
ATOM   9983  N  N     . ARG D 2 251 ? -58.610 69.172 -34.615 1.00 123.76 ? 630 ARG D N     1 
ATOM   9984  C  CA    . ARG D 2 251 ? -58.466 69.823 -33.315 1.00 124.42 ? 630 ARG D CA    1 
ATOM   9985  C  C     . ARG D 2 251 ? -59.813 69.957 -32.621 1.00 118.22 ? 630 ARG D C     1 
ATOM   9986  O  O     . ARG D 2 251 ? -59.958 69.606 -31.450 1.00 114.48 ? 630 ARG D O     1 
ATOM   9987  C  CB    . ARG D 2 251 ? -57.804 71.201 -33.452 1.00 127.30 ? 630 ARG D CB    1 
ATOM   9988  C  CG    . ARG D 2 251 ? -58.068 72.136 -32.282 1.00 137.02 ? 630 ARG D CG    1 
ATOM   9989  C  CD    . ARG D 2 251 ? -57.626 73.560 -32.590 1.00 169.40 ? 630 ARG D CD    1 
ATOM   9990  N  NE    . ARG D 2 251 ? -56.455 73.989 -31.816 1.00 192.28 ? 630 ARG D NE    1 
ATOM   9991  C  CZ    . ARG D 2 251 ? -55.293 74.370 -32.344 1.00 196.89 ? 630 ARG D CZ    1 
ATOM   9992  N  NH1   . ARG D 2 251 ? -55.122 74.377 -33.664 1.00 198.67 ? 630 ARG D NH1   1 
ATOM   9993  N  NH2   . ARG D 2 251 ? -54.300 74.752 -31.548 1.00 187.95 ? 630 ARG D NH2   1 
ATOM   9994  N  N     . LYS D 2 252 ? -60.795 70.478 -33.347 1.00 121.86 ? 631 LYS D N     1 
ATOM   9995  C  CA    . LYS D 2 252 ? -62.106 70.712 -32.766 1.00 131.05 ? 631 LYS D CA    1 
ATOM   9996  C  C     . LYS D 2 252 ? -62.671 69.386 -32.274 1.00 136.74 ? 631 LYS D C     1 
ATOM   9997  O  O     . LYS D 2 252 ? -63.158 69.276 -31.147 1.00 130.78 ? 631 LYS D O     1 
ATOM   9998  C  CB    . LYS D 2 252 ? -63.053 71.358 -33.784 1.00 137.49 ? 631 LYS D CB    1 
ATOM   9999  C  CG    . LYS D 2 252 ? -63.953 72.436 -33.191 1.00 147.33 ? 631 LYS D CG    1 
ATOM   10000 C  CD    . LYS D 2 252 ? -65.362 72.428 -33.776 1.00 159.29 ? 631 LYS D CD    1 
ATOM   10001 C  CE    . LYS D 2 252 ? -66.130 73.647 -33.294 1.00 170.22 ? 631 LYS D CE    1 
ATOM   10002 N  NZ    . LYS D 2 252 ? -65.607 74.118 -31.967 1.00 169.61 ? 631 LYS D NZ    1 
ATOM   10003 N  N     . TRP D 2 253 ? -62.588 68.374 -33.130 1.00 144.29 ? 632 TRP D N     1 
ATOM   10004 C  CA    . TRP D 2 253 ? -63.068 67.042 -32.798 1.00 134.91 ? 632 TRP D CA    1 
ATOM   10005 C  C     . TRP D 2 253 ? -62.470 66.557 -31.483 1.00 125.62 ? 632 TRP D C     1 
ATOM   10006 O  O     . TRP D 2 253 ? -63.152 65.920 -30.687 1.00 123.73 ? 632 TRP D O     1 
ATOM   10007 C  CB    . TRP D 2 253 ? -62.746 66.063 -33.922 1.00 122.13 ? 632 TRP D CB    1 
ATOM   10008 C  CG    . TRP D 2 253 ? -63.508 64.797 -33.794 1.00 129.18 ? 632 TRP D CG    1 
ATOM   10009 C  CD1   . TRP D 2 253 ? -64.717 64.500 -34.365 1.00 135.22 ? 632 TRP D CD1   1 
ATOM   10010 C  CD2   . TRP D 2 253 ? -63.134 63.654 -33.028 1.00 127.99 ? 632 TRP D CD2   1 
ATOM   10011 N  NE1   . TRP D 2 253 ? -65.109 63.233 -34.007 1.00 137.33 ? 632 TRP D NE1   1 
ATOM   10012 C  CE2   . TRP D 2 253 ? -64.151 62.693 -33.188 1.00 141.18 ? 632 TRP D CE2   1 
ATOM   10013 C  CE3   . TRP D 2 253 ? -62.037 63.344 -32.230 1.00 115.10 ? 632 TRP D CE3   1 
ATOM   10014 C  CZ2   . TRP D 2 253 ? -64.094 61.447 -32.575 1.00 140.21 ? 632 TRP D CZ2   1 
ATOM   10015 C  CZ3   . TRP D 2 253 ? -61.985 62.121 -31.627 1.00 123.73 ? 632 TRP D CZ3   1 
ATOM   10016 C  CH2   . TRP D 2 253 ? -63.010 61.184 -31.795 1.00 131.97 ? 632 TRP D CH2   1 
ATOM   10017 N  N     . ILE D 2 254 ? -61.190 66.855 -31.272 1.00 122.72 ? 633 ILE D N     1 
ATOM   10018 C  CA    . ILE D 2 254 ? -60.536 66.587 -29.997 1.00 97.21  ? 633 ILE D CA    1 
ATOM   10019 C  C     . ILE D 2 254 ? -61.186 67.350 -28.860 1.00 113.44 ? 633 ILE D C     1 
ATOM   10020 O  O     . ILE D 2 254 ? -61.719 66.738 -27.944 1.00 112.52 ? 633 ILE D O     1 
ATOM   10021 C  CB    . ILE D 2 254 ? -59.094 67.025 -29.999 1.00 105.13 ? 633 ILE D CB    1 
ATOM   10022 C  CG1   . ILE D 2 254 ? -58.217 65.867 -30.393 1.00 92.74  ? 633 ILE D CG1   1 
ATOM   10023 C  CG2   . ILE D 2 254 ? -58.690 67.520 -28.612 1.00 111.06 ? 633 ILE D CG2   1 
ATOM   10024 C  CD1   . ILE D 2 254 ? -58.063 65.770 -31.851 1.00 107.26 ? 633 ILE D CD1   1 
ATOM   10025 N  N     . GLU D 2 255 ? -61.155 68.682 -28.925 1.00 112.19 ? 634 GLU D N     1 
ATOM   10026 C  CA    . GLU D 2 255 ? -61.672 69.501 -27.841 1.00 107.64 ? 634 GLU D CA    1 
ATOM   10027 C  C     . GLU D 2 255 ? -63.042 69.010 -27.408 1.00 155.96 ? 634 GLU D C     1 
ATOM   10028 O  O     . GLU D 2 255 ? -63.284 68.751 -26.228 1.00 150.54 ? 634 GLU D O     1 
ATOM   10029 C  CB    . GLU D 2 255 ? -61.826 70.939 -28.290 1.00 135.64 ? 634 GLU D CB    1 
ATOM   10030 C  CG    . GLU D 2 255 ? -60.625 71.510 -28.983 1.00 154.10 ? 634 GLU D CG    1 
ATOM   10031 C  CD    . GLU D 2 255 ? -60.738 73.021 -29.141 1.00 186.01 ? 634 GLU D CD    1 
ATOM   10032 O  OE1   . GLU D 2 255 ? -61.881 73.538 -29.047 1.00 196.74 ? 634 GLU D OE1   1 
ATOM   10033 O  OE2   . GLU D 2 255 ? -59.691 73.685 -29.346 1.00 192.29 ? 634 GLU D OE2   1 
ATOM   10034 N  N     . ASP D 2 256 ? -63.936 68.891 -28.382 1.00 132.92 ? 635 ASP D N     1 
ATOM   10035 C  CA    . ASP D 2 256 ? -65.336 68.565 -28.137 1.00 139.47 ? 635 ASP D CA    1 
