data_3KUY
# 
_entry.id   3KUY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KUY         
NDB   NA0384       
RCSB  RCSB056479   
WWPDB D_1000056479 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2NZD 
_pdbx_database_related.details        'Nucleosome core particle containing 145 bp of DNA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KUY 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, B.'      1 
'Davey, C.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            38 
_citation.page_first                2081 
_citation.page_last                 2088 
_citation.year                      2010 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20026584 
_citation.pdbx_database_id_DOI      10.1093/nar/gkp1174 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Davey, G.E.' 1 
primary 'Wu, B.'      2 
primary 'Dong, Y.'    3 
primary 'Surana, U.'  4 
primary 'Davey, C.A.' 5 
# 
_cell.entry_id           3KUY 
_cell.length_a           106.161 
_cell.length_b           109.588 
_cell.length_c           182.413 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KUY 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'                                                      15303.930 2 ? ? ? ? 
2 polymer     man 'Histone H4'                                                        11263.231 2 ? ? ? ? 
3 polymer     man 'Histone H2A'                                                       12941.095 2 ? ? ? ? 
4 polymer     man 'Histone H2B'                                                       13848.097 2 ? ? ? ? 
5 polymer     syn 'DNA (145-MER)'                                                     44749.664 1 ? ? ? ? 
6 polymer     syn 'DNA (145-MER)'                                                     44740.648 1 ? ? ? ? 
7 non-polymer syn 'MANGANESE (II) ION'                                                54.938    1 ? ? ? ? 
8 non-polymer syn '2-[(2R)-oxiran-2-ylmethyl]-1H-benzo[de]isoquinoline-1,3(2H)-dione' 253.253   2 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2   ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
2   ? 
4 UNP Q92130_XENLA Q92130 4 
;PDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2   ? 
5 PDB 3KUY         3KUY   5 
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
-72 ? 
6 PDB 3KUY         3KUY   6 
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
-72 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3KUY A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3KUY B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3KUY C 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
4  4 3KUY D 1 ? 125 ? Q92130 2   ? 126 ? -2  122 
5  1 3KUY E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3KUY F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3KUY G 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
8  4 3KUY H 1 ? 125 ? Q92130 2   ? 126 ? -2  122 
9  5 3KUY I 1 ? 145 ? 3KUY   -72 ? 72  ? -72 72  
10 6 3KUY J 1 ? 145 ? 3KUY   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KUY ALA A 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 1 
4 3KUY GLU D 2   ? UNP Q92130 ASP 3   'SEE REMARK 999' -1  2 
4 3KUY PRO D 10  ? UNP Q92130 ALA 11  'SEE REMARK 999' 7   3 
4 3KUY THR D 32  ? UNP Q92130 SER 33  'SEE REMARK 999' 29  4 
5 3KUY ALA E 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 5 
8 3KUY GLU H 2   ? UNP Q92130 ASP 3   'SEE REMARK 999' -1  6 
8 3KUY PRO H 10  ? UNP Q92130 ALA 11  'SEE REMARK 999' 7   7 
8 3KUY THR H 32  ? UNP Q92130 SER 33  'SEE REMARK 999' 29  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                             ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                            ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                          ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                     ? 'C4 H7 N O4'      133.103 
ATV non-polymer         . '2-[(2R)-oxiran-2-ylmethyl]-1H-benzo[de]isoquinoline-1,3(2H)-dione' 
'N-(2,3-epoxypropyl)-1,8-naphthalimide' 'C15 H11 N O3'    253.253 
CYS 'L-peptide linking' y CYSTEINE                                                            ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                 ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                        ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                           ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                     ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                             ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                           ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                          ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                             ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                              ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                          ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                                ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                                       ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                             ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                              ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                           ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                                                            ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                              ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3KUY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    
;85 mM MnCl2, 60 mM KCl, 20 mM K-Cacodylate, 4 mg/ml NCP over well with 1/2 conc., pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K, EVAPORATION
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54180 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54180 
# 
_reflns.entry_id                     3KUY 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             54.8 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   47896 
_reflns.number_all                   ? 
_reflns.pdbx_number_measured_all     356697 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              3.06 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.483 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6839 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3KUY 
_refine.ls_number_reflns_obs                     46854 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.17 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    99.86 
_refine.ls_R_factor_obs                          0.23896 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23800 
_refine.ls_R_factor_R_free                       0.28591 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  978 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.919 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               76.089 
_refine.aniso_B[1][1]                            2.12 
_refine.aniso_B[2][2]                            -3.16 
_refine.aniso_B[3][3]                            1.03 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2NZD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.424 
_refine.overall_SU_ML                            0.322 
_refine.overall_SU_B                             16.017 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6064 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12042 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        53.17 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.021  ? 12865 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.389  2.545  ? 18622 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.901  5.000  ? 757   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.190 21.338 ? 269   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.419 15.000 ? 1181  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.053 15.000 ? 84    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 2115  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 7577  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.206  0.200  ? 5326  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.308  0.200  ? 8063  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.144  0.200  ? 369   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.181  0.200  ? 22    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.300  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.605  1.500  ? 3865  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.080  2.000  ? 6110  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.990  3.000  ? 12207 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.855  4.500  ? 12506 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.900 
_refine_ls_shell.d_res_low                        2.975 
_refine_ls_shell.number_reflns_R_work             3338 
_refine_ls_shell.R_factor_R_work                  0.294 
_refine_ls_shell.percent_reflns_obs               98.28 
_refine_ls_shell.R_factor_R_free                  0.360 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             85 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KUY 
_struct.title                     'DNA Stretching in the Nucleosome Facilitates Alkylation by an Intercalating Antitumor Agent' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KUY 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
;Nucleosome, chromatin, DNA stretching, intercalation, alkylation, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, STRUCTURAL PROTEIN-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? GLY A 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  5  ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? ALA C 21  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 ALA C 45  ? ASP C 72  ? ALA C 45  ASP C 72  1 ? 28 
HELX_P HELX_P12 12 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 103 ? ALA D 124 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? ALA G 21  ? THR G 16  ALA G 21  1 ? 6  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 103 ? SER H 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 K MN .   MN ? ? E ASP 77  E MN 1001 1_555 ? ? ? ? ? ? ?               2.302 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT 145 N3 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT 145 O4 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA 144 N1 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA 144 N6 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG 143 N2 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT 142 N3 ? ? I DA  -69 J DT 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT 142 O4 ? ? I DA  -69 J DT 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT 141 N3 ? ? I DA  -68 J DT 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  5   N6  ? ? ? 1_555 J DT 141 O4 ? ? I DA  -68 J DT 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA 140 N1 ? ? I DT  -67 J DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA 140 N6 ? ? I DT  -67 J DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT 139 N3 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT 139 O4 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA 138 N1 ? ? I DT  -65 J DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA 138 N6 ? ? I DT  -65 J DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG 137 N2 ? ? I DC  -64 J DG 64   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog17  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG 136 N1 ? ? I DC  -63 J DG 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG 136 O6 ? ? I DC  -63 J DG 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG 136 N2 ? ? I DC  -63 J DG 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT 135 N3 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT 135 O4 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG 134 N2 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog23  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DA 132 N6 ? ? I DC  -60 J DA 59   1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog24  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DG 133 N1 ? ? I DC  -60 J DG 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DC  13  N4  ? ? ? 1_555 J DG 133 O6 ? ? I DC  -60 J DG 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG 133 N2 ? ? I DC  -60 J DG 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA 132 N1 ? ? I DT  -59 J DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DT  14  O4  ? ? ? 1_555 J DA 132 N6 ? ? I DT  -59 J DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC 131 N3 ? ? I DG  -58 J DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC 131 O2 ? ? I DG  -58 J DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC 131 N4 ? ? I DG  -58 J DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG 130 N1 ? ? I DC  -57 J DG 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG 130 O6 ? ? I DC  -57 J DG 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG 130 N2 ? ? I DC  -57 J DG 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT 129 N3 ? ? I DA  -56 J DT 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT 129 O4 ? ? I DA  -56 J DT 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC 128 N3 ? ? I DG  -55 J DC 55   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog38  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT 127 O4 ? ? I DA  -54 J DT 54   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog39  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J DA 126 N1 ? ? I DT  -53 J DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J DA 126 N6 ? ? I DT  -53 J DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT 125 N3 ? ? I DA  -52 J DT 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT 125 O4 ? ? I DA  -52 J DT 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J DG 124 N1 ? ? I DC  -51 J DG 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG 124 O6 ? ? I DC  -51 J DG 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG 124 N2 ? ? I DC  -51 J DG 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA 123 N1 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog47  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DG 121 O6 ? ? I DA  -49 J DG 48   1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog48  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT 122 N3 ? ? I DA  -49 J DT 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DT 122 O4 ? ? I DA  -49 J DT 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG 120 O6 ? ? I DC  -48 J DG 47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog51  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG 121 N1 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG 121 O6 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG 121 N2 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DT 119 O4 ? ? I DC  -47 J DT 46   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog55  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG 120 N2 ? ? I DC  -47 J DG 47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog56  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT 118 O4 ? ? I DA  -46 J DT 45   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog57  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT 119 N3 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT 119 O4 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT 118 N3 ? ? I DA  -45 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT 118 O4 ? ? I DA  -45 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT 116 O4 ? ? I DA  -44 J DT 43   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog62  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT 117 N3 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT 117 O4 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT 116 N3 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT 116 O4 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DG  31  N1  ? ? ? 1_555 J DC 115 N3 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC 115 O2 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DG  31  O6  ? ? ? 1_555 J DC 115 N4 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA 114 N1 ? ? I DT  -41 J DA 41   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog70  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC 113 N3 ? ? I DG  -40 J DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC 113 O2 ? ? I DG  -40 J DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC 113 N4 ? ? I DG  -40 J DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT 111 O4 ? ? I DA  -38 J DT 38   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog74  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA 110 N1 ? ? I DT  -37 J DA 37   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog75  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA 109 N1 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA 109 N6 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DC 107 N3 ? ? I DT  -35 J DC 34   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog78  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DC 107 N4 ? ? I DT  -35 J DC 34   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog79  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA 108 N1 ? ? I DT  -35 J DA 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA 108 N6 ? ? I DT  -35 J DA 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC 106 N4 ? ? I DG  -34 J DC 33   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog82  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC 107 N3 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC 107 O2 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC 107 N4 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC 106 N3 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC 106 O2 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DC 106 N4 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT 105 N3 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J DT 105 O4 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT 104 N3 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT 104 O4 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG 102 N2 ? ? I DC  -29 J DG 29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog93  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA 101 N1 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog94  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC 100 N3 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC 100 O2 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC 100 N4 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG 99  N1 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG 99  O6 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG 99  N2 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA 98  N1 ? ? I DT  -25 J DA 25   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog101 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG 97  N1 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG 97  O6 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG 97  N2 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  50  N4  ? ? ? 1_555 J DG 96  O6 ? ? I DC  -23 J DG 23   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog105 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT 95  N3 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT 95  O4 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA 94  N1 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA 94  N6 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG 93  N1 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG 93  O6 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG 93  N2 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT 92  N3 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT 92  O4 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT 91  N3 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J DT 91  O4 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT 90  N3 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog117 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT 89  N3 ? ? I DA  -16 J DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT 89  O4 ? ? I DA  -16 J DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC 88  N3 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J DC 88  O2 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J DC 88  N4 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DC 87  N3 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J DC 87  O2 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J DC 87  N4 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DC  60  N4  ? ? ? 1_555 J DG 86  O6 ? ? I DC  -13 J DG 13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog126 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT 85  N3 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog127 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA 84  N1 ? ? I DT  -11 J DA 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA 84  N6 ? ? I DT  -11 J DA 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC 83  N3 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC 83  O2 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC 83  N4 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA 82  N1 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA 82  N6 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA 81  N1 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA 81  N6 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J DG 80  N1 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J DG 80  O6 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG 80  N2 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT 79  N3 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT 79  O4 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC 78  N3 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC 78  O2 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC 78  N4 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG 77  N1 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG 77  O6 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG 77  N2 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA 76  N1 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA 76  N6 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC 75  N3 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J DC 75  O2 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J DC 75  N4 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT 74  N3 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT 74  O4 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT 73  N3 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT 73  O4 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA 72  N1 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA 72  N6 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG 71  N1 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog159 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT 70  N3 ? ? I DA  3   J DT -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT 70  O4 ? ? I DA  3   J DT -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC 69  N3 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC 69  O2 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC 69  N4 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG 68  N1 ? ? I DC  5   J DG -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG 68  O6 ? ? I DC  5   J DG -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG 68  N2 ? ? I DC  5   J DG -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA 67  N1 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA 67  N6 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC 66  N3 ? ? I DG  7   J DC -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC 66  O2 ? ? I DG  7   J DC -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC 66  N4 ? ? I DG  7   J DC -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT 65  N3 ? ? I DA  8   J DT -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT 65  O4 ? ? I DA  8   J DT -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT 64  N3 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT 64  O4 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG 63  N1 ? ? I DC  10  J DG -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG 63  O6 ? ? I DC  10  J DG -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG 63  N2 ? ? I DC  10  J DG -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT 62  N3 ? ? I DA  11  J DT -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT 62  O4 ? ? I DA  11  J DT -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA 61  N1 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA 61  N6 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC 60  N3 ? ? I DG  13  J DC -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC 60  O2 ? ? I DG  13  J DC -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC 60  N4 ? ? I DG  13  J DC -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG 59  N1 ? ? I DC  14  J DG -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG 59  O6 ? ? I DC  14  J DG -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG 59  N2 ? ? I DC  14  J DG -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J DG 58  N1 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J DG 58  O6 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG 58  N2 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA 57  N1 ? ? I DT  16  J DA -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA 57  N6 ? ? I DT  16  J DA -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA 56  N1 ? ? I DT  17  J DA -17  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog195 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J DA 55  N1 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog196 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA 54  N1 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J DA 54  N6 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DC 53  N4 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog199 hydrog ? ? I DA  94  N1  ? ? ? 1_555 J DT 52  N3 ? ? I DA  21  J DT -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DA  94  N6  ? ? ? 1_555 J DT 52  O4 ? ? I DA  21  J DT -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J DA 51  N1 ? ? I DT  22  J DA -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DT  95  O4  ? ? ? 1_555 J DA 51  N6 ? ? I DT  22  J DA -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DG  96  O6  ? ? ? 1_555 J DC 50  N4 ? ? I DG  23  J DC -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog204 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC 49  N3 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC 49  O2 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC 49  N4 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DC 47  N3 ? ? I DA  25  J DC -26  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog208 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT 48  N3 ? ? I DA  25  J DT -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DT 48  O4 ? ? I DA  25  J DT -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC 47  O2 ? ? I DG  26  J DC -26  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog211 hydrog ? ? I DC  100 N3  ? ? ? 1_555 J DG 46  N1 ? ? I DC  27  J DG -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DC  100 N4  ? ? ? 1_555 J DG 46  O6 ? ? I DC  27  J DG -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG 46  N2 ? ? I DC  27  J DG -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DG  102 N1  ? ? ? 1_555 J DC 44  N3 ? ? I DG  29  J DC -29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog215 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DT 45  O2 ? ? I DG  29  J DT -28  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog216 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA 43  N1 ? ? I DT  30  J DA -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA 43  N6 ? ? I DT  30  J DA -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA 42  N1 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog219 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA 41  N1 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA 41  N6 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG 40  N1 ? ? I DC  33  J DG -33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog222 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG 39  N1 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG 39  O6 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG 39  N2 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT 38  N3 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT 38  O4 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT 37  N3 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT 37  O4 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT 36  N3 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT 36  O4 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA 35  N1 ? ? I DT  38  J DA -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J DA 35  N6 ? ? I DT  38  J DA -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT 34  N3 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT 34  O4 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DT 32  O4 ? ? I DC  40  J DT -41  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog236 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG 33  N1 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG 33  O6 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG 33  N2 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DG 31  N1 ? ? I DA  41  J DG -42  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog240 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DG 31  O6 ? ? I DA  41  J DG -42  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog241 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT 32  N3 ? ? I DA  41  J DT -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT 32  O4 ? ? I DA  41  J DT -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG 31  N2 ? ? I DC  42  J DG -42  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog244 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA 30  N1 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA 30  N6 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA 29  N1 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA 29  N6 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA 28  N1 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA 28  N6 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC 26  O2 ? ? I DG  47  J DC -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog251 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DA 27  N1 ? ? I DG  47  J DA -46  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog252 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC 25  O2 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog253 hydrog ? ? I DA  123 N6  ? ? ? 1_555 J DC 22  N3 ? ? I DA  50  J DC -51  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog254 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT 23  N3 ? ? I DA  50  J DT -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog255 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DA 21  N6 ? ? I DG  51  J DA -52  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog256 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DC 22  O2 ? ? I DG  51  J DC -51  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog257 hydrog ? ? I DT  125 N3  ? ? ? 1_555 J DA 21  N1 ? ? I DT  52  J DA -52  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog258 hydrog ? ? I DA  126 N1  ? ? ? 1_555 J DT 20  N3 ? ? I DA  53  J DT -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DA  126 N6  ? ? ? 1_555 J DT 20  O4 ? ? I DA  53  J DT -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA 19  N1 ? ? I DT  54  J DA -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA 19  N6 ? ? I DT  54  J DA -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG 18  N1 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG 18  O6 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG 18  N2 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA 17  N1 ? ? I DT  56  J DA -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA 17  N6 ? ? I DT  56  J DA -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC 16  N3 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC 16  O2 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC 16  N4 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG 15  N1 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG 15  O6 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG 15  N2 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT 14  N3 ? ? I DA  59  J DT -59  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog274 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC 13  N3 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J DC 13  O2 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J DC 13  N4 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC 12  N3 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC 12  O2 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC 12  N4 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA 11  N1 ? ? I DT  62  J DA -62  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog281 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC 10  N3 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC 10  O2 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC 10  N4 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC 9   N3 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog285 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT 8   N3 ? ? I DA  65  J DT -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT 8   O4 ? ? I DA  65  J DT -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA 7   N1 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA 7   N6 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT 6   N3 ? ? I DA  67  J DT -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT 6   O4 ? ? I DA  67  J DT -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA 5   N1 ? ? I DT  68  J DA -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA 5   N6 ? ? I DT  68  J DA -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA 4   N1 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA 4   N6 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC 3   N3 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC 3   O2 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC 3   N4 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT 2   N3 ? ? I DA  71  J DT -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT 2   O4 ? ? I DA  71  J DT -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA 1   N1 ? ? I DT  72  J DA -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA 1   N6 ? ? I DT  72  J DA -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN E 1001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ATV J 73'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ATV I 73'  
1   ?        ? ? ? ? ? ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 VAL D 48 ? VAL D 45  . ? 3_545 ? 
2  AC1 2 ASP E 77 ? ASP E 77  . ? 1_555 ? 
3  AC2 4 DC  I 87 ? DC  I 14  . ? 1_555 ? 
4  AC2 4 DC  I 88 ? DC  I 15  . ? 1_555 ? 
5  AC2 4 DG  J 58 ? DG  J -15 . ? 1_555 ? 
6  AC2 4 DG  J 59 ? DG  J -14 . ? 1_555 ? 
7  AC3 4 DG  I 58 ? DG  I -15 . ? 1_555 ? 
8  AC3 4 DG  I 59 ? DG  I -14 . ? 1_555 ? 
9  AC3 4 DC  J 87 ? DC  J 14  . ? 1_555 ? 
10 AC3 4 DC  J 88 ? DC  J 15  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KUY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KUY 
_atom_sites.fract_transf_matrix[1][1]   0.009420 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009125 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005482 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 38  ? -60.656 -28.290 79.733 1.00 89.64  ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1 38  ? -59.665 -28.043 80.786 1.00 89.41  ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1 38  ? -58.417 -28.935 80.634 1.00 89.06  ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1 38  ? -57.977 -29.569 81.606 1.00 88.98  ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1 38  ? -60.437 -28.387 82.070 1.00 89.52  ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 38  ? -61.546 -29.369 81.622 1.00 89.72  ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 38  ? -61.606 -29.357 80.105 1.00 89.69  ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1 39  ? -57.864 -28.971 79.419 1.00 88.40  ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1 39  ? -56.711 -29.828 79.087 1.00 87.75  ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1 39  ? -55.706 -29.125 78.163 1.00 86.64  ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1 39  ? -56.090 -28.457 77.197 1.00 86.54  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1 39  ? -57.185 -31.140 78.461 1.00 88.15  ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 39  ? -56.075 -32.078 78.106 1.00 89.26  ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 39  ? -55.360 -31.974 76.929 1.00 90.07  ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 39  ? -55.565 -33.144 78.767 1.00 89.94  ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 39  ? -54.458 -32.939 76.883 1.00 90.66  ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 39  ? -54.561 -33.662 77.986 1.00 90.57  ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 40  ? -54.421 -29.314 78.451 1.00 85.09  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1 40  ? -53.383 -28.444 77.908 1.00 83.58  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1 40  ? -52.101 -29.198 77.521 1.00 82.58  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1 40  ? -51.554 -29.964 78.327 1.00 82.53  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1 40  ? -53.078 -27.357 78.944 1.00 83.55  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 40  ? -52.262 -26.194 78.442 1.00 83.11  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 40  ? -51.957 -25.245 79.574 1.00 81.43  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 40  ? -51.034 -24.193 79.169 1.00 80.44  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 40  ? -51.387 -23.088 78.519 1.00 79.75  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 40  ? -52.656 -22.874 78.176 1.00 79.01  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 40  ? -50.461 -22.195 78.209 1.00 78.63  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 41  ? -51.628 -28.969 76.292 1.00 81.15  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1 41  ? -50.419 -29.628 75.772 1.00 79.67  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1 41  ? -49.134 -29.017 76.329 1.00 78.63  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1 41  ? -49.039 -27.801 76.494 1.00 78.60  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1 41  ? -50.386 -29.596 74.239 1.00 79.71  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 41  ? -51.288 -30.609 73.564 1.00 79.41  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 41  ? -52.298 -30.199 72.692 1.00 79.05  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 41  ? -51.125 -31.978 73.791 1.00 79.48  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 41  ? -53.129 -31.129 72.064 1.00 79.44  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 41  ? -51.953 -32.915 73.175 1.00 79.69  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 41  ? -52.953 -32.485 72.313 1.00 79.49  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 41  ? -53.771 -33.414 71.707 1.00 79.30  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1 42  ? -48.149 -29.868 76.607 1.00 77.18  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1 42  ? -46.891 -29.429 77.207 1.00 76.08  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1 42  ? -45.999 -28.705 76.200 1.00 75.02  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1 42  ? -45.976 -29.067 75.021 1.00 74.94  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1 42  ? -46.141 -30.610 77.831 1.00 76.25  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 42  ? -46.964 -31.377 78.851 1.00 77.29  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 42  ? -46.226 -31.529 80.168 1.00 79.22  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 42  ? -45.205 -32.565 80.086 1.00 80.44  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 42  ? -45.315 -33.767 80.641 1.00 81.58  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 42  ? -46.398 -34.091 81.341 1.00 81.79  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 42  ? -44.335 -34.648 80.502 1.00 82.59  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 43  ? -45.260 -27.677 76.663 1.00 73.86  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1 43  ? -44.386 -26.878 75.806 1.00 72.87  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1 43  ? -43.430 -27.745 75.007 1.00 71.63  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1 43  ? -42.670 -28.516 75.588 1.00 71.54  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1 43  ? -43.603 -26.025 76.808 1.00 72.87  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 43  ? -44.501 -25.892 77.950 1.00 73.37  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 43  ? -45.210 -27.209 78.059 1.00 73.90  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1 44  ? -43.486 -27.621 73.684 1.00 70.34  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1 44  ? -42.630 -28.407 72.802 1.00 68.78  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1 44  ? -43.357 -29.504 72.054 1.00 67.54  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1 44  ? -42.846 -30.029 71.072 1.00 67.59  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1 45  ? -44.553 -29.845 72.518 1.00 66.48  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1 45  ? -45.329 -30.930 71.934 1.00 65.40  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1 45  ? -45.894 -30.492 70.602 1.00 64.66  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1 45  ? -45.839 -31.236 69.619 1.00 64.48  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1 45  ? -46.473 -31.370 72.875 1.00 65.57  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 45  ? -45.917 -31.880 74.093 1.00 65.18  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 45  ? -47.346 -32.449 72.233 1.00 65.58  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 46  ? -46.432 -29.278 70.578 1.00 63.78  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 46  ? -46.992 -28.716 69.360 1.00 63.04  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 46  ? -45.868 -28.329 68.412 1.00 62.47  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1 46  ? -46.015 -28.452 67.198 1.00 62.69  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 46  ? -47.873 -27.470 69.626 1.00 63.11  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 46  ? -48.732 -27.151 68.400 1.00 63.23  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 46  ? -48.754 -27.675 70.846 1.00 63.11  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 47  ? -44.752 -27.852 68.966 1.00 61.50  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1 47  ? -43.602 -27.467 68.155 1.00 60.36  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1 47  ? -43.168 -28.671 67.323 1.00 59.83  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1 47  ? -43.022 -28.575 66.095 1.00 59.77  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1 47  ? -42.477 -26.976 69.031 1.00 60.21  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1 48  ? -43.001 -29.806 67.999 1.00 58.77  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1 48  ? -42.742 -31.080 67.349 1.00 58.12  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1 48  ? -43.808 -31.400 66.305 1.00 57.63  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1 48  ? -43.495 -31.792 65.180 1.00 57.34  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1 48  ? -42.708 -32.190 68.399 1.00 58.21  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 48  ? -41.384 -32.684 68.983 1.00 58.55  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 48  ? -40.251 -31.669 68.882 1.00 59.55  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 48  ? -41.594 -33.106 70.422 1.00 58.76  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 49  ? -45.067 -31.226 66.696 1.00 57.12  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1 49  ? -46.202 -31.531 65.840 1.00 56.65  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1 49  ? -46.156 -30.646 64.606 1.00 56.46  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1 49  ? -46.346 -31.124 63.488 1.00 56.63  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1 49  ? -47.507 -31.339 66.611 1.00 56.62  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 49  ? -48.744 -31.869 65.921 1.00 56.43  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 49  ? -49.832 -32.262 66.921 1.00 56.11  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 49  ? -50.543 -31.123 67.501 1.00 56.24  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 49  ? -50.694 -30.923 68.808 1.00 55.52  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 49  ? -50.188 -31.791 69.678 1.00 54.73  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 49  ? -51.361 -29.858 69.244 1.00 54.73  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 50  ? -45.877 -29.362 64.820 1.00 56.10  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1 50  ? -45.673 -28.422 63.732 1.00 55.91  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1 50  ? -44.486 -28.835 62.851 1.00 55.39  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1 50  ? -44.612 -28.846 61.624 1.00 55.48  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1 50  ? -45.473 -27.011 64.268 1.00 55.69  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 50  ? -46.740 -26.303 64.688 1.00 56.42  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 50  ? -46.464 -24.972 65.392 1.00 57.17  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 50  ? -45.601 -24.193 64.920 1.00 58.82  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 50  ? -47.114 -24.697 66.426 1.00 58.63  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 51  ? -43.352 -29.191 63.462 1.00 54.61  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1 51  ? -42.181 -29.638 62.684 1.00 54.02  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1 51  ? -42.562 -30.701 61.659 1.00 54.12  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1 51  ? -42.236 -30.568 60.484 1.00 54.07  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1 51  ? -41.018 -30.159 63.573 1.00 53.71  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 51  ? -40.285 -28.986 64.230 1.00 53.59  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 51  ? -40.037 -30.951 62.753 1.00 52.20  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 51  ? -39.562 -29.321 65.529 1.00 52.90  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 52  ? -43.280 -31.729 62.108 1.00 54.21  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 52  ? -43.619 -32.867 61.263 1.00 54.27  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 52  ? -44.596 -32.467 60.173 1.00 54.31  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1 52  ? -44.514 -32.946 59.041 1.00 54.16  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 52  ? -44.182 -34.016 62.101 1.00 54.27  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 52  ? -43.272 -34.415 63.232 1.00 55.05  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 52  ? -43.232 -35.919 63.487 1.00 56.48  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 52  ? -42.327 -36.238 64.598 1.00 57.45  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 52  ? -42.623 -36.047 65.887 1.00 57.39  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 52  ? -43.805 -35.545 66.234 1.00 57.01  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 52  ? -41.744 -36.358 66.832 1.00 56.69  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 53  ? -45.516 -31.578 60.517 1.00 54.53  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1 53  ? -46.462 -31.063 59.546 1.00 54.81  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1 53  ? -45.728 -30.341 58.425 1.00 54.57  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1 53  ? -45.886 -30.689 57.251 1.00 55.01  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1 53  ? -47.466 -30.137 60.216 1.00 54.99  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 53  ? -48.541 -29.618 59.300 1.00 56.75  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 53  ? -49.324 -28.570 60.039 1.00 61.09  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 53  ? -50.318 -27.899 59.209 1.00 63.70  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 53  ? -50.896 -26.745 59.539 1.00 65.50  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 53  ? -50.567 -26.137 60.676 1.00 66.22  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 53  ? -51.796 -26.192 58.735 1.00 66.17  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 54  ? -44.906 -29.362 58.783 1.00 54.04  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1 54  ? -44.239 -28.540 57.778 1.00 53.81  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1 54  ? -43.092 -29.220 57.004 1.00 53.55  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1 54  ? -42.757 -28.791 55.893 1.00 53.46  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1 54  ? -43.813 -27.202 58.375 1.00 53.69  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 54  ? -44.995 -26.371 58.773 1.00 53.77  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 54  ? -45.275 -26.119 60.113 1.00 53.66  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 54  ? -45.863 -25.858 57.808 1.00 54.48  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 54  ? -46.383 -25.361 60.487 1.00 52.91  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 54  ? -46.971 -25.096 58.178 1.00 54.00  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 54  ? -47.223 -24.861 59.518 1.00 53.00  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 54  ? -48.320 -24.117 59.881 1.00 53.64  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1 55  ? -42.504 -30.272 57.569 1.00 53.13  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1 55  ? -41.497 -31.029 56.830 1.00 53.07  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1 55  ? -42.182 -31.934 55.820 1.00 53.41  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1 55  ? -41.563 -32.384 54.854 1.00 53.55  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1 55  ? -40.559 -31.800 57.762 1.00 52.58  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 55  ? -39.991 -30.909 58.847 1.00 52.47  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 55  ? -38.590 -31.257 59.298 1.00 52.42  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 55  ? -38.226 -32.428 59.441 1.00 53.09  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 55  ? -37.799 -30.224 59.564 1.00 52.05  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 56  ? -43.473 -32.168 56.036 1.00 53.76  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1 56  ? -44.252 -33.012 55.156 1.00 54.55  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1 56  ? -44.732 -32.261 53.936 1.00 54.26  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1 56  ? -44.651 -32.779 52.829 1.00 54.44  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1 56  ? -45.425 -33.655 55.899 1.00 54.68  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 56  ? -45.067 -35.036 56.433 1.00 56.38  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 56  ? -46.221 -35.765 57.153 1.00 56.26  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 56  ? -45.690 -37.072 57.810 1.00 57.89  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 56  ? -46.657 -37.728 58.755 1.00 59.69  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1 57  ? -45.228 -31.041 54.135 1.00 53.97  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1 57  ? -45.779 -30.259 53.040 1.00 53.43  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1 57  ? -44.724 -29.358 52.388 1.00 53.44  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1 57  ? -43.568 -29.303 52.838 1.00 53.54  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1 57  ? -46.973 -29.444 53.522 1.00 53.35  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1 57  ? -46.569 -28.464 54.451 1.00 53.47  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1 58  ? -45.136 -28.654 51.329 1.00 53.00  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1 58  ? -44.234 -27.836 50.523 1.00 52.22  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1 58  ? -44.786 -26.445 50.180 1.00 52.29  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1 58  ? -44.183 -25.710 49.402 1.00 51.82  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1 58  ? -43.869 -28.547 49.215 1.00 51.89  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1 58  ? -45.011 -28.583 48.359 1.00 51.24  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 58  ? -43.421 -29.942 49.483 1.00 51.54  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1 59  ? -45.934 -26.080 50.738 1.00 52.54  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1 59  ? -46.475 -24.754 50.449 1.00 53.08  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1 59  ? -45.546 -23.685 50.988 1.00 52.78  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1 