ATOM   10036 C  C     . ASP D 2 256 ? -65.579 67.150 -27.621 1.00 134.87 ? 635 ASP D C     1 
ATOM   10037 O  O     . ASP D 2 256 ? -66.571 66.899 -26.940 1.00 146.06 ? 635 ASP D O     1 
ATOM   10038 C  CB    . ASP D 2 256 ? -66.140 68.777 -29.418 1.00 155.58 ? 635 ASP D CB    1 
ATOM   10039 C  CG    . ASP D 2 256 ? -65.970 70.174 -29.985 1.00 176.48 ? 635 ASP D CG    1 
ATOM   10040 O  OD1   . ASP D 2 256 ? -65.723 71.116 -29.191 1.00 185.38 ? 635 ASP D OD1   1 
ATOM   10041 O  OD2   . ASP D 2 256 ? -66.084 70.328 -31.224 1.00 178.68 ? 635 ASP D OD2   1 
ATOM   10042 N  N     . ASN D 2 257 ? -64.684 66.224 -27.940 1.00 130.12 ? 636 ASN D N     1 
ATOM   10043 C  CA    . ASN D 2 257 ? -64.980 64.810 -27.723 1.00 134.63 ? 636 ASN D CA    1 
ATOM   10044 C  C     . ASN D 2 257 ? -63.958 64.052 -26.882 1.00 131.47 ? 636 ASN D C     1 
ATOM   10045 O  O     . ASN D 2 257 ? -64.299 63.089 -26.202 1.00 133.69 ? 636 ASN D O     1 
ATOM   10046 C  CB    . ASN D 2 257 ? -65.192 64.118 -29.067 1.00 142.37 ? 636 ASN D CB    1 
ATOM   10047 C  CG    . ASN D 2 257 ? -66.172 64.864 -29.937 1.00 154.25 ? 636 ASN D CG    1 
ATOM   10048 O  OD1   . ASN D 2 257 ? -67.303 65.125 -29.525 1.00 159.52 ? 636 ASN D OD1   1 
ATOM   10049 N  ND2   . ASN D 2 257 ? -65.743 65.233 -31.140 1.00 156.29 ? 636 ASN D ND2   1 
ATOM   10050 N  N     . VAL D 2 258 ? -62.700 64.462 -26.964 1.00 130.76 ? 637 VAL D N     1 
ATOM   10051 C  CA    . VAL D 2 258 ? -61.661 63.937 -26.087 1.00 124.25 ? 637 VAL D CA    1 
ATOM   10052 C  C     . VAL D 2 258 ? -61.926 64.385 -24.665 1.00 114.46 ? 637 VAL D C     1 
ATOM   10053 O  O     . VAL D 2 258 ? -61.881 65.586 -24.375 1.00 101.66 ? 637 VAL D O     1 
ATOM   10054 C  CB    . VAL D 2 258 ? -60.246 64.330 -26.500 1.00 129.41 ? 637 VAL D CB    1 
ATOM   10055 C  CG1   . VAL D 2 258 ? -59.244 63.662 -25.546 1.00 124.09 ? 637 VAL D CG1   1 
ATOM   10056 C  CG2   . VAL D 2 258 ? -59.986 63.951 -27.981 1.00 103.63 ? 637 VAL D CG2   1 
ATOM   10057 N  N     . LYS D 2 259 ? -62.359 63.453 -23.826 1.00 120.47 ? 638 LYS D N     1 
ATOM   10058 C  CA    . LYS D 2 259 ? -62.594 63.749 -22.418 1.00 125.13 ? 638 LYS D CA    1 
ATOM   10059 C  C     . LYS D 2 259 ? -61.294 63.752 -21.592 1.00 135.92 ? 638 LYS D C     1 
ATOM   10060 O  O     . LYS D 2 259 ? -60.852 62.708 -21.131 1.00 139.54 ? 638 LYS D O     1 
ATOM   10061 C  CB    . LYS D 2 259 ? -63.645 62.782 -21.864 1.00 110.54 ? 638 LYS D CB    1 
ATOM   10062 N  N     . PHE D 2 260 ? -60.680 64.921 -21.415 1.00 139.04 ? 639 PHE D N     1 
ATOM   10063 C  CA    . PHE D 2 260 ? -59.451 65.021 -20.630 1.00 127.80 ? 639 PHE D CA    1 
ATOM   10064 C  C     . PHE D 2 260 ? -59.806 65.022 -19.158 1.00 142.89 ? 639 PHE D C     1 
ATOM   10065 O  O     . PHE D 2 260 ? -59.093 65.614 -18.355 1.00 142.60 ? 639 PHE D O     1 
ATOM   10066 C  CB    . PHE D 2 260 ? -58.713 66.331 -20.935 1.00 116.62 ? 639 PHE D CB    1 
ATOM   10067 C  CG    . PHE D 2 260 ? -58.293 66.486 -22.365 1.00 112.08 ? 639 PHE D CG    1 
ATOM   10068 C  CD1   . PHE D 2 260 ? -57.087 65.976 -22.808 1.00 119.53 ? 639 PHE D CD1   1 
ATOM   10069 C  CD2   . PHE D 2 260 ? -59.094 67.155 -23.264 1.00 119.78 ? 639 PHE D CD2   1 
ATOM   10070 C  CE1   . PHE D 2 260 ? -56.692 66.113 -24.134 1.00 119.35 ? 639 PHE D CE1   1 
ATOM   10071 C  CE2   . PHE D 2 260 ? -58.705 67.288 -24.597 1.00 125.63 ? 639 PHE D CE2   1 
ATOM   10072 C  CZ    . PHE D 2 260 ? -57.500 66.766 -25.030 1.00 112.55 ? 639 PHE D CZ    1 
ATOM   10073 N  N     . THR D 2 261 ? -60.913 64.364 -18.814 1.00 160.71 ? 640 THR D N     1 
ATOM   10074 C  CA    . THR D 2 261 ? -61.542 64.481 -17.488 1.00 157.24 ? 640 THR D CA    1 
ATOM   10075 C  C     . THR D 2 261 ? -60.960 65.586 -16.610 1.00 137.87 ? 640 THR D C     1 
ATOM   10076 O  O     . THR D 2 261 ? -61.185 66.771 -16.865 1.00 127.32 ? 640 THR D O     1 
ATOM   10077 C  CB    . THR D 2 261 ? -61.595 63.130 -16.708 1.00 177.28 ? 640 THR D CB    1 
ATOM   10078 O  OG1   . THR D 2 261 ? -61.353 63.374 -15.310 1.00 168.22 ? 640 THR D OG1   1 
ATOM   10079 C  CG2   . THR D 2 261 ? -60.581 62.106 -17.270 1.00 171.86 ? 640 THR D CG2   1 
ATOM   10080 C  "C5'" . DC  E 3 9   ? -22.280 32.881 -48.089 1.00 175.01 ? 9   DC  E "C5'" 1 
ATOM   10081 C  "C4'" . DC  E 3 9   ? -22.207 31.849 -46.977 1.00 185.94 ? 9   DC  E "C4'" 1 
ATOM   10082 O  "O4'" . DC  E 3 9   ? -20.844 31.379 -46.852 1.00 198.20 ? 9   DC  E "O4'" 1 
ATOM   10083 C  "C3'" . DC  E 3 9   ? -22.606 32.354 -45.594 1.00 178.04 ? 9   DC  E "C3'" 1 
ATOM   10084 O  "O3'" . DC  E 3 9   ? -23.935 31.920 -45.308 1.00 190.40 ? 9   DC  E "O3'" 1 
ATOM   10085 C  "C2'" . DC  E 3 9   ? -21.587 31.732 -44.635 1.00 163.89 ? 9   DC  E "C2'" 1 
ATOM   10086 C  "C1'" . DC  E 3 9   ? -20.638 30.937 -45.528 1.00 179.18 ? 9   DC  E "C1'" 1 
ATOM   10087 N  N1    . DC  E 3 9   ? -19.197 31.114 -45.181 1.00 174.39 ? 9   DC  E N1    1 
ATOM   10088 C  C2    . DC  E 3 9   ? -18.590 30.203 -44.311 1.00 162.36 ? 9   DC  E C2    1 