59  ? -44.793 -23.925 51.934 1.00 52.46  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1 59  ? -47.917 -24.530 50.965 1.00 53.35  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 59  ? -48.562 -25.625 51.800 1.00 55.65  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 59  ? -47.947 -25.781 53.179 1.00 58.77  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 59  ? -48.669 -25.562 54.182 1.00 59.28  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 59  ? -46.745 -26.136 53.255 1.00 60.04  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 60  ? -45.591 -22.514 50.358 1.00 52.50  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1 60  ? -44.906 -21.352 50.880 1.00 52.24  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1 60  ? -45.593 -20.973 52.179 1.00 52.27  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1 60  ? -46.802 -21.141 52.318 1.00 52.35  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1 60  ? -44.929 -20.214 49.867 1.00 52.12  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 60  ? -44.263 -20.548 48.529 1.00 52.23  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 60  ? -44.805 -19.689 47.405 1.00 52.96  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 60  ? -42.744 -20.459 48.590 1.00 52.19  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 61  ? -44.823 -20.501 53.148 1.00 52.46  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1 61  ? -45.357 -20.351 54.494 1.00 52.82  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1 61  ? -45.471 -18.889 54.904 1.00 53.30  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1 61  ? -45.786 -18.571 56.056 1.00 53.54  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1 61  ? -44.539 -21.175 55.491 1.00 52.60  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 61  ? -44.268 -22.618 55.040 1.00 52.32  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 61  ? -43.351 -23.325 56.004 1.00 52.98  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 61  ? -45.542 -23.417 54.839 1.00 51.68  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 62  ? -45.233 -18.008 53.937 1.00 53.56  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1 62  ? -45.423 -16.581 54.112 1.00 54.12  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1 62  ? -46.528 -16.174 53.151 1.00 54.71  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1 62  ? -46.589 -16.693 52.036 1.00 54.84  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1 62  ? -44.116 -15.803 53.814 1.00 54.12  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 62  ? -42.955 -16.393 54.617 1.00 53.63  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 62  ? -44.274 -14.303 54.114 1.00 53.52  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 62  ? -41.584 -16.127 54.010 1.00 55.13  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 63  ? -47.400 -15.263 53.585 1.00 55.35  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1 63  ? -48.559 -14.846 52.780 1.00 56.11  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1 63  ? -48.101 -14.051 51.556 1.00 55.99  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1 63  ? -47.307 -13.123 51.685 1.00 56.28  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1 63  ? -49.544 -14.001 53.605 1.00 56.43  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 63  ? -49.568 -14.279 55.106 1.00 58.88  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 63  ? -50.749 -15.145 55.556 1.00 62.74  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 63  ? -52.018 -14.414 55.756 1.00 67.19  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 63  ? -52.195 -13.307 56.496 1.00 68.48  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 63  ? -51.176 -12.690 57.099 1.00 69.31  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 63  ? -53.409 -12.782 56.601 1.00 68.57  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 64  ? -48.608 -14.411 50.380 1.00 55.91  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1 64  ? -48.159 -13.805 49.123 1.00 56.14  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1 64  ? -48.127 -12.271 49.098 1.00 55.90  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1 64  ? -47.131 -11.677 48.680 1.00 56.21  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1 64  ? -48.964 -14.337 47.937 1.00 56.21  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 64  ? -49.012 -15.852 47.868 1.00 58.25  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 64  ? -48.866 -16.353 46.433 1.00 61.09  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 64  ? -48.650 -17.871 46.405 1.00 62.69  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 64  ? -48.687 -18.406 45.006 1.00 63.59  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 65  ? -49.198 -11.628 49.546 1.00 55.52  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 65  ? -49.293 -10.175 49.424 1.00 55.13  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 65  ? -48.205 -9.434  50.206 1.00 54.82  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1 65  ? -47.449 -8.676  49.595 1.00 55.00  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 65  ? -50.699 -9.657  49.768 1.00 55.36  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 65  ? -50.923 -8.139  49.680 1.00 55.22  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 65  ? -51.073 -7.672  48.241 1.00 54.82  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 65  ? -52.123 -7.719  50.516 1.00 55.16  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 66  ? -48.115 -9.648  51.543 1.00 54.36  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1 66  ? -47.051 -9.025  52.332 1.00 54.16  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1 66  ? -45.705 -9.166  51.638 1.00 54.29  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1 66  ? -44.934 -8.203  51.567 1.00 54.24  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1 66  ? -47.033 -9.844  53.623 1.00 54.10  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 66  ? -48.353 -10.442 53.737 1.00 54.40  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 66  ? -49.003 -10.472 52.383 1.00 54.44  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1 67  ? -45.440 -10.366 51.115 1.00 54.45  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1 67  ? -44.211 -10.634 50.386 1.00 54.22  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1 67  ? -44.116 -9.801  49.119 1.00 54.73  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1 67  ? -43.052 -9.245  48.814 1.00 54.85  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1 67  ? -44.074 -12.107 50.039 1.00 53.49  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 67  ? -42.711 -12.468 49.540 1.00 52.58  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 67  ? -41.694 -12.777 50.431 1.00 51.27  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 67  ? -42.434 -12.478 48.180 1.00 51.83  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 67  ? -40.428 -13.098 49.974 1.00 50.74  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 67  ? -41.171 -12.798 47.715 1.00 51.46  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 67  ? -40.164 -13.106 48.616 1.00 51.32  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 68  ? -45.217 -9.717  48.378 1.00 55.25  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1 68  ? -45.204 -8.957  47.139 1.00 56.06  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1 68  ? -44.858 -7.500  47.456 1.00 56.03  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1 68  ? -44.007 -6.903  46.786 1.00 55.79  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1 68  ? -46.521 -9.089  46.371 1.00 56.14  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 68  ? -46.345 -8.822  44.883 1.00 59.02  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 68  ? -47.559 -9.211  44.051 1.00 63.69  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 68  ? -48.635 -8.621  44.196 1.00 66.81  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 68  ? -47.388 -10.191 43.156 1.00 63.72  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 69  ? -45.481 -6.953  48.504 1.00 56.00  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1 69  ? -45.174 -5.590  48.934 1.00 56.22  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1 69  ? -43.684 -5.417  49.176 1.00 55.84  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1 69  ? -43.044 -4.577  48.543 1.00 55.79  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1 69  ? -45.978 -5.175  50.177 1.00 56.42  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 69  ? -47.442 -4.819  49.875 1.00 57.25  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 69  ? -48.028 -3.787  50.847 1.00 57.65  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 69  ? -47.948 -4.194  52.254 1.00 58.38  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 69  ? -48.748 -5.077  52.856 1.00 58.32  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 69  ? -49.718 -5.700  52.192 1.00 57.36  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 69  ? -48.564 -5.347  54.144 1.00 59.27  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 70  ? -43.135 -6.245  50.063 1.00 55.60  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 70  ? -41.721 -6.166  50.440 1.00 55.12  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 70  ? -40.788 -6.200  49.241 1.00 54.74  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1 70  ? -39.870 -5.404  49.152 1.00 54.75  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 70  ? -41.359 -7.290  51.396 1.00 55.01  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 70  ? -39.959 -7.220  51.988 1.00 55.26  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 70  ? -39.804 -6.015  52.895 1.00 55.67  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 70  ? -39.691 -8.491  52.755 1.00 56.18  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 71  ? -41.033 -7.124  48.322 1.00 54.38  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1 71  ? -40.242 -7.200  47.105 1.00 53.89  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1 71  ? -40.345 -5.901  46.326 1.00 53.70  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1 71  ? -39.338 -5.302  45.993 1.00 53.46  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1 71  ? -40.680 -8.381  46.236 1.00 53.78  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 71  ? -40.023 -8.320  44.887 1.00 53.43  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 71  ? -40.339 -9.673  46.925 1.00 53.46  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 72  ? -41.570 -5.459  46.071 1.00 54.13  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1 72  ? -41.815 -4.216  45.336 1.00 54.64  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1 72  ? -41.130 -2.999  45.954 1.00 54.95  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1 72  ? -40.578 -2.164  45.230 1.00 54.75  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1 72  ? -43.309 -3.968  45.200 1.00 54.57  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 72  ? -43.981 -4.926  44.233 1.00 55.16  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 72  ? -45.476 -4.641  44.100 1.00 55.75  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 72  ? -46.083 -5.514  43.100 1.00 56.90  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 72  ? -45.867 -5.414  41.787 1.00 56.68  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 72  ? -45.053 -4.475  41.308 1.00 55.69  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 72  ? -46.462 -6.256  40.954 1.00 55.96  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 73  ? -41.152 -2.930  47.287 1.00 55.33  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 73  ? -40.564 -1.835  48.041 1.00 56.04  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 73  ? -39.046 -1.800  47.872 1.00 56.20  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1 73  ? -38.478 -0.761  47.525 1.00 56.58  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 73  ? -40.937 -1.960  49.518 1.00 55.84  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 73  ? -40.159 -1.035  50.447 1.00 56.76  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 73  ? -40.471 -1.270  51.917 1.00 57.67  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 73  ? -41.615 -0.979  52.347 1.00 59.47  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 73  ? -39.559 -1.732  52.650 1.00 60.61  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 74  ? -38.399 -2.938  48.121 1.00 56.33  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1 74  ? -36.948 -3.074  48.016 1.00 56.25  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1 74  ? -36.463 -2.772  46.594 1.00 56.90  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1 74  ? -35.387 -2.196  46.402 1.00 56.71  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1 74  ? -36.490 -4.475  48.501 1.00 55.97  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 74  ? -36.601 -4.559  50.028 1.00 55.19  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 74  ? -35.070 -4.781  48.068 1.00 55.58  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 74  ? -36.680 -5.955  50.605 1.00 52.98  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 75  ? -37.279 -3.126  45.606 1.00 57.69  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 75  ? -36.937 -2.876  44.204 1.00 58.56  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 75  ? -36.931 -1.382  43.849 1.00 59.20  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1 75  ? -36.070 -0.922  43.090 1.00 58.98  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 75  ? -37.856 -3.653  43.288 1.00 58.16  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 76  ? -37.883 -0.639  44.418 1.00 60.25  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 76  ? -38.016 0.816   44.209 1.00 61.37  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 76  ? -36.692 1.567   44.432 1.00 61.82  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1 76  ? -36.406 2.551   43.749 1.00 61.98  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 76  ? -39.136 1.387   45.106 1.00 61.47  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 76  ? -39.546 2.856   44.857 1.00 62.82  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 76  ? -40.406 3.078   43.592 1.00 64.22  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 76  ? -40.988 2.144   43.036 1.00 65.07  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 76  ? -40.484 4.331   43.150 1.00 63.73  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 77  ? -35.881 1.089   45.373 1.00 62.39  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1 77  ? -34.572 1.683   45.615 1.00 62.92  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1 77  ? -33.597 1.462   44.465 1.00 63.09  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1 77  ? -32.581 2.134   44.389 1.00 63.62  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1 77  ? -33.974 1.177   46.932 1.00 63.04  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 77  ? -34.561 1.885   48.150 1.00 64.44  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 77  ? -35.202 1.208   48.987 1.00 65.51  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 77  ? -34.388 3.124   48.266 1.00 65.26  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 78  ? -33.892 0.535   43.565 1.00 63.22  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1 78  ? -32.967 0.281   42.468 1.00 63.63  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1 78  ? -33.447 0.909   41.162 1.00 64.13  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1 78  ? -32.658 1.519   40.441 1.00 64.22  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1 78  ? -32.672 -1.222  42.305 1.00 63.51  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 78  ? -32.129 -1.878  43.550 1.00 62.84  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 78  ? -32.799 -2.953  44.132 1.00 61.99  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 78  ? -30.958 -1.416  44.149 1.00 61.85  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 78  ? -32.305 -3.557  45.289 1.00 61.40  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 78  ? -30.460 -2.015  45.314 1.00 61.16  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 78  ? -31.134 -3.081  45.881 1.00 61.43  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 79  ? -34.731 0.737   40.853 1.00 64.65  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1 79  ? -35.359 1.433   39.730 1.00 65.20  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1 79  ? -36.818 1.735   40.042 1.00 65.62  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1 79  ? -37.481 0.980   40.759 1.00 65.90  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1 79  ? -35.243 0.644   38.426 1.00 64.97  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 79  ? -35.462 1.505   37.191 1.00 65.98  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 79  ? -35.709 0.702   35.924 1.00 67.02  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 79  ? -35.909 1.631   34.718 1.00 68.15  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 79  ? -35.832 0.907   33.399 1.00 68.85  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1 80  ? -37.310 2.847   39.500 1.00 66.12  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1 80  ? -38.680 3.299   39.749 1.00 66.40  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1 80  ? -39.633 2.893   38.634 1.00 66.30  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1 80  ? -39.214 2.580   37.517 1.00 66.08  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1 80  ? -38.746 4.820   39.890 1.00 66.45  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1 80  ? -38.207 5.418   38.708 1.00 66.87  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 80  ? -37.946 5.291   41.102 1.00 67.03  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1 81  ? -40.921 2.925   38.959 1.00 66.53  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1 81  ? -41.998 2.516   38.053 1.00 66.71  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1 81  ? -41.696 1.145   37.457 1.00 66.40  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1 81  ? -41.396 1.012   36.263 1.00 66.83  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1 81  ? -42.273 3.577   36.971 1.00 66.76  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 81  ? -43.587 3.332   36.224 1.00 67.83  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 81  ? -44.606 2.969   36.874 1.00 66.26  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 81  ? -43.586 3.504   34.977 1.00 70.04  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 82  ? -41.754 0.133   38.313 1.00 65.70  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1 82  ? -41.375 -1.206  37.918 1.00 65.24  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1 82  ? -42.505 -2.169  38.143 1.00 64.88  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1 82  ? -43.035 -2.281  39.245 1.00 65.09  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1 82  ? -40.148 -1.677  38.694 1.00 65.38  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 82  ? -38.774 -1.474  38.058 1.00 65.55  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 82  ? -37.711 -1.982  39.005 1.00 65.41  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 82  ? -38.664 -2.185  36.722 1.00 65.21  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 83  ? -42.871 -2.868  37.085 1.00 64.22  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1 83  ? -43.862 -3.902  37.197 1.00 63.68  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1 83  ? -43.139 -5.250  37.288 1.00 63.05  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1 83  ? -41.987 -5.395  36.843 1.00 62.76  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1 83  ? -44.829 -3.843  36.014 1.00 64.17  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 83  ? -45.367 -2.442  35.731 1.00 64.99  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 83  ? -46.161 -2.406  34.446 1.00 66.99  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 83  ? -47.571 -2.685  34.693 1.00 69.27  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 83  ? -48.456 -3.031  33.761 1.00 70.27  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 83  ? -48.086 -3.153  32.486 1.00 70.19  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 83  ? -49.721 -3.263  34.112 1.00 70.54  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 84  ? -43.829 -6.220  37.880 1.00 62.01  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1 84  ? -43.270 -7.515  38.214 1.00 60.79  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1 84  ? -44.131 -8.605  37.619 1.00 60.15  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1 84  ? -45.338 -8.641  37.863 1.00 60.37  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1 84  ? -43.243 -7.682  39.736 1.00 60.60  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 84  ? -41.944 -7.280  40.370 1.00 60.46  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 84  ? -41.667 -5.950  40.638 1.00 60.34  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 84  ? -40.994 -8.243  40.704 1.00 60.35  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 84  ? -40.457 -5.582  41.222 1.00 61.00  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 84  ? -39.781 -7.889  41.286 1.00 60.11  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 84  ? -39.511 -6.561  41.547 1.00 60.89  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 85  ? -43.526 -9.501  36.847 1.00 59.07  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1 85  ? -44.241 -10.687 36.414 1.00 58.16  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1 85  ? -44.689 -11.468 37.636 1.00 57.99  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1 85  ? -43.916 -11.648 38.577 1.00 58.02  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1 85  ? -43.363 -11.568 35.541 1.00 58.00  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 85  ? -43.275 -11.111 34.111 1.00 57.11  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 85  ? -42.692 -12.156 33.193 1.00 56.02  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 85  ? -42.388 -13.280 33.611 1.00 55.95  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 85  ? -42.532 -11.794 31.926 1.00 54.50  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1 86  ? -45.944 -11.907 37.621 1.00 57.73  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1 86  ? -46.501 -12.784 38.655 1.00 57.36  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1 86  ? -45.574 -13.948 38.982 1.00 57.01  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1 86  ? -45.384 -14.280 40.148 1.00 57.02  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1 86  ? -47.864 -13.319 38.213 1.00 57.45  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1 86  ? -48.048 -14.658 38.640 1.00 58.10  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1 87  ? -44.998 -14.566 37.953 1.00 56.56  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1 87  ? -44.077 -15.672 38.169 1.00 56.00  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1 87  ? -42.725 -15.232 38.746 1.00 55.89  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1 87  ? -42.116 -15.993 39.510 1.00 56.17  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1 87  ? -43.871 -16.464 36.888 1.00 55.81  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1 87  ? -42.869 -15.875 36.098 1.00 55.27  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1 88  ? -42.260 -14.028 38.387 1.00 55.12  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1 88  ? -40.995 -13.485 38.919 1.00 54.56  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1 88  ? -41.010 -13.313 40.425 1.00 54.30  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1 88  ? -40.032 -13.629 41.094 1.00 54.24  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1 88  ? -40.648 -12.177 38.269 1.00 54.60  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1 89  ? -42.118 -12.794 40.946 1.00 54.25  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1 89  ? -42.330 -12.662 42.382 1.00 54.08  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1 89  ? -42.279 -14.062 42.975 1.00 54.43  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1 89  ? -41.526 -14.336 43.916 1.00 54.31  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1 89  ? -43.693 -12.012 42.691 1.00 53.83  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 89  ? -43.922 -11.931 44.184 1.00 54.30  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 89  ? -43.786 -10.630 42.078 1.00 53.36  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1 90  ? -43.073 -14.947 42.385 1.00 54.94  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1 90  ? -43.087 -16.357 42.752 1.00 55.55  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1 90  ? -41.687 -16.975 42.827 1.00 54.88  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1 90  ? -41.345 -17.602 43.822 1.00 54.88  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1 90  ? -43.986 -17.146 41.794 1.00 56.19  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1 90  ? -45.464 -16.984 42.082 1.00 58.65  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1 90  ? -45.790 -17.298 43.828 1.00 64.66  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1 90  ? -45.556 -19.090 43.859 1.00 65.48  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1 91  ? -40.877 -16.787 41.790 1.00 54.21  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1 91  ? -39.505 -17.277 41.822 1.00 53.57  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1 91  ? -38.798 -16.782 43.093 1.00 53.32  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1 91  ? -38.271 -17.590 43.858 1.00 53.64  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1 91  ? -38.759 -16.867 40.578 1.00 53.14  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1 92  ? -38.844 -15.471 43.340 1.00 52.57  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1 92  ? -38.224 -14.870 44.521 1.00 51.81  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1 92  ? -38.684 -15.455 45.852 1.00 51.22  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1 92  ? -37.882 -15.605 46.768 1.00 51.06  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1 92  ? -38.460 -13.360 44.547 1.00 52.15  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 92  ? -37.590 -12.477 43.652 1.00 52.49  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 92  ? -38.205 -11.108 43.552 1.00 52.43  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 92  ? -36.162 -12.386 44.169 1.00 52.60  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 93  ? -39.968 -15.774 45.973 1.00 50.44  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1 93  ? -40.458 -16.310 47.238 1.00 49.78  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1 93  ? -39.971 -17.734 47.450 1.00 49.32  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1 93  ? -39.607 -18.132 48.570 1.00 49.09  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1 93  ? -41.982 -16.236 47.341 1.00 49.71  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 93  ? -42.464 -16.567 48.739 1.00 50.54  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 93  ? -43.942 -16.357 48.958 1.00 52.15  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 93  ? -44.610 -15.645 48.207 1.00 52.92  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 93  ? -44.464 -16.970 50.015 1.00 52.73  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 94  ? -39.968 -18.496 46.363 1.00 48.54  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1 94  ? -39.525 -19.859 46.407 1.00 48.08  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1 94  ? -38.089 -19.879 46.874 1.00 47.43  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1 94  ? -37.765 -20.573 47.836 1.00 47.75  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1 94  ? -39.658 -20.496 45.039 1.00 48.35  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 94  ? -41.069 -20.962 44.730 1.00 49.97  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 94  ? -41.472 -22.225 45.467 1.00 51.01  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 94  ? -42.688 -22.397 45.693 1.00 53.51  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 94  ? -40.597 -23.048 45.807 1.00 50.83  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 95  ? -37.253 -19.077 46.214 1.00 46.37  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1 95  ? -35.833 -18.948 46.535 1.00 45.25  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1 95  ? -35.601 -18.451 47.951 1.00 44.76  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1 95  ? -34.746 -18.982 48.662 1.00 44.93  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1 95  ? -35.153 -18.024 45.551 1.00 45.01  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1 96  ? -36.358 -17.434 48.358 1.00 43.78  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1 96  ? -36.170 -16.843 49.673 1.00 43.05  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1 96  ? -36.471 -17.829 50.774 1.00 42.82  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1 96  ? -35.697 -17.974 51.721 1.00 43.20  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1 96  ? -37.013 -15.590 49.839 1.00 42.79  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1 96  ? -36.430 -14.517 49.124 1.00 42.18  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1 97  ? -37.587 -18.530 50.633 1.00 42.49  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1 97  ? -38.026 -19.476 51.653 1.00 41.63  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1 97  ? -37.063 -20.659 51.722 1.00 40.69  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1 97  ? -36.671 -21.080 52.807 1.00 40.21  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1 97  ? -39.472 -19.915 51.393 1.00 41.60  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 97  ? -40.495 -18.791 51.576 1.00 42.28  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 97  ? -41.904 -19.303 51.887 1.00 43.65  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 97  ? -42.073 -20.520 52.103 1.00 44.43  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 97  ? -42.851 -18.491 51.923 1.00 44.01  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 98  ? -36.655 -21.154 50.557 1.00 39.96  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1 98  ? -35.691 -22.236 50.479 1.00 39.75  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1 98  ? -34.426 -21.812 51.218 1.00 40.03  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1 98  ? -33.917 -22.556 52.064 1.00 40.22  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1 98  ? -35.382 -22.573 49.028 1.00 39.39  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1 99  ? -33.951 -20.601 50.910 1.00 40.10  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1 99  ? -32.832 -19.990 51.599 1.00 39.92  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1 99  ? -33.078 -19.950 53.088 1.00 39.94  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1 99  ? -32.257 -20.437 53.860 1.00 40.21  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1 99  ? -32.562 -18.572 51.079 1.00 40.09  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 99  ? -31.606 -17.776 51.959 1.00 40.86  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 99  ? -30.228 -17.964 51.874 1.00 39.98  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 99  ? -32.092 -16.844 52.896 1.00 40.75  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 99  ? -29.347 -17.242 52.690 1.00 40.43  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 99  ? -31.229 -16.121 53.701 1.00 39.99  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 99  ? -29.856 -16.322 53.600 1.00 40.93  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 99  ? -28.989 -15.607 54.417 1.00 41.25  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1 100 ? -34.197 -19.364 53.500 1.00 39.90  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1 100 ? -34.446 -19.198 54.929 1.00 40.18  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1 100 ? -34.511 -20.528 55.665 1.00 40.25  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1 100 ? -33.895 -20.672 56.733 1.00 40.50  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1 100 ? -35.689 -18.346 55.207 1.00 39.92  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 100 ? -35.510 -16.829 55.061 1.00 40.13  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 100 ? -36.763 -16.103 55.481 1.00 39.48  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 100 ? -34.300 -16.277 55.830 1.00 39.15  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 101 ? -35.220 -21.498 55.080 1.00 39.78  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1 101 ? -35.403 -22.820 55.695 1.00 39.48  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1 101 ? -34.058 -23.491 55.982 1.00 39.63  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1 101 ? -33.873 -24.103 57.037 1.00 39.31  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1 101 ? -36.269 -23.766 54.818 1.00 39.42  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 101 ? -36.154 -25.183 55.324 1.00 39.51  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 101 ? -37.729 -23.331 54.804 1.00 38.07  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1 102 ? -33.125 -23.363 55.037 1.00 39.73  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1 102 ? -31.792 -23.922 55.181 1.00 39.84  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1 102 ? -31.011 -23.185 56.272 1.00 40.41  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1 102 ? -30.343 -23.799 57.111 1.00 40.90  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1 102 ? -31.073 -23.847 53.881 1.00 39.61  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1 103 ? -31.113 -21.864 56.276 1.00 40.63  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1 103 ? -30.430 -21.065 57.273 1.00 40.80  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1 103 ? -30.888 -21.438 58.674 1.00 41.43  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1 103 ? -30.094 -21.420 59.614 1.00 41.69  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1 103 ? -30.678 -19.587 57.022 1.00 40.70  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1 103 ? -29.956 -18.617 57.942 1.00 39.78  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1 103 ? -28.450 -18.821 57.841 1.00 39.03  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1 103 ? -30.363 -17.194 57.580 1.00 38.09  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1 104 ? -32.168 -21.777 58.817 1.00 41.78  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1 104 ? -32.660 -22.271 60.094 1.00 42.23  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1 104 ? -32.028 -23.632 60.450 1.00 42.84  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1 104 ? -31.723 -23.894 61.618 1.00 43.04  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1 104 ? -34.193 -22.316 60.131 1.00 41.74  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1 104 ? -34.832 -20.975 60.359 1.00 41.73  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1 104 ? -35.698 -20.433 59.425 1.00 41.36  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1 104 ? -34.558 -20.238 61.509 1.00 42.34  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1 104 ? -36.299 -19.183 59.635 1.00 39.56  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1 104 ? -35.141 -18.983 61.716 1.00 40.70  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1 104 ? -36.016 -18.464 60.774 1.00 39.97  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1 105 ? -31.797 -24.482 59.450 1.00 42.87  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1 105 ? -31.189 -25.773 59.727 1.00 43.01  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1 105 ? -29.799 -25.598 60.336 1.00 42.84  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1 105 ? -29.521 -26.156 61.402 1.00 43.14  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1 105 ? -31.148 -26.659 58.482 1.00 42.85  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1 105 ? -32.500 -26.954 57.893 1.00 44.30  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1 105 ? -32.409 -27.746 56.603 1.00 47.91  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1 105 ? -31.411 -28.496 56.473 1.00 50.85  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1 105 ? -33.318 -27.632 55.730 1.00 47.06  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1 106 ? -28.937 -24.816 59.689 1.00 42.50  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 106 ? -27.582 -24.620 60.211 1.00 42.64  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 106 ? -27.643 -23.856 61.530 1.00 42.27  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1 106 ? -26.863 -24.103 62.449 1.00 41.80  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 106 ? -26.699 -23.857 59.224 1.00 42.92  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 106 ? -26.747 -24.431 57.818 1.00 44.37  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 106 ? -27.227 -25.574 57.646 1.00 46.34  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 106 ? -26.314 -23.723 56.877 1.00 45.04  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1 107 ? -28.583 -22.920 61.606 1.00 42.13  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1 107 ? -28.814 -22.163 62.828 1.00 41.93  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1 107 ? -29.070 -23.133 63.972 1.00 41.69  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1 107 ? -28.391 -23.096 65.011 1.00 41.57  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1 107 ? -29.988 -21.186 62.654 1.00 41.75  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1 107 ? -29.617 -20.187 61.696 1.00 42.72  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 107 ? -30.321 -20.499 63.950 1.00 41.46  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1 108 ? -30.032 -24.022 63.749 1.00 41.32  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1 108 ? -30.384 -25.040 64.718 1.00 40.80  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1 108 ? -29.189 -25.901 65.084 1.00 40.34  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1 108 ? -28.965 -26.187 66.261 1.00 40.02  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1 108 ? -31.522 -25.899 64.196 1.00 41.01  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 108 ? -32.306 -26.530 65.297 1.00 41.63  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 108 ? -32.271 -26.064 66.429 1.00 42.85  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 108 ? -33.017 -27.608 64.984 1.00 43.73  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 109 ? -28.401 -26.287 64.087 1.00 39.86  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1 109 ? -27.152 -26.972 64.388 1.00 39.89  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1 109 ? -26.240 -26.170 65.333 1.00 39.88  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1 109 ? -25.673 -26.731 66.262 1.00 39.98  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1 109 ? -26.435 -27.390 63.115 1.00 39.70  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 109 ? -27.147 -28.537 62.390 1.00 40.00  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 109 ? -26.286 -29.082 61.282 1.00 40.13  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 109 ? -27.514 -29.661 63.342 1.00 39.56  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1 110 ? -26.154 -24.861 65.120 1.00 39.94  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1 110 ? -25.349 -23.978 65.948 1.00 40.05  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1 110 ? -25.864 -23.799 67.370 1.00 40.28  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1 110 ? -25.073 -23.639 68.304 1.00 40.16  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1 110 ? -25.233 -22.617 65.297 1.00 39.99  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1 110 ? -24.161 -22.615 63.894 1.00 41.11  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1 111 ? -27.183 -23.796 67.539 1.00 40.40  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1 111 ? -27.751 -23.776 68.878 1.00 40.23  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1 111 ? -27.356 -25.070 69.589 1.00 40.52  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1 111 ? -26.764 -25.039 70.657 1.00 41.30  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1 111 ? -29.227 -23.637 68.811 1.00 39.98  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1 112 ? -27.640 -26.207 68.972 1.00 40.47  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1 112 ? -27.285 -27.489 69.548 1.00 40.50  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1 112 ? -25.775 -27.614 69.805 1.00 40.77  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1 112 ? -25.341 -28.328 70.717 1.00 41.24  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1 112 ? -27.775 -28.642 68.657 1.00 40.57  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1 112 ? -29.282 -28.491 68.391 1.00 40.64  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1 112 ? -27.459 -29.996 69.296 1.00 40.02  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1 112 ? -29.838 -29.464 67.369 1.00 40.52  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1 113 ? -24.960 -26.916 69.029 1.00 40.44  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1 113 ? -23.542 -26.997 69.290 1.00 40.09  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1 113 ? -23.227 -26.378 70.644 1.00 40.56  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1 113 ? -22.303 -26.811 71.331 1.00 40.82  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1 113 ? -22.735 -26.321 68.199 1.00 39.67  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1 113 ? -21.259 -26.506 68.350 1.00 38.29  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1 113 ? -20.589 -27.587 67.824 1.00 37.10  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1 113 ? -20.322 -25.743 68.958 1.00 37.49  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1 113 ? -19.304 -27.486 68.107 1.00 36.63  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1 113 ? -19.116 -26.378 68.797 1.00 36.40  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1 114 ? -23.999 -25.366 71.021 1.00 40.93  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 114 ? -23.752 -24.637 72.255 1.00 41.51  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 114 ? -24.530 -25.263 73.417 1.00 42.18  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1 114 ? -24.704 -24.653 74.484 1.00 42.06  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 114 ? -24.099 -23.163 72.078 1.00 41.13  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1 115 ? -24.983 -26.496 73.195 1.00 42.92  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1 115 ? -25.737 -27.266 74.189 1.00 43.73  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1 115 ? -27.035 -26.577 74.609 1.00 43.28  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1 115 ? -27.419 -26.620 75.776 1.00 43.23  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1 115 ? -24.864 -27.610 75.410 1.00 43.55  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1 115 ? -23.702 -28.551 75.110 1.00 44.35  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1 115 ? -22.835 -28.737 76.353 1.00 45.27  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1 115 ? -21.891 -29.938 76.206 1.00 49.45  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1 115 ? -21.146 -30.256 77.481 1.00 50.26  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1 116 ? -27.697 -25.939 73.646 1.00 43.19  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1 116 ? -29.039 -25.376 73.851 1.00 43.07  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1 116 ? -30.072 -26.098 72.968 1.00 43.08  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1 116 ? -29.747 -27.042 72.253 1.00 43.26  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1 116 ? -29.039 -23.865 73.561 1.00 43.32  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1 116 ? -28.251 -23.009 74.563 1.00 42.60  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1 116 ? -28.249 -21.535 74.187 1.00 42.52  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1 116 ? -27.217 -21.168 73.208 1.00 41.53  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1 116 ? -27.455 -20.835 71.937 1.00 41.58  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1 116 ? -28.694 -20.820 71.455 1.00 41.27  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1 116 ? -26.451 -20.506 71.136 1.00 41.14  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1 117 ? -31.321 -25.666 73.030 1.00 43.19  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1 117 ? -32.340 -26.173 72.111 1.00 43.48  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1 117 ? -33.117 -25.008 71.534 1.00 43.67  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1 117 ? -34.048 -25.206 70.751 1.00 43.60  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1 117 ? -33.341 -27.157 72.780 1.00 43.53  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1 117 ? -32.688 -28.509 73.076 1.00 43.48  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1 117 ? -33.944 -26.556 74.031 1.00 43.91  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1 118 ? -32.714 -23.800 71.937 1.00 43.97  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1 118 ? -33.389 -22.566 71.573 1.00 44.24  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1 118 ? -32.511 -21.781 70.626 1.00 44.28  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1 118 ? -31.459 -21.296 71.024 1.00 44.63  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1 118 ? -33.646 -21.671 72.818 1.00 44.25  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 118 ? -33.970 -22.484 73.950 1.00 45.31  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 118 ? -34.785 -20.672 72.566 1.00 44.15  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1 119 ? -32.934 -21.633 69.377 1.00 44.49  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1 119 ? -32.173 -20.793 68.443 1.00 44.72  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1 119 ? -32.188 -19.304 68.850 1.00 45.15  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1 119 ? -33.127 -18.844 69.505 1.00 45.00  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1 119 ? -32.591 -20.997 66.967 1.00 44.39  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 119 ? -34.050 -20.602 66.745 1.00 43.68  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 119 ? -32.334 -22.426 66.559 1.00 43.95  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 119 ? -34.379 -20.305 65.302 1.00 43.24  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1 120 ? -31.130 -18.587 68.466 1.00 45.44  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1 120 ? -30.823 -17.240 68.959 1.00 45.86  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1 120 ? -30.009 -16.500 67.904 1.00 45.68  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1 120 ? -29.326 -17.139 67.118 1.00 45.75  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1 120 ? -29.984 -17.310 70.234 1.00 45.50  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1 120 ? -30.746 -17.606 71.479 1.00 45.48  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1 120 ? -29.643 -17.597 72.898 1.00 47.29  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1 120 ? -30.642 -18.493 74.096 1.00 46.87  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1 121 ? -30.046 -15.151 67.907 1.00 45.53  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1 121 ? -29.364 -14.395 66.867 1.00 45.22  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1 121 ? -27.881 -14.775 66.697 1.00 44.85  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1 121 ? -27.354 -14.736 65.571 1.00 44.82  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1 121 ? -29.504 -12.950 67.354 1.00 45.12  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 121 ? -30.770 -12.964 68.100 1.00 45.31  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 121 ? -30.706 -14.243 68.862 1.00 45.60  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1 122 ? -27.215 -15.153 67.785 1.00 43.66  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1 122 ? -25.823 -15.500 67.650 1.00 42.76  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1 122 ? -25.680 -16.757 66.794 1.00 42.49  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1 122 ? -24.782 -16.828 65.953 1.00 43.08  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1 122 ? -25.116 -15.600 68.999 1.00 42.71  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1 122 ? -25.769 -16.492 70.022 1.00 42.89  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1 122 ? -25.024 -16.424 71.330 1.00 43.31  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1 122 ? -25.773 -17.178 72.402 1.00 45.18  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1 122 ? -25.271 -16.848 73.758 1.00 46.20  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1 123 ? -26.593 -17.714 66.966 1.00 41.54  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1 123 ? -26.662 -18.894 66.101 1.00 40.45  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1 123 ? -26.821 -18.504 64.617 1.00 40.39  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1 123 ? -26.146 -19.071 63.760 1.00 40.57  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1 123 ? -27.797 -19.838 66.533 1.00 40.03  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1 123 ? -27.781 -20.167 68.041 1.00 39.71  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1 123 ? -26.698 -20.406 68.624 1.00 38.78  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1 123 ? -28.874 -20.216 68.651 1.00 38.59  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1 124 ? -27.682 -17.530 64.306 1.00 40.08  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1 124 ? -27.819 -17.063 62.913 1.00 40.22  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1 124 ? -26.546 -16.356 62.466 1.00 39.83  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1 124 ? -26.061 -16.548 61.362 1.00 39.17  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1 124 ? -29.054 -16.121 62.684 1.00 40.49  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1 124 ? -30.339 -16.745 63.233 1.00 41.17  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1 124 ? -29.262 -15.820 61.189 1.00 39.55  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1 124 ? -31.596 -15.922 62.961 1.00 40.60  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1 125 ? -26.004 -15.546 63.361 1.00 40.29  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1 125 ? -24.796 -14.778 63.098 1.00 40.51  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1 125 ? -23.599 -15.666 62.778 1.00 39.95  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1 125 ? -22.809 -15.357 61.882 1.00 39.92  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1 125 ? -24.500 -13.882 64.299 1.00 40.90  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 125 ? -25.220 -12.544 64.239 1.00 43.11  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 125 ? -25.590 -11.993 65.601 1.00 45.60  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 125 ? -24.931 -12.266 66.606 1.00 47.47  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 125 ? -26.652 -11.197 65.638 1.00 47.03  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1 126 ? -23.487 -16.772 63.511 1.00 39.17  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1 126 ? -22.403 -17.724 63.327 1.00 38.51  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1 126 ? -22.551 -18.511 62.040 1.00 38.21  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1 126 ? -21.573 -18.730 61.332 1.00 38.15  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1 126 ? -22.345 -18.687 64.498 1.00 38.28  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 126 ? -21.250 -19.733 64.455 1.00 37.89  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 126 ? -19.869 -19.103 64.503 1.00 37.74  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 126 ? -21.454 -20.652 65.618 1.00 37.11  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1 127 ? -23.772 -18.947 61.750 1.00 37.67  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1 127 ? -24.034 -19.638 60.507 1.00 37.27  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1 127 ? -23.654 -18.767 59.315 1.00 37.12  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1 127 ? -22.876 -19.191 58.455 1.00 36.92  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1 127 ? -25.470 -20.048 60.432 1.00 37.64  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1 128 ? -24.155 -17.535 59.286 1.00 37.04  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1 128 ? -23.901 -16.654 58.142 1.00 37.18  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1 128 ? -22.422 -16.333 57.964 1.00 37.56  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1 128 ? -21.932 -16.229 56.838 1.00 37.16  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1 128 ? -24.764 -15.405 58.203 1.00 36.81  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1 128 ? -26.236 -15.733 58.047 1.00 36.63  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1 128 ? -27.102 -14.525 57.823 1.00 36.25  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1 128 ? -26.646 -13.673 56.725 1.00 36.83  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1 128 ? -26.273 -12.407 56.893 1.00 37.37  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1 128 ? -26.301 -11.871 58.111 1.00 36.68  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1 128 ? -25.870 -11.676 55.857 1.00 36.51  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1 129 ? -21.717 -16.225 59.083 1.00 38.26  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1 129 ? -20.276 -15.990 59.084 1.00 39.34  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1 129 ? -19.473 -17.149 58.481 1.00 39.72  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1 129 ? -18.467 -16.935 57.795 1.00 39.47  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1 129 ? -19.806 -15.692 60.511 1.00 39.23  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1 129 ? -18.343 -15.874 60.760 1.00 40.51  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1 129 ? -17.460 -14.872 59.991 1.00 45.07  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1 129 ? -16.041 -15.196 60.178 1.00 46.88  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1 129 ? -15.437 -16.254 59.631 1.00 46.13  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1 129 ? -16.113 -17.082 58.834 1.00 44.78  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1 129 ? -14.156 -16.479 59.882 1.00 45.05  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1 130 ? -19.925 -18.371 58.746 1.00 40.37  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1 130 ? -19.184 -19.556 58.338 1.00 40.76  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1 130 ? -19.546 -19.858 56.901 1.00 41.22  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1 130 ? -18.750 -20.419 56.155 1.00 40.87  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1 130 ? -19.442 -20.730 59.290 1.00 40.43  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 130 ? -18.800 -20.424 60.629 1.00 40.93  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 130 ? -18.829 -22.002 58.784 1.00 40.30  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 130 ? -19.304 -21.277 61.735 1.00 43.35  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 131 ? -20.751 -19.444 56.523 1.00 42.17  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1 131 ? -21.218 -19.552 55.146 1.00 42.92  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1 131 ? -20.476 -18.566 54.233 1.00 43.80  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1 131 ? -20.465 -18.737 53.029 1.00 43.27  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1 131 ? -22.727 -19.301 55.093 1.00 42.49  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 131 ? -23.585 -20.541 55.219 1.00 41.52  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 131 ? -24.866 -20.191 55.938 1.00 41.56  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 131 ? -25.967 -21.139 55.758 1.00 41.24  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 131 ? -27.030 -20.908 54.984 1.00 42.46  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 131 ? -27.120 -19.773 54.297 1.00 41.84  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 131 ? -28.010 -21.808 54.887 1.00 42.44  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1 132 ? -19.857 -17.542 54.823 1.00 45.42  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1 132 ? -19.205 -16.480 54.060 1.00 47.31  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1 132 ? -20.140 -15.360 53.621 1.00 48.97  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1 132 ? -19.797 -14.564 52.737 1.00 49.60  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1 133 ? -21.323 -15.283 54.220 1.00 50.03  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1 133 ? -22.193 -14.138 53.996 1.00 51.44  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1 133 ? -21.758 -12.944 54.858 1.00 52.67  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1 133 ? -22.090 -11.797 54.546 1.00 53.05  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1 133 ? -23.648 -14.506 54.273 1.00 51.59  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1 133 ? -24.299 -15.364 53.195 1.00 51.90  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1 133 ? -25.386 -16.273 53.742 1.00 52.98  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1 133 ? -26.228 -15.805 54.545 1.00 52.90  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1 133 ? -25.394 -17.466 53.365 1.00 54.68  ? 133  GLU A OE2   1 
ATOM   792   N  N     . VAL B 2 21  ? -54.320 1.818   60.655 1.00 89.86  ? 21   VAL B N     1 
ATOM   793   C  CA    . VAL B 2 21  ? -53.266 1.021   61.355 1.00 89.69  ? 21   VAL B CA    1 
ATOM   794   C  C     . VAL B 2 21  ? -52.054 0.855   60.425 1.00 89.54  ? 21   VAL B C     1 
ATOM   795   O  O     . VAL B 2 21  ? -51.839 -0.221  59.848 1.00 89.58  ? 21   VAL B O     1 
ATOM   796   C  CB    . VAL B 2 21  ? -53.791 -0.379  61.830 1.00 89.74  ? 21   VAL B CB    1 
ATOM   797   C  CG1   . VAL B 2 21  ? -53.102 -0.800  63.128 1.00 89.64  ? 21   VAL B CG1   1 
ATOM   798   C  CG2   . VAL B 2 21  ? -55.318 -0.380  62.007 1.00 89.98  ? 21   VAL B CG2   1 
ATOM   799   N  N     . LEU B 2 22  ? -51.274 1.930   60.273 1.00 89.13  ? 22   LEU B N     1 
ATOM   800   C  CA    . LEU B 2 22  ? -50.073 1.909   59.417 1.00 88.65  ? 22   LEU B CA    1 
ATOM   801   C  C     . LEU B 2 22  ? -49.067 0.849   59.869 1.00 87.91  ? 22   LEU B C     1 
ATOM   802   O  O     . LEU B 2 22  ? -49.027 0.483   61.049 1.00 87.99  ? 22   LEU B O     1 
ATOM   803   C  CB    . LEU B 2 22  ? -49.400 3.293   59.337 1.00 88.69  ? 22   LEU B CB    1 
ATOM   804   C  CG    . LEU B 2 22  ? -49.305 4.266   60.526 1.00 89.10  ? 22   LEU B CG    1 
ATOM   805   C  CD1   . LEU B 2 22  ? -48.886 3.614   61.853 1.00 89.58  ? 22   LEU B CD1   1 
ATOM   806   C  CD2   . LEU B 2 22  ? -48.360 5.420   60.179 1.00 89.00  ? 22   LEU B CD2   1 
ATOM   807   N  N     . ARG B 2 23  ? -48.268 0.355   58.926 1.00 86.83  ? 23   ARG B N     1 
ATOM   808   C  CA    . ARG B 2 23  ? -47.282 -0.687  59.220 1.00 85.72  ? 23   ARG B CA    1 
ATOM   809   C  C     . ARG B 2 23  ? -46.152 -0.697  58.185 1.00 84.58  ? 23   ARG B C     1 
ATOM   810   O  O     . ARG B 2 23  ? -46.382 -0.411  57.003 1.00 84.47  ? 23   ARG B O     1 
ATOM   811   C  CB    . ARG B 2 23  ? -47.969 -2.064  59.305 1.00 85.84  ? 23   ARG B CB    1 
ATOM   812   C  CG    . ARG B 2 23  ? -47.125 -3.148  59.983 1.00 86.84  ? 23   ARG B CG    1 
ATOM   813   C  CD    . ARG B 2 23  ? -47.966 -4.116  60.820 1.00 88.17  ? 23   ARG B CD    1 
ATOM   814   N  NE    . ARG B 2 23  ? -48.337 -5.411  60.209 1.00 89.43  ? 23   ARG B NE    1 
ATOM   815   C  CZ    . ARG B 2 23  ? -48.258 -5.766  58.919 1.00 89.94  ? 23   ARG B CZ    1 
ATOM   816   N  NH1   . ARG B 2 23  ? -47.804 -4.937  57.979 1.00 90.48  ? 23   ARG B NH1   1 
ATOM   817   N  NH2   . ARG B 2 23  ? -48.646 -6.987  58.564 1.00 89.26  ? 23   ARG B NH2   1 
ATOM   818   N  N     . ASP B 2 24  ? -44.934 -1.006  58.639 1.00 83.10  ? 24   ASP B N     1 
ATOM   819   C  CA    . ASP B 2 24  ? -43.795 -1.232  57.734 1.00 81.43  ? 24   ASP B CA    1 
ATOM   820   C  C     . ASP B 2 24  ? -43.963 -2.540  56.972 1.00 79.76  ? 24   ASP B C     1 
ATOM   821   O  O     . ASP B 2 24  ? -44.556 -3.492  57.483 1.00 79.59  ? 24   ASP B O     1 
ATOM   822   C  CB    . ASP B 2 24  ? -42.473 -1.245  58.502 1.00 81.78  ? 24   ASP B CB    1 
ATOM   823   C  CG    . ASP B 2 24  ? -42.051 0.137   58.964 1.00 82.72  ? 24   ASP B CG    1 
ATOM   824   O  OD1   . ASP B 2 24  ? -41.733 0.992   58.101 1.00 83.29  ? 24   ASP B OD1   1 
ATOM   825   O  OD2   . ASP B 2 24  ? -42.032 0.363   60.196 1.00 83.75  ? 24   ASP B OD2   1 
ATOM   826   N  N     . ASN B 2 25  ? -43.444 -2.578  55.748 1.00 77.79  ? 25   ASN B N     1 
ATOM   827   C  CA    . ASN B 2 25  ? -43.588 -3.752  54.887 1.00 75.82  ? 25   ASN B CA    1 
ATOM   828   C  C     . ASN B 2 25  ? -42.799 -4.978  55.345 1.00 74.25  ? 25   ASN B C     1 
ATOM   829   O  O     . ASN B 2 25  ? -43.272 -6.108  55.229 1.00 73.99  ? 25   ASN B O     1 
ATOM   830   C  CB    . ASN B 2 25  ? -43.238 -3.400  53.446 1.00 76.06  ? 25   ASN B CB    1 
ATOM   831   C  CG    . ASN B 2 25  ? -44.379 -2.719  52.725 1.00 76.05  ? 25   ASN B CG    1 
ATOM   832   O  OD1   . ASN B 2 25  ? -45.543 -3.093  52.891 1.00 76.40  ? 25   ASN B OD1   1 
ATOM   833   N  ND2   . ASN B 2 25  ? -44.054 -1.721  51.911 1.00 75.52  ? 25   ASN B ND2   1 
ATOM   834   N  N     . ILE B 2 26  ? -41.601 -4.741  55.869 1.00 72.17  ? 26   ILE B N     1 
ATOM   835   C  CA    . ILE B 2 26  ? -40.785 -5.797  56.432 1.00 70.09  ? 26   ILE B CA    1 
ATOM   836   C  C     . ILE B 2 26  ? -41.454 -6.429  57.659 1.00 68.78  ? 26   ILE B C     1 
ATOM   837   O  O     . ILE B 2 26  ? -41.240 -7.608  57.950 1.00 68.85  ? 26   ILE B O     1 
ATOM   838   C  CB    . ILE B 2 26  ? -39.351 -5.297  56.751 1.00 70.15  ? 26   ILE B CB    1 
ATOM   839   C  CG1   . ILE B 2 26  ? -38.449 -6.446  57.218 1.00 69.88  ? 26   ILE B CG1   1 
ATOM   840   C  CG2   . ILE B 2 26  ? -39.370 -4.159  57.767 1.00 70.31  ? 26   ILE B CG2   1 
ATOM   841   C  CD1   . ILE B 2 26  ? -38.150 -7.465  56.138 1.00 69.87  ? 26   ILE B CD1   1 
ATOM   842   N  N     . GLN B 2 27  ? -42.275 -5.655  58.363 1.00 66.94  ? 27   GLN B N     1 
ATOM   843   C  CA    . GLN B 2 27  ? -43.009 -6.175  59.520 1.00 65.24  ? 27   GLN B CA    1 
ATOM   844   C  C     . GLN B 2 27  ? -44.180 -7.040  59.068 1.00 63.88  ? 27   GLN B C     1 
ATOM   845   O  O     . GLN B 2 27  ? -44.743 -7.804  59.859 1.00 63.50  ? 27   GLN B O     1 
ATOM   846   C  CB    . GLN B 2 27  ? -43.497 -5.042  60.415 1.00 65.27  ? 27   GLN B CB    1 
ATOM   847   C  CG    . GLN B 2 27  ? -42.388 -4.155  60.959 1.00 65.86  ? 27   GLN B CG    1 
ATOM   848   C  CD    . GLN B 2 27  ? -41.404 -4.897  61.844 1.00 66.95  ? 27   GLN B CD    1 
ATOM   849   O  OE1   . GLN B 2 27  ? -41.759 -5.853  62.541 1.00 66.42  ? 27   GLN B OE1   1 
ATOM   850   N  NE2   . GLN B 2 27  ? -40.153 -4.451  61.823 1.00 68.19  ? 27   GLN B NE2   1 
ATOM   851   N  N     . GLY B 2 28  ? -44.524 -6.912  57.787 1.00 62.24  ? 28   GLY B N     1 
ATOM   852   C  CA    . GLY B 2 28  ? -45.556 -7.722  57.161 1.00 60.43  ? 28   GLY B CA    1 
ATOM   853   C  C     . GLY B 2 28  ? -45.143 -9.173  57.089 1.00 59.24  ? 28   GLY B C     1 
ATOM   854   O  O     . GLY B 2 28  ? -45.996 -10.061 57.013 1.00 59.50  ? 28   GLY B O     1 
ATOM   855   N  N     . ILE B 2 29  ? -43.828 -9.405  57.082 1.00 57.70  ? 29   ILE B N     1 
ATOM   856   C  CA    . ILE B 2 29  ? -43.266 -10.732 57.282 1.00 55.93  ? 29   ILE B CA    1 
ATOM   857   C  C     . ILE B 2 29  ? -43.421 -10.992 58.770 1.00 55.04  ? 29   ILE B C     1 
ATOM   858   O  O     . ILE B 2 29  ? -42.651 -10.496 59.597 1.00 54.51  ? 29   ILE B O     1 
ATOM   859   C  CB    . ILE B 2 29  ? -41.777 -10.824 56.852 1.00 55.88  ? 29   ILE B CB    1 
ATOM   860   C  CG1   . ILE B 2 29  ? -41.571 -10.302 55.432 1.00 55.36  ? 29   ILE B CG1   1 
ATOM   861   C  CG2   . ILE B 2 29  ? -41.273 -12.253 56.966 1.00 55.66  ? 29   ILE B CG2   1 
ATOM   862   C  CD1   . ILE B 2 29  ? -42.407 -10.999 54.383 1.00 56.95  ? 29   ILE B CD1   1 
ATOM   863   N  N     . THR B 2 30  ? -44.447 -11.759 59.099 1.00 54.10  ? 30   THR B N     1 
ATOM   864   C  CA    . THR B 2 30  ? -44.938 -11.820 60.469 1.00 53.50  ? 30   THR B CA    1 
ATOM   865   C  C     . THR B 2 30  ? -44.279 -12.924 61.293 1.00 52.94  ? 30   THR B C     1 
ATOM   866   O  O     . THR B 2 30  ? -43.713 -13.864 60.744 1.00 52.70  ? 30   THR B O     1 
ATOM   867   C  CB    . THR B 2 30  ? -46.480 -11.978 60.486 1.00 53.53  ? 30   THR B CB    1 
ATOM   868   O  OG1   . THR B 2 30  ? -46.848 -13.238 59.900 1.00 53.41  ? 30   THR B OG1   1 
ATOM   869   C  CG2   . THR B 2 30  ? -47.145 -10.844 59.718 1.00 52.90  ? 30   THR B CG2   1 
ATOM   870   N  N     . LYS B 2 31  ? -44.359 -12.800 62.613 1.00 52.37  ? 31   LYS B N     1 
ATOM   871   C  CA    . LYS B 2 31  ? -43.891 -13.847 63.513 1.00 52.18  ? 31   LYS B CA    1 
ATOM   872   C  C     . LYS B 2 31  ? -44.422 -15.249 63.135 1.00 52.13  ? 31   LYS B C     1 
ATOM   873   O  O     . LYS B 2 31  ? -43.632 -16.169 62.921 1.00 52.09  ? 31   LYS B O     1 
ATOM   874   C  CB    . LYS B 2 31  ? -44.226 -13.487 64.960 1.00 52.03  ? 31   LYS B CB    1 
ATOM   875   C  CG    . LYS B 2 31  ? -44.060 -14.609 65.954 1.00 52.60  ? 31   LYS B CG    1 
ATOM   876   C  CD    . LYS B 2 31  ? -44.345 -14.093 67.345 1.00 55.06  ? 31   LYS B CD    1 
ATOM   877   C  CE    . LYS B 2 31  ? -43.928 -15.081 68.422 1.00 56.33  ? 31   LYS B CE    1 
ATOM   878   N  NZ    . LYS B 2 31  ? -44.139 -14.494 69.789 1.00 57.64  ? 31   LYS B NZ    1 
ATOM   879   N  N     . PRO B 2 32  ? -45.755 -15.417 63.023 1.00 52.16  ? 32   PRO B N     1 
ATOM   880   C  CA    . PRO B 2 32  ? -46.239 -16.775 62.749 1.00 51.93  ? 32   PRO B CA    1 
ATOM   881   C  C     . PRO B 2 32  ? -45.603 -17.404 61.509 1.00 51.82  ? 32   PRO B C     1 
ATOM   882   O  O     . PRO B 2 32  ? -45.288 -18.591 61.524 1.00 52.21  ? 32   PRO B O     1 
ATOM   883   C  CB    . PRO B 2 32  ? -47.738 -16.573 62.534 1.00 52.12  ? 32   PRO B CB    1 
ATOM   884   C  CG    . PRO B 2 32  ? -48.061 -15.311 63.285 1.00 52.31  ? 32   PRO B CG    1 
ATOM   885   C  CD    . PRO B 2 32  ? -46.864 -14.445 63.128 1.00 51.94  ? 32   PRO B CD    1 
ATOM   886   N  N     . ALA B 2 33  ? -45.412 -16.606 60.458 1.00 51.61  ? 33   ALA B N     1 
ATOM   887   C  CA    . ALA B 2 33  ? -44.757 -17.044 59.216 1.00 50.86  ? 33   ALA B CA    1 
ATOM   888   C  C     . ALA B 2 33  ? -43.313 -17.466 59.462 1.00 50.58  ? 33   ALA B C     1 
ATOM   889   O  O     . ALA B 2 33  ? -42.881 -18.527 59.007 1.00 50.90  ? 33   ALA B O     1 
ATOM   890   C  CB    . ALA B 2 33  ? -44.802 -15.938 58.187 1.00 50.43  ? 33   ALA B CB    1 
ATOM   891   N  N     . ILE B 2 34  ? -42.570 -16.632 60.183 1.00 49.96  ? 34   ILE B N     1 
ATOM   892   C  CA    . ILE B 2 34  ? -41.176 -16.919 60.485 1.00 49.35  ? 34   ILE B CA    1 
ATOM   893   C  C     . ILE B 2 34  ? -41.108 -18.162 61.363 1.00 49.43  ? 34   ILE B C     1 
ATOM   894   O  O     . ILE B 2 34  ? -40.206 -18.994 61.226 1.00 49.65  ? 34   ILE B O     1 
ATOM   895   C  CB    . ILE B 2 34  ? -40.479 -15.724 61.173 1.00 48.99  ? 34   ILE B CB    1 
ATOM   896   C  CG1   . ILE B 2 34  ? -40.426 -14.523 60.228 1.00 48.25  ? 34   ILE B CG1   1 
ATOM   897   C  CG2   . ILE B 2 34  ? -39.076 -16.095 61.585 1.00 49.00  ? 34   ILE B CG2   1 
ATOM   898   C  CD1   . ILE B 2 34  ? -40.137 -13.212 60.906 1.00 47.60  ? 34   ILE B CD1   1 
ATOM   899   N  N     . ARG B 2 35  ? -42.082 -18.297 62.250 1.00 49.26  ? 35   ARG B N     1 
ATOM   900   C  CA    . ARG B 2 35  ? -42.136 -19.453 63.119 1.00 49.33  ? 35   ARG B CA    1 
ATOM   901   C  C     . ARG B 2 35  ? -42.261 -20.730 62.273 1.00 48.95  ? 35   ARG B C     1 
ATOM   902   O  O     . ARG B 2 35  ? -41.548 -21.718 62.515 1.00 48.66  ? 35   ARG B O     1 
ATOM   903   C  CB    . ARG B 2 35  ? -43.274 -19.287 64.120 1.00 49.46  ? 35   ARG B CB    1 
ATOM   904   C  CG    . ARG B 2 35  ? -43.545 -20.488 65.002 1.00 51.47  ? 35   ARG B CG    1 
ATOM   905   C  CD    . ARG B 2 35  ? -44.477 -20.103 66.130 1.00 53.68  ? 35   ARG B CD    1 
ATOM   906   N  NE    . ARG B 2 35  ? -43.750 -19.447 67.210 1.00 54.91  ? 35   ARG B NE    1 
ATOM   907   C  CZ    . ARG B 2 35  ? -43.599 -19.972 68.421 1.00 56.57  ? 35   ARG B CZ    1 
ATOM   908   N  NH1   . ARG B 2 35  ? -44.141 -21.147 68.712 1.00 57.95  ? 35   ARG B NH1   1 
ATOM   909   N  NH2   . ARG B 2 35  ? -42.922 -19.318 69.352 1.00 57.63  ? 35   ARG B NH2   1 
ATOM   910   N  N     . ARG B 2 36  ? -43.134 -20.674 61.261 1.00 48.46  ? 36   ARG B N     1 
ATOM   911   C  CA    . ARG B 2 36  ? -43.389 -21.794 60.353 1.00 47.77  ? 36   ARG B CA    1 
ATOM   912   C  C     . ARG B 2 36  ? -42.154 -22.168 59.538 1.00 47.28  ? 36   ARG B C     1 
ATOM   913   O  O     . ARG B 2 36  ? -41.821 -23.353 59.394 1.00 47.58  ? 36   ARG B O     1 
ATOM   914   C  CB    . ARG B 2 36  ? -44.544 -21.464 59.420 1.00 47.97  ? 36   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2 36  ? -45.899 -21.398 60.106 1.00 48.68  ? 36   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2 36  ? -47.035 -21.425 59.081 1.00 49.39  ? 36   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2 36  ? -47.124 -20.186 58.326 1.00 51.10  ? 36   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2 36  ? -47.811 -19.118 58.724 1.00 52.75  ? 36   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2 36  ? -48.483 -19.138 59.875 1.00 53.04  ? 36   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2 36  ? -47.829 -18.026 57.970 1.00 52.44  ? 36   ARG B NH2   1 
ATOM   921   N  N     . LEU B 2 37  ? -41.471 -21.155 59.019 1.00 46.18  ? 37   LEU B N     1 
ATOM   922   C  CA    . LEU B 2 37  ? -40.201 -21.358 58.343 1.00 45.33  ? 37   LEU B CA    1 
ATOM   923   C  C     . LEU B 2 37  ? -39.218 -22.119 59.222 1.00 44.94  ? 37   LEU B C     1 
ATOM   924   O  O     . LEU B 2 37  ? -38.649 -23.127 58.812 1.00 45.03  ? 37   LEU B O     1 
ATOM   925   C  CB    . LEU B 2 37  ? -39.610 -20.016 57.924 1.00 45.27  ? 37   LEU B CB    1 
ATOM   926   C  CG    . LEU B 2 37  ? -40.314 -19.382 56.722 1.00 45.00  ? 37   LEU B CG    1 
ATOM   927   C  CD1   . LEU B 2 37  ? -39.952 -17.919 56.602 1.00 44.54  ? 37   LEU B CD1   1 
ATOM   928   C  CD2   . LEU B 2 37  ? -39.992 -20.132 55.434 1.00 43.68  ? 37   LEU B CD2   1 
ATOM   929   N  N     . ALA B 2 38  ? -39.033 -21.649 60.445 1.00 44.45  ? 38   ALA B N     1 
ATOM   930   C  CA    . ALA B 2 38  ? -38.135 -22.321 61.363 1.00 44.12  ? 38   ALA B CA    1 
ATOM   931   C  C     . ALA B 2 38  ? -38.549 -23.788 61.544 1.00 44.00  ? 38   ALA B C     1 
ATOM   932   O  O     . ALA B 2 38  ? -37.703 -24.676 61.726 1.00 43.37  ? 38   ALA B O     1 
ATOM   933   C  CB    . ALA B 2 38  ? -38.112 -21.592 62.686 1.00 43.65  ? 38   ALA B CB    1 
ATOM   934   N  N     . ARG B 2 39  ? -39.857 -24.033 61.474 1.00 44.03  ? 39   ARG B N     1 
ATOM   935   C  CA    . ARG B 2 39  ? -40.383 -25.358 61.753 1.00 44.24  ? 39   ARG B CA    1 
ATOM   936   C  C     . ARG B 2 39  ? -39.945 -26.298 60.669 1.00 44.00  ? 39   ARG B C     1 
ATOM   937   O  O     . ARG B 2 39  ? -39.386 -27.349 60.959 1.00 44.19  ? 39   ARG B O     1 
ATOM   938   C  CB    . ARG B 2 39  ? -41.901 -25.345 61.872 1.00 44.60  ? 39   ARG B CB    1 
ATOM   939   C  CG    . ARG B 2 39  ? -42.421 -24.682 63.135 1.00 45.51  ? 39   ARG B CG    1 
ATOM   940   C  CD    . ARG B 2 39  ? -42.051 -25.450 64.391 1.00 46.31  ? 39   ARG B CD    1 
ATOM   941   N  NE    . ARG B 2 39  ? -42.884 -25.026 65.506 1.00 47.46  ? 39   ARG B NE    1 
ATOM   942   C  CZ    . ARG B 2 39  ? -42.444 -24.374 66.572 1.00 49.69  ? 39   ARG B CZ    1 
ATOM   943   N  NH1   . ARG B 2 39  ? -41.160 -24.072 66.701 1.00 49.31  ? 39   ARG B NH1   1 
ATOM   944   N  NH2   . ARG B 2 39  ? -43.299 -24.032 67.525 1.00 52.47  ? 39   ARG B NH2   1 
ATOM   945   N  N     . ARG B 2 40  ? -40.174 -25.903 59.420 1.00 43.60  ? 40   ARG B N     1 
ATOM   946   C  CA    . ARG B 2 40  ? -39.661 -26.644 58.276 1.00 43.30  ? 40   ARG B CA    1 
ATOM   947   C  C     . ARG B 2 40  ? -38.167 -26.919 58.432 1.00 43.11  ? 40   ARG B C     1 
ATOM   948   O  O     . ARG B 2 40  ? -37.677 -27.965 58.009 1.00 43.21  ? 40   ARG B O     1 
ATOM   949   C  CB    . ARG B 2 40  ? -39.935 -25.870 56.990 1.00 43.48  ? 40   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2 40  ? -39.814 -26.693 55.717 1.00 43.11  ? 40   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2 40  ? -40.547 -26.035 54.574 1.00 42.19  ? 40   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2 40  ? -41.907 -26.540 54.455 1.00 43.27  ? 40   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2 40  ? -42.817 -26.058 53.614 1.00 44.34  ? 40   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2 40  ? -42.522 -25.032 52.824 1.00 44.15  ? 40   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2 40  ? -44.032 -26.596 53.570 1.00 44.25  ? 40   ARG B NH2   1 
ATOM   956   N  N     . GLY B 2 41  ? -37.456 -25.985 59.062 1.00 43.04  ? 41   GLY B N     1 
ATOM   957   C  CA    . GLY B 2 41  ? -36.037 -26.160 59.388 1.00 43.01  ? 41   GLY B CA    1 
ATOM   958   C  C     . GLY B 2 41  ? -35.758 -27.082 60.566 1.00 43.04  ? 41   GLY B C     1 
ATOM   959   O  O     . GLY B 2 41  ? -34.596 -27.360 60.886 1.00 43.10  ? 41   GLY B O     1 
ATOM   960   N  N     . GLY B 2 42  ? -36.820 -27.554 61.215 1.00 43.00  ? 42   GLY B N     1 
ATOM   961   C  CA    . GLY B 2 42  ? -36.694 -28.440 62.364 1.00 43.03  ? 42   GLY B CA    1 
ATOM   962   C  C     . GLY B 2 42  ? -36.350 -27.737 63.661 1.00 43.09  ? 42   GLY B C     1 
ATOM   963   O  O     . GLY B 2 42  ? -35.742 -28.327 64.548 1.00 42.96  ? 42   GLY B O     1 
ATOM   964   N  N     . VAL B 2 43  ? -36.746 -26.475 63.768 1.00 43.56  ? 43   VAL B N     1 
ATOM   965   C  CA    . VAL B 2 43  ? -36.505 -25.681 64.971 1.00 44.12  ? 43   VAL B CA    1 
ATOM   966   C  C     . VAL B 2 43  ? -37.654 -25.826 65.974 1.00 44.16  ? 43   VAL B C     1 
ATOM   967   O  O     . VAL B 2 43  ? -38.812 -25.619 65.643 1.00 43.84  ? 43   VAL B O     1 
ATOM   968   C  CB    . VAL B 2 43  ? -36.271 -24.190 64.610 1.00 44.22  ? 43   VAL B CB    1 
ATOM   969   C  CG1   . VAL B 2 43  ? -36.281 -23.312 65.849 1.00 44.60  ? 43   VAL B CG1   1 
ATOM   970   C  CG2   . VAL B 2 43  ? -34.956 -24.021 63.873 1.00 44.37  ? 43   VAL B CG2   1 
ATOM   971   N  N     . LYS B 2 44  ? -37.312 -26.156 67.209 1.00 45.06  ? 44   LYS B N     1 
ATOM   972   C  CA    . LYS B 2 44  ? -38.303 -26.486 68.240 1.00 46.11  ? 44   LYS B CA    1 
ATOM   973   C  C     . LYS B 2 44  ? -38.559 -25.328 69.196 1.00 46.16  ? 44   LYS B C     1 
ATOM   974   O  O     . LYS B 2 44  ? -39.678 -25.131 69.643 1.00 46.49  ? 44   LYS B O     1 
ATOM   975   C  CB    . LYS B 2 44  ? -37.833 -27.721 69.017 1.00 46.41  ? 44   LYS B CB    1 
ATOM   976   C  CG    . LYS B 2 44  ? -38.718 -28.182 70.156 1.00 48.15  ? 44   LYS B CG    1 
ATOM   977   C  CD    . LYS B 2 44  ? -37.908 -29.107 71.069 1.00 50.81  ? 44   LYS B CD    1 
ATOM   978   C  CE    . LYS B 2 44  ? -38.800 -29.957 71.964 1.00 51.66  ? 44   LYS B CE    1 
ATOM   979   N  NZ    . LYS B 2 44  ? -37.985 -30.898 72.788 1.00 52.19  ? 44   LYS B NZ    1 
ATOM   980   N  N     . ARG B 2 45  ? -37.517 -24.566 69.506 1.00 46.70  ? 45   ARG B N     1 
ATOM   981   C  CA    . ARG B 2 45  ? -37.634 -23.436 70.417 1.00 47.08  ? 45   ARG B CA    1 
ATOM   982   C  C     . ARG B 2 45  ? -36.914 -22.216 69.856 1.00 47.09  ? 45   ARG B C     1 
ATOM   983   O  O     . ARG B 2 45  ? -35.765 -22.320 69.416 1.00 46.42  ? 45   ARG B O     1 
ATOM   984   C  CB    . ARG B 2 45  ? -37.081 -23.796 71.790 1.00 47.38  ? 45   ARG B CB    1 
ATOM   985   C  CG    . ARG B 2 45  ? -37.839 -23.150 72.913 1.00 48.52  ? 45   ARG B CG    1 
ATOM   986   C  CD    . ARG B 2 45  ? -37.407 -23.696 74.262 1.00 52.01  ? 45   ARG B CD    1 
ATOM   987   N  NE    . ARG B 2 45  ? -37.923 -22.844 75.329 1.00 54.86  ? 45   ARG B NE    1 
ATOM   988   C  CZ    . ARG B 2 45  ? -37.208 -21.930 75.981 1.00 56.59  ? 45   ARG B CZ    1 
ATOM   989   N  NH1   . ARG B 2 45  ? -35.919 -21.755 75.709 1.00 56.62  ? 45   ARG B NH1   1 
ATOM   990   N  NH2   . ARG B 2 45  ? -37.786 -21.196 76.922 1.00 58.38  ? 45   ARG B NH2   1 
ATOM   991   N  N     . ILE B 2 46  ? -37.595 -21.063 69.920 1.00 47.25  ? 46   ILE B N     1 
ATOM   992   C  CA    . ILE B 2 46  ? -37.221 -19.856 69.178 1.00 47.13  ? 46   ILE B CA    1 
ATOM   993   C  C     . ILE B 2 46  ? -37.144 -18.610 70.082 1.00 47.86  ? 46   ILE B C     1 
ATOM   994   O  O     . ILE B 2 46  ? -38.162 -18.114 70.557 1.00 48.17  ? 46   ILE B O     1 
ATOM   995   C  CB    . ILE B 2 46  ? -38.231 -19.625 68.017 1.00 46.84  ? 46   ILE B CB    1 
ATOM   996   C  CG1   . ILE B 2 46  ? -38.255 -20.832 67.076 1.00 46.09  ? 46   ILE B CG1   1 
ATOM   997   C  CG2   . ILE B 2 46  ? -37.910 -18.374 67.244 1.00 46.68  ? 46   ILE B CG2   1 
ATOM   998   C  CD1   . ILE B 2 46  ? -39.443 -20.864 66.128 1.00 46.67  ? 46   ILE B CD1   1 
ATOM   999   N  N     . SER B 2 47  ? -35.937 -18.102 70.318 1.00 48.63  ? 47   SER B N     1 
ATOM   1000  C  CA    . SER B 2 47  ? -35.764 -16.881 71.120 1.00 49.15  ? 47   SER B CA    1 
ATOM   1001  C  C     . SER B 2 47  ? -36.485 -15.709 70.482 1.00 49.42  ? 47   SER B C     1 
ATOM   1002  O  O     . SER B 2 47  ? -36.510 -15.594 69.260 1.00 49.54  ? 47   SER B O     1 
ATOM   1003  C  CB    . SER B 2 47  ? -34.291 -16.538 71.313 1.00 49.24  ? 47   SER B CB    1 
ATOM   1004  O  OG    . SER B 2 47  ? -34.112 -15.168 71.640 1.00 50.46  ? 47   SER B OG    1 
ATOM   1005  N  N     . GLY B 2 48  ? -37.044 -14.837 71.327 1.00 49.65  ? 48   GLY B N     1 
ATOM   1006  C  CA    . GLY B 2 48  ? -37.897 -13.739 70.899 1.00 49.45  ? 48   GLY B CA    1 
ATOM   1007  C  C     . GLY B 2 48  ? -37.220 -12.778 69.956 1.00 50.08  ? 48   GLY B C     1 
ATOM   1008  O  O     . GLY B 2 48  ? -37.892 -12.026 69.243 1.00 50.36  ? 48   GLY B O     1 
ATOM   1009  N  N     . LEU B 2 49  ? -35.888 -12.797 69.944 1.00 50.16  ? 49   LEU B N     1 
ATOM   1010  C  CA    . LEU B 2 49  ? -35.122 -11.864 69.127 1.00 50.33  ? 49   LEU B CA    1 
ATOM   1011  C  C     . LEU B 2 49  ? -34.849 -12.396 67.709 1.00 50.56  ? 49   LEU B C     1 
ATOM   1012  O  O     . LEU B 2 49  ? -34.204 -11.715 66.900 1.00 50.91  ? 49   LEU B O     1 
ATOM   1013  C  CB    . LEU B 2 49  ? -33.811 -11.502 69.823 1.00 50.45  ? 49   LEU B CB    1 
ATOM   1014  C  CG    . LEU B 2 49  ? -33.858 -10.872 71.222 1.00 50.91  ? 49   LEU B CG    1 
ATOM   1015  C  CD1   . LEU B 2 49  ? -32.700 -11.386 72.071 1.00 51.05  ? 49   LEU B CD1   1 
ATOM   1016  C  CD2   . LEU B 2 49  ? -33.844 -9.351  71.154 1.00 50.36  ? 49   LEU B CD2   1 
ATOM   1017  N  N     . ILE B 2 50  ? -35.345 -13.597 67.407 1.00 50.26  ? 50   ILE B N     1 
ATOM   1018  C  CA    . ILE B 2 50  ? -35.114 -14.229 66.103 1.00 49.99  ? 50   ILE B CA    1 
ATOM   1019  C  C     . ILE B 2 50  ? -35.857 -13.491 64.994 1.00 49.89  ? 50   ILE B C     1 
ATOM   1020  O  O     . ILE B 2 50  ? -35.337 -13.328 63.884 1.00 49.99  ? 50   ILE B O     1 
ATOM   1021  C  CB    . ILE B 2 50  ? -35.509 -15.743 66.108 1.00 49.97  ? 50   ILE B CB    1 
ATOM   1022  C  CG1   . ILE B 2 50  ? -34.473 -16.591 66.860 1.00 50.34  ? 50   ILE B CG1   1 
ATOM   1023  C  CG2   . ILE B 2 50  ? -35.693 -16.287 64.702 1.00 49.78  ? 50   ILE B CG2   1 
ATOM   1024  C  CD1   . ILE B 2 50  ? -33.165 -16.843 66.107 1.00 51.19  ? 50   ILE B CD1   1 
ATOM   1025  N  N     . TYR B 2 51  ? -37.057 -13.017 65.316 1.00 49.63  ? 51   TYR B N     1 
ATOM   1026  C  CA    . TYR B 2 51  ? -37.959 -12.454 64.318 1.00 49.28  ? 51   TYR B CA    1 
ATOM   1027  C  C     . TYR B 2 51  ? -37.410 -11.172 63.714 1.00 49.29  ? 51   TYR B C     1 
ATOM   1028  O  O     . TYR B 2 51  ? -37.567 -10.930 62.513 1.00 49.24  ? 51   TYR B O     1 
ATOM   1029  C  CB    . TYR B 2 51  ? -39.379 -12.293 64.887 1.00 49.22  ? 51   TYR B CB    1 
ATOM   1030  C  CG    . TYR B 2 51  ? -39.814 -13.525 65.655 1.00 48.72  ? 51   TYR B CG    1 
ATOM   1031  C  CD1   . TYR B 2 51  ? -40.241 -14.678 64.995 1.00 47.78  ? 51   TYR B CD1   1 
ATOM   1032  C  CD2   . TYR B 2 51  ? -39.735 -13.556 67.037 1.00 47.57  ? 51   TYR B CD2   1 
ATOM   1033  C  CE1   . TYR B 2 51  ? -40.606 -15.817 65.708 1.00 47.84  ? 51   TYR B CE1   1 
ATOM   1034  C  CE2   . TYR B 2 51  ? -40.088 -14.682 67.750 1.00 47.98  ? 51   TYR B CE2   1 
ATOM   1035  C  CZ    . TYR B 2 51  ? -40.529 -15.812 67.094 1.00 48.28  ? 51   TYR B CZ    1 
ATOM   1036  O  OH    . TYR B 2 51  ? -40.880 -16.930 67.845 1.00 48.72  ? 51   TYR B OH    1 
ATOM   1037  N  N     . GLU B 2 52  ? -36.733 -10.367 64.525 1.00 49.23  ? 52   GLU B N     1 
ATOM   1038  C  CA    . GLU B 2 52  ? -36.078 -9.187  63.968 1.00 49.23  ? 52   GLU B CA    1 
ATOM   1039  C  C     . GLU B 2 52  ? -34.798 -9.546  63.218 1.00 48.49  ? 52   GLU B C     1 
ATOM   1040  O  O     . GLU B 2 52  ? -34.583 -9.046  62.125 1.00 49.00  ? 52   GLU B O     1 
ATOM   1041  C  CB    . GLU B 2 52  ? -35.855 -8.084  65.010 1.00 49.52  ? 52   GLU B CB    1 
ATOM   1042  C  CG    . GLU B 2 52  ? -37.097 -7.250  65.296 1.00 51.42  ? 52   GLU B CG    1 
ATOM   1043  C  CD    . GLU B 2 52  ? -37.587 -6.463  64.076 1.00 54.68  ? 52   GLU B CD    1 
ATOM   1044  O  OE1   . GLU B 2 52  ? -36.976 -5.419  63.746 1.00 55.43  ? 52   GLU B OE1   1 
ATOM   1045  O  OE2   . GLU B 2 52  ? -38.591 -6.888  63.453 1.00 55.63  ? 52   GLU B OE2   1 
ATOM   1046  N  N     . GLU B 2 53  ? -33.967 -10.421 63.777 1.00 47.65  ? 53   GLU B N     1 
ATOM   1047  C  CA    . GLU B 2 53  ? -32.787 -10.915 63.047 1.00 46.75  ? 53   GLU B CA    1 
ATOM   1048  C  C     . GLU B 2 53  ? -33.189 -11.501 61.675 1.00 45.96  ? 53   GLU B C     1 
ATOM   1049  O  O     . GLU B 2 53  ? -32.575 -11.185 60.643 1.00 45.48  ? 53   GLU B O     1 
ATOM   1050  C  CB    . GLU B 2 53  ? -32.026 -11.951 63.881 1.00 46.55  ? 53   GLU B CB    1 
ATOM   1051  C  CG    . GLU B 2 53  ? -30.594 -12.210 63.455 1.00 47.00  ? 53   GLU B CG    1 
ATOM   1052  C  CD    . GLU B 2 53  ? -29.626 -11.082 63.832 1.00 49.42  ? 53   GLU B CD    1 
ATOM   1053  O  OE1   . GLU B 2 53  ? -29.814 -10.437 64.894 1.00 49.13  ? 53   GLU B OE1   1 
ATOM   1054  O  OE2   . GLU B 2 53  ? -28.663 -10.848 63.058 1.00 49.61  ? 53   GLU B OE2   1 
ATOM   1055  N  N     . THR B 2 54  ? -34.247 -12.312 61.669 1.00 44.92  ? 54   THR B N     1 
ATOM   1056  C  CA    . THR B 2 54  ? -34.686 -12.992 60.446 1.00 44.15  ? 54   THR B CA    1 
ATOM   1057  C  C     . THR B 2 54  ? -35.081 -12.021 59.347 1.00 43.56  ? 54   THR B C     1 
ATOM   1058  O  O     . THR B 2 54  ? -34.659 -12.176 58.201 1.00 43.37  ? 54   THR B O     1 
ATOM   1059  C  CB    . THR B 2 54  ? -35.816 -14.004 60.723 1.00 44.24  ? 54   THR B CB    1 
ATOM   1060  O  OG1   . THR B 2 54  ? -35.356 -14.961 61.693 1.00 44.33  ? 54   THR B OG1   1 
ATOM   1061  C  CG2   . THR B 2 54  ? -36.220 -14.737 59.445 1.00 43.21  ? 54   THR B CG2   1 
ATOM   1062  N  N     . ARG B 2 55  ? -35.874 -11.015 59.706 1.00 43.03  ? 55   ARG B N     1 
ATOM   1063  C  CA    . ARG B 2 55  ? -36.241 -9.942  58.780 1.00 42.15  ? 55   ARG B CA    1 
ATOM   1064  C  C     . ARG B 2 55  ? -34.995 -9.207  58.294 1.00 41.28  ? 55   ARG B C     1 
ATOM   1065  O  O     . ARG B 2 55  ? -34.866 -8.902  57.105 1.00 40.95  ? 55   ARG B O     1 
ATOM   1066  C  CB    . ARG B 2 55  ? -37.226 -8.976  59.430 1.00 42.23  ? 55   ARG B CB    1 
ATOM   1067  C  CG    . ARG B 2 55  ? -38.564 -9.605  59.801 1.00 42.77  ? 55   ARG B CG    1 
ATOM   1068  C  CD    . ARG B 2 55  ? -39.522 -8.570  60.405 1.00 42.90  ? 55   ARG B CD    1 
ATOM   1069  N  NE    . ARG B 2 55  ? -40.749 -9.180  60.920 1.00 41.87  ? 55   ARG B NE    1 
ATOM   1070  C  CZ    . ARG B 2 55  ? -40.998 -9.401  62.208 1.00 41.20  ? 55   ARG B CZ    1 
ATOM   1071  N  NH1   . ARG B 2 55  ? -40.118 -9.058  63.148 1.00 40.95  ? 55   ARG B NH1   1 
ATOM   1072  N  NH2   . ARG B 2 55  ? -42.136 -9.973  62.557 1.00 40.77  ? 55   ARG B NH2   1 
ATOM   1073  N  N     . GLY B 2 56  ? -34.063 -8.955  59.203 1.00 40.45  ? 56   GLY B N     1 
ATOM   1074  C  CA    . GLY B 2 56  ? -32.764 -8.407  58.806 1.00 40.32  ? 56   GLY B CA    1 
ATOM   1075  C  C     . GLY B 2 56  ? -32.112 -9.162  57.644 1.00 39.65  ? 56   GLY B C     1 
ATOM   1076  O  O     . GLY B 2 56  ? -31.814 -8.579  56.587 1.00 39.73  ? 56   GLY B O     1 
ATOM   1077  N  N     . VAL B 2 57  ? -31.929 -10.464 57.856 1.00 38.64  ? 57   VAL B N     1 
ATOM   1078  C  CA    . VAL B 2 57  ? -31.304 -11.377 56.913 1.00 37.61  ? 57   VAL B CA    1 
ATOM   1079  C  C     . VAL B 2 57  ? -32.089 -11.442 55.611 1.00 37.61  ? 57   VAL B C     1 
ATOM   1080  O  O     . VAL B 2 57  ? -31.502 -11.452 54.522 1.00 37.64  ? 57   VAL B O     1 
ATOM   1081  C  CB    . VAL B 2 57  ? -31.184 -12.815 57.541 1.00 37.54  ? 57   VAL B CB    1 
ATOM   1082  C  CG1   . VAL B 2 57  ? -31.025 -13.880 56.480 1.00 36.72  ? 57   VAL B CG1   1 
ATOM   1083  C  CG2   . VAL B 2 57  ? -30.042 -12.902 58.569 1.00 36.24  ? 57   VAL B CG2   1 
ATOM   1084  N  N     . LEU B 2 58  ? -33.413 -11.483 55.715 1.00 37.37  ? 58   LEU B N     1 
ATOM   1085  C  CA    . LEU B 2 58  ? -34.244 -11.646 54.535 1.00 37.69  ? 58   LEU B CA    1 
ATOM   1086  C  C     . LEU B 2 58  ? -34.182 -10.424 53.618 1.00 38.45  ? 58   LEU B C     1 
ATOM   1087  O  O     . LEU B 2 58  ? -34.225 -10.542 52.381 1.00 38.52  ? 58   LEU B O     1 
ATOM   1088  C  CB    . LEU B 2 58  ? -35.674 -11.936 54.949 1.00 37.52  ? 58   LEU B CB    1 
ATOM   1089  C  CG    . LEU B 2 58  ? -36.765 -11.831 53.890 1.00 36.95  ? 58   LEU B CG    1 
ATOM   1090  C  CD1   . LEU B 2 58  ? -36.463 -12.674 52.671 1.00 36.50  ? 58   LEU B CD1   1 
ATOM   1091  C  CD2   . LEU B 2 58  ? -38.082 -12.239 54.510 1.00 36.67  ? 58   LEU B CD2   1 
ATOM   1092  N  N     . LYS B 2 59  ? -34.081 -9.251  54.231 1.00 38.79  ? 59   LYS B N     1 
ATOM   1093  C  CA    . LYS B 2 59  ? -34.001 -8.017  53.484 1.00 39.45  ? 59   LYS B CA    1 
ATOM   1094  C  C     . LYS B 2 59  ? -32.672 -7.963  52.741 1.00 39.16  ? 59   LYS B C     1 
ATOM   1095  O  O     . LYS B 2 59  ? -32.629 -7.516  51.588 1.00 39.44  ? 59   LYS B O     1 
ATOM   1096  C  CB    . LYS B 2 59  ? -34.196 -6.824  54.425 1.00 39.71  ? 59   LYS B CB    1 
ATOM   1097  C  CG    . LYS B 2 59  ? -34.083 -5.422  53.806 1.00 40.67  ? 59   LYS B CG    1 
ATOM   1098  C  CD    . LYS B 2 59  ? -34.512 -4.363  54.851 1.00 41.21  ? 59   LYS B CD    1 
ATOM   1099  C  CE    . LYS B 2 59  ? -34.066 -2.932  54.492 1.00 44.33  ? 59   LYS B CE    1 
ATOM   1100  N  NZ    . LYS B 2 59  ? -32.711 -2.605  55.041 1.00 45.72  ? 59   LYS B NZ    1 
ATOM   1101  N  N     . VAL B 2 60  ? -31.603 -8.439  53.385 1.00 38.57  ? 60   VAL B N     1 
ATOM   1102  C  CA    . VAL B 2 60  ? -30.273 -8.434  52.775 1.00 38.11  ? 60   VAL B CA    1 
ATOM   1103  C  C     . VAL B 2 60  ? -30.241 -9.408  51.602 1.00 38.41  ? 60   VAL B C     1 
ATOM   1104  O  O     . VAL B 2 60  ? -29.679 -9.095  50.550 1.00 38.52  ? 60   VAL B O     1 
ATOM   1105  C  CB    . VAL B 2 60  ? -29.166 -8.768  53.791 1.00 38.09  ? 60   VAL B CB    1 
ATOM   1106  C  CG1   . VAL B 2 60  ? -27.901 -9.209  53.082 1.00 38.03  ? 60   VAL B CG1   1 
ATOM   1107  C  CG2   . VAL B 2 60  ? -28.877 -7.576  54.690 1.00 37.47  ? 60   VAL B CG2   1 
ATOM   1108  N  N     . PHE B 2 61  ? -30.859 -10.575 51.785 1.00 38.48  ? 61   PHE B N     1 
ATOM   1109  C  CA    . PHE B 2 61  ? -31.014 -11.558 50.718 1.00 38.77  ? 61   PHE B CA    1 
ATOM   1110  C  C     . PHE B 2 61  ? -31.802 -10.984 49.548 1.00 39.35  ? 61   PHE B C     1 
ATOM   1111  O  O     . PHE B 2 61  ? -31.390 -11.108 48.388 1.00 39.47  ? 61   PHE B O     1 
ATOM   1112  C  CB    . PHE B 2 61  ? -31.722 -12.829 51.237 1.00 38.93  ? 61   PHE B CB    1 
ATOM   1113  C  CG    . PHE B 2 61  ? -31.903 -13.910 50.180 1.00 38.03  ? 61   PHE B CG    1 
ATOM   1114  C  CD1   . PHE B 2 61  ? -30.872 -14.790 49.879 1.00 36.32  ? 61   PHE B CD1   1 
ATOM   1115  C  CD2   . PHE B 2 61  ? -33.096 -14.032 49.484 1.00 37.33  ? 61   PHE B CD2   1 
ATOM   1116  C  CE1   . PHE B 2 61  ? -31.034 -15.767 48.903 1.00 36.93  ? 61   PHE B CE1   1 
ATOM   1117  C  CE2   . PHE B 2 61  ? -33.254 -15.014 48.493 1.00 37.15  ? 61   PHE B CE2   1 
ATOM   1118  C  CZ    . PHE B 2 61  ? -32.232 -15.874 48.210 1.00 36.78  ? 61   PHE B CZ    1 
ATOM   1119  N  N     . LEU B 2 62  ? -32.939 -10.361 49.842 1.00 39.95  ? 62   LEU B N     1 
ATOM   1120  C  CA    . LEU B 2 62  ? -33.767 -9.826  48.762 1.00 40.73  ? 62   LEU B CA    1 
ATOM   1121  C  C     . LEU B 2 62  ? -33.096 -8.668  48.028 1.00 41.22  ? 62   LEU B C     1 
ATOM   1122  O  O     . LEU B 2 62  ? -33.204 -8.565  46.802 1.00 41.30  ? 62   LEU B O     1 
ATOM   1123  C  CB    . LEU B 2 62  ? -35.178 -9.470  49.238 1.00 40.55  ? 62   LEU B CB    1 
ATOM   1124  C  CG    . LEU B 2 62  ? -36.107 -10.685 49.369 1.00 40.00  ? 62   LEU B CG    1 
ATOM   1125  C  CD1   . LEU B 2 62  ? -37.431 -10.279 49.986 1.00 40.28  ? 62   LEU B CD1   1 
ATOM   1126  C  CD2   . LEU B 2 62  ? -36.337 -11.371 48.045 1.00 37.66  ? 62   LEU B CD2   1 
ATOM   1127  N  N     . GLU B 2 63  ? -32.380 -7.825  48.773 1.00 41.57  ? 63   GLU B N     1 
ATOM   1128  C  CA    . GLU B 2 63  ? -31.643 -6.731  48.166 1.00 42.04  ? 63   GLU B CA    1 
ATOM   1129  C  C     . GLU B 2 63  ? -30.619 -7.291  47.200 1.00 42.40  ? 63   GLU B C     1 
ATOM   1130  O  O     . GLU B 2 63  ? -30.561 -6.864  46.040 1.00 42.74  ? 63   GLU B O     1 
ATOM   1131  C  CB    . GLU B 2 63  ? -30.951 -5.876  49.220 1.00 42.11  ? 63   GLU B CB    1 
ATOM   1132  C  CG    . GLU B 2 63  ? -31.887 -5.095  50.106 1.00 43.00  ? 63   GLU B CG    1 
ATOM   1133  C  CD    . GLU B 2 63  ? -31.172 -4.372  51.228 1.00 45.07  ? 63   GLU B CD    1 
ATOM   1134  O  OE1   . GLU B 2 63  ? -29.943 -4.546  51.372 1.00 45.98  ? 63   GLU B OE1   1 
ATOM   1135  O  OE2   . GLU B 2 63  ? -31.839 -3.620  51.972 1.00 46.43  ? 63   GLU B OE2   1 
ATOM   1136  N  N     . ASN B 2 64  ? -29.835 -8.270  47.662 1.00 42.53  ? 64   ASN B N     1 
ATOM   1137  C  CA    . ASN B 2 64  ? -28.769 -8.838  46.832 1.00 42.87  ? 64   ASN B CA    1 
ATOM   1138  C  C     . ASN B 2 64  ? -29.307 -9.480  45.564 1.00 43.08  ? 64   ASN B C     1 
ATOM   1139  O  O     . ASN B 2 64  ? -28.717 -9.331  44.489 1.00 43.42  ? 64   ASN B O     1 
ATOM   1140  C  CB    . ASN B 2 64  ? -27.901 -9.823  47.615 1.00 42.84  ? 64   ASN B CB    1 
ATOM   1141  C  CG    . ASN B 2 64  ? -27.041 -9.143  48.656 1.00 43.63  ? 64   ASN B CG    1 
ATOM   1142  O  OD1   . ASN B 2 64  ? -26.896 -7.920  48.655 1.00 46.10  ? 64   ASN B OD1   1 
ATOM   1143  N  ND2   . ASN B 2 64  ? -26.468 -9.928  49.559 1.00 43.47  ? 64   ASN B ND2   1 
ATOM   1144  N  N     . VAL B 2 65  ? -30.437 -10.171 45.688 1.00 43.07  ? 65   VAL B N     1 
ATOM   1145  C  CA    . VAL B 2 65  ? -31.003 -10.890 44.554 1.00 43.25  ? 65   VAL B CA    1 
ATOM   1146  C  C     . VAL B 2 65  ? -31.711 -9.940  43.584 1.00 43.45  ? 65   VAL B C     1 
ATOM   1147  O  O     . VAL B 2 65  ? -31.571 -10.080 42.356 1.00 43.36  ? 65   VAL B O     1 
ATOM   1148  C  CB    . VAL B 2 65  ? -31.936 -12.048 45.001 1.00 43.15  ? 65   VAL B CB    1 
ATOM   1149  C  CG1   . VAL B 2 65  ? -32.512 -12.747 43.813 1.00 42.46  ? 65   VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B 2 65  ? -31.168 -13.055 45.830 1.00 43.48  ? 65   VAL B CG2   1 
ATOM   1151  N  N     . ILE B 2 66  ? -32.451 -8.974  44.133 1.00 43.61  ? 66   ILE B N     1 
ATOM   1152  C  CA    . ILE B 2 66  ? -33.241 -8.061  43.305 1.00 43.68  ? 66   ILE B CA    1 
ATOM   1153  C  C     . ILE B 2 66  ? -32.343 -7.092  42.536 1.00 44.51  ? 66   ILE B C     1 
ATOM   1154  O  O     . ILE B 2 66  ? -32.461 -6.973  41.318 1.00 44.12  ? 66   ILE B O     1 
ATOM   1155  C  CB    . ILE B 2 66  ? -34.346 -7.344  44.116 1.00 43.38  ? 66   ILE B CB    1 
ATOM   1156  C  CG1   . ILE B 2 66  ? -35.455 -8.350  44.462 1.00 41.99  ? 66   ILE B CG1   1 
ATOM   1157  C  CG2   . ILE B 2 66  ? -34.919 -6.150  43.330 1.00 43.23  ? 66   ILE B CG2   1 
ATOM   1158  C  CD1   . ILE B 2 66  ? -36.385 -7.932  45.555 1.00 38.81  ? 66   ILE B CD1   1 
ATOM   1159  N  N     . ARG B 2 67  ? -31.423 -6.436  43.242 1.00 45.43  ? 67   ARG B N     1 
ATOM   1160  C  CA    . ARG B 2 67  ? -30.452 -5.555  42.603 1.00 46.68  ? 67   ARG B CA    1 
ATOM   1161  C  C     . ARG B 2 67  ? -29.934 -6.147  41.293 1.00 46.71  ? 67   ARG B C     1 
ATOM   1162  O  O     . ARG B 2 67  ? -29.845 -5.442  40.277 1.00 46.95  ? 67   ARG B O     1 
ATOM   1163  C  CB    . ARG B 2 67  ? -29.282 -5.276  43.543 1.00 46.45  ? 67   ARG B CB    1 
ATOM   1164  C  CG    . ARG B 2 67  ? -28.130 -4.509  42.901 1.00 47.44  ? 67   ARG B CG    1 
ATOM   1165  C  CD    . ARG B 2 67  ? -26.909 -4.470  43.823 1.00 49.09  ? 67   ARG B CD    1 
ATOM   1166  N  NE    . ARG B 2 67  ? -27.068 -3.530  44.944 1.00 54.58  ? 67   ARG B NE    1 
ATOM   1167  C  CZ    . ARG B 2 67  ? -27.140 -3.870  46.234 1.00 55.80  ? 67   ARG B CZ    1 
ATOM   1168  N  NH1   . ARG B 2 67  ? -27.070 -5.145  46.615 1.00 55.57  ? 67   ARG B NH1   1 
ATOM   1169  N  NH2   . ARG B 2 67  ? -27.280 -2.918  47.153 1.00 56.88  ? 67   ARG B NH2   1 
ATOM   1170  N  N     . ASP B 2 68  ? -29.605 -7.441  41.326 1.00 46.76  ? 68   ASP B N     1 
ATOM   1171  C  CA    . ASP B 2 68  ? -29.078 -8.135  40.158 1.00 46.74  ? 68   ASP B CA    1 
ATOM   1172  C  C     . ASP B 2 68  ? -30.169 -8.371  39.134 1.00 46.34  ? 68   ASP B C     1 
ATOM   1173  O  O     . ASP B 2 68  ? -29.963 -8.104  37.963 1.00 46.34  ? 68   ASP B O     1 
ATOM   1174  C  CB    . ASP B 2 68  ? -28.397 -9.456  40.539 1.00 46.96  ? 68   ASP B CB    1 
ATOM   1175  C  CG    . ASP B 2 68  ? -26.946 -9.277  40.975 1.00 47.73  ? 68   ASP B CG    1 
ATOM   1176  O  OD1   . ASP B 2 68  ? -26.545 -8.169  41.413 1.00 48.89  ? 68   ASP B OD1   1 
ATOM   1177  O  OD2   . ASP B 2 68  ? -26.199 -10.274 40.896 1.00 48.62  ? 68   ASP B OD2   1 
ATOM   1178  N  N     . ALA B 2 69  ? -31.326 -8.863  39.575 1.00 46.25  ? 69   ALA B N     1 
ATOM   1179  C  CA    . ALA B 2 69  ? -32.468 -9.107  38.669 1.00 46.16  ? 69   ALA B CA    1 
ATOM   1180  C  C     . ALA B 2 69  ? -32.854 -7.851  37.902 1.00 45.93  ? 69   ALA B C     1 
ATOM   1181  O  O     . ALA B 2 69  ? -33.010 -7.883  36.688 1.00 46.29  ? 69   ALA B O     1 
ATOM   1182  C  CB    . ALA B 2 69  ? -33.672 -9.639  39.433 1.00 46.15  ? 69   ALA B CB    1 
ATOM   1183  N  N     . VAL B 2 70  ? -32.992 -6.741  38.612 1.00 45.62  ? 70   VAL B N     1 
ATOM   1184  C  CA    . VAL B 2 70  ? -33.295 -5.479  37.967 1.00 45.27  ? 70   VAL B CA    1 
ATOM   1185  C  C     . VAL B 2 70  ? -32.176 -5.082  37.007 1.00 45.29  ? 70   VAL B C     1 
ATOM   1186  O  O     . VAL B 2 70  ? -32.447 -4.726  35.867 1.00 45.67  ? 70   VAL B O     1 
ATOM   1187  C  CB    . VAL B 2 70  ? -33.587 -4.373  38.979 1.00 45.11  ? 70   VAL B CB    1 
ATOM   1188  C  CG1   . VAL B 2 70  ? -33.694 -3.036  38.278 1.00 45.33  ? 70   VAL B CG1   1 
ATOM   1189  C  CG2   . VAL B 2 70  ? -34.865 -4.683  39.718 1.00 44.41  ? 70   VAL B CG2   1 
ATOM   1190  N  N     . THR B 2 71  ? -30.923 -5.161  37.440 1.00 45.06  ? 71   THR B N     1 
ATOM   1191  C  CA    . THR B 2 71  ? -29.820 -4.889  36.517 1.00 44.83  ? 71   THR B CA    1 
ATOM   1192  C  C     . THR B 2 71  ? -30.032 -5.651  35.220 1.00 44.94  ? 71   THR B C     1 
ATOM   1193  O  O     . THR B 2 71  ? -29.731 -5.143  34.151 1.00 45.01  ? 71   THR B O     1 
ATOM   1194  C  CB    . THR B 2 71  ? -28.468 -5.262  37.114 1.00 44.67  ? 71   THR B CB    1 
ATOM   1195  O  OG1   . THR B 2 71  ? -28.233 -4.446  38.262 1.00 45.74  ? 71   THR B OG1   1 
ATOM   1196  C  CG2   . THR B 2 71  ? -27.352 -5.046  36.117 1.00 43.29  ? 71   THR B CG2   1 
ATOM   1197  N  N     . TYR B 2 72  ? -30.568 -6.865  35.317 1.00 45.02  ? 72   TYR B N     1 
ATOM   1198  C  CA    . TYR B 2 72  ? -30.875 -7.630  34.120 1.00 45.43  ? 72   TYR B CA    1 
ATOM   1199  C  C     . TYR B 2 72  ? -32.042 -6.996  33.355 1.00 46.37  ? 72   TYR B C     1 
ATOM   1200  O  O     . TYR B 2 72  ? -31.978 -6.870  32.127 1.00 46.47  ? 72   TYR B O     1 
ATOM   1201  C  CB    . TYR B 2 72  ? -31.151 -9.092  34.440 1.00 44.34  ? 72   TYR B CB    1 
ATOM   1202  C  CG    . TYR B 2 72  ? -29.910 -9.938  34.600 1.00 43.43  ? 72   TYR B CG    1 
ATOM   1203  C  CD1   . TYR B 2 72  ? -29.647 -10.601 35.798 1.00 42.35  ? 72   TYR B CD1   1 
ATOM   1204  C  CD2   . TYR B 2 72  ? -29.012 -10.103 33.544 1.00 42.43  ? 72   TYR B CD2   1 
ATOM   1205  C  CE1   . TYR B 2 72  ? -28.521 -11.389 35.946 1.00 40.57  ? 72   TYR B CE1   1 
ATOM   1206  C  CE2   . TYR B 2 72  ? -27.891 -10.894 33.685 1.00 41.80  ? 72   TYR B CE2   1 
ATOM   1207  C  CZ    . TYR B 2 72  ? -27.655 -11.527 34.892 1.00 41.34  ? 72   TYR B CZ    1 
ATOM   1208  O  OH    . TYR B 2 72  ? -26.544 -12.296 35.042 1.00 41.84  ? 72   TYR B OH    1 
ATOM   1209  N  N     . THR B 2 73  ? -33.082 -6.583  34.088 1.00 47.11  ? 73   THR B N     1 
ATOM   1210  C  CA    . THR B 2 73  ? -34.205 -5.860  33.502 1.00 47.81  ? 73   THR B CA    1 
ATOM   1211  C  C     . THR B 2 73  ? -33.704 -4.667  32.696 1.00 48.97  ? 73   THR B C     1 
ATOM   1212  O  O     . THR B 2 73  ? -33.888 -4.623  31.477 1.00 49.46  ? 73   THR B O     1 
ATOM   1213  C  CB    . THR B 2 73  ? -35.185 -5.361  34.558 1.00 47.34  ? 73   THR B CB    1 
ATOM   1214  O  OG1   . THR B 2 73  ? -35.523 -6.434  35.441 1.00 47.07  ? 73   THR B OG1   1 
ATOM   1215  C  CG2   . THR B 2 73  ? -36.440 -4.850  33.894 1.00 46.82  ? 73   THR B CG2   1 
ATOM   1216  N  N     . GLU B 2 74  ? -33.056 -3.719  33.372 1.00 49.98  ? 74   GLU B N     1 
ATOM   1217  C  CA    . GLU B 2 74  ? -32.550 -2.504  32.727 1.00 51.19  ? 74   GLU B CA    1 
ATOM   1218  C  C     . GLU B 2 74  ? -31.750 -2.793  31.467 1.00 51.45  ? 74   GLU B C     1 
ATOM   1219  O  O     . GLU B 2 74  ? -31.936 -2.139  30.435 1.00 51.54  ? 74   GLU B O     1 
ATOM   1220  C  CB    . GLU B 2 74  ? -31.689 -1.687  33.683 1.00 51.46  ? 74   GLU B CB    1 
ATOM   1221  C  CG    . GLU B 2 74  ? -32.470 -0.751  34.561 1.00 53.63  ? 74   GLU B CG    1 
ATOM   1222  C  CD    . GLU B 2 74  ? -31.595 -0.097  35.607 1.00 57.38  ? 74   GLU B CD    1 
ATOM   1223  O  OE1   . GLU B 2 74  ? -31.057 0.995   35.304 1.00 60.43  ? 74   GLU B OE1   1 
ATOM   1224  O  OE2   . GLU B 2 74  ? -31.429 -0.673  36.712 1.00 57.28  ? 74   GLU B OE2   1 
ATOM   1225  N  N     . HIS B 2 75  ? -30.866 -3.778  31.536 1.00 51.54  ? 75   HIS B N     1 
ATOM   1226  C  CA    . HIS B 2 75  ? -30.121 -4.110  30.349 1.00 51.76  ? 75   HIS B CA    1 
ATOM   1227  C  C     . HIS B 2 75  ? -31.050 -4.369  29.159 1.00 52.16  ? 75   HIS B C     1 
ATOM   1228  O  O     . HIS B 2 75  ? -30.772 -3.945  28.041 1.00 52.07  ? 75   HIS B O     1 
ATOM   1229  C  CB    . HIS B 2 75  ? -29.199 -5.296  30.569 1.00 51.52  ? 75   HIS B CB    1 
ATOM   1230  C  CG    . HIS B 2 75  ? -28.210 -5.453  29.472 1.00 50.62  ? 75   HIS B CG    1 
ATOM   1231  N  ND1   . HIS B 2 75  ? -27.026 -4.756  29.446 1.00 50.21  ? 75   HIS B ND1   1 
ATOM   1232  C  CD2   . HIS B 2 75  ? -28.264 -6.157  28.318 1.00 51.05  ? 75   HIS B CD2   1 
ATOM   1233  C  CE1   . HIS B 2 75  ? -26.369 -5.057  28.339 1.00 52.33  ? 75   HIS B CE1   1 
ATOM   1234  N  NE2   . HIS B 2 75  ? -27.100 -5.906  27.636 1.00 51.49  ? 75   HIS B NE2   1 
ATOM   1235  N  N     . ALA B 2 76  ? -32.158 -5.055  29.416 1.00 52.83  ? 76   ALA B N     1 
ATOM   1236  C  CA    . ALA B 2 76  ? -33.062 -5.484  28.360 1.00 53.58  ? 76   ALA B CA    1 
ATOM   1237  C  C     . ALA B 2 76  ? -34.039 -4.369  27.979 1.00 54.23  ? 76   ALA B C     1 
ATOM   1238  O  O     . ALA B 2 76  ? -34.933 -4.569  27.151 1.00 54.24  ? 76   ALA B O     1 
ATOM   1239  C  CB    . ALA B 2 76  ? -33.801 -6.738  28.793 1.00 53.43  ? 76   ALA B CB    1 
ATOM   1240  N  N     . LYS B 2 77  ? -33.849 -3.197  28.589 1.00 54.94  ? 77   LYS B N     1 
ATOM   1241  C  CA    . LYS B 2 77  ? -34.718 -2.028  28.390 1.00 55.55  ? 77   LYS B CA    1 
ATOM   1242  C  C     . LYS B 2 77  ? -36.196 -2.374  28.633 1.00 55.65  ? 77   LYS B C     1 
ATOM   1243  O  O     . LYS B 2 77  ? -37.041 -2.180  27.758 1.00 55.93  ? 77   LYS B O     1 
ATOM   1244  C  CB    . LYS B 2 77  ? -34.520 -1.430  26.986 1.00 55.71  ? 77   LYS B CB    1 
ATOM   1245  C  CG    . LYS B 2 77  ? -33.064 -1.162  26.569 1.00 56.98  ? 77   LYS B CG    1 
ATOM   1246  C  CD    . LYS B 2 77  ? -32.962 -1.154  25.039 1.00 59.72  ? 77   LYS B CD    1 
ATOM   1247  C  CE    . LYS B 2 77  ? -31.531 -1.000  24.532 1.00 60.80  ? 77   LYS B CE    1 
ATOM   1248  N  NZ    . LYS B 2 77  ? -31.494 -1.179  23.042 1.00 61.72  ? 77   LYS B NZ    1 
ATOM   1249  N  N     . ARG B 2 78  ? -36.503 -2.905  29.812 1.00 55.57  ? 78   ARG B N     1 
ATOM   1250  C  CA    . ARG B 2 78  ? -37.879 -3.263  30.143 1.00 55.76  ? 78   ARG B CA    1 
ATOM   1251  C  C     . ARG B 2 78  ? -38.330 -2.519  31.392 1.00 56.01  ? 78   ARG B C     1 
ATOM   1252  O  O     . ARG B 2 78  ? -37.506 -2.086  32.192 1.00 56.41  ? 78   ARG B O     1 
ATOM   1253  C  CB    . ARG B 2 78  ? -38.028 -4.780  30.334 1.00 55.83  ? 78   ARG B CB    1 
ATOM   1254  C  CG    . ARG B 2 78  ? -37.778 -5.612  29.071 1.00 56.12  ? 78   ARG B CG    1 
ATOM   1255  C  CD    . ARG B 2 78  ? -38.151 -7.097  29.248 1.00 55.76  ? 78   ARG B CD    1 
ATOM   1256  N  NE    . ARG B 2 78  ? -37.020 -7.926  29.685 1.00 55.39  ? 78   ARG B NE    1 
ATOM   1257  C  CZ    . ARG B 2 78  ? -36.816 -8.338  30.939 1.00 54.75  ? 78   ARG B CZ    1 
ATOM   1258  N  NH1   . ARG B 2 78  ? -37.666 -8.020  31.909 1.00 54.64  ? 78   ARG B NH1   1 
ATOM   1259  N  NH2   . ARG B 2 78  ? -35.764 -9.082  31.226 1.00 53.68  ? 78   ARG B NH2   1 
ATOM   1260  N  N     . LYS B 2 79  ? -39.638 -2.351  31.553 1.00 56.12  ? 79   LYS B N     1 
ATOM   1261  C  CA    . LYS B 2 79  ? -40.181 -1.712  32.747 1.00 56.29  ? 79   LYS B CA    1 
ATOM   1262  C  C     . LYS B 2 79  ? -40.680 -2.802  33.678 1.00 55.51  ? 79   LYS B C     1 
ATOM   1263  O  O     . LYS B 2 79  ? -41.275 -2.520  34.727 1.00 55.62  ? 79   LYS B O     1 
ATOM   1264  C  CB    . LYS B 2 79  ? -41.319 -0.740  32.385 1.00 56.53  ? 79   LYS B CB    1 
ATOM   1265  C  CG    . LYS B 2 79  ? -40.872 0.513   31.610 1.00 57.92  ? 79   LYS B CG    1 
ATOM   1266  C  CD    . LYS B 2 79  ? -41.921 1.634   31.677 1.00 57.92  ? 79   LYS B CD    1 
ATOM   1267  C  CE    . LYS B 2 79  ? -41.288 2.997   31.310 1.00 61.12  ? 79   LYS B CE    1 
ATOM   1268  N  NZ    . LYS B 2 79  ? -42.271 4.139   31.174 1.00 60.86  ? 79   LYS B NZ    1 
ATOM   1269  N  N     . THR B 2 80  ? -40.408 -4.048  33.287 1.00 54.74  ? 80   THR B N     1 
ATOM   1270  C  CA    . THR B 2 80  ? -40.947 -5.235  33.954 1.00 53.90  ? 80   THR B CA    1 
ATOM   1271  C  C     . THR B 2 80  ? -39.869 -6.269  34.290 1.00 53.06  ? 80   THR B C     1 
ATOM   1272  O  O     . THR B 2 80  ? -39.114 -6.703  33.414 1.00 52.85  ? 80   THR B O     1 
ATOM   1273  C  CB    . THR B 2 80  ? -42.070 -5.874  33.089 1.00 53.97  ? 80   THR B CB    1 
ATOM   1274  O  OG1   . THR B 2 80  ? -43.292 -5.161  33.311 1.00 55.40  ? 80   THR B OG1   1 
ATOM   1275  C  CG2   . THR B 2 80  ? -42.292 -7.344  33.417 1.00 53.23  ? 80   THR B CG2   1 
ATOM   1276  N  N     . VAL B 2 81  ? -39.808 -6.658  35.564 1.00 52.01  ? 81   VAL B N     1 
ATOM   1277  C  CA    . VAL B 2 81  ? -38.915 -7.739  35.994 1.00 50.95  ? 81   VAL B CA    1 
ATOM   1278  C  C     . VAL B 2 81  ? -39.540 -9.071  35.601 1.00 50.31  ? 81   VAL B C     1 
ATOM   1279  O  O     . VAL B 2 81  ? -40.609 -9.428  36.103 1.00 50.25  ? 81   VAL B O     1 
ATOM   1280  C  CB    . VAL B 2 81  ? -38.658 -7.727  37.524 1.00 50.74  ? 81   VAL B CB    1 
ATOM   1281  C  CG1   . VAL B 2 81  ? -37.658 -8.807  37.899 1.00 50.32  ? 81   VAL B CG1   1 
ATOM   1282  C  CG2   . VAL B 2 81  ? -38.147 -6.381  37.970 1.00 50.44  ? 81   VAL B CG2   1 
ATOM   1283  N  N     . THR B 2 82  ? -38.879 -9.793  34.700 1.00 49.46  ? 82   THR B N     1 
ATOM   1284  C  CA    . THR B 2 82  ? -39.342 -11.116 34.285 1.00 48.44  ? 82   THR B CA    1 
ATOM   1285  C  C     . THR B 2 82  ? -38.750 -12.191 35.166 1.00 48.12  ? 82   THR B C     1 
ATOM   1286  O  O     . THR B 2 82  ? -37.629 -12.056 35.649 1.00 48.19  ? 82   THR B O     1 
ATOM   1287  C  CB    . THR B 2 82  ? -38.948 -11.440 32.843 1.00 48.32  ? 82   THR B CB    1 
ATOM   1288  O  OG1   . THR B 2 82  ? -37.519 -11.426 32.714 1.00 47.90  ? 82   THR B OG1   1 
ATOM   1289  C  CG2   . THR B 2 82  ? -39.559 -10.439 31.897 1.00 48.24  ? 82   THR B CG2   1 
ATOM   1290  N  N     . ALA B 2 83  ? -39.498 -13.277 35.344 1.00 47.49  ? 83   ALA B N     1 
ATOM   1291  C  CA    . ALA B 2 83  ? -39.038 -14.420 36.121 1.00 46.37  ? 83   ALA B CA    1 
ATOM   1292  C  C     . ALA B 2 83  ? -37.622 -14.819 35.761 1.00 45.81  ? 83   ALA B C     1 
ATOM   1293  O  O     . ALA B 2 83  ? -36.862 -15.186 36.650 1.00 45.87  ? 83   ALA B O     1 
ATOM   1294  C  CB    . ALA B 2 83  ? -39.964 -15.579 35.939 1.00 46.51  ? 83   ALA B CB    1 
ATOM   1295  N  N     . MET B 2 84  ? -37.275 -14.742 34.473 1.00 44.97  ? 84   MET B N     1 
ATOM   1296  C  CA    . MET B 2 84  ? -35.932 -15.064 34.014 1.00 44.60  ? 84   MET B CA    1 
ATOM   1297  C  C     . MET B 2 84  ? -34.898 -14.119 34.607 1.00 44.86  ? 84   MET B C     1 
ATOM   1298  O  O     . MET B 2 84  ? -33.805 -14.550 34.954 1.00 44.69  ? 84   MET B O     1 
ATOM   1299  C  CB    . MET B 2 84  ? -35.827 -15.045 32.495 1.00 44.33  ? 84   MET B CB    1 
ATOM   1300  C  CG    . MET B 2 84  ? -36.458 -16.227 31.798 1.00 44.49  ? 84   MET B CG    1 
ATOM   1301  S  SD    . MET B 2 84  ? -35.937 -17.864 32.376 1.00 47.70  ? 84   MET B SD    1 
ATOM   1302  C  CE    . MET B 2 84  ? -34.211 -17.906 31.856 1.00 44.12  ? 84   MET B CE    1 
ATOM   1303  N  N     . ASP B 2 85  ? -35.246 -12.839 34.739 1.00 45.10  ? 85   ASP B N     1 
ATOM   1304  C  CA    . ASP B 2 85  ? -34.359 -11.877 35.392 1.00 45.49  ? 85   ASP B CA    1 
ATOM   1305  C  C     . ASP B 2 85  ? -33.993 -12.383 36.775 1.00 45.21  ? 85   ASP B C     1 
ATOM   1306  O  O     . ASP B 2 85  ? -32.840 -12.314 37.187 1.00 45.61  ? 85   ASP B O     1 
ATOM   1307  C  CB    . ASP B 2 85  ? -35.012 -10.495 35.525 1.00 45.77  ? 85   ASP B CB    1 
ATOM   1308  C  CG    . ASP B 2 85  ? -35.149 -9.769  34.198 1.00 47.11  ? 85   ASP B CG    1 
ATOM   1309  O  OD1   . ASP B 2 85  ? -34.442 -10.126 33.221 1.00 48.62  ? 85   ASP B OD1   1 
ATOM   1310  O  OD2   . ASP B 2 85  ? -35.972 -8.828  34.142 1.00 47.64  ? 85   ASP B OD2   1 
ATOM   1311  N  N     . VAL B 2 86  ? -34.991 -12.887 37.485 1.00 44.74  ? 86   VAL B N     1 
ATOM   1312  C  CA    . VAL B 2 86  ? -34.807 -13.408 38.826 1.00 44.55  ? 86   VAL B CA    1 