ATOM   10089 O  O2    . DC  E 3 9   ? -19.259 29.273 -43.846 1.00 159.82 ? 9   DC  E O2    1 
ATOM   10090 N  N3    . DC  E 3 9   ? -17.283 30.367 -44.001 1.00 149.29 ? 9   DC  E N3    1 
ATOM   10091 C  C4    . DC  E 3 9   ? -16.588 31.379 -44.519 1.00 157.29 ? 9   DC  E C4    1 
ATOM   10092 N  N4    . DC  E 3 9   ? -15.299 31.485 -44.175 1.00 156.02 ? 9   DC  E N4    1 
ATOM   10093 C  C5    . DC  E 3 9   ? -17.189 32.320 -45.409 1.00 166.78 ? 9   DC  E C5    1 
ATOM   10094 C  C6    . DC  E 3 9   ? -18.483 32.151 -45.710 1.00 173.32 ? 9   DC  E C6    1 
ATOM   10095 P  P     . DA  E 3 10  ? -24.723 32.404 -43.999 1.00 204.83 ? 10  DA  E P     1 
ATOM   10096 O  OP1   . DA  E 3 10  ? -25.373 31.214 -43.406 1.00 215.65 ? 10  DA  E OP1   1 
ATOM   10097 O  OP2   . DA  E 3 10  ? -25.546 33.570 -44.388 1.00 196.53 ? 10  DA  E OP2   1 
ATOM   10098 O  "O5'" . DA  E 3 10  ? -23.570 32.927 -43.018 1.00 193.72 ? 10  DA  E "O5'" 1 
ATOM   10099 C  "C5'" . DA  E 3 10  ? -23.802 33.057 -41.618 1.00 189.42 ? 10  DA  E "C5'" 1 
ATOM   10100 C  "C4'" . DA  E 3 10  ? -23.811 31.702 -40.929 1.00 173.05 ? 10  DA  E "C4'" 1 
ATOM   10101 O  "O4'" . DA  E 3 10  ? -22.672 30.921 -41.370 1.00 151.47 ? 10  DA  E "O4'" 1 
ATOM   10102 C  "C3'" . DA  E 3 10  ? -23.741 31.764 -39.409 1.00 169.66 ? 10  DA  E "C3'" 1 
ATOM   10103 O  "O3'" . DA  E 3 10  ? -24.638 30.824 -38.828 1.00 162.98 ? 10  DA  E "O3'" 1 
ATOM   10104 C  "C2'" . DA  E 3 10  ? -22.288 31.434 -39.074 1.00 168.36 ? 10  DA  E "C2'" 1 
ATOM   10105 C  "C1'" . DA  E 3 10  ? -21.724 30.776 -40.330 1.00 157.20 ? 10  DA  E "C1'" 1 
ATOM   10106 N  N9    . DA  E 3 10  ? -20.455 31.364 -40.759 1.00 151.84 ? 10  DA  E N9    1 
ATOM   10107 C  C8    . DA  E 3 10  ? -20.277 32.533 -41.446 1.00 149.34 ? 10  DA  E C8    1 
ATOM   10108 N  N7    . DA  E 3 10  ? -19.021 32.819 -41.697 1.00 126.88 ? 10  DA  E N7    1 
ATOM   10109 C  C5    . DA  E 3 10  ? -18.323 31.764 -41.133 1.00 127.42 ? 10  DA  E C5    1 
ATOM   10110 C  C6    . DA  E 3 10  ? -16.947 31.473 -41.058 1.00 124.12 ? 10  DA  E C6    1 
ATOM   10111 N  N6    . DA  E 3 10  ? -16.003 32.264 -41.580 1.00 123.10 ? 10  DA  E N6    1 
ATOM   10112 N  N1    . DA  E 3 10  ? -16.579 30.340 -40.427 1.00 114.43 ? 10  DA  E N1    1 
ATOM   10113 C  C2    . DA  E 3 10  ? -17.532 29.557 -39.908 1.00 114.31 ? 10  DA  E C2    1 
ATOM   10114 N  N3    . DA  E 3 10  ? -18.854 29.724 -39.916 1.00 132.73 ? 10  DA  E N3    1 
ATOM   10115 C  C4    . DA  E 3 10  ? -19.190 30.859 -40.550 1.00 139.15 ? 10  DA  E C4    1 
ATOM   10116 P  P     . DT  E 3 11  ? -25.422 31.231 -37.495 1.00 169.66 ? 11  DT  E P     1 
ATOM   10117 O  OP1   . DT  E 3 11  ? -26.451 30.200 -37.232 1.00 172.44 ? 11  DT  E OP1   1 
ATOM   10118 O  OP2   . DT  E 3 11  ? -25.816 32.651 -37.621 1.00 165.67 ? 11  DT  E OP2   1 
ATOM   10119 O  "O5'" . DT  E 3 11  ? -24.285 31.134 -36.373 1.00 156.35 ? 11  DT  E "O5'" 1 
ATOM   10120 C  "C5'" . DT  E 3 11  ? -23.746 29.869 -36.008 1.00 150.28 ? 11  DT  E "C5'" 1 
ATOM   10121 C  "C4'" . DT  E 3 11  ? -22.420 30.034 -35.285 1.00 143.42 ? 11  DT  E "C4'" 1 
ATOM   10122 O  "O4'" . DT  E 3 11  ? -21.377 30.346 -36.236 1.00 142.77 ? 11  DT  E "O4'" 1 
ATOM   10123 C  "C3'" . DT  E 3 11  ? -22.377 31.168 -34.267 1.00 136.71 ? 11  DT  E "C3'" 1 
ATOM   10124 O  "O3'" . DT  E 3 11  ? -22.599 30.650 -32.962 1.00 134.45 ? 11  DT  E "O3'" 1 
ATOM   10125 C  "C2'" . DT  E 3 11  ? -20.967 31.749 -34.390 1.00 135.81 ? 11  DT  E "C2'" 1 
ATOM   10126 C  "C1'" . DT  E 3 11  ? -20.323 30.958 -35.526 1.00 143.62 ? 11  DT  E "C1'" 1 
ATOM   10127 N  N1    . DT  E 3 11  ? -19.527 31.800 -36.465 1.00 134.62 ? 11  DT  E N1    1 
ATOM   10128 C  C2    . DT  E 3 11  ? -18.241 31.420 -36.782 1.00 116.81 ? 11  DT  E C2    1 
ATOM   10129 O  O2    . DT  E 3 11  ? -17.710 30.419 -36.336 1.00 121.60 ? 11  DT  E O2    1 
ATOM   10130 N  N3    . DT  E 3 11  ? -17.595 32.263 -37.650 1.00 100.60 ? 11  DT  E N3    1 
ATOM   10131 C  C4    . DT  E 3 11  ? -18.097 33.420 -38.217 1.00 110.34 ? 11  DT  E C4    1 
ATOM   10132 O  O4    . DT  E 3 11  ? -17.439 34.113 -38.988 1.00 114.05 ? 11  DT  E O4    1 
ATOM   10133 C  C5    . DT  E 3 11  ? -19.446 33.758 -37.841 1.00 124.24 ? 11  DT  E C5    1 
ATOM   10134 C  C7    . DT  E 3 11  ? -20.093 34.992 -38.395 1.00 138.95 ? 11  DT  E C7    1 
ATOM   10135 C  C6    . DT  E 3 11  ? -20.088 32.945 -36.993 1.00 132.16 ? 11  DT  E C6    1 
ATOM   10136 P  P     . DG  E 3 12  ? -23.436 31.501 -31.897 1.00 154.31 ? 12  DG  E P     1 
ATOM   10137 O  OP1   . DG  E 3 12  ? -23.973 30.555 -30.894 1.00 138.09 ? 12  DG  E OP1   1 
ATOM   10138 O  OP2   . DG  E 3 12  ? -24.354 32.391 -32.643 1.00 167.38 ? 12  DG  E OP2   1 
ATOM   10139 O  "O5'" . DG  E 3 12  ? -22.324 32.415 -31.201 1.00 109.94 ? 12  DG  E "O5'" 1 
ATOM   10140 C  "C5'" . DG  E 3 12  ? -21.352 31.831 -30.343 1.00 115.33 ? 12  DG  E "C5'" 1 
ATOM   10141 C  "C4'" . DG  E 3 12  ? -20.431 32.892 -29.768 1.00 105.10 ? 12  DG  E "C4'" 1 
ATOM   10142 O  "O4'" . DG  E 3 12  ? -19.613 33.446 -30.832 1.00 109.24 ? 12  DG  E "O4'" 1 