ATOM   1313  C  C     . VAL B 2 86  ? -34.004 -14.715 38.785 1.00 44.26  ? 86   VAL B C     1 
ATOM   1314  O  O     . VAL B 2 86  ? -33.110 -14.926 39.608 1.00 44.53  ? 86   VAL B O     1 
ATOM   1315  C  CB    . VAL B 2 86  ? -36.173 -13.608 39.514 1.00 44.50  ? 86   VAL B CB    1 
ATOM   1316  C  CG1   . VAL B 2 86  ? -36.028 -14.321 40.825 1.00 45.01  ? 86   VAL B CG1   1 
ATOM   1317  C  CG2   . VAL B 2 86  ? -36.829 -12.267 39.736 1.00 44.73  ? 86   VAL B CG2   1 
ATOM   1318  N  N     . VAL B 2 87  ? -34.309 -15.567 37.812 1.00 43.45  ? 87   VAL B N     1 
ATOM   1319  C  CA    . VAL B 2 87  ? -33.654 -16.857 37.691 1.00 42.91  ? 87   VAL B CA    1 
ATOM   1320  C  C     . VAL B 2 87  ? -32.169 -16.667 37.406 1.00 42.71  ? 87   VAL B C     1 
ATOM   1321  O  O     . VAL B 2 87  ? -31.322 -17.354 37.974 1.00 42.80  ? 87   VAL B O     1 
ATOM   1322  C  CB    . VAL B 2 87  ? -34.347 -17.750 36.616 1.00 43.00  ? 87   VAL B CB    1 
ATOM   1323  C  CG1   . VAL B 2 87  ? -33.523 -18.996 36.311 1.00 42.69  ? 87   VAL B CG1   1 
ATOM   1324  C  CG2   . VAL B 2 87  ? -35.745 -18.171 37.087 1.00 42.73  ? 87   VAL B CG2   1 
ATOM   1325  N  N     . TYR B 2 88  ? -31.867 -15.719 36.533 1.00 42.57  ? 88   TYR B N     1 
ATOM   1326  C  CA    . TYR B 2 88  ? -30.503 -15.384 36.201 1.00 42.35  ? 88   TYR B CA    1 
ATOM   1327  C  C     . TYR B 2 88  ? -29.756 -14.778 37.390 1.00 41.79  ? 88   TYR B C     1 
ATOM   1328  O  O     . TYR B 2 88  ? -28.554 -15.017 37.564 1.00 41.91  ? 88   TYR B O     1 
ATOM   1329  C  CB    . TYR B 2 88  ? -30.483 -14.399 35.040 1.00 43.42  ? 88   TYR B CB    1 
ATOM   1330  C  CG    . TYR B 2 88  ? -30.888 -14.970 33.705 1.00 44.71  ? 88   TYR B CG    1 
ATOM   1331  C  CD1   . TYR B 2 88  ? -31.753 -14.275 32.871 1.00 46.56  ? 88   TYR B CD1   1 
ATOM   1332  C  CD2   . TYR B 2 88  ? -30.404 -16.195 33.270 1.00 46.54  ? 88   TYR B CD2   1 
ATOM   1333  C  CE1   . TYR B 2 88  ? -32.128 -14.781 31.641 1.00 46.48  ? 88   TYR B CE1   1 
ATOM   1334  C  CE2   . TYR B 2 88  ? -30.771 -16.715 32.041 1.00 47.05  ? 88   TYR B CE2   1 
ATOM   1335  C  CZ    . TYR B 2 88  ? -31.630 -15.993 31.231 1.00 46.55  ? 88   TYR B CZ    1 
ATOM   1336  O  OH    . TYR B 2 88  ? -31.995 -16.490 30.004 1.00 46.99  ? 88   TYR B OH    1 
ATOM   1337  N  N     . ALA B 2 89  ? -30.460 -13.984 38.194 1.00 40.89  ? 89   ALA B N     1 
ATOM   1338  C  CA    . ALA B 2 89  ? -29.874 -13.382 39.393 1.00 40.14  ? 89   ALA B CA    1 
ATOM   1339  C  C     . ALA B 2 89  ? -29.533 -14.484 40.374 1.00 39.80  ? 89   ALA B C     1 
ATOM   1340  O  O     . ALA B 2 89  ? -28.408 -14.540 40.892 1.00 39.99  ? 89   ALA B O     1 
ATOM   1341  C  CB    . ALA B 2 89  ? -30.837 -12.398 40.033 1.00 40.03  ? 89   ALA B CB    1 
ATOM   1342  N  N     . LEU B 2 90  ? -30.502 -15.366 40.614 1.00 38.81  ? 90   LEU B N     1 
ATOM   1343  C  CA    . LEU B 2 90  ? -30.302 -16.480 41.512 1.00 38.53  ? 90   LEU B CA    1 
ATOM   1344  C  C     . LEU B 2 90  ? -29.121 -17.360 41.078 1.00 39.14  ? 90   LEU B C     1 
ATOM   1345  O  O     . LEU B 2 90  ? -28.399 -17.913 41.923 1.00 38.89  ? 90   LEU B O     1 
ATOM   1346  C  CB    . LEU B 2 90  ? -31.581 -17.299 41.643 1.00 38.02  ? 90   LEU B CB    1 
ATOM   1347  C  CG    . LEU B 2 90  ? -32.700 -16.605 42.427 1.00 37.28  ? 90   LEU B CG    1 
ATOM   1348  C  CD1   . LEU B 2 90  ? -34.053 -17.237 42.173 1.00 35.33  ? 90   LEU B CD1   1 
ATOM   1349  C  CD2   . LEU B 2 90  ? -32.401 -16.527 43.913 1.00 35.40  ? 90   LEU B CD2   1 
ATOM   1350  N  N     . LYS B 2 91  ? -28.904 -17.466 39.769 1.00 39.41  ? 91   LYS B N     1 
ATOM   1351  C  CA    . LYS B 2 91  ? -27.827 -18.298 39.281 1.00 39.97  ? 91   LYS B CA    1 
ATOM   1352  C  C     . LYS B 2 91  ? -26.482 -17.700 39.662 1.00 40.41  ? 91   LYS B C     1 
ATOM   1353  O  O     . LYS B 2 91  ? -25.599 -18.419 40.133 1.00 40.66  ? 91   LYS B O     1 
ATOM   1354  C  CB    . LYS B 2 91  ? -27.942 -18.553 37.778 1.00 40.03  ? 91   LYS B CB    1 
ATOM   1355  C  CG    . LYS B 2 91  ? -26.813 -19.406 37.199 1.00 40.73  ? 91   LYS B CG    1 
ATOM   1356  C  CD    . LYS B 2 91  ? -27.313 -20.588 36.347 1.00 42.26  ? 91   LYS B CD    1 
ATOM   1357  C  CE    . LYS B 2 91  ? -27.767 -20.188 34.928 1.00 43.55  ? 91   LYS B CE    1 
ATOM   1358  N  NZ    . LYS B 2 91  ? -28.131 -21.382 34.080 1.00 41.98  ? 91   LYS B NZ    1 
ATOM   1359  N  N     . ARG B 2 92  ? -26.324 -16.393 39.485 1.00 40.72  ? 92   ARG B N     1 
ATOM   1360  C  CA    . ARG B 2 92  ? -25.028 -15.780 39.765 1.00 40.92  ? 92   ARG B CA    1 
ATOM   1361  C  C     . ARG B 2 92  ? -24.787 -15.548 41.255 1.00 41.85  ? 92   ARG B C     1 
ATOM   1362  O  O     . ARG B 2 92  ? -23.635 -15.393 41.667 1.00 42.51  ? 92   ARG B O     1 
ATOM   1363  C  CB    . ARG B 2 92  ? -24.773 -14.523 38.928 1.00 40.40  ? 92   ARG B CB    1 
ATOM   1364  C  CG    . ARG B 2 92  ? -25.801 -13.409 39.081 1.00 40.27  ? 92   ARG B CG    1 
ATOM   1365  C  CD    . ARG B 2 92  ? -25.431 -12.158 38.253 1.00 40.31  ? 92   ARG B CD    1 
ATOM   1366  N  NE    . ARG B 2 92  ? -23.987 -11.943 38.219 1.00 40.50  ? 92   ARG B NE    1 
ATOM   1367  C  CZ    . ARG B 2 92  ? -23.245 -11.548 39.254 1.00 40.39  ? 92   ARG B CZ    1 
ATOM   1368  N  NH1   . ARG B 2 92  ? -23.806 -11.290 40.438 1.00 39.42  ? 92   ARG B NH1   1 
ATOM   1369  N  NH2   . ARG B 2 92  ? -21.930 -11.424 39.101 1.00 38.94  ? 92   ARG B NH2   1 
ATOM   1370  N  N     . GLN B 2 93  ? -25.847 -15.551 42.068 1.00 42.37  ? 93   GLN B N     1 
ATOM   1371  C  CA    . GLN B 2 93  ? -25.672 -15.544 43.532 1.00 42.79  ? 93   GLN B CA    1 
ATOM   1372  C  C     . GLN B 2 93  ? -25.384 -16.969 44.055 1.00 42.73  ? 93   GLN B C     1 
ATOM   1373  O  O     . GLN B 2 93  ? -25.313 -17.198 45.267 1.00 42.60  ? 93   GLN B O     1 
ATOM   1374  C  CB    . GLN B 2 93  ? -26.915 -14.991 44.238 1.00 43.08  ? 93   GLN B CB    1 
ATOM   1375  C  CG    . GLN B 2 93  ? -27.325 -13.587 43.824 1.00 44.38  ? 93   GLN B CG    1 
ATOM   1376  C  CD    . GLN B 2 93  ? -26.311 -12.520 44.216 1.00 46.30  ? 93   GLN B CD    1 
ATOM   1377  O  OE1   . GLN B 2 93  ? -25.645 -12.614 45.264 1.00 46.75  ? 93   GLN B OE1   1 
ATOM   1378  N  NE2   . GLN B 2 93  ? -26.194 -11.489 43.376 1.00 45.35  ? 93   GLN B NE2   1 
ATOM   1379  N  N     . GLY B 2 94  ? -25.245 -17.918 43.132 1.00 42.35  ? 94   GLY B N     1 
ATOM   1380  C  CA    . GLY B 2 94  ? -25.051 -19.313 43.474 1.00 42.57  ? 94   GLY B CA    1 
ATOM   1381  C  C     . GLY B 2 94  ? -26.230 -19.954 44.180 1.00 42.83  ? 94   GLY B C     1 
ATOM   1382  O  O     . GLY B 2 94  ? -26.048 -20.863 44.987 1.00 43.02  ? 94   GLY B O     1 
ATOM   1383  N  N     . ARG B 2 95  ? -27.436 -19.468 43.890 1.00 43.15  ? 95   ARG B N     1 
ATOM   1384  C  CA    . ARG B 2 95  ? -28.666 -20.000 44.473 1.00 42.90  ? 95   ARG B CA    1 
ATOM   1385  C  C     . ARG B 2 95  ? -29.591 -20.481 43.361 1.00 42.20  ? 95   ARG B C     1 
ATOM   1386  O  O     . ARG B 2 95  ? -30.795 -20.213 43.408 1.00 42.63  ? 95   ARG B O     1 
ATOM   1387  C  CB    . ARG B 2 95  ? -29.402 -18.941 45.303 1.00 43.10  ? 95   ARG B CB    1 
ATOM   1388  C  CG    . ARG B 2 95  ? -28.550 -18.074 46.221 1.00 45.56  ? 95   ARG B CG    1 
ATOM   1389  C  CD    . ARG B 2 95  ? -28.509 -18.549 47.685 1.00 48.52  ? 95   ARG B CD    1 
ATOM   1390  N  NE    . ARG B 2 95  ? -29.585 -19.484 48.018 1.00 51.02  ? 95   ARG B NE    1 
ATOM   1391  C  CZ    . ARG B 2 95  ? -29.490 -20.427 48.960 1.00 51.96  ? 95   ARG B CZ    1 
ATOM   1392  N  NH1   . ARG B 2 95  ? -28.365 -20.548 49.676 1.00 50.91  ? 95   ARG B NH1   1 
ATOM   1393  N  NH2   . ARG B 2 95  ? -30.518 -21.249 49.186 1.00 50.64  ? 95   ARG B NH2   1 
ATOM   1394  N  N     . THR B 2 96  ? -29.031 -21.178 42.369 1.00 41.39  ? 96   THR B N     1 
ATOM   1395  C  CA    . THR B 2 96  ? -29.789 -21.745 41.231 1.00 40.40  ? 96   THR B CA    1 
ATOM   1396  C  C     . THR B 2 96  ? -31.160 -22.292 41.617 1.00 40.42  ? 96   THR B C     1 
ATOM   1397  O  O     . THR B 2 96  ? -31.262 -23.195 42.449 1.00 40.20  ? 96   THR B O     1 
ATOM   1398  C  CB    . THR B 2 96  ? -29.008 -22.881 40.554 1.00 39.92  ? 96   THR B CB    1 
ATOM   1399  O  OG1   . THR B 2 96  ? -27.795 -22.370 40.000 1.00 40.22  ? 96   THR B OG1   1 
ATOM   1400  C  CG2   . THR B 2 96  ? -29.802 -23.495 39.453 1.00 39.45  ? 96   THR B CG2   1 
ATOM   1401  N  N     . LEU B 2 97  ? -32.205 -21.733 41.005 1.00 40.78  ? 97   LEU B N     1 
ATOM   1402  C  CA    . LEU B 2 97  ? -33.580 -22.197 41.190 1.00 40.90  ? 97   LEU B CA    1 
ATOM   1403  C  C     . LEU B 2 97  ? -34.111 -22.893 39.940 1.00 41.48  ? 97   LEU B C     1 
ATOM   1404  O  O     . LEU B 2 97  ? -33.933 -22.401 38.829 1.00 41.43  ? 97   LEU B O     1 
ATOM   1405  C  CB    . LEU B 2 97  ? -34.476 -21.018 41.566 1.00 41.02  ? 97   LEU B CB    1 
ATOM   1406  C  CG    . LEU B 2 97  ? -35.979 -21.182 41.814 1.00 40.94  ? 97   LEU B CG    1 
ATOM   1407  C  CD1   . LEU B 2 97  ? -36.247 -22.181 42.911 1.00 41.96  ? 97   LEU B CD1   1 
ATOM   1408  C  CD2   . LEU B 2 97  ? -36.592 -19.862 42.185 1.00 40.38  ? 97   LEU B CD2   1 
ATOM   1409  N  N     . TYR B 2 98  ? -34.751 -24.048 40.140 1.00 42.30  ? 98   TYR B N     1 
ATOM   1410  C  CA    . TYR B 2 98  ? -35.384 -24.841 39.074 1.00 42.45  ? 98   TYR B CA    1 
ATOM   1411  C  C     . TYR B 2 98  ? -36.872 -24.644 39.177 1.00 43.34  ? 98   TYR B C     1 
ATOM   1412  O  O     . TYR B 2 98  ? -37.418 -24.625 40.283 1.00 43.53  ? 98   TYR B O     1 
ATOM   1413  C  CB    . TYR B 2 98  ? -35.132 -26.323 39.293 1.00 41.75  ? 98   TYR B CB    1 
ATOM   1414  C  CG    . TYR B 2 98  ? -33.791 -26.855 38.850 1.00 41.41  ? 98   TYR B CG    1 
ATOM   1415  C  CD1   . TYR B 2 98  ? -32.767 -26.003 38.417 1.00 40.60  ? 98   TYR B CD1   1 
ATOM   1416  C  CD2   . TYR B 2 98  ? -33.532 -28.222 38.908 1.00 39.93  ? 98   TYR B CD2   1 
ATOM   1417  C  CE1   . TYR B 2 98  ? -31.537 -26.510 38.015 1.00 40.15  ? 98   TYR B CE1   1 
ATOM   1418  C  CE2   . TYR B 2 98  ? -32.310 -28.730 38.530 1.00 40.32  ? 98   TYR B CE2   1 
ATOM   1419  C  CZ    . TYR B 2 98  ? -31.314 -27.874 38.077 1.00 40.90  ? 98   TYR B CZ    1 
ATOM   1420  O  OH    . TYR B 2 98  ? -30.100 -28.401 37.690 1.00 40.66  ? 98   TYR B OH    1 
ATOM   1421  N  N     . GLY B 2 99  ? -37.534 -24.502 38.034 1.00 44.27  ? 99   GLY B N     1 
ATOM   1422  C  CA    . GLY B 2 99  ? -38.979 -24.329 38.015 1.00 45.22  ? 99   GLY B CA    1 
ATOM   1423  C  C     . GLY B 2 99  ? -39.512 -23.181 37.180 1.00 46.18  ? 99   GLY B C     1 
ATOM   1424  O  O     . GLY B 2 99  ? -40.650 -23.232 36.730 1.00 46.41  ? 99   GLY B O     1 
ATOM   1425  N  N     . PHE B 2 100 ? -38.704 -22.149 36.954 1.00 47.08  ? 100  PHE B N     1 
ATOM   1426  C  CA    . PHE B 2 100 ? -39.233 -20.915 36.381 1.00 47.93  ? 100  PHE B CA    1 
ATOM   1427  C  C     . PHE B 2 100 ? -38.638 -20.513 35.039 1.00 49.13  ? 100  PHE B C     1 
ATOM   1428  O  O     . PHE B 2 100 ? -38.753 -19.353 34.626 1.00 49.82  ? 100  PHE B O     1 
ATOM   1429  C  CB    . PHE B 2 100 ? -39.146 -19.774 37.394 1.00 47.39  ? 100  PHE B CB    1 
ATOM   1430  C  CG    . PHE B 2 100 ? -39.960 -20.013 38.628 1.00 47.13  ? 100  PHE B CG    1 
ATOM   1431  C  CD1   . PHE B 2 100 ? -39.385 -20.585 39.758 1.00 47.67  ? 100  PHE B CD1   1 
ATOM   1432  C  CD2   . PHE B 2 100 ? -41.310 -19.680 38.661 1.00 46.37  ? 100  PHE B CD2   1 
ATOM   1433  C  CE1   . PHE B 2 100 ? -40.160 -20.822 40.916 1.00 48.47  ? 100  PHE B CE1   1 
ATOM   1434  C  CE2   . PHE B 2 100 ? -42.085 -19.904 39.801 1.00 46.03  ? 100  PHE B CE2   1 
ATOM   1435  C  CZ    . PHE B 2 100 ? -41.513 -20.481 40.932 1.00 46.83  ? 100  PHE B CZ    1 
ATOM   1436  N  N     . GLY B 2 101 ? -38.038 -21.467 34.337 1.00 50.15  ? 101  GLY B N     1 
ATOM   1437  C  CA    . GLY B 2 101 ? -37.493 -21.187 33.015 1.00 51.39  ? 101  GLY B CA    1 
ATOM   1438  C  C     . GLY B 2 101 ? -35.997 -21.415 32.898 1.00 52.53  ? 101  GLY B C     1 
ATOM   1439  O  O     . GLY B 2 101 ? -35.354 -21.999 33.783 1.00 53.01  ? 101  GLY B O     1 
ATOM   1440  N  N     . GLY B 2 102 ? -35.436 -20.976 31.777 1.00 53.31  ? 102  GLY B N     1 
ATOM   1441  C  CA    . GLY B 2 102 ? -33.997 -21.082 31.544 1.00 53.62  ? 102  GLY B CA    1 
ATOM   1442  C  C     . GLY B 2 102 ? -33.453 -22.492 31.544 1.00 53.78  ? 102  GLY B C     1 
ATOM   1443  O  O     . GLY B 2 102 ? -32.233 -22.639 31.591 1.00 54.04  ? 102  GLY B O     1 
ATOM   1444  O  OXT   . GLY B 2 102 ? -34.191 -23.489 31.489 1.00 53.97  ? 102  GLY B OXT   1 
ATOM   1445  N  N     . ALA C 3 14  ? 0.699   7.007   12.824 1.00 68.21  ? 14   ALA C N     1 
ATOM   1446  C  CA    . ALA C 3 14  ? 0.194   5.759   13.481 1.00 68.15  ? 14   ALA C CA    1 
ATOM   1447  C  C     . ALA C 3 14  ? 0.042   5.930   14.995 1.00 67.92  ? 14   ALA C C     1 
ATOM   1448  O  O     . ALA C 3 14  ? 1.013   6.241   15.691 1.00 67.85  ? 14   ALA C O     1 
ATOM   1449  C  CB    . ALA C 3 14  ? 1.112   4.580   13.169 1.00 68.31  ? 14   ALA C CB    1 
ATOM   1450  N  N     . LYS C 3 15  ? -1.180  5.724   15.489 1.00 67.36  ? 15   LYS C N     1 
ATOM   1451  C  CA    . LYS C 3 15  ? -1.496  5.899   16.908 1.00 66.79  ? 15   LYS C CA    1 
ATOM   1452  C  C     . LYS C 3 15  ? -2.254  4.720   17.498 1.00 65.95  ? 15   LYS C C     1 
ATOM   1453  O  O     . LYS C 3 15  ? -3.119  4.125   16.843 1.00 66.02  ? 15   LYS C O     1 
ATOM   1454  C  CB    . LYS C 3 15  ? -2.290  7.186   17.132 1.00 66.98  ? 15   LYS C CB    1 
ATOM   1455  C  CG    . LYS C 3 15  ? -1.398  8.404   17.248 1.00 68.56  ? 15   LYS C CG    1 
ATOM   1456  C  CD    . LYS C 3 15  ? -2.091  9.563   17.951 1.00 70.62  ? 15   LYS C CD    1 
ATOM   1457  C  CE    . LYS C 3 15  ? -1.255  10.841  17.804 1.00 71.51  ? 15   LYS C CE    1 
ATOM   1458  N  NZ    . LYS C 3 15  ? -2.033  12.092  18.086 1.00 71.84  ? 15   LYS C NZ    1 
ATOM   1459  N  N     . THR C 3 16  ? -1.926  4.384   18.742 1.00 64.70  ? 16   THR C N     1 
ATOM   1460  C  CA    . THR C 3 16  ? -2.579  3.266   19.412 1.00 63.26  ? 16   THR C CA    1 
ATOM   1461  C  C     . THR C 3 16  ? -3.976  3.682   19.860 1.00 62.70  ? 16   THR C C     1 
ATOM   1462  O  O     . THR C 3 16  ? -4.213  4.851   20.174 1.00 62.51  ? 16   THR C O     1 
ATOM   1463  C  CB    . THR C 3 16  ? -1.767  2.750   20.617 1.00 63.03  ? 16   THR C CB    1 
ATOM   1464  O  OG1   . THR C 3 16  ? -1.811  3.706   21.683 1.00 62.74  ? 16   THR C OG1   1 
ATOM   1465  C  CG2   . THR C 3 16  ? -0.325  2.479   20.224 1.00 62.25  ? 16   THR C CG2   1 
ATOM   1466  N  N     . ARG C 3 17  ? -4.897  2.721   19.862 1.00 61.76  ? 17   ARG C N     1 
ATOM   1467  C  CA    . ARG C 3 17  ? -6.234  2.923   20.411 1.00 60.85  ? 17   ARG C CA    1 
ATOM   1468  C  C     . ARG C 3 17  ? -6.165  3.130   21.925 1.00 60.12  ? 17   ARG C C     1 
ATOM   1469  O  O     . ARG C 3 17  ? -7.110  3.642   22.541 1.00 59.77  ? 17   ARG C O     1 
ATOM   1470  C  CB    . ARG C 3 17  ? -7.115  1.720   20.104 1.00 61.08  ? 17   ARG C CB    1 
ATOM   1471  C  CG    . ARG C 3 17  ? -7.321  1.468   18.632 1.00 61.88  ? 17   ARG C CG    1 
ATOM   1472  C  CD    . ARG C 3 17  ? -8.513  0.562   18.401 1.00 61.94  ? 17   ARG C CD    1 
ATOM   1473  N  NE    . ARG C 3 17  ? -8.132  -0.842  18.456 1.00 61.82  ? 17   ARG C NE    1 
ATOM   1474  C  CZ    . ARG C 3 17  ? -8.975  -1.835  18.708 1.00 61.82  ? 17   ARG C CZ    1 
ATOM   1475  N  NH1   . ARG C 3 17  ? -10.263 -1.587  18.942 1.00 61.33  ? 17   ARG C NH1   1 
ATOM   1476  N  NH2   . ARG C 3 17  ? -8.518  -3.077  18.737 1.00 62.26  ? 17   ARG C NH2   1 
ATOM   1477  N  N     . SER C 3 18  ? -5.046  2.707   22.514 1.00 59.16  ? 18   SER C N     1 
ATOM   1478  C  CA    . SER C 3 18  ? -4.762  2.961   23.916 1.00 58.46  ? 18   SER C CA    1 
ATOM   1479  C  C     . SER C 3 18  ? -4.567  4.464   24.123 1.00 57.92  ? 18   SER C C     1 
ATOM   1480  O  O     . SER C 3 18  ? -5.300  5.092   24.897 1.00 57.57  ? 18   SER C O     1 
ATOM   1481  C  CB    . SER C 3 18  ? -3.530  2.177   24.376 1.00 58.50  ? 18   SER C CB    1 
ATOM   1482  O  OG    . SER C 3 18  ? -3.807  0.793   24.477 1.00 58.39  ? 18   SER C OG    1 
ATOM   1483  N  N     . SER C 3 19  ? -3.600  5.041   23.407 1.00 57.13  ? 19   SER C N     1 
ATOM   1484  C  CA    . SER C 3 19  ? -3.412  6.490   23.440 1.00 56.32  ? 19   SER C CA    1 
ATOM   1485  C  C     . SER C 3 19  ? -4.709  7.202   23.066 1.00 55.54  ? 19   SER C C     1 
ATOM   1486  O  O     . SER C 3 19  ? -5.102  8.140   23.745 1.00 55.82  ? 19   SER C O     1 
ATOM   1487  C  CB    . SER C 3 19  ? -2.241  6.942   22.557 1.00 56.27  ? 19   SER C CB    1 
ATOM   1488  O  OG    . SER C 3 19  ? -2.317  6.379   21.267 1.00 56.43  ? 19   SER C OG    1 
ATOM   1489  N  N     . ARG C 3 20  ? -5.386  6.723   22.023 1.00 54.36  ? 20   ARG C N     1 
ATOM   1490  C  CA    . ARG C 3 20  ? -6.666  7.273   21.601 1.00 53.60  ? 20   ARG C CA    1 
ATOM   1491  C  C     . ARG C 3 20  ? -7.699  7.331   22.713 1.00 52.83  ? 20   ARG C C     1 
ATOM   1492  O  O     . ARG C 3 20  ? -8.563  8.207   22.716 1.00 52.64  ? 20   ARG C O     1 
ATOM   1493  C  CB    . ARG C 3 20  ? -7.253  6.455   20.459 1.00 54.24  ? 20   ARG C CB    1 
ATOM   1494  C  CG    . ARG C 3 20  ? -6.695  6.742   19.085 1.00 56.33  ? 20   ARG C CG    1 
ATOM   1495  C  CD    . ARG C 3 20  ? -7.368  5.864   18.041 1.00 59.85  ? 20   ARG C CD    1 
ATOM   1496  N  NE    . ARG C 3 20  ? -6.579  5.796   16.810 1.00 64.24  ? 20   ARG C NE    1 
ATOM   1497  C  CZ    . ARG C 3 20  ? -6.610  6.706   15.833 1.00 66.58  ? 20   ARG C CZ    1 
ATOM   1498  N  NH1   . ARG C 3 20  ? -7.398  7.781   15.920 1.00 67.21  ? 20   ARG C NH1   1 
ATOM   1499  N  NH2   . ARG C 3 20  ? -5.848  6.540   14.756 1.00 67.35  ? 20   ARG C NH2   1 
ATOM   1500  N  N     . ALA C 3 21  ? -7.640  6.383   23.642 1.00 52.19  ? 21   ALA C N     1 
ATOM   1501  C  CA    . ALA C 3 21  ? -8.590  6.370   24.760 1.00 51.33  ? 21   ALA C CA    1 
ATOM   1502  C  C     . ALA C 3 21  ? -7.927  6.882   26.036 1.00 50.54  ? 21   ALA C C     1 
ATOM   1503  O  O     . ALA C 3 21  ? -8.553  6.975   27.089 1.00 50.54  ? 21   ALA C O     1 
ATOM   1504  C  CB    . ALA C 3 21  ? -9.165  4.981   24.959 1.00 51.52  ? 21   ALA C CB    1 
ATOM   1505  N  N     . GLY C 3 22  ? -6.655  7.234   25.922 1.00 49.60  ? 22   GLY C N     1 
ATOM   1506  C  CA    . GLY C 3 22  ? -5.904  7.769   27.042 1.00 48.82  ? 22   GLY C CA    1 
ATOM   1507  C  C     . GLY C 3 22  ? -5.686  6.729   28.106 1.00 47.96  ? 22   GLY C C     1 
ATOM   1508  O  O     . GLY C 3 22  ? -5.896  6.990   29.286 1.00 48.05  ? 22   GLY C O     1 
ATOM   1509  N  N     . LEU C 3 23  ? -5.270  5.544   27.673 1.00 47.59  ? 23   LEU C N     1 
ATOM   1510  C  CA    . LEU C 3 23  ? -5.120  4.409   28.564 1.00 47.07  ? 23   LEU C CA    1 
ATOM   1511  C  C     . LEU C 3 23  ? -3.715  3.878   28.502 1.00 47.13  ? 23   LEU C C     1 
ATOM   1512  O  O     . LEU C 3 23  ? -3.059  3.924   27.455 1.00 47.30  ? 23   LEU C O     1 
ATOM   1513  C  CB    . LEU C 3 23  ? -6.099  3.287   28.216 1.00 46.83  ? 23   LEU C CB    1 
ATOM   1514  C  CG    . LEU C 3 23  ? -7.619  3.467   28.296 1.00 46.44  ? 23   LEU C CG    1 
ATOM   1515  C  CD1   . LEU C 3 23  ? -8.280  2.144   27.972 1.00 46.59  ? 23   LEU C CD1   1 
ATOM   1516  C  CD2   . LEU C 3 23  ? -8.090  3.966   29.657 1.00 46.76  ? 23   LEU C CD2   1 
ATOM   1517  N  N     . GLN C 3 24  ? -3.261  3.386   29.648 1.00 47.04  ? 24   GLN C N     1 
ATOM   1518  C  CA    . GLN C 3 24  ? -1.993  2.686   29.761 1.00 46.71  ? 24   GLN C CA    1 
ATOM   1519  C  C     . GLN C 3 24  ? -2.131  1.247   29.300 1.00 46.45  ? 24   GLN C C     1 
ATOM   1520  O  O     . GLN C 3 24  ? -1.217  0.712   28.690 1.00 46.45  ? 24   GLN C O     1 
ATOM   1521  C  CB    . GLN C 3 24  ? -1.507  2.710   31.209 1.00 46.80  ? 24   GLN C CB    1 
ATOM   1522  C  CG    . GLN C 3 24  ? -1.422  4.099   31.808 1.00 45.94  ? 24   GLN C CG    1 
ATOM   1523  C  CD    . GLN C 3 24  ? -0.563  5.021   30.987 1.00 45.26  ? 24   GLN C CD    1 
ATOM   1524  O  OE1   . GLN C 3 24  ? 0.544   4.661   30.561 1.00 44.23  ? 24   GLN C OE1   1 
ATOM   1525  N  NE2   . GLN C 3 24  ? -1.063  6.227   30.756 1.00 46.12  ? 24   GLN C NE2   1 
ATOM   1526  N  N     . PHE C 3 25  ? -3.281  0.639   29.588 1.00 46.37  ? 25   PHE C N     1 
ATOM   1527  C  CA    . PHE C 3 25  ? -3.526  -0.779  29.313 1.00 46.72  ? 25   PHE C CA    1 
ATOM   1528  C  C     . PHE C 3 25  ? -3.749  -1.020  27.815 1.00 47.02  ? 25   PHE C C     1 
ATOM   1529  O  O     . PHE C 3 25  ? -4.303  -0.156  27.136 1.00 47.21  ? 25   PHE C O     1 
ATOM   1530  C  CB    . PHE C 3 25  ? -4.717  -1.276  30.146 1.00 46.53  ? 25   PHE C CB    1 
ATOM   1531  C  CG    . PHE C 3 25  ? -4.324  -1.979  31.418 1.00 46.72  ? 25   PHE C CG    1 
ATOM   1532  C  CD1   . PHE C 3 25  ? -3.561  -1.339  32.386 1.00 47.28  ? 25   PHE C CD1   1 
ATOM   1533  C  CD2   . PHE C 3 25  ? -4.728  -3.291  31.656 1.00 48.00  ? 25   PHE C CD2   1 
ATOM   1534  C  CE1   . PHE C 3 25  ? -3.191  -1.997  33.571 1.00 46.39  ? 25   PHE C CE1   1 
ATOM   1535  C  CE2   . PHE C 3 25  ? -4.369  -3.958  32.845 1.00 47.04  ? 25   PHE C CE2   1 
ATOM   1536  C  CZ    . PHE C 3 25  ? -3.597  -3.306  33.794 1.00 46.30  ? 25   PHE C CZ    1 
ATOM   1537  N  N     . PRO C 3 26  ? -3.338  -2.200  27.295 1.00 47.28  ? 26   PRO C N     1 
ATOM   1538  C  CA    . PRO C 3 26  ? -3.335  -2.426  25.854 1.00 47.46  ? 26   PRO C CA    1 
ATOM   1539  C  C     . PRO C 3 26  ? -4.711  -2.756  25.296 1.00 47.75  ? 26   PRO C C     1 
ATOM   1540  O  O     . PRO C 3 26  ? -5.160  -3.897  25.404 1.00 47.95  ? 26   PRO C O     1 
ATOM   1541  C  CB    . PRO C 3 26  ? -2.402  -3.628  25.700 1.00 47.27  ? 26   PRO C CB    1 
ATOM   1542  C  CG    . PRO C 3 26  ? -2.579  -4.379  26.926 1.00 46.80  ? 26   PRO C CG    1 
ATOM   1543  C  CD    . PRO C 3 26  ? -2.880  -3.398  28.017 1.00 47.42  ? 26   PRO C CD    1 
ATOM   1544  N  N     . VAL C 3 27  ? -5.366  -1.762  24.700 1.00 47.97  ? 27   VAL C N     1 
ATOM   1545  C  CA    . VAL C 3 27  ? -6.655  -1.959  24.038 1.00 48.17  ? 27   VAL C CA    1 
ATOM   1546  C  C     . VAL C 3 27  ? -6.582  -3.022  22.929 1.00 48.37  ? 27   VAL C C     1 
ATOM   1547  O  O     . VAL C 3 27  ? -7.452  -3.883  22.847 1.00 48.43  ? 27   VAL C O     1 
ATOM   1548  C  CB    . VAL C 3 27  ? -7.202  -0.634  23.489 1.00 48.21  ? 27   VAL C CB    1 
ATOM   1549  C  CG1   . VAL C 3 27  ? -8.473  -0.856  22.670 1.00 48.44  ? 27   VAL C CG1   1 
ATOM   1550  C  CG2   . VAL C 3 27  ? -7.466  0.322   24.636 1.00 48.44  ? 27   VAL C CG2   1 
ATOM   1551  N  N     . GLY C 3 28  ? -5.542  -2.974  22.100 1.00 48.53  ? 28   GLY C N     1 
ATOM   1552  C  CA    . GLY C 3 28  ? -5.358  -3.978  21.059 1.00 48.98  ? 28   GLY C CA    1 
ATOM   1553  C  C     . GLY C 3 28  ? -5.355  -5.394  21.616 1.00 49.52  ? 28   GLY C C     1 
ATOM   1554  O  O     . GLY C 3 28  ? -6.071  -6.267  21.130 1.00 49.53  ? 28   GLY C O     1 
ATOM   1555  N  N     . ARG C 3 29  ? -4.544  -5.612  22.647 1.00 50.13  ? 29   ARG C N     1 
ATOM   1556  C  CA    . ARG C 3 29  ? -4.374  -6.927  23.274 1.00 50.50  ? 29   ARG C CA    1 
ATOM   1557  C  C     . ARG C 3 29  ? -5.702  -7.430  23.810 1.00 50.80  ? 29   ARG C C     1 
ATOM   1558  O  O     . ARG C 3 29  ? -6.089  -8.570  23.585 1.00 51.08  ? 29   ARG C O     1 
ATOM   1559  C  CB    . ARG C 3 29  ? -3.375  -6.820  24.431 1.00 50.40  ? 29   ARG C CB    1 
ATOM   1560  C  CG    . ARG C 3 29  ? -3.090  -8.106  25.150 1.00 50.54  ? 29   ARG C CG    1 
ATOM   1561  C  CD    . ARG C 3 29  ? -1.705  -8.573  24.803 1.00 53.45  ? 29   ARG C CD    1 
ATOM   1562  N  NE    . ARG C 3 29  ? -0.806  -8.449  25.946 1.00 55.50  ? 29   ARG C NE    1 
ATOM   1563  C  CZ    . ARG C 3 29  ? 0.521   -8.430  25.871 1.00 56.87  ? 29   ARG C CZ    1 
ATOM   1564  N  NH1   . ARG C 3 29  ? 1.153   -8.495  24.706 1.00 58.98  ? 29   ARG C NH1   1 
ATOM   1565  N  NH2   . ARG C 3 29  ? 1.226   -8.333  26.974 1.00 58.51  ? 29   ARG C NH2   1 
ATOM   1566  N  N     . VAL C 3 30  ? -6.387  -6.557  24.531 1.00 50.88  ? 30   VAL C N     1 
ATOM   1567  C  CA    . VAL C 3 30  ? -7.638  -6.891  25.147 1.00 51.05  ? 30   VAL C CA    1 
ATOM   1568  C  C     . VAL C 3 30  ? -8.683  -7.171  24.059 1.00 51.74  ? 30   VAL C C     1 
ATOM   1569  O  O     . VAL C 3 30  ? -9.480  -8.099  24.187 1.00 51.94  ? 30   VAL C O     1 
ATOM   1570  C  CB    . VAL C 3 30  ? -8.042  -5.781  26.147 1.00 50.75  ? 30   VAL C CB    1 
ATOM   1571  C  CG1   . VAL C 3 30  ? -9.471  -5.934  26.615 1.00 50.71  ? 30   VAL C CG1   1 
ATOM   1572  C  CG2   . VAL C 3 30  ? -7.112  -5.814  27.329 1.00 50.06  ? 30   VAL C CG2   1 
ATOM   1573  N  N     . HIS C 3 31  ? -8.663  -6.409  22.969 1.00 52.50  ? 31   HIS C N     1 
ATOM   1574  C  CA    . HIS C 3 31  ? -9.573  -6.703  21.854 1.00 53.43  ? 31   HIS C CA    1 
ATOM   1575  C  C     . HIS C 3 31  ? -9.383  -8.150  21.359 1.00 53.29  ? 31   HIS C C     1 
ATOM   1576  O  O     . HIS C 3 31  ? -10.353 -8.880  21.137 1.00 53.32  ? 31   HIS C O     1 
ATOM   1577  C  CB    . HIS C 3 31  ? -9.387  -5.724  20.691 1.00 53.55  ? 31   HIS C CB    1 
ATOM   1578  C  CG    . HIS C 3 31  ? -10.587 -5.609  19.802 1.00 55.86  ? 31   HIS C CG    1 
ATOM   1579  N  ND1   . HIS C 3 31  ? -11.665 -6.467  19.890 1.00 58.11  ? 31   HIS C ND1   1 
ATOM   1580  C  CD2   . HIS C 3 31  ? -10.872 -4.753  18.790 1.00 57.24  ? 31   HIS C CD2   1 
ATOM   1581  C  CE1   . HIS C 3 31  ? -12.568 -6.133  18.983 1.00 59.12  ? 31   HIS C CE1   1 
ATOM   1582  N  NE2   . HIS C 3 31  ? -12.109 -5.099  18.299 1.00 58.64  ? 31   HIS C NE2   1 
ATOM   1583  N  N     . ARG C 3 32  ? -8.123  -8.546  21.211 1.00 52.81  ? 32   ARG C N     1 
ATOM   1584  C  CA    . ARG C 3 32  ? -7.765  -9.843  20.685 1.00 52.45  ? 32   ARG C CA    1 
ATOM   1585  C  C     . ARG C 3 32  ? -8.208  -10.973 21.605 1.00 52.62  ? 32   ARG C C     1 
ATOM   1586  O  O     . ARG C 3 32  ? -8.851  -11.924 21.146 1.00 52.75  ? 32   ARG C O     1 
ATOM   1587  C  CB    . ARG C 3 32  ? -6.262  -9.893  20.471 1.00 52.36  ? 32   ARG C CB    1 
ATOM   1588  C  CG    . ARG C 3 32  ? -5.756  -11.116 19.780 1.00 51.93  ? 32   ARG C CG    1 
ATOM   1589  C  CD    . ARG C 3 32  ? -4.265  -11.112 19.865 1.00 52.28  ? 32   ARG C CD    1 
ATOM   1590  N  NE    . ARG C 3 32  ? -3.806  -11.836 21.040 1.00 53.49  ? 32   ARG C NE    1 
ATOM   1591  C  CZ    . ARG C 3 32  ? -2.793  -11.461 21.816 1.00 53.91  ? 32   ARG C CZ    1 
ATOM   1592  N  NH1   . ARG C 3 32  ? -2.131  -10.338 21.573 1.00 54.27  ? 32   ARG C NH1   1 
ATOM   1593  N  NH2   . ARG C 3 32  ? -2.454  -12.211 22.854 1.00 54.05  ? 32   ARG C NH2   1 
ATOM   1594  N  N     . LEU C 3 33  ? -7.875  -10.866 22.895 1.00 52.54  ? 33   LEU C N     1 
ATOM   1595  C  CA    . LEU C 3 33  ? -8.212  -11.907 23.870 1.00 52.38  ? 33   LEU C CA    1 
ATOM   1596  C  C     . LEU C 3 33  ? -9.720  -12.167 23.961 1.00 53.09  ? 33   LEU C C     1 
ATOM   1597  O  O     . LEU C 3 33  ? -10.132 -13.298 24.210 1.00 53.77  ? 33   LEU C O     1 
ATOM   1598  C  CB    . LEU C 3 33  ? -7.635  -11.599 25.240 1.00 51.70  ? 33   LEU C CB    1 
ATOM   1599  C  CG    . LEU C 3 33  ? -6.119  -11.463 25.398 1.00 50.80  ? 33   LEU C CG    1 
ATOM   1600  C  CD1   . LEU C 3 33  ? -5.800  -10.816 26.732 1.00 48.75  ? 33   LEU C CD1   1 
ATOM   1601  C  CD2   . LEU C 3 33  ? -5.396  -12.787 25.280 1.00 49.62  ? 33   LEU C CD2   1 
ATOM   1602  N  N     . LEU C 3 34  ? -10.537 -11.147 23.725 1.00 53.46  ? 34   LEU C N     1 
ATOM   1603  C  CA    . LEU C 3 34  ? -11.981 -11.340 23.683 1.00 54.37  ? 34   LEU C CA    1 
ATOM   1604  C  C     . LEU C 3 34  ? -12.429 -12.192 22.498 1.00 55.26  ? 34   LEU C C     1 
ATOM   1605  O  O     . LEU C 3 34  ? -13.371 -12.986 22.609 1.00 55.22  ? 34   LEU C O     1 
ATOM   1606  C  CB    . LEU C 3 34  ? -12.710 -9.997  23.656 1.00 54.27  ? 34   LEU C CB    1 
ATOM   1607  C  CG    . LEU C 3 34  ? -12.814 -9.201  24.961 1.00 54.11  ? 34   LEU C CG    1 
ATOM   1608  C  CD1   . LEU C 3 34  ? -13.324 -7.797  24.662 1.00 54.69  ? 34   LEU C CD1   1 
ATOM   1609  C  CD2   . LEU C 3 34  ? -13.707 -9.890  25.979 1.00 52.44  ? 34   LEU C CD2   1 
ATOM   1610  N  N     . ARG C 3 35  ? -11.757 -12.012 21.363 1.00 56.42  ? 35   ARG C N     1 
ATOM   1611  C  CA    . ARG C 3 35  ? -12.070 -12.759 20.152 1.00 57.16  ? 35   ARG C CA    1 
ATOM   1612  C  C     . ARG C 3 35  ? -11.745 -14.221 20.362 1.00 57.50  ? 35   ARG C C     1 
ATOM   1613  O  O     . ARG C 3 35  ? -12.542 -15.093 20.022 1.00 57.66  ? 35   ARG C O     1 
ATOM   1614  C  CB    . ARG C 3 35  ? -11.254 -12.252 18.970 1.00 57.22  ? 35   ARG C CB    1 
ATOM   1615  C  CG    . ARG C 3 35  ? -11.579 -10.854 18.522 1.00 58.63  ? 35   ARG C CG    1 
ATOM   1616  C  CD    . ARG C 3 35  ? -11.075 -10.617 17.099 1.00 60.35  ? 35   ARG C CD    1 
ATOM   1617  N  NE    . ARG C 3 35  ? -11.093 -9.200  16.746 1.00 62.55  ? 35   ARG C NE    1 
ATOM   1618  C  CZ    . ARG C 3 35  ? -12.196 -8.482  16.520 1.00 63.74  ? 35   ARG C CZ    1 
ATOM   1619  N  NH1   . ARG C 3 35  ? -13.407 -9.031  16.617 1.00 63.13  ? 35   ARG C NH1   1 
ATOM   1620  N  NH2   . ARG C 3 35  ? -12.084 -7.197  16.198 1.00 64.69  ? 35   ARG C NH2   1 
ATOM   1621  N  N     . LYS C 3 36  ? -10.571 -14.471 20.938 1.00 57.83  ? 36   LYS C N     1 
ATOM   1622  C  CA    . LYS C 3 36  ? -10.029 -15.817 21.017 1.00 58.46  ? 36   LYS C CA    1 
ATOM   1623  C  C     . LYS C 3 36  ? -10.631 -16.625 22.176 1.00 57.93  ? 36   LYS C C     1 
ATOM   1624  O  O     . LYS C 3 36  ? -10.530 -17.855 22.197 1.00 58.31  ? 36   LYS C O     1 
ATOM   1625  C  CB    . LYS C 3 36  ? -8.489  -15.782 21.075 1.00 58.44  ? 36   LYS C CB    1 
ATOM   1626  C  CG    . LYS C 3 36  ? -7.881  -15.924 22.477 1.00 59.41  ? 36   LYS C CG    1 
ATOM   1627  C  CD    . LYS C 3 36  ? -6.374  -15.656 22.483 1.00 60.04  ? 36   LYS C CD    1 
ATOM   1628  C  CE    . LYS C 3 36  ? -5.545  -16.843 21.979 1.00 63.27  ? 36   LYS C CE    1 
ATOM   1629  N  NZ    . LYS C 3 36  ? -4.096  -16.454 21.813 1.00 63.98  ? 36   LYS C NZ    1 
ATOM   1630  N  N     . GLY C 3 37  ? -11.255 -15.937 23.129 1.00 57.25  ? 37   GLY C N     1 
ATOM   1631  C  CA    . GLY C 3 37  ? -11.884 -16.605 24.267 1.00 56.20  ? 37   GLY C CA    1 
ATOM   1632  C  C     . GLY C 3 37  ? -13.337 -16.971 24.020 1.00 55.68  ? 37   GLY C C     1 
ATOM   1633  O  O     . GLY C 3 37  ? -14.031 -17.421 24.940 1.00 55.33  ? 37   GLY C O     1 
ATOM   1634  N  N     . ASN C 3 38  ? -13.794 -16.764 22.782 1.00 55.18  ? 38   ASN C N     1 
ATOM   1635  C  CA    . ASN C 3 38  ? -15.130 -17.160 22.341 1.00 55.04  ? 38   ASN C CA    1 
ATOM   1636  C  C     . ASN C 3 38  ? -16.215 -16.794 23.316 1.00 54.27  ? 38   ASN C C     1 
ATOM   1637  O  O     . ASN C 3 38  ? -16.818 -17.663 23.950 1.00 54.59  ? 38   ASN C O     1 
ATOM   1638  C  CB    . ASN C 3 38  ? -15.184 -18.665 22.071 1.00 55.77  ? 38   ASN C CB    1 
ATOM   1639  C  CG    . ASN C 3 38  ? -14.467 -19.041 20.810 1.00 57.64  ? 38   ASN C CG    1 
ATOM   1640  O  OD1   . ASN C 3 38  ? -13.332 -19.531 20.858 1.00 60.41  ? 38   ASN C OD1   1 
ATOM   1641  N  ND2   . ASN C 3 38  ? -15.103 -18.786 19.659 1.00 58.24  ? 38   ASN C ND2   1 
ATOM   1642  N  N     . TYR C 3 39  ? -16.464 -15.502 23.439 1.00 53.29  ? 39   TYR C N     1 
ATOM   1643  C  CA    . TYR C 3 39  ? -17.461 -15.029 24.366 1.00 52.17  ? 39   TYR C CA    1 
ATOM   1644  C  C     . TYR C 3 39  ? -18.727 -14.664 23.603 1.00 52.30  ? 39   TYR C C     1 
ATOM   1645  O  O     . TYR C 3 39  ? -19.831 -14.751 24.156 1.00 52.23  ? 39   TYR C O     1 
ATOM   1646  C  CB    . TYR C 3 39  ? -16.912 -13.849 25.163 1.00 51.68  ? 39   TYR C CB    1 
ATOM   1647  C  CG    . TYR C 3 39  ? -15.728 -14.185 26.050 1.00 49.90  ? 39   TYR C CG    1 
ATOM   1648  C  CD1   . TYR C 3 39  ? -14.428 -13.934 25.633 1.00 48.63  ? 39   TYR C CD1   1 
ATOM   1649  C  CD2   . TYR C 3 39  ? -15.916 -14.734 27.313 1.00 49.24  ? 39   TYR C CD2   1 
ATOM   1650  C  CE1   . TYR C 3 39  ? -13.333 -14.233 26.449 1.00 48.97  ? 39   TYR C CE1   1 
ATOM   1651  C  CE2   . TYR C 3 39  ? -14.836 -15.045 28.136 1.00 49.39  ? 39   TYR C CE2   1 
ATOM   1652  C  CZ    . TYR C 3 39  ? -13.546 -14.792 27.698 1.00 50.07  ? 39   TYR C CZ    1 
ATOM   1653  O  OH    . TYR C 3 39  ? -12.476 -15.097 28.510 1.00 50.19  ? 39   TYR C OH    1 
ATOM   1654  N  N     . ALA C 3 40  ? -18.555 -14.274 22.335 1.00 52.22  ? 40   ALA C N     1 
ATOM   1655  C  CA    . ALA C 3 40  ? -19.659 -13.976 21.415 1.00 52.72  ? 40   ALA C CA    1 
ATOM   1656  C  C     . ALA C 3 40  ? -19.193 -13.963 19.962 1.00 53.65  ? 40   ALA C C     1 
ATOM   1657  O  O     . ALA C 3 40  ? -17.983 -13.932 19.683 1.00 53.59  ? 40   ALA C O     1 
ATOM   1658  C  CB    . ALA C 3 40  ? -20.305 -12.660 21.760 1.00 52.52  ? 40   ALA C CB    1 
ATOM   1659  N  N     . GLU C 3 41  ? -20.150 -13.982 19.031 1.00 54.87  ? 41   GLU C N     1 
ATOM   1660  C  CA    . GLU C 3 41  ? -19.811 -14.047 17.606 1.00 56.13  ? 41   GLU C CA    1 
ATOM   1661  C  C     . GLU C 3 41  ? -18.977 -12.844 17.240 1.00 56.31  ? 41   GLU C C     1 
ATOM   1662  O  O     . GLU C 3 41  ? -17.870 -12.986 16.731 1.00 56.48  ? 41   GLU C O     1 
ATOM   1663  C  CB    . GLU C 3 41  ? -21.058 -14.099 16.710 1.00 56.44  ? 41   GLU C CB    1 
ATOM   1664  C  CG    . GLU C 3 41  ? -21.972 -15.320 16.906 1.00 59.56  ? 41   GLU C CG    1 
ATOM   1665  C  CD    . GLU C 3 41  ? -21.256 -16.675 16.742 1.00 62.21  ? 41   GLU C CD    1 
ATOM   1666  O  OE1   . GLU C 3 41  ? -20.565 -16.897 15.712 1.00 62.04  ? 41   GLU C OE1   1 
ATOM   1667  O  OE2   . GLU C 3 41  ? -21.412 -17.524 17.652 1.00 62.59  ? 41   GLU C OE2   1 
ATOM   1668  N  N     . ARG C 3 42  ? -19.519 -11.666 17.544 1.00 56.78  ? 42   ARG C N     1 
ATOM   1669  C  CA    . ARG C 3 42  ? -18.939 -10.386 17.177 1.00 57.19  ? 42   ARG C CA    1 
ATOM   1670  C  C     . ARG C 3 42  ? -18.540 -9.608  18.430 1.00 56.87  ? 42   ARG C C     1 
ATOM   1671  O  O     . ARG C 3 42  ? -19.152 -9.781  19.487 1.00 57.12  ? 42   ARG C O     1 
ATOM   1672  C  CB    . ARG C 3 42  ? -19.970 -9.561  16.410 1.00 57.79  ? 42   ARG C CB    1 
ATOM   1673  C  CG    . ARG C 3 42  ? -20.482 -10.167 15.118 1.00 60.12  ? 42   ARG C CG    1 
ATOM   1674  C  CD    . ARG C 3 42  ? -21.421 -9.178  14.436 1.00 64.29  ? 42   ARG C CD    1 
ATOM   1675  N  NE    . ARG C 3 42  ? -21.256 -9.168  12.981 1.00 67.86  ? 42   ARG C NE    1 
ATOM   1676  C  CZ    . ARG C 3 42  ? -21.512 -8.117  12.206 1.00 69.74  ? 42   ARG C CZ    1 
ATOM   1677  N  NH1   . ARG C 3 42  ? -21.949 -6.980  12.744 1.00 70.38  ? 42   ARG C NH1   1 
ATOM   1678  N  NH2   . ARG C 3 42  ? -21.332 -8.201  10.893 1.00 70.25  ? 42   ARG C NH2   1 
ATOM   1679  N  N     . VAL C 3 43  ? -17.537 -8.737  18.308 1.00 56.14  ? 43   VAL C N     1 
ATOM   1680  C  CA    . VAL C 3 43  ? -17.124 -7.885  19.425 1.00 55.48  ? 43   VAL C CA    1 
ATOM   1681  C  C     . VAL C 3 43  ? -17.001 -6.433  19.008 1.00 55.22  ? 43   VAL C C     1 
ATOM   1682  O  O     . VAL C 3 43  ? -16.086 -6.063  18.264 1.00 55.64  ? 43   VAL C O     1 
ATOM   1683  C  CB    . VAL C 3 43  ? -15.786 -8.347  20.047 1.00 55.40  ? 43   VAL C CB    1 
ATOM   1684  C  CG1   . VAL C 3 43  ? -15.293 -7.353  21.090 1.00 53.93  ? 43   VAL C CG1   1 
ATOM   1685  C  CG2   . VAL C 3 43  ? -15.950 -9.722  20.656 1.00 55.66  ? 43   VAL C CG2   1 
ATOM   1686  N  N     . GLY C 3 44  ? -17.912 -5.609  19.509 1.00 54.52  ? 44   GLY C N     1 
ATOM   1687  C  CA    . GLY C 3 44  ? -17.856 -4.169  19.273 1.00 53.70  ? 44   GLY C CA    1 
ATOM   1688  C  C     . GLY C 3 44  ? -16.545 -3.515  19.678 1.00 53.06  ? 44   GLY C C     1 
ATOM   1689  O  O     . GLY C 3 44  ? -15.814 -4.019  20.536 1.00 52.81  ? 44   GLY C O     1 
ATOM   1690  N  N     . ALA C 3 45  ? -16.266 -2.378  19.049 1.00 52.63  ? 45   ALA C N     1 
ATOM   1691  C  CA    . ALA C 3 45  ? -14.997 -1.668  19.184 1.00 51.87  ? 45   ALA C CA    1 
ATOM   1692  C  C     . ALA C 3 45  ? -14.909 -0.860  20.481 1.00 51.54  ? 45   ALA C C     1 
ATOM   1693  O  O     . ALA C 3 45  ? -13.812 -0.482  20.909 1.00 51.64  ? 45   ALA C O     1 
ATOM   1694  C  CB    . ALA C 3 45  ? -14.785 -0.770  17.992 1.00 51.87  ? 45   ALA C CB    1 
ATOM   1695  N  N     . GLY C 3 46  ? -16.061 -0.589  21.091 1.00 50.80  ? 46   GLY C N     1 
ATOM   1696  C  CA    . GLY C 3 46  ? -16.107 0.085   22.382 1.00 49.75  ? 46   GLY C CA    1 
ATOM   1697  C  C     . GLY C 3 46  ? -15.704 -0.840  23.513 1.00 49.19  ? 46   GLY C C     1 
ATOM   1698  O  O     . GLY C 3 46  ? -14.964 -0.441  24.421 1.00 49.72  ? 46   GLY C O     1 
ATOM   1699  N  N     . ALA C 3 47  ? -16.178 -2.084  23.433 1.00 48.21  ? 47   ALA C N     1 
ATOM   1700  C  CA    . ALA C 3 47  ? -15.969 -3.113  24.451 1.00 46.78  ? 47   ALA C CA    1 
ATOM   1701  C  C     . ALA C 3 47  ? -14.543 -3.204  25.009 1.00 45.86  ? 47   ALA C C     1 
ATOM   1702  O  O     . ALA C 3 47  ? -14.362 -3.042  26.217 1.00 45.68  ? 47   ALA C O     1 
ATOM   1703  C  CB    . ALA C 3 47  ? -16.441 -4.465  23.937 1.00 46.99  ? 47   ALA C CB    1 
ATOM   1704  N  N     . PRO C 3 48  ? -13.528 -3.418  24.147 1.00 44.86  ? 48   PRO C N     1 
ATOM   1705  C  CA    . PRO C 3 48  ? -12.178 -3.553  24.715 1.00 44.53  ? 48   PRO C CA    1 
ATOM   1706  C  C     . PRO C 3 48  ? -11.666 -2.242  25.297 1.00 44.25  ? 48   PRO C C     1 
ATOM   1707  O  O     . PRO C 3 48  ? -10.885 -2.244  26.259 1.00 44.36  ? 48   PRO C O     1 
ATOM   1708  C  CB    . PRO C 3 48  ? -11.315 -3.965  23.523 1.00 44.38  ? 48   PRO C CB    1 
ATOM   1709  C  CG    . PRO C 3 48  ? -12.066 -3.517  22.329 1.00 44.91  ? 48   PRO C CG    1 
ATOM   1710  C  CD    . PRO C 3 48  ? -13.527 -3.511  22.679 1.00 44.74  ? 48   PRO C CD    1 
ATOM   1711  N  N     . VAL C 3 49  ? -12.121 -1.131  24.729 1.00 43.60  ? 49   VAL C N     1 
ATOM   1712  C  CA    . VAL C 3 49  ? -11.723 0.168   25.218 1.00 42.92  ? 49   VAL C CA    1 
ATOM   1713  C  C     . VAL C 3 49  ? -12.228 0.279   26.644 1.00 42.30  ? 49   VAL C C     1 
ATOM   1714  O  O     . VAL C 3 49  ? -11.482 0.655   27.551 1.00 42.28  ? 49   VAL C O     1 
ATOM   1715  C  CB    . VAL C 3 49  ? -12.232 1.314   24.292 1.00 42.93  ? 49   VAL C CB    1 
ATOM   1716  C  CG1   . VAL C 3 49  ? -12.252 2.650   25.013 1.00 43.37  ? 49   VAL C CG1   1 
ATOM   1717  C  CG2   . VAL C 3 49  ? -11.349 1.410   23.075 1.00 42.02  ? 49   VAL C CG2   1 
ATOM   1718  N  N     . TYR C 3 50  ? -13.479 -0.105  26.843 1.00 41.57  ? 50   TYR C N     1 
ATOM   1719  C  CA    . TYR C 3 50  ? -14.117 0.012   28.143 1.00 41.24  ? 50   TYR C CA    1 
ATOM   1720  C  C     . TYR C 3 50  ? -13.527 -0.965  29.156 1.00 41.42  ? 50   TYR C C     1 
ATOM   1721  O  O     . TYR C 3 50  ? -13.294 -0.611  30.311 1.00 41.58  ? 50   TYR C O     1 
ATOM   1722  C  CB    . TYR C 3 50  ? -15.590 -0.265  27.971 1.00 41.04  ? 50   TYR C CB    1 
ATOM   1723  C  CG    . TYR C 3 50  ? -16.457 0.112   29.130 1.00 40.74  ? 50   TYR C CG    1 
ATOM   1724  C  CD1   . TYR C 3 50  ? -17.531 0.969   28.948 1.00 40.78  ? 50   TYR C CD1   1 
ATOM   1725  C  CD2   . TYR C 3 50  ? -16.236 -0.409  30.396 1.00 40.06  ? 50   TYR C CD2   1 
ATOM   1726  C  CE1   . TYR C 3 50  ? -18.351 1.305   29.991 1.00 40.58  ? 50   TYR C CE1   1 
ATOM   1727  C  CE2   . TYR C 3 50  ? -17.044 -0.072  31.444 1.00 40.24  ? 50   TYR C CE2   1 
ATOM   1728  C  CZ    . TYR C 3 50  ? -18.103 0.785   31.237 1.00 40.77  ? 50   TYR C CZ    1 
ATOM   1729  O  OH    . TYR C 3 50  ? -18.923 1.131   32.283 1.00 41.93  ? 50   TYR C OH    1 
ATOM   1730  N  N     . LEU C 3 51  ? -13.294 -2.198  28.715 1.00 41.32  ? 51   LEU C N     1 
ATOM   1731  C  CA    . LEU C 3 51  ? -12.778 -3.235  29.588 1.00 41.10  ? 51   LEU C CA    1 
ATOM   1732  C  C     . LEU C 3 51  ? -11.344 -2.935  30.009 1.00 41.19  ? 51   LEU C C     1 
ATOM   1733  O  O     . LEU C 3 51  ? -10.998 -3.107  31.186 1.00 41.45  ? 51   LEU C O     1 
ATOM   1734  C  CB    . LEU C 3 51  ? -12.880 -4.617  28.918 1.00 41.40  ? 51   LEU C CB    1 
ATOM   1735  C  CG    . LEU C 3 51  ? -12.322 -5.883  29.605 1.00 40.86  ? 51   LEU C CG    1 
ATOM   1736  C  CD1   . LEU C 3 51  ? -12.935 -6.159  30.971 1.00 39.08  ? 51   LEU C CD1   1 
ATOM   1737  C  CD2   . LEU C 3 51  ? -12.534 -7.069  28.702 1.00 40.76  ? 51   LEU C CD2   1 
ATOM   1738  N  N     . ALA C 3 52  ? -10.507 -2.491  29.068 1.00 40.68  ? 52   ALA C N     1 
ATOM   1739  C  CA    . ALA C 3 52  ? -9.125  -2.152  29.428 1.00 40.41  ? 52   ALA C CA    1 
ATOM   1740  C  C     . ALA C 3 52  ? -9.121  -1.029  30.465 1.00 40.42  ? 52   ALA C C     1 
ATOM   1741  O  O     . ALA C 3 52  ? -8.232  -0.948  31.325 1.00 39.97  ? 52   ALA C O     1 
ATOM   1742  C  CB    . ALA C 3 52  ? -8.327  -1.763  28.219 1.00 40.11  ? 52   ALA C CB    1 
ATOM   1743  N  N     . ALA C 3 53  ? -10.142 -0.183  30.383 1.00 40.28  ? 53   ALA C N     1 
ATOM   1744  C  CA    . ALA C 3 53  ? -10.313 0.885   31.332 1.00 40.69  ? 53   ALA C CA    1 
ATOM   1745  C  C     . ALA C 3 53  ? -10.565 0.320   32.734 1.00 40.98  ? 53   ALA C C     1 
ATOM   1746  O  O     . ALA C 3 53  ? -9.796  0.593   33.668 1.00 41.15  ? 53   ALA C O     1 
ATOM   1747  C  CB    . ALA C 3 53  ? -11.445 1.797   30.892 1.00 40.81  ? 53   ALA C CB    1 
ATOM   1748  N  N     . VAL C 3 54  ? -11.625 -0.479  32.865 1.00 40.88  ? 54   VAL C N     1 
ATOM   1749  C  CA    . VAL C 3 54  ? -12.005 -1.080  34.138 1.00 40.93  ? 54   VAL C CA    1 
ATOM   1750  C  C     . VAL C 3 54  ? -10.834 -1.873  34.720 1.00 41.08  ? 54   VAL C C     1 
ATOM   1751  O  O     . VAL C 3 54  ? -10.536 -1.807  35.919 1.00 41.15  ? 54   VAL C O     1 
ATOM   1752  C  CB    . VAL C 3 54  ? -13.251 -1.985  33.966 1.00 41.13  ? 54   VAL C CB    1 
ATOM   1753  C  CG1   . VAL C 3 54  ? -13.608 -2.704  35.267 1.00 40.81  ? 54   VAL C CG1   1 
ATOM   1754  C  CG2   . VAL C 3 54  ? -14.431 -1.165  33.475 1.00 40.76  ? 54   VAL C CG2   1 
ATOM   1755  N  N     . LEU C 3 55  ? -10.152 -2.594  33.847 1.00 41.30  ? 55   LEU C N     1 
ATOM   1756  C  CA    . LEU C 3 55  ? -9.034  -3.398  34.257 1.00 41.99  ? 55   LEU C CA    1 
ATOM   1757  C  C     . LEU C 3 55  ? -7.897  -2.543  34.796 1.00 42.66  ? 55   LEU C C     1 
ATOM   1758  O  O     . LEU C 3 55  ? -7.245  -2.927  35.756 1.00 42.32  ? 55   LEU C O     1 
ATOM   1759  C  CB    . LEU C 3 55  ? -8.591  -4.307  33.105 1.00 42.18  ? 55   LEU C CB    1 
ATOM   1760  C  CG    . LEU C 3 55  ? -9.562  -5.475  32.819 1.00 41.77  ? 55   LEU C CG    1 
ATOM   1761  C  CD1   . LEU C 3 55  ? -9.146  -6.260  31.620 1.00 41.84  ? 55   LEU C CD1   1 
ATOM   1762  C  CD2   . LEU C 3 55  ? -9.700  -6.410  34.015 1.00 40.70  ? 55   LEU C CD2   1 
ATOM   1763  N  N     . GLU C 3 56  ? -7.708  -1.361  34.204 1.00 43.73  ? 56   GLU C N     1 
ATOM   1764  C  CA    . GLU C 3 56  ? -6.650  -0.423  34.602 1.00 44.23  ? 56   GLU C CA    1 
ATOM   1765  C  C     . GLU C 3 56  ? -6.998  0.279   35.892 1.00 43.91  ? 56   GLU C C     1 
ATOM   1766  O  O     . GLU C 3 56  ? -6.124  0.536   36.723 1.00 44.34  ? 56   GLU C O     1 
ATOM   1767  C  CB    . GLU C 3 56  ? -6.445  0.630   33.524 1.00 44.88  ? 56   GLU C CB    1 
ATOM   1768  C  CG    . GLU C 3 56  ? -5.220  1.509   33.703 1.00 46.63  ? 56   GLU C CG    1 
ATOM   1769  C  CD    . GLU C 3 56  ? -4.981  2.388   32.486 1.00 50.04  ? 56   GLU C CD    1 
ATOM   1770  O  OE1   . GLU C 3 56  ? -4.712  1.830   31.397 1.00 50.35  ? 56   GLU C OE1   1 
ATOM   1771  O  OE2   . GLU C 3 56  ? -5.069  3.635   32.612 1.00 52.13  ? 56   GLU C OE2   1 
ATOM   1772  N  N     . TYR C 3 57  ? -8.271  0.610   36.049 1.00 43.33  ? 57   TYR C N     1 
ATOM   1773  C  CA    . TYR C 3 57  ? -8.719  1.284   37.253 1.00 43.08  ? 57   TYR C CA    1 
ATOM   1774  C  C     . TYR C 3 57  ? -8.515  0.369   38.456 1.00 42.78  ? 57   TYR C C     1 
ATOM   1775  O  O     . TYR C 3 57  ? -8.002  0.802   39.485 1.00 42.80  ? 57   TYR C O     1 
ATOM   1776  C  CB    . TYR C 3 57  ? -10.184 1.685   37.121 1.00 43.44  ? 57   TYR C CB    1 
ATOM   1777  C  CG    . TYR C 3 57  ? -10.910 1.826   38.432 1.00 44.39  ? 57   TYR C CG    1 
ATOM   1778  C  CD1   . TYR C 3 57  ? -10.637 2.890   39.297 1.00 45.64  ? 57   TYR C CD1   1 
ATOM   1779  C  CD2   . TYR C 3 57  ? -11.886 0.899   38.808 1.00 44.86  ? 57   TYR C CD2   1 
ATOM   1780  C  CE1   . TYR C 3 57  ? -11.323 3.023   40.515 1.00 46.42  ? 57   TYR C CE1   1 
ATOM   1781  C  CE2   . TYR C 3 57  ? -12.577 1.019   40.020 1.00 44.89  ? 57   TYR C CE2   1 
ATOM   1782  C  CZ    . TYR C 3 57  ? -12.287 2.078   40.868 1.00 45.60  ? 57   TYR C CZ    1 
ATOM   1783  O  OH    . TYR C 3 57  ? -12.963 2.202   42.062 1.00 45.45  ? 57   TYR C OH    1 
ATOM   1784  N  N     . LEU C 3 58  ? -8.906  -0.899  38.310 1.00 41.87  ? 58   LEU C N     1 
ATOM   1785  C  CA    . LEU C 3 58  ? -8.791  -1.855  39.396 1.00 40.69  ? 58   LEU C CA    1 
ATOM   1786  C  C     . LEU C 3 58  ? -7.347  -2.105  39.790 1.00 40.35  ? 58   LEU C C     1 
ATOM   1787  O  O     . LEU C 3 58  ? -7.031  -2.098  40.972 1.00 40.48  ? 58   LEU C O     1 
ATOM   1788  C  CB    . LEU C 3 58  ? -9.482  -3.164  39.047 1.00 40.42  ? 58   LEU C CB    1 
ATOM   1789  C  CG    . LEU C 3 58  ? -10.997 -3.150  39.120 1.00 39.98  ? 58   LEU C CG    1 
ATOM   1790  C  CD1   . LEU C 3 58  ? -11.538 -4.428  38.533 1.00 39.88  ? 58   LEU C CD1   1 
ATOM   1791  C  CD2   . LEU C 3 58  ? -11.505 -2.954  40.546 1.00 39.01  ? 58   LEU C CD2   1 
ATOM   1792  N  N     . THR C 3 59  ? -6.461  -2.311  38.821 1.00 39.87  ? 59   THR C N     1 
ATOM   1793  C  CA    . THR C 3 59  ? -5.063  -2.539  39.181 1.00 39.26  ? 59   THR C CA    1 
ATOM   1794  C  C     . THR C 3 59  ? -4.458  -1.302  39.853 1.00 39.22  ? 59   THR C C     1 
ATOM   1795  O  O     . THR C 3 59  ? -3.574  -1.436  40.704 1.00 38.99  ? 59   THR C O     1 
ATOM   1796  C  CB    . THR C 3 59  ? -4.183  -3.065  38.010 1.00 39.07  ? 59   THR C CB    1 
ATOM   1797  O  OG1   . THR C 3 59  ? -3.108  -2.164  37.730 1.00 38.23  ? 59   THR C OG1   1 
ATOM   1798  C  CG2   . THR C 3 59  ? -4.994  -3.298  36.789 1.00 38.32  ? 59   THR C CG2   1 
ATOM   1799  N  N     . ALA C 3 60  ? -4.958  -0.113  39.496 1.00 38.94  ? 60   ALA C N     1 
ATOM   1800  C  CA    . ALA C 3 60  ? -4.515  1.141   40.134 1.00 38.85  ? 60   ALA C CA    1 
ATOM   1801  C  C     . ALA C 3 60  ? -4.898  1.211   41.615 1.00 38.92  ? 60   ALA C C     1 
ATOM   1802  O  O     . ALA C 3 60  ? -4.065  1.533   42.471 1.00 38.76  ? 60   ALA C O     1 
ATOM   1803  C  CB    . ALA C 3 60  ? -5.061  2.334   39.396 1.00 38.81  ? 60   ALA C CB    1 
ATOM   1804  N  N     . GLU C 3 61  ? -6.159  0.896   41.898 1.00 38.92  ? 61   GLU C N     1 
ATOM   1805  C  CA    . GLU C 3 61  ? -6.692  0.846   43.249 1.00 39.18  ? 61   GLU C CA    1 
ATOM   1806  C  C     . GLU C 3 61  ? -5.879  -0.113  44.129 1.00 39.64  ? 61   GLU C C     1 
ATOM   1807  O  O     . GLU C 3 61  ? -5.437  0.245   45.227 1.00 39.68  ? 61   GLU C O     1 
ATOM   1808  C  CB    . GLU C 3 61  ? -8.156  0.429   43.184 1.00 38.68  ? 61   GLU C CB    1 
ATOM   1809  C  CG    . GLU C 3 61  ? -8.829  0.270   44.512 1.00 41.31  ? 61   GLU C CG    1 
ATOM   1810  C  CD    . GLU C 3 61  ? -9.098  1.587   45.237 1.00 46.63  ? 61   GLU C CD    1 
ATOM   1811  O  OE1   . GLU C 3 61  ? -9.055  2.680   44.604 1.00 48.57  ? 61   GLU C OE1   1 
ATOM   1812  O  OE2   . GLU C 3 61  ? -9.384  1.520   46.460 1.00 48.84  ? 61   GLU C OE2   1 
ATOM   1813  N  N     . ILE C 3 62  ? -5.660  -1.327  43.635 1.00 39.83  ? 62   ILE C N     1 
ATOM   1814  C  CA    . ILE C 3 62  ? -4.976  -2.331  44.420 1.00 40.15  ? 62   ILE C CA    1 
ATOM   1815  C  C     . ILE C 3 62  ? -3.487  -1.957  44.623 1.00 40.05  ? 62   ILE C C     1 
ATOM   1816  O  O     . ILE C 3 62  ? -2.947  -2.140  45.715 1.00 40.19  ? 62   ILE C O     1 
ATOM   1817  C  CB    . ILE C 3 62  ? -5.203  -3.730  43.835 1.00 40.10  ? 62   ILE C CB    1 
ATOM   1818  C  CG1   . ILE C 3 62  ? -4.757  -4.817  44.788 1.00 41.06  ? 62   ILE C CG1   1 
ATOM   1819  C  CG2   . ILE C 3 62  ? -4.435  -3.927  42.578 1.00 42.00  ? 62   ILE C CG2   1 
ATOM   1820  C  CD1   . ILE C 3 62  ? -5.411  -6.160  44.439 1.00 43.32  ? 62   ILE C CD1   1 
ATOM   1821  N  N     . LEU C 3 63  ? -2.849  -1.381  43.605 1.00 39.53  ? 63   LEU C N     1 
ATOM   1822  C  CA    . LEU C 3 63  ? -1.484  -0.880  43.766 1.00 39.30  ? 63   LEU C CA    1 
ATOM   1823  C  C     . LEU C 3 63  ? -1.375  0.333   44.720 1.00 39.45  ? 63   LEU C C     1 
ATOM   1824  O  O     . LEU C 3 63  ? -0.407  0.447   45.481 1.00 39.29  ? 63   LEU C O     1 
ATOM   1825  C  CB    . LEU C 3 63  ? -0.856  -0.560  42.413 1.00 38.88  ? 63   LEU C CB    1 
ATOM   1826  C  CG    . LEU C 3 63  ? -0.489  -1.746  41.522 1.00 38.83  ? 63   LEU C CG    1 
ATOM   1827  C  CD1   . LEU C 3 63  ? -0.214  -1.247  40.139 1.00 37.66  ? 63   LEU C CD1   1 
ATOM   1828  C  CD2   . LEU C 3 63  ? 0.696   -2.565  42.055 1.00 37.71  ? 63   LEU C CD2   1 
ATOM   1829  N  N     . GLU C 3 64  ? -2.362  1.225   44.684 1.00 39.48  ? 64   GLU C N     1 
ATOM   1830  C  CA    . GLU C 3 64  ? -2.384  2.355   45.598 1.00 39.69  ? 64   GLU C CA    1 
ATOM   1831  C  C     . GLU C 3 64  ? -2.322  1.813   47.008 1.00 39.89  ? 64   GLU C C     1 
ATOM   1832  O  O     . GLU C 3 64  ? -1.405  2.122   47.762 1.00 39.90  ? 64   GLU C O     1 
ATOM   1833  C  CB    . GLU C 3 64  ? -3.660  3.175   45.413 1.00 39.82  ? 64   GLU C CB    1 
ATOM   1834  C  CG    . GLU C 3 64  ? -3.765  4.399   46.316 1.00 40.22  ? 64   GLU C CG    1 
ATOM   1835  C  CD    . GLU C 3 64  ? -2.679  5.420   46.050 1.00 40.61  ? 64   GLU C CD    1 
ATOM   1836  O  OE1   . GLU C 3 64  ? -2.061  5.912   47.009 1.00 42.63  ? 64   GLU C OE1   1 
ATOM   1837  O  OE2   . GLU C 3 64  ? -2.438  5.735   44.881 1.00 41.68  ? 64   GLU C OE2   1 
ATOM   1838  N  N     . LEU C 3 65  ? -3.303  0.976   47.339 1.00 40.41  ? 65   LEU C N     1 
ATOM   1839  C  CA    . LEU C 3 65  ? -3.420  0.354   48.664 1.00 40.31  ? 65   LEU C CA    1 
ATOM   1840  C  C     . LEU C 3 65  ? -2.260  -0.594  49.031 1.00 40.29  ? 65   LEU C C     1 
ATOM   1841  O  O     . LEU C 3 65  ? -1.866  -0.676  50.205 1.00 40.36  ? 65   LEU C O     1 
ATOM   1842  C  CB    . LEU C 3 65  ? -4.761  -0.360  48.789 1.00 39.98  ? 65   LEU C CB    1 
ATOM   1843  C  CG    . LEU C 3 65  ? -5.971  0.563   48.675 1.00 39.96  ? 65   LEU C CG    1 
ATOM   1844  C  CD1   . LEU C 3 65  ? -7.224  -0.250  48.387 1.00 40.92  ? 65   LEU C CD1   1 
ATOM   1845  C  CD2   . LEU C 3 65  ? -6.153  1.389   49.930 1.00 39.64  ? 65   LEU C CD2   1 
ATOM   1846  N  N     . ALA C 3 66  ? -1.715  -1.292  48.039 1.00 39.84  ? 66   ALA C N     1 
ATOM   1847  C  CA    . ALA C 3 66  ? -0.578  -2.173  48.281 1.00 39.95  ? 66   ALA C CA    1 
ATOM   1848  C  C     . ALA C 3 66  ? 0.669   -1.369  48.618 1.00 39.84  ? 66   ALA C C     1 
ATOM   1849  O  O     . ALA C 3 66  ? 1.459   -1.759  49.488 1.00 39.28  ? 66   ALA C O     1 
ATOM   1850  C  CB    . ALA C 3 66  ? -0.320  -3.043  47.079 1.00 40.30  ? 66   ALA C CB    1 
ATOM   1851  N  N     . GLY C 3 67  ? 0.825   -0.244  47.917 1.00 39.74  ? 67   GLY C N     1 
ATOM   1852  C  CA    . GLY C 3 67  ? 1.921   0.692   48.153 1.00 39.05  ? 67   GLY C CA    1 
ATOM   1853  C  C     . GLY C 3 67  ? 1.906   1.236   49.566 1.00 38.76  ? 67   GLY C C     1 
ATOM   1854  O  O     . GLY C 3 67  ? 2.951   1.433   50.177 1.00 38.63  ? 67   GLY C O     1 
ATOM   1855  N  N     . ASN C 3 68  ? 0.718   1.480   50.100 1.00 38.60  ? 68   ASN C N     1 
ATOM   1856  C  CA    . ASN C 3 68  ? 0.642   2.037   51.426 1.00 38.76  ? 68   ASN C CA    1 
ATOM   1857  C  C     . ASN C 3 68  ? 1.112   1.016   52.432 1.00 39.23  ? 68   ASN C C     1 
ATOM   1858  O  O     . ASN C 3 68  ? 1.883   1.342   53.330 1.00 39.21  ? 68   ASN C O     1 
ATOM   1859  C  CB    . ASN C 3 68  ? -0.768  2.489   51.733 1.00 38.88  ? 68   ASN C CB    1 
ATOM   1860  C  CG    . ASN C 3 68  ? -1.247  3.585   50.797 1.00 39.40  ? 68   ASN C CG    1 
ATOM   1861  O  OD1   . ASN C 3 68  ? -0.451  4.234   50.097 1.00 37.20  ? 68   ASN C OD1   1 
ATOM   1862  N  ND2   . ASN C 3 68  ? -2.565  3.805   50.787 1.00 39.87  ? 68   ASN C ND2   1 
ATOM   1863  N  N     . ALA C 3 69  ? 0.677   -0.233  52.252 1.00 39.92  ? 69   ALA C N     1 
ATOM   1864  C  CA    . ALA C 3 69  ? 1.098   -1.339  53.108 1.00 40.06  ? 69   ALA C CA    1 
ATOM   1865  C  C     . ALA C 3 69  ? 2.610   -1.504  53.074 1.00 40.54  ? 69   ALA C C     1 
ATOM   1866  O  O     . ALA C 3 69  ? 3.245   -1.659  54.112 1.00 40.12  ? 69   ALA C O     1 
ATOM   1867  C  CB    . ALA C 3 69  ? 0.424   -2.600  52.695 1.00 40.09  ? 69   ALA C CB    1 
ATOM   1868  N  N     . ALA C 3 70  ? 3.190   -1.442  51.881 1.00 41.52  ? 70   ALA C N     1 
ATOM   1869  C  CA    . ALA C 3 70  ? 4.635   -1.504  51.766 1.00 42.83  ? 70   ALA C CA    1 
ATOM   1870  C  C     . ALA C 3 70  ? 5.239   -0.378  52.578 1.00 44.28  ? 70   ALA C C     1 
ATOM   1871  O  O     . ALA C 3 70  ? 6.212   -0.593  53.292 1.00 45.05  ? 70   ALA C O     1 
ATOM   1872  C  CB    . ALA C 3 70  ? 5.077   -1.432  50.341 1.00 41.93  ? 70   ALA C CB    1 
ATOM   1873  N  N     . ARG C 3 71  ? 4.650   0.813   52.506 1.00 45.83  ? 71   ARG C N     1 
ATOM   1874  C  CA    . ARG C 3 71  ? 5.213   1.942   53.224 1.00 47.67  ? 71   ARG C CA    1 
ATOM   1875  C  C     . ARG C 3 71  ? 5.032   1.762   54.725 1.00 47.99  ? 71   ARG C C     1 
ATOM   1876  O  O     . ARG C 3 71  ? 5.969   1.982   55.489 1.00 48.23  ? 71   ARG C O     1 
ATOM   1877  C  CB    . ARG C 3 71  ? 4.614   3.263   52.749 1.00 47.69  ? 71   ARG C CB    1 
ATOM   1878  C  CG    . ARG C 3 71  ? 5.205   4.488   53.436 1.00 48.92  ? 71   ARG C CG    1 
ATOM   1879  C  CD    . ARG C 3 71  ? 4.549   5.787   53.009 1.00 49.67  ? 71   ARG C CD    1 
ATOM   1880  N  NE    . ARG C 3 71  ? 4.938   6.204   51.654 1.00 55.05  ? 71   ARG C NE    1 
ATOM   1881  C  CZ    . ARG C 3 71  ? 4.884   7.460   51.199 1.00 56.86  ? 71   ARG C CZ    1 
ATOM   1882  N  NH1   . ARG C 3 71  ? 4.472   8.451   51.988 1.00 57.78  ? 71   ARG C NH1   1 
ATOM   1883  N  NH2   . ARG C 3 71  ? 5.245   7.732   49.948 1.00 57.42  ? 71   ARG C NH2   1 
ATOM   1884  N  N     . ASP C 3 72  ? 3.837   1.342   55.135 1.00 48.88  ? 72   ASP C N     1 
ATOM   1885  C  CA    . ASP C 3 72  ? 3.514   1.109   56.548 1.00 49.70  ? 72   ASP C CA    1 
ATOM   1886  C  C     . ASP C 3 72  ? 4.443   0.102   57.225 1.00 50.42  ? 72   ASP C C     1 
ATOM   1887  O  O     . ASP C 3 72  ? 4.374   -0.091  58.437 1.00 50.88  ? 72   ASP C O     1 
ATOM   1888  C  CB    . ASP C 3 72  ? 2.079   0.598   56.684 1.00 49.35  ? 72   ASP C CB    1 
ATOM   1889  C  CG    . ASP C 3 72  ? 1.048   1.662   56.424 1.00 49.68  ? 72   ASP C CG    1 
ATOM   1890  O  OD1   . ASP C 3 72  ? 1.364   2.869   56.469 1.00 50.36  ? 72   ASP C OD1   1 
ATOM   1891  O  OD2   . ASP C 3 72  ? -0.106  1.284   56.176 1.00 51.09  ? 72   ASP C OD2   1 
ATOM   1892  N  N     . ASN C 3 73  ? 5.295   -0.541  56.432 1.00 51.21  ? 73   ASN C N     1 
ATOM   1893  C  CA    . ASN C 3 73  ? 6.123   -1.646  56.887 1.00 51.98  ? 73   ASN C CA    1 
ATOM   1894  C  C     . ASN C 3 73  ? 7.584   -1.371  56.622 1.00 51.95  ? 73   ASN C C     1 
ATOM   1895  O  O     . ASN C 3 73  ? 8.407   -2.286  56.687 1.00 52.28  ? 73   ASN C O     1 
ATOM   1896  C  CB    . ASN C 3 73  ? 5.734   -2.936  56.158 1.00 52.44  ? 73   ASN C CB    1 
ATOM   1897  C  CG    . ASN C 3 73  ? 4.412   -3.502  56.629 1.00 54.22  ? 73   ASN C CG    1 
ATOM   1898  O  OD1   . ASN C 3 73  ? 4.390   -4.508  57.333 1.00 57.23  ? 73   ASN C OD1   1 
ATOM   1899  N  ND2   . ASN C 3 73  ? 3.301   -2.860  56.251 1.00 54.77  ? 73   ASN C ND2   1 
ATOM   1900  N  N     . LYS C 3 74  ? 7.895   -0.118  56.300 1.00 51.74  ? 74   LYS C N     1 
ATOM   1901  C  CA    . LYS C 3 74  ? 9.270   0.330   56.031 1.00 51.81  ? 74   LYS C CA    1 
ATOM   1902  C  C     . LYS C 3 74  ? 9.938   -0.377  54.845 1.00 50.72  ? 74   LYS C C     1 
ATOM   1903  O  O     . LYS C 3 74  ? 11.157  -0.462  54.754 1.00 50.61  ? 74   LYS C O     1 
ATOM   1904  C  CB    . LYS C 3 74  ? 10.126  0.266   57.310 1.00 52.84  ? 74   LYS C CB    1 
ATOM   1905  C  CG    . LYS C 3 74  ? 9.893   1.454   58.245 1.00 55.40  ? 74   LYS C CG    1 
ATOM   1906  C  CD    . LYS C 3 74  ? 9.764   1.059   59.729 1.00 57.73  ? 74   LYS C CD    1 
ATOM   1907  C  CE    . LYS C 3 74  ? 9.296   2.292   60.564 1.00 58.52  ? 74   LYS C CE    1 
ATOM   1908  N  NZ    . LYS C 3 74  ? 8.988   2.020   62.025 1.00 58.83  ? 74   LYS C NZ    1 
ATOM   1909  N  N     . LYS C 3 75  ? 9.125   -0.860  53.920 1.00 49.70  ? 75   LYS C N     1 
ATOM   1910  C  CA    . LYS C 3 75  ? 9.630   -1.499  52.710 1.00 48.67  ? 75   LYS C CA    1 
ATOM   1911  C  C     . LYS C 3 75  ? 9.310   -0.626  51.510 1.00 47.64  ? 75   LYS C C     1 
ATOM   1912  O  O     . LYS C 3 75  ? 8.433   0.232   51.569 1.00 47.37  ? 75   LYS C O     1 
ATOM   1913  C  CB    . LYS C 3 75  ? 8.978   -2.866  52.513 1.00 48.88  ? 75   LYS C CB    1 
ATOM   1914  C  CG    . LYS C 3 75  ? 8.852   -3.682  53.767 1.00 49.17  ? 75   LYS C CG    1 
ATOM   1915  C  CD    . LYS C 3 75  ? 9.972   -4.682  53.889 1.00 50.34  ? 75   LYS C CD    1 
ATOM   1916  C  CE    . LYS C 3 75  ? 9.826   -5.463  55.171 1.00 51.53  ? 75   LYS C CE    1 
ATOM   1917  N  NZ    . LYS C 3 75  ? 10.171  -4.597  56.331 1.00 53.43  ? 75   LYS C NZ    1 
ATOM   1918  N  N     . THR C 3 76  ? 10.005  -0.895  50.416 1.00 46.48  ? 76   THR C N     1 
ATOM   1919  C  CA    . THR C 3 76  ? 9.992   -0.065  49.234 1.00 45.46  ? 76   THR C CA    1 
ATOM   1920  C  C     . THR C 3 76  ? 9.535   -0.904  48.068 1.00 44.63  ? 76   THR C C     1 
ATOM   1921  O  O     . THR C 3 76  ? 9.079   -0.381  47.048 1.00 44.59  ? 76   THR C O     1 
ATOM   1922  C  CB    . THR C 3 76  ? 11.409  0.488   48.981 1.00 45.71  ? 76   THR C CB    1 
ATOM   1923  O  OG1   . THR C 3 76  ? 11.610  1.625   49.823 1.00 46.52  ? 76   THR C OG1   1 
ATOM   1924  C  CG2   . THR C 3 76  ? 11.627  0.897   47.525 1.00 45.91  ? 76   THR C CG2   1 
ATOM   1925  N  N     . ARG C 3 77  ? 9.666   -2.220  48.218 1.00 43.65  ? 77   ARG C N     1 
ATOM   1926  C  CA    . ARG C 3 77  ? 9.182   -3.136  47.199 1.00 41.99  ? 77   ARG C CA    1 
ATOM   1927  C  C     . ARG C 3 77  ? 7.938   -3.854  47.671 1.00 40.25  ? 77   ARG C C     1 
ATOM   1928  O  O     . ARG C 3 77  ? 7.962   -4.504  48.714 1.00 40.24  ? 77   ARG C O     1 
ATOM   1929  C  CB    . ARG C 3 77  ? 10.254  -4.136  46.839 1.00 42.15  ? 77   ARG C CB    1 
ATOM   1930  C  CG    . ARG C 3 77  ? 9.943   -4.844  45.548 1.00 44.45  ? 77   ARG C CG    1 
ATOM   1931  C  CD    . ARG C 3 77  ? 10.958  -5.918  45.254 1.00 47.58  ? 77   ARG C CD    1 
ATOM   1932  N  NE    . ARG C 3 77  ? 12.255  -5.349  44.921 1.00 49.58  ? 77   ARG C NE    1 
ATOM   1933  C  CZ    . ARG C 3 77  ? 13.357  -5.534  45.635 1.00 51.26  ? 77   ARG C CZ    1 
ATOM   1934  N  NH1   . ARG C 3 77  ? 13.332  -6.286  46.730 1.00 52.43  ? 77   ARG C NH1   1 
ATOM   1935  N  NH2   . ARG C 3 77  ? 14.489  -4.969  45.245 1.00 52.43  ? 77   ARG C NH2   1 
ATOM   1936  N  N     . ILE C 3 78  ? 6.856   -3.717  46.910 1.00 38.41  ? 78   ILE C N     1 
ATOM   1937  C  CA    . ILE C 3 78  ? 5.625   -4.474  47.150 1.00 37.01  ? 78   ILE C CA    1 
ATOM   1938  C  C     . ILE C 3 78  ? 5.863   -5.995  46.994 1.00 36.79  ? 78   ILE C C     1 
ATOM   1939  O  O     . ILE C 3 78  ? 6.338   -6.461  45.947 1.00 36.61  ? 78   ILE C O     1 
ATOM   1940  C  CB    . ILE C 3 78  ? 4.496   -4.056  46.174 1.00 36.92  ? 78   ILE C CB    1 
ATOM   1941  C  CG1   . ILE C 3 78  ? 4.056   -2.608  46.426 1.00 36.12  ? 78   ILE C CG1   1 
ATOM   1942  C  CG2   . ILE C 3 78  ? 3.313   -5.029  46.276 1.00 36.32  ? 78   ILE C CG2   1 
ATOM   1943  C  CD1   . ILE C 3 78  ? 3.094   -2.051  45.405 1.00 36.26  ? 78   ILE C CD1   1 
ATOM   1944  N  N     . ILE C 3 79  ? 5.547   -6.748  48.046 1.00 35.92  ? 79   ILE C N     1 
ATOM   1945  C  CA    . ILE C 3 79  ? 5.569   -8.214  48.020 1.00 34.59  ? 79   ILE C CA    1 
ATOM   1946  C  C     . ILE C 3 79  ? 4.144   -8.745  48.227 1.00 34.98  ? 79   ILE C C     1 
ATOM   1947  O  O     . ILE C 3 79  ? 3.271   -8.003  48.670 1.00 35.65  ? 79   ILE C O     1 
ATOM   1948  C  CB    . ILE C 3 79  ? 6.569   -8.808  49.089 1.00 35.10  ? 79   ILE C CB    1 
ATOM   1949  C  CG1   . ILE C 3 79  ? 6.076   -8.619  50.536 1.00 32.53  ? 79   ILE C CG1   1 
ATOM   1950  C  CG2   . ILE C 3 79  ? 7.985   -8.238  48.881 1.00 35.07  ? 79   ILE C CG2   1 
ATOM   1951  C  CD1   . ILE C 3 79  ? 6.943   -9.301  51.567 1.00 31.34  ? 79   ILE C CD1   1 
ATOM   1952  N  N     . PRO C 3 80  ? 3.890   -10.028 47.922 1.00 34.67  ? 80   PRO C N     1 
ATOM   1953  C  CA    . PRO C 3 80  ? 2.533   -10.571 48.098 1.00 34.13  ? 80   PRO C CA    1 
ATOM   1954  C  C     . PRO C 3 80  ? 1.849   -10.233 49.415 1.00 33.69  ? 80   PRO C C     1 
ATOM   1955  O  O     . PRO C 3 80  ? 0.667   -9.948  49.393 1.00 33.97  ? 80   PRO C O     1 
ATOM   1956  C  CB    . PRO C 3 80  ? 2.749   -12.062 47.976 1.00 33.94  ? 80   PRO C CB    1 
ATOM   1957  C  CG    . PRO C 3 80  ? 3.845   -12.137 46.987 1.00 34.62  ? 80   PRO C CG    1 
ATOM   1958  C  CD    . PRO C 3 80  ? 4.795   -11.048 47.377 1.00 34.81  ? 80   PRO C CD    1 
ATOM   1959  N  N     . ARG C 3 81  ? 2.566   -10.245 50.539 1.00 33.25  ? 81   ARG C N     1 
ATOM   1960  C  CA    . ARG C 3 81  ? 1.976   -9.822  51.819 1.00 33.00  ? 81   ARG C CA    1 
ATOM   1961  C  C     . ARG C 3 81  ? 1.287   -8.468  51.697 1.00 33.06  ? 81   ARG C C     1 
ATOM   1962  O  O     . ARG C 3 81  ? 0.232   -8.229  52.298 1.00 33.11  ? 81   ARG C O     1 
ATOM   1963  C  CB    . ARG C 3 81  ? 3.032   -9.742  52.921 1.00 32.74  ? 81   ARG C CB    1 
ATOM   1964  C  CG    . ARG C 3 81  ? 2.557   -9.052  54.173 1.00 33.21  ? 81   ARG C CG    1 
ATOM   1965  C  CD    . ARG C 3 81  ? 2.453   -9.983  55.386 1.00 34.70  ? 81   ARG C CD    1 
ATOM   1966  N  NE    . ARG C 3 81  ? 1.170   -10.670 55.491 1.00 34.71  ? 81   ARG C NE    1 
ATOM   1967  C  CZ    . ARG C 3 81  ? 0.438   -10.761 56.604 1.00 35.07  ? 81   ARG C CZ    1 
ATOM   1968  N  NH1   . ARG C 3 81  ? 0.848   -10.229 57.741 1.00 32.68  ? 81   ARG C NH1   1 
ATOM   1969  N  NH2   . ARG C 3 81  ? -0.713  -11.416 56.582 1.00 35.93  ? 81   ARG C NH2   1 
ATOM   1970  N  N     . HIS C 3 82  ? 1.887   -7.574  50.914 1.00 32.89  ? 82   HIS C N     1 
ATOM   1971  C  CA    . HIS C 3 82  ? 1.360   -6.213  50.801 1.00 32.31  ? 82   HIS C CA    1 
ATOM   1972  C  C     . HIS C 3 82  ? 0.057   -6.217  50.042 1.00 32.32  ? 82   HIS C C     1 
ATOM   1973  O  O     . HIS C 3 82  ? -0.852  -5.430  50.360 1.00 33.14  ? 82   HIS C O     1 
ATOM   1974  C  CB    . HIS C 3 82  ? 2.375   -5.257  50.172 1.00 31.68  ? 82   HIS C CB    1 
ATOM   1975  C  CG    . HIS C 3 82  ? 3.652   -5.176  50.939 1.00 30.75  ? 82   HIS C CG    1 
ATOM   1976  N  ND1   . HIS C 3 82  ? 4.889   -5.201  50.333 1.00 30.43  ? 82   HIS C ND1   1 
ATOM   1977  C  CD2   . HIS C 3 82  ? 3.885   -5.128  52.274 1.00 29.73  ? 82   HIS C CD2   1 
ATOM   1978  C  CE1   . HIS C 3 82  ? 5.831   -5.155  51.262 1.00 30.71  ? 82   HIS C CE1   1 
ATOM   1979  N  NE2   . HIS C 3 82  ? 5.249   -5.111  52.448 1.00 29.77  ? 82   HIS C NE2   1 
ATOM   1980  N  N     . LEU C 3 83  ? -0.043  -7.110  49.057 1.00 31.43  ? 83   LEU C N     1 
ATOM   1981  C  CA    . LEU C 3 83  ? -1.276  -7.251  48.294 1.00 30.68  ? 83   LEU C CA    1 
ATOM   1982  C  C     . LEU C 3 83  ? -2.374  -7.780  49.195 1.00 30.64  ? 83   LEU C C     1 
ATOM   1983  O  O     . LEU C 3 83  ? -3.530  -7.317  49.151 1.00 30.22  ? 83   LEU C O     1 
ATOM   1984  C  CB    . LEU C 3 83  ? -1.067  -8.180  47.113 1.00 30.15  ? 83   LEU C CB    1 
ATOM   1985  C  CG    . LEU C 3 83  ? -0.129  -7.630  46.044 1.00 30.01  ? 83   LEU C CG    1 
ATOM   1986  C  CD1   . LEU C 3 83  ? 0.138   -8.645  44.915 1.00 26.74  ? 83   LEU C CD1   1 
ATOM   1987  C  CD2   . LEU C 3 83  ? -0.695  -6.301  45.509 1.00 29.65  ? 83   LEU C CD2   1 
ATOM   1988  N  N     . GLN C 3 84  ? -1.997  -8.738  50.033 1.00 30.65  ? 84   GLN C N     1 
ATOM   1989  C  CA    . GLN C 3 84  ? -2.956  -9.356  50.916 1.00 31.25  ? 84   GLN C CA    1 
ATOM   1990  C  C     . GLN C 3 84  ? -3.451  -8.322  51.958 1.00 31.19  ? 84   GLN C C     1 
ATOM   1991  O  O     . GLN C 3 84  ? -4.653  -8.228  52.240 1.00 30.96  ? 84   GLN C O     1 
ATOM   1992  C  CB    . GLN C 3 84  ? -2.372  -10.615 51.552 1.00 30.88  ? 84   GLN C CB    1 
ATOM   1993  C  CG    . GLN C 3 84  ? -3.173  -11.135 52.747 1.00 32.74  ? 84   GLN C CG    1 
ATOM   1994  C  CD    . GLN C 3 84  ? -4.351  -12.056 52.390 1.00 34.14  ? 84   GLN C CD    1 
ATOM   1995  O  OE1   . GLN C 3 84  ? -5.069  -11.858 51.387 1.00 34.43  ? 84   GLN C OE1   1 
ATOM   1996  N  NE2   . GLN C 3 84  ? -4.568  -13.060 53.242 1.00 32.35  ? 84   GLN C NE2   1 
ATOM   1997  N  N     . LEU C 3 85  ? -2.534  -7.523  52.486 1.00 30.82  ? 85   LEU C N     1 
ATOM   1998  C  CA    . LEU C 3 85  ? -2.931  -6.502  53.424 1.00 30.97  ? 85   LEU C CA    1 
ATOM   1999  C  C     . LEU C 3 85  ? -3.958  -5.565  52.783 1.00 30.67  ? 85   LEU C C     1 
ATOM   2000  O  O     . LEU C 3 85  ? -5.016  -5.307  53.377 1.00 30.51  ? 85   LEU C O     1 
ATOM   2001  C  CB    . LEU C 3 85  ? -1.708  -5.752  53.964 1.00 31.63  ? 85   LEU C CB    1 
ATOM   2002  C  CG    . LEU C 3 85  ? -0.857  -6.600  54.933 1.00 32.20  ? 85   LEU C CG    1 
ATOM   2003  C  CD1   . LEU C 3 85  ? 0.478   -5.938  55.244 1.00 33.97  ? 85   LEU C CD1   1 
ATOM   2004  C  CD2   . LEU C 3 85  ? -1.602  -6.871  56.210 1.00 32.37  ? 85   LEU C CD2   1 
ATOM   2005  N  N     . ALA C 3 86  ? -3.666  -5.113  51.563 1.00 30.05  ? 86   ALA C N     1 
ATOM   2006  C  CA    . ALA C 3 86  ? -4.549  -4.232  50.809 1.00 30.14  ? 86   ALA C CA    1 
ATOM   2007  C  C     . ALA C 3 86  ? -5.964  -4.789  50.622 1.00 30.77  ? 86   ALA C C     1 
ATOM   2008  O  O     . ALA C 3 86  ? -6.924  -4.285  51.193 1.00 30.80  ? 86   ALA C O     1 
ATOM   2009  C  CB    . ALA C 3 86  ? -3.927  -3.903  49.480 1.00 29.91  ? 86   ALA C CB    1 
ATOM   2010  N  N     . VAL C 3 87  ? -6.077  -5.849  49.829 1.00 31.73  ? 87   VAL C N     1 
ATOM   2011  C  CA    . VAL C 3 87  ? -7.328  -6.556  49.599 1.00 31.85  ? 87   VAL C CA    1 
ATOM   2012  C  C     . VAL C 3 87  ? -8.082  -6.819  50.910 1.00 32.54  ? 87   VAL C C     1 
ATOM   2013  O  O     . VAL C 3 87  ? -9.236  -6.426  51.053 1.00 33.28  ? 87   VAL C O     1 
ATOM   2014  C  CB    . VAL C 3 87  ? -7.028  -7.892  48.895 1.00 32.01  ? 87   VAL C CB    1 
ATOM   2015  C  CG1   . VAL C 3 87  ? -8.269  -8.724  48.755 1.00 31.91  ? 87   VAL C CG1   1 
ATOM   2016  C  CG2   . VAL C 3 87  ? -6.377  -7.653  47.529 1.00 31.61  ? 87   VAL C CG2   1 
ATOM   2017  N  N     . ARG C 3 88  ? -7.429  -7.459  51.877 1.00 32.48  ? 88   ARG C N     1 
ATOM   2018  C  CA    . ARG C 3 88  ? -8.127  -7.909  53.055 1.00 32.49  ? 88   ARG C CA    1 
ATOM   2019  C  C     . ARG C 3 88  ? -8.522  -6.754  53.934 1.00 33.32  ? 88   ARG C C     1 
ATOM   2020  O  O     . ARG C 3 88  ? -9.461  -6.853  54.713 1.00 33.84  ? 88   ARG C O     1 
ATOM   2021  C  CB    . ARG C 3 88  ? -7.296  -8.929  53.852 1.00 32.60  ? 88   ARG C CB    1 
ATOM   2022  C  CG    . ARG C 3 88  ? -7.112  -10.338 53.198 1.00 31.03  ? 88   ARG C CG    1 
ATOM   2023  C  CD    . ARG C 3 88  ? -8.334  -10.810 52.396 1.00 28.64  ? 88   ARG C CD    1 
ATOM   2024  N  NE    . ARG C 3 88  ? -7.950  -11.603 51.225 1.00 26.49  ? 88   ARG C NE    1 
ATOM   2025  C  CZ    . ARG C 3 88  ? -8.782  -11.990 50.258 1.00 25.37  ? 88   ARG C CZ    1 
ATOM   2026  N  NH1   . ARG C 3 88  ? -10.078 -11.665 50.273 1.00 25.28  ? 88   ARG C NH1   1 
ATOM   2027  N  NH2   . ARG C 3 88  ? -8.313  -12.705 49.255 1.00 23.93  ? 88   ARG C NH2   1 
ATOM   2028  N  N     . ASN C 3 89  ? -7.814  -5.642  53.839 1.00 34.32  ? 89   ASN C N     1 
ATOM   2029  C  CA    . ASN C 3 89  ? -8.196  -4.500  54.672 1.00 34.92  ? 89   ASN C CA    1 
ATOM   2030  C  C     . ASN C 3 89  ? -9.228  -3.582  54.053 1.00 35.92  ? 89   ASN C C     1 
ATOM   2031  O  O     . ASN C 3 89  ? -9.660  -2.639  54.702 1.00 36.23  ? 89   ASN C O     1 
ATOM   2032  C  CB    . ASN C 3 89  ? -6.988  -3.705  55.105 1.00 34.33  ? 89   ASN C CB    1 
ATOM   2033  C  CG    . ASN C 3 89  ? -6.359  -4.260  56.342 1.00 33.63  ? 89   ASN C CG    1 
ATOM   2034  O  OD1   . ASN C 3 89  ? -7.036  -4.541  57.328 1.00 32.28  ? 89   ASN C OD1   1 
ATOM   2035  N  ND2   . ASN C 3 89  ? -5.048  -4.416  56.309 1.00 35.05  ? 89   ASN C ND2   1 
ATOM   2036  N  N     . ASP C 3 90  ? -9.617  -3.867  52.808 1.00 37.09  ? 90   ASP C N     1 
ATOM   2037  C  CA    . ASP C 3 90  ? -10.556 -3.048  52.074 1.00 38.40  ? 90   ASP C CA    1 
ATOM   2038  C  C     . ASP C 3 90  ? -11.858 -3.796  51.860 1.00 39.66  ? 90   ASP C C     1 
ATOM   2039  O  O     . ASP C 3 90  ? -11.907 -4.728  51.044 1.00 40.45  ? 90   ASP C O     1 
ATOM   2040  C  CB    . ASP C 3 90  ? -9.986  -2.696  50.719 1.00 38.08  ? 90   ASP C CB    1 
ATOM   2041  C  CG    . ASP C 3 90  ? -10.839 -1.687  49.993 1.00 40.61  ? 90   ASP C CG    1 
ATOM   2042  O  OD1   . ASP C 3 90  ? -10.747 -0.491  50.334 1.00 41.70  ? 90   ASP C OD1   1 
ATOM   2043  O  OD2   . ASP C 3 90  ? -11.607 -2.080  49.086 1.00 44.24  ? 90   ASP C OD2   1 
ATOM   2044  N  N     . GLU C 3 91  ? -12.919 -3.393  52.561 1.00 40.40  ? 91   GLU C N     1 
ATOM   2045  C  CA    . GLU C 3 91  ? -14.212 -4.078  52.438 1.00 41.18  ? 91   GLU C CA    1 
ATOM   2046  C  C     . GLU C 3 91  ? -14.535 -4.589  51.036 1.00 40.78  ? 91   GLU C C     1 
ATOM   2047  O  O     . GLU C 3 91  ? -14.914 -5.752  50.874 1.00 40.61  ? 91   GLU C O     1 
ATOM   2048  C  CB    . GLU C 3 91  ? -15.349 -3.194  52.912 1.00 41.67  ? 91   GLU C CB    1 
ATOM   2049  C  CG    . GLU C 3 91  ? -15.815 -3.507  54.308 1.00 45.54  ? 91   GLU C CG    1 
ATOM   2050  C  CD    . GLU C 3 91  ? -17.310 -3.285  54.447 1.00 52.24  ? 91   GLU C CD    1 
ATOM   2051  O  OE1   . GLU C 3 91  ? -18.075 -3.831  53.593 1.00 53.45  ? 91   GLU C OE1   1 
ATOM   2052  O  OE2   . GLU C 3 91  ? -17.713 -2.555  55.398 1.00 54.39  ? 91   GLU C OE2   1 
ATOM   2053  N  N     . GLU C 3 92  ? -14.369 -3.726  50.034 1.00 40.52  ? 92   GLU C N     1 
ATOM   2054  C  CA    . GLU C 3 92  ? -14.815 -4.037  48.669 1.00 40.51  ? 92   GLU C CA    1 
ATOM   2055  C  C     . GLU C 3 92  ? -13.857 -4.947  47.921 1.00 40.18  ? 92   GLU C C     1 
ATOM   2056  O  O     . GLU C 3 92  ? -14.286 -5.920  47.274 1.00 40.45  ? 92   GLU C O     1 
ATOM   2057  C  CB    . GLU C 3 92  ? -15.100 -2.771  47.863 1.00 40.34  ? 92   GLU C CB    1 
ATOM   2058  C  CG    . GLU C 3 92  ? -16.295 -2.010  48.393 1.00 41.53  ? 92   GLU C CG    1 
ATOM   2059  C  CD    . GLU C 3 92  ? -16.977 -1.178  47.342 1.00 44.18  ? 92   GLU C CD    1 
ATOM   2060  O  OE1   . GLU C 3 92  ? -16.339 -0.883  46.308 1.00 44.78  ? 92   GLU C OE1   1 
ATOM   2061  O  OE2   . GLU C 3 92  ? -18.155 -0.812  47.557 1.00 45.82  ? 92   GLU C OE2   1 
ATOM   2062  N  N     . LEU C 3 93  ? -12.565 -4.648  48.019 1.00 39.33  ? 93   LEU C N     1 
ATOM   2063  C  CA    . LEU C 3 93  ? -11.579 -5.507  47.403 1.00 38.76  ? 93   LEU C CA    1 
ATOM   2064  C  C     . LEU C 3 93  ? -11.643 -6.917  47.991 1.00 38.86  ? 93   LEU C C     1 
ATOM   2065  O  O     . LEU C 3 93  ? -11.602 -7.905  47.253 1.00 39.03  ? 93   LEU C O     1 
ATOM   2066  C  CB    . LEU C 3 93  ? -10.192 -4.891  47.497 1.00 38.50  ? 93   LEU C CB    1 
ATOM   2067  C  CG    . LEU C 3 93  ? -9.839  -3.969  46.323 1.00 37.33  ? 93   LEU C CG    1 
ATOM   2068  C  CD1   . LEU C 3 93  ? -8.375  -3.585  46.368 1.00 36.39  ? 93   LEU C CD1   1 
ATOM   2069  C  CD2   . LEU C 3 93  ? -10.162 -4.621  44.978 1.00 34.75  ? 93   LEU C CD2   1 
ATOM   2070  N  N     . ASN C 3 94  ? -11.789 -6.999  49.312 1.00 38.64  ? 94   ASN C N     1 
ATOM   2071  C  CA    . ASN C 3 94  ? -12.076 -8.262  49.987 1.00 38.33  ? 94   ASN C CA    1 
ATOM   2072  C  C     . ASN C 3 94  ? -13.272 -9.036  49.439 1.00 38.66  ? 94   ASN C C     1 
ATOM   2073  O  O     . ASN C 3 94  ? -13.208 -10.258 49.339 1.00 39.65  ? 94   ASN C O     1 
ATOM   2074  C  CB    . ASN C 3 94  ? -12.290 -8.059  51.480 1.00 37.91  ? 94   ASN C CB    1 
ATOM   2075  C  CG    . ASN C 3 94  ? -12.291 -9.366  52.233 1.00 36.54  ? 94   ASN C CG    1 
ATOM   2076  O  OD1   . ASN C 3 94  ? -11.452 -10.228 51.989 1.00 36.05  ? 94   ASN C OD1   1 
ATOM   2077  N  ND2   . ASN C 3 94  ? -13.229 -9.525  53.147 1.00 35.43  ? 94   ASN C ND2   1 
ATOM   2078  N  N     . LYS C 3 95  ? -14.370 -8.365  49.118 1.00 38.37  ? 95   LYS C N     1 
ATOM   2079  C  CA    . LYS C 3 95  ? -15.486 -9.101  48.547 1.00 38.77  ? 95   LYS C CA    1 
ATOM   2080  C  C     . LYS C 3 95  ? -15.186 -9.529  47.110 1.00 37.97  ? 95   LYS C C     1 
ATOM   2081  O  O     . LYS C 3 95  ? -15.493 -10.642 46.713 1.00 37.46  ? 95   LYS C O     1 
ATOM   2082  C  CB    . LYS C 3 95  ? -16.800 -8.324  48.621 1.00 39.30  ? 95   LYS C CB    1 
ATOM   2083  C  CG    . LYS C 3 95  ? -17.952 -9.060  47.956 1.00 42.57  ? 95   LYS C CG    1 
ATOM   2084  C  CD    . LYS C 3 95  ? -19.300 -8.468  48.357 1.00 50.25  ? 95   LYS C CD    1 
ATOM   2085  C  CE    . LYS C 3 95  ? -20.387 -9.578  48.470 1.00 53.37  ? 95   LYS C CE    1 
ATOM   2086  N  NZ    . LYS C 3 95  ? -21.147 -9.508  49.789 1.00 52.80  ? 95   LYS C NZ    1 
ATOM   2087  N  N     . LEU C 3 96  ? -14.573 -8.644  46.331 1.00 37.60  ? 96   LEU C N     1 
ATOM   2088  C  CA    . LEU C 3 96  ? -14.291 -8.971  44.939 1.00 37.01  ? 96   LEU C CA    1 
ATOM   2089  C  C     . LEU C 3 96  ? -13.484 -10.267 44.840 1.00 37.22  ? 96   LEU C C     1 
ATOM   2090  O  O     . LEU C 3 96  ? -13.686 -11.072 43.926 1.00 37.20  ? 96   LEU C O     1 
ATOM   2091  C  CB    . LEU C 3 96  ? -13.558 -7.828  44.254 1.00 36.37  ? 96   LEU C CB    1 
ATOM   2092  C  CG    . LEU C 3 96  ? -13.187 -8.023  42.782 1.00 36.12  ? 96   LEU C CG    1 
ATOM   2093  C  CD1   . LEU C 3 96  ? -14.358 -8.507  41.922 1.00 33.79  ? 96   LEU C CD1   1 
ATOM   2094  C  CD2   . LEU C 3 96  ? -12.608 -6.726  42.224 1.00 36.55  ? 96   LEU C CD2   1 
ATOM   2095  N  N     . LEU C 3 97  ? -12.603 -10.452 45.819 1.00 37.12  ? 97   LEU C N     1 
ATOM   2096  C  CA    . LEU C 3 97  ? -11.628 -11.506 45.835 1.00 37.09  ? 97   LEU C CA    1 
ATOM   2097  C  C     . LEU C 3 97  ? -11.830 -12.350 47.073 1.00 37.63  ? 97   LEU C C     1 
ATOM   2098  O  O     . LEU C 3 97  ? -10.853 -12.808 47.708 1.00 37.52  ? 97   LEU C O     1 
ATOM   2099  C  CB    . LEU C 3 97  ? -10.245 -10.896 45.902 1.00 36.78  ? 97   LEU C CB    1 
ATOM   2100  C  CG    . LEU C 3 97  ? -9.669  -10.132 44.728 1.00 36.82  ? 97   LEU C CG    1 
ATOM   2101  C  CD1   . LEU C 3 97  ? -8.293  -9.668  45.130 1.00 36.45  ? 97   LEU C CD1   1 
ATOM   2102  C  CD2   . LEU C 3 97  ? -9.604  -11.018 43.505 1.00 36.68  ? 97   LEU C CD2   1 
ATOM   2103  N  N     . GLY C 3 98  ? -13.096 -12.545 47.427 1.00 37.66  ? 98   GLY C N     1 
ATOM   2104  C  CA    . GLY C 3 98  ? -13.428 -13.258 48.651 1.00 37.58  ? 98   GLY C CA    1 
ATOM   2105  C  C     . GLY C 3 98  ? -13.307 -14.762 48.508 1.00 37.45  ? 98   GLY C C     1 
ATOM   2106  O  O     . GLY C 3 98  ? -13.429 -15.483 49.481 1.00 38.02  ? 98   GLY C O     1 
ATOM   2107  N  N     . ARG C 3 99  ? -13.087 -15.245 47.297 1.00 37.24  ? 99   ARG C N     1 
ATOM   2108  C  CA    . ARG C 3 99  ? -12.909 -16.673 47.080 1.00 37.19  ? 99   ARG C CA    1 
ATOM   2109  C  C     . ARG C 3 99  ? -11.668 -16.855 46.236 1.00 36.38  ? 99   ARG C C     1 
ATOM   2110  O  O     . ARG C 3 99  ? -11.658 -17.599 45.247 1.00 36.51  ? 99   ARG C O     1 
ATOM   2111  C  CB    . ARG C 3 99  ? -14.165 -17.276 46.460 1.00 37.37  ? 99   ARG C CB    1 
ATOM   2112  C  CG    . ARG C 3 99  ? -15.349 -16.941 47.319 1.00 41.61  ? 99   ARG C CG    1 
ATOM   2113  C  CD    . ARG C 3 99  ? -16.488 -17.937 47.302 1.00 50.79  ? 99   ARG C CD    1 
ATOM   2114  N  NE    . ARG C 3 99  ? -17.444 -17.574 48.368 1.00 56.61  ? 99   ARG C NE    1 
ATOM   2115  C  CZ    . ARG C 3 99  ? -18.618 -18.166 48.603 1.00 58.94  ? 99   ARG C CZ    1 
ATOM   2116  N  NH1   . ARG C 3 99  ? -19.044 -19.186 47.844 1.00 59.57  ? 99   ARG C NH1   1 
ATOM   2117  N  NH2   . ARG C 3 99  ? -19.369 -17.730 49.613 1.00 59.10  ? 99   ARG C NH2   1 
ATOM   2118  N  N     . VAL C 3 100 ? -10.635 -16.110 46.637 1.00 35.32  ? 100  VAL C N     1 
ATOM   2119  C  CA    . VAL C 3 100 ? -9.343  -16.081 45.973 1.00 34.45  ? 100  VAL C CA    1 
ATOM   2120  C  C     . VAL C 3 100 ? -8.227  -16.162 47.011 1.00 34.38  ? 100  VAL C C     1 
ATOM   2121  O  O     . VAL C 3 100 ? -8.304  -15.551 48.077 1.00 34.09  ? 100  VAL C O     1 
ATOM   2122  C  CB    . VAL C 3 100 ? -9.163  -14.793 45.168 1.00 34.25  ? 100  VAL C CB    1 
ATOM   2123  C  CG1   . VAL C 3 100 ? -7.739  -14.636 44.728 1.00 33.15  ? 100  VAL C CG1   1 
ATOM   2124  C  CG2   . VAL C 3 100 ? -10.061 -14.804 43.957 1.00 34.48  ? 100  VAL C CG2   1 
ATOM   2125  N  N     . THR C 3 101 ? -7.200  -16.937 46.701 1.00 34.12  ? 101  THR C N     1 
ATOM   2126  C  CA    . THR C 3 101 ? -6.077  -17.062 47.591 1.00 34.04  ? 101  THR C CA    1 
ATOM   2127  C  C     . THR C 3 101 ? -4.854  -16.478 46.920 1.00 33.81  ? 101  THR C C     1 
ATOM   2128  O  O     . THR C 3 101 ? -4.555  -16.773 45.756 1.00 33.97  ? 101  THR C O     1 
ATOM   2129  C  CB    . THR C 3 101 ? -5.879  -18.522 48.032 1.00 34.57  ? 101  THR C CB    1 
ATOM   2130  O  OG1   . THR C 3 101 ? -6.909  -18.857 48.987 1.00 35.92  ? 101  THR C OG1   1 
ATOM   2131  C  CG2   . THR C 3 101 ? -4.493  -18.737 48.665 1.00 33.76  ? 101  THR C CG2   1 
ATOM   2132  N  N     . ILE C 3 102 ? -4.202  -15.587 47.658 1.00 33.28  ? 102  ILE C N     1 
ATOM   2133  C  CA    . ILE C 3 102 ? -3.005  -14.909 47.220 1.00 32.24  ? 102  ILE C CA    1 
ATOM   2134  C  C     . ILE C 3 102 ? -1.881  -15.688 47.858 1.00 32.56  ? 102  ILE C C     1 
ATOM   2135  O  O     . ILE C 3 102 ? -1.664  -15.629 49.081 1.00 32.58  ? 102  ILE C O     1 
ATOM   2136  C  CB    . ILE C 3 102 ? -2.987  -13.420 47.691 1.00 32.15  ? 102  ILE C CB    1 
ATOM   2137  C  CG1   . ILE C 3 102 ? -4.063  -12.602 46.955 1.00 30.13  ? 102  ILE C CG1   1 
ATOM   2138  C  CG2   . ILE C 3 102 ? -1.606  -12.788 47.509 1.00 30.52  ? 102  ILE C CG2   1 
ATOM   2139  C  CD1   . ILE C 3 102 ? -4.363  -11.291 47.611 1.00 26.41  ? 102  ILE C CD1   1 
ATOM   2140  N  N     . ALA C 3 103 ? -1.197  -16.470 47.034 1.00 32.51  ? 103  ALA C N     1 
ATOM   2141  C  CA    . ALA C 3 103 ? -0.049  -17.209 47.506 1.00 32.81  ? 103  ALA C CA    1 
ATOM   2142  C  C     . ALA C 3 103 ? 0.832   -16.264 48.325 1.00 33.29  ? 103  ALA C C     1 
ATOM   2143  O  O     . ALA C 3 103 ? 1.020   -15.093 47.951 1.00 33.55  ? 103  ALA C O     1 
ATOM   2144  C  CB    . ALA C 3 103 ? 0.712   -17.778 46.342 1.00 32.39  ? 103  ALA C CB    1 
ATOM   2145  N  N     . GLN C 3 104 ? 1.345   -16.764 49.447 1.00 33.40  ? 104  GLN C N     1 
ATOM   2146  C  CA    . GLN C 3 104 ? 2.350   -16.037 50.253 1.00 33.80  ? 104  GLN C CA    1 
ATOM   2147  C  C     . GLN C 3 104 ? 1.885   -14.693 50.850 1.00 33.59  ? 104  GLN C C     1 
ATOM   2148  O  O     . GLN C 3 104 ? 2.698   -13.822 51.168 1.00 33.63  ? 104  GLN C O     1 
ATOM   2149  C  CB    . GLN C 3 104 ? 3.664   -15.881 49.480 1.00 33.49  ? 104  GLN C CB    1 
ATOM   2150  C  CG    . GLN C 3 104 ? 4.483   -17.137 49.450 1.00 35.41  ? 104  GLN C CG    1 
ATOM   2151  C  CD    . GLN C 3 104 ? 4.991   -17.537 50.845 1.00 37.89  ? 104  GLN C CD    1 
ATOM   2152  O  OE1   . GLN C 3 104 ? 5.564   -16.707 51.573 1.00 39.27  ? 104  GLN C OE1   1 
ATOM   2153  N  NE2   . GLN C 3 104 ? 4.776   -18.804 51.223 1.00 35.59  ? 104  GLN C NE2   1 
ATOM   2154  N  N     . GLY C 3 105 ? 0.578   -14.560 51.032 1.00 33.30  ? 105  GLY C N     1 
ATOM   2155  C  CA    . GLY C 3 105 ? 0.008   -13.397 51.670 1.00 33.32  ? 105  GLY C CA    1 
ATOM   2156  C  C     . GLY C 3 105 ? -0.344  -13.499 53.143 1.00 33.60  ? 105  GLY C C     1 
ATOM   2157  O  O     . GLY C 3 105 ? -0.679  -12.479 53.764 1.00 34.27  ? 105  GLY C O     1 
ATOM   2158  N  N     . GLY C 3 106 ? -0.280  -14.697 53.728 1.00 33.48  ? 106  GLY C N     1 
ATOM   2159  C  CA    . GLY C 3 106 ? -0.590  -14.849 55.160 1.00 33.15  ? 106  GLY C CA    1 
ATOM   2160  C  C     . GLY C 3 106 ? -1.995  -14.393 55.476 1.00 33.31  ? 106  GLY C C     1 
ATOM   2161  O  O     . GLY C 3 106 ? -2.865  -14.424 54.603 1.00 33.53  ? 106  GLY C O     1 
ATOM   2162  N  N     . VAL C 3 107 ? -2.219  -13.963 56.716 1.00 33.66  ? 107  VAL C N     1 
ATOM   2163  C  CA    . VAL C 3 107 ? -3.547  -13.510 57.180 1.00 33.80  ? 107  VAL C CA    1 
ATOM   2164  C  C     . VAL C 3 107 ? -3.488  -12.186 57.952 1.00 34.36  ? 107  VAL C C     1 
ATOM   2165  O  O     . VAL C 3 107 ? -2.404  -11.712 58.297 1.00 34.47  ? 107  VAL C O     1 
ATOM   2166  C  CB    . VAL C 3 107 ? -4.229  -14.567 58.060 1.00 33.32  ? 107  VAL C CB    1 
ATOM   2167  C  CG1   . VAL C 3 107 ? -4.345  -15.862 57.318 1.00 33.55  ? 107  VAL C CG1   1 
ATOM   2168  C  CG2   . VAL C 3 107 ? -3.454  -14.785 59.330 1.00 33.74  ? 107  VAL C CG2   1 
ATOM   2169  N  N     . LEU C 3 108 ? -4.642  -11.582 58.225 1.00 35.39  ? 108  LEU C N     1 
ATOM   2170  C  CA    . LEU C 3 108 ? -4.663  -10.367 59.060 1.00 36.48  ? 108  LEU C CA    1 
ATOM   2171  C  C     . LEU C 3 108 ? -4.475  -10.720 60.531 1.00 37.37  ? 108  LEU C C     1 
ATOM   2172  O  O     . LEU C 3 108 ? -5.146  -11.627 61.033 1.00 37.71  ? 108  LEU C O     1 
ATOM   2173  C  CB    . LEU C 3 108 ? -5.946  -9.548  58.845 1.00 36.14  ? 108  LEU C CB    1 
ATOM   2174  C  CG    . LEU C 3 108 ? -6.063  -8.894  57.455 1.00 35.53  ? 108  LEU C CG    1 
ATOM   2175  C  CD1   . LEU C 3 108 ? -7.324  -8.058  57.325 1.00 34.17  ? 108  LEU C CD1   1 
ATOM   2176  C  CD2   . LEU C 3 108 ? -4.832  -8.052  57.143 1.00 33.72  ? 108  LEU C CD2   1 
ATOM   2177  N  N     . PRO C 3 109 ? -3.527  -10.049 61.219 1.00 38.48  ? 109  PRO C N     1 
ATOM   2178  C  CA    . PRO C 3 109 ? -3.399  -10.309 62.653 1.00 39.16  ? 109  PRO C CA    1 
ATOM   2179  C  C     . PRO C 3 109 ? -4.756  -10.110 63.272 1.00 40.13  ? 109  PRO C C     1 
ATOM   2180  O  O     . PRO C 3 109 ? -5.325  -9.041  63.144 1.00 40.35  ? 109  PRO C O     1 
ATOM   2181  C  CB    . PRO C 3 109 ? -2.439  -9.217  63.125 1.00 38.76  ? 109  PRO C CB    1 
ATOM   2182  C  CG    . PRO C 3 109 ? -1.596  -8.922  61.920 1.00 38.45  ? 109  PRO C CG    1 
ATOM   2183  C  CD    . PRO C 3 109 ? -2.539  -9.055  60.754 1.00 38.66  ? 109  PRO C CD    1 
ATOM   2184  N  N     . ASN C 3 110 ? -5.309  -11.146 63.874 1.00 41.64  ? 110  ASN C N     1 
ATOM   2185  C  CA    . ASN C 3 110 ? -6.579  -11.000 64.548 1.00 43.42  ? 110  ASN C CA    1 
ATOM   2186  C  C     . ASN C 3 110 ? -6.807  -12.136 65.512 1.00 44.18  ? 110  ASN C C     1 
ATOM   2187  O  O     . ASN C 3 110 ? -7.073  -13.284 65.091 1.00 44.74  ? 110  ASN C O     1 
ATOM   2188  C  CB    . ASN C 3 110 ? -7.741  -10.918 63.552 1.00 44.03  ? 110  ASN C CB    1 
ATOM   2189  C  CG    . ASN C 3 110 ? -9.082  -10.732 64.244 1.00 46.21  ? 110  ASN C CG    1 
ATOM   2190  O  OD1   . ASN C 3 110 ? -9.139  -10.538 65.469 1.00 48.40  ? 110  ASN C OD1   1 
ATOM   2191  N  ND2   . ASN C 3 110 ? -10.172 -10.800 63.472 1.00 46.86  ? 110  ASN C ND2   1 
ATOM   2192  N  N     . ILE C 3 111 ? -6.704  -11.790 66.798 1.00 44.49  ? 111  ILE C N     1 
ATOM   2193  C  CA    . ILE C 3 111 ? -6.938  -12.683 67.928 1.00 44.57  ? 111  ILE C CA    1 
ATOM   2194  C  C     . ILE C 3 111 ? -8.303  -12.365 68.524 1.00 45.08  ? 111  ILE C C     1 
ATOM   2195  O  O     . ILE C 3 111 ? -8.575  -11.224 68.849 1.00 45.39  ? 111  ILE C O     1 
ATOM   2196  C  CB    . ILE C 3 111 ? -5.892  -12.441 69.011 1.00 44.08  ? 111  ILE C CB    1 
ATOM   2197  C  CG1   . ILE C 3 111 ? -4.489  -12.628 68.444 1.00 43.91  ? 111  ILE C CG1   1 
ATOM   2198  C  CG2   . ILE C 3 111 ? -6.137  -13.342 70.207 1.00 44.53  ? 111  ILE C CG2   1 
ATOM   2199  C  CD1   . ILE C 3 111 ? -3.372  -12.162 69.381 1.00 42.99  ? 111  ILE C CD1   1 
ATOM   2200  N  N     . GLN C 3 112 ? -9.157  -13.371 68.669 1.00 45.84  ? 112  GLN C N     1 
ATOM   2201  C  CA    . GLN C 3 112 ? -10.484 -13.184 69.239 1.00 46.38  ? 112  GLN C CA    1 
ATOM   2202  C  C     . GLN C 3 112 ? -10.403 -12.799 70.701 1.00 47.47  ? 112  GLN C C     1 
ATOM   2203  O  O     . GLN C 3 112 ? -9.581  -13.342 71.433 1.00 47.42  ? 112  GLN C O     1 
ATOM   2204  C  CB    . GLN C 3 112 ? -11.282 -14.472 69.120 1.00 46.27  ? 112  GLN C CB    1 
ATOM   2205  C  CG    . GLN C 3 112 ? -11.615 -14.856 67.708 1.00 46.35  ? 112  GLN C CG    1 
ATOM   2206  C  CD    . GLN C 3 112 ? -12.805 -14.104 67.195 1.00 47.18  ? 112  GLN C CD    1 
ATOM   2207  O  OE1   . GLN C 3 112 ? -13.865 -14.077 67.840 1.00 47.43  ? 112  GLN C OE1   1 
ATOM   2208  N  NE2   . GLN C 3 112 ? -12.647 -13.473 66.034 1.00 46.69  ? 112  GLN C NE2   1 
ATOM   2209  N  N     . SER C 3 113 ? -11.283 -11.884 71.115 1.00 48.88  ? 113  SER C N     1 
ATOM   2210  C  CA    . SER C 3 113 ? -11.353 -11.347 72.479 1.00 49.99  ? 113  SER C CA    1 
ATOM   2211  C  C     . SER C 3 113 ? -11.130 -12.334 73.618 1.00 50.70  ? 113  SER C C     1 
ATOM   2212  O  O     . SER C 3 113 ? -10.119 -12.266 74.320 1.00 50.97  ? 113  SER C O     1 
ATOM   2213  C  CB    . SER C 3 113 ? -12.703 -10.678 72.695 1.00 50.18  ? 113  SER C CB    1 
ATOM   2214  O  OG    . SER C 3 113 ? -12.709 -9.383  72.147 1.00 51.53  ? 113  SER C OG    1 
ATOM   2215  N  N     . VAL C 3 114 ? -12.087 -13.236 73.806 1.00 51.57  ? 114  VAL C N     1 
ATOM   2216  C  CA    . VAL C 3 114 ? -12.074 -14.187 74.925 1.00 52.61  ? 114  VAL C CA    1 
ATOM   2217  C  C     . VAL C 3 114 ? -10.734 -14.897 75.116 1.00 53.57  ? 114  VAL C C     1 
ATOM   2218  O  O     . VAL C 3 114 ? -10.467 -15.442 76.189 1.00 54.19  ? 114  VAL C O     1 
ATOM   2219  C  CB    . VAL C 3 114 ? -13.180 -15.276 74.794 1.00 52.33  ? 114  VAL C CB    1 
ATOM   2220  C  CG1   . VAL C 3 114 ? -14.560 -14.649 74.552 1.00 52.73  ? 114  VAL C CG1   1 
ATOM   2221  C  CG2   . VAL C 3 114 ? -12.841 -16.264 73.688 1.00 51.99  ? 114  VAL C CG2   1 
ATOM   2222  N  N     . LEU C 3 115 ? -9.899  -14.900 74.080 1.00 54.43  ? 115  LEU C N     1 
ATOM   2223  C  CA    . LEU C 3 115 ? -8.630  -15.614 74.127 1.00 55.11  ? 115  LEU C CA    1 
ATOM   2224  C  C     . LEU C 3 115 ? -7.557  -14.852 74.875 1.00 55.85  ? 115  LEU C C     1 
ATOM   2225  O  O     . LEU C 3 115 ? -6.565  -15.441 75.301 1.00 55.56  ? 115  LEU C O     1 
ATOM   2226  C  CB    . LEU C 3 115 ? -8.141  -15.941 72.714 1.00 55.23  ? 115  LEU C CB    1 
ATOM   2227  C  CG    . LEU C 3 115 ? -8.971  -16.884 71.842 1.00 54.50  ? 115  LEU C CG    1 
ATOM   2228  C  CD1   . LEU C 3 115 ? -8.191  -17.177 70.575 1.00 53.25  ? 115  LEU C CD1   1 
ATOM   2229  C  CD2   . LEU C 3 115 ? -9.343  -18.170 72.584 1.00 52.86  ? 115  LEU C CD2   1 
ATOM   2230  N  N     . LEU C 3 116 ? -7.761  -13.545 75.026 1.00 57.27  ? 116  LEU C N     1 
ATOM   2231  C  CA    . LEU C 3 116 ? -6.787  -12.672 75.679 1.00 58.56  ? 116  LEU C CA    1 
ATOM   2232  C  C     . LEU C 3 116 ? -6.811  -12.818 77.194 1.00 59.82  ? 116  LEU C C     1 
ATOM   2233  O  O     . LEU C 3 116 ? -7.863  -13.069 77.781 1.00 59.68  ? 116  LEU C O     1 
ATOM   2234  C  CB    . LEU C 3 116 ? -7.001  -11.216 75.263 1.00 58.46  ? 116  LEU C CB    1 
ATOM   2235  C  CG    . LEU C 3 116 ? -6.760  -10.849 73.793 1.00 58.16  ? 116  LEU C CG    1 
ATOM   2236  C  CD1   . LEU C 3 116 ? -7.014  -9.370  73.571 1.00 57.58  ? 116  LEU C CD1   1 
ATOM   2237  C  CD2   . LEU C 3 116 ? -5.358  -11.211 73.340 1.00 57.57  ? 116  LEU C CD2   1 
ATOM   2238  N  N     . PRO C 3 117 ? -5.641  -12.669 77.833 1.00 61.50  ? 117  PRO C N     1 
ATOM   2239  C  CA    . PRO C 3 117 ? -5.474  -12.906 79.280 1.00 62.99  ? 117  PRO C CA    1 
ATOM   2240  C  C     . PRO C 3 117 ? -6.201  -11.935 80.221 1.00 64.59  ? 117  PRO C C     1 
ATOM   2241  O  O     . PRO C 3 117 ? -6.778  -10.936 79.767 1.00 64.46  ? 117  PRO C O     1 
ATOM   2242  C  CB    . PRO C 3 117 ? -3.956  -12.805 79.483 1.00 62.65  ? 117  PRO C CB    1 
ATOM   2243  C  CG    . PRO C 3 117 ? -3.464  -11.992 78.341 1.00 62.26  ? 117  PRO C CG    1 
ATOM   2244  C  CD    . PRO C 3 117 ? -4.373  -12.285 77.184 1.00 61.59  ? 117  PRO C CD    1 
ATOM   2245  N  N     . LYS C 3 118 ? -6.141  -12.250 81.524 1.00 66.65  ? 118  LYS C N     1 
ATOM   2246  C  CA    . LYS C 3 118 ? -6.726  -11.458 82.637 1.00 68.62  ? 118  LYS C CA    1 
ATOM   2247  C  C     . LYS C 3 118 ? -8.163  -10.959 82.369 1.00 69.54  ? 118  LYS C C     1 
ATOM   2248  O  O     . LYS C 3 118 ? -9.043  -11.781 82.086 1.00 69.98  ? 118  LYS C O     1 
ATOM   2249  C  CB    . LYS C 3 118 ? -5.777  -10.341 83.145 1.00 68.46  ? 118  LYS C CB    1 
ATOM   2250  C  CG    . LYS C 3 118 ? -5.160  -9.436  82.068 1.00 69.05  ? 118  LYS C CG    1 
ATOM   2251  C  CD    . LYS C 3 118 ? -4.732  -8.079  82.619 1.00 69.61  ? 118  LYS C CD    1 
ATOM   2252  C  CE    . LYS C 3 118 ? -5.848  -7.031  82.501 1.00 71.33  ? 118  LYS C CE    1 
ATOM   2253  N  NZ    . LYS C 3 118 ? -5.365  -5.641  82.804 1.00 71.33  ? 118  LYS C NZ    1 
ATOM   2254  N  N     . LYS C 3 119 ? -8.398  -9.642  82.466 1.00 70.51  ? 119  LYS C N     1 
ATOM   2255  C  CA    . LYS C 3 119 ? -9.742  -9.045  82.268 1.00 71.32  ? 119  LYS C CA    1 
ATOM   2256  C  C     . LYS C 3 119 ? -9.704  -7.631  81.671 1.00 71.51  ? 119  LYS C C     1 
ATOM   2257  O  O     . LYS C 3 119 ? -9.081  -6.716  82.225 1.00 71.89  ? 119  LYS C O     1 
ATOM   2258  C  CB    . LYS C 3 119 ? -10.599 -9.061  83.563 1.00 71.63  ? 119  LYS C CB    1 
ATOM   2259  C  CG    . LYS C 3 119 ? -9.834  -9.143  84.905 1.00 72.26  ? 119  LYS C CG    1 
ATOM   2260  C  CD    . LYS C 3 119 ? -9.758  -10.601 85.431 1.00 73.30  ? 119  LYS C CD    1 
ATOM   2261  C  CE    . LYS C 3 119 ? -8.778  -10.770 86.605 1.00 72.89  ? 119  LYS C CE    1 
ATOM   2262  N  NZ    . LYS C 3 119 ? -7.345  -10.742 86.174 1.00 72.96  ? 119  LYS C NZ    1 
ATOM   2263  N  N     . LYS D 4 31  ? 10.248  -21.412 20.537 1.00 81.19  ? 28   LYS D N     1 
ATOM   2264  C  CA    . LYS D 4 31  ? 10.504  -20.941 21.936 1.00 81.23  ? 28   LYS D CA    1 
ATOM   2265  C  C     . LYS D 4 31  ? 9.490   -19.843 22.278 1.00 80.93  ? 28   LYS D C     1 
ATOM   2266  O  O     . LYS D 4 31  ? 9.847   -18.670 22.455 1.00 80.91  ? 28   LYS D O     1 
ATOM   2267  C  CB    . LYS D 4 31  ? 11.951  -20.441 22.089 1.00 81.38  ? 28   LYS D CB    1 
ATOM   2268  C  CG    . LYS D 4 31  ? 13.002  -21.275 21.336 1.00 82.00  ? 28   LYS D CG    1 
ATOM   2269  C  CD    . LYS D 4 31  ? 13.319  -20.692 19.945 1.00 82.62  ? 28   LYS D CD    1 
ATOM   2270  C  CE    . LYS D 4 31  ? 13.603  -21.788 18.907 1.00 82.41  ? 28   LYS D CE    1 
ATOM   2271  N  NZ    . LYS D 4 31  ? 14.619  -22.788 19.353 1.00 82.04  ? 28   LYS D NZ    1 
ATOM   2272  N  N     . THR D 4 32  ? 8.227   -20.252 22.388 1.00 80.45  ? 29   THR D N     1 
ATOM   2273  C  CA    . THR D 4 32  ? 7.088   -19.338 22.256 1.00 80.06  ? 29   THR D CA    1 
ATOM   2274  C  C     . THR D 4 32  ? 6.922   -18.273 23.349 1.00 79.36  ? 29   THR D C     1 
ATOM   2275  O  O     . THR D 4 32  ? 7.243   -18.498 24.526 1.00 79.54  ? 29   THR D O     1 
ATOM   2276  C  CB    . THR D 4 32  ? 5.753   -20.100 22.030 1.00 80.26  ? 29   THR D CB    1 
ATOM   2277  O  OG1   . THR D 4 32  ? 4.815   -19.231 21.375 1.00 81.24  ? 29   THR D OG1   1 
ATOM   2278  C  CG2   . THR D 4 32  ? 5.161   -20.611 23.354 1.00 80.34  ? 29   THR D CG2   1 
ATOM   2279  N  N     . ARG D 4 33  ? 6.397   -17.122 22.926 1.00 78.19  ? 30   ARG D N     1 
ATOM   2280  C  CA    . ARG D 4 33  ? 6.267   -15.928 23.768 1.00 77.03  ? 30   ARG D CA    1 
ATOM   2281  C  C     . ARG D 4 33  ? 5.113   -15.988 24.785 1.00 75.65  ? 30   ARG D C     1 
ATOM   2282  O  O     . ARG D 4 33  ? 3.934   -15.974 24.405 1.00 75.44  ? 30   ARG D O     1 
ATOM   2283  C  CB    . ARG D 4 33  ? 6.143   -14.665 22.892 1.00 77.19  ? 30   ARG D CB    1 
ATOM   2284  C  CG    . ARG D 4 33  ? 5.072   -14.740 21.776 1.00 78.05  ? 30   ARG D CG    1 
ATOM   2285  C  CD    . ARG D 4 33  ? 4.281   -13.433 21.631 1.00 78.90  ? 30   ARG D CD    1 
ATOM   2286  N  NE    . ARG D 4 33  ? 5.122   -12.249 21.830 1.00 80.05  ? 30   ARG D NE    1 
ATOM   2287  C  CZ    . ARG D 4 33  ? 4.791   -11.004 21.486 1.00 80.92  ? 30   ARG D CZ    1 
ATOM   2288  N  NH1   . ARG D 4 33  ? 3.623   -10.745 20.905 1.00 81.01  ? 30   ARG D NH1   1 
ATOM   2289  N  NH2   . ARG D 4 33  ? 5.642   -10.009 21.719 1.00 81.43  ? 30   ARG D NH2   1 
ATOM   2290  N  N     . LYS D 4 34  ? 5.459   -16.044 26.070 1.00 73.82  ? 31   LYS D N     1 
ATOM   2291  C  CA    . LYS D 4 34  ? 4.445   -15.956 27.125 1.00 72.34  ? 31   LYS D CA    1 
ATOM   2292  C  C     . LYS D 4 34  ? 4.091   -14.510 27.472 1.00 70.67  ? 31   LYS D C     1 
ATOM   2293  O  O     . LYS D 4 34  ? 4.776   -13.844 28.255 1.00 70.76  ? 31   LYS D O     1 
ATOM   2294  C  CB    . LYS D 4 34  ? 4.817   -16.771 28.377 1.00 72.38  ? 31   LYS D CB    1 
ATOM   2295  C  CG    . LYS D 4 34  ? 6.276   -16.704 28.800 1.00 72.94  ? 31   LYS D CG    1 
ATOM   2296  C  CD    . LYS D 4 34  ? 6.613   -17.820 29.786 1.00 73.13  ? 31   LYS D CD    1 
ATOM   2297  C  CE    . LYS D 4 34  ? 8.104   -17.832 30.132 1.00 74.53  ? 31   LYS D CE    1 
ATOM   2298  N  NZ    . LYS D 4 34  ? 8.411   -18.762 31.258 1.00 74.50  ? 31   LYS D NZ    1 
ATOM   2299  N  N     . GLU D 4 35  ? 3.012   -14.038 26.860 1.00 68.49  ? 32   GLU D N     1 
ATOM   2300  C  CA    . GLU D 4 35  ? 2.467   -12.711 27.103 1.00 66.34  ? 32   GLU D CA    1 
ATOM   2301  C  C     . GLU D 4 35  ? 2.011   -12.520 28.541 1.00 64.56  ? 32   GLU D C     1 
ATOM   2302  O  O     . GLU D 4 35  ? 1.503   -13.464 29.156 1.00 64.44  ? 32   GLU D O     1 
ATOM   2303  C  CB    . GLU D 4 35  ? 1.248   -12.510 26.222 1.00 66.63  ? 32   GLU D CB    1 
ATOM   2304  C  CG    . GLU D 4 35  ? 1.531   -12.092 24.809 1.00 67.59  ? 32   GLU D CG    1 
ATOM   2305  C  CD    . GLU D 4 35  ? 0.296   -11.502 24.181 1.00 70.10  ? 32   GLU D CD    1 
ATOM   2306  O  OE1   . GLU D 4 35  ? -0.814  -11.781 24.711 1.00 70.23  ? 32   GLU D OE1   1 
ATOM   2307  O  OE2   . GLU D 4 35  ? 0.429   -10.754 23.182 1.00 70.52  ? 32   GLU D OE2   1 
ATOM   2308  N  N     . SER D 4 36  ? 2.172   -11.299 29.065 1.00 62.11  ? 33   SER D N     1 
ATOM   2309  C  CA    . SER D 4 36  ? 1.584   -10.934 30.357 1.00 59.93  ? 33   SER D CA    1 
ATOM   2310  C  C     . SER D 4 36  ? 1.045   -9.519  30.367 1.00 58.44  ? 33   SER D C     1 
ATOM   2311  O  O     . SER D 4 36  ? 0.919   -8.898  29.334 1.00 58.20  ? 33   SER D O     1 
ATOM   2312  C  CB    . SER D 4 36  ? 2.560   -11.159 31.515 1.00 59.73  ? 33   SER D CB    1 
ATOM   2313  O  OG    . SER D 4 36  ? 3.663   -10.302 31.407 1.00 59.53  ? 33   SER D OG    1 
ATOM   2314  N  N     . TYR D 4 37  ? 0.688   -9.037  31.550 1.00 56.99  ? 34   TYR D N     1 
ATOM   2315  C  CA    . TYR D 4 37  ? 0.277   -7.656  31.749 1.00 55.26  ? 34   TYR D CA    1 
ATOM   2316  C  C     . TYR D 4 37  ? 1.325   -6.862  32.520 1.00 54.82  ? 34   TYR D C     1 
ATOM   2317  O  O     . TYR D 4 37  ? 1.055   -5.742  32.962 1.00 54.99  ? 34   TYR D O     1 
ATOM   2318  C  CB    . TYR D 4 37  ? -1.023  -7.614  32.522 1.00 54.38  ? 34   TYR D CB    1 
ATOM   2319  C  CG    . TYR D 4 37  ? -2.214  -8.021  31.722 1.00 53.53  ? 34   TYR D CG    1 
ATOM   2320  C  CD1   . TYR D 4 37  ? -2.708  -9.312  31.786 1.00 52.72  ? 34   TYR D CD1   1 
ATOM   2321  C  CD2   . TYR D 4 37  ? -2.864  -7.109  30.906 1.00 53.35  ? 34   TYR D CD2   1 
ATOM   2322  C  CE1   . TYR D 4 37  ? -3.818  -9.685  31.060 1.00 52.67  ? 34   TYR D CE1   1 
ATOM   2323  C  CE2   . TYR D 4 37  ? -3.972  -7.480  30.164 1.00 53.03  ? 34   TYR D CE2   1 
ATOM   2324  C  CZ    . TYR D 4 37  ? -4.442  -8.764  30.252 1.00 52.37  ? 34   TYR D CZ    1 
ATOM   2325  O  OH    . TYR D 4 37  ? -5.540  -9.125  29.524 1.00 52.89  ? 34   TYR D OH    1 
ATOM   2326  N  N     . ALA D 4 38  ? 2.519   -7.430  32.656 1.00 54.06  ? 35   ALA D N     1 
ATOM   2327  C  CA    . ALA D 4 38  ? 3.545   -6.890  33.546 1.00 53.84  ? 35   ALA D CA    1 
ATOM   2328  C  C     . ALA D 4 38  ? 3.945   -5.430  33.301 1.00 53.64  ? 35   ALA D C     1 
ATOM   2329  O  O     . ALA D 4 38  ? 4.079   -4.665  34.264 1.00 53.69  ? 35   ALA D O     1 
ATOM   2330  C  CB    . ALA D 4 38  ? 4.782   -7.794  33.561 1.00 53.65  ? 35   ALA D CB    1 
ATOM   2331  N  N     . ILE D 4 39  ? 4.126   -5.039  32.038 1.00 52.96  ? 36   ILE D N     1 
ATOM   2332  C  CA    . ILE D 4 39  ? 4.620   -3.695  31.739 1.00 52.48  ? 36   ILE D CA    1 
ATOM   2333  C  C     . ILE D 4 39  ? 3.538   -2.661  31.941 1.00 52.39  ? 36   ILE D C     1 
ATOM   2334  O  O     . ILE D 4 39  ? 3.808   -1.486  32.202 1.00 52.40  ? 36   ILE D O     1 
ATOM   2335  C  CB    . ILE D 4 39  ? 5.226   -3.561  30.323 1.00 52.40  ? 36   ILE D CB    1 
ATOM   2336  C  CG1   . ILE D 4 39  ? 4.188   -3.853  29.237 1.00 51.77  ? 36   ILE D CG1   1 
ATOM   2337  C  CG2   . ILE D 4 39  ? 6.499   -4.419  30.196 1.00 52.76  ? 36   ILE D CG2   1 
ATOM   2338  C  CD1   . ILE D 4 39  ? 4.752   -3.786  27.857 1.00 50.72  ? 36   ILE D CD1   1 
ATOM   2339  N  N     . TYR D 4 40  ? 2.304   -3.113  31.824 1.00 52.04  ? 37   TYR D N     1 
ATOM   2340  C  CA    . TYR D 4 40  ? 1.185   -2.226  31.966 1.00 51.56  ? 37   TYR D CA    1 
ATOM   2341  C  C     . TYR D 4 40  ? 0.952   -2.044  33.439 1.00 50.88  ? 37   TYR D C     1 
ATOM   2342  O  O     . TYR D 4 40  ? 0.687   -0.940  33.897 1.00 51.49  ? 37   TYR D O     1 
ATOM   2343  C  CB    . TYR D 4 40  ? -0.032  -2.814  31.263 1.00 52.08  ? 37   TYR D CB    1 
ATOM   2344  C  CG    . TYR D 4 40  ? 0.253   -3.156  29.822 1.00 52.29  ? 37   TYR D CG    1 
ATOM   2345  C  CD1   . TYR D 4 40  ? 0.541   -4.456  29.437 1.00 52.90  ? 37   TYR D CD1   1 
ATOM   2346  C  CD2   . TYR D 4 40  ? 0.268   -2.166  28.850 1.00 53.00  ? 37   TYR D CD2   1 
ATOM   2347  C  CE1   . TYR D 4 40  ? 0.812   -4.764  28.108 1.00 53.98  ? 37   TYR D CE1   1 
ATOM   2348  C  CE2   . TYR D 4 40  ? 0.538   -2.455  27.532 1.00 53.41  ? 37   TYR D CE2   1 
ATOM   2349  C  CZ    . TYR D 4 40  ? 0.805   -3.751  27.164 1.00 53.62  ? 37   TYR D CZ    1 
ATOM   2350  O  OH    . TYR D 4 40  ? 1.063   -4.022  25.845 1.00 53.84  ? 37   TYR D OH    1 
ATOM   2351  N  N     . VAL D 4 41  ? 1.074   -3.129  34.191 1.00 49.88  ? 38   VAL D N     1 
ATOM   2352  C  CA    . VAL D 4 41  ? 0.930   -3.053  35.638 1.00 48.70  ? 38   VAL D CA    1 
ATOM   2353  C  C     . VAL D 4 41  ? 1.994   -2.103  36.137 1.00 48.10  ? 38   VAL D C     1 
ATOM   2354  O  O     . VAL D 4 41  ? 1.694   -1.195  36.898 1.00 47.67  ? 38   VAL D O     1 
ATOM   2355  C  CB    . VAL D 4 41  ? 1.030   -4.447  36.313 1.00 48.62  ? 38   VAL D CB    1 
ATOM   2356  C  CG1   . VAL D 4 41  ? 1.332   -4.316  37.793 1.00 48.48  ? 38   VAL D CG1   1 
ATOM   2357  C  CG2   . VAL D 4 41  ? -0.255  -5.215  36.105 1.00 47.32  ? 38   VAL D CG2   1 
ATOM   2358  N  N     . TYR D 4 42  ? 3.220   -2.287  35.647 1.00 47.94  ? 39   TYR D N     1 
ATOM   2359  C  CA    . TYR D 4 42  ? 4.366   -1.505  36.101 1.00 47.92  ? 39   TYR D CA    1 
ATOM   2360  C  C     . TYR D 4 42  ? 4.193   -0.013  35.812 1.00 47.65  ? 39   TYR D C     1 
ATOM   2361  O  O     . TYR D 4 42  ? 4.492   0.817   36.664 1.00 47.68  ? 39   TYR D O     1 
ATOM   2362  C  CB    . TYR D 4 42  ? 5.666   -2.033  35.504 1.00 48.31  ? 39   TYR D CB    1 
ATOM   2363  C  CG    . TYR D 4 42  ? 6.894   -1.459  36.168 1.00 49.64  ? 39   TYR D CG    1 
ATOM   2364  C  CD1   . TYR D 4 42  ? 7.480   -2.095  37.280 1.00 49.56  ? 39   TYR D CD1   1 
ATOM   2365  C  CD2   . TYR D 4 42  ? 7.477   -0.264  35.693 1.00 49.90  ? 39   TYR D CD2   1 
ATOM   2366  C  CE1   . TYR D 4 42  ? 8.615   -1.557  37.906 1.00 50.06  ? 39   TYR D CE1   1 
ATOM   2367  C  CE2   . TYR D 4 42  ? 8.608   0.281   36.296 1.00 50.02  ? 39   TYR D CE2   1 
ATOM   2368  C  CZ    . TYR D 4 42  ? 9.178   -0.364  37.404 1.00 50.98  ? 39   TYR D CZ    1 
ATOM   2369  O  OH    . TYR D 4 42  ? 10.305  0.192   38.001 1.00 51.19  ? 39   TYR D OH    1 
ATOM   2370  N  N     . LYS D 4 43  ? 3.698   0.317   34.622 1.00 47.32  ? 40   LYS D N     1 
ATOM   2371  C  CA    . LYS D 4 43  ? 3.386   1.695   34.263 1.00 47.06  ? 40   LYS D CA    1 
ATOM   2372  C  C     . LYS D 4 43  ? 2.491   2.305   35.321 1.00 46.74  ? 40   LYS D C     1 
ATOM   2373  O  O     . LYS D 4 43  ? 2.879   3.252   36.013 1.00 47.06  ? 40   LYS D O     1 
ATOM   2374  C  CB    . LYS D 4 43  ? 2.711   1.769   32.891 1.00 46.70  ? 40   LYS D CB    1 
ATOM   2375  C  CG    . LYS D 4 43  ? 3.698   1.814   31.729 1.00 47.51  ? 40   LYS D CG    1 
ATOM   2376  C  CD    . LYS D 4 43  ? 2.999   1.767   30.379 1.00 47.77  ? 40   LYS D CD    1 
ATOM   2377  C  CE    . LYS D 4 43  ? 3.980   1.382   29.279 1.00 49.40  ? 40   LYS D CE    1 
ATOM   2378  N  NZ    . LYS D 4 43  ? 3.269   1.157   27.987 1.00 50.67  ? 40   LYS D NZ    1 
ATOM   2379  N  N     . VAL D 4 44  ? 1.300   1.732   35.452 1.00 46.11  ? 41   VAL D N     1 
ATOM   2380  C  CA    . VAL D 4 44  ? 0.307   2.156   36.438 1.00 45.12  ? 41   VAL D CA    1 
ATOM   2381  C  C     . VAL D 4 44  ? 0.926   2.245   37.833 1.00 44.69  ? 41   VAL D C     1 
ATOM   2382  O  O     . VAL D 4 44  ? 0.641   3.162   38.601 1.00 44.38  ? 41   VAL D O     1 
ATOM   2383  C  CB    . VAL D 4 44  ? -0.880  1.175   36.428 1.00 44.95  ? 41   VAL D CB    1 
ATOM   2384  C  CG1   . VAL D 4 44  ? -1.882  1.511   37.511 1.00 44.01  ? 41   VAL D CG1   1 
ATOM   2385  C  CG2   . VAL D 4 44  ? -1.531  1.169   35.050 1.00 44.47  ? 41   VAL D CG2   1 
ATOM   2386  N  N     . LEU D 4 45  ? 1.792   1.291   38.150 1.00 44.37  ? 42   LEU D N     1 
ATOM   2387  C  CA    . LEU D 4 45  ? 2.477   1.324   39.428 1.00 44.15  ? 42   LEU D CA    1 
ATOM   2388  C  C     . LEU D 4 45  ? 3.227   2.657   39.581 1.00 44.09  ? 42   LEU D C     1 
ATOM   2389  O  O     . LEU D 4 45  ? 3.081   3.347   40.604 1.00 44.24  ? 42   LEU D O     1 
ATOM   2390  C  CB    . LEU D 4 45  ? 3.410   0.112   39.599 1.00 43.58  ? 42   LEU D CB    1 
ATOM   2391  C  CG    . LEU D 4 45  ? 4.266   0.144   40.870 1.00 43.52  ? 42   LEU D CG    1 
ATOM   2392  C  CD1   . LEU D 4 45  ? 3.407   0.293   42.142 1.00 42.22  ? 42   LEU D CD1   1 
ATOM   2393  C  CD2   . LEU D 4 45  ? 5.214   -1.048  40.967 1.00 43.79  ? 42   LEU D CD2   1 
ATOM   2394  N  N     . LYS D 4 46  ? 3.996   3.018   38.554 1.00 43.55  ? 43   LYS D N     1 
ATOM   2395  C  CA    . LYS D 4 46  ? 4.835   4.210   38.594 1.00 43.43  ? 43   LYS D CA    1 
ATOM   2396  C  C     . LYS D 4 46  ? 4.030   5.492   38.686 1.00 42.96  ? 43   LYS D C     1 
ATOM   2397  O  O     . LYS D 4 46  ? 4.509   6.486   39.235 1.00 43.03  ? 43   LYS D O     1 
ATOM   2398  C  CB    . LYS D 4 46  ? 5.784   4.253   37.394 1.00 43.65  ? 43   LYS D CB    1 
ATOM   2399  C  CG    . LYS D 4 46  ? 6.954   3.278   37.521 1.00 44.67  ? 43   LYS D CG    1 
ATOM   2400  C  CD    . LYS D 4 46  ? 7.724   3.540   38.817 1.00 46.34  ? 43   LYS D CD    1 
ATOM   2401  C  CE    . LYS D 4 46  ? 8.273   2.278   39.442 1.00 45.73  ? 43   LYS D CE    1 
ATOM   2402  N  NZ    . LYS D 4 46  ? 8.568   2.549   40.879 1.00 47.67  ? 43   LYS D NZ    1 
ATOM   2403  N  N     . GLN D 4 47  ? 2.808   5.451   38.165 1.00 42.38  ? 44   GLN D N     1 
ATOM   2404  C  CA    . GLN D 4 47  ? 1.874   6.558   38.277 1.00 42.17  ? 44   GLN D CA    1 
ATOM   2405  C  C     . GLN D 4 47  ? 1.413   6.802   39.713 1.00 42.17  ? 44   GLN D C     1 
ATOM   2406  O  O     . GLN D 4 47  ? 1.311   7.951   40.157 1.00 42.33  ? 44   GLN D O     1 
ATOM   2407  C  CB    . GLN D 4 47  ? 0.660   6.346   37.378 1.00 42.09  ? 44   GLN D CB    1 
ATOM   2408  C  CG    . GLN D 4 47  ? 0.947   6.401   35.876 1.00 42.29  ? 44   GLN D CG    1 
ATOM   2409  C  CD    . GLN D 4 47  ? -0.337  6.390   35.049 1.00 42.46  ? 44   GLN D CD    1 
ATOM   2410  O  OE1   . GLN D 4 47  ? -1.356  5.812   35.466 1.00 42.18  ? 44   GLN D OE1   1 
ATOM   2411  N  NE2   . GLN D 4 47  ? -0.295  7.026   33.876 1.00 40.60  ? 44   GLN D NE2   1 
ATOM   2412  N  N     . VAL D 4 48  ? 1.141   5.738   40.453 1.00 42.34  ? 45   VAL D N     1 
ATOM   2413  C  CA    . VAL D 4 48  ? 0.574   5.920   41.789 1.00 42.53  ? 45   VAL D CA    1 
ATOM   2414  C  C     . VAL D 4 48  ? 1.596   5.912   42.900 1.00 42.78  ? 45   VAL D C     1 
ATOM   2415  O  O     . VAL D 4 48  ? 1.393   6.553   43.925 1.00 43.77  ? 45   VAL D O     1 
ATOM   2416  C  CB    . VAL D 4 48  ? -0.538  4.919   42.105 1.00 42.40  ? 45   VAL D CB    1 
ATOM   2417  C  CG1   . VAL D 4 48  ? -1.768  5.270   41.302 1.00 42.73  ? 45   VAL D CG1   1 
ATOM   2418  C  CG2   . VAL D 4 48  ? -0.083  3.488   41.844 1.00 41.76  ? 45   VAL D CG2   1 
ATOM   2419  N  N     . HIS D 4 49  ? 2.691   5.196   42.715 1.00 42.63  ? 46   HIS D N     1 
ATOM   2420  C  CA    . HIS D 4 49  ? 3.728   5.205   43.729 1.00 42.85  ? 46   HIS D CA    1 
ATOM   2421  C  C     . HIS D 4 49  ? 5.102   5.255   43.059 1.00 43.39  ? 46   HIS D C     1 
ATOM   2422  O  O     . HIS D 4 49  ? 5.736   4.210   42.857 1.00 43.49  ? 46   HIS D O     1 
ATOM   2423  C  CB    . HIS D 4 49  ? 3.600   3.999   44.651 1.00 42.29  ? 46   HIS D CB    1 
ATOM   2424  C  CG    . HIS D 4 49  ? 2.488   4.101   45.645 1.00 41.29  ? 46   HIS D CG    1 
ATOM   2425  N  ND1   . HIS D 4 49  ? 2.532   4.953   46.725 1.00 41.33  ? 46   HIS D ND1   1 
ATOM   2426  C  CD2   . HIS D 4 49  ? 1.324   3.420   45.754 1.00 40.76  ? 46   HIS D CD2   1 
ATOM   2427  C  CE1   . HIS D 4 49  ? 1.439   4.801   47.452 1.00 39.65  ? 46   HIS D CE1   1 
ATOM   2428  N  NE2   . HIS D 4 49  ? 0.686   3.882   46.881 1.00 39.32  ? 46   HIS D NE2   1 
ATOM   2429  N  N     . PRO D 4 50  ? 5.560   6.480   42.707 1.00 43.69  ? 47   PRO D N     1 
ATOM   2430  C  CA    . PRO D 4 50  ? 6.735   6.705   41.857 1.00 43.57  ? 47   PRO D CA    1 
ATOM   2431  C  C     . PRO D 4 50  ? 8.046   6.091   42.339 1.00 43.64  ? 47   PRO D C     1 
ATOM   2432  O  O     . PRO D 4 50  ? 8.902   5.834   41.508 1.00 43.57  ? 47   PRO D O     1 
ATOM   2433  C  CB    . PRO D 4 50  ? 6.826   8.229   41.791 1.00 43.76  ? 47   PRO D CB    1 
ATOM   2434  C  CG    . PRO D 4 50  ? 5.408   8.687   42.037 1.00 43.21  ? 47   PRO D CG    1 
ATOM   2435  C  CD    . PRO D 4 50  ? 4.927   7.760   43.090 1.00 43.45  ? 47   PRO D CD    1 
ATOM   2436  N  N     . ASP D 4 51  ? 8.206   5.831   43.639 1.00 43.86  ? 48   ASP D N     1 
ATOM   2437  C  CA    . ASP D 4 51  ? 9.468   5.217   44.115 1.00 44.27  ? 48   ASP D CA    1 
ATOM   2438  C  C     . ASP D 4 51  ? 9.315   3.819   44.743 1.00 44.42  ? 48   ASP D C     1 
ATOM   2439  O  O     . ASP D 4 51  ? 10.245  3.319   45.403 1.00 44.92  ? 48   ASP D O     1 
ATOM   2440  C  CB    . ASP D 4 51  ? 10.235  6.135   45.096 1.00 44.47  ? 48   ASP D CB    1 
ATOM   2441  C  CG    . ASP D 4 51  ? 10.302  7.604   44.641 1.00 45.04  ? 48   ASP D CG    1 
ATOM   2442  O  OD1   . ASP D 4 51  ? 10.480  7.882   43.416 1.00 44.60  ? 48   ASP D OD1   1 
ATOM   2443  O  OD2   . ASP D 4 51  ? 10.180  8.476   45.542 1.00 43.50  ? 48   ASP D OD2   1 
ATOM   2444  N  N     . THR D 4 52  ? 8.154   3.195   44.531 1.00 43.94  ? 49   THR D N     1 