ATOM   10143 C  "C3'" . DG  E 3 12  ? -21.134 34.087 -29.136 1.00 97.59  ? 12  DG  E "C3'" 1 
ATOM   10144 O  "O3'" . DG  E 3 12  ? -20.324 34.637 -28.106 1.00 88.54  ? 12  DG  E "O3'" 1 
ATOM   10145 C  "C2'" . DG  E 3 12  ? -21.222 35.050 -30.313 1.00 112.36 ? 12  DG  E "C2'" 1 
ATOM   10146 C  "C1'" . DG  E 3 12  ? -19.835 34.841 -30.905 1.00 106.72 ? 12  DG  E "C1'" 1 
ATOM   10147 N  N9    . DG  E 3 12  ? -19.699 35.263 -32.295 1.00 106.41 ? 12  DG  E N9    1 
ATOM   10148 C  C8    . DG  E 3 12  ? -20.669 35.261 -33.267 1.00 128.68 ? 12  DG  E C8    1 
ATOM   10149 N  N7    . DG  E 3 12  ? -20.245 35.694 -34.422 1.00 140.37 ? 12  DG  E N7    1 
ATOM   10150 C  C5    . DG  E 3 12  ? -18.908 36.000 -34.204 1.00 134.25 ? 12  DG  E C5    1 
ATOM   10151 C  C6    . DG  E 3 12  ? -17.930 36.510 -35.089 1.00 131.98 ? 12  DG  E C6    1 
ATOM   10152 O  O6    . DG  E 3 12  ? -18.052 36.804 -36.287 1.00 131.36 ? 12  DG  E O6    1 
ATOM   10153 N  N1    . DG  E 3 12  ? -16.700 36.674 -34.455 1.00 131.27 ? 12  DG  E N1    1 
ATOM   10154 C  C2    . DG  E 3 12  ? -16.447 36.383 -33.135 1.00 138.90 ? 12  DG  E C2    1 
ATOM   10155 N  N2    . DG  E 3 12  ? -15.198 36.606 -32.703 1.00 150.44 ? 12  DG  E N2    1 
ATOM   10156 N  N3    . DG  E 3 12  ? -17.356 35.904 -32.296 1.00 129.75 ? 12  DG  E N3    1 
ATOM   10157 C  C4    . DG  E 3 12  ? -18.558 35.740 -32.898 1.00 122.81 ? 12  DG  E C4    1 
ATOM   10158 P  P     . DA  E 3 13  ? -21.002 35.110 -26.737 1.00 118.83 ? 13  DA  E P     1 
ATOM   10159 O  OP1   . DA  E 3 13  ? -21.346 33.900 -25.959 1.00 126.47 ? 13  DA  E OP1   1 
ATOM   10160 O  OP2   . DA  E 3 13  ? -22.054 36.091 -27.081 1.00 118.91 ? 13  DA  E OP2   1 
ATOM   10161 O  "O5'" . DA  E 3 13  ? -19.831 35.894 -25.978 1.00 116.09 ? 13  DA  E "O5'" 1 
ATOM   10162 C  "C5'" . DA  E 3 13  ? -19.758 37.315 -26.057 1.00 120.67 ? 13  DA  E "C5'" 1 
ATOM   10163 C  "C4'" . DA  E 3 13  ? -18.519 37.776 -26.802 1.00 105.90 ? 13  DA  E "C4'" 1 
ATOM   10164 O  "O4'" . DA  E 3 13  ? -18.627 37.402 -28.195 1.00 112.39 ? 13  DA  E "O4'" 1 
ATOM   10165 C  "C3'" . DA  E 3 13  ? -18.315 39.286 -26.820 1.00 95.57  ? 13  DA  E "C3'" 1 
ATOM   10166 O  "O3'" . DA  E 3 13  ? -17.450 39.672 -25.759 1.00 76.50  ? 13  DA  E "O3'" 1 
ATOM   10167 C  "C2'" . DA  E 3 13  ? -17.652 39.564 -28.170 1.00 101.27 ? 13  DA  E "C2'" 1 
ATOM   10168 C  "C1'" . DA  E 3 13  ? -17.812 38.268 -28.960 1.00 123.97 ? 13  DA  E "C1'" 1 
ATOM   10169 N  N9    . DA  E 3 13  ? -18.412 38.480 -30.274 1.00 138.62 ? 13  DA  E N9    1 
ATOM   10170 C  C8    . DA  E 3 13  ? -19.703 38.236 -30.652 1.00 152.88 ? 13  DA  E C8    1 
ATOM   10171 N  N7    . DA  E 3 13  ? -19.950 38.531 -31.907 1.00 129.61 ? 13  DA  E N7    1 
ATOM   10172 C  C5    . DA  E 3 13  ? -18.738 39.001 -32.382 1.00 110.92 ? 13  DA  E C5    1 
ATOM   10173 C  C6    . DA  E 3 13  ? -18.337 39.477 -33.644 1.00 126.71 ? 13  DA  E C6    1 
ATOM   10174 N  N6    . DA  E 3 13  ? -19.164 39.554 -34.692 1.00 147.19 ? 13  DA  E N6    1 
ATOM   10175 N  N1    . DA  E 3 13  ? -17.053 39.871 -33.782 1.00 138.71 ? 13  DA  E N1    1 
ATOM   10176 C  C2    . DA  E 3 13  ? -16.234 39.790 -32.726 1.00 144.51 ? 13  DA  E C2    1 
ATOM   10177 N  N3    . DA  E 3 13  ? -16.498 39.360 -31.494 1.00 131.96 ? 13  DA  E N3    1 
ATOM   10178 C  C4    . DA  E 3 13  ? -17.780 38.978 -31.388 1.00 121.68 ? 13  DA  E C4    1 
ATOM   10179 P  P     . DA  E 3 14  ? -17.334 41.216 -25.355 1.00 107.54 ? 14  DA  E P     1 
ATOM   10180 O  OP1   . DA  E 3 14  ? -16.355 41.328 -24.249 1.00 87.33  ? 14  DA  E OP1   1 
ATOM   10181 O  OP2   . DA  E 3 14  ? -18.704 41.753 -25.194 1.00 130.93 ? 14  DA  E OP2   1 
ATOM   10182 O  "O5'" . DA  E 3 14  ? -16.697 41.863 -26.668 1.00 113.48 ? 14  DA  E "O5'" 1 
ATOM   10183 C  "C5'" . DA  E 3 14  ? -17.006 43.194 -27.039 1.00 122.59 ? 14  DA  E "C5'" 1 
ATOM   10184 C  "C4'" . DA  E 3 14  ? -16.237 43.537 -28.299 1.00 114.13 ? 14  DA  E "C4'" 1 
ATOM   10185 O  "O4'" . DA  E 3 14  ? -16.526 42.579 -29.343 1.00 107.66 ? 14  DA  E "O4'" 1 
ATOM   10186 C  "C3'" . DA  E 3 14  ? -16.582 44.864 -28.947 1.00 95.32  ? 14  DA  E "C3'" 1 
ATOM   10187 O  "O3'" . DA  E 3 14  ? -15.970 45.926 -28.234 1.00 90.52  ? 14  DA  E "O3'" 1 
ATOM   10188 C  "C2'" . DA  E 3 14  ? -15.961 44.668 -30.325 1.00 92.52  ? 14  DA  E "C2'" 1 
ATOM   10189 C  "C1'" . DA  E 3 14  ? -16.180 43.175 -30.578 1.00 101.99 ? 14  DA  E "C1'" 1 
ATOM   10190 N  N9    . DA  E 3 14  ? -17.228 42.910 -31.557 1.00 108.11 ? 14  DA  E N9    1 
ATOM   10191 C  C8    . DA  E 3 14  ? -18.493 42.440 -31.339 1.00 102.67 ? 14  DA  E C8    1 
ATOM   10192 N  N7    . DA  E 3 14  ? -19.202 42.309 -32.438 1.00 106.64 ? 14  DA  E N7    1 
ATOM   10193 C  C5    . DA  E 3 14  ? -18.343 42.724 -33.444 1.00 106.06 ? 14  DA  E C5    1 
ATOM   10194 C  C6    . DA  E 3 14  ? -18.481 42.827 -34.843 1.00 104.14 ? 14  DA  E C6    1 
ATOM   10195 N  N6    . DA  E 3 14  ? -19.595 42.506 -35.514 1.00 105.48 ? 14  DA  E N6    1 
ATOM   10196 N  N1    . DA  E 3 14  ? -17.417 43.279 -35.537 1.00 119.45 ? 14  DA  E N1    1 
ATOM   10197 C  C2    . DA  E 3 14  ? -16.297 43.604 -34.884 1.00 128.81 ? 14  DA  E C2    1 
ATOM   10198 N  N3    . DA  E 3 14  ? -16.051 43.548 -33.579 1.00 121.39 ? 14  DA  E N3    1 
ATOM   10199 C  C4    . DA  E 3 14  ? -17.124 43.097 -32.913 1.00 111.26 ? 14  DA  E C4    1 
ATOM   10200 P  P     . DT  E 3 15  ? -16.591 47.396 -28.324 1.00 114.20 ? 15  DT  E P     1 
ATOM   10201 O  OP1   . DT  E 3 15  ? -16.076 48.178 -27.178 1.00 107.25 ? 15  DT  E OP1   1 
ATOM   10202 O  OP2   . DT  E 3 15  ? -18.051 47.258 -28.529 1.00 107.28 ? 15  DT  E OP2   1 
ATOM   10203 O  "O5'" . DT  E 3 15  ? -15.950 47.962 -29.676 1.00 126.26 ? 15  DT  E "O5'" 1 
ATOM   10204 C  "C5'" . DT  E 3 15  ? -14.554 47.823 -29.903 1.00 129.38 ? 15  DT  E "C5'" 1 
ATOM   10205 C  "C4'" . DT  E 3 15  ? -14.200 48.168 -31.339 1.00 125.17 ? 15  DT  E "C4'" 1 
ATOM   10206 O  "O4'" . DT  E 3 15  ? -14.883 47.263 -32.244 1.00 115.32 ? 15  DT  E "O4'" 1 
ATOM   10207 C  "C3'" . DT  E 3 15  ? -14.572 49.586 -31.760 1.00 134.84 ? 15  DT  E "C3'" 1 
ATOM   10208 O  "O3'" . DT  E 3 15  ? -13.433 50.234 -32.311 1.00 164.96 ? 15  DT  E "O3'" 1 
ATOM   10209 C  "C2'" . DT  E 3 15  ? -15.678 49.406 -32.798 1.00 126.20 ? 15  DT  E "C2'" 1 
ATOM   10210 C  "C1'" . DT  E 3 15  ? -15.456 47.989 -33.311 1.00 106.28 ? 15  DT  E "C1'" 1 
ATOM   10211 N  N1    . DT  E 3 15  ? -16.729 47.320 -33.700 1.00 99.94  ? 15  DT  E N1    1 
ATOM   10212 C  C2    . DT  E 3 15  ? -17.065 47.221 -35.032 1.00 103.76 ? 15  DT  E C2    1 
ATOM   10213 O  O2    . DT  E 3 15  ? -16.367 47.654 -35.930 1.00 114.98 ? 15  DT  E O2    1 
ATOM   10214 N  N3    . DT  E 3 15  ? -18.259 46.591 -35.277 1.00 106.05 ? 15  DT  E N3    1 
ATOM   10215 C  C4    . DT  E 3 15  ? -19.128 46.064 -34.340 1.00 105.75 ? 15  DT  E C4    1 
ATOM   10216 O  O4    . DT  E 3 15  ? -20.180 45.515 -34.651 1.00 110.81 ? 15  DT  E O4    1 
ATOM   10217 C  C5    . DT  E 3 15  ? -18.717 46.203 -32.967 1.00 97.62  ? 15  DT  E C5    1 
ATOM   10218 C  C7    . DT  E 3 15  ? -19.587 45.664 -31.870 1.00 100.80 ? 15  DT  E C7    1 
ATOM   10219 C  C6    . DT  E 3 15  ? -17.554 46.816 -32.714 1.00 104.88 ? 15  DT  E C6    1 
ATOM   10220 P  P     . DA  F 4 1   ? -41.269 48.491 -30.356 1.00 118.47 ? 1   DA  F P     1 
ATOM   10221 O  OP1   . DA  F 4 1   ? -40.399 49.323 -29.495 1.00 140.82 ? 1   DA  F OP1   1 
ATOM   10222 O  OP2   . DA  F 4 1   ? -42.684 48.267 -29.984 1.00 120.27 ? 1   DA  F OP2   1 
ATOM   10223 O  "O5'" . DA  F 4 1   ? -41.228 49.092 -31.836 1.00 102.60 ? 1   DA  F "O5'" 1 
ATOM   10224 C  "C5'" . DA  F 4 1   ? -41.947 48.416 -32.859 1.00 116.55 ? 1   DA  F "C5'" 1 
ATOM   10225 C  "C4'" . DA  F 4 1   ? -41.143 48.317 -34.143 1.00 109.20 ? 1   DA  F "C4'" 1 
ATOM   10226 O  "O4'" . DA  F 4 1   ? -41.018 49.609 -34.787 1.00 116.54 ? 1   DA  F "O4'" 1 
ATOM   10227 C  "C3'" . DA  F 4 1   ? -39.692 47.887 -33.995 1.00 106.56 ? 1   DA  F "C3'" 1 
ATOM   10228 O  "O3'" . DA  F 4 1   ? -39.586 46.509 -33.649 1.00 119.01 ? 1   DA  F "O3'" 1 
ATOM   10229 C  "C2'" . DA  F 4 1   ? -39.225 48.198 -35.410 1.00 95.08  ? 1   DA  F "C2'" 1 
ATOM   10230 C  "C1'" . DA  F 4 1   ? -39.888 49.554 -35.641 1.00 111.23 ? 1   DA  F "C1'" 1 
ATOM   10231 N  N9    . DA  F 4 1   ? -38.975 50.655 -35.346 1.00 122.95 ? 1   DA  F N9    1 
ATOM   10232 C  C8    . DA  F 4 1   ? -38.866 51.382 -34.192 1.00 119.45 ? 1   DA  F C8    1 
ATOM   10233 N  N7    . DA  F 4 1   ? -37.932 52.306 -34.240 1.00 116.14 ? 1   DA  F N7    1 
ATOM   10234 C  C5    . DA  F 4 1   ? -37.390 52.170 -35.507 1.00 110.75 ? 1   DA  F C5    1 
ATOM   10235 C  C6    . DA  F 4 1   ? -36.359 52.850 -36.186 1.00 118.42 ? 1   DA  F C6    1 
ATOM   10236 N  N6    . DA  F 4 1   ? -35.646 53.857 -35.666 1.00 136.49 ? 1   DA  F N6    1 
ATOM   10237 N  N1    . DA  F 4 1   ? -36.082 52.450 -37.443 1.00 115.67 ? 1   DA  F N1    1 
ATOM   10238 C  C2    . DA  F 4 1   ? -36.777 51.447 -37.987 1.00 115.09 ? 1   DA  F C2    1 
ATOM   10239 N  N3    . DA  F 4 1   ? -37.762 50.737 -37.447 1.00 115.25 ? 1   DA  F N3    1 
ATOM   10240 C  C4    . DA  F 4 1   ? -38.020 51.154 -36.198 1.00 109.48 ? 1   DA  F C4    1 
ATOM   10241 P  P     . DG  F 4 2   ? -38.701 45.482 -34.505 1.00 132.09 ? 2   DG  F P     1 
ATOM   10242 O  OP1   . DG  F 4 2   ? -39.340 45.330 -35.831 1.00 164.20 ? 2   DG  F OP1   1 
ATOM   10243 O  OP2   . DG  F 4 2   ? -38.477 44.294 -33.655 1.00 128.67 ? 2   DG  F OP2   1 
ATOM   10244 O  "O5'" . DG  F 4 2   ? -37.285 46.209 -34.688 1.00 122.00 ? 2   DG  F "O5'" 1 
ATOM   10245 C  "C5'" . DG  F 4 2   ? -36.247 45.583 -35.452 1.00 132.67 ? 2   DG  F "C5'" 1 
ATOM   10246 C  "C4'" . DG  F 4 2   ? -36.419 45.849 -36.939 1.00 98.40  ? 2   DG  F "C4'" 1 
ATOM   10247 O  "O4'" . DG  F 4 2   ? -36.873 47.216 -37.124 1.00 120.07 ? 2   DG  F "O4'" 1 
ATOM   10248 C  "C3'" . DG  F 4 2   ? -35.154 45.706 -37.784 1.00 99.12  ? 2   DG  F "C3'" 1 