ATOM   2445  C  CA    . THR D 4 52  ? 7.861   1.854   45.015 1.00 42.75  ? 49   THR D CA    1 
ATOM   2446  C  C     . THR D 4 52  ? 8.025   0.852   43.884 1.00 42.80  ? 49   THR D C     1 
ATOM   2447  O  O     . THR D 4 52  ? 7.573   1.092   42.767 1.00 42.70  ? 49   THR D O     1 
ATOM   2448  C  CB    . THR D 4 52  ? 6.424   1.774   45.474 1.00 42.67  ? 49   THR D CB    1 
ATOM   2449  O  OG1   . THR D 4 52  ? 6.137   2.870   46.345 1.00 42.51  ? 49   THR D OG1   1 
ATOM   2450  C  CG2   . THR D 4 52  ? 6.162   0.479   46.200 1.00 42.85  ? 49   THR D CG2   1 
ATOM   2451  N  N     . GLY D 4 53  ? 8.669   -0.273  44.171 1.00 42.76  ? 50   GLY D N     1 
ATOM   2452  C  CA    . GLY D 4 53  ? 8.804   -1.348  43.190 1.00 42.81  ? 50   GLY D CA    1 
ATOM   2453  C  C     . GLY D 4 53  ? 7.834   -2.504  43.444 1.00 42.96  ? 50   GLY D C     1 
ATOM   2454  O  O     . GLY D 4 53  ? 6.913   -2.403  44.260 1.00 42.88  ? 50   GLY D O     1 
ATOM   2455  N  N     . ILE D 4 54  ? 8.036   -3.612  42.737 1.00 42.82  ? 51   ILE D N     1 
ATOM   2456  C  CA    . ILE D 4 54  ? 7.188   -4.782  42.917 1.00 42.29  ? 51   ILE D CA    1 
ATOM   2457  C  C     . ILE D 4 54  ? 7.993   -6.045  42.653 1.00 42.46  ? 51   ILE D C     1 
ATOM   2458  O  O     . ILE D 4 54  ? 8.604   -6.171  41.603 1.00 43.04  ? 51   ILE D O     1 
ATOM   2459  C  CB    . ILE D 4 54  ? 5.906   -4.711  42.028 1.00 42.45  ? 51   ILE D CB    1 
ATOM   2460  C  CG1   . ILE D 4 54  ? 4.859   -5.735  42.499 1.00 41.72  ? 51   ILE D CG1   1 
ATOM   2461  C  CG2   . ILE D 4 54  ? 6.245   -4.839  40.551 1.00 41.37  ? 51   ILE D CG2   1 
ATOM   2462  C  CD1   . ILE D 4 54  ? 3.524   -5.688  41.763 1.00 41.13  ? 51   ILE D CD1   1 
ATOM   2463  N  N     . SER D 4 55  ? 8.009   -6.961  43.622 1.00 42.34  ? 52   SER D N     1 
ATOM   2464  C  CA    . SER D 4 55  ? 8.648   -8.278  43.468 1.00 41.79  ? 52   SER D CA    1 
ATOM   2465  C  C     . SER D 4 55  ? 7.931   -9.083  42.386 1.00 41.50  ? 52   SER D C     1 
ATOM   2466  O  O     . SER D 4 55  ? 6.765   -8.823  42.097 1.00 41.35  ? 52   SER D O     1 
ATOM   2467  C  CB    . SER D 4 55  ? 8.625   -9.051  44.790 1.00 41.75  ? 52   SER D CB    1 
ATOM   2468  O  OG    . SER D 4 55  ? 7.377   -9.705  44.981 1.00 42.02  ? 52   SER D OG    1 
ATOM   2469  N  N     . SER D 4 56  ? 8.619   -10.058 41.797 1.00 41.12  ? 53   SER D N     1 
ATOM   2470  C  CA    . SER D 4 56  ? 8.054   -10.797 40.674 1.00 40.87  ? 53   SER D CA    1 
ATOM   2471  C  C     . SER D 4 56  ? 6.931   -11.744 41.098 1.00 40.69  ? 53   SER D C     1 
ATOM   2472  O  O     . SER D 4 56  ? 6.055   -12.070 40.281 1.00 40.69  ? 53   SER D O     1 
ATOM   2473  C  CB    . SER D 4 56  ? 9.134   -11.530 39.883 1.00 40.71  ? 53   SER D CB    1 
ATOM   2474  O  OG    . SER D 4 56  ? 9.456   -12.751 40.499 1.00 41.38  ? 53   SER D OG    1 
ATOM   2475  N  N     . LYS D 4 57  ? 6.948   -12.183 42.357 1.00 40.06  ? 54   LYS D N     1 
ATOM   2476  C  CA    . LYS D 4 57  ? 5.821   -12.943 42.876 1.00 40.24  ? 54   LYS D CA    1 
ATOM   2477  C  C     . LYS D 4 57  ? 4.591   -12.057 43.019 1.00 39.77  ? 54   LYS D C     1 
ATOM   2478  O  O     . LYS D 4 57  ? 3.480   -12.454 42.638 1.00 39.96  ? 54   LYS D O     1 
ATOM   2479  C  CB    . LYS D 4 57  ? 6.151   -13.615 44.204 1.00 40.87  ? 54   LYS D CB    1 
ATOM   2480  C  CG    . LYS D 4 57  ? 6.913   -14.932 44.060 1.00 43.14  ? 54   LYS D CG    1 
ATOM   2481  C  CD    . LYS D 4 57  ? 7.349   -15.452 45.438 1.00 46.81  ? 54   LYS D CD    1 
ATOM   2482  C  CE    . LYS D 4 57  ? 8.183   -16.735 45.345 1.00 49.33  ? 54   LYS D CE    1 
ATOM   2483  N  NZ    . LYS D 4 57  ? 8.215   -17.425 46.685 1.00 51.43  ? 54   LYS D NZ    1 
ATOM   2484  N  N     . ALA D 4 58  ? 4.793   -10.853 43.557 1.00 39.09  ? 55   ALA D N     1 
ATOM   2485  C  CA    . ALA D 4 58  ? 3.753   -9.834  43.579 1.00 37.87  ? 55   ALA D CA    1 
ATOM   2486  C  C     . ALA D 4 58  ? 3.235   -9.545  42.181 1.00 37.54  ? 55   ALA D C     1 
ATOM   2487  O  O     . ALA D 4 58  ? 2.035   -9.466  41.977 1.00 37.91  ? 55   ALA D O     1 
ATOM   2488  C  CB    . ALA D 4 58  ? 4.263   -8.602  44.205 1.00 37.79  ? 55   ALA D CB    1 
ATOM   2489  N  N     . MET D 4 59  ? 4.126   -9.421  41.204 1.00 37.36  ? 56   MET D N     1 
ATOM   2490  C  CA    . MET D 4 59  ? 3.699   -9.104  39.855 1.00 37.52  ? 56   MET D CA    1 
ATOM   2491  C  C     . MET D 4 59  ? 2.859   -10.252 39.352 1.00 37.77  ? 56   MET D C     1 
ATOM   2492  O  O     . MET D 4 59  ? 1.789   -10.045 38.785 1.00 38.21  ? 56   MET D O     1 
ATOM   2493  C  CB    . MET D 4 59  ? 4.891   -8.855  38.931 1.00 37.82  ? 56   MET D CB    1 
ATOM   2494  C  CG    . MET D 4 59  ? 4.527   -8.600  37.467 1.00 38.47  ? 56   MET D CG    1 
ATOM   2495  S  SD    . MET D 4 59  ? 3.486   -7.133  37.283 1.00 45.21  ? 56   MET D SD    1 
ATOM   2496  C  CE    . MET D 4 59  ? 4.735   -5.830  37.332 1.00 43.16  ? 56   MET D CE    1 
ATOM   2497  N  N     . SER D 4 60  ? 3.343   -11.467 39.589 1.00 37.85  ? 57   SER D N     1 
ATOM   2498  C  CA    . SER D 4 60  ? 2.627   -12.668 39.219 1.00 37.76  ? 57   SER D CA    1 
ATOM   2499  C  C     . SER D 4 60  ? 1.172   -12.634 39.694 1.00 37.54  ? 57   SER D C     1 
ATOM   2500  O  O     . SER D 4 60  ? 0.243   -12.756 38.878 1.00 37.24  ? 57   SER D O     1 
ATOM   2501  C  CB    . SER D 4 60  ? 3.334   -13.877 39.783 1.00 37.68  ? 57   SER D CB    1 
ATOM   2502  O  OG    . SER D 4 60  ? 2.749   -15.033 39.232 1.00 40.07  ? 57   SER D OG    1 
ATOM   2503  N  N     . ILE D 4 61  ? 0.977   -12.441 41.000 1.00 37.24  ? 58   ILE D N     1 
ATOM   2504  C  CA    . ILE D 4 61  ? -0.367  -12.227 41.542 1.00 37.53  ? 58   ILE D CA    1 
ATOM   2505  C  C     . ILE D 4 61  ? -1.122  -11.132 40.787 1.00 37.98  ? 58   ILE D C     1 
ATOM   2506  O  O     . ILE D 4 61  ? -2.285  -11.334 40.398 1.00 37.98  ? 58   ILE D O     1 
ATOM   2507  C  CB    . ILE D 4 61  ? -0.341  -11.864 43.014 1.00 37.51  ? 58   ILE D CB    1 
ATOM   2508  C  CG1   . ILE D 4 61  ? 0.155   -13.055 43.825 1.00 37.69  ? 58   ILE D CG1   1 
ATOM   2509  C  CG2   . ILE D 4 61  ? -1.730  -11.467 43.482 1.00 36.92  ? 58   ILE D CG2   1 
ATOM   2510  C  CD1   . ILE D 4 61  ? 1.005   -12.653 44.982 1.00 36.72  ? 58   ILE D CD1   1 
ATOM   2511  N  N     . MET D 4 62  ? -0.465  -9.987  40.576 1.00 37.92  ? 59   MET D N     1 
ATOM   2512  C  CA    . MET D 4 62  ? -1.075  -8.904  39.807 1.00 38.05  ? 59   MET D CA    1 
ATOM   2513  C  C     . MET D 4 62  ? -1.512  -9.415  38.447 1.00 37.87  ? 59   MET D C     1 
ATOM   2514  O  O     . MET D 4 62  ? -2.635  -9.168  37.998 1.00 37.37  ? 59   MET D O     1 
ATOM   2515  C  CB    . MET D 4 62  ? -0.132  -7.701  39.672 1.00 38.40  ? 59   MET D CB    1 
ATOM   2516  C  CG    . MET D 4 62  ? -0.058  -6.818  40.921 1.00 37.87  ? 59   MET D CG    1 
ATOM   2517  S  SD    . MET D 4 62  ? -1.689  -6.519  41.618 1.00 39.23  ? 59   MET D SD    1 
ATOM   2518  C  CE    . MET D 4 62  ? -2.453  -5.454  40.404 1.00 35.41  ? 59   MET D CE    1 
ATOM   2519  N  N     . ASN D 4 63  ? -0.636  -10.180 37.816 1.00 38.28  ? 60   ASN D N     1 
ATOM   2520  C  CA    . ASN D 4 63  ? -0.988  -10.802 36.548 1.00 38.82  ? 60   ASN D CA    1 
ATOM   2521  C  C     . ASN D 4 63  ? -2.172  -11.768 36.644 1.00 38.63  ? 60   ASN D C     1 
ATOM   2522  O  O     . ASN D 4 63  ? -3.023  -11.800 35.756 1.00 38.31  ? 60   ASN D O     1 
ATOM   2523  C  CB    . ASN D 4 63  ? 0.204   -11.483 35.914 1.00 38.70  ? 60   ASN D CB    1 
ATOM   2524  C  CG    . ASN D 4 63  ? -0.045  -11.804 34.477 1.00 40.05  ? 60   ASN D CG    1 
ATOM   2525  O  OD1   . ASN D 4 63  ? -0.820  -11.121 33.801 1.00 39.09  ? 60   ASN D OD1   1 
ATOM   2526  N  ND2   . ASN D 4 63  ? 0.587   -12.870 33.993 1.00 43.21  ? 60   ASN D ND2   1 
ATOM   2527  N  N     . SER D 4 64  ? -2.229  -12.532 37.735 1.00 38.33  ? 61   SER D N     1 
ATOM   2528  C  CA    . SER D 4 64  ? -3.348  -13.435 37.963 1.00 38.20  ? 61   SER D CA    1 
ATOM   2529  C  C     . SER D 4 64  ? -4.625  -12.653 38.183 1.00 37.95  ? 61   SER D C     1 
ATOM   2530  O  O     . SER D 4 64  ? -5.712  -13.061 37.744 1.00 38.49  ? 61   SER D O     1 
ATOM   2531  C  CB    . SER D 4 64  ? -3.093  -14.308 39.180 1.00 38.11  ? 61   SER D CB    1 
ATOM   2532  O  OG    . SER D 4 64  ? -2.106  -15.274 38.887 1.00 40.03  ? 61   SER D OG    1 
ATOM   2533  N  N     . PHE D 4 65  ? -4.494  -11.530 38.879 1.00 37.11  ? 62   PHE D N     1 
ATOM   2534  C  CA    . PHE D 4 65  ? -5.645  -10.724 39.212 1.00 36.00  ? 62   PHE D CA    1 
ATOM   2535  C  C     . PHE D 4 65  ? -6.295  -10.186 37.932 1.00 35.62  ? 62   PHE D C     1 
ATOM   2536  O  O     . PHE D 4 65  ? -7.504  -10.326 37.751 1.00 35.40  ? 62   PHE D O     1 
ATOM   2537  C  CB    . PHE D 4 65  ? -5.250  -9.613  40.186 1.00 35.67  ? 62   PHE D CB    1 
ATOM   2538  C  CG    . PHE D 4 65  ? -6.269  -8.538  40.318 1.00 34.89  ? 62   PHE D CG    1 
ATOM   2539  C  CD1   . PHE D 4 65  ? -7.411  -8.738  41.073 1.00 35.30  ? 62   PHE D CD1   1 
ATOM   2540  C  CD2   . PHE D 4 65  ? -6.092  -7.318  39.680 1.00 33.99  ? 62   PHE D CD2   1 
ATOM   2541  C  CE1   . PHE D 4 65  ? -8.363  -7.729  41.193 1.00 35.62  ? 62   PHE D CE1   1 
ATOM   2542  C  CE2   . PHE D 4 65  ? -7.036  -6.310  39.792 1.00 33.63  ? 62   PHE D CE2   1 
ATOM   2543  C  CZ    . PHE D 4 65  ? -8.170  -6.514  40.548 1.00 34.57  ? 62   PHE D CZ    1 
ATOM   2544  N  N     . VAL D 4 66  ? -5.494  -9.609  37.034 1.00 35.10  ? 63   VAL D N     1 
ATOM   2545  C  CA    . VAL D 4 66  ? -6.032  -9.016  35.800 1.00 34.32  ? 63   VAL D CA    1 
ATOM   2546  C  C     . VAL D 4 66  ? -6.784  -10.067 34.974 1.00 34.11  ? 63   VAL D C     1 
ATOM   2547  O  O     . VAL D 4 66  ? -7.955  -9.871  34.627 1.00 33.55  ? 63   VAL D O     1 
ATOM   2548  C  CB    . VAL D 4 66  ? -4.928  -8.322  34.969 1.00 34.21  ? 63   VAL D CB    1 
ATOM   2549  C  CG1   . VAL D 4 66  ? -5.455  -7.917  33.617 1.00 34.36  ? 63   VAL D CG1   1 
ATOM   2550  C  CG2   . VAL D 4 66  ? -4.376  -7.106  35.712 1.00 33.65  ? 63   VAL D CG2   1 
ATOM   2551  N  N     . ASN D 4 67  ? -6.115  -11.195 34.719 1.00 34.19  ? 64   ASN D N     1 
ATOM   2552  C  CA    . ASN D 4 67  ? -6.685  -12.321 33.984 1.00 34.52  ? 64   ASN D CA    1 
ATOM   2553  C  C     . ASN D 4 67  ? -7.975  -12.861 34.575 1.00 34.40  ? 64   ASN D C     1 
ATOM   2554  O  O     . ASN D 4 67  ? -8.895  -13.241 33.847 1.00 34.17  ? 64   ASN D O     1 
ATOM   2555  C  CB    . ASN D 4 67  ? -5.670  -13.440 33.895 1.00 34.76  ? 64   ASN D CB    1 
ATOM   2556  C  CG    . ASN D 4 67  ? -4.558  -13.126 32.935 1.00 37.37  ? 64   ASN D CG    1 
ATOM   2557  O  OD1   . ASN D 4 67  ? -4.790  -12.849 31.754 1.00 40.58  ? 64   ASN D OD1   1 
ATOM   2558  N  ND2   . ASN D 4 67  ? -3.329  -13.159 33.432 1.00 41.39  ? 64   ASN D ND2   1 
ATOM   2559  N  N     . ASP D 4 68  ? -8.036  -12.890 35.898 1.00 34.45  ? 65   ASP D N     1 
ATOM   2560  C  CA    . ASP D 4 68  ? -9.229  -13.298 36.591 1.00 34.93  ? 65   ASP D CA    1 
ATOM   2561  C  C     . ASP D 4 68  ? -10.394 -12.372 36.267 1.00 35.41  ? 65   ASP D C     1 
ATOM   2562  O  O     . ASP D 4 68  ? -11.390 -12.786 35.659 1.00 35.64  ? 65   ASP D O     1 
ATOM   2563  C  CB    . ASP D 4 68  ? -8.963  -13.316 38.081 1.00 35.01  ? 65   ASP D CB    1 
ATOM   2564  C  CG    . ASP D 4 68  ? -10.046 -14.021 38.850 1.00 36.84  ? 65   ASP D CG    1 
ATOM   2565  O  OD1   . ASP D 4 68  ? -10.733 -14.894 38.259 1.00 39.39  ? 65   ASP D OD1   1 
ATOM   2566  O  OD2   . ASP D 4 68  ? -10.200 -13.713 40.052 1.00 37.98  ? 65   ASP D OD2   1 
ATOM   2567  N  N     . VAL D 4 69  ? -10.243 -11.105 36.639 1.00 35.96  ? 66   VAL D N     1 
ATOM   2568  C  CA    . VAL D 4 69  ? -11.268 -10.098 36.427 1.00 36.27  ? 66   VAL D CA    1 
ATOM   2569  C  C     . VAL D 4 69  ? -11.690 -10.019 34.950 1.00 36.82  ? 66   VAL D C     1 
ATOM   2570  O  O     . VAL D 4 69  ? -12.886 -9.924  34.641 1.00 35.98  ? 66   VAL D O     1 
ATOM   2571  C  CB    . VAL D 4 69  ? -10.812 -8.728  36.964 1.00 36.36  ? 66   VAL D CB    1 
ATOM   2572  C  CG1   . VAL D 4 69  ? -11.984 -7.765  36.997 1.00 36.73  ? 66   VAL D CG1   1 
ATOM   2573  C  CG2   . VAL D 4 69  ? -10.236 -8.868  38.385 1.00 36.02  ? 66   VAL D CG2   1 
ATOM   2574  N  N     . PHE D 4 70  ? -10.706 -10.085 34.046 1.00 37.68  ? 67   PHE D N     1 
ATOM   2575  C  CA    . PHE D 4 70  ? -10.993 -10.140 32.620 1.00 38.45  ? 67   PHE D CA    1 
ATOM   2576  C  C     . PHE D 4 70  ? -11.962 -11.281 32.358 1.00 39.31  ? 67   PHE D C     1 
ATOM   2577  O  O     . PHE D 4 70  ? -13.030 -11.046 31.787 1.00 39.90  ? 67   PHE D O     1 
ATOM   2578  C  CB    . PHE D 4 70  ? -9.720  -10.323 31.795 1.00 38.88  ? 67   PHE D CB    1 
ATOM   2579  C  CG    . PHE D 4 70  ? -9.964  -10.458 30.300 1.00 39.15  ? 67   PHE D CG    1 
ATOM   2580  C  CD1   . PHE D 4 70  ? -9.792  -9.365  29.449 1.00 39.31  ? 67   PHE D CD1   1 
ATOM   2581  C  CD2   . PHE D 4 70  ? -10.344 -11.678 29.746 1.00 38.67  ? 67   PHE D CD2   1 
ATOM   2582  C  CE1   . PHE D 4 70  ? -10.005 -9.480  28.070 1.00 39.52  ? 67   PHE D CE1   1 
ATOM   2583  C  CE2   . PHE D 4 70  ? -10.563 -11.807 28.370 1.00 39.27  ? 67   PHE D CE2   1 
ATOM   2584  C  CZ    . PHE D 4 70  ? -10.398 -10.706 27.532 1.00 40.09  ? 67   PHE D CZ    1 
ATOM   2585  N  N     . GLU D 4 71  ? -11.605 -12.499 32.795 1.00 39.60  ? 68   GLU D N     1 
ATOM   2586  C  CA    . GLU D 4 71  ? -12.453 -13.677 32.589 1.00 39.81  ? 68   GLU D CA    1 
ATOM   2587  C  C     . GLU D 4 71  ? -13.858 -13.471 33.128 1.00 39.21  ? 68   GLU D C     1 
ATOM   2588  O  O     . GLU D 4 71  ? -14.831 -13.749 32.445 1.00 38.71  ? 68   GLU D O     1 
ATOM   2589  C  CB    . GLU D 4 71  ? -11.849 -14.917 33.244 1.00 40.44  ? 68   GLU D CB    1 
ATOM   2590  C  CG    . GLU D 4 71  ? -10.818 -15.681 32.420 1.00 42.83  ? 68   GLU D CG    1 
ATOM   2591  C  CD    . GLU D 4 71  ? -9.815  -16.438 33.313 1.00 46.11  ? 68   GLU D CD    1 
ATOM   2592  O  OE1   . GLU D 4 71  ? -10.133 -16.677 34.509 1.00 47.26  ? 68   GLU D OE1   1 
ATOM   2593  O  OE2   . GLU D 4 71  ? -8.708  -16.781 32.823 1.00 47.29  ? 68   GLU D OE2   1 
ATOM   2594  N  N     . ARG D 4 72  ? -13.967 -12.976 34.354 1.00 39.18  ? 69   ARG D N     1 
ATOM   2595  C  CA    . ARG D 4 72  ? -15.284 -12.806 34.964 1.00 39.19  ? 69   ARG D CA    1 
ATOM   2596  C  C     . ARG D 4 72  ? -16.137 -11.703 34.318 1.00 39.45  ? 69   ARG D C     1 
ATOM   2597  O  O     . ARG D 4 72  ? -17.362 -11.836 34.249 1.00 40.00  ? 69   ARG D O     1 
ATOM   2598  C  CB    . ARG D 4 72  ? -15.166 -12.529 36.448 1.00 39.21  ? 69   ARG D CB    1 
ATOM   2599  C  CG    . ARG D 4 72  ? -14.322 -13.502 37.255 1.00 38.91  ? 69   ARG D CG    1 
ATOM   2600  C  CD    . ARG D 4 72  ? -14.709 -13.321 38.712 1.00 37.58  ? 69   ARG D CD    1 
ATOM   2601  N  NE    . ARG D 4 72  ? -13.540 -13.272 39.565 1.00 36.95  ? 69   ARG D NE    1 
ATOM   2602  C  CZ    . ARG D 4 72  ? -13.519 -12.715 40.769 1.00 36.31  ? 69   ARG D CZ    1 
ATOM   2603  N  NH1   . ARG D 4 72  ? -14.602 -12.126 41.262 1.00 35.56  ? 69   ARG D NH1   1 
ATOM   2604  N  NH2   . ARG D 4 72  ? -12.398 -12.726 41.472 1.00 35.78  ? 69   ARG D NH2   1 
ATOM   2605  N  N     . ILE D 4 73  ? -15.520 -10.616 33.855 1.00 39.15  ? 70   ILE D N     1 
ATOM   2606  C  CA    . ILE D 4 73  ? -16.299 -9.574  33.182 1.00 39.17  ? 70   ILE D CA    1 
ATOM   2607  C  C     . ILE D 4 73  ? -16.756 -10.107 31.832 1.00 39.72  ? 70   ILE D C     1 
ATOM   2608  O  O     . ILE D 4 73  ? -17.955 -10.083 31.522 1.00 39.40  ? 70   ILE D O     1 
ATOM   2609  C  CB    . ILE D 4 73  ? -15.547 -8.214  33.069 1.00 39.15  ? 70   ILE D CB    1 
ATOM   2610  C  CG1   . ILE D 4 73  ? -15.551 -7.494  34.419 1.00 37.96  ? 70   ILE D CG1   1 
ATOM   2611  C  CG2   . ILE D 4 73  ? -16.193 -7.308  32.038 1.00 38.56  ? 70   ILE D CG2   1 
ATOM   2612  C  CD1   . ILE D 4 73  ? -14.406 -6.534  34.586 1.00 37.00  ? 70   ILE D CD1   1 
ATOM   2613  N  N     . ALA D 4 74  ? -15.801 -10.623 31.054 1.00 40.33  ? 71   ALA D N     1 
ATOM   2614  C  CA    . ALA D 4 74  ? -16.099 -11.303 29.784 1.00 40.88  ? 71   ALA D CA    1 
ATOM   2615  C  C     . ALA D 4 74  ? -17.107 -12.457 29.958 1.00 41.47  ? 71   ALA D C     1 
ATOM   2616  O  O     . ALA D 4 74  ? -17.946 -12.683 29.080 1.00 42.21  ? 71   ALA D O     1 
ATOM   2617  C  CB    . ALA D 4 74  ? -14.825 -11.789 29.123 1.00 40.21  ? 71   ALA D CB    1 
ATOM   2618  N  N     . GLY D 4 75  ? -17.037 -13.161 31.090 1.00 41.52  ? 72   GLY D N     1 
ATOM   2619  C  CA    . GLY D 4 75  ? -17.964 -14.245 31.374 1.00 42.10  ? 72   GLY D CA    1 
ATOM   2620  C  C     . GLY D 4 75  ? -19.383 -13.727 31.465 1.00 42.73  ? 72   GLY D C     1 
ATOM   2621  O  O     . GLY D 4 75  ? -20.256 -14.135 30.700 1.00 42.14  ? 72   GLY D O     1 
ATOM   2622  N  N     . GLU D 4 76  ? -19.598 -12.806 32.402 1.00 43.61  ? 73   GLU D N     1 
ATOM   2623  C  CA    . GLU D 4 76  ? -20.872 -12.102 32.546 1.00 44.44  ? 73   GLU D CA    1 
ATOM   2624  C  C     . GLU D 4 76  ? -21.313 -11.441 31.261 1.00 44.59  ? 73   GLU D C     1 
ATOM   2625  O  O     . GLU D 4 76  ? -22.504 -11.353 30.998 1.00 45.04  ? 73   GLU D O     1 
ATOM   2626  C  CB    . GLU D 4 76  ? -20.776 -11.020 33.620 1.00 44.63  ? 73   GLU D CB    1 
ATOM   2627  C  CG    . GLU D 4 76  ? -20.518 -11.545 35.005 1.00 46.15  ? 73   GLU D CG    1 
ATOM   2628  C  CD    . GLU D 4 76  ? -21.754 -12.157 35.629 1.00 48.01  ? 73   GLU D CD    1 
ATOM   2629  O  OE1   . GLU D 4 76  ? -22.854 -12.091 34.991 1.00 47.32  ? 73   GLU D OE1   1 
ATOM   2630  O  OE2   . GLU D 4 76  ? -21.602 -12.696 36.760 1.00 47.33  ? 73   GLU D OE2   1 
ATOM   2631  N  N     . ALA D 4 77  ? -20.359 -10.952 30.474 1.00 44.92  ? 74   ALA D N     1 
ATOM   2632  C  CA    . ALA D 4 77  ? -20.697 -10.268 29.236 1.00 45.32  ? 74   ALA D CA    1 
ATOM   2633  C  C     . ALA D 4 77  ? -21.278 -11.291 28.289 1.00 45.69  ? 74   ALA D C     1 
ATOM   2634  O  O     . ALA D 4 77  ? -22.336 -11.089 27.702 1.00 45.50  ? 74   ALA D O     1 
ATOM   2635  C  CB    . ALA D 4 77  ? -19.476 -9.622  28.630 1.00 45.32  ? 74   ALA D CB    1 
ATOM   2636  N  N     . SER D 4 78  ? -20.576 -12.410 28.171 1.00 46.35  ? 75   SER D N     1 
ATOM   2637  C  CA    . SER D 4 78  ? -21.000 -13.490 27.311 1.00 46.82  ? 75   SER D CA    1 
ATOM   2638  C  C     . SER D 4 78  ? -22.450 -13.884 27.586 1.00 47.05  ? 75   SER D C     1 
ATOM   2639  O  O     . SER D 4 78  ? -23.305 -13.744 26.709 1.00 47.22  ? 75   SER D O     1 
ATOM   2640  C  CB    . SER D 4 78  ? -20.071 -14.671 27.486 1.00 46.46  ? 75   SER D CB    1 
ATOM   2641  O  OG    . SER D 4 78  ? -20.452 -15.678 26.594 1.00 47.82  ? 75   SER D OG    1 
ATOM   2642  N  N     . ARG D 4 79  ? -22.714 -14.350 28.807 1.00 47.56  ? 76   ARG D N     1 
ATOM   2643  C  CA    . ARG D 4 79  ? -24.049 -14.740 29.252 1.00 48.24  ? 76   ARG D CA    1 
ATOM   2644  C  C     . ARG D 4 79  ? -25.097 -13.688 28.944 1.00 49.10  ? 76   ARG D C     1 
ATOM   2645  O  O     . ARG D 4 79  ? -26.177 -14.001 28.429 1.00 49.43  ? 76   ARG D O     1 
ATOM   2646  C  CB    . ARG D 4 79  ? -24.053 -14.995 30.757 1.00 48.23  ? 76   ARG D CB    1 
ATOM   2647  C  CG    . ARG D 4 79  ? -24.149 -16.447 31.177 1.00 47.52  ? 76   ARG D CG    1 
ATOM   2648  C  CD    . ARG D 4 79  ? -23.548 -16.626 32.559 1.00 46.79  ? 76   ARG D CD    1 
ATOM   2649  N  NE    . ARG D 4 79  ? -22.108 -16.833 32.435 1.00 46.23  ? 76   ARG D NE    1 
ATOM   2650  C  CZ    . ARG D 4 79  ? -21.200 -16.435 33.315 1.00 45.46  ? 76   ARG D CZ    1 
ATOM   2651  N  NH1   . ARG D 4 79  ? -21.565 -15.783 34.414 1.00 45.60  ? 76   ARG D NH1   1 
ATOM   2652  N  NH2   . ARG D 4 79  ? -19.920 -16.687 33.080 1.00 45.19  ? 76   ARG D NH2   1 
ATOM   2653  N  N     . LEU D 4 80  ? -24.777 -12.439 29.266 1.00 49.65  ? 77   LEU D N     1 
ATOM   2654  C  CA    . LEU D 4 80  ? -25.695 -11.337 29.044 1.00 50.31  ? 77   LEU D CA    1 
ATOM   2655  C  C     . LEU D 4 80  ? -26.153 -11.247 27.585 1.00 50.97  ? 77   LEU D C     1 
ATOM   2656  O  O     . LEU D 4 80  ? -27.353 -11.199 27.289 1.00 51.00  ? 77   LEU D O     1 
ATOM   2657  C  CB    . LEU D 4 80  ? -25.023 -10.039 29.466 1.00 50.15  ? 77   LEU D CB    1 
ATOM   2658  C  CG    . LEU D 4 80  ? -25.865 -8.831  29.861 1.00 49.68  ? 77   LEU D CG    1 
ATOM   2659  C  CD1   . LEU D 4 80  ? -27.188 -9.218  30.495 1.00 48.24  ? 77   LEU D CD1   1 
ATOM   2660  C  CD2   . LEU D 4 80  ? -25.017 -8.058  30.828 1.00 50.16  ? 77   LEU D CD2   1 
ATOM   2661  N  N     . ALA D 4 81  ? -25.188 -11.229 26.678 1.00 51.85  ? 78   ALA D N     1 
ATOM   2662  C  CA    . ALA D 4 81  ? -25.478 -11.161 25.268 1.00 53.16  ? 78   ALA D CA    1 
ATOM   2663  C  C     . ALA D 4 81  ? -26.435 -12.289 24.927 1.00 54.32  ? 78   ALA D C     1 
ATOM   2664  O  O     . ALA D 4 81  ? -27.507 -12.056 24.347 1.00 54.32  ? 78   ALA D O     1 
ATOM   2665  C  CB    . ALA D 4 81  ? -24.207 -11.281 24.476 1.00 53.21  ? 78   ALA D CB    1 
ATOM   2666  N  N     . HIS D 4 82  ? -26.057 -13.505 25.329 1.00 55.47  ? 79   HIS D N     1 
ATOM   2667  C  CA    . HIS D 4 82  ? -26.859 -14.691 25.057 1.00 56.46  ? 79   HIS D CA    1 
ATOM   2668  C  C     . HIS D 4 82  ? -28.283 -14.541 25.557 1.00 56.66  ? 79   HIS D C     1 
ATOM   2669  O  O     . HIS D 4 82  ? -29.210 -14.741 24.797 1.00 56.66  ? 79   HIS D O     1 
ATOM   2670  C  CB    . HIS D 4 82  ? -26.204 -15.953 25.622 1.00 56.75  ? 79   HIS D CB    1 
ATOM   2671  C  CG    . HIS D 4 82  ? -25.064 -16.465 24.793 1.00 58.06  ? 79   HIS D CG    1 
ATOM   2672  N  ND1   . HIS D 4 82  ? -25.170 -16.680 23.434 1.00 59.44  ? 79   HIS D ND1   1 
ATOM   2673  C  CD2   . HIS D 4 82  ? -23.803 -16.825 25.134 1.00 58.70  ? 79   HIS D CD2   1 
ATOM   2674  C  CE1   . HIS D 4 82  ? -24.020 -17.139 22.972 1.00 59.86  ? 79   HIS D CE1   1 
ATOM   2675  N  NE2   . HIS D 4 82  ? -23.172 -17.233 23.982 1.00 59.73  ? 79   HIS D NE2   1 
ATOM   2676  N  N     . TYR D 4 83  ? -28.458 -14.154 26.816 1.00 57.55  ? 80   TYR D N     1 
ATOM   2677  C  CA    . TYR D 4 83  ? -29.801 -14.028 27.390 1.00 58.51  ? 80   TYR D CA    1 
ATOM   2678  C  C     . TYR D 4 83  ? -30.668 -13.011 26.638 1.00 58.77  ? 80   TYR D C     1 
ATOM   2679  O  O     . TYR D 4 83  ? -31.858 -12.874 26.918 1.00 58.72  ? 80   TYR D O     1 
ATOM   2680  C  CB    . TYR D 4 83  ? -29.755 -13.651 28.876 1.00 58.81  ? 80   TYR D CB    1 
ATOM   2681  C  CG    . TYR D 4 83  ? -28.948 -14.561 29.780 1.00 59.77  ? 80   TYR D CG    1 
ATOM   2682  C  CD1   . TYR D 4 83  ? -28.477 -14.089 31.008 1.00 60.61  ? 80   TYR D CD1   1 
ATOM   2683  C  CD2   . TYR D 4 83  ? -28.650 -15.885 29.425 1.00 59.97  ? 80   TYR D CD2   1 
ATOM   2684  C  CE1   . TYR D 4 83  ? -27.728 -14.895 31.865 1.00 60.01  ? 80   TYR D CE1   1 
ATOM   2685  C  CE2   . TYR D 4 83  ? -27.891 -16.707 30.282 1.00 60.18  ? 80   TYR D CE2   1 
ATOM   2686  C  CZ    . TYR D 4 83  ? -27.438 -16.197 31.505 1.00 60.15  ? 80   TYR D CZ    1 
ATOM   2687  O  OH    . TYR D 4 83  ? -26.699 -16.975 32.379 1.00 60.38  ? 80   TYR D OH    1 
ATOM   2688  N  N     . ASN D 4 84  ? -30.065 -12.302 25.686 1.00 59.27  ? 81   ASN D N     1 
ATOM   2689  C  CA    . ASN D 4 84  ? -30.773 -11.281 24.916 1.00 59.52  ? 81   ASN D CA    1 
ATOM   2690  C  C     . ASN D 4 84  ? -30.641 -11.517 23.426 1.00 59.68  ? 81   ASN D C     1 
ATOM   2691  O  O     . ASN D 4 84  ? -30.814 -10.601 22.619 1.00 59.85  ? 81   ASN D O     1 
ATOM   2692  C  CB    . ASN D 4 84  ? -30.260 -9.892  25.284 1.00 59.39  ? 81   ASN D CB    1 
ATOM   2693  C  CG    . ASN D 4 84  ? -30.667 -9.487  26.669 1.00 59.24  ? 81   ASN D CG    1 
ATOM   2694  O  OD1   . ASN D 4 84  ? -31.785 -9.021  26.880 1.00 59.65  ? 81   ASN D OD1   1 
ATOM   2695  N  ND2   . ASN D 4 84  ? -29.767 -9.671  27.634 1.00 57.95  ? 81   ASN D ND2   1 
ATOM   2696  N  N     . LYS D 4 85  ? -30.318 -12.757 23.072 1.00 59.87  ? 82   LYS D N     1 
ATOM   2697  C  CA    . LYS D 4 85  ? -30.150 -13.161 21.683 1.00 59.95  ? 82   LYS D CA    1 
ATOM   2698  C  C     . LYS D 4 85  ? -29.387 -12.089 20.906 1.00 59.74  ? 82   LYS D C     1 
ATOM   2699  O  O     . LYS D 4 85  ? -29.649 -11.847 19.737 1.00 59.93  ? 82   LYS D O     1 
ATOM   2700  C  CB    . LYS D 4 85  ? -31.516 -13.470 21.057 1.00 60.38  ? 82   LYS D CB    1 
ATOM   2701  C  CG    . LYS D 4 85  ? -32.278 -14.601 21.752 1.00 60.40  ? 82   LYS D CG    1 
ATOM   2702  C  CD    . LYS D 4 85  ? -33.726 -14.204 21.971 1.00 62.17  ? 82   LYS D CD    1 
ATOM   2703  C  CE    . LYS D 4 85  ? -34.384 -15.024 23.081 1.00 63.31  ? 82   LYS D CE    1 
ATOM   2704  N  NZ    . LYS D 4 85  ? -34.938 -16.314 22.577 1.00 64.09  ? 82   LYS D NZ    1 
ATOM   2705  N  N     . ARG D 4 86  ? -28.461 -11.435 21.599 1.00 59.72  ? 83   ARG D N     1 
ATOM   2706  C  CA    . ARG D 4 86  ? -27.541 -10.489 21.008 1.00 59.75  ? 83   ARG D CA    1 
ATOM   2707  C  C     . ARG D 4 86  ? -26.256 -11.231 20.767 1.00 59.13  ? 83   ARG D C     1 
ATOM   2708  O  O     . ARG D 4 86  ? -25.736 -11.881 21.668 1.00 59.28  ? 83   ARG D O     1 
ATOM   2709  C  CB    . ARG D 4 86  ? -27.270 -9.313  21.953 1.00 60.30  ? 83   ARG D CB    1 
ATOM   2710  C  CG    . ARG D 4 86  ? -28.391 -8.285  22.041 1.00 62.42  ? 83   ARG D CG    1 
ATOM   2711  C  CD    . ARG D 4 86  ? -28.771 -7.745  20.659 1.00 66.62  ? 83   ARG D CD    1 
ATOM   2712  N  NE    . ARG D 4 86  ? -29.906 -6.829  20.737 1.00 69.76  ? 83   ARG D NE    1 
ATOM   2713  C  CZ    . ARG D 4 86  ? -31.183 -7.203  20.717 1.00 71.17  ? 83   ARG D CZ    1 
ATOM   2714  N  NH1   . ARG D 4 86  ? -31.510 -8.489  20.608 1.00 71.73  ? 83   ARG D NH1   1 
ATOM   2715  N  NH2   . ARG D 4 86  ? -32.139 -6.284  20.806 1.00 72.02  ? 83   ARG D NH2   1 
ATOM   2716  N  N     . SER D 4 87  ? -25.751 -11.132 19.546 1.00 58.39  ? 84   SER D N     1 
ATOM   2717  C  CA    . SER D 4 87  ? -24.565 -11.858 19.131 1.00 57.38  ? 84   SER D CA    1 
ATOM   2718  C  C     . SER D 4 87  ? -23.306 -10.990 19.177 1.00 56.69  ? 84   SER D C     1 
ATOM   2719  O  O     . SER D 4 87  ? -22.215 -11.453 18.822 1.00 56.32  ? 84   SER D O     1 
ATOM   2720  C  CB    . SER D 4 87  ? -24.786 -12.423 17.722 1.00 57.71  ? 84   SER D CB    1 
ATOM   2721  O  OG    . SER D 4 87  ? -25.144 -11.401 16.800 1.00 57.53  ? 84   SER D OG    1 
ATOM   2722  N  N     . THR D 4 88  ? -23.461 -9.734  19.606 1.00 56.05  ? 85   THR D N     1 
ATOM   2723  C  CA    . THR D 4 88  ? -22.315 -8.811  19.755 1.00 55.39  ? 85   THR D CA    1 
ATOM   2724  C  C     . THR D 4 88  ? -22.072 -8.437  21.217 1.00 54.38  ? 85   THR D C     1 
ATOM   2725  O  O     . THR D 4 88  ? -23.017 -8.179  21.951 1.00 54.41  ? 85   THR D O     1 
ATOM   2726  C  CB    . THR D 4 88  ? -22.500 -7.496  18.969 1.00 55.22  ? 85   THR D CB    1 
ATOM   2727  O  OG1   . THR D 4 88  ? -23.409 -7.687  17.882 1.00 55.96  ? 85   THR D OG1   1 
ATOM   2728  C  CG2   . THR D 4 88  ? -21.169 -7.028  18.421 1.00 56.00  ? 85   THR D CG2   1 
ATOM   2729  N  N     . ILE D 4 89  ? -20.812 -8.411  21.643 1.00 53.34  ? 86   ILE D N     1 
ATOM   2730  C  CA    . ILE D 4 89  ? -20.487 -7.832  22.950 1.00 52.48  ? 86   ILE D CA    1 
ATOM   2731  C  C     . ILE D 4 89  ? -20.042 -6.383  22.748 1.00 52.38  ? 86   ILE D C     1 
ATOM   2732  O  O     . ILE D 4 89  ? -18.931 -6.114  22.264 1.00 52.36  ? 86   ILE D O     1 
ATOM   2733  C  CB    . ILE D 4 89  ? -19.432 -8.645  23.739 1.00 52.21  ? 86   ILE D CB    1 
ATOM   2734  C  CG1   . ILE D 4 89  ? -20.060 -9.927  24.304 1.00 52.67  ? 86   ILE D CG1   1 
ATOM   2735  C  CG2   . ILE D 4 89  ? -18.899 -7.839  24.896 1.00 51.77  ? 86   ILE D CG2   1 
ATOM   2736  C  CD1   . ILE D 4 89  ? -19.060 -10.998 24.757 1.00 52.07  ? 86   ILE D CD1   1 
ATOM   2737  N  N     . THR D 4 90  ? -20.927 -5.452  23.086 1.00 51.71  ? 87   THR D N     1 
ATOM   2738  C  CA    . THR D 4 90  ? -20.578 -4.040  23.013 1.00 51.50  ? 87   THR D CA    1 
ATOM   2739  C  C     . THR D 4 90  ? -20.135 -3.484  24.368 1.00 51.12  ? 87   THR D C     1 
ATOM   2740  O  O     . THR D 4 90  ? -20.199 -4.164  25.391 1.00 50.90  ? 87   THR D O     1 
ATOM   2741  C  CB    . THR D 4 90  ? -21.727 -3.180  22.448 1.00 51.48  ? 87   THR D CB    1 
ATOM   2742  O  OG1   . THR D 4 90  ? -22.799 -3.100  23.403 1.00 51.97  ? 87   THR D OG1   1 
ATOM   2743  C  CG2   . THR D 4 90  ? -22.226 -3.757  21.134 1.00 51.45  ? 87   THR D CG2   1 
ATOM   2744  N  N     . SER D 4 91  ? -19.687 -2.237  24.358 1.00 50.84  ? 88   SER D N     1 
ATOM   2745  C  CA    . SER D 4 91  ? -19.306 -1.556  25.574 1.00 50.58  ? 88   SER D CA    1 
ATOM   2746  C  C     . SER D 4 91  ? -20.475 -1.555  26.551 1.00 50.20  ? 88   SER D C     1 
ATOM   2747  O  O     . SER D 4 91  ? -20.277 -1.572  27.762 1.00 50.13  ? 88   SER D O     1 
ATOM   2748  C  CB    . SER D 4 91  ? -18.849 -0.128  25.259 1.00 50.75  ? 88   SER D CB    1 
ATOM   2749  O  OG    . SER D 4 91  ? -19.955 0.704   24.962 1.00 51.14  ? 88   SER D OG    1 
ATOM   2750  N  N     . ARG D 4 92  ? -21.696 -1.558  26.026 1.00 50.06  ? 89   ARG D N     1 
ATOM   2751  C  CA    . ARG D 4 92  ? -22.867 -1.607  26.893 1.00 49.94  ? 89   ARG D CA    1 
ATOM   2752  C  C     . ARG D 4 92  ? -22.969 -2.920  27.670 1.00 49.97  ? 89   ARG D C     1 
ATOM   2753  O  O     . ARG D 4 92  ? -23.282 -2.915  28.859 1.00 50.33  ? 89   ARG D O     1 
ATOM   2754  C  CB    . ARG D 4 92  ? -24.147 -1.354  26.120 1.00 49.87  ? 89   ARG D CB    1 
ATOM   2755  C  CG    . ARG D 4 92  ? -25.283 -1.040  27.049 1.00 49.57  ? 89   ARG D CG    1 
ATOM   2756  C  CD    . ARG D 4 92  ? -26.513 -0.593  26.308 1.00 49.80  ? 89   ARG D CD    1 
ATOM   2757  N  NE    . ARG D 4 92  ? -27.672 -0.650  27.196 1.00 49.41  ? 89   ARG D NE    1 
ATOM   2758  C  CZ    . ARG D 4 92  ? -28.582 -1.617  27.180 1.00 47.99  ? 89   ARG D CZ    1 
ATOM   2759  N  NH1   . ARG D 4 92  ? -28.488 -2.614  26.301 1.00 47.29  ? 89   ARG D NH1   1 
ATOM   2760  N  NH2   . ARG D 4 92  ? -29.593 -1.571  28.037 1.00 47.41  ? 89   ARG D NH2   1 
ATOM   2761  N  N     . GLU D 4 93  ? -22.701 -4.039  26.996 1.00 49.50  ? 90   GLU D N     1 
ATOM   2762  C  CA    . GLU D 4 93  ? -22.604 -5.338  27.662 1.00 48.47  ? 90   GLU D CA    1 
ATOM   2763  C  C     . GLU D 4 93  ? -21.573 -5.330  28.789 1.00 47.74  ? 90   GLU D C     1 
ATOM   2764  O  O     . GLU D 4 93  ? -21.910 -5.631  29.932 1.00 47.93  ? 90   GLU D O     1 
ATOM   2765  C  CB    . GLU D 4 93  ? -22.287 -6.438  26.651 1.00 48.48  ? 90   GLU D CB    1 
ATOM   2766  C  CG    . GLU D 4 93  ? -23.519 -7.106  26.057 1.00 48.52  ? 90   GLU D CG    1 
ATOM   2767  C  CD    . GLU D 4 93  ? -24.429 -6.150  25.297 1.00 48.10  ? 90   GLU D CD    1 
ATOM   2768  O  OE1   . GLU D 4 93  ? -25.661 -6.337  25.369 1.00 47.78  ? 90   GLU D OE1   1 
ATOM   2769  O  OE2   . GLU D 4 93  ? -23.918 -5.219  24.636 1.00 47.66  ? 90   GLU D OE2   1 
ATOM   2770  N  N     . ILE D 4 94  ? -20.333 -4.972  28.465 1.00 46.74  ? 91   ILE D N     1 
ATOM   2771  C  CA    . ILE D 4 94  ? -19.254 -4.888  29.445 1.00 46.18  ? 91   ILE D CA    1 
ATOM   2772  C  C     . ILE D 4 94  ? -19.687 -4.082  30.664 1.00 46.27  ? 91   ILE D C     1 
ATOM   2773  O  O     . ILE D 4 94  ? -19.379 -4.446  31.802 1.00 46.33  ? 91   ILE D O     1 
ATOM   2774  C  CB    . ILE D 4 94  ? -18.004 -4.213  28.846 1.00 46.17  ? 91   ILE D CB    1 
ATOM   2775  C  CG1   . ILE D 4 94  ? -17.523 -4.941  27.576 1.00 45.80  ? 91   ILE D CG1   1 
ATOM   2776  C  CG2   . ILE D 4 94  ? -16.896 -4.050  29.911 1.00 46.44  ? 91   ILE D CG2   1 
ATOM   2777  C  CD1   . ILE D 4 94  ? -16.905 -6.322  27.809 1.00 46.34  ? 91   ILE D CD1   1 
ATOM   2778  N  N     . GLN D 4 95  ? -20.411 -2.990  30.420 1.00 46.08  ? 92   GLN D N     1 
ATOM   2779  C  CA    . GLN D 4 95  ? -20.879 -2.127  31.494 1.00 45.59  ? 92   GLN D CA    1 
ATOM   2780  C  C     . GLN D 4 95  ? -21.771 -2.906  32.464 1.00 45.15  ? 92   GLN D C     1 
ATOM   2781  O  O     . GLN D 4 95  ? -21.483 -2.972  33.654 1.00 45.36  ? 92   GLN D O     1 
ATOM   2782  C  CB    . GLN D 4 95  ? -21.575 -0.877  30.932 1.00 45.77  ? 92   GLN D CB    1 
ATOM   2783  C  CG    . GLN D 4 95  ? -22.169 0.043   32.010 1.00 46.19  ? 92   GLN D CG    1 
ATOM   2784  C  CD    . GLN D 4 95  ? -22.057 1.522   31.691 1.00 45.97  ? 92   GLN D CD    1 
ATOM   2785  O  OE1   . GLN D 4 95  ? -23.034 2.251   31.785 1.00 47.47  ? 92   GLN D OE1   1 
ATOM   2786  N  NE2   . GLN D 4 95  ? -20.864 1.974   31.344 1.00 44.11  ? 92   GLN D NE2   1 
ATOM   2787  N  N     . THR D 4 96  ? -22.829 -3.523  31.958 1.00 44.40  ? 93   THR D N     1 
ATOM   2788  C  CA    . THR D 4 96  ? -23.673 -4.355  32.802 1.00 44.24  ? 93   THR D CA    1 
ATOM   2789  C  C     . THR D 4 96  ? -22.913 -5.479  33.534 1.00 44.03  ? 93   THR D C     1 
ATOM   2790  O  O     . THR D 4 96  ? -23.256 -5.820  34.671 1.00 44.06  ? 93   THR D O     1 
ATOM   2791  C  CB    . THR D 4 96  ? -24.831 -4.940  32.015 1.00 44.20  ? 93   THR D CB    1 
ATOM   2792  O  OG1   . THR D 4 96  ? -25.378 -3.920  31.177 1.00 44.75  ? 93   THR D OG1   1 
ATOM   2793  C  CG2   . THR D 4 96  ? -25.912 -5.436  32.954 1.00 43.65  ? 93   THR D CG2   1 
ATOM   2794  N  N     . ALA D 4 97  ? -21.878 -6.035  32.908 1.00 43.44  ? 94   ALA D N     1 
ATOM   2795  C  CA    . ALA D 4 97  ? -21.061 -7.047  33.580 1.00 43.06  ? 94   ALA D CA    1 
ATOM   2796  C  C     . ALA D 4 97  ? -20.403 -6.427  34.795 1.00 42.99  ? 94   ALA D C     1 
ATOM   2797  O  O     . ALA D 4 97  ? -20.390 -7.015  35.874 1.00 43.10  ? 94   ALA D O     1 
ATOM   2798  C  CB    . ALA D 4 97  ? -20.004 -7.597  32.642 1.00 43.02  ? 94   ALA D CB    1 
ATOM   2799  N  N     . VAL D 4 98  ? -19.874 -5.220  34.606 1.00 42.75  ? 95   VAL D N     1 
ATOM   2800  C  CA    . VAL D 4 98  ? -19.133 -4.525  35.639 1.00 42.41  ? 95   VAL D CA    1 
ATOM   2801  C  C     . VAL D 4 98  ? -20.011 -4.257  36.845 1.00 42.43  ? 95   VAL D C     1 
ATOM   2802  O  O     . VAL D 4 98  ? -19.593 -4.477  37.987 1.00 41.85  ? 95   VAL D O     1 
ATOM   2803  C  CB    . VAL D 4 98  ? -18.494 -3.241  35.090 1.00 42.28  ? 95   VAL D CB    1 
ATOM   2804  C  CG1   . VAL D 4 98  ? -18.004 -2.342  36.208 1.00 42.56  ? 95   VAL D CG1   1 
ATOM   2805  C  CG2   . VAL D 4 98  ? -17.339 -3.600  34.177 1.00 41.99  ? 95   VAL D CG2   1 
ATOM   2806  N  N     . ARG D 4 99  ? -21.240 -3.823  36.592 1.00 42.84  ? 96   ARG D N     1 
ATOM   2807  C  CA    . ARG D 4 99  ? -22.167 -3.539  37.692 1.00 43.56  ? 96   ARG D CA    1 
ATOM   2808  C  C     . ARG D 4 99  ? -22.559 -4.830  38.401 1.00 42.23  ? 96   ARG D C     1 
ATOM   2809  O  O     . ARG D 4 99  ? -22.620 -4.847  39.634 1.00 42.19  ? 96   ARG D O     1 
ATOM   2810  C  CB    . ARG D 4 99  ? -23.397 -2.733  37.239 1.00 43.40  ? 96   ARG D CB    1 
ATOM   2811  C  CG    . ARG D 4 99  ? -23.085 -1.326  36.677 1.00 45.30  ? 96   ARG D CG    1 
ATOM   2812  C  CD    . ARG D 4 99  ? -24.334 -0.412  36.644 1.00 46.70  ? 96   ARG D CD    1 
ATOM   2813  N  NE    . ARG D 4 99  ? -24.220 0.698   35.676 1.00 54.00  ? 96   ARG D NE    1 
ATOM   2814  C  CZ    . ARG D 4 99  ? -25.118 0.989   34.718 1.00 55.34  ? 96   ARG D CZ    1 
ATOM   2815  N  NH1   . ARG D 4 99  ? -26.240 0.273   34.583 1.00 56.01  ? 96   ARG D NH1   1 
ATOM   2816  N  NH2   . ARG D 4 99  ? -24.902 2.011   33.895 1.00 53.97  ? 96   ARG D NH2   1 
ATOM   2817  N  N     . LEU D 4 100 ? -22.779 -5.900  37.625 1.00 41.17  ? 97   LEU D N     1 
ATOM   2818  C  CA    . LEU D 4 100 ? -23.184 -7.209  38.162 1.00 40.22  ? 97   LEU D CA    1 
ATOM   2819  C  C     . LEU D 4 100 ? -22.086 -7.856  38.985 1.00 40.59  ? 97   LEU D C     1 
ATOM   2820  O  O     . LEU D 4 100 ? -22.359 -8.427  40.039 1.00 41.05  ? 97   LEU D O     1 
ATOM   2821  C  CB    . LEU D 4 100 ? -23.639 -8.176  37.064 1.00 39.44  ? 97   LEU D CB    1 
ATOM   2822  C  CG    . LEU D 4 100 ? -25.075 -8.037  36.540 1.00 37.41  ? 97   LEU D CG    1 
ATOM   2823  C  CD1   . LEU D 4 100 ? -25.263 -8.748  35.216 1.00 33.46  ? 97   LEU D CD1   1 
ATOM   2824  C  CD2   . LEU D 4 100 ? -26.128 -8.489  37.557 1.00 36.40  ? 97   LEU D CD2   1 
ATOM   2825  N  N     . LEU D 4 101 ? -20.851 -7.731  38.524 1.00 40.72  ? 98   LEU D N     1 
ATOM   2826  C  CA    . LEU D 4 101 ? -19.707 -8.288  39.225 1.00 41.31  ? 98   LEU D CA    1 
ATOM   2827  C  C     . LEU D 4 101 ? -19.206 -7.516  40.460 1.00 41.13  ? 98   LEU D C     1 
ATOM   2828  O  O     . LEU D 4 101 ? -19.164 -8.064  41.556 1.00 41.45  ? 98   LEU D O     1 
ATOM   2829  C  CB    . LEU D 4 101 ? -18.554 -8.476  38.249 1.00 41.66  ? 98   LEU D CB    1 
ATOM   2830  C  CG    . LEU D 4 101 ? -17.649 -9.643  38.624 1.00 43.18  ? 98   LEU D CG    1 
ATOM   2831  C  CD1   . LEU D 4 101 ? -18.286 -10.936 38.121 1.00 44.46  ? 98   LEU D CD1   1 
ATOM   2832  C  CD2   . LEU D 4 101 ? -16.273 -9.443  38.017 1.00 44.37  ? 98   LEU D CD2   1 
ATOM   2833  N  N     . LEU D 4 102 ? -18.800 -6.263  40.278 1.00 41.19  ? 99   LEU D N     1 
ATOM   2834  C  CA    . LEU D 4 102 ? -18.127 -5.502  41.334 1.00 41.18  ? 99   LEU D CA    1 
ATOM   2835  C  C     . LEU D 4 102 ? -19.089 -4.957  42.376 1.00 41.46  ? 99   LEU D C     1 
ATOM   2836  O  O     . LEU D 4 102 ? -20.242 -4.662  42.058 1.00 42.03  ? 99   LEU D O     1 
ATOM   2837  C  CB    . LEU D 4 102 ? -17.335 -4.334  40.744 1.00 41.06  ? 99   LEU D CB    1 
ATOM   2838  C  CG    . LEU D 4 102 ? -16.499 -4.504  39.477 1.00 41.27  ? 99   LEU D CG    1 
ATOM   2839  C  CD1   . LEU D 4 102 ? -15.740 -3.223  39.238 1.00 41.66  ? 99   LEU D CD1   1 
ATOM   2840  C  CD2   . LEU D 4 102 ? -15.544 -5.669  39.596 1.00 41.58  ? 99   LEU D CD2   1 
ATOM   2841  N  N     . PRO D 4 103 ? -18.624 -4.816  43.630 1.00 41.58  ? 100  PRO D N     1 
ATOM   2842  C  CA    . PRO D 4 103 ? -19.488 -4.191  44.622 1.00 41.70  ? 100  PRO D CA    1 
ATOM   2843  C  C     . PRO D 4 103 ? -19.504 -2.664  44.568 1.00 41.97  ? 100  PRO D C     1 
ATOM   2844  O  O     . PRO D 4 103 ? -18.521 -2.031  44.162 1.00 41.45  ? 100  PRO D O     1 
ATOM   2845  C  CB    . PRO D 4 103 ? -18.897 -4.659  45.950 1.00 41.24  ? 100  PRO D CB    1 
ATOM   2846  C  CG    . PRO D 4 103 ? -17.461 -4.868  45.665 1.00 41.47  ? 100  PRO D CG    1 
ATOM   2847  C  CD    . PRO D 4 103 ? -17.336 -5.240  44.211 1.00 41.77  ? 100  PRO D CD    1 
ATOM   2848  N  N     . GLY D 4 104 ? -20.648 -2.116  44.975 1.00 42.36  ? 101  GLY D N     1 
ATOM   2849  C  CA    . GLY D 4 104 ? -20.827 -0.711  45.308 1.00 43.21  ? 101  GLY D CA    1 
ATOM   2850  C  C     . GLY D 4 104 ? -19.969 0.339   44.641 1.00 43.90  ? 101  GLY D C     1 
ATOM   2851  O  O     . GLY D 4 104 ? -20.293 0.819   43.556 1.00 43.50  ? 101  GLY D O     1 
ATOM   2852  N  N     . GLU D 4 105 ? -18.879 0.703   45.308 1.00 44.74  ? 102  GLU D N     1 
ATOM   2853  C  CA    . GLU D 4 105 ? -18.105 1.860   44.913 1.00 45.90  ? 102  GLU D CA    1 
ATOM   2854  C  C     . GLU D 4 105 ? -17.121 1.533   43.818 1.00 46.20  ? 102  GLU D C     1 
ATOM   2855  O  O     . GLU D 4 105 ? -16.850 2.363   42.963 1.00 46.74  ? 102  GLU D O     1 
ATOM   2856  C  CB    . GLU D 4 105 ? -17.389 2.463   46.117 1.00 46.15  ? 102  GLU D CB    1 
ATOM   2857  C  CG    . GLU D 4 105 ? -17.515 3.994   46.204 1.00 49.46  ? 102  GLU D CG    1 
ATOM   2858  C  CD    . GLU D 4 105 ? -18.983 4.477   46.293 1.00 53.32  ? 102  GLU D CD    1 
ATOM   2859  O  OE1   . GLU D 4 105 ? -19.853 3.711   46.773 1.00 54.88  ? 102  GLU D OE1   1 
ATOM   2860  O  OE2   . GLU D 4 105 ? -19.270 5.624   45.877 1.00 54.83  ? 102  GLU D OE2   1 
ATOM   2861  N  N     . LEU D 4 106 ? -16.573 0.322   43.853 1.00 46.82  ? 103  LEU D N     1 
ATOM   2862  C  CA    . LEU D 4 106 ? -15.648 -0.129  42.825 1.00 46.46  ? 103  LEU D CA    1 
ATOM   2863  C  C     . LEU D 4 106 ? -16.387 -0.178  41.503 1.00 46.78  ? 103  LEU D C     1 
ATOM   2864  O  O     . LEU D 4 106 ? -15.838 0.221   40.473 1.00 47.07  ? 103  LEU D O     1 
ATOM   2865  C  CB    . LEU D 4 106 ? -15.067 -1.502  43.161 1.00 46.09  ? 103  LEU D CB    1 
ATOM   2866  C  CG    . LEU D 4 106 ? -13.855 -1.611  44.084 1.00 45.12  ? 103  LEU D CG    1 
ATOM   2867  C  CD1   . LEU D 4 106 ? -13.508 -3.076  44.245 1.00 45.19  ? 103  LEU D CD1   1 
ATOM   2868  C  CD2   . LEU D 4 106 ? -12.656 -0.864  43.562 1.00 43.81  ? 103  LEU D CD2   1 
ATOM   2869  N  N     . ALA D 4 107 ? -17.635 -0.645  41.542 1.00 46.84  ? 104  ALA D N     1 
ATOM   2870  C  CA    . ALA D 4 107 ? -18.474 -0.676  40.359 1.00 47.27  ? 104  ALA D CA    1 
ATOM   2871  C  C     . ALA D 4 107 ? -18.670 0.750   39.853 1.00 48.09  ? 104  ALA D C     1 
ATOM   2872  O  O     . ALA D 4 107 ? -18.211 1.094   38.752 1.00 48.16  ? 104  ALA D O     1 
ATOM   2873  C  CB    . ALA D 4 107 ? -19.796 -1.327  40.665 1.00 46.82  ? 104  ALA D CB    1 
ATOM   2874  N  N     . LYS D 4 108 ? -19.305 1.577   40.691 1.00 48.90  ? 105  LYS D N     1 
ATOM   2875  C  CA    . LYS D 4 108 ? -19.624 2.979   40.386 1.00 49.48  ? 105  LYS D CA    1 
ATOM   2876  C  C     . LYS D 4 108 ? -18.447 3.741   39.768 1.00 49.40  ? 105  LYS D C     1 
ATOM   2877  O  O     . LYS D 4 108 ? -18.606 4.433   38.753 1.00 49.35  ? 105  LYS D O     1 
ATOM   2878  C  CB    . LYS D 4 108 ? -20.128 3.693   41.645 1.00 49.69  ? 105  LYS D CB    1 
ATOM   2879  C  CG    . LYS D 4 108 ? -20.488 5.161   41.440 1.00 52.11  ? 105  LYS D CG    1 
ATOM   2880  C  CD    . LYS D 4 108 ? -20.328 6.008   42.714 1.00 55.52  ? 105  LYS D CD    1 
ATOM   2881  C  CE    . LYS D 4 108 ? -21.651 6.160   43.499 1.00 57.71  ? 105  LYS D CE    1 
ATOM   2882  N  NZ    . LYS D 4 108 ? -21.627 7.349   44.434 1.00 57.12  ? 105  LYS D NZ    1 
ATOM   2883  N  N     . HIS D 4 109 ? -17.269 3.602   40.365 1.00 49.37  ? 106  HIS D N     1 
ATOM   2884  C  CA    . HIS D 4 109 ? -16.091 4.245   39.814 1.00 50.04  ? 106  HIS D CA    1 
ATOM   2885  C  C     . HIS D 4 109 ? -15.622 3.625   38.499 1.00 50.20  ? 106  HIS D C     1 
ATOM   2886  O  O     . HIS D 4 109 ? -15.289 4.358   37.561 1.00 50.25  ? 106  HIS D O     1 
ATOM   2887  C  CB    . HIS D 4 109 ? -14.957 4.284   40.828 1.00 50.30  ? 106  HIS D CB    1 
ATOM   2888  C  CG    . HIS D 4 109 ? -15.054 5.419   41.795 1.00 51.50  ? 106  HIS D CG    1 
ATOM   2889  N  ND1   . HIS D 4 109 ? -15.126 5.229   43.156 1.00 53.11  ? 106  HIS D ND1   1 
ATOM   2890  C  CD2   . HIS D 4 109 ? -15.090 6.758   41.598 1.00 52.54  ? 106  HIS D CD2   1 
ATOM   2891  C  CE1   . HIS D 4 109 ? -15.199 6.403   43.759 1.00 53.86  ? 106  HIS D CE1   1 
ATOM   2892  N  NE2   . HIS D 4 109 ? -15.179 7.347   42.835 1.00 53.38  ? 106  HIS D NE2   1 
ATOM   2893  N  N     . ALA D 4 110 ? -15.603 2.288   38.432 1.00 50.14  ? 107  ALA D N     1 
ATOM   2894  C  CA    . ALA D 4 110 ? -15.209 1.570   37.216 1.00 49.92  ? 107  ALA D CA    1 
ATOM   2895  C  C     . ALA D 4 110 ? -16.099 1.942   36.039 1.00 49.87  ? 107  ALA D C     1 
ATOM   2896  O  O     . ALA D 4 110 ? -15.616 2.078   34.923 1.00 49.39  ? 107  ALA D O     1 
ATOM   2897  C  CB    . ALA D 4 110 ? -15.239 0.064   37.443 1.00 50.21  ? 107  ALA D CB    1 
ATOM   2898  N  N     . VAL D 4 111 ? -17.398 2.102   36.305 1.00 50.17  ? 108  VAL D N     1 
ATOM   2899  C  CA    . VAL D 4 111 ? -18.364 2.568   35.297 1.00 50.59  ? 108  VAL D CA    1 
ATOM   2900  C  C     . VAL D 4 111 ? -17.974 3.933   34.711 1.00 50.96  ? 108  VAL D C     1 
ATOM   2901  O  O     . VAL D 4 111 ? -18.020 4.111   33.499 1.00 50.99  ? 108  VAL D O     1 
ATOM   2902  C  CB    . VAL D 4 111 ? -19.806 2.680   35.858 1.00 50.53  ? 108  VAL D CB    1 
ATOM   2903  C  CG1   . VAL D 4 111 ? -20.789 3.047   34.743 1.00 49.75  ? 108  VAL D CG1   1 
ATOM   2904  C  CG2   . VAL D 4 111 ? -20.230 1.395   36.550 1.00 50.39  ? 108  VAL D CG2   1 
ATOM   2905  N  N     . SER D 4 112 ? -17.605 4.889   35.567 1.00 51.19  ? 109  SER D N     1 
ATOM   2906  C  CA    . SER D 4 112 ? -17.080 6.171   35.087 1.00 51.77  ? 109  SER D CA    1 
ATOM   2907  C  C     . SER D 4 112 ? -15.889 5.949   34.164 1.00 51.55  ? 109  SER D C     1 
ATOM   2908  O  O     . SER D 4 112 ? -15.932 6.290   32.981 1.00 51.38  ? 109  SER D O     1 
ATOM   2909  C  CB    . SER D 4 112 ? -16.656 7.091   36.247 1.00 51.95  ? 109  SER D CB    1 
ATOM   2910  O  OG    . SER D 4 112 ? -17.785 7.612   36.928 1.00 53.21  ? 109  SER D OG    1 
ATOM   2911  N  N     . GLU D 4 113 ? -14.842 5.350   34.716 1.00 51.59  ? 110  GLU D N     1 
ATOM   2912  C  CA    . GLU D 4 113 ? -13.558 5.265   34.045 1.00 51.87  ? 110  GLU D CA    1 
ATOM   2913  C  C     . GLU D 4 113 ? -13.642 4.619   32.653 1.00 51.91  ? 110  GLU D C     1 
ATOM   2914  O  O     . GLU D 4 113 ? -12.897 4.993   31.741 1.00 51.72  ? 110  GLU D O     1 
ATOM   2915  C  CB    . GLU D 4 113 ? -12.550 4.570   34.958 1.00 51.85  ? 110  GLU D CB    1 
ATOM   2916  C  CG    . GLU D 4 113 ? -11.944 5.497   36.014 1.00 52.88  ? 110  GLU D CG    1 
ATOM   2917  C  CD    . GLU D 4 113 ? -10.525 5.944   35.657 1.00 55.12  ? 110  GLU D CD    1 
ATOM   2918  O  OE1   . GLU D 4 113 ? -10.367 7.018   35.029 1.00 56.65  ? 110  GLU D OE1   1 
ATOM   2919  O  OE2   . GLU D 4 113 ? -9.563  5.216   35.989 1.00 54.69  ? 110  GLU D OE2   1 
ATOM   2920  N  N     . GLY D 4 114 ? -14.573 3.678   32.500 1.00 51.95  ? 111  GLY D N     1 
ATOM   2921  C  CA    . GLY D 4 114 ? -14.821 3.017   31.225 1.00 52.28  ? 111  GLY D CA    1 
ATOM   2922  C  C     . GLY D 4 114 ? -15.654 3.851   30.264 1.00 52.62  ? 111  GLY D C     1 
ATOM   2923  O  O     . GLY D 4 114 ? -15.365 3.906   29.064 1.00 52.46  ? 111  GLY D O     1 
ATOM   2924  N  N     . THR D 4 115 ? -16.694 4.495   30.790 1.00 52.98  ? 112  THR D N     1 
ATOM   2925  C  CA    . THR D 4 115 ? -17.513 5.410   30.003 1.00 53.53  ? 112  THR D CA    1 
ATOM   2926  C  C     . THR D 4 115 ? -16.634 6.522   29.451 1.00 54.10  ? 112  THR D C     1 
ATOM   2927  O  O     . THR D 4 115 ? -16.734 6.892   28.282 1.00 54.27  ? 112  THR D O     1 
ATOM   2928  C  CB    . THR D 4 115 ? -18.611 6.053   30.847 1.00 53.18  ? 112  THR D CB    1 
ATOM   2929  O  OG1   . THR D 4 115 ? -19.339 5.040   31.535 1.00 52.65  ? 112  THR D OG1   1 
ATOM   2930  C  CG2   . THR D 4 115 ? -19.561 6.831   29.967 1.00 53.91  ? 112  THR D CG2   1 
ATOM   2931  N  N     . LYS D 4 116 ? -15.765 7.026   30.319 1.00 54.82  ? 113  LYS D N     1 
ATOM   2932  C  CA    . LYS D 4 116 ? -14.850 8.109   30.015 1.00 55.71  ? 113  LYS D CA    1 
ATOM   2933  C  C     . LYS D 4 116 ? -13.940 7.753   28.845 1.00 56.12  ? 113  LYS D C     1 
ATOM   2934  O  O     . LYS D 4 116 ? -13.688 8.586   27.979 1.00 56.45  ? 113  LYS D O     1 
ATOM   2935  C  CB    . LYS D 4 116 ? -14.033 8.433   31.274 1.00 55.84  ? 113  LYS D CB    1 
ATOM   2936  C  CG    . LYS D 4 116 ? -13.085 9.607   31.194 1.00 56.55  ? 113  LYS D CG    1 
ATOM   2937  C  CD    . LYS D 4 116 ? -12.653 10.014  32.602 1.00 59.50  ? 113  LYS D CD    1 
ATOM   2938  C  CE    . LYS D 4 116 ? -11.427 10.950  32.601 1.00 61.13  ? 113  LYS D CE    1 
ATOM   2939  N  NZ    . LYS D 4 116 ? -10.116 10.224  32.490 1.00 60.01  ? 113  LYS D NZ    1 
ATOM   2940  N  N     . ALA D 4 117 ? -13.460 6.514   28.819 1.00 56.60  ? 114  ALA D N     1 
ATOM   2941  C  CA    . ALA D 4 117 ? -12.491 6.101   27.824 1.00 57.19  ? 114  ALA D CA    1 
ATOM   2942  C  C     . ALA D 4 117 ? -13.185 5.831   26.504 1.00 57.77  ? 114  ALA D C     1 
ATOM   2943  O  O     . ALA D 4 117 ? -12.602 6.008   25.434 1.00 57.72  ? 114  ALA D O     1 
ATOM   2944  C  CB    . ALA D 4 117 ? -11.734 4.876   28.296 1.00 57.13  ? 114  ALA D CB    1 
ATOM   2945  N  N     . VAL D 4 118 ? -14.436 5.402   26.578 1.00 58.62  ? 115  VAL D N     1 
ATOM   2946  C  CA    . VAL D 4 118 ? -15.200 5.147   25.367 1.00 59.61  ? 115  VAL D CA    1 
ATOM   2947  C  C     . VAL D 4 118 ? -15.528 6.467   24.667 1.00 60.20  ? 115  VAL D C     1 
ATOM   2948  O  O     . VAL D 4 118 ? -15.310 6.596   23.461 1.00 60.41  ? 115  VAL D O     1 
ATOM   2949  C  CB    . VAL D 4 118 ? -16.433 4.255   25.643 1.00 59.62  ? 115  VAL D CB    1 
ATOM   2950  C  CG1   . VAL D 4 118 ? -17.408 4.260   24.478 1.00 59.28  ? 115  VAL D CG1   1 
ATOM   2951  C  CG2   . VAL D 4 118 ? -15.965 2.834   25.913 1.00 59.85  ? 115  VAL D CG2   1 
ATOM   2952  N  N     . THR D 4 119 ? -16.006 7.450   25.426 1.00 60.73  ? 116  THR D N     1 
ATOM   2953  C  CA    . THR D 4 119 ? -16.166 8.796   24.900 1.00 61.48  ? 116  THR D CA    1 
ATOM   2954  C  C     . THR D 4 119 ? -14.866 9.308   24.270 1.00 62.26  ? 116  THR D C     1 
ATOM   2955  O  O     . THR D 4 119 ? -14.839 9.674   23.096 1.00 62.57  ? 116  THR D O     1 
ATOM   2956  C  CB    . THR D 4 119 ? -16.593 9.777   25.973 1.00 61.19  ? 116  THR D CB    1 
ATOM   2957  O  OG1   . THR D 4 119 ? -17.652 9.215   26.752 1.00 61.97  ? 116  THR D OG1   1 
ATOM   2958  C  CG2   . THR D 4 119 ? -17.102 11.018  25.319 1.00 62.05  ? 116  THR D CG2   1 
ATOM   2959  N  N     . LYS D 4 120 ? -13.790 9.324   25.048 1.00 63.08  ? 117  LYS D N     1 
ATOM   2960  C  CA    . LYS D 4 120 ? -12.504 9.777   24.549 1.00 64.01  ? 117  LYS D CA    1 
ATOM   2961  C  C     . LYS D 4 120 ? -12.086 9.035   23.284 1.00 64.71  ? 117  LYS D C     1 
ATOM   2962  O  O     . LYS D 4 120 ? -11.492 9.631   22.392 1.00 65.04  ? 117  LYS D O     1 
ATOM   2963  C  CB    . LYS D 4 120 ? -11.417 9.702   25.637 1.00 64.13  ? 117  LYS D CB    1 
ATOM   2964  C  CG    . LYS D 4 120 ? -9.991  9.872   25.100 1.00 64.57  ? 117  LYS D CG    1 
ATOM   2965  C  CD    . LYS D 4 120 ? -9.031  10.630  26.026 1.00 64.94  ? 117  LYS D CD    1 
ATOM   2966  C  CE    . LYS D 4 120 ? -7.610  10.655  25.400 1.00 65.25  ? 117  LYS D CE    1 
ATOM   2967  N  NZ    . LYS D 4 120 ? -6.730  11.798  25.827 1.00 65.14  ? 117  LYS D NZ    1 
ATOM   2968  N  N     . TYR D 4 121 ? -12.403 7.746   23.197 1.00 65.82  ? 118  TYR D N     1 
ATOM   2969  C  CA    . TYR D 4 121 ? -11.998 6.933   22.040 1.00 66.74  ? 118  TYR D CA    1 
ATOM   2970  C  C     . TYR D 4 121 ? -12.812 7.272   20.791 1.00 67.60  ? 118  TYR D C     1 
ATOM   2971  O  O     . TYR D 4 121 ? -12.271 7.326   19.682 1.00 67.53  ? 118  TYR D O     1 
ATOM   2972  C  CB    . TYR D 4 121 ? -12.115 5.450   22.358 1.00 66.47  ? 118  TYR D CB    1 
ATOM   2973  C  CG    . TYR D 4 121 ? -11.909 4.548   21.170 1.00 66.21  ? 118  TYR D CG    1 
ATOM   2974  C  CD1   . TYR D 4 121 ? -10.629 4.152   20.785 1.00 65.65  ? 118  TYR D CD1   1 
ATOM   2975  C  CD2   . TYR D 4 121 ? -12.997 4.074   20.437 1.00 65.93  ? 118  TYR D CD2   1 
ATOM   2976  C  CE1   . TYR D 4 121 ? -10.436 3.311   19.692 1.00 65.74  ? 118  TYR D CE1   1 
ATOM   2977  C  CE2   . TYR D 4 121 ? -12.818 3.241   19.347 1.00 66.08  ? 118  TYR D CE2   1 
ATOM   2978  C  CZ    . TYR D 4 121 ? -11.535 2.864   18.976 1.00 66.50  ? 118  TYR D CZ    1 
ATOM   2979  O  OH    . TYR D 4 121 ? -11.362 2.032   17.890 1.00 67.67  ? 118  TYR D OH    1 
ATOM   2980  N  N     . THR D 4 122 ? -14.115 7.473   21.000 1.00 68.66  ? 119  THR D N     1 
ATOM   2981  C  CA    . THR D 4 122 ? -15.041 7.948   19.984 1.00 69.55  ? 119  THR D CA    1 
ATOM   2982  C  C     . THR D 4 122 ? -14.611 9.329   19.498 1.00 70.41  ? 119  THR D C     1 
ATOM   2983  O  O     . THR D 4 122 ? -14.394 9.528   18.300 1.00 70.73  ? 119  THR D O     1 
ATOM   2984  C  CB    . THR D 4 122 ? -16.477 8.025   20.547 1.00 69.54  ? 119  THR D CB    1 
ATOM   2985  O  OG1   . THR D 4 122 ? -16.933 6.709   20.882 1.00 69.23  ? 119  THR D OG1   1 
ATOM   2986  C  CG2   . THR D 4 122 ? -17.434 8.655   19.536 1.00 69.93  ? 119  THR D CG2   1 
ATOM   2987  N  N     . SER D 4 123 ? -14.470 10.272  20.430 1.00 71.35  ? 120  SER D N     1 
ATOM   2988  C  CA    . SER D 4 123 ? -14.083 11.645  20.098 1.00 72.17  ? 120  SER D CA    1 
ATOM   2989  C  C     . SER D 4 123 ? -12.764 11.714  19.328 1.00 72.70  ? 120  SER D C     1 
ATOM   2990  O  O     . SER D 4 123 ? -12.535 12.681  18.603 1.00 72.89  ? 120  SER D O     1 
ATOM   2991  C  CB    . SER D 4 123 ? -13.987 12.510  21.355 1.00 72.14  ? 120  SER D CB    1 
ATOM   2992  O  OG    . SER D 4 123 ? -12.640 12.598  21.805 1.00 72.17  ? 120  SER D OG    1 
ATOM   2993  N  N     . ALA D 4 124 ? -11.914 10.697  19.480 1.00 73.39  ? 121  ALA D N     1 
ATOM   2994  C  CA    . ALA D 4 124 ? -10.623 10.644  18.774 1.00 74.47  ? 121  ALA D CA    1 
ATOM   2995  C  C     . ALA D 4 124 ? -10.674 9.973   17.385 1.00 75.30  ? 121  ALA D C     1 
ATOM   2996  O  O     . ALA D 4 124 ? -9.660  9.448   16.896 1.00 75.46  ? 121  ALA D O     1 
ATOM   2997  C  CB    . ALA D 4 124 ? -9.548  10.006  19.654 1.00 74.20  ? 121  ALA D CB    1 
ATOM   2998  N  N     . LYS D 4 125 ? -11.858 9.993   16.766 1.00 76.29  ? 122  LYS D N     1 
ATOM   2999  C  CA    . LYS D 4 125 ? -12.069 9.542   15.374 1.00 77.29  ? 122  LYS D CA    1 
ATOM   3000  C  C     . LYS D 4 125 ? -13.512 9.836   14.903 1.00 77.44  ? 122  LYS D C     1 
ATOM   3001  O  O     . LYS D 4 125 ? -13.785 10.897  14.332 1.00 77.69  ? 122  LYS D O     1 
ATOM   3002  C  CB    . LYS D 4 125 ? -11.724 8.049   15.196 1.00 77.34  ? 122  LYS D CB    1 
ATOM   3003  C  CG    . LYS D 4 125 ? -11.503 7.625   13.745 1.00 77.69  ? 122  LYS D CG    1 
ATOM   3004  C  CD    . LYS D 4 125 ? -10.891 6.234   13.667 1.00 77.89  ? 122  LYS D CD    1 
ATOM   3005  C  CE    . LYS D 4 125 ? -10.007 6.097   12.429 1.00 78.53  ? 122  LYS D CE    1 
ATOM   3006  N  NZ    . LYS D 4 125 ? -8.801  5.273   12.734 1.00 78.59  ? 122  LYS D NZ    1 
ATOM   3007  O  OXT   . LYS D 4 125 ? -14.444 9.041   15.074 1.00 77.47  ? 122  LYS D OXT   1 
ATOM   3008  N  N     . PRO E 1 38  ? 14.619  -21.412 87.694 1.00 73.21  ? 38   PRO E N     1 
ATOM   3009  C  CA    . PRO E 1 38  ? 13.894  -21.848 86.497 1.00 72.88  ? 38   PRO E CA    1 
ATOM   3010  C  C     . PRO E 1 38  ? 12.561  -21.104 86.307 1.00 72.52  ? 38   PRO E C     1 