ATOM   10249 O  "O3'" . DG  F 4 2   ? -35.089 44.414 -38.382 1.00 118.22 ? 2   DG  F "O3'" 1 
ATOM   10250 C  "C2'" . DG  F 4 2   ? -35.330 46.795 -38.839 1.00 93.55  ? 2   DG  F "C2'" 1 
ATOM   10251 C  "C1'" . DG  F 4 2   ? -36.032 47.886 -38.041 1.00 112.33 ? 2   DG  F "C1'" 1 
ATOM   10252 N  N9    . DG  F 4 2   ? -35.116 48.748 -37.297 1.00 103.23 ? 2   DG  F N9    1 
ATOM   10253 C  C8    . DG  F 4 2   ? -35.147 49.028 -35.952 1.00 86.19  ? 2   DG  F C8    1 
ATOM   10254 N  N7    . DG  F 4 2   ? -34.197 49.837 -35.569 1.00 102.27 ? 2   DG  F N7    1 
ATOM   10255 C  C5    . DG  F 4 2   ? -33.487 50.111 -36.731 1.00 107.52 ? 2   DG  F C5    1 
ATOM   10256 C  C6    . DG  F 4 2   ? -32.348 50.929 -36.937 1.00 112.35 ? 2   DG  F C6    1 
ATOM   10257 O  O6    . DG  F 4 2   ? -31.718 51.596 -36.104 1.00 131.56 ? 2   DG  F O6    1 
ATOM   10258 N  N1    . DG  F 4 2   ? -31.947 50.930 -38.272 1.00 114.91 ? 2   DG  F N1    1 
ATOM   10259 C  C2    . DG  F 4 2   ? -32.573 50.228 -39.276 1.00 136.67 ? 2   DG  F C2    1 
ATOM   10260 N  N2    . DG  F 4 2   ? -32.050 50.346 -40.506 1.00 168.04 ? 2   DG  F N2    1 
ATOM   10261 N  N3    . DG  F 4 2   ? -33.640 49.461 -39.095 1.00 118.54 ? 2   DG  F N3    1 
ATOM   10262 C  C4    . DG  F 4 2   ? -34.042 49.448 -37.802 1.00 107.35 ? 2   DG  F C4    1 
ATOM   10263 P  P     . DT  F 4 3   ? -33.764 43.919 -39.134 1.00 133.45 ? 3   DT  F P     1 
ATOM   10264 O  OP1   . DT  F 4 3   ? -34.044 42.577 -39.693 1.00 114.21 ? 3   DT  F OP1   1 
ATOM   10265 O  OP2   . DT  F 4 3   ? -32.621 44.111 -38.214 1.00 121.18 ? 3   DT  F OP2   1 
ATOM   10266 O  "O5'" . DT  F 4 3   ? -33.611 44.958 -40.343 1.00 108.80 ? 3   DT  F "O5'" 1 
ATOM   10267 C  "C5'" . DT  F 4 3   ? -32.994 44.553 -41.561 1.00 137.98 ? 3   DT  F "C5'" 1 
ATOM   10268 C  "C4'" . DT  F 4 3   ? -31.752 45.369 -41.884 1.00 142.32 ? 3   DT  F "C4'" 1 
ATOM   10269 O  "O4'" . DT  F 4 3   ? -31.848 46.699 -41.314 1.00 121.89 ? 3   DT  F "O4'" 1 
ATOM   10270 C  "C3'" . DT  F 4 3   ? -30.435 44.874 -41.309 1.00 143.69 ? 3   DT  F "C3'" 1 
ATOM   10271 O  "O3'" . DT  F 4 3   ? -29.965 43.698 -41.975 1.00 102.64 ? 3   DT  F "O3'" 1 
ATOM   10272 C  "C2'" . DT  F 4 3   ? -29.573 46.101 -41.579 1.00 149.31 ? 3   DT  F "C2'" 1 
ATOM   10273 C  "C1'" . DT  F 4 3   ? -30.536 47.231 -41.220 1.00 135.38 ? 3   DT  F "C1'" 1 
ATOM   10274 N  N1    . DT  F 4 3   ? -30.291 47.761 -39.847 1.00 127.60 ? 3   DT  F N1    1 
ATOM   10275 C  C2    . DT  F 4 3   ? -29.309 48.712 -39.672 1.00 127.81 ? 3   DT  F C2    1 
ATOM   10276 O  O2    . DT  F 4 3   ? -28.634 49.147 -40.589 1.00 141.51 ? 3   DT  F O2    1 
ATOM   10277 N  N3    . DT  F 4 3   ? -29.147 49.140 -38.379 1.00 103.18 ? 3   DT  F N3    1 
ATOM   10278 C  C4    . DT  F 4 3   ? -29.856 48.716 -37.270 1.00 116.19 ? 3   DT  F C4    1 
ATOM   10279 O  O4    . DT  F 4 3   ? -29.639 49.160 -36.147 1.00 133.70 ? 3   DT  F O4    1 
ATOM   10280 C  C5    . DT  F 4 3   ? -30.866 47.717 -37.525 1.00 123.02 ? 3   DT  F C5    1 
ATOM   10281 C  C7    . DT  F 4 3   ? -31.700 47.180 -36.400 1.00 114.33 ? 3   DT  F C7    1 
ATOM   10282 C  C6    . DT  F 4 3   ? -31.033 47.291 -38.784 1.00 123.85 ? 3   DT  F C6    1 
ATOM   10283 P  P     . DC  F 4 4   ? -29.368 43.719 -43.462 1.00 171.42 ? 4   DC  F P     1 
ATOM   10284 O  OP1   . DC  F 4 4   ? -30.343 44.405 -44.338 1.00 168.73 ? 4   DC  F OP1   1 
ATOM   10285 O  OP2   . DC  F 4 4   ? -28.939 42.338 -43.780 1.00 184.62 ? 4   DC  F OP2   1 
ATOM   10286 O  "O5'" . DC  F 4 4   ? -28.049 44.619 -43.353 1.00 122.41 ? 4   DC  F "O5'" 1 
ATOM   10287 C  "C5'" . DC  F 4 4   ? -27.590 45.312 -44.508 1.00 149.16 ? 4   DC  F "C5'" 1 
ATOM   10288 C  "C4'" . DC  F 4 4   ? -26.369 46.164 -44.208 1.00 140.10 ? 4   DC  F "C4'" 1 
ATOM   10289 O  "O4'" . DC  F 4 4   ? -26.606 46.998 -43.048 1.00 125.53 ? 4   DC  F "O4'" 1 
ATOM   10290 C  "C3'" . DC  F 4 4   ? -25.113 45.394 -43.838 1.00 135.84 ? 4   DC  F "C3'" 1 
ATOM   10291 O  "O3'" . DC  F 4 4   ? -24.460 44.925 -45.009 1.00 159.00 ? 4   DC  F "O3'" 1 
ATOM   10292 C  "C2'" . DC  F 4 4   ? -24.290 46.476 -43.147 1.00 124.13 ? 4   DC  F "C2'" 1 
ATOM   10293 C  "C1'" . DC  F 4 4   ? -25.355 47.352 -42.485 1.00 133.02 ? 4   DC  F "C1'" 1 
ATOM   10294 N  N1    . DC  F 4 4   ? -25.414 47.198 -40.999 1.00 140.04 ? 4   DC  F N1    1 
ATOM   10295 C  C2    . DC  F 4 4   ? -24.313 47.576 -40.221 1.00 127.40 ? 4   DC  F C2    1 
ATOM   10296 O  O2    . DC  F 4 4   ? -23.306 48.032 -40.778 1.00 130.73 ? 4   DC  F O2    1 
ATOM   10297 N  N3    . DC  F 4 4   ? -24.379 47.432 -38.874 1.00 124.64 ? 4   DC  F N3    1 
ATOM   10298 C  C4    . DC  F 4 4   ? -25.480 46.940 -38.306 1.00 131.89 ? 4   DC  F C4    1 
ATOM   10299 N  N4    . DC  F 4 4   ? -25.496 46.818 -36.975 1.00 119.54 ? 4   DC  F N4    1 
ATOM   10300 C  C5    . DC  F 4 4   ? -26.612 46.550 -39.080 1.00 139.21 ? 4   DC  F C5    1 
ATOM   10301 C  C6    . DC  F 4 4   ? -26.536 46.696 -40.408 1.00 146.33 ? 4   DC  F C6    1 
ATOM   10302 P  P     . DA  F 4 5   ? -23.383 43.746 -44.902 1.00 185.70 ? 5   DA  F P     1 
ATOM   10303 O  OP1   . DA  F 4 5   ? -23.303 43.084 -46.222 1.00 178.51 ? 5   DA  F OP1   1 
ATOM   10304 O  OP2   . DA  F 4 5   ? -23.704 42.950 -43.696 1.00 163.74 ? 5   DA  F OP2   1 
ATOM   10305 O  "O5'" . DA  F 4 5   ? -22.013 44.527 -44.632 1.00 155.93 ? 5   DA  F "O5'" 1 
ATOM   10306 C  "C5'" . DA  F 4 5   ? -21.493 45.422 -45.611 1.00 131.81 ? 5   DA  F "C5'" 1 
ATOM   10307 C  "C4'" . DA  F 4 5   ? -20.349 46.239 -45.038 1.00 117.80 ? 5   DA  F "C4'" 1 
ATOM   10308 O  "O4'" . DA  F 4 5   ? -20.826 47.077 -43.955 1.00 122.14 ? 5   DA  F "O4'" 1 
ATOM   10309 C  "C3'" . DA  F 4 5   ? -19.223 45.425 -44.420 1.00 112.97 ? 5   DA  F "C3'" 1 
ATOM   10310 O  "O3'" . DA  F 4 5   ? -18.302 45.011 -45.419 1.00 113.10 ? 5   DA  F "O3'" 1 
ATOM   10311 C  "C2'" . DA  F 4 5   ? -18.602 46.443 -43.471 1.00 119.70 ? 5   DA  F "C2'" 1 
ATOM   10312 C  "C1'" . DA  F 4 5   ? -19.844 47.152 -42.937 1.00 122.93 ? 5   DA  F "C1'" 1 
ATOM   10313 N  N9    . DA  F 4 5   ? -20.382 46.540 -41.725 1.00 119.76 ? 5   DA  F N9    1 
ATOM   10314 C  C8    . DA  F 4 5   ? -21.434 45.672 -41.643 1.00 114.94 ? 5   DA  F C8    1 
ATOM   10315 N  N7    . DA  F 4 5   ? -21.704 45.278 -40.422 1.00 119.76 ? 5   DA  F N7    1 
ATOM   10316 C  C5    . DA  F 4 5   ? -20.761 45.933 -39.648 1.00 116.85 ? 5   DA  F C5    1 
ATOM   10317 C  C6    . DA  F 4 5   ? -20.513 45.935 -38.261 1.00 108.74 ? 5   DA  F C6    1 
ATOM   10318 N  N6    . DA  F 4 5   ? -21.235 45.223 -37.390 1.00 120.99 ? 5   DA  F N6    1 
ATOM   10319 N  N1    . DA  F 4 5   ? -19.496 46.697 -37.809 1.00 106.16 ? 5   DA  F N1    1 
ATOM   10320 C  C2    . DA  F 4 5   ? -18.780 47.405 -38.690 1.00 131.23 ? 5   DA  F C2    1 
ATOM   10321 N  N3    . DA  F 4 5   ? -18.919 47.482 -40.013 1.00 138.33 ? 5   DA  F N3    1 
ATOM   10322 C  C4    . DA  F 4 5   ? -19.937 46.716 -40.433 1.00 128.06 ? 5   DA  F C4    1 
ATOM   10323 P  P     . DT  F 4 6   ? -17.549 43.607 -45.274 1.00 147.80 ? 6   DT  F P     1 
ATOM   10324 O  OP1   . DT  F 4 6   ? -16.764 43.390 -46.509 1.00 135.68 ? 6   DT  F OP1   1 
ATOM   10325 O  OP2   . DT  F 4 6   ? -18.538 42.598 -44.839 1.00 146.77 ? 6   DT  F OP2   1 
ATOM   10326 O  "O5'" . DT  F 4 6   ? -16.545 43.856 -44.054 1.00 137.83 ? 6   DT  F "O5'" 1 
ATOM   10327 C  "C5'" . DT  F 4 6   ? -15.488 44.795 -44.183 1.00 140.25 ? 6   DT  F "C5'" 1 
ATOM   10328 C  "C4'" . DT  F 4 6   ? -14.893 45.119 -42.826 1.00 116.74 ? 6   DT  F "C4'" 1 
ATOM   10329 O  "O4'" . DT  F 4 6   ? -15.928 45.653 -41.966 1.00 125.80 ? 6   DT  F "O4'" 1 
ATOM   10330 C  "C3'" . DT  F 4 6   ? -14.343 43.929 -42.053 1.00 107.24 ? 6   DT  F "C3'" 1 
ATOM   10331 O  "O3'" . DT  F 4 6   ? -13.014 43.639 -42.467 1.00 126.28 ? 6   DT  F "O3'" 1 
ATOM   10332 C  "C2'" . DT  F 4 6   ? -14.372 44.466 -40.627 1.00 102.56 ? 6   DT  F "C2'" 1 
ATOM   10333 C  "C1'" . DT  F 4 6   ? -15.643 45.312 -40.623 1.00 120.03 ? 6   DT  F "C1'" 1 
ATOM   10334 N  N1    . DT  F 4 6   ? -16.810 44.594 -40.035 1.00 120.66 ? 6   DT  F N1    1 
ATOM   10335 C  C2    . DT  F 4 6   ? -16.957 44.594 -38.667 1.00 111.20 ? 6   DT  F C2    1 
ATOM   10336 O  O2    . DT  F 4 6   ? -16.183 45.155 -37.913 1.00 122.85 ? 6   DT  F O2    1 
ATOM   10337 N  N3    . DT  F 4 6   ? -18.053 43.911 -38.209 1.00 108.87 ? 6   DT  F N3    1 
ATOM   10338 C  C4    . DT  F 4 6   ? -18.996 43.238 -38.960 1.00 103.36 ? 6   DT  F C4    1 
ATOM   10339 O  O4    . DT  F 4 6   ? -19.943 42.655 -38.441 1.00 99.85  ? 6   DT  F O4    1 
ATOM   10340 C  C5    . DT  F 4 6   ? -18.783 43.276 -40.387 1.00 120.15 ? 6   DT  F C5    1 
ATOM   10341 C  C7    . DT  F 4 6   ? -19.740 42.582 -41.311 1.00 132.60 ? 6   DT  F C7    1 
ATOM   10342 C  C6    . DT  F 4 6   ? -17.714 43.941 -40.851 1.00 130.93 ? 6   DT  F C6    1 
ATOM   10343 P  P     . DT  F 4 7   ? -12.436 42.151 -42.349 1.00 131.28 ? 7   DT  F P     1 
ATOM   10344 O  OP1   . DT  F 4 7   ? -11.234 42.067 -43.206 1.00 127.58 ? 7   DT  F OP1   1 
ATOM   10345 O  OP2   . DT  F 4 7   ? -13.560 41.211 -42.561 1.00 134.99 ? 7   DT  F OP2   1 
ATOM   10346 O  "O5'" . DT  F 4 7   ? -11.988 42.045 -40.816 1.00 111.18 ? 7   DT  F "O5'" 1 
ATOM   10347 C  "C5'" . DT  F 4 7   ? -11.083 42.990 -40.255 1.00 108.96 ? 7   DT  F "C5'" 1 
ATOM   10348 C  "C4'" . DT  F 4 7   ? -10.719 42.587 -38.837 1.00 99.75  ? 7   DT  F "C4'" 1 
ATOM   10349 O  "O4'" . DT  F 4 7   ? -11.916 42.560 -38.019 1.00 111.63 ? 7   DT  F "O4'" 1 
ATOM   10350 C  "C3'" . DT  F 4 7   ? -10.077 41.208 -38.722 1.00 108.48 ? 7   DT  F "C3'" 1 
ATOM   10351 O  "O3'" . DT  F 4 7   ? -8.890  41.277 -37.941 1.00 102.80 ? 7   DT  F "O3'" 1 
ATOM   10352 C  "C2'" . DT  F 4 7   ? -11.145 40.343 -38.054 1.00 119.75 ? 7   DT  F "C2'" 1 
ATOM   10353 C  "C1'" . DT  F 4 7   ? -11.975 41.359 -37.280 1.00 123.91 ? 7   DT  F "C1'" 1 
ATOM   10354 N  N1    . DT  F 4 7   ? -13.411 40.973 -37.150 1.00 133.76 ? 7   DT  F N1    1 