ATOM   3011  O  O     . PRO E 1 38  ? 11.619  -21.301 87.080 1.00 72.42  ? 38   PRO E O     1 
ATOM   3012  C  CB    . PRO E 1 38  ? 13.655  -23.343 86.762 1.00 72.99  ? 38   PRO E CB    1 
ATOM   3013  C  CG    . PRO E 1 38  ? 13.782  -23.515 88.297 1.00 72.99  ? 38   PRO E CG    1 
ATOM   3014  C  CD    . PRO E 1 38  ? 14.249  -22.201 88.884 1.00 73.17  ? 38   PRO E CD    1 
ATOM   3015  N  N     . HIS E 1 39  ? 12.500  -20.253 85.284 1.00 72.17  ? 39   HIS E N     1 
ATOM   3016  C  CA    . HIS E 1 39  ? 11.293  -19.469 84.974 1.00 71.58  ? 39   HIS E CA    1 
ATOM   3017  C  C     . HIS E 1 39  ? 10.275  -20.334 84.240 1.00 70.25  ? 39   HIS E C     1 
ATOM   3018  O  O     . HIS E 1 39  ? 10.637  -21.369 83.665 1.00 70.31  ? 39   HIS E O     1 
ATOM   3019  C  CB    . HIS E 1 39  ? 11.659  -18.251 84.118 1.00 72.18  ? 39   HIS E CB    1 
ATOM   3020  C  CG    . HIS E 1 39  ? 10.740  -17.078 84.295 1.00 74.62  ? 39   HIS E CG    1 
ATOM   3021  N  ND1   . HIS E 1 39  ? 10.199  -16.386 83.228 1.00 76.22  ? 39   HIS E ND1   1 
ATOM   3022  C  CD2   . HIS E 1 39  ? 10.280  -16.464 85.415 1.00 76.03  ? 39   HIS E CD2   1 
ATOM   3023  C  CE1   . HIS E 1 39  ? 9.446   -15.398 83.683 1.00 76.93  ? 39   HIS E CE1   1 
ATOM   3024  N  NE2   . HIS E 1 39  ? 9.475   -15.425 85.006 1.00 77.34  ? 39   HIS E NE2   1 
ATOM   3025  N  N     . ARG E 1 40  ? 9.010   -19.915 84.261 1.00 68.39  ? 40   ARG E N     1 
ATOM   3026  C  CA    . ARG E 1 40  ? 7.941   -20.639 83.559 1.00 66.49  ? 40   ARG E CA    1 
ATOM   3027  C  C     . ARG E 1 40  ? 6.818   -19.741 83.072 1.00 64.80  ? 40   ARG E C     1 
ATOM   3028  O  O     . ARG E 1 40  ? 6.284   -18.934 83.830 1.00 64.87  ? 40   ARG E O     1 
ATOM   3029  C  CB    . ARG E 1 40  ? 7.347   -21.748 84.438 1.00 66.72  ? 40   ARG E CB    1 
ATOM   3030  C  CG    . ARG E 1 40  ? 7.830   -23.140 84.058 1.00 67.23  ? 40   ARG E CG    1 
ATOM   3031  C  CD    . ARG E 1 40  ? 6.842   -24.245 84.415 1.00 67.28  ? 40   ARG E CD    1 
ATOM   3032  N  NE    . ARG E 1 40  ? 7.258   -25.496 83.784 1.00 69.02  ? 40   ARG E NE    1 
ATOM   3033  C  CZ    . ARG E 1 40  ? 6.547   -26.176 82.887 1.00 69.95  ? 40   ARG E CZ    1 
ATOM   3034  N  NH1   . ARG E 1 40  ? 5.341   -25.761 82.514 1.00 69.97  ? 40   ARG E NH1   1 
ATOM   3035  N  NH2   . ARG E 1 40  ? 7.041   -27.297 82.380 1.00 70.41  ? 40   ARG E NH2   1 
ATOM   3036  N  N     . TYR E 1 41  ? 6.440   -19.896 81.812 1.00 62.52  ? 41   TYR E N     1 
ATOM   3037  C  CA    . TYR E 1 41  ? 5.283   -19.179 81.319 1.00 60.47  ? 41   TYR E CA    1 
ATOM   3038  C  C     . TYR E 1 41  ? 4.018   -19.965 81.614 1.00 59.64  ? 41   TYR E C     1 
ATOM   3039  O  O     . TYR E 1 41  ? 3.970   -21.176 81.419 1.00 59.67  ? 41   TYR E O     1 
ATOM   3040  C  CB    . TYR E 1 41  ? 5.434   -18.846 79.835 1.00 59.81  ? 41   TYR E CB    1 
ATOM   3041  C  CG    . TYR E 1 41  ? 6.490   -17.798 79.606 1.00 58.63  ? 41   TYR E CG    1 
ATOM   3042  C  CD1   . TYR E 1 41  ? 7.717   -18.126 79.043 1.00 57.20  ? 41   TYR E CD1   1 
ATOM   3043  C  CD2   . TYR E 1 41  ? 6.278   -16.478 80.002 1.00 58.02  ? 41   TYR E CD2   1 
ATOM   3044  C  CE1   . TYR E 1 41  ? 8.695   -17.161 78.856 1.00 57.05  ? 41   TYR E CE1   1 
ATOM   3045  C  CE2   . TYR E 1 41  ? 7.250   -15.510 79.821 1.00 57.30  ? 41   TYR E CE2   1 
ATOM   3046  C  CZ    . TYR E 1 41  ? 8.452   -15.855 79.246 1.00 57.57  ? 41   TYR E CZ    1 
ATOM   3047  O  OH    . TYR E 1 41  ? 9.411   -14.883 79.073 1.00 58.42  ? 41   TYR E OH    1 
ATOM   3048  N  N     . ARG E 1 42  ? 3.011   -19.271 82.128 1.00 58.52  ? 42   ARG E N     1 
ATOM   3049  C  CA    . ARG E 1 42  ? 1.720   -19.876 82.399 1.00 57.65  ? 42   ARG E CA    1 
ATOM   3050  C  C     . ARG E 1 42  ? 1.065   -20.320 81.091 1.00 56.60  ? 42   ARG E C     1 
ATOM   3051  O  O     . ARG E 1 42  ? 1.157   -19.621 80.078 1.00 56.88  ? 42   ARG E O     1 
ATOM   3052  C  CB    . ARG E 1 42  ? 0.849   -18.892 83.168 1.00 57.98  ? 42   ARG E CB    1 
ATOM   3053  C  CG    . ARG E 1 42  ? 1.348   -18.668 84.597 1.00 59.97  ? 42   ARG E CG    1 
ATOM   3054  C  CD    . ARG E 1 42  ? 0.822   -17.385 85.198 1.00 63.17  ? 42   ARG E CD    1 
ATOM   3055  N  NE    . ARG E 1 42  ? -0.634  -17.347 85.170 1.00 66.22  ? 42   ARG E NE    1 
ATOM   3056  C  CZ    . ARG E 1 42  ? -1.360  -16.232 85.197 1.00 68.16  ? 42   ARG E CZ    1 
ATOM   3057  N  NH1   . ARG E 1 42  ? -0.764  -15.036 85.254 1.00 68.39  ? 42   ARG E NH1   1 
ATOM   3058  N  NH2   . ARG E 1 42  ? -2.689  -16.316 85.163 1.00 68.26  ? 42   ARG E NH2   1 
ATOM   3059  N  N     . PRO E 1 43  ? 0.439   -21.507 81.084 1.00 55.41  ? 43   PRO E N     1 
ATOM   3060  C  CA    . PRO E 1 43  ? -0.087  -22.004 79.826 1.00 54.51  ? 43   PRO E CA    1 
ATOM   3061  C  C     . PRO E 1 43  ? -1.000  -21.003 79.132 1.00 53.72  ? 43   PRO E C     1 
ATOM   3062  O  O     . PRO E 1 43  ? -1.868  -20.390 79.767 1.00 53.70  ? 43   PRO E O     1 
ATOM   3063  C  CB    . PRO E 1 43  ? -0.858  -23.267 80.234 1.00 54.45  ? 43   PRO E CB    1 
ATOM   3064  C  CG    . PRO E 1 43  ? -0.968  -23.223 81.696 1.00 54.69  ? 43   PRO E CG    1 
ATOM   3065  C  CD    . PRO E 1 43  ? 0.203   -22.461 82.178 1.00 55.35  ? 43   PRO E CD    1 
ATOM   3066  N  N     . GLY E 1 44  ? -0.785  -20.844 77.831 1.00 52.69  ? 44   GLY E N     1 
ATOM   3067  C  CA    . GLY E 1 44  ? -1.574  -19.933 77.029 1.00 51.33  ? 44   GLY E CA    1 
ATOM   3068  C  C     . GLY E 1 44  ? -0.744  -18.748 76.605 1.00 50.42  ? 44   GLY E C     1 
ATOM   3069  O  O     . GLY E 1 44  ? -1.068  -18.064 75.630 1.00 50.79  ? 44   GLY E O     1 
ATOM   3070  N  N     . THR E 1 45  ? 0.334   -18.498 77.337 1.00 49.26  ? 45   THR E N     1 
ATOM   3071  C  CA    . THR E 1 45  ? 1.113   -17.299 77.112 1.00 48.08  ? 45   THR E CA    1 
ATOM   3072  C  C     . THR E 1 45  ? 1.962   -17.479 75.874 1.00 47.28  ? 45   THR E C     1 
ATOM   3073  O  O     . THR E 1 45  ? 2.020   -16.579 75.027 1.00 47.47  ? 45   THR E O     1 
ATOM   3074  C  CB    . THR E 1 45  ? 1.950   -16.924 78.352 1.00 48.34  ? 45   THR E CB    1 
ATOM   3075  O  OG1   . THR E 1 45  ? 1.065   -16.548 79.416 1.00 48.60  ? 45   THR E OG1   1 
ATOM   3076  C  CG2   . THR E 1 45  ? 2.888   -15.754 78.061 1.00 48.21  ? 45   THR E CG2   1 
ATOM   3077  N  N     . VAL E 1 46  ? 2.590   -18.647 75.750 1.00 46.00  ? 46   VAL E N     1 
ATOM   3078  C  CA    . VAL E 1 46  ? 3.396   -18.931 74.577 1.00 44.63  ? 46   VAL E CA    1 
ATOM   3079  C  C     . VAL E 1 46  ? 2.445   -19.095 73.409 1.00 44.06  ? 46   VAL E C     1 
ATOM   3080  O  O     . VAL E 1 46  ? 2.756   -18.674 72.292 1.00 43.93  ? 46   VAL E O     1 
ATOM   3081  C  CB    . VAL E 1 46  ? 4.272   -20.207 74.721 1.00 44.96  ? 46   VAL E CB    1 
ATOM   3082  C  CG1   . VAL E 1 46  ? 5.385   -20.226 73.654 1.00 44.18  ? 46   VAL E CG1   1 
ATOM   3083  C  CG2   . VAL E 1 46  ? 4.872   -20.319 76.106 1.00 43.58  ? 46   VAL E CG2   1 
ATOM   3084  N  N     . ALA E 1 47  ? 1.279   -19.695 73.668 1.00 43.19  ? 47   ALA E N     1 
ATOM   3085  C  CA    . ALA E 1 47  ? 0.289   -19.918 72.610 1.00 42.42  ? 47   ALA E CA    1 
ATOM   3086  C  C     . ALA E 1 47  ? -0.010  -18.608 71.889 1.00 42.34  ? 47   ALA E C     1 
ATOM   3087  O  O     . ALA E 1 47  ? 0.059   -18.558 70.648 1.00 42.75  ? 47   ALA E O     1 
ATOM   3088  C  CB    . ALA E 1 47  ? -0.971  -20.546 73.154 1.00 41.99  ? 47   ALA E CB    1 
ATOM   3089  N  N     . LEU E 1 48  ? -0.295  -17.552 72.668 1.00 41.70  ? 48   LEU E N     1 
ATOM   3090  C  CA    . LEU E 1 48  ? -0.532  -16.200 72.149 1.00 40.97  ? 48   LEU E CA    1 
ATOM   3091  C  C     . LEU E 1 48  ? 0.705   -15.606 71.514 1.00 40.62  ? 48   LEU E C     1 
ATOM   3092  O  O     . LEU E 1 48  ? 0.601   -14.902 70.527 1.00 40.52  ? 48   LEU E O     1 
ATOM   3093  C  CB    . LEU E 1 48  ? -1.018  -15.271 73.249 1.00 41.00  ? 48   LEU E CB    1 
ATOM   3094  C  CG    . LEU E 1 48  ? -2.432  -15.488 73.774 1.00 41.60  ? 48   LEU E CG    1 
ATOM   3095  C  CD1   . LEU E 1 48  ? -2.561  -14.929 75.178 1.00 40.91  ? 48   LEU E CD1   1 
ATOM   3096  C  CD2   . LEU E 1 48  ? -3.472  -14.863 72.834 1.00 41.84  ? 48   LEU E CD2   1 
ATOM   3097  N  N     . ARG E 1 49  ? 1.875   -15.888 72.072 1.00 40.38  ? 49   ARG E N     1 
ATOM   3098  C  CA    . ARG E 1 49  ? 3.121   -15.458 71.455 1.00 40.85  ? 49   ARG E CA    1 
ATOM   3099  C  C     . ARG E 1 49  ? 3.172   -15.990 70.024 1.00 40.64  ? 49   ARG E C     1 
ATOM   3100  O  O     . ARG E 1 49  ? 3.539   -15.271 69.086 1.00 40.29  ? 49   ARG E O     1 
ATOM   3101  C  CB    . ARG E 1 49  ? 4.321   -15.999 72.241 1.00 40.85  ? 49   ARG E CB    1 
ATOM   3102  C  CG    . ARG E 1 49  ? 5.582   -15.160 72.123 1.00 41.45  ? 49   ARG E CG    1 
ATOM   3103  C  CD    . ARG E 1 49  ? 6.902   -15.927 72.353 1.00 42.39  ? 49   ARG E CD    1 
ATOM   3104  N  NE    . ARG E 1 49  ? 7.215   -16.365 73.726 1.00 44.73  ? 49   ARG E NE    1 
ATOM   3105  C  CZ    . ARG E 1 49  ? 6.694   -15.877 74.852 1.00 47.03  ? 49   ARG E CZ    1 
ATOM   3106  N  NH1   . ARG E 1 49  ? 5.802   -14.881 74.839 1.00 47.67  ? 49   ARG E NH1   1 
ATOM   3107  N  NH2   . ARG E 1 49  ? 7.083   -16.386 76.014 1.00 47.07  ? 49   ARG E NH2   1 
ATOM   3108  N  N     . GLU E 1 50  ? 2.785   -17.258 69.872 1.00 40.63  ? 50   GLU E N     1 
ATOM   3109  C  CA    . GLU E 1 50  ? 2.876   -17.961 68.595 1.00 40.57  ? 50   GLU E CA    1 
ATOM   3110  C  C     . GLU E 1 50  ? 1.807   -17.489 67.620 1.00 39.81  ? 50   GLU E C     1 
ATOM   3111  O  O     . GLU E 1 50  ? 2.067   -17.351 66.414 1.00 39.49  ? 50   GLU E O     1 
ATOM   3112  C  CB    . GLU E 1 50  ? 2.797   -19.470 68.805 1.00 40.61  ? 50   GLU E CB    1 
ATOM   3113  C  CG    . GLU E 1 50  ? 4.079   -20.094 69.295 1.00 40.93  ? 50   GLU E CG    1 
ATOM   3114  C  CD    . GLU E 1 50  ? 3.902   -21.529 69.813 1.00 42.10  ? 50   GLU E CD    1 
ATOM   3115  O  OE1   . GLU E 1 50  ? 4.860   -22.011 70.470 1.00 44.58  ? 50   GLU E OE1   1 
ATOM   3116  O  OE2   . GLU E 1 50  ? 2.836   -22.175 69.575 1.00 42.58  ? 50   GLU E OE2   1 
ATOM   3117  N  N     . ILE E 1 51  ? 0.605   -17.238 68.135 1.00 39.04  ? 51   ILE E N     1 
ATOM   3118  C  CA    . ILE E 1 51  ? -0.413  -16.606 67.306 1.00 38.51  ? 51   ILE E CA    1 
ATOM   3119  C  C     . ILE E 1 51  ? 0.129   -15.298 66.702 1.00 38.15  ? 51   ILE E C     1 
ATOM   3120  O  O     . ILE E 1 51  ? 0.134   -15.135 65.482 1.00 37.76  ? 51   ILE E O     1 
ATOM   3121  C  CB    . ILE E 1 51  ? -1.722  -16.342 68.055 1.00 38.40  ? 51   ILE E CB    1 
ATOM   3122  C  CG1   . ILE E 1 51  ? -2.187  -17.624 68.767 1.00 37.75  ? 51   ILE E CG1   1 
ATOM   3123  C  CG2   . ILE E 1 51  ? -2.744  -15.748 67.079 1.00 37.60  ? 51   ILE E CG2   1 
ATOM   3124  C  CD1   . ILE E 1 51  ? -3.703  -17.737 69.029 1.00 37.29  ? 51   ILE E CD1   1 
ATOM   3125  N  N     . ARG E 1 52  ? 0.617   -14.394 67.549 1.00 37.75  ? 52   ARG E N     1 
ATOM   3126  C  CA    . ARG E 1 52  ? 1.190   -13.138 67.054 1.00 38.07  ? 52   ARG E CA    1 
ATOM   3127  C  C     . ARG E 1 52  ? 2.306   -13.424 66.047 1.00 38.07  ? 52   ARG E C     1 
ATOM   3128  O  O     . ARG E 1 52  ? 2.402   -12.776 65.021 1.00 38.20  ? 52   ARG E O     1 
ATOM   3129  C  CB    . ARG E 1 52  ? 1.668   -12.234 68.199 1.00 37.61  ? 52   ARG E CB    1 
ATOM   3130  C  CG    . ARG E 1 52  ? 0.551   -11.845 69.191 1.00 38.28  ? 52   ARG E CG    1 
ATOM   3131  C  CD    . ARG E 1 52  ? 1.083   -11.168 70.450 1.00 38.53  ? 52   ARG E CD    1 
ATOM   3132  N  NE    . ARG E 1 52  ? 0.274   -11.407 71.659 1.00 39.98  ? 52   ARG E NE    1 
ATOM   3133  C  CZ    . ARG E 1 52  ? -0.903  -10.826 71.931 1.00 40.95  ? 52   ARG E CZ    1 
ATOM   3134  N  NH1   . ARG E 1 52  ? -1.468  -9.981  71.068 1.00 42.77  ? 52   ARG E NH1   1 
ATOM   3135  N  NH2   . ARG E 1 52  ? -1.529  -11.088 73.074 1.00 39.22  ? 52   ARG E NH2   1 
ATOM   3136  N  N     . ARG E 1 53  ? 3.128   -14.423 66.324 1.00 38.57  ? 53   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1 53  ? 4.232   -14.724 65.443 1.00 38.80  ? 53   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1 53  ? 3.721   -15.127 64.061 1.00 38.83  ? 53   ARG E C     1 
ATOM   3139  O  O     . ARG E 1 53  ? 4.008   -14.460 63.065 1.00 38.96  ? 53   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1 53  ? 5.122   -15.819 66.033 1.00 38.65  ? 53   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1 53  ? 6.287   -16.143 65.126 1.00 40.50  ? 53   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1 53  ? 7.208   -17.210 65.676 1.00 44.91  ? 53   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1 53  ? 8.152   -17.629 64.633 1.00 48.00  ? 53   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1 53  ? 8.901   -18.729 64.680 1.00 48.68  ? 53   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1 53  ? 8.824   -19.551 65.727 1.00 48.74  ? 53   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1 53  ? 9.711   -19.015 63.668 1.00 48.04  ? 53   ARG E NH2   1 
ATOM   3147  N  N     . TYR E 1 54  ? 2.957   -16.213 64.008 1.00 38.66  ? 54   TYR E N     1 
ATOM   3148  C  CA    . TYR E 1 54  ? 2.544   -16.771 62.729 1.00 38.57  ? 54   TYR E CA    1 
ATOM   3149  C  C     . TYR E 1 54  ? 1.542   -15.915 61.953 1.00 38.69  ? 54   TYR E C     1 
ATOM   3150  O  O     . TYR E 1 54  ? 1.529   -15.980 60.726 1.00 38.68  ? 54   TYR E O     1 
ATOM   3151  C  CB    . TYR E 1 54  ? 2.097   -18.236 62.882 1.00 38.53  ? 54   TYR E CB    1 
ATOM   3152  C  CG    . TYR E 1 54  ? 3.247   -19.101 63.311 1.00 37.64  ? 54   TYR E CG    1 
ATOM   3153  C  CD1   . TYR E 1 54  ? 3.301   -19.660 64.582 1.00 36.77  ? 54   TYR E CD1   1 
ATOM   3154  C  CD2   . TYR E 1 54  ? 4.318   -19.306 62.459 1.00 38.35  ? 54   TYR E CD2   1 
ATOM   3155  C  CE1   . TYR E 1 54  ? 4.384   -20.425 64.974 1.00 36.33  ? 54   TYR E CE1   1 
ATOM   3156  C  CE2   . TYR E 1 54  ? 5.404   -20.054 62.844 1.00 38.22  ? 54   TYR E CE2   1 
ATOM   3157  C  CZ    . TYR E 1 54  ? 5.436   -20.610 64.097 1.00 37.49  ? 54   TYR E CZ    1 
ATOM   3158  O  OH    . TYR E 1 54  ? 6.540   -21.362 64.427 1.00 38.54  ? 54   TYR E OH    1 
ATOM   3159  N  N     . GLN E 1 55  ? 0.730   -15.110 62.649 1.00 38.91  ? 55   GLN E N     1 
ATOM   3160  C  CA    . GLN E 1 55  ? -0.173  -14.173 61.960 1.00 39.56  ? 55   GLN E CA    1 
ATOM   3161  C  C     . GLN E 1 55  ? 0.625   -13.088 61.214 1.00 40.25  ? 55   GLN E C     1 
ATOM   3162  O  O     . GLN E 1 55  ? 0.186   -12.557 60.183 1.00 40.76  ? 55   GLN E O     1 
ATOM   3163  C  CB    . GLN E 1 55  ? -1.270  -13.615 62.880 1.00 38.85  ? 55   GLN E CB    1 
ATOM   3164  C  CG    . GLN E 1 55  ? -2.369  -14.633 63.164 1.00 38.38  ? 55   GLN E CG    1 
ATOM   3165  C  CD    . GLN E 1 55  ? -3.633  -14.094 63.860 1.00 39.88  ? 55   GLN E CD    1 
ATOM   3166  O  OE1   . GLN E 1 55  ? -3.658  -13.000 64.428 1.00 41.36  ? 55   GLN E OE1   1 
ATOM   3167  N  NE2   . GLN E 1 55  ? -4.691  -14.898 63.835 1.00 40.76  ? 55   GLN E NE2   1 
ATOM   3168  N  N     . LYS E 1 56  ? 1.833   -12.837 61.705 1.00 40.90  ? 56   LYS E N     1 
ATOM   3169  C  CA    . LYS E 1 56  ? 2.745   -11.843 61.158 1.00 41.78  ? 56   LYS E CA    1 
ATOM   3170  C  C     . LYS E 1 56  ? 3.461   -12.346 59.888 1.00 41.23  ? 56   LYS E C     1 
ATOM   3171  O  O     . LYS E 1 56  ? 3.695   -11.564 58.962 1.00 41.22  ? 56   LYS E O     1 
ATOM   3172  C  CB    . LYS E 1 56  ? 3.758   -11.473 62.248 1.00 42.06  ? 56   LYS E CB    1 
ATOM   3173  C  CG    . LYS E 1 56  ? 4.360   -10.086 62.178 1.00 44.44  ? 56   LYS E CG    1 
ATOM   3174  C  CD    . LYS E 1 56  ? 5.356   -9.839  63.363 1.00 44.01  ? 56   LYS E CD    1 
ATOM   3175  C  CE    . LYS E 1 56  ? 6.106   -8.478  63.216 1.00 46.17  ? 56   LYS E CE    1 
ATOM   3176  N  NZ    . LYS E 1 56  ? 7.446   -8.419  63.937 1.00 46.60  ? 56   LYS E NZ    1 
ATOM   3177  N  N     . SER E 1 57  ? 3.805   -13.635 59.828 1.00 40.52  ? 57   SER E N     1 
ATOM   3178  C  CA    . SER E 1 57  ? 4.562   -14.136 58.684 1.00 40.24  ? 57   SER E CA    1 
ATOM   3179  C  C     . SER E 1 57  ? 3.694   -14.779 57.605 1.00 40.15  ? 57   SER E C     1 
ATOM   3180  O  O     . SER E 1 57  ? 2.475   -14.917 57.786 1.00 40.18  ? 57   SER E O     1 
ATOM   3181  C  CB    . SER E 1 57  ? 5.655   -15.096 59.131 1.00 40.47  ? 57   SER E CB    1 
ATOM   3182  O  OG    . SER E 1 57  ? 5.101   -16.237 59.761 1.00 41.87  ? 57   SER E OG    1 
ATOM   3183  N  N     . THR E 1 58  ? 4.328   -15.172 56.488 1.00 39.76  ? 58   THR E N     1 
ATOM   3184  C  CA    . THR E 1 58  ? 3.634   -15.810 55.354 1.00 39.14  ? 58   THR E CA    1 
ATOM   3185  C  C     . THR E 1 58  ? 4.302   -17.088 54.804 1.00 39.46  ? 58   THR E C     1 
ATOM   3186  O  O     . THR E 1 58  ? 3.787   -17.715 53.871 1.00 39.37  ? 58   THR E O     1 
ATOM   3187  C  CB    . THR E 1 58  ? 3.500   -14.852 54.193 1.00 38.91  ? 58   THR E CB    1 
ATOM   3188  O  OG1   . THR E 1 58  ? 4.800   -14.582 53.669 1.00 38.22  ? 58   THR E OG1   1 
ATOM   3189  C  CG2   . THR E 1 58  ? 2.843   -13.567 54.634 1.00 38.62  ? 58   THR E CG2   1 
ATOM   3190  N  N     . GLU E 1 59  ? 5.464   -17.429 55.358 1.00 39.54  ? 59   GLU E N     1 
ATOM   3191  C  CA    . GLU E 1 59  ? 6.148   -18.708 55.155 1.00 39.36  ? 59   GLU E CA    1 
ATOM   3192  C  C     . GLU E 1 59  ? 5.158   -19.844 55.270 1.00 38.74  ? 59   GLU E C     1 
ATOM   3193  O  O     . GLU E 1 59  ? 4.165   -19.741 55.992 1.00 38.17  ? 59   GLU E O     1 
ATOM   3194  C  CB    . GLU E 1 59  ? 7.143   -18.881 56.289 1.00 39.58  ? 59   GLU E CB    1 
ATOM   3195  C  CG    . GLU E 1 59  ? 6.471   -18.509 57.617 1.00 42.00  ? 59   GLU E CG    1 
ATOM   3196  C  CD    . GLU E 1 59  ? 7.320   -18.771 58.838 1.00 46.08  ? 59   GLU E CD    1 
ATOM   3197  O  OE1   . GLU E 1 59  ? 8.181   -19.675 58.772 1.00 47.49  ? 59   GLU E OE1   1 
ATOM   3198  O  OE2   . GLU E 1 59  ? 7.109   -18.072 59.869 1.00 47.40  ? 59   GLU E OE2   1 
ATOM   3199  N  N     . LEU E 1 60  ? 5.435   -20.947 54.591 1.00 38.46  ? 60   LEU E N     1 
ATOM   3200  C  CA    . LEU E 1 60  ? 4.593   -22.124 54.776 1.00 38.12  ? 60   LEU E CA    1 
ATOM   3201  C  C     . LEU E 1 60  ? 4.982   -22.832 56.063 1.00 38.30  ? 60   LEU E C     1 
ATOM   3202  O  O     . LEU E 1 60  ? 6.074   -22.632 56.605 1.00 38.28  ? 60   LEU E O     1 
ATOM   3203  C  CB    . LEU E 1 60  ? 4.650   -23.064 53.572 1.00 37.76  ? 60   LEU E CB    1 
ATOM   3204  C  CG    . LEU E 1 60  ? 4.231   -22.409 52.261 1.00 36.57  ? 60   LEU E CG    1 
ATOM   3205  C  CD1   . LEU E 1 60  ? 4.510   -23.317 51.116 1.00 35.93  ? 60   LEU E CD1   1 
ATOM   3206  C  CD2   . LEU E 1 60  ? 2.766   -21.989 52.278 1.00 36.13  ? 60   LEU E CD2   1 
ATOM   3207  N  N     . LEU E 1 61  ? 4.075   -23.655 56.555 1.00 38.52  ? 61   LEU E N     1 
ATOM   3208  C  CA    . LEU E 1 61  ? 4.210   -24.177 57.890 1.00 39.15  ? 61   LEU E CA    1 
ATOM   3209  C  C     . LEU E 1 61  ? 4.390   -25.696 57.911 1.00 39.48  ? 61   LEU E C     1 
ATOM   3210  O  O     . LEU E 1 61  ? 4.797   -26.262 58.926 1.00 39.87  ? 61   LEU E O     1 
ATOM   3211  C  CB    . LEU E 1 61  ? 3.018   -23.711 58.741 1.00 39.46  ? 61   LEU E CB    1 
ATOM   3212  C  CG    . LEU E 1 61  ? 2.698   -22.195 58.704 1.00 39.12  ? 61   LEU E CG    1 
ATOM   3213  C  CD1   . LEU E 1 61  ? 1.491   -21.855 59.552 1.00 39.09  ? 61   LEU E CD1   1 
ATOM   3214  C  CD2   . LEU E 1 61  ? 3.880   -21.383 59.161 1.00 38.20  ? 61   LEU E CD2   1 
ATOM   3215  N  N     . ILE E 1 62  ? 4.095   -26.353 56.796 1.00 39.20  ? 62   ILE E N     1 
ATOM   3216  C  CA    . ILE E 1 62  ? 4.339   -27.768 56.689 1.00 39.30  ? 62   ILE E CA    1 
ATOM   3217  C  C     . ILE E 1 62  ? 5.686   -27.897 55.978 1.00 39.98  ? 62   ILE E C     1 
ATOM   3218  O  O     . ILE E 1 62  ? 5.904   -27.228 54.962 1.00 40.19  ? 62   ILE E O     1 
ATOM   3219  C  CB    . ILE E 1 62  ? 3.220   -28.485 55.899 1.00 39.14  ? 62   ILE E CB    1 
ATOM   3220  C  CG1   . ILE E 1 62  ? 1.870   -28.336 56.613 1.00 39.17  ? 62   ILE E CG1   1 
ATOM   3221  C  CG2   . ILE E 1 62  ? 3.545   -29.969 55.711 1.00 38.57  ? 62   ILE E CG2   1 
ATOM   3222  C  CD1   . ILE E 1 62  ? 0.645   -28.536 55.720 1.00 37.30  ? 62   ILE E CD1   1 
ATOM   3223  N  N     . ARG E 1 63  ? 6.583   -28.741 56.511 1.00 39.91  ? 63   ARG E N     1 
ATOM   3224  C  CA    . ARG E 1 63  ? 7.880   -28.976 55.897 1.00 39.67  ? 63   ARG E CA    1 
ATOM   3225  C  C     . ARG E 1 63  ? 7.684   -29.499 54.455 1.00 39.39  ? 63   ARG E C     1 
ATOM   3226  O  O     . ARG E 1 63  ? 6.787   -30.296 54.199 1.00 38.82  ? 63   ARG E O     1 
ATOM   3227  C  CB    . ARG E 1 63  ? 8.717   -29.946 56.737 1.00 39.85  ? 63   ARG E CB    1 
ATOM   3228  C  CG    . ARG E 1 63  ? 9.124   -29.494 58.147 1.00 42.00  ? 63   ARG E CG    1 
ATOM   3229  C  CD    . ARG E 1 63  ? 10.260  -28.430 58.188 1.00 48.46  ? 63   ARG E CD    1 
ATOM   3230  N  NE    . ARG E 1 63  ? 9.765   -27.122 58.680 1.00 52.42  ? 63   ARG E NE    1 
ATOM   3231  C  CZ    . ARG E 1 63  ? 9.755   -25.977 57.988 1.00 52.74  ? 63   ARG E CZ    1 
ATOM   3232  N  NH1   . ARG E 1 63  ? 10.257  -25.913 56.753 1.00 53.53  ? 63   ARG E NH1   1 
ATOM   3233  N  NH2   . ARG E 1 63  ? 9.251   -24.881 58.544 1.00 53.09  ? 63   ARG E NH2   1 
ATOM   3234  N  N     . LYS E 1 64  ? 8.522   -29.032 53.527 1.00 39.26  ? 64   LYS E N     1 
ATOM   3235  C  CA    . LYS E 1 64  ? 8.300   -29.228 52.091 1.00 39.49  ? 64   LYS E CA    1 
ATOM   3236  C  C     . LYS E 1 64  ? 8.212   -30.673 51.658 1.00 38.89  ? 64   LYS E C     1 
ATOM   3237  O  O     . LYS E 1 64  ? 7.217   -31.088 51.062 1.00 38.81  ? 64   LYS E O     1 
ATOM   3238  C  CB    . LYS E 1 64  ? 9.376   -28.530 51.265 1.00 39.55  ? 64   LYS E CB    1 
ATOM   3239  C  CG    . LYS E 1 64  ? 9.121   -27.079 51.126 1.00 42.45  ? 64   LYS E CG    1 
ATOM   3240  C  CD    . LYS E 1 64  ? 9.854   -26.459 49.938 1.00 46.44  ? 64   LYS E CD    1 
ATOM   3241  C  CE    . LYS E 1 64  ? 9.835   -24.923 50.093 1.00 47.84  ? 64   LYS E CE    1 
ATOM   3242  N  NZ    . LYS E 1 64  ? 8.599   -24.471 50.843 1.00 48.58  ? 64   LYS E NZ    1 
ATOM   3243  N  N     . LEU E 1 65  ? 9.271   -31.418 51.952 1.00 38.51  ? 65   LEU E N     1 
ATOM   3244  C  CA    . LEU E 1 65  ? 9.408   -32.792 51.514 1.00 37.83  ? 65   LEU E CA    1 
ATOM   3245  C  C     . LEU E 1 65  ? 8.261   -33.664 52.019 1.00 37.24  ? 65   LEU E C     1 
ATOM   3246  O  O     . LEU E 1 65  ? 7.567   -34.268 51.198 1.00 37.49  ? 65   LEU E O     1 
ATOM   3247  C  CB    . LEU E 1 65  ? 10.757  -33.366 51.933 1.00 37.85  ? 65   LEU E CB    1 
ATOM   3248  C  CG    . LEU E 1 65  ? 10.989  -34.847 51.610 1.00 37.38  ? 65   LEU E CG    1 
ATOM   3249  C  CD1   . LEU E 1 65  ? 11.095  -35.099 50.114 1.00 34.62  ? 65   LEU E CD1   1 
ATOM   3250  C  CD2   . LEU E 1 65  ? 12.245  -35.274 52.318 1.00 38.28  ? 65   LEU E CD2   1 
ATOM   3251  N  N     . PRO E 1 66  ? 8.041   -33.717 53.350 1.00 36.17  ? 66   PRO E N     1 
ATOM   3252  C  CA    . PRO E 1 66  ? 6.916   -34.508 53.822 1.00 35.79  ? 66   PRO E CA    1 
ATOM   3253  C  C     . PRO E 1 66  ? 5.653   -34.244 53.007 1.00 35.44  ? 66   PRO E C     1 
ATOM   3254  O  O     . PRO E 1 66  ? 5.063   -35.194 52.481 1.00 35.71  ? 66   PRO E O     1 
ATOM   3255  C  CB    . PRO E 1 66  ? 6.738   -34.044 55.266 1.00 35.71  ? 66   PRO E CB    1 
ATOM   3256  C  CG    . PRO E 1 66  ? 8.098   -33.648 55.682 1.00 35.98  ? 66   PRO E CG    1 
ATOM   3257  C  CD    . PRO E 1 66  ? 8.758   -33.074 54.463 1.00 36.14  ? 66   PRO E CD    1 
ATOM   3258  N  N     . PHE E 1 67  ? 5.267   -32.974 52.869 1.00 35.10  ? 67   PHE E N     1 
ATOM   3259  C  CA    . PHE E 1 67  ? 4.098   -32.603 52.068 1.00 34.70  ? 67   PHE E CA    1 
ATOM   3260  C  C     . PHE E 1 67  ? 4.178   -33.122 50.635 1.00 34.99  ? 67   PHE E C     1 
ATOM   3261  O  O     . PHE E 1 67  ? 3.178   -33.607 50.097 1.00 34.86  ? 67   PHE E O     1 
ATOM   3262  C  CB    . PHE E 1 67  ? 3.878   -31.092 52.044 1.00 34.23  ? 67   PHE E CB    1 
ATOM   3263  C  CG    . PHE E 1 67  ? 2.669   -30.675 51.248 1.00 33.23  ? 67   PHE E CG    1 
ATOM   3264  C  CD1   . PHE E 1 67  ? 1.438   -30.532 51.864 1.00 31.71  ? 67   PHE E CD1   1 
ATOM   3265  C  CD2   . PHE E 1 67  ? 2.760   -30.449 49.878 1.00 33.30  ? 67   PHE E CD2   1 
ATOM   3266  C  CE1   . PHE E 1 67  ? 0.319   -30.163 51.140 1.00 31.15  ? 67   PHE E CE1   1 
ATOM   3267  C  CE2   . PHE E 1 67  ? 1.645   -30.084 49.144 1.00 32.28  ? 67   PHE E CE2   1 
ATOM   3268  C  CZ    . PHE E 1 67  ? 0.419   -29.929 49.789 1.00 32.40  ? 67   PHE E CZ    1 
ATOM   3269  N  N     . GLN E 1 68  ? 5.350   -33.002 50.016 1.00 35.30  ? 68   GLN E N     1 
ATOM   3270  C  CA    . GLN E 1 68  ? 5.529   -33.466 48.646 1.00 36.22  ? 68   GLN E CA    1 
ATOM   3271  C  C     . GLN E 1 68  ? 5.227   -34.971 48.513 1.00 36.35  ? 68   GLN E C     1 
ATOM   3272  O  O     . GLN E 1 68  ? 4.640   -35.422 47.507 1.00 36.39  ? 68   GLN E O     1 
ATOM   3273  C  CB    . GLN E 1 68  ? 6.937   -33.168 48.154 1.00 36.23  ? 68   GLN E CB    1 
ATOM   3274  C  CG    . GLN E 1 68  ? 7.108   -33.449 46.687 1.00 39.59  ? 68   GLN E CG    1 
ATOM   3275  C  CD    . GLN E 1 68  ? 8.398   -32.903 46.123 1.00 44.17  ? 68   GLN E CD    1 
ATOM   3276  O  OE1   . GLN E 1 68  ? 9.492   -33.298 46.539 1.00 47.17  ? 68   GLN E OE1   1 
ATOM   3277  N  NE2   . GLN E 1 68  ? 8.282   -31.998 45.155 1.00 45.42  ? 68   GLN E NE2   1 
ATOM   3278  N  N     . ARG E 1 69  ? 5.609   -35.739 49.534 1.00 36.08  ? 69   ARG E N     1 
ATOM   3279  C  CA    . ARG E 1 69  ? 5.451   -37.179 49.474 1.00 35.92  ? 69   ARG E CA    1 
ATOM   3280  C  C     . ARG E 1 69  ? 4.006   -37.499 49.524 1.00 35.60  ? 69   ARG E C     1 
ATOM   3281  O  O     . ARG E 1 69  ? 3.547   -38.360 48.771 1.00 36.02  ? 69   ARG E O     1 
ATOM   3282  C  CB    . ARG E 1 69  ? 6.106   -37.871 50.646 1.00 36.29  ? 69   ARG E CB    1 
ATOM   3283  C  CG    . ARG E 1 69  ? 7.561   -38.096 50.502 1.00 35.50  ? 69   ARG E CG    1 
ATOM   3284  C  CD    . ARG E 1 69  ? 8.001   -38.943 51.652 1.00 34.49  ? 69   ARG E CD    1 
ATOM   3285  N  NE    . ARG E 1 69  ? 9.261   -38.454 52.161 1.00 34.14  ? 69   ARG E NE    1 
ATOM   3286  C  CZ    . ARG E 1 69  ? 9.442   -37.991 53.389 1.00 34.50  ? 69   ARG E CZ    1 
ATOM   3287  N  NH1   . ARG E 1 69  ? 8.432   -37.968 54.269 1.00 30.61  ? 69   ARG E NH1   1 
ATOM   3288  N  NH2   . ARG E 1 69  ? 10.659  -37.559 53.724 1.00 34.85  ? 69   ARG E NH2   1 
ATOM   3289  N  N     . LEU E 1 70  ? 3.299   -36.810 50.419 1.00 35.08  ? 70   LEU E N     1 
ATOM   3290  C  CA    . LEU E 1 70  ? 1.844   -36.968 50.544 1.00 34.66  ? 70   LEU E CA    1 
ATOM   3291  C  C     . LEU E 1 70  ? 1.151   -36.704 49.216 1.00 34.17  ? 70   LEU E C     1 
ATOM   3292  O  O     . LEU E 1 70  ? 0.243   -37.428 48.837 1.00 34.03  ? 70   LEU E O     1 
ATOM   3293  C  CB    . LEU E 1 70  ? 1.260   -36.057 51.630 1.00 34.60  ? 70   LEU E CB    1 
ATOM   3294  C  CG    . LEU E 1 70  ? -0.256  -36.197 51.830 1.00 33.96  ? 70   LEU E CG    1 
ATOM   3295  C  CD1   . LEU E 1 70  ? -0.614  -37.625 52.250 1.00 32.74  ? 70   LEU E CD1   1 
ATOM   3296  C  CD2   . LEU E 1 70  ? -0.745  -35.176 52.843 1.00 32.16  ? 70   LEU E CD2   1 
ATOM   3297  N  N     . VAL E 1 71  ? 1.600   -35.682 48.506 1.00 33.88  ? 71   VAL E N     1 
ATOM   3298  C  CA    . VAL E 1 71  ? 1.044   -35.393 47.201 1.00 34.00  ? 71   VAL E CA    1 
ATOM   3299  C  C     . VAL E 1 71  ? 1.280   -36.589 46.290 1.00 34.08  ? 71   VAL E C     1 
ATOM   3300  O  O     . VAL E 1 71  ? 0.322   -37.171 45.764 1.00 34.24  ? 71   VAL E O     1 
ATOM   3301  C  CB    . VAL E 1 71  ? 1.618   -34.090 46.611 1.00 33.78  ? 71   VAL E CB    1 
ATOM   3302  C  CG1   . VAL E 1 71  ? 1.149   -33.894 45.190 1.00 33.16  ? 71   VAL E CG1   1 
ATOM   3303  C  CG2   . VAL E 1 71  ? 1.185   -32.936 47.466 1.00 33.51  ? 71   VAL E CG2   1 
ATOM   3304  N  N     . ARG E 1 72  ? 2.543   -36.968 46.138 1.00 34.05  ? 72   ARG E N     1 
ATOM   3305  C  CA    . ARG E 1 72  ? 2.916   -38.109 45.297 1.00 34.49  ? 72   ARG E CA    1 
ATOM   3306  C  C     . ARG E 1 72  ? 2.188   -39.425 45.669 1.00 34.35  ? 72   ARG E C     1 
ATOM   3307  O  O     . ARG E 1 72  ? 1.774   -40.180 44.784 1.00 34.10  ? 72   ARG E O     1 
ATOM   3308  C  CB    . ARG E 1 72  ? 4.433   -38.306 45.317 1.00 34.74  ? 72   ARG E CB    1 
ATOM   3309  C  CG    . ARG E 1 72  ? 5.210   -37.179 44.655 1.00 35.65  ? 72   ARG E CG    1 
ATOM   3310  C  CD    . ARG E 1 72  ? 6.623   -37.619 44.390 1.00 38.48  ? 72   ARG E CD    1 
ATOM   3311  N  NE    . ARG E 1 72  ? 7.517   -36.484 44.227 1.00 42.52  ? 72   ARG E NE    1 
ATOM   3312  C  CZ    . ARG E 1 72  ? 7.696   -35.816 43.088 1.00 44.10  ? 72   ARG E CZ    1 
ATOM   3313  N  NH1   . ARG E 1 72  ? 7.042   -36.172 41.978 1.00 42.56  ? 72   ARG E NH1   1 
ATOM   3314  N  NH2   . ARG E 1 72  ? 8.545   -34.790 43.065 1.00 44.41  ? 72   ARG E NH2   1 
ATOM   3315  N  N     . GLU E 1 73  ? 2.024   -39.684 46.965 1.00 33.82  ? 73   GLU E N     1 
ATOM   3316  C  CA    . GLU E 1 73  ? 1.270   -40.842 47.402 1.00 33.96  ? 73   GLU E CA    1 
ATOM   3317  C  C     . GLU E 1 73  ? -0.168  -40.813 46.897 1.00 34.36  ? 73   GLU E C     1 
ATOM   3318  O  O     . GLU E 1 73  ? -0.652  -41.786 46.329 1.00 34.95  ? 73   GLU E O     1 
ATOM   3319  C  CB    . GLU E 1 73  ? 1.276   -40.980 48.927 1.00 33.81  ? 73   GLU E CB    1 
ATOM   3320  C  CG    . GLU E 1 73  ? 0.373   -42.108 49.406 1.00 31.56  ? 73   GLU E CG    1 
ATOM   3321  C  CD    . GLU E 1 73  ? 0.286   -42.188 50.906 1.00 30.70  ? 73   GLU E CD    1 
ATOM   3322  O  OE1   . GLU E 1 73  ? 1.346   -42.170 51.548 1.00 29.68  ? 73   GLU E OE1   1 
ATOM   3323  O  OE2   . GLU E 1 73  ? -0.847  -42.282 51.445 1.00 31.88  ? 73   GLU E OE2   1 
ATOM   3324  N  N     . ILE E 1 74  ? -0.849  -39.699 47.111 1.00 34.57  ? 74   ILE E N     1 
ATOM   3325  C  CA    . ILE E 1 74  ? -2.238  -39.578 46.707 1.00 34.71  ? 74   ILE E CA    1 
ATOM   3326  C  C     . ILE E 1 74  ? -2.337  -39.611 45.189 1.00 35.21  ? 74   ILE E C     1 
ATOM   3327  O  O     . ILE E 1 74  ? -3.268  -40.186 44.635 1.00 35.03  ? 74   ILE E O     1 
ATOM   3328  C  CB    . ILE E 1 74  ? -2.875  -38.295 47.275 1.00 34.29  ? 74   ILE E CB    1 
ATOM   3329  C  CG1   . ILE E 1 74  ? -2.995  -38.412 48.788 1.00 34.21  ? 74   ILE E CG1   1 
ATOM   3330  C  CG2   . ILE E 1 74  ? -4.243  -38.046 46.678 1.00 34.03  ? 74   ILE E CG2   1 
ATOM   3331  C  CD1   . ILE E 1 74  ? -3.190  -37.076 49.479 1.00 35.90  ? 74   ILE E CD1   1 
ATOM   3332  N  N     . ALA E 1 75  ? -1.381  -38.992 44.509 1.00 36.12  ? 75   ALA E N     1 
ATOM   3333  C  CA    . ALA E 1 75  ? -1.473  -38.894 43.054 1.00 37.08  ? 75   ALA E CA    1 
ATOM   3334  C  C     . ALA E 1 75  ? -1.376  -40.291 42.461 1.00 37.55  ? 75   ALA E C     1 
ATOM   3335  O  O     . ALA E 1 75  ? -2.207  -40.699 41.638 1.00 37.17  ? 75   ALA E O     1 
ATOM   3336  C  CB    . ALA E 1 75  ? -0.392  -37.982 42.495 1.00 36.65  ? 75   ALA E CB    1 
ATOM   3337  N  N     . GLN E 1 76  ? -0.365  -41.016 42.935 1.00 38.46  ? 76   GLN E N     1 
ATOM   3338  C  CA    . GLN E 1 76  ? -0.054  -42.366 42.491 1.00 39.15  ? 76   GLN E CA    1 
ATOM   3339  C  C     . GLN E 1 76  ? -1.256  -43.287 42.595 1.00 39.60  ? 76   GLN E C     1 
ATOM   3340  O  O     . GLN E 1 76  ? -1.505  -44.032 41.660 1.00 39.82  ? 76   GLN E O     1 
ATOM   3341  C  CB    . GLN E 1 76  ? 1.096   -42.924 43.314 1.00 39.44  ? 76   GLN E CB    1 
ATOM   3342  C  CG    . GLN E 1 76  ? 1.751   -44.153 42.765 1.00 39.02  ? 76   GLN E CG    1 
ATOM   3343  C  CD    . GLN E 1 76  ? 3.010   -44.435 43.499 1.00 39.03  ? 76   GLN E CD    1 
ATOM   3344  O  OE1   . GLN E 1 76  ? 3.034   -44.453 44.721 1.00 39.86  ? 76   GLN E OE1   1 
ATOM   3345  N  NE2   . GLN E 1 76  ? 4.084   -44.620 42.766 1.00 42.67  ? 76   GLN E NE2   1 
ATOM   3346  N  N     . ASP E 1 77  ? -1.991  -43.241 43.710 1.00 40.00  ? 77   ASP E N     1 
ATOM   3347  C  CA    . ASP E 1 77  ? -3.252  -43.974 43.815 1.00 41.20  ? 77   ASP E CA    1 
ATOM   3348  C  C     . ASP E 1 77  ? -4.250  -43.660 42.682 1.00 42.38  ? 77   ASP E C     1 
ATOM   3349  O  O     . ASP E 1 77  ? -5.019  -44.533 42.294 1.00 42.98  ? 77   ASP E O     1 
ATOM   3350  C  CB    . ASP E 1 77  ? -3.939  -43.733 45.150 1.00 40.99  ? 77   ASP E CB    1 
ATOM   3351  C  CG    . ASP E 1 77  ? -3.106  -44.161 46.342 1.00 41.86  ? 77   ASP E CG    1 
ATOM   3352  O  OD1   . ASP E 1 77  ? -2.180  -44.979 46.202 1.00 42.80  ? 77   ASP E OD1   1 
ATOM   3353  O  OD2   . ASP E 1 77  ? -3.410  -43.679 47.457 1.00 43.98  ? 77   ASP E OD2   1 
ATOM   3354  N  N     . PHE E 1 78  ? -4.252  -42.434 42.162 1.00 43.48  ? 78   PHE E N     1 
ATOM   3355  C  CA    . PHE E 1 78  ? -5.108  -42.105 41.027 1.00 44.82  ? 78   PHE E CA    1 
ATOM   3356  C  C     . PHE E 1 78  ? -4.480  -42.522 39.707 1.00 45.61  ? 78   PHE E C     1 
ATOM   3357  O  O     . PHE E 1 78  ? -5.199  -42.821 38.750 1.00 45.61  ? 78   PHE E O     1 
ATOM   3358  C  CB    . PHE E 1 78  ? -5.441  -40.611 40.978 1.00 45.14  ? 78   PHE E CB    1 
ATOM   3359  C  CG    . PHE E 1 78  ? -6.489  -40.192 41.972 1.00 46.83  ? 78   PHE E CG    1 
ATOM   3360  C  CD1   . PHE E 1 78  ? -6.128  -39.580 43.179 1.00 48.24  ? 78   PHE E CD1   1 
ATOM   3361  C  CD2   . PHE E 1 78  ? -7.837  -40.417 41.721 1.00 47.79  ? 78   PHE E CD2   1 
ATOM   3362  C  CE1   . PHE E 1 78  ? -7.096  -39.195 44.124 1.00 47.30  ? 78   PHE E CE1   1 
ATOM   3363  C  CE2   . PHE E 1 78  ? -8.814  -40.033 42.668 1.00 48.72  ? 78   PHE E CE2   1 
ATOM   3364  C  CZ    . PHE E 1 78  ? -8.435  -39.412 43.866 1.00 46.91  ? 78   PHE E CZ    1 
ATOM   3365  N  N     . LYS E 1 79  ? -3.148  -42.530 39.653 1.00 46.53  ? 79   LYS E N     1 
ATOM   3366  C  CA    . LYS E 1 79  ? -2.428  -42.738 38.402 1.00 47.56  ? 79   LYS E CA    1 
ATOM   3367  C  C     . LYS E 1 79  ? -0.948  -43.023 38.627 1.00 48.67  ? 79   LYS E C     1 
ATOM   3368  O  O     . LYS E 1 79  ? -0.278  -42.330 39.402 1.00 49.44  ? 79   LYS E O     1 
ATOM   3369  C  CB    . LYS E 1 79  ? -2.566  -41.501 37.528 1.00 47.22  ? 79   LYS E CB    1 
ATOM   3370  C  CG    . LYS E 1 79  ? -2.991  -41.790 36.119 1.00 47.66  ? 79   LYS E CG    1 
ATOM   3371  C  CD    . LYS E 1 79  ? -1.817  -41.948 35.198 1.00 48.01  ? 79   LYS E CD    1 
ATOM   3372  C  CE    . LYS E 1 79  ? -2.204  -42.725 33.963 1.00 48.04  ? 79   LYS E CE    1 
ATOM   3373  N  NZ    . LYS E 1 79  ? -1.086  -43.646 33.616 1.00 49.08  ? 79   LYS E NZ    1 
ATOM   3374  N  N     . THR E 1 80  ? -0.439  -44.039 37.940 1.00 49.60  ? 80   THR E N     1 
ATOM   3375  C  CA    . THR E 1 80  ? 0.972   -44.408 38.019 1.00 50.54  ? 80   THR E CA    1 
ATOM   3376  C  C     . THR E 1 80  ? 1.770   -43.607 37.007 1.00 50.88  ? 80   THR E C     1 
ATOM   3377  O  O     . THR E 1 80  ? 1.184   -42.913 36.176 1.00 50.87  ? 80   THR E O     1 
ATOM   3378  C  CB    . THR E 1 80  ? 1.163   -45.898 37.710 1.00 50.98  ? 80   THR E CB    1 
ATOM   3379  O  OG1   . THR E 1 80  ? 0.441   -46.229 36.509 1.00 51.79  ? 80   THR E OG1   1 
ATOM   3380  C  CG2   . THR E 1 80  ? 0.674   -46.765 38.887 1.00 50.67  ? 80   THR E CG2   1 
ATOM   3381  N  N     . ASP E 1 81  ? 3.097   -43.729 37.062 1.00 51.42  ? 81   ASP E N     1 
ATOM   3382  C  CA    . ASP E 1 81  ? 4.004   -42.928 36.234 1.00 52.46  ? 81   ASP E CA    1 
ATOM   3383  C  C     . ASP E 1 81  ? 3.498   -41.486 36.081 1.00 52.27  ? 81   ASP E C     1 
ATOM   3384  O  O     . ASP E 1 81  ? 2.966   -41.108 35.025 1.00 52.64  ? 81   ASP E O     1 
ATOM   3385  C  CB    . ASP E 1 81  ? 4.182   -43.542 34.838 1.00 53.31  ? 81   ASP E CB    1 
ATOM   3386  C  CG    . ASP E 1 81  ? 4.354   -45.043 34.869 1.00 57.11  ? 81   ASP E CG    1 
ATOM   3387  O  OD1   . ASP E 1 81  ? 3.510   -45.761 34.247 1.00 59.47  ? 81   ASP E OD1   1 
ATOM   3388  O  OD2   . ASP E 1 81  ? 5.340   -45.498 35.514 1.00 61.48  ? 81   ASP E OD2   1 
ATOM   3389  N  N     . LEU E 1 82  ? 3.616   -40.690 37.137 1.00 51.71  ? 82   LEU E N     1 
ATOM   3390  C  CA    . LEU E 1 82  ? 3.327   -39.263 37.025 1.00 50.80  ? 82   LEU E CA    1 
ATOM   3391  C  C     . LEU E 1 82  ? 4.497   -38.480 37.561 1.00 50.38  ? 82   LEU E C     1 
ATOM   3392  O  O     . LEU E 1 82  ? 5.191   -38.903 38.484 1.00 50.43  ? 82   LEU E O     1 
ATOM   3393  C  CB    . LEU E 1 82  ? 2.049   -38.863 37.771 1.00 50.57  ? 82   LEU E CB    1 
ATOM   3394  C  CG    . LEU E 1 82  ? 0.667   -39.096 37.149 1.00 50.12  ? 82   LEU E CG    1 
ATOM   3395  C  CD1   . LEU E 1 82  ? -0.433  -38.670 38.114 1.00 48.52  ? 82   LEU E CD1   1 
ATOM   3396  C  CD2   . LEU E 1 82  ? 0.513   -38.365 35.838 1.00 48.87  ? 82   LEU E CD2   1 
ATOM   3397  N  N     . ARG E 1 83  ? 4.713   -37.327 36.968 1.00 49.87  ? 83   ARG E N     1 
ATOM   3398  C  CA    . ARG E 1 83  ? 5.712   -36.415 37.457 1.00 49.36  ? 83   ARG E CA    1 
ATOM   3399  C  C     . ARG E 1 83  ? 4.997   -35.124 37.819 1.00 48.16  ? 83   ARG E C     1 
ATOM   3400  O  O     . ARG E 1 83  ? 3.857   -34.887 37.403 1.00 47.73  ? 83   ARG E O     1 
ATOM   3401  C  CB    . ARG E 1 83  ? 6.768   -36.168 36.380 1.00 50.21  ? 83   ARG E CB    1 
ATOM   3402  C  CG    . ARG E 1 83  ? 7.519   -37.418 35.938 1.00 52.40  ? 83   ARG E CG    1 
ATOM   3403  C  CD    . ARG E 1 83  ? 7.866   -37.339 34.461 1.00 56.69  ? 83   ARG E CD    1 
ATOM   3404  N  NE    . ARG E 1 83  ? 9.195   -37.889 34.194 1.00 60.19  ? 83   ARG E NE    1 
ATOM   3405  C  CZ    . ARG E 1 83  ? 10.303  -37.154 34.103 1.00 62.98  ? 83   ARG E CZ    1 
ATOM   3406  N  NH1   . ARG E 1 83  ? 10.242  -35.828 34.235 1.00 63.56  ? 83   ARG E NH1   1 
ATOM   3407  N  NH2   . ARG E 1 83  ? 11.473  -37.740 33.865 1.00 63.99  ? 83   ARG E NH2   1 
ATOM   3408  N  N     . PHE E 1 84  ? 5.680   -34.295 38.595 1.00 46.74  ? 84   PHE E N     1 
ATOM   3409  C  CA    . PHE E 1 84  ? 5.130   -33.046 39.071 1.00 45.35  ? 84   PHE E CA    1 
ATOM   3410  C  C     . PHE E 1 84  ? 6.115   -31.931 38.816 1.00 44.71  ? 84   PHE E C     1 
ATOM   3411  O  O     . PHE E 1 84  ? 7.283   -32.044 39.202 1.00 45.27  ? 84   PHE E O     1 
ATOM   3412  C  CB    . PHE E 1 84  ? 4.887   -33.146 40.570 1.00 44.76  ? 84   PHE E CB    1 
ATOM   3413  C  CG    . PHE E 1 84  ? 3.561   -33.732 40.926 1.00 44.68  ? 84   PHE E CG    1 
ATOM   3414  C  CD1   . PHE E 1 84  ? 3.387   -35.104 40.998 1.00 43.60  ? 84   PHE E CD1   1 
ATOM   3415  C  CD2   . PHE E 1 84  ? 2.472   -32.902 41.199 1.00 44.23  ? 84   PHE E CD2   1 
ATOM   3416  C  CE1   . PHE E 1 84  ? 2.141   -35.642 41.338 1.00 42.79  ? 84   PHE E CE1   1 
ATOM   3417  C  CE2   . PHE E 1 84  ? 1.238   -33.436 41.533 1.00 43.09  ? 84   PHE E CE2   1 
ATOM   3418  C  CZ    . PHE E 1 84  ? 1.076   -34.808 41.602 1.00 42.67  ? 84   PHE E CZ    1 
ATOM   3419  N  N     . GLN E 1 85  ? 5.665   -30.853 38.177 1.00 43.50  ? 85   GLN E N     1 
ATOM   3420  C  CA    . GLN E 1 85  ? 6.454   -29.629 38.169 1.00 42.53  ? 85   GLN E CA    1 
ATOM   3421  C  C     . GLN E 1 85  ? 6.582   -29.206 39.607 1.00 41.83  ? 85   GLN E C     1 
ATOM   3422  O  O     . GLN E 1 85  ? 5.646   -29.367 40.385 1.00 41.81  ? 85   GLN E O     1 
ATOM   3423  C  CB    . GLN E 1 85  ? 5.775   -28.533 37.371 1.00 42.69  ? 85   GLN E CB    1 
ATOM   3424  C  CG    . GLN E 1 85  ? 5.767   -28.770 35.876 1.00 44.00  ? 85   GLN E CG    1 
ATOM   3425  C  CD    . GLN E 1 85  ? 5.113   -27.631 35.123 1.00 47.03  ? 85   GLN E CD    1 
ATOM   3426  O  OE1   . GLN E 1 85  ? 4.364   -26.829 35.700 1.00 47.75  ? 85   GLN E OE1   1 
ATOM   3427  N  NE2   . GLN E 1 85  ? 5.379   -27.555 33.820 1.00 48.47  ? 85   GLN E NE2   1 
ATOM   3428  N  N     . SER E 1 86  ? 7.742   -28.696 39.990 1.00 41.51  ? 86   SER E N     1 
ATOM   3429  C  CA    . SER E 1 86  ? 7.939   -28.336 41.389 1.00 41.32  ? 86   SER E CA    1 
ATOM   3430  C  C     . SER E 1 86  ? 6.884   -27.335 41.791 1.00 40.61  ? 86   SER E C     1 
ATOM   3431  O  O     . SER E 1 86  ? 6.366   -27.398 42.885 1.00 40.98  ? 86   SER E O     1 
ATOM   3432  C  CB    . SER E 1 86  ? 9.320   -27.759 41.628 1.00 41.35  ? 86   SER E CB    1 
ATOM   3433  O  OG    . SER E 1 86  ? 9.458   -26.571 40.886 1.00 43.56  ? 86   SER E OG    1 
ATOM   3434  N  N     . SER E 1 87  ? 6.546   -26.430 40.886 1.00 40.10  ? 87   SER E N     1 
ATOM   3435  C  CA    . SER E 1 87  ? 5.545   -25.424 41.168 1.00 39.85  ? 87   SER E CA    1 
ATOM   3436  C  C     . SER E 1 87  ? 4.125   -25.984 41.220 1.00 39.46  ? 87   SER E C     1 
ATOM   3437  O  O     . SER E 1 87  ? 3.204   -25.273 41.626 1.00 39.96  ? 87   SER E O     1 
ATOM   3438  C  CB    . SER E 1 87  ? 5.607   -24.312 40.136 1.00 39.88  ? 87   SER E CB    1 
ATOM   3439  O  OG    . SER E 1 87  ? 5.138   -24.794 38.898 1.00 41.00  ? 87   SER E OG    1 
ATOM   3440  N  N     . ALA E 1 88  ? 3.928   -27.234 40.808 1.00 38.56  ? 88   ALA E N     1 
ATOM   3441  C  CA    . ALA E 1 88  ? 2.626   -27.863 41.002 1.00 37.49  ? 88   ALA E CA    1 
ATOM   3442  C  C     . ALA E 1 88  ? 2.531   -28.247 42.459 1.00 37.19  ? 88   ALA E C     1 
ATOM   3443  O  O     . ALA E 1 88  ? 1.502   -28.048 43.117 1.00 37.49  ? 88   ALA E O     1 
ATOM   3444  C  CB    . ALA E 1 88  ? 2.469   -29.043 40.143 1.00 37.04  ? 88   ALA E CB    1 
ATOM   3445  N  N     . VAL E 1 89  ? 3.624   -28.766 42.990 1.00 36.73  ? 89   VAL E N     1 
ATOM   3446  C  CA    . VAL E 1 89  ? 3.604   -29.179 44.383 1.00 36.26  ? 89   VAL E CA    1 
ATOM   3447  C  C     . VAL E 1 89  ? 3.399   -27.938 45.224 1.00 36.31  ? 89   VAL E C     1 
ATOM   3448  O  O     . VAL E 1 89  ? 2.599   -27.945 46.157 1.00 36.76  ? 89   VAL E O     1 
ATOM   3449  C  CB    . VAL E 1 89  ? 4.870   -29.957 44.818 1.00 35.84  ? 89   VAL E CB    1 
ATOM   3450  C  CG1   . VAL E 1 89  ? 4.629   -30.632 46.143 1.00 36.01  ? 89   VAL E CG1   1 
ATOM   3451  C  CG2   . VAL E 1 89  ? 5.251   -31.000 43.785 1.00 34.97  ? 89   VAL E CG2   1 
ATOM   3452  N  N     . MET E 1 90  ? 4.084   -26.857 44.859 1.00 36.41  ? 90   MET E N     1 
ATOM   3453  C  CA    . MET E 1 90  ? 4.025   -25.612 45.633 1.00 36.25  ? 90   MET E CA    1 
ATOM   3454  C  C     . MET E 1 90  ? 2.650   -24.957 45.541 1.00 35.64  ? 90   MET E C     1 
ATOM   3455  O  O     . MET E 1 90  ? 2.142   -24.432 46.534 1.00 35.51  ? 90   MET E O     1 
ATOM   3456  C  CB    . MET E 1 90  ? 5.133   -24.653 45.216 1.00 36.61  ? 90   MET E CB    1 
ATOM   3457  C  CG    . MET E 1 90  ? 6.538   -25.056 45.699 1.00 38.80  ? 90   MET E CG    1 
ATOM   3458  S  SD    . MET E 1 90  ? 6.633   -25.430 47.471 1.00 45.70  ? 90   MET E SD    1 
ATOM   3459  C  CE    . MET E 1 90  ? 6.630   -23.777 48.192 1.00 45.88  ? 90   MET E CE    1 
ATOM   3460  N  N     . ALA E 1 91  ? 2.029   -25.025 44.364 1.00 34.67  ? 91   ALA E N     1 
ATOM   3461  C  CA    . ALA E 1 91  ? 0.669   -24.542 44.221 1.00 33.80  ? 91   ALA E CA    1 
ATOM   3462  C  C     . ALA E 1 91  ? -0.250  -25.283 45.192 1.00 33.81  ? 91   ALA E C     1 
ATOM   3463  O  O     . ALA E 1 91  ? -0.967  -24.649 45.966 1.00 33.45  ? 91   ALA E O     1 
ATOM   3464  C  CB    . ALA E 1 91  ? 0.207   -24.702 42.810 1.00 33.63  ? 91   ALA E CB    1 
ATOM   3465  N  N     . LEU E 1 92  ? -0.195  -26.622 45.177 1.00 33.68  ? 92   LEU E N     1 
ATOM   3466  C  CA    . LEU E 1 92  ? -1.020  -27.443 46.075 1.00 33.41  ? 92   LEU E CA    1 
ATOM   3467  C  C     . LEU E 1 92  ? -0.759  -27.137 47.548 1.00 33.41  ? 92   LEU E C     1 
ATOM   3468  O  O     . LEU E 1 92  ? -1.704  -27.114 48.351 1.00 33.64  ? 92   LEU E O     1 
ATOM   3469  C  CB    . LEU E 1 92  ? -0.811  -28.936 45.833 1.00 33.57  ? 92   LEU E CB    1 
ATOM   3470  C  CG    . LEU E 1 92  ? -1.278  -29.572 44.522 1.00 33.66  ? 92   LEU E CG    1 
ATOM   3471  C  CD1   . LEU E 1 92  ? -0.451  -30.810 44.224 1.00 33.16  ? 92   LEU E CD1   1 
ATOM   3472  C  CD2   . LEU E 1 92  ? -2.746  -29.907 44.586 1.00 32.50  ? 92   LEU E CD2   1 
ATOM   3473  N  N     . GLN E 1 93  ? 0.507   -26.905 47.909 1.00 32.60  ? 93   GLN E N     1 
ATOM   3474  C  CA    . GLN E 1 93  ? 0.810   -26.596 49.291 1.00 32.00  ? 93   GLN E CA    1 
ATOM   3475  C  C     . GLN E 1 93  ? 0.238   -25.238 49.672 1.00 32.64  ? 93   GLN E C     1 
ATOM   3476  O  O     . GLN E 1 93  ? -0.344  -25.113 50.754 1.00 33.68  ? 93   GLN E O     1 
ATOM   3477  C  CB    . GLN E 1 93  ? 2.298   -26.682 49.613 1.00 31.28  ? 93   GLN E CB    1 
ATOM   3478  C  CG    . GLN E 1 93  ? 2.549   -26.440 51.080 1.00 30.38  ? 93   GLN E CG    1 
ATOM   3479  C  CD    . GLN E 1 93  ? 3.894   -26.884 51.565 1.00 30.64  ? 93   GLN E CD    1 
ATOM   3480  O  OE1   . GLN E 1 93  ? 4.705   -27.395 50.808 1.00 32.69  ? 93   GLN E OE1   1 
ATOM   3481  N  NE2   . GLN E 1 93  ? 4.141   -26.702 52.852 1.00 30.91  ? 93   GLN E NE2   1 
ATOM   3482  N  N     . GLU E 1 94  ? 0.384   -24.238 48.796 1.00 32.01  ? 94   GLU E N     1 
ATOM   3483  C  CA    . GLU E 1 94  ? -0.142  -22.916 49.062 1.00 31.81  ? 94   GLU E CA    1 
ATOM   3484  C  C     . GLU E 1 94  ? -1.636  -22.948 49.269 1.00 31.74  ? 94   GLU E C     1 
ATOM   3485  O  O     . GLU E 1 94  ? -2.148  -22.266 50.138 1.00 32.35  ? 94   GLU E O     1 
ATOM   3486  C  CB    . GLU E 1 94  ? 0.161   -21.948 47.923 1.00 32.37  ? 94   GLU E CB    1 
ATOM   3487  C  CG    . GLU E 1 94  ? 1.553   -21.322 47.941 1.00 33.78  ? 94   GLU E CG    1 
ATOM   3488  C  CD    . GLU E 1 94  ? 1.784   -20.347 49.088 1.00 36.69  ? 94   GLU E CD    1 
ATOM   3489  O  OE1   . GLU E 1 94  ? 0.823   -19.964 49.806 1.00 38.35  ? 94   GLU E OE1   1 
ATOM   3490  O  OE2   . GLU E 1 94  ? 2.958   -19.972 49.275 1.00 39.00  ? 94   GLU E OE2   1 
ATOM   3491  N  N     . ALA E 1 95  ? -2.350  -23.721 48.468 1.00 31.48  ? 95   ALA E N     1 
ATOM   3492  C  CA    . ALA E 1 95  ? -3.785  -23.805 48.639 1.00 31.40  ? 95   ALA E CA    1 
ATOM   3493  C  C     . ALA E 1 95  ? -4.110  -24.585 49.897 1.00 31.70  ? 95   ALA E C     1 
ATOM   3494  O  O     . ALA E 1 95  ? -5.065  -24.262 50.593 1.00 31.89  ? 95   ALA E O     1 
ATOM   3495  C  CB    . ALA E 1 95  ? -4.447  -24.456 47.426 1.00 30.81  ? 95   ALA E CB    1 
ATOM   3496  N  N     . SER E 1 96  ? -3.320  -25.617 50.187 1.00 32.01  ? 96   SER E N     1 
ATOM   3497  C  CA    . SER E 1 96  ? -3.667  -26.539 51.276 1.00 32.34  ? 96   SER E CA    1 
ATOM   3498  C  C     . SER E 1 96  ? -3.565  -25.859 52.620 1.00 31.95  ? 96   SER E C     1 
ATOM   3499  O  O     . SER E 1 96  ? -4.435  -26.040 53.474 1.00 31.45  ? 96   SER E O     1 
ATOM   3500  C  CB    . SER E 1 96  ? -2.816  -27.825 51.246 1.00 32.91  ? 96   SER E CB    1 
ATOM   3501  O  OG    . SER E 1 96  ? -3.288  -28.764 50.271 1.00 33.34  ? 96   SER E OG    1 
ATOM   3502  N  N     . GLU E 1 97  ? -2.512  -25.056 52.789 1.00 31.98  ? 97   GLU E N     1 
ATOM   3503  C  CA    . GLU E 1 97  ? -2.333  -24.252 54.012 1.00 32.02  ? 97   GLU E CA    1 
ATOM   3504  C  C     . GLU E 1 97  ? -3.353  -23.098 54.110 1.00 30.55  ? 97   GLU E C     1 
ATOM   3505  O  O     . GLU E 1 97  ? -3.941  -22.857 55.177 1.00 29.89  ? 97   GLU E O     1 
ATOM   3506  C  CB    . GLU E 1 97  ? -0.885  -23.790 54.186 1.00 31.77  ? 97   GLU E CB    1 
ATOM   3507  C  CG    . GLU E 1 97  ? 0.134   -24.956 54.164 1.00 33.71  ? 97   GLU E CG    1 
ATOM   3508  C  CD    . GLU E 1 97  ? 1.476   -24.654 54.876 1.00 34.38  ? 97   GLU E CD    1 
ATOM   3509  O  OE1   . GLU E 1 97  ? 1.690   -23.522 55.366 1.00 38.55  ? 97   GLU E OE1   1 
ATOM   3510  O  OE2   . GLU E 1 97  ? 2.330   -25.561 54.953 1.00 36.85  ? 97   GLU E OE2   1 
ATOM   3511  N  N     . ALA E 1 98  ? -3.605  -22.421 53.002 1.00 29.58  ? 98   ALA E N     1 
ATOM   3512  C  CA    . ALA E 1 98  ? -4.630  -21.385 53.010 1.00 29.48  ? 98   ALA E CA    1 
ATOM   3513  C  C     . ALA E 1 98  ? -6.004  -21.931 53.396 1.00 29.69  ? 98   ALA E C     1 
ATOM   3514  O  O     . ALA E 1 98  ? -6.729  -21.245 54.129 1.00 30.17  ? 98   ALA E O     1 
ATOM   3515  C  CB    . ALA E 1 98  ? -4.693  -20.669 51.695 1.00 29.24  ? 98   ALA E CB    1 
ATOM   3516  N  N     . TYR E 1 99  ? -6.346  -23.145 52.929 1.00 29.51  ? 99   TYR E N     1 
ATOM   3517  C  CA    . TYR E 1 99  ? -7.609  -23.819 53.299 1.00 29.39  ? 99   TYR E CA    1 
ATOM   3518  C  C     . TYR E 1 99  ? -7.616  -24.170 54.781 1.00 29.45  ? 99   TYR E C     1 
ATOM   3519  O  O     . TYR E 1 99  ? -8.608  -23.928 55.479 1.00 29.33  ? 99   TYR E O     1 
ATOM   3520  C  CB    . TYR E 1 99  ? -7.878  -25.082 52.442 1.00 29.60  ? 99   TYR E CB    1 
ATOM   3521  C  CG    . TYR E 1 99  ? -8.965  -26.017 52.944 1.00 29.38  ? 99   TYR E CG    1 
ATOM   3522  C  CD1   . TYR E 1 99  ? -10.305 -25.764 52.682 1.00 30.98  ? 99   TYR E CD1   1 
ATOM   3523  C  CD2   . TYR E 1 99  ? -8.647  -27.175 53.654 1.00 30.59  ? 99   TYR E CD2   1 
ATOM   3524  C  CE1   . TYR E 1 99  ? -11.315 -26.638 53.132 1.00 30.16  ? 99   TYR E CE1   1 
ATOM   3525  C  CE2   . TYR E 1 99  ? -9.652  -28.046 54.115 1.00 30.68  ? 99   TYR E CE2   1 
ATOM   3526  C  CZ    . TYR E 1 99  ? -10.980 -27.759 53.848 1.00 30.62  ? 99   TYR E CZ    1 
ATOM   3527  O  OH    . TYR E 1 99  ? -11.976 -28.593 54.296 1.00 31.08  ? 99   TYR E OH    1 
ATOM   3528  N  N     . LEU E 1 100 ? -6.514  -24.738 55.262 1.00 29.07  ? 100  LEU E N     1 
ATOM   3529  C  CA    . LEU E 1 100 ? -6.516  -25.261 56.606 1.00 28.96  ? 100  LEU E CA    1 
ATOM   3530  C  C     . LEU E 1 100 ? -6.605  -24.137 57.619 1.00 29.02  ? 100  LEU E C     1 
ATOM   3531  O  O     . LEU E 1 100 ? -7.397  -24.215 58.550 1.00 29.27  ? 100  LEU E O     1 
ATOM   3532  C  CB    . LEU E 1 100 ? -5.311  -26.171 56.849 1.00 29.48  ? 100  LEU E CB    1 
ATOM   3533  C  CG    . LEU E 1 100 ? -5.244  -27.566 56.177 1.00 29.37  ? 100  LEU E CG    1 
ATOM   3534  C  CD1   . LEU E 1 100 ? -3.921  -28.279 56.539 1.00 27.53  ? 100  LEU E CD1   1 
ATOM   3535  C  CD2   . LEU E 1 100 ? -6.447  -28.466 56.502 1.00 26.89  ? 100  LEU E CD2   1 
ATOM   3536  N  N     . VAL E 1 101 ? -5.832  -23.068 57.403 1.00 29.42  ? 101  VAL E N     1 
ATOM   3537  C  CA    . VAL E 1 101 ? -5.878  -21.837 58.243 1.00 28.68  ? 101  VAL E CA    1 
ATOM   3538  C  C     . VAL E 1 101 ? -7.290  -21.227 58.275 1.00 28.78  ? 101  VAL E C     1 
ATOM   3539  O  O     . VAL E 1 101 ? -7.805  -20.873 59.342 1.00 28.34  ? 101  VAL E O     1 
ATOM   3540  C  CB    . VAL E 1 101 ? -4.825  -20.781 57.775 1.00 28.83  ? 101  VAL E CB    1 
ATOM   3541  C  CG1   . VAL E 1 101 ? -4.993  -19.455 58.523 1.00 28.66  ? 101  VAL E CG1   1 
ATOM   3542  C  CG2   . VAL E 1 101 ? -3.378  -21.315 57.938 1.00 26.99  ? 101  VAL E CG2   1 
ATOM   3543  N  N     . ALA E 1 102 ? -7.933  -21.150 57.109 1.00 28.64  ? 102  ALA E N     1 
ATOM   3544  C  CA    . ALA E 1 102 ? -9.317  -20.702 57.059 1.00 28.73  ? 102  ALA E CA    1 
ATOM   3545  C  C     . ALA E 1 102 ? -10.202 -21.579 57.947 1.00 29.47  ? 102  ALA E C     1 
ATOM   3546  O  O     . ALA E 1 102 ? -10.968 -21.065 58.781 1.00 30.38  ? 102  ALA E O     1 
ATOM   3547  C  CB    . ALA E 1 102 ? -9.806  -20.734 55.673 1.00 28.73  ? 102  ALA E CB    1 
ATOM   3548  N  N     . LEU E 1 103 ? -10.085 -22.899 57.787 1.00 29.11  ? 103  LEU E N     1 
ATOM   3549  C  CA    . LEU E 1 103 ? -10.890 -23.830 58.548 1.00 28.76  ? 103  LEU E CA    1 
ATOM   3550  C  C     . LEU E 1 103 ? -10.689 -23.669 60.060 1.00 29.79  ? 103  LEU E C     1 
ATOM   3551  O  O     . LEU E 1 103 ? -11.646 -23.765 60.848 1.00 28.90  ? 103  LEU E O     1 
ATOM   3552  C  CB    . LEU E 1 103 ? -10.569 -25.239 58.114 1.00 28.40  ? 103  LEU E CB    1 
ATOM   3553  C  CG    . LEU E 1 103 ? -11.486 -26.312 58.665 1.00 27.75  ? 103  LEU E CG    1 
ATOM   3554  C  CD1   . LEU E 1 103 ? -12.893 -26.066 58.210 1.00 28.08  ? 103  LEU E CD1   1 
ATOM   3555  C  CD2   . LEU E 1 103 ? -11.010 -27.663 58.202 1.00 27.20  ? 103  LEU E CD2   1 
ATOM   3556  N  N     . PHE E 1 104 ? -9.448  -23.401 60.468 1.00 30.96  ? 104  PHE E N     1 
ATOM   3557  C  CA    . PHE E 1 104 ? -9.177  -23.218 61.889 1.00 31.96  ? 104  PHE E CA    1 
ATOM   3558  C  C     . PHE E 1 104 ? -9.830  -21.941 62.408 1.00 33.04  ? 104  PHE E C     1 
ATOM   3559  O  O     . PHE E 1 104 ? -10.431 -21.963 63.491 1.00 33.47  ? 104  PHE E O     1 
ATOM   3560  C  CB    . PHE E 1 104 ? -7.691  -23.234 62.185 1.00 31.55  ? 104  PHE E CB    1 
ATOM   3561  C  CG    . PHE E 1 104 ? -7.096  -24.606 62.216 1.00 31.54  ? 104  PHE E CG    1 
ATOM   3562  C  CD1   . PHE E 1 104 ? -5.976  -24.905 61.450 1.00 30.63  ? 104  PHE E CD1   1 
ATOM   3563  C  CD2   . PHE E 1 104 ? -7.637  -25.599 63.033 1.00 31.56  ? 104  PHE E CD2   1 
ATOM   3564  C  CE1   . PHE E 1 104 ? -5.412  -26.169 61.479 1.00 29.92  ? 104  PHE E CE1   1 
ATOM   3565  C  CE2   . PHE E 1 104 ? -7.080  -26.868 63.069 1.00 30.99  ? 104  PHE E CE2   1 
ATOM   3566  C  CZ    . PHE E 1 104 ? -5.964  -27.154 62.283 1.00 30.69  ? 104  PHE E CZ    1 
ATOM   3567  N  N     . GLU E 1 105 ? -9.739  -20.846 61.636 1.00 33.46  ? 105  GLU E N     1 
ATOM   3568  C  CA    . GLU E 1 105 ? -10.488 -19.626 61.966 1.00 33.81  ? 105  GLU E CA    1 
ATOM   3569  C  C     . GLU E 1 105 ? -11.932 -20.038 62.217 1.00 33.68  ? 105  GLU E C     1 
ATOM   3570  O  O     . GLU E 1 105 ? -12.444 -19.832 63.315 1.00 33.74  ? 105  GLU E O     1 
ATOM   3571  C  CB    . GLU E 1 105 ? -10.399 -18.553 60.862 1.00 33.48  ? 105  GLU E CB    1 
ATOM   3572  C  CG    . GLU E 1 105 ? -9.025  -17.867 60.732 1.00 35.06  ? 105  GLU E CG    1 
ATOM   3573  C  CD    . GLU E 1 105 ? -8.729  -17.323 59.322 1.00 34.90  ? 105  GLU E CD    1 
ATOM   3574  O  OE1   . GLU E 1 105 ? -9.692  -17.135 58.545 1.00 36.94  ? 105  GLU E OE1   1 
ATOM   3575  O  OE2   . GLU E 1 105 ? -7.533  -17.079 59.000 1.00 34.03  ? 105  GLU E OE2   1 