ATOM   10355 C  C2    . DT  F 4 7   ? -13.960 40.771 -35.901 1.00 129.17 ? 7   DT  F C2    1 
ATOM   10356 O  O2    . DT  F 4 7   ? -13.335 40.889 -34.862 1.00 125.84 ? 7   DT  F O2    1 
ATOM   10357 N  N3    . DT  F 4 7   ? -15.287 40.421 -35.910 1.00 117.68 ? 7   DT  F N3    1 
ATOM   10358 C  C4    . DT  F 4 7   ? -16.098 40.258 -37.019 1.00 139.38 ? 7   DT  F C4    1 
ATOM   10359 O  O4    . DT  F 4 7   ? -17.280 39.942 -36.928 1.00 134.96 ? 7   DT  F O4    1 
ATOM   10360 C  C5    . DT  F 4 7   ? -15.461 40.484 -38.291 1.00 150.37 ? 7   DT  F C5    1 
ATOM   10361 C  C7    . DT  F 4 7   ? -16.243 40.335 -39.562 1.00 154.70 ? 7   DT  F C7    1 
ATOM   10362 C  C6    . DT  F 4 7   ? -14.167 40.826 -38.295 1.00 140.39 ? 7   DT  F C6    1 
ATOM   10363 P  P     . DC  F 4 8   ? -7.639  40.362 -38.333 1.00 123.50 ? 8   DC  F P     1 
ATOM   10364 O  OP1   . DC  F 4 8   ? -6.446  40.930 -37.667 1.00 112.63 ? 8   DC  F OP1   1 
ATOM   10365 O  OP2   . DC  F 4 8   ? -7.655  40.182 -39.802 1.00 134.15 ? 8   DC  F OP2   1 
ATOM   10366 O  "O5'" . DC  F 4 8   ? -7.985  38.951 -37.662 1.00 113.05 ? 8   DC  F "O5'" 1 
ATOM   10367 C  "C5'" . DC  F 4 8   ? -7.855  38.790 -36.256 1.00 119.66 ? 8   DC  F "C5'" 1 
ATOM   10368 C  "C4'" . DC  F 4 8   ? -8.649  37.594 -35.763 1.00 116.07 ? 8   DC  F "C4'" 1 
ATOM   10369 O  "O4'" . DC  F 4 8   ? -10.062 37.894 -35.806 1.00 117.28 ? 8   DC  F "O4'" 1 
ATOM   10370 C  "C3'" . DC  F 4 8   ? -8.502  36.329 -36.598 1.00 107.69 ? 8   DC  F "C3'" 1 
ATOM   10371 O  "O3'" . DC  F 4 8   ? -7.443  35.527 -36.079 1.00 94.37  ? 8   DC  F "O3'" 1 
ATOM   10372 C  "C2'" . DC  F 4 8   ? -9.857  35.634 -36.450 1.00 112.22 ? 8   DC  F "C2'" 1 
ATOM   10373 C  "C1'" . DC  F 4 8   ? -10.748 36.663 -35.754 1.00 116.05 ? 8   DC  F "C1'" 1 
ATOM   10374 N  N1    . DC  F 4 8   ? -12.091 36.820 -36.387 1.00 112.25 ? 8   DC  F N1    1 
ATOM   10375 C  C2    . DC  F 4 8   ? -13.187 37.186 -35.598 1.00 127.09 ? 8   DC  F C2    1 
ATOM   10376 O  O2    . DC  F 4 8   ? -13.020 37.379 -34.387 1.00 123.79 ? 8   DC  F O2    1 
ATOM   10377 N  N3    . DC  F 4 8   ? -14.401 37.322 -36.185 1.00 128.78 ? 8   DC  F N3    1 
ATOM   10378 C  C4    . DC  F 4 8   ? -14.540 37.106 -37.494 1.00 120.07 ? 8   DC  F C4    1 
ATOM   10379 N  N4    . DC  F 4 8   ? -15.760 37.252 -38.023 1.00 125.26 ? 8   DC  F N4    1 
ATOM   10380 C  C5    . DC  F 4 8   ? -13.435 36.729 -38.313 1.00 112.88 ? 8   DC  F C5    1 
ATOM   10381 C  C6    . DC  F 4 8   ? -12.242 36.599 -37.724 1.00 100.17 ? 8   DC  F C6    1 
ATOM   10382 P  P     . DA  F 4 9   ? -6.739  34.429 -37.006 1.00 123.94 ? 9   DA  F P     1 
ATOM   10383 O  OP1   . DA  F 4 9   ? -5.331  34.298 -36.571 1.00 105.43 ? 9   DA  F OP1   1 
ATOM   10384 O  OP2   . DA  F 4 9   ? -7.048  34.759 -38.415 1.00 143.67 ? 9   DA  F OP2   1 
ATOM   10385 O  "O5'" . DA  F 4 9   ? -7.520  33.084 -36.634 1.00 101.61 ? 9   DA  F "O5'" 1 
ATOM   10386 C  "C5'" . DA  F 4 9   ? -7.447  32.555 -35.317 1.00 94.12  ? 9   DA  F "C5'" 1 
ATOM   10387 C  "C4'" . DA  F 4 9   ? -8.238  31.262 -35.202 1.00 113.44 ? 9   DA  F "C4'" 1 
ATOM   10388 O  "O4'" . DA  F 4 9   ? -9.640  31.521 -35.472 1.00 120.97 ? 9   DA  F "O4'" 1 
ATOM   10389 C  "C3'" . DA  F 4 9   ? -7.830  30.159 -36.172 1.00 111.60 ? 9   DA  F "C3'" 1 
ATOM   10390 O  "O3'" . DA  F 4 9   ? -7.962  28.896 -35.535 1.00 105.62 ? 9   DA  F "O3'" 1 
ATOM   10391 C  "C2'" . DA  F 4 9   ? -8.823  30.319 -37.319 1.00 94.69  ? 9   DA  F "C2'" 1 
ATOM   10392 C  "C1'" . DA  F 4 9   ? -10.080 30.757 -36.577 1.00 126.86 ? 9   DA  F "C1'" 1 
ATOM   10393 N  N9    . DA  F 4 9   ? -10.965 31.610 -37.366 1.00 130.90 ? 9   DA  F N9    1 
ATOM   10394 C  C8    . DA  F 4 9   ? -10.612 32.724 -38.075 1.00 127.21 ? 9   DA  F C8    1 
ATOM   10395 N  N7    . DA  F 4 9   ? -11.616 33.303 -38.690 1.00 133.18 ? 9   DA  F N7    1 
ATOM   10396 C  C5    . DA  F 4 9   ? -12.706 32.515 -38.358 1.00 128.95 ? 9   DA  F C5    1 
ATOM   10397 C  C6    . DA  F 4 9   ? -14.073 32.595 -38.696 1.00 119.20 ? 9   DA  F C6    1 
ATOM   10398 N  N6    . DA  F 4 9   ? -14.584 33.552 -39.476 1.00 123.93 ? 9   DA  F N6    1 
ATOM   10399 N  N1    . DA  F 4 9   ? -14.897 31.649 -38.198 1.00 118.61 ? 9   DA  F N1    1 
ATOM   10400 C  C2    . DA  F 4 9   ? -14.381 30.691 -37.418 1.00 123.95 ? 9   DA  F C2    1 
ATOM   10401 N  N3    . DA  F 4 9   ? -13.118 30.512 -37.031 1.00 128.69 ? 9   DA  F N3    1 
ATOM   10402 C  C4    . DA  F 4 9   ? -12.323 31.467 -37.541 1.00 133.85 ? 9   DA  F C4    1 
ATOM   10403 P  P     . DT  F 4 10  ? -7.255  27.610 -36.171 1.00 136.77 ? 10  DT  F P     1 
ATOM   10404 O  OP1   . DT  F 4 10  ? -6.703  26.795 -35.066 1.00 131.54 ? 10  DT  F OP1   1 
ATOM   10405 O  OP2   . DT  F 4 10  ? -6.367  28.077 -37.260 1.00 142.76 ? 10  DT  F OP2   1 
ATOM   10406 O  "O5'" . DT  F 4 10  ? -8.482  26.825 -36.832 1.00 158.62 ? 10  DT  F "O5'" 1 
ATOM   10407 C  "C5'" . DT  F 4 10  ? -9.570  26.404 -36.021 1.00 145.25 ? 10  DT  F "C5'" 1 
ATOM   10408 C  "C4'" . DT  F 4 10  ? -10.757 26.001