ATOM   3576  N  N     . ASP E 1 106 ? -12.574 -20.663 61.225 1.00 33.63  ? 106  ASP E N     1 
ATOM   3577  C  CA    . ASP E 1 106 ? -13.976 -21.056 61.374 1.00 33.96  ? 106  ASP E CA    1 
ATOM   3578  C  C     . ASP E 1 106 ? -14.179 -21.985 62.573 1.00 33.82  ? 106  ASP E C     1 
ATOM   3579  O  O     . ASP E 1 106 ? -15.149 -21.830 63.315 1.00 33.50  ? 106  ASP E O     1 
ATOM   3580  C  CB    . ASP E 1 106 ? -14.510 -21.692 60.090 1.00 34.26  ? 106  ASP E CB    1 
ATOM   3581  C  CG    . ASP E 1 106 ? -14.698 -20.690 58.989 1.00 36.04  ? 106  ASP E CG    1 
ATOM   3582  O  OD1   . ASP E 1 106 ? -14.509 -19.495 59.282 1.00 38.51  ? 106  ASP E OD1   1 
ATOM   3583  O  OD2   . ASP E 1 106 ? -15.030 -21.073 57.834 1.00 38.79  ? 106  ASP E OD2   1 
ATOM   3584  N  N     . THR E 1 107 ? -13.248 -22.932 62.755 1.00 33.74  ? 107  THR E N     1 
ATOM   3585  C  CA    . THR E 1 107 ? -13.273 -23.884 63.878 1.00 33.48  ? 107  THR E CA    1 
ATOM   3586  C  C     . THR E 1 107 ? -13.229 -23.149 65.210 1.00 32.96  ? 107  THR E C     1 
ATOM   3587  O  O     . THR E 1 107 ? -14.028 -23.415 66.097 1.00 33.53  ? 107  THR E O     1 
ATOM   3588  C  CB    . THR E 1 107 ? -12.078 -24.853 63.847 1.00 33.39  ? 107  THR E CB    1 
ATOM   3589  O  OG1   . THR E 1 107 ? -12.013 -25.510 62.579 1.00 34.83  ? 107  THR E OG1   1 
ATOM   3590  C  CG2   . THR E 1 107 ? -12.231 -25.894 64.892 1.00 32.81  ? 107  THR E CG2   1 
ATOM   3591  N  N     . ASN E 1 108 ? -12.291 -22.223 65.335 1.00 32.06  ? 108  ASN E N     1 
ATOM   3592  C  CA    . ASN E 1 108 ? -12.127 -21.441 66.544 1.00 31.23  ? 108  ASN E CA    1 
ATOM   3593  C  C     . ASN E 1 108 ? -13.433 -20.771 66.961 1.00 31.09  ? 108  ASN E C     1 
ATOM   3594  O  O     . ASN E 1 108 ? -13.821 -20.786 68.141 1.00 30.23  ? 108  ASN E O     1 
ATOM   3595  C  CB    . ASN E 1 108 ? -11.053 -20.386 66.311 1.00 30.79  ? 108  ASN E CB    1 
ATOM   3596  C  CG    . ASN E 1 108 ? -10.309 -20.045 67.555 1.00 30.29  ? 108  ASN E CG    1 
ATOM   3597  O  OD1   . ASN E 1 108 ? -10.562 -20.606 68.613 1.00 32.01  ? 108  ASN E OD1   1 
ATOM   3598  N  ND2   . ASN E 1 108 ? -9.374  -19.130 67.446 1.00 30.42  ? 108  ASN E ND2   1 
ATOM   3599  N  N     . LEU E 1 109 ? -14.108 -20.196 65.967 1.00 31.24  ? 109  LEU E N     1 
ATOM   3600  C  CA    . LEU E 1 109 ? -15.370 -19.524 66.181 1.00 31.59  ? 109  LEU E CA    1 
ATOM   3601  C  C     . LEU E 1 109 ? -16.418 -20.499 66.677 1.00 32.27  ? 109  LEU E C     1 
ATOM   3602  O  O     . LEU E 1 109 ? -17.240 -20.138 67.517 1.00 32.60  ? 109  LEU E O     1 
ATOM   3603  C  CB    . LEU E 1 109 ? -15.853 -18.870 64.905 1.00 31.21  ? 109  LEU E CB    1 
ATOM   3604  C  CG    . LEU E 1 109 ? -15.224 -17.570 64.433 1.00 30.80  ? 109  LEU E CG    1 
ATOM   3605  C  CD1   . LEU E 1 109 ? -16.125 -17.009 63.333 1.00 30.72  ? 109  LEU E CD1   1 
ATOM   3606  C  CD2   . LEU E 1 109 ? -15.087 -16.568 65.554 1.00 29.28  ? 109  LEU E CD2   1 
ATOM   3607  N  N     . CYS E 1 110 ? -16.381 -21.733 66.166 1.00 32.66  ? 110  CYS E N     1 
ATOM   3608  C  CA    . CYS E 1 110 ? -17.265 -22.774 66.664 1.00 33.21  ? 110  CYS E CA    1 
ATOM   3609  C  C     . CYS E 1 110 ? -17.036 -23.118 68.159 1.00 33.62  ? 110  CYS E C     1 
ATOM   3610  O  O     . CYS E 1 110 ? -17.996 -23.245 68.919 1.00 33.44  ? 110  CYS E O     1 
ATOM   3611  C  CB    . CYS E 1 110 ? -17.187 -24.004 65.777 1.00 32.81  ? 110  CYS E CB    1 
ATOM   3612  S  SG    . CYS E 1 110 ? -18.043 -23.812 64.181 1.00 34.58  ? 110  CYS E SG    1 
ATOM   3613  N  N     . ALA E 1 111 ? -15.777 -23.256 68.573 1.00 33.96  ? 111  ALA E N     1 
ATOM   3614  C  CA    . ALA E 1 111 ? -15.461 -23.558 69.956 1.00 34.51  ? 111  ALA E CA    1 
ATOM   3615  C  C     . ALA E 1 111 ? -16.007 -22.464 70.852 1.00 35.53  ? 111  ALA E C     1 
ATOM   3616  O  O     . ALA E 1 111 ? -16.750 -22.720 71.799 1.00 35.99  ? 111  ALA E O     1 
ATOM   3617  C  CB    . ALA E 1 111 ? -13.985 -23.668 70.133 1.00 34.42  ? 111  ALA E CB    1 
ATOM   3618  N  N     . ILE E 1 112 ? -15.640 -21.230 70.536 1.00 36.24  ? 112  ILE E N     1 
ATOM   3619  C  CA    . ILE E 1 112 ? -16.051 -20.083 71.312 1.00 36.27  ? 112  ILE E CA    1 
ATOM   3620  C  C     . ILE E 1 112 ? -17.552 -20.012 71.342 1.00 37.13  ? 112  ILE E C     1 
ATOM   3621  O  O     . ILE E 1 112 ? -18.135 -19.670 72.364 1.00 38.38  ? 112  ILE E O     1 
ATOM   3622  C  CB    . ILE E 1 112 ? -15.479 -18.798 70.725 1.00 36.02  ? 112  ILE E CB    1 
ATOM   3623  C  CG1   . ILE E 1 112 ? -13.972 -18.784 70.946 1.00 36.18  ? 112  ILE E CG1   1 
ATOM   3624  C  CG2   . ILE E 1 112 ? -16.134 -17.578 71.343 1.00 35.00  ? 112  ILE E CG2   1 
ATOM   3625  C  CD1   . ILE E 1 112 ? -13.213 -18.035 69.891 1.00 37.96  ? 112  ILE E CD1   1 
ATOM   3626  N  N     . HIS E 1 113 ? -18.207 -20.345 70.238 1.00 37.71  ? 113  HIS E N     1 
ATOM   3627  C  CA    . HIS E 1 113 ? -19.658 -20.351 70.268 1.00 37.92  ? 113  HIS E CA    1 
ATOM   3628  C  C     . HIS E 1 113 ? -20.120 -21.281 71.378 1.00 38.36  ? 113  HIS E C     1 
ATOM   3629  O  O     . HIS E 1 113 ? -21.113 -21.008 72.030 1.00 38.83  ? 113  HIS E O     1 
ATOM   3630  C  CB    . HIS E 1 113 ? -20.218 -20.794 68.946 1.00 37.79  ? 113  HIS E CB    1 
ATOM   3631  C  CG    . HIS E 1 113 ? -21.700 -20.709 68.873 1.00 38.25  ? 113  HIS E CG    1 
ATOM   3632  N  ND1   . HIS E 1 113 ? -22.376 -19.511 68.931 1.00 39.73  ? 113  HIS E ND1   1 
ATOM   3633  C  CD2   . HIS E 1 113 ? -22.641 -21.668 68.718 1.00 39.25  ? 113  HIS E CD2   1 
ATOM   3634  C  CE1   . HIS E 1 113 ? -23.673 -19.734 68.819 1.00 39.77  ? 113  HIS E CE1   1 
ATOM   3635  N  NE2   . HIS E 1 113 ? -23.861 -21.035 68.688 1.00 40.41  ? 113  HIS E NE2   1 
ATOM   3636  N  N     . ALA E 1 114 ? -19.356 -22.352 71.606 1.00 38.78  ? 114  ALA E N     1 
ATOM   3637  C  CA    . ALA E 1 114 ? -19.615 -23.340 72.657 1.00 39.11  ? 114  ALA E CA    1 
ATOM   3638  C  C     . ALA E 1 114 ? -19.091 -22.922 74.043 1.00 39.46  ? 114  ALA E C     1 
ATOM   3639  O  O     . ALA E 1 114 ? -19.069 -23.733 74.983 1.00 39.22  ? 114  ALA E O     1 
ATOM   3640  C  CB    . ALA E 1 114 ? -19.009 -24.677 72.259 1.00 39.10  ? 114  ALA E CB    1 
ATOM   3641  N  N     . LYS E 1 115 ? -18.659 -21.665 74.164 1.00 39.59  ? 115  LYS E N     1 
ATOM   3642  C  CA    . LYS E 1 115 ? -18.095 -21.149 75.412 1.00 39.44  ? 115  LYS E CA    1 
ATOM   3643  C  C     . LYS E 1 115 ? -16.854 -21.941 75.840 1.00 38.99  ? 115  LYS E C     1 
ATOM   3644  O  O     . LYS E 1 115 ? -16.612 -22.145 77.020 1.00 39.03  ? 115  LYS E O     1 
ATOM   3645  C  CB    . LYS E 1 115 ? -19.158 -21.136 76.516 1.00 39.39  ? 115  LYS E CB    1 
ATOM   3646  C  CG    . LYS E 1 115 ? -20.223 -20.095 76.288 1.00 41.42  ? 115  LYS E CG    1 
ATOM   3647  C  CD    . LYS E 1 115 ? -21.430 -20.352 77.140 1.00 45.26  ? 115  LYS E CD    1 
ATOM   3648  C  CE    . LYS E 1 115 ? -22.364 -19.161 77.136 1.00 47.61  ? 115  LYS E CE    1 
ATOM   3649  N  NZ    . LYS E 1 115 ? -23.543 -19.453 78.024 1.00 51.42  ? 115  LYS E NZ    1 
ATOM   3650  N  N     . ARG E 1 116 ? -16.075 -22.383 74.862 1.00 38.41  ? 116  ARG E N     1 
ATOM   3651  C  CA    . ARG E 1 116 ? -14.822 -23.067 75.113 1.00 37.61  ? 116  ARG E CA    1 
ATOM   3652  C  C     . ARG E 1 116 ? -13.735 -22.214 74.521 1.00 37.87  ? 116  ARG E C     1 
ATOM   3653  O  O     . ARG E 1 116 ? -14.016 -21.254 73.802 1.00 38.66  ? 116  ARG E O     1 
ATOM   3654  C  CB    . ARG E 1 116 ? -14.821 -24.448 74.443 1.00 37.35  ? 116  ARG E CB    1 
ATOM   3655  C  CG    . ARG E 1 116 ? -15.631 -25.497 75.192 1.00 35.62  ? 116  ARG E CG    1 
ATOM   3656  C  CD    . ARG E 1 116 ? -15.469 -26.865 74.586 1.00 33.23  ? 116  ARG E CD    1 
ATOM   3657  N  NE    . ARG E 1 116 ? -16.388 -27.111 73.473 1.00 31.50  ? 116  ARG E NE    1 
ATOM   3658  C  CZ    . ARG E 1 116 ? -16.074 -27.053 72.177 1.00 28.83  ? 116  ARG E CZ    1 
ATOM   3659  N  NH1   . ARG E 1 116 ? -14.851 -26.739 71.767 1.00 24.65  ? 116  ARG E NH1   1 
ATOM   3660  N  NH2   . ARG E 1 116 ? -17.015 -27.311 71.280 1.00 29.33  ? 116  ARG E NH2   1 
ATOM   3661  N  N     . VAL E 1 117 ? -12.486 -22.542 74.822 1.00 37.89  ? 117  VAL E N     1 
ATOM   3662  C  CA    . VAL E 1 117 ? -11.362 -21.919 74.130 1.00 37.53  ? 117  VAL E CA    1 
ATOM   3663  C  C     . VAL E 1 117 ? -10.484 -23.000 73.486 1.00 38.06  ? 117  VAL E C     1 
ATOM   3664  O  O     . VAL E 1 117 ? -9.442  -22.699 72.903 1.00 38.14  ? 117  VAL E O     1 
ATOM   3665  C  CB    . VAL E 1 117 ? -10.555 -20.971 75.057 1.00 37.05  ? 117  VAL E CB    1 
ATOM   3666  C  CG1   . VAL E 1 117 ? -11.446 -19.883 75.589 1.00 36.66  ? 117  VAL E CG1   1 
ATOM   3667  C  CG2   . VAL E 1 117 ? -9.933  -21.719 76.205 1.00 36.12  ? 117  VAL E CG2   1 
ATOM   3668  N  N     . THR E 1 118 ? -10.925 -24.254 73.603 1.00 38.58  ? 118  THR E N     1 
ATOM   3669  C  CA    . THR E 1 118 ? -10.243 -25.404 73.021 1.00 39.11  ? 118  THR E CA    1 
ATOM   3670  C  C     . THR E 1 118 ? -11.017 -25.937 71.824 1.00 39.20  ? 118  THR E C     1 
ATOM   3671  O  O     . THR E 1 118 ? -12.133 -26.440 71.985 1.00 39.54  ? 118  THR E O     1 
ATOM   3672  C  CB    . THR E 1 118 ? -10.173 -26.564 74.029 1.00 39.26  ? 118  THR E CB    1 
ATOM   3673  O  OG1   . THR E 1 118 ? -9.780  -26.067 75.314 1.00 41.17  ? 118  THR E OG1   1 
ATOM   3674  C  CG2   . THR E 1 118 ? -9.183  -27.625 73.564 1.00 38.56  ? 118  THR E CG2   1 
ATOM   3675  N  N     . ILE E 1 119 ? -10.433 -25.852 70.633 1.00 38.88  ? 119  ILE E N     1 
ATOM   3676  C  CA    . ILE E 1 119 ? -11.027 -26.514 69.474 1.00 38.71  ? 119  ILE E CA    1 
ATOM   3677  C  C     . ILE E 1 119 ? -10.984 -28.038 69.643 1.00 38.79  ? 119  ILE E C     1 
ATOM   3678  O  O     . ILE E 1 119 ? -10.028 -28.578 70.194 1.00 38.37  ? 119  ILE E O     1 
ATOM   3679  C  CB    . ILE E 1 119 ? -10.356 -26.100 68.144 1.00 38.55  ? 119  ILE E CB    1 
ATOM   3680  C  CG1   . ILE E 1 119 ? -8.886  -26.537 68.104 1.00 38.66  ? 119  ILE E CG1   1 
ATOM   3681  C  CG2   . ILE E 1 119 ? -10.505 -24.601 67.933 1.00 39.10  ? 119  ILE E CG2   1 
ATOM   3682  C  CD1   . ILE E 1 119 ? -8.219  -26.436 66.746 1.00 38.39  ? 119  ILE E CD1   1 
ATOM   3683  N  N     . MET E 1 120 ? -12.044 -28.708 69.193 1.00 39.03  ? 120  MET E N     1 
ATOM   3684  C  CA    . MET E 1 120 ? -12.138 -30.178 69.197 1.00 39.36  ? 120  MET E CA    1 
ATOM   3685  C  C     . MET E 1 120 ? -12.798 -30.614 67.878 1.00 39.50  ? 120  MET E C     1 
ATOM   3686  O  O     . MET E 1 120 ? -13.415 -29.790 67.188 1.00 39.73  ? 120  MET E O     1 
ATOM   3687  C  CB    . MET E 1 120 ? -12.936 -30.706 70.405 1.00 38.71  ? 120  MET E CB    1 
ATOM   3688  C  CG    . MET E 1 120 ? -13.220 -29.677 71.458 1.00 38.52  ? 120  MET E CG    1 
ATOM   3689  S  SD    . MET E 1 120 ? -13.917 -30.150 73.055 1.00 40.72  ? 120  MET E SD    1 
ATOM   3690  C  CE    . MET E 1 120 ? -14.864 -31.668 72.765 1.00 37.44  ? 120  MET E CE    1 
ATOM   3691  N  N     . PRO E 1 121 ? -12.657 -31.901 67.506 1.00 39.48  ? 121  PRO E N     1 
ATOM   3692  C  CA    . PRO E 1 121 ? -13.248 -32.368 66.265 1.00 39.25  ? 121  PRO E CA    1 
ATOM   3693  C  C     . PRO E 1 121 ? -14.698 -31.923 66.009 1.00 39.40  ? 121  PRO E C     1 
ATOM   3694  O  O     . PRO E 1 121 ? -15.029 -31.613 64.854 1.00 40.12  ? 121  PRO E O     1 
ATOM   3695  C  CB    . PRO E 1 121 ? -13.132 -33.884 66.391 1.00 39.29  ? 121  PRO E CB    1 
ATOM   3696  C  CG    . PRO E 1 121 ? -11.859 -34.061 67.129 1.00 39.29  ? 121  PRO E CG    1 
ATOM   3697  C  CD    . PRO E 1 121 ? -11.922 -32.989 68.183 1.00 39.57  ? 121  PRO E CD    1 
ATOM   3698  N  N     . LYS E 1 122 ? -15.556 -31.883 67.031 1.00 38.80  ? 122  LYS E N     1 
ATOM   3699  C  CA    . LYS E 1 122 ? -16.936 -31.441 66.790 1.00 38.94  ? 122  LYS E CA    1 
ATOM   3700  C  C     . LYS E 1 122 ? -16.945 -30.035 66.203 1.00 38.27  ? 122  LYS E C     1 
ATOM   3701  O  O     . LYS E 1 122 ? -17.731 -29.751 65.304 1.00 38.58  ? 122  LYS E O     1 
ATOM   3702  C  CB    . LYS E 1 122 ? -17.872 -31.567 68.023 1.00 38.77  ? 122  LYS E CB    1 
ATOM   3703  C  CG    . LYS E 1 122 ? -17.416 -30.888 69.302 1.00 39.74  ? 122  LYS E CG    1 
ATOM   3704  C  CD    . LYS E 1 122 ? -18.113 -31.460 70.531 1.00 40.64  ? 122  LYS E CD    1 
ATOM   3705  C  CE    . LYS E 1 122 ? -19.274 -30.574 70.979 1.00 46.39  ? 122  LYS E CE    1 
ATOM   3706  N  NZ    . LYS E 1 122 ? -20.131 -31.149 72.077 1.00 48.57  ? 122  LYS E NZ    1 
ATOM   3707  N  N     . ASP E 1 123 ? -16.042 -29.178 66.679 1.00 37.71  ? 123  ASP E N     1 
ATOM   3708  C  CA    . ASP E 1 123 ? -15.910 -27.824 66.144 1.00 37.05  ? 123  ASP E CA    1 
ATOM   3709  C  C     . ASP E 1 123 ? -15.570 -27.880 64.659 1.00 37.33  ? 123  ASP E C     1 
ATOM   3710  O  O     . ASP E 1 123 ? -16.137 -27.135 63.872 1.00 37.54  ? 123  ASP E O     1 
ATOM   3711  C  CB    . ASP E 1 123 ? -14.854 -27.003 66.900 1.00 36.52  ? 123  ASP E CB    1 
ATOM   3712  C  CG    . ASP E 1 123 ? -15.142 -26.876 68.398 1.00 35.53  ? 123  ASP E CG    1 
ATOM   3713  O  OD1   . ASP E 1 123 ? -16.302 -26.623 68.788 1.00 32.73  ? 123  ASP E OD1   1 
ATOM   3714  O  OD2   . ASP E 1 123 ? -14.187 -27.021 69.193 1.00 34.08  ? 123  ASP E OD2   1 
ATOM   3715  N  N     . ILE E 1 124 ? -14.662 -28.770 64.264 1.00 37.63  ? 124  ILE E N     1 
ATOM   3716  C  CA    . ILE E 1 124 ? -14.287 -28.866 62.848 1.00 37.63  ? 124  ILE E CA    1 
ATOM   3717  C  C     . ILE E 1 124 ? -15.490 -29.331 62.051 1.00 38.25  ? 124  ILE E C     1 
ATOM   3718  O  O     . ILE E 1 124 ? -15.767 -28.824 60.968 1.00 38.22  ? 124  ILE E O     1 
ATOM   3719  C  CB    . ILE E 1 124 ? -13.098 -29.841 62.596 1.00 37.40  ? 124  ILE E CB    1 
ATOM   3720  C  CG1   . ILE E 1 124 ? -11.807 -29.309 63.227 1.00 36.30  ? 124  ILE E CG1   1 
ATOM   3721  C  CG2   . ILE E 1 124 ? -12.880 -30.064 61.103 1.00 36.63  ? 124  ILE E CG2   1 
ATOM   3722  C  CD1   . ILE E 1 124 ? -10.576 -30.066 62.812 1.00 32.97  ? 124  ILE E CD1   1 
ATOM   3723  N  N     . GLN E 1 125 ? -16.216 -30.295 62.601 1.00 38.98  ? 125  GLN E N     1 
ATOM   3724  C  CA    . GLN E 1 125 ? -17.262 -30.952 61.837 1.00 39.43  ? 125  GLN E CA    1 
ATOM   3725  C  C     . GLN E 1 125 ? -18.445 -30.029 61.637 1.00 39.40  ? 125  GLN E C     1 
ATOM   3726  O  O     . GLN E 1 125 ? -19.110 -30.103 60.609 1.00 39.99  ? 125  GLN E O     1 
ATOM   3727  C  CB    . GLN E 1 125 ? -17.670 -32.263 62.489 1.00 39.34  ? 125  GLN E CB    1 
ATOM   3728  C  CG    . GLN E 1 125 ? -16.529 -33.240 62.558 1.00 40.75  ? 125  GLN E CG    1 
ATOM   3729  C  CD    . GLN E 1 125 ? -16.774 -34.341 63.557 1.00 43.38  ? 125  GLN E CD    1 
ATOM   3730  O  OE1   . GLN E 1 125 ? -17.927 -34.637 63.902 1.00 44.31  ? 125  GLN E OE1   1 
ATOM   3731  N  NE2   . GLN E 1 125 ? -15.689 -34.970 64.027 1.00 42.65  ? 125  GLN E NE2   1 
ATOM   3732  N  N     . LEU E 1 126 ? -18.693 -29.148 62.599 1.00 39.15  ? 126  LEU E N     1 
ATOM   3733  C  CA    . LEU E 1 126 ? -19.761 -28.178 62.448 1.00 39.21  ? 126  LEU E CA    1 
ATOM   3734  C  C     . LEU E 1 126 ? -19.381 -27.194 61.353 1.00 39.41  ? 126  LEU E C     1 
ATOM   3735  O  O     . LEU E 1 126 ? -20.195 -26.883 60.487 1.00 39.42  ? 126  LEU E O     1 
ATOM   3736  C  CB    . LEU E 1 126 ? -20.048 -27.452 63.765 1.00 39.20  ? 126  LEU E CB    1 
ATOM   3737  C  CG    . LEU E 1 126 ? -21.265 -26.526 63.758 1.00 39.21  ? 126  LEU E CG    1 
ATOM   3738  C  CD1   . LEU E 1 126 ? -22.561 -27.305 63.627 1.00 39.83  ? 126  LEU E CD1   1 
ATOM   3739  C  CD2   . LEU E 1 126 ? -21.314 -25.695 65.014 1.00 39.18  ? 126  LEU E CD2   1 
ATOM   3740  N  N     . ALA E 1 127 ? -18.132 -26.730 61.379 1.00 39.58  ? 127  ALA E N     1 
ATOM   3741  C  CA    . ALA E 1 127 ? -17.651 -25.769 60.393 1.00 39.86  ? 127  ALA E CA    1 
ATOM   3742  C  C     . ALA E 1 127 ? -17.846 -26.310 58.997 1.00 40.37  ? 127  ALA E C     1 
ATOM   3743  O  O     . ALA E 1 127 ? -18.436 -25.649 58.131 1.00 40.57  ? 127  ALA E O     1 
ATOM   3744  C  CB    . ALA E 1 127 ? -16.208 -25.457 60.621 1.00 39.92  ? 127  ALA E CB    1 
ATOM   3745  N  N     . ARG E 1 128 ? -17.361 -27.531 58.792 1.00 40.84  ? 128  ARG E N     1 
ATOM   3746  C  CA    . ARG E 1 128 ? -17.454 -28.185 57.503 1.00 40.86  ? 128  ARG E CA    1 
ATOM   3747  C  C     . ARG E 1 128 ? -18.900 -28.498 57.126 1.00 41.47  ? 128  ARG E C     1 
ATOM   3748  O  O     . ARG E 1 128 ? -19.224 -28.534 55.942 1.00 41.70  ? 128  ARG E O     1 
ATOM   3749  C  CB    . ARG E 1 128 ? -16.582 -29.424 57.463 1.00 40.38  ? 128  ARG E CB    1 
ATOM   3750  C  CG    . ARG E 1 128 ? -15.103 -29.133 57.650 1.00 40.08  ? 128  ARG E CG    1 
ATOM   3751  C  CD    . ARG E 1 128 ? -14.261 -29.976 56.702 1.00 41.41  ? 128  ARG E CD    1 
ATOM   3752  N  NE    . ARG E 1 128 ? -14.534 -31.407 56.852 1.00 43.42  ? 128  ARG E NE    1 
ATOM   3753  C  CZ    . ARG E 1 128 ? -14.539 -32.288 55.860 1.00 44.31  ? 128  ARG E CZ    1 
ATOM   3754  N  NH1   . ARG E 1 128 ? -14.290 -31.921 54.612 1.00 44.68  ? 128  ARG E NH1   1 
ATOM   3755  N  NH2   . ARG E 1 128 ? -14.808 -33.550 56.123 1.00 47.21  ? 128  ARG E NH2   1 
ATOM   3756  N  N     . ARG E 1 129 ? -19.778 -28.698 58.107 1.00 42.02  ? 129  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1 129 ? -21.190 -28.886 57.772 1.00 43.08  ? 129  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1 129 ? -21.791 -27.588 57.243 1.00 43.12  ? 129  ARG E C     1 
ATOM   3759  O  O     . ARG E 1 129 ? -22.402 -27.570 56.183 1.00 42.95  ? 129  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1 129 ? -21.997 -29.424 58.948 1.00 43.29  ? 129  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1 129 ? -23.413 -29.825 58.572 1.00 46.64  ? 129  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1 129 ? -23.864 -31.037 59.391 1.00 52.93  ? 129  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1 129 ? -25.204 -31.511 59.010 1.00 57.45  ? 129  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1 129 ? -25.934 -32.378 59.724 1.00 59.87  ? 129  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1 129 ? -25.466 -32.871 60.871 1.00 60.05  ? 129  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1 129 ? -27.145 -32.749 59.297 1.00 60.70  ? 129  ARG E NH2   1 
ATOM   3767  N  N     . ILE E 1 130 ? -21.581 -26.496 57.970 1.00 43.52  ? 130  ILE E N     1 
ATOM   3768  C  CA    . ILE E 1 130 ? -22.140 -25.220 57.572 1.00 43.76  ? 130  ILE E CA    1 
ATOM   3769  C  C     . ILE E 1 130 ? -21.567 -24.767 56.233 1.00 44.16  ? 130  ILE E C     1 
ATOM   3770  O  O     . ILE E 1 130 ? -22.317 -24.284 55.381 1.00 44.84  ? 130  ILE E O     1 
ATOM   3771  C  CB    . ILE E 1 130 ? -21.980 -24.163 58.660 1.00 43.83  ? 130  ILE E CB    1 
ATOM   3772  C  CG1   . ILE E 1 130 ? -22.647 -24.673 59.949 1.00 45.24  ? 130  ILE E CG1   1 
ATOM   3773  C  CG2   . ILE E 1 130 ? -22.601 -22.855 58.219 1.00 42.23  ? 130  ILE E CG2   1 
ATOM   3774  C  CD1   . ILE E 1 130 ? -22.663 -23.691 61.113 1.00 45.54  ? 130  ILE E CD1   1 
ATOM   3775  N  N     . ARG E 1 131 ? -20.265 -24.965 56.025 1.00 44.15  ? 131  ARG E N     1 
ATOM   3776  C  CA    . ARG E 1 131 ? -19.641 -24.707 54.717 1.00 43.96  ? 131  ARG E CA    1 
ATOM   3777  C  C     . ARG E 1 131 ? -20.207 -25.576 53.573 1.00 44.49  ? 131  ARG E C     1 
ATOM   3778  O  O     . ARG E 1 131 ? -19.900 -25.338 52.413 1.00 44.58  ? 131  ARG E O     1 
ATOM   3779  C  CB    . ARG E 1 131 ? -18.145 -24.957 54.793 1.00 43.54  ? 131  ARG E CB    1 
ATOM   3780  C  CG    . ARG E 1 131 ? -17.369 -24.063 55.707 1.00 41.83  ? 131  ARG E CG    1 
ATOM   3781  C  CD    . ARG E 1 131 ? -15.974 -24.622 55.803 1.00 38.92  ? 131  ARG E CD    1 
ATOM   3782  N  NE    . ARG E 1 131 ? -14.979 -23.647 56.214 1.00 36.72  ? 131  ARG E NE    1 
ATOM   3783  C  CZ    . ARG E 1 131 ? -13.752 -23.601 55.712 1.00 37.78  ? 131  ARG E CZ    1 
ATOM   3784  N  NH1   . ARG E 1 131 ? -13.397 -24.456 54.762 1.00 37.42  ? 131  ARG E NH1   1 
ATOM   3785  N  NH2   . ARG E 1 131 ? -12.885 -22.688 56.134 1.00 38.17  ? 131  ARG E NH2   1 
ATOM   3786  N  N     . GLY E 1 132 ? -21.009 -26.587 53.898 1.00 44.93  ? 132  GLY E N     1 
ATOM   3787  C  CA    . GLY E 1 132 ? -21.503 -27.522 52.888 1.00 46.07  ? 132  GLY E CA    1 
ATOM   3788  C  C     . GLY E 1 132 ? -20.448 -28.447 52.294 1.00 47.01  ? 132  GLY E C     1 
ATOM   3789  O  O     . GLY E 1 132 ? -20.536 -28.841 51.139 1.00 46.87  ? 132  GLY E O     1 
ATOM   3790  N  N     . GLU E 1 133 ? -19.436 -28.788 53.083 1.00 48.20  ? 133  GLU E N     1 
ATOM   3791  C  CA    . GLU E 1 133 ? -18.456 -29.786 52.679 1.00 49.07  ? 133  GLU E CA    1 
ATOM   3792  C  C     . GLU E 1 133 ? -18.972 -31.196 53.004 1.00 50.30  ? 133  GLU E C     1 
ATOM   3793  O  O     . GLU E 1 133 ? -19.133 -32.024 52.093 1.00 50.80  ? 133  GLU E O     1 
ATOM   3794  C  CB    . GLU E 1 133 ? -17.086 -29.496 53.307 1.00 48.84  ? 133  GLU E CB    1 
ATOM   3795  C  CG    . GLU E 1 133 ? -16.516 -28.140 52.871 1.00 48.44  ? 133  GLU E CG    1 
ATOM   3796  C  CD    . GLU E 1 133 ? -15.151 -27.794 53.463 1.00 48.38  ? 133  GLU E CD    1 
ATOM   3797  O  OE1   . GLU E 1 133 ? -14.486 -28.685 54.030 1.00 48.20  ? 133  GLU E OE1   1 
ATOM   3798  O  OE2   . GLU E 1 133 ? -14.740 -26.616 53.354 1.00 46.95  ? 133  GLU E OE2   1 
ATOM   3799  N  N     . LYS F 2 16  ? 14.495  -46.716 33.836 1.00 87.04  ? 16   LYS F N     1 
ATOM   3800  C  CA    . LYS F 2 16  ? 14.221  -46.581 35.303 1.00 87.08  ? 16   LYS F CA    1 
ATOM   3801  C  C     . LYS F 2 16  ? 14.225  -47.939 36.041 1.00 86.77  ? 16   LYS F C     1 
ATOM   3802  O  O     . LYS F 2 16  ? 13.995  -48.997 35.427 1.00 86.73  ? 16   LYS F O     1 
ATOM   3803  C  CB    . LYS F 2 16  ? 12.906  -45.810 35.551 1.00 87.20  ? 16   LYS F CB    1 
ATOM   3804  C  CG    . LYS F 2 16  ? 11.622  -46.586 35.221 1.00 87.65  ? 16   LYS F CG    1 
ATOM   3805  C  CD    . LYS F 2 16  ? 10.528  -46.277 36.233 1.00 87.86  ? 16   LYS F CD    1 
ATOM   3806  C  CE    . LYS F 2 16  ? 9.781   -47.538 36.644 1.00 87.62  ? 16   LYS F CE    1 
ATOM   3807  N  NZ    . LYS F 2 16  ? 9.246   -47.417 38.035 1.00 87.28  ? 16   LYS F NZ    1 
ATOM   3808  N  N     . ARG F 2 17  ? 14.497  -47.894 37.351 1.00 86.16  ? 17   ARG F N     1 
ATOM   3809  C  CA    . ARG F 2 17  ? 14.573  -49.106 38.192 1.00 85.32  ? 17   ARG F CA    1 
ATOM   3810  C  C     . ARG F 2 17  ? 14.110  -48.902 39.638 1.00 84.25  ? 17   ARG F C     1 
ATOM   3811  O  O     . ARG F 2 17  ? 14.746  -48.170 40.405 1.00 84.27  ? 17   ARG F O     1 
ATOM   3812  C  CB    . ARG F 2 17  ? 15.986  -49.700 38.184 1.00 85.45  ? 17   ARG F CB    1 
ATOM   3813  C  CG    . ARG F 2 17  ? 16.224  -50.689 37.067 1.00 86.63  ? 17   ARG F CG    1 
ATOM   3814  C  CD    . ARG F 2 17  ? 17.428  -51.553 37.365 1.00 88.95  ? 17   ARG F CD    1 
ATOM   3815  N  NE    . ARG F 2 17  ? 17.871  -52.290 36.182 1.00 90.91  ? 17   ARG F NE    1 
ATOM   3816  C  CZ    . ARG F 2 17  ? 18.933  -53.094 36.144 1.00 92.22  ? 17   ARG F CZ    1 
ATOM   3817  N  NH1   . ARG F 2 17  ? 19.681  -53.279 37.231 1.00 92.62  ? 17   ARG F NH1   1 
ATOM   3818  N  NH2   . ARG F 2 17  ? 19.249  -53.720 35.015 1.00 92.55  ? 17   ARG F NH2   1 
ATOM   3819  N  N     . HIS F 2 18  ? 13.026  -49.595 39.992 1.00 82.81  ? 18   HIS F N     1 
ATOM   3820  C  CA    . HIS F 2 18  ? 12.389  -49.565 41.323 1.00 81.34  ? 18   HIS F CA    1 
ATOM   3821  C  C     . HIS F 2 18  ? 12.041  -48.158 41.794 1.00 79.48  ? 18   HIS F C     1 
ATOM   3822  O  O     . HIS F 2 18  ? 12.925  -47.418 42.233 1.00 79.59  ? 18   HIS F O     1 
ATOM   3823  C  CB    . HIS F 2 18  ? 13.224  -50.252 42.441 1.00 81.91  ? 18   HIS F CB    1 
ATOM   3824  C  CG    . HIS F 2 18  ? 14.345  -51.128 41.960 1.00 83.48  ? 18   HIS F CG    1 
ATOM   3825  N  ND1   . HIS F 2 18  ? 14.204  -52.488 41.777 1.00 85.27  ? 18   HIS F ND1   1 
ATOM   3826  C  CD2   . HIS F 2 18  ? 15.644  -50.846 41.682 1.00 84.93  ? 18   HIS F CD2   1 
ATOM   3827  C  CE1   . HIS F 2 18  ? 15.358  -53.002 41.378 1.00 85.73  ? 18   HIS F CE1   1 
ATOM   3828  N  NE2   . HIS F 2 18  ? 16.246  -52.026 41.308 1.00 85.53  ? 18   HIS F NE2   1 
ATOM   3829  N  N     . ARG F 2 19  ? 10.764  -47.790 41.733 1.00 77.13  ? 19   ARG F N     1 
ATOM   3830  C  CA    . ARG F 2 19  ? 10.316  -46.571 42.420 1.00 74.72  ? 19   ARG F CA    1 
ATOM   3831  C  C     . ARG F 2 19  ? 9.841   -46.955 43.821 1.00 72.32  ? 19   ARG F C     1 
ATOM   3832  O  O     . ARG F 2 19  ? 8.806   -47.613 43.966 1.00 72.39  ? 19   ARG F O     1 
ATOM   3833  C  CB    . ARG F 2 19  ? 9.207   -45.852 41.630 1.00 75.28  ? 19   ARG F CB    1 
ATOM   3834  C  CG    . ARG F 2 19  ? 9.138   -44.328 41.866 1.00 76.49  ? 19   ARG F CG    1 
ATOM   3835  C  CD    . ARG F 2 19  ? 8.428   -43.958 43.182 1.00 79.14  ? 19   ARG F CD    1 
ATOM   3836  N  NE    . ARG F 2 19  ? 8.810   -42.628 43.667 1.00 80.54  ? 19   ARG F NE    1 
ATOM   3837  C  CZ    . ARG F 2 19  ? 8.108   -41.511 43.467 1.00 81.32  ? 19   ARG F CZ    1 
ATOM   3838  N  NH1   . ARG F 2 19  ? 6.960   -41.544 42.790 1.00 81.29  ? 19   ARG F NH1   1 
ATOM   3839  N  NH2   . ARG F 2 19  ? 8.554   -40.352 43.949 1.00 80.96  ? 19   ARG F NH2   1 
ATOM   3840  N  N     . LYS F 2 20  ? 10.601  -46.553 44.839 1.00 69.18  ? 20   LYS F N     1 
ATOM   3841  C  CA    . LYS F 2 20  ? 10.323  -46.914 46.243 1.00 66.05  ? 20   LYS F CA    1 
ATOM   3842  C  C     . LYS F 2 20  ? 8.872   -46.671 46.684 1.00 63.98  ? 20   LYS F C     1 
ATOM   3843  O  O     . LYS F 2 20  ? 8.237   -45.702 46.259 1.00 63.99  ? 20   LYS F O     1 
ATOM   3844  C  CB    . LYS F 2 20  ? 11.287  -46.182 47.170 1.00 66.09  ? 20   LYS F CB    1 
ATOM   3845  C  CG    . LYS F 2 20  ? 10.961  -46.284 48.648 1.00 65.99  ? 20   LYS F CG    1 
ATOM   3846  C  CD    . LYS F 2 20  ? 11.132  -47.697 49.205 1.00 64.40  ? 20   LYS F CD    1 
ATOM   3847  C  CE    . LYS F 2 20  ? 11.201  -47.670 50.732 1.00 63.81  ? 20   LYS F CE    1 
ATOM   3848  N  NZ    . LYS F 2 20  ? 9.904   -47.281 51.367 1.00 63.14  ? 20   LYS F NZ    1 
ATOM   3849  N  N     . VAL F 2 21  ? 8.366   -47.557 47.541 1.00 60.95  ? 21   VAL F N     1 
ATOM   3850  C  CA    . VAL F 2 21  ? 6.950   -47.606 47.891 1.00 57.81  ? 21   VAL F CA    1 
ATOM   3851  C  C     . VAL F 2 21  ? 6.598   -46.436 48.782 1.00 55.92  ? 21   VAL F C     1 
ATOM   3852  O  O     . VAL F 2 21  ? 7.257   -46.216 49.795 1.00 55.85  ? 21   VAL F O     1 
ATOM   3853  C  CB    . VAL F 2 21  ? 6.574   -48.943 48.611 1.00 57.86  ? 21   VAL F CB    1 
ATOM   3854  C  CG1   . VAL F 2 21  ? 5.158   -48.905 49.154 1.00 57.18  ? 21   VAL F CG1   1 
ATOM   3855  C  CG2   . VAL F 2 21  ? 6.712   -50.111 47.679 1.00 57.61  ? 21   VAL F CG2   1 
ATOM   3856  N  N     . LEU F 2 22  ? 5.554   -45.700 48.393 1.00 53.34  ? 22   LEU F N     1 
ATOM   3857  C  CA    . LEU F 2 22  ? 5.008   -44.610 49.198 1.00 50.72  ? 22   LEU F CA    1 
ATOM   3858  C  C     . LEU F 2 22  ? 3.841   -45.096 50.036 1.00 49.32  ? 22   LEU F C     1 
ATOM   3859  O  O     . LEU F 2 22  ? 2.855   -45.582 49.492 1.00 49.02  ? 22   LEU F O     1 
ATOM   3860  C  CB    . LEU F 2 22  ? 4.564   -43.442 48.311 1.00 50.23  ? 22   LEU F CB    1 
ATOM   3861  C  CG    . LEU F 2 22  ? 5.647   -42.837 47.413 1.00 49.27  ? 22   LEU F CG    1 
ATOM   3862  C  CD1   . LEU F 2 22  ? 5.068   -42.028 46.262 1.00 47.68  ? 22   LEU F CD1   1 
ATOM   3863  C  CD2   . LEU F 2 22  ? 6.635   -42.019 48.227 1.00 48.88  ? 22   LEU F CD2   1 
ATOM   3864  N  N     . ARG F 2 23  ? 3.964   -44.961 51.358 1.00 47.86  ? 23   ARG F N     1 
ATOM   3865  C  CA    . ARG F 2 23  ? 2.877   -45.278 52.298 1.00 46.35  ? 23   ARG F CA    1 
ATOM   3866  C  C     . ARG F 2 23  ? 2.890   -44.426 53.573 1.00 45.83  ? 23   ARG F C     1 
ATOM   3867  O  O     . ARG F 2 23  ? 3.944   -44.030 54.057 1.00 45.35  ? 23   ARG F O     1 
ATOM   3868  C  CB    . ARG F 2 23  ? 2.879   -46.768 52.673 1.00 46.35  ? 23   ARG F CB    1 
ATOM   3869  C  CG    . ARG F 2 23  ? 4.236   -47.334 53.057 1.00 45.95  ? 23   ARG F CG    1 
ATOM   3870  C  CD    . ARG F 2 23  ? 4.223   -48.862 53.062 1.00 45.42  ? 23   ARG F CD    1 
ATOM   3871  N  NE    . ARG F 2 23  ? 4.037   -49.349 54.423 1.00 42.46  ? 23   ARG F NE    1 
ATOM   3872  C  CZ    . ARG F 2 23  ? 5.024   -49.723 55.228 1.00 40.07  ? 23   ARG F CZ    1 
ATOM   3873  N  NH1   . ARG F 2 23  ? 6.288   -49.699 54.810 1.00 37.92  ? 23   ARG F NH1   1 
ATOM   3874  N  NH2   . ARG F 2 23  ? 4.733   -50.128 56.451 1.00 37.99  ? 23   ARG F NH2   1 
ATOM   3875  N  N     . ASP F 2 24  ? 1.696   -44.149 54.099 1.00 45.32  ? 24   ASP F N     1 
ATOM   3876  C  CA    . ASP F 2 24  ? 1.514   -43.490 55.404 1.00 44.38  ? 24   ASP F CA    1 
ATOM   3877  C  C     . ASP F 2 24  ? 2.103   -42.084 55.518 1.00 43.97  ? 24   ASP F C     1 
ATOM   3878  O  O     . ASP F 2 24  ? 2.329   -41.577 56.617 1.00 43.56  ? 24   ASP F O     1 
ATOM   3879  C  CB    . ASP F 2 24  ? 2.066   -44.368 56.518 1.00 44.13  ? 24   ASP F CB    1 
ATOM   3880  C  CG    . ASP F 2 24  ? 1.374   -44.123 57.816 1.00 44.70  ? 24   ASP F CG    1 
ATOM   3881  O  OD1   . ASP F 2 24  ? 0.120   -44.002 57.785 1.00 45.81  ? 24   ASP F OD1   1 
ATOM   3882  O  OD2   . ASP F 2 24  ? 2.070   -44.047 58.856 1.00 43.78  ? 24   ASP F OD2   1 
ATOM   3883  N  N     . ASN F 2 25  ? 2.335   -41.452 54.376 1.00 43.50  ? 25   ASN F N     1 
ATOM   3884  C  CA    . ASN F 2 25  ? 2.900   -40.128 54.334 1.00 42.98  ? 25   ASN F CA    1 
ATOM   3885  C  C     . ASN F 2 25  ? 2.025   -39.026 54.926 1.00 43.53  ? 25   ASN F C     1 
ATOM   3886  O  O     . ASN F 2 25  ? 2.477   -37.890 55.073 1.00 43.68  ? 25   ASN F O     1 
ATOM   3887  C  CB    . ASN F 2 25  ? 3.254   -39.799 52.912 1.00 42.68  ? 25   ASN F CB    1 
ATOM   3888  C  CG    . ASN F 2 25  ? 4.464   -40.517 52.467 1.00 41.84  ? 25   ASN F CG    1 
ATOM   3889  O  OD1   . ASN F 2 25  ? 5.577   -40.115 52.784 1.00 41.46  ? 25   ASN F OD1   1 
ATOM   3890  N  ND2   . ASN F 2 25  ? 4.272   -41.608 51.742 1.00 41.65  ? 25   ASN F ND2   1 
ATOM   3891  N  N     . ILE F 2 26  ? 0.785   -39.367 55.272 1.00 44.08  ? 26   ILE F N     1 
ATOM   3892  C  CA    . ILE F 2 26  ? -0.100  -38.467 56.004 1.00 44.16  ? 26   ILE F CA    1 
ATOM   3893  C  C     . ILE F 2 26  ? 0.518   -38.133 57.348 1.00 44.10  ? 26   ILE F C     1 
ATOM   3894  O  O     . ILE F 2 26  ? 0.157   -37.144 57.969 1.00 44.57  ? 26   ILE F O     1 
ATOM   3895  C  CB    . ILE F 2 26  ? -1.522  -39.093 56.228 1.00 44.26  ? 26   ILE F CB    1 
ATOM   3896  C  CG1   . ILE F 2 26  ? -2.536  -38.059 56.735 1.00 44.99  ? 26   ILE F CG1   1 
ATOM   3897  C  CG2   . ILE F 2 26  ? -1.482  -40.222 57.242 1.00 44.37  ? 26   ILE F CG2   1 
ATOM   3898  C  CD1   . ILE F 2 26  ? -2.852  -36.933 55.761 1.00 46.46  ? 26   ILE F CD1   1 
ATOM   3899  N  N     . GLN F 2 27  ? 1.445   -38.962 57.801 1.00 44.16  ? 27   GLN F N     1 
ATOM   3900  C  CA    . GLN F 2 27  ? 1.935   -38.851 59.173 1.00 44.33  ? 27   GLN F CA    1 
ATOM   3901  C  C     . GLN F 2 27  ? 3.159   -37.972 59.246 1.00 44.01  ? 27   GLN F C     1 
ATOM   3902  O  O     . GLN F 2 27  ? 3.757   -37.826 60.316 1.00 44.58  ? 27   GLN F O     1 
ATOM   3903  C  CB    . GLN F 2 27  ? 2.212   -40.229 59.786 1.00 44.42  ? 27   GLN F CB    1 
ATOM   3904  C  CG    . GLN F 2 27  ? 0.960   -41.015 60.154 1.00 45.53  ? 27   GLN F CG    1 
ATOM   3905  C  CD    . GLN F 2 27  ? 0.208   -40.400 61.322 1.00 49.03  ? 27   GLN F CD    1 
ATOM   3906  O  OE1   . GLN F 2 27  ? 0.800   -39.694 62.148 1.00 51.21  ? 27   GLN F OE1   1 
ATOM   3907  N  NE2   . GLN F 2 27  ? -1.108  -40.658 61.399 1.00 49.02  ? 27   GLN F NE2   1 
ATOM   3908  N  N     . GLY F 2 28  ? 3.524   -37.392 58.108 1.00 43.35  ? 28   GLY F N     1 
ATOM   3909  C  CA    . GLY F 2 28  ? 4.568   -36.382 58.061 1.00 43.08  ? 28   GLY F CA    1 
ATOM   3910  C  C     . GLY F 2 28  ? 3.943   -35.006 58.214 1.00 43.02  ? 28   GLY F C     1 
ATOM   3911  O  O     . GLY F 2 28  ? 4.642   -33.996 58.236 1.00 43.59  ? 28   GLY F O     1 
ATOM   3912  N  N     . ILE F 2 29  ? 2.614   -34.961 58.273 1.00 42.24  ? 29   ILE F N     1 
ATOM   3913  C  CA    . ILE F 2 29  ? 1.910   -33.748 58.633 1.00 41.38  ? 29   ILE F CA    1 
ATOM   3914  C  C     . ILE F 2 29  ? 1.964   -33.777 60.148 1.00 41.25  ? 29   ILE F C     1 
ATOM   3915  O  O     . ILE F 2 29  ? 1.069   -34.281 60.832 1.00 40.94  ? 29   ILE F O     1 
ATOM   3916  C  CB    . ILE F 2 29  ? 0.471   -33.714 58.073 1.00 41.30  ? 29   ILE F CB    1 
ATOM   3917  C  CG1   . ILE F 2 29  ? 0.466   -33.960 56.560 1.00 40.77  ? 29   ILE F CG1   1 
ATOM   3918  C  CG2   . ILE F 2 29  ? -0.189  -32.382 58.340 1.00 41.43  ? 29   ILE F CG2   1 
ATOM   3919  C  CD1   . ILE F 2 29  ? 1.762   -33.605 55.843 1.00 39.09  ? 29   ILE F CD1   1 
ATOM   3920  N  N     . THR F 2 30  ? 3.072   -33.261 60.661 1.00 40.98  ? 30   THR F N     1 
ATOM   3921  C  CA    . THR F 2 30  ? 3.422   -33.444 62.049 1.00 40.68  ? 30   THR F CA    1 
ATOM   3922  C  C     . THR F 2 30  ? 2.493   -32.644 62.938 1.00 40.21  ? 30   THR F C     1 
ATOM   3923  O  O     . THR F 2 30  ? 1.794   -31.753 62.475 1.00 40.00  ? 30   THR F O     1 
ATOM   3924  C  CB    . THR F 2 30  ? 4.904   -33.087 62.318 1.00 40.75  ? 30   THR F CB    1 
ATOM   3925  O  OG1   . THR F 2 30  ? 5.048   -31.674 62.439 1.00 42.32  ? 30   THR F OG1   1 
ATOM   3926  C  CG2   . THR F 2 30  ? 5.809   -33.565 61.184 1.00 40.76  ? 30   THR F CG2   1 
ATOM   3927  N  N     . LYS F 2 31  ? 2.477   -33.002 64.216 1.00 40.18  ? 31   LYS F N     1 
ATOM   3928  C  CA    . LYS F 2 31  ? 1.715   -32.309 65.246 1.00 39.45  ? 31   LYS F CA    1 
ATOM   3929  C  C     . LYS F 2 31  ? 2.154   -30.840 65.388 1.00 38.96  ? 31   LYS F C     1 
ATOM   3930  O  O     . LYS F 2 31  ? 1.309   -29.972 65.527 1.00 39.28  ? 31   LYS F O     1 
ATOM   3931  C  CB    . LYS F 2 31  ? 1.882   -33.066 66.553 1.00 39.59  ? 31   LYS F CB    1 
ATOM   3932  C  CG    . LYS F 2 31  ? 1.141   -32.538 67.750 1.00 40.68  ? 31   LYS F CG    1 
ATOM   3933  C  CD    . LYS F 2 31  ? 1.842   -33.032 68.993 1.00 41.26  ? 31   LYS F CD    1 
ATOM   3934  C  CE    . LYS F 2 31  ? 1.223   -32.479 70.242 1.00 42.33  ? 31   LYS F CE    1 
ATOM   3935  N  NZ    . LYS F 2 31  ? 2.264   -32.471 71.315 1.00 44.71  ? 31   LYS F NZ    1 
ATOM   3936  N  N     . PRO F 2 32  ? 3.473   -30.559 65.364 1.00 38.41  ? 32   PRO F N     1 
ATOM   3937  C  CA    . PRO F 2 32  ? 3.917   -29.165 65.329 1.00 37.86  ? 32   PRO F CA    1 
ATOM   3938  C  C     . PRO F 2 32  ? 3.430   -28.401 64.101 1.00 37.84  ? 32   PRO F C     1 
ATOM   3939  O  O     . PRO F 2 32  ? 3.023   -27.241 64.229 1.00 38.26  ? 32   PRO F O     1 
ATOM   3940  C  CB    . PRO F 2 32  ? 5.442   -29.279 65.287 1.00 37.70  ? 32   PRO F CB    1 
ATOM   3941  C  CG    . PRO F 2 32  ? 5.736   -30.622 65.866 1.00 38.45  ? 32   PRO F CG    1 
ATOM   3942  C  CD    . PRO F 2 32  ? 4.615   -31.493 65.434 1.00 38.24  ? 32   PRO F CD    1 
ATOM   3943  N  N     . ALA F 2 33  ? 3.490   -29.020 62.924 1.00 37.24  ? 33   ALA F N     1 
ATOM   3944  C  CA    . ALA F 2 33  ? 3.003   -28.374 61.717 1.00 37.18  ? 33   ALA F CA    1 
ATOM   3945  C  C     . ALA F 2 33  ? 1.500   -28.053 61.820 1.00 37.35  ? 33   ALA F C     1 
ATOM   3946  O  O     . ALA F 2 33  ? 1.052   -26.989 61.419 1.00 36.93  ? 33   ALA F O     1 
ATOM   3947  C  CB    . ALA F 2 33  ? 3.291   -29.223 60.515 1.00 36.82  ? 33   ALA F CB    1 
ATOM   3948  N  N     . ILE F 2 34  ? 0.731   -28.967 62.394 1.00 37.89  ? 34   ILE F N     1 
ATOM   3949  C  CA    . ILE F 2 34  ? -0.695  -28.748 62.571 1.00 38.42  ? 34   ILE F CA    1 
ATOM   3950  C  C     . ILE F 2 34  ? -0.961  -27.726 63.663 1.00 39.24  ? 34   ILE F C     1 
ATOM   3951  O  O     . ILE F 2 34  ? -1.984  -27.043 63.636 1.00 40.27  ? 34   ILE F O     1 
ATOM   3952  C  CB    . ILE F 2 34  ? -1.430  -30.051 62.901 1.00 38.49  ? 34   ILE F CB    1 
ATOM   3953  C  CG1   . ILE F 2 34  ? -1.297  -31.043 61.738 1.00 37.48  ? 34   ILE F CG1   1 
ATOM   3954  C  CG2   . ILE F 2 34  ? -2.910  -29.782 63.227 1.00 37.77  ? 34   ILE F CG2   1 
ATOM   3955  C  CD1   . ILE F 2 34  ? -1.479  -32.473 62.186 1.00 36.95  ? 34   ILE F CD1   1 
ATOM   3956  N  N     . ARG F 2 35  ? -0.057  -27.606 64.625 1.00 39.27  ? 35   ARG F N     1 
ATOM   3957  C  CA    . ARG F 2 35  ? -0.226  -26.591 65.642 1.00 39.74  ? 35   ARG F CA    1 
ATOM   3958  C  C     . ARG F 2 35  ? 0.065   -25.211 65.055 1.00 39.18  ? 35   ARG F C     1 
ATOM   3959  O  O     . ARG F 2 35  ? -0.668  -24.262 65.297 1.00 39.51  ? 35   ARG F O     1 
ATOM   3960  C  CB    . ARG F 2 35  ? 0.657   -26.893 66.836 1.00 39.66  ? 35   ARG F CB    1 
ATOM   3961  C  CG    . ARG F 2 35  ? 0.610   -25.843 67.950 1.00 42.30  ? 35   ARG F CG    1 
ATOM   3962  C  CD    . ARG F 2 35  ? 1.696   -26.100 69.010 1.00 42.06  ? 35   ARG F CD    1 
ATOM   3963  N  NE    . ARG F 2 35  ? 1.654   -27.500 69.387 1.00 47.57  ? 35   ARG F NE    1 
ATOM   3964  C  CZ    . ARG F 2 35  ? 0.769   -28.022 70.230 1.00 51.33  ? 35   ARG F CZ    1 
ATOM   3965  N  NH1   . ARG F 2 35  ? -0.134  -27.249 70.833 1.00 50.09  ? 35   ARG F NH1   1 
ATOM   3966  N  NH2   . ARG F 2 35  ? 0.813   -29.330 70.495 1.00 54.37  ? 35   ARG F NH2   1 
ATOM   3967  N  N     . ARG F 2 36  ? 1.112   -25.105 64.248 1.00 38.74  ? 36   ARG F N     1 
ATOM   3968  C  CA    . ARG F 2 36  ? 1.479   -23.823 63.671 1.00 37.77  ? 36   ARG F CA    1 
ATOM   3969  C  C     . ARG F 2 36  ? 0.336   -23.225 62.853 1.00 37.14  ? 36   ARG F C     1 
ATOM   3970  O  O     . ARG F 2 36  ? 0.018   -22.040 63.015 1.00 37.16  ? 36   ARG F O     1 
ATOM   3971  C  CB    . ARG F 2 36  ? 2.751   -23.939 62.834 1.00 38.01  ? 36   ARG F CB    1 
ATOM   3972  C  CG    . ARG F 2 36  ? 4.013   -24.086 63.643 1.00 38.05  ? 36   ARG F CG    1 
ATOM   3973  C  CD    . ARG F 2 36  ? 5.265   -23.910 62.778 1.00 40.25  ? 36   ARG F CD    1 
ATOM   3974  N  NE    . ARG F 2 36  ? 5.479   -24.985 61.796 1.00 41.55  ? 36   ARG F NE    1 
ATOM   3975  C  CZ    . ARG F 2 36  ? 6.163   -26.110 62.024 1.00 41.00  ? 36   ARG F CZ    1 
ATOM   3976  N  NH1   . ARG F 2 36  ? 6.715   -26.361 63.207 1.00 41.24  ? 36   ARG F NH1   1 
ATOM   3977  N  NH2   . ARG F 2 36  ? 6.302   -26.995 61.057 1.00 40.67  ? 36   ARG F NH2   1 
ATOM   3978  N  N     . LEU F 2 37  ? -0.298  -24.044 62.010 1.00 36.09  ? 37   LEU F N     1 
ATOM   3979  C  CA    . LEU F 2 37  ? -1.428  -23.586 61.180 1.00 35.14  ? 37   LEU F CA    1 
ATOM   3980  C  C     . LEU F 2 37  ? -2.587  -23.091 62.038 1.00 34.99  ? 37   LEU F C     1 
ATOM   3981  O  O     . LEU F 2 37  ? -3.133  -22.011 61.801 1.00 34.48  ? 37   LEU F O     1 
ATOM   3982  C  CB    . LEU F 2 37  ? -1.915  -24.680 60.241 1.00 34.90  ? 37   LEU F CB    1 
ATOM   3983  C  CG    . LEU F 2 37  ? -0.924  -25.259 59.245 1.00 33.62  ? 37   LEU F CG    1 
ATOM   3984  C  CD1   . LEU F 2 37  ? -1.357  -26.629 58.835 1.00 32.48  ? 37   LEU F CD1   1 
ATOM   3985  C  CD2   . LEU F 2 37  ? -0.806  -24.375 58.064 1.00 35.36  ? 37   LEU F CD2   1 
ATOM   3986  N  N     . ALA F 2 38  ? -2.942  -23.871 63.053 1.00 35.07  ? 38   ALA F N     1 
ATOM   3987  C  CA    . ALA F 2 38  ? -3.901  -23.409 64.070 1.00 35.29  ? 38   ALA F CA    1 
ATOM   3988  C  C     . ALA F 2 38  ? -3.540  -22.009 64.585 1.00 35.20  ? 38   ALA F C     1 
ATOM   3989  O  O     . ALA F 2 38  ? -4.407  -21.131 64.684 1.00 35.14  ? 38   ALA F O     1 
ATOM   3990  C  CB    . ALA F 2 38  ? -3.988  -24.397 65.230 1.00 34.78  ? 38   ALA F CB    1 
ATOM   3991  N  N     . ARG F 2 39  ? -2.262  -21.805 64.900 1.00 34.87  ? 39   ARG F N     1 
ATOM   3992  C  CA    . ARG F 2 39  ? -1.828  -20.523 65.428 1.00 35.04  ? 39   ARG F CA    1 
ATOM   3993  C  C     . ARG F 2 39  ? -2.145  -19.410 64.435 1.00 35.16  ? 39   ARG F C     1 
ATOM   3994  O  O     . ARG F 2 39  ? -2.765  -18.411 64.793 1.00 35.34  ? 39   ARG F O     1 
ATOM   3995  C  CB    . ARG F 2 39  ? -0.329  -20.525 65.742 1.00 34.90  ? 39   ARG F CB    1 
ATOM   3996  C  CG    . ARG F 2 39  ? 0.072   -21.480 66.815 1.00 32.71  ? 39   ARG F CG    1 
ATOM   3997  C  CD    . ARG F 2 39  ? -0.478  -21.134 68.159 1.00 29.83  ? 39   ARG F CD    1 
ATOM   3998  N  NE    . ARG F 2 39  ? 0.224   -21.948 69.133 1.00 30.96  ? 39   ARG F NE    1 
ATOM   3999  C  CZ    . ARG F 2 39  ? -0.350  -22.696 70.068 1.00 30.42  ? 39   ARG F CZ    1 
ATOM   4000  N  NH1   . ARG F 2 39  ? -1.669  -22.697 70.224 1.00 29.01  ? 39   ARG F NH1   1 
ATOM   4001  N  NH2   . ARG F 2 39  ? 0.421   -23.407 70.877 1.00 29.33  ? 39   ARG F NH2   1 
ATOM   4002  N  N     . ARG F 2 40  ? -1.725  -19.597 63.189 1.00 34.64  ? 40   ARG F N     1 
ATOM   4003  C  CA    . ARG F 2 40  ? -2.054  -18.654 62.149 1.00 34.14  ? 40   ARG F CA    1 
ATOM   4004  C  C     . ARG F 2 40  ? -3.555  -18.428 62.140 1.00 33.92  ? 40   ARG F C     1 
ATOM   4005  O  O     . ARG F 2 40  ? -3.981  -17.293 62.070 1.00 34.17  ? 40   ARG F O     1 
ATOM   4006  C  CB    . ARG F 2 40  ? -1.555  -19.144 60.788 1.00 34.20  ? 40   ARG F CB    1 
ATOM   4007  C  CG    . ARG F 2 40  ? -1.733  -18.145 59.670 1.00 33.49  ? 40   ARG F CG    1 
ATOM   4008  C  CD    . ARG F 2 40  ? -0.765  -18.424 58.542 1.00 31.83  ? 40   ARG F CD    1 
ATOM   4009  N  NE    . ARG F 2 40  ? 0.584   -17.980 58.865 1.00 32.09  ? 40   ARG F NE    1 
ATOM   4010  C  CZ    . ARG F 2 40  ? 1.675   -18.334 58.190 1.00 31.48  ? 40   ARG F CZ    1 
ATOM   4011  N  NH1   . ARG F 2 40  ? 1.572   -19.159 57.164 1.00 31.00  ? 40   ARG F NH1   1 
ATOM   4012  N  NH2   . ARG F 2 40  ? 2.874   -17.881 58.554 1.00 29.66  ? 40   ARG F NH2   1 
ATOM   4013  N  N     . GLY F 2 41  ? -4.348  -19.497 62.253 1.00 33.82  ? 41   GLY F N     1 
ATOM   4014  C  CA    . GLY F 2 41  ? -5.815  -19.386 62.323 1.00 33.59  ? 41   GLY F CA    1 
ATOM   4015  C  C     . GLY F 2 41  ? -6.281  -18.828 63.660 1.00 34.16  ? 41   GLY F C     1 
ATOM   4016  O  O     . GLY F 2 41  ? -7.477  -18.750 63.940 1.00 34.38  ? 41   GLY F O     1 
ATOM   4017  N  N     . GLY F 2 42  ? -5.334  -18.442 64.503 1.00 34.09  ? 42   GLY F N     1 
ATOM   4018  C  CA    . GLY F 2 42  ? -5.666  -17.761 65.733 1.00 34.64  ? 42   GLY F CA    1 
ATOM   4019  C  C     . GLY F 2 42  ? -6.239  -18.658 66.804 1.00 35.13  ? 42   GLY F C     1 
ATOM   4020  O  O     . GLY F 2 42  ? -7.047  -18.215 67.613 1.00 35.63  ? 42   GLY F O     1 
ATOM   4021  N  N     . VAL F 2 43  ? -5.804  -19.916 66.816 1.00 35.37  ? 43   VAL F N     1 
ATOM   4022  C  CA    . VAL F 2 43  ? -6.277  -20.902 67.772 1.00 34.76  ? 43   VAL F CA    1 
ATOM   4023  C  C     . VAL F 2 43  ? -5.314  -21.003 68.940 1.00 35.22  ? 43   VAL F C     1 
ATOM   4024  O  O     . VAL F 2 43  ? -4.114  -21.229 68.776 1.00 34.97  ? 43   VAL F O     1 
ATOM   4025  C  CB    . VAL F 2 43  ? -6.483  -22.258 67.102 1.00 34.44  ? 43   VAL F CB    1 
ATOM   4026  C  CG1   . VAL F 2 43  ? -6.682  -23.353 68.133 1.00 34.65  ? 43   VAL F CG1   1 
ATOM   4027  C  CG2   . VAL F 2 43  ? -7.678  -22.190 66.192 1.00 33.99  ? 43   VAL F CG2   1 
ATOM   4028  N  N     . LYS F 2 44  ? -5.868  -20.813 70.130 1.00 36.24  ? 44   LYS F N     1 
ATOM   4029  C  CA    . LYS F 2 44  ? -5.090  -20.748 71.369 1.00 36.75  ? 44   LYS F CA    1 
ATOM   4030  C  C     . LYS F 2 44  ? -4.900  -22.126 71.996 1.00 36.95  ? 44   LYS F C     1 
ATOM   4031  O  O     . LYS F 2 44  ? -3.806  -22.448 72.447 1.00 37.96  ? 44   LYS F O     1 
ATOM   4032  C  CB    . LYS F 2 44  ? -5.764  -19.788 72.350 1.00 36.43  ? 44   LYS F CB    1 
ATOM   4033  C  CG    . LYS F 2 44  ? -4.909  -19.346 73.518 1.00 37.49  ? 44   LYS F CG    1 
ATOM   4034  C  CD    . LYS F 2 44  ? -5.793  -18.707 74.605 1.00 38.47  ? 44   LYS F CD    1 
ATOM   4035  C  CE    . LYS F 2 44  ? -4.979  -18.223 75.795 1.00 38.58  ? 44   LYS F CE    1 
ATOM   4036  N  NZ    . LYS F 2 44  ? -5.867  -17.946 76.969 1.00 38.88  ? 44   LYS F NZ    1 
ATOM   4037  N  N     . ARG F 2 45  ? -5.952  -22.937 72.012 1.00 36.98  ? 45   ARG F N     1 
ATOM   4038  C  CA    . ARG F 2 45  ? -5.914  -24.230 72.664 1.00 37.19  ? 45   ARG F CA    1 
ATOM   4039  C  C     . ARG F 2 45  ? -6.472  -25.322 71.767 1.00 37.18  ? 45   ARG F C     1 
ATOM   4040  O  O     . ARG F 2 45  ? -7.507  -25.143 71.116 1.00 36.93  ? 45   ARG F O     1 
ATOM   4041  C  CB    . ARG F 2 45  ? -6.690  -24.172 73.970 1.00 37.69  ? 45   ARG F CB    1 
ATOM   4042  C  CG    . ARG F 2 45  ? -6.123  -25.041 75.088 1.00 39.12  ? 45   ARG F CG    1 
ATOM   4043  C  CD    . ARG F 2 45  ? -6.837  -24.768 76.412 1.00 41.31  ? 45   ARG F CD    1 
ATOM   4044  N  NE    . ARG F 2 45  ? -6.418  -25.727 77.422 1.00 44.17  ? 45   ARG F NE    1 
ATOM   4045  C  CZ    . ARG F 2 45  ? -7.109  -26.817 77.751 1.00 46.00  ? 45   ARG F CZ    1 
ATOM   4046  N  NH1   . ARG F 2 45  ? -8.275  -27.075 77.166 1.00 45.96  ? 45   ARG F NH1   1 
ATOM   4047  N  NH2   . ARG F 2 45  ? -6.638  -27.650 78.678 1.00 46.87  ? 45   ARG F NH2   1 
ATOM   4048  N  N     . ILE F 2 46  ? -5.782  -26.463 71.767 1.00 37.37  ? 46   ILE F N     1 
ATOM   4049  C  CA    . ILE F 2 46  ? -6.024  -27.566 70.837 1.00 37.35  ? 46   ILE F CA    1 
ATOM   4050  C  C     . ILE F 2 46  ? -6.232  -28.917 71.549 1.00 37.97  ? 46   ILE F C     1 
ATOM   4051  O  O     . ILE F 2 46  ? -5.342  -29.426 72.254 1.00 38.09  ? 46   ILE F O     1 
ATOM   4052  C  CB    . ILE F 2 46  ? -4.826  -27.711 69.889 1.00 37.13  ? 46   ILE F CB    1 
ATOM   4053  C  CG1   . ILE F 2 46  ? -4.592  -26.422 69.120 1.00 36.16  ? 46   ILE F CG1   1 
ATOM   4054  C  CG2   . ILE F 2 46  ? -5.018  -28.883 68.946 1.00 37.53  ? 46   ILE F CG2   1 
ATOM   4055  C  CD1   . ILE F 2 46  ? -3.286  -26.382 68.399 1.00 35.83  ? 46   ILE F CD1   1 
ATOM   4056  N  N     . SER F 2 47  ? -7.403  -29.507 71.344 1.00 38.52  ? 47   SER F N     1 
ATOM   4057  C  CA    . SER F 2 47  ? -7.695  -30.855 71.856 1.00 38.59  ? 47   SER F CA    1 
ATOM   4058  C  C     . SER F 2 47  ? -6.792  -31.901 71.210 1.00 38.55  ? 47   SER F C     1 
ATOM   4059  O  O     . SER F 2 47  ? -6.425  -31.770 70.043 1.00 38.70  ? 47   SER F O     1 
ATOM   4060  C  CB    . SER F 2 47  ? -9.153  -31.215 71.599 1.00 38.19  ? 47   SER F CB    1 
ATOM   4061  O  OG    . SER F 2 47  ? -9.286  -32.599 71.385 1.00 38.96  ? 47   SER F OG    1 
ATOM   4062  N  N     . GLY F 2 48  ? -6.462  -32.945 71.967 1.00 38.46  ? 48   GLY F N     1 
ATOM   4063  C  CA    . GLY F 2 48  ? -5.558  -33.998 71.491 1.00 38.55  ? 48   GLY F CA    1 
ATOM   4064  C  C     . GLY F 2 48  ? -5.985  -34.725 70.224 1.00 38.45  ? 48   GLY F C     1 
ATOM   4065  O  O     . GLY F 2 48  ? -5.138  -35.244 69.485 1.00 38.66  ? 48   GLY F O     1 
ATOM   4066  N  N     . LEU F 2 49  ? -7.292  -34.750 69.977 1.00 37.87  ? 49   LEU F N     1 
ATOM   4067  C  CA    . LEU F 2 49  ? -7.866  -35.410 68.820 1.00 37.74  ? 49   LEU F CA    1 
ATOM   4068  C  C     . LEU F 2 49  ? -7.801  -34.603 67.507 1.00 37.69  ? 49   LEU F C     1 
ATOM   4069  O  O     . LEU F 2 49  ? -8.039  -35.157 66.418 1.00 38.05  ? 49   LEU F O     1 
ATOM   4070  C  CB    . LEU F 2 49  ? -9.322  -35.727 69.122 1.00 38.21  ? 49   LEU F CB    1 
ATOM   4071  C  CG    . LEU F 2 49  ? -9.582  -36.655 70.305 1.00 39.06  ? 49   LEU F CG    1 
ATOM   4072  C  CD1   . LEU F 2 49  ? -11.026 -36.462 70.803 1.00 39.20  ? 49   LEU F CD1   1 
ATOM   4073  C  CD2   . LEU F 2 49  ? -9.259  -38.117 69.932 1.00 36.93  ? 49   LEU F CD2   1 
ATOM   4074  N  N     . ILE F 2 50  ? -7.497  -33.307 67.599 1.00 36.74  ? 50   ILE F N     1 
ATOM   4075  C  CA    . ILE F 2 50  ? -7.468  -32.449 66.427 1.00 36.04  ? 50   ILE F CA    1 
ATOM   4076  C  C     . ILE F 2 50  ? -6.535  -33.000 65.340 1.00 36.51  ? 50   ILE F C     1 
ATOM   4077  O  O     . ILE F 2 50  ? -6.875  -32.981 64.138 1.00 36.71  ? 50   ILE F O     1 
ATOM   4078  C  CB    . ILE F 2 50  ? -7.081  -30.981 66.797 1.00 35.82  ? 50   ILE F CB    1 
ATOM   4079  C  CG1   . ILE F 2 50  ? -8.234  -30.255 67.519 1.00 35.03  ? 50   ILE F CG1   1 
ATOM   4080  C  CG2   . ILE F 2 50  ? -6.586  -30.190 65.576 1.00 34.73  ? 50   ILE F CG2   1 
ATOM   4081  C  CD1   . ILE F 2 50  ? -9.501  -30.046 66.723 1.00 32.31  ? 50   ILE F CD1   1 
ATOM   4082  N  N     . TYR F 2 51  ? -5.371  -33.504 65.742 1.00 36.09  ? 51   TYR F N     1 
ATOM   4083  C  CA    . TYR F 2 51  ? -4.353  -33.775 64.751 1.00 36.29  ? 51   TYR F CA    1 
ATOM   4084  C  C     . TYR F 2 51  ? -4.806  -34.791 63.718 1.00 36.74  ? 51   TYR F C     1 
ATOM   4085  O  O     . TYR F 2 51  ? -4.658  -34.547 62.525 1.00 37.13  ? 51   TYR F O     1 
ATOM   4086  C  CB    . TYR F 2 51  ? -3.005  -34.061 65.386 1.00 36.19  ? 51   TYR F CB    1 
ATOM   4087  C  CG    . TYR F 2 51  ? -2.696  -33.042 66.460 1.00 37.00  ? 51   TYR F CG    1 
ATOM   4088  C  CD1   . TYR F 2 51  ? -2.881  -33.349 67.803 1.00 36.88  ? 51   TYR F CD1   1 
ATOM   4089  C  CD2   . TYR F 2 51  ? -2.270  -31.750 66.131 1.00 36.47  ? 51   TYR F CD2   1 
ATOM   4090  C  CE1   . TYR F 2 51  ? -2.638  -32.427 68.774 1.00 37.21  ? 51   TYR F CE1   1 
ATOM   4091  C  CE2   . TYR F 2 51  ? -2.025  -30.816 67.098 1.00 35.05  ? 51   TYR F CE2   1 
ATOM   4092  C  CZ    . TYR F 2 51  ? -2.212  -31.157 68.420 1.00 37.36  ? 51   TYR F CZ    1 
ATOM   4093  O  OH    . TYR F 2 51  ? -1.966  -30.236 69.426 1.00 39.43  ? 51   TYR F OH    1 
ATOM   4094  N  N     . GLU F 2 52  ? -5.415  -35.889 64.162 1.00 37.16  ? 52   GLU F N     1 
ATOM   4095  C  CA    . GLU F 2 52  ? -5.913  -36.912 63.235 1.00 37.42  ? 52   GLU F CA    1 
ATOM   4096  C  C     . GLU F 2 52  ? -7.070  -36.391 62.391 1.00 36.84  ? 52   GLU F C     1 
ATOM   4097  O  O     . GLU F 2 52  ? -7.142  -36.662 61.185 1.00 36.75  ? 52   GLU F O     1 
ATOM   4098  C  CB    . GLU F 2 52  ? -6.332  -38.188 63.974 1.00 37.66  ? 52   GLU F CB    1 
ATOM   4099  C  CG    . GLU F 2 52  ? -5.156  -39.061 64.406 1.00 40.75  ? 52   GLU F CG    1 
ATOM   4100  C  CD    . GLU F 2 52  ? -4.314  -39.554 63.229 1.00 44.23  ? 52   GLU F CD    1 
ATOM   4101  O  OE1   . GLU F 2 52  ? -4.919  -40.078 62.259 1.00 46.64  ? 52   GLU F OE1   1 
ATOM   4102  O  OE2   . GLU F 2 52  ? -3.059  -39.419 63.270 1.00 43.70  ? 52   GLU F OE2   1 
ATOM   4103  N  N     . GLU F 2 53  ? -7.960  -35.631 63.021 1.00 36.00  ? 53   GLU F N     1 
ATOM   4104  C  CA    . GLU F 2 53  ? -9.100  -35.076 62.320 1.00 35.51  ? 53   GLU F CA    1 
ATOM   4105  C  C     . GLU F 2 53  ? -8.579  -34.208 61.187 1.00 34.97  ? 53   GLU F C     1 
ATOM   4106  O  O     . GLU F 2 53  ? -9.050  -34.301 60.054 1.00 35.13  ? 53   GLU F O     1 
ATOM   4107  C  CB    . GLU F 2 53  ? -9.968  -34.265 63.277 1.00 35.41  ? 53   GLU F CB    1 
ATOM   4108  C  CG    . GLU F 2 53  ? -11.340 -33.917 62.746 1.00 37.49  ? 53   GLU F CG    1 
ATOM   4109  C  CD    . GLU F 2 53  ? -12.371 -35.040 62.883 1.00 41.28  ? 53   GLU F CD    1 
ATOM   4110  O  OE1   . GLU F 2 53  ? -12.163 -35.976 63.691 1.00 41.44  ? 53   GLU F OE1   1 
ATOM   4111  O  OE2   . GLU F 2 53  ? -13.410 -34.976 62.178 1.00 43.18  ? 53   GLU F OE2   1 
ATOM   4112  N  N     . THR F 2 54  ? -7.578  -33.388 61.491 1.00 34.38  ? 54   THR F N     1 
ATOM   4113  C  CA    . THR F 2 54  ? -7.016  -32.485 60.507 1.00 33.62  ? 54   THR F CA    1 
ATOM   4114  C  C     . THR F 2 54  ? -6.302  -33.278 59.414 1.00 33.34  ? 54   THR F C     1 
ATOM   4115  O  O     . THR F 2 54  ? -6.400  -32.939 58.233 1.00 33.92  ? 54   THR F O     1 
ATOM   4116  C  CB    . THR F 2 54  ? -6.112  -31.427 61.167 1.00 33.58  ? 54   THR F CB    1 
ATOM   4117  O  OG1   . THR F 2 54  ? -6.916  -30.631 62.031 1.00 34.15  ? 54   THR F OG1   1 
ATOM   4118  C  CG2   . THR F 2 54  ? -5.480  -30.493 60.148 1.00 32.07  ? 54   THR F CG2   1 
ATOM   4119  N  N     . ARG F 2 55  ? -5.612  -34.344 59.792 1.00 32.48  ? 55   ARG F N     1 
ATOM   4120  C  CA    . ARG F 2 55  ? -4.972  -35.187 58.796 1.00 31.88  ? 55   ARG F CA    1 
ATOM   4121  C  C     . ARG F 2 55  ? -6.022  -35.740 57.827 1.00 31.49  ? 55   ARG F C     1 
ATOM   4122  O  O     . ARG F 2 55  ? -5.886  -35.619 56.609 1.00 31.28  ? 55   ARG F O     1 
ATOM   4123  C  CB    . ARG F 2 55  ? -4.146  -36.285 59.464 1.00 31.80  ? 55   ARG F CB    1 
ATOM   4124  C  CG    . ARG F 2 55  ? -2.903  -35.727 60.114 1.00 31.67  ? 55   ARG F CG    1 
ATOM   4125  C  CD    . ARG F 2 55  ? -1.855  -36.803 60.418 1.00 31.56  ? 55   ARG F CD    1 
ATOM   4126  N  NE    . ARG F 2 55  ? -0.776  -36.245 61.239 1.00 28.50  ? 55   ARG F NE    1 
ATOM   4127  C  CZ    . ARG F 2 55  ? -0.730  -36.263 62.571 1.00 26.59  ? 55   ARG F CZ    1 
ATOM   4128  N  NH1   . ARG F 2 55  ? -1.691  -36.829 63.296 1.00 25.55  ? 55   ARG F NH1   1 
ATOM   4129  N  NH2   . ARG F 2 55  ? 0.297   -35.702 63.180 1.00 27.19  ? 55   ARG F NH2   1 
ATOM   4130  N  N     . GLY F 2 56  ? -7.090  -36.301 58.377 1.00 31.05  ? 56   GLY F N     1 
ATOM   4131  C  CA    . GLY F 2 56  ? -8.228  -36.721 57.574 1.00 30.51  ? 56   GLY F CA    1 
ATOM   4132  C  C     . GLY F 2 56  ? -8.746  -35.617 56.672 1.00 30.39  ? 56   GLY F C     1 
ATOM   4133  O  O     . GLY F 2 56  ? -8.884  -35.836 55.462 1.00 30.63  ? 56   GLY F O     1 
ATOM   4134  N  N     . VAL F 2 57  ? -9.017  -34.435 57.247 1.00 29.73  ? 57   VAL F N     1 
ATOM   4135  C  CA    . VAL F 2 57  ? -9.562  -33.292 56.490 1.00 29.03  ? 57   VAL F CA    1 
ATOM   4136  C  C     . VAL F 2 57  ? -8.606  -32.825 55.407 1.00 29.09  ? 57   VAL F C     1 
ATOM   4137  O  O     . VAL F 2 57  ? -9.019  -32.513 54.291 1.00 29.38  ? 57   VAL F O     1 
ATOM   4138  C  CB    . VAL F 2 57  ? -9.925  -32.097 57.391 1.00 28.98  ? 57   VAL F CB    1 
ATOM   4139  C  CG1   . VAL F 2 57  ? -10.128 -30.845 56.556 1.00 27.63  ? 57   VAL F CG1   1 
ATOM   4140  C  CG2   . VAL F 2 57  ? -11.169 -32.405 58.230 1.00 28.34  ? 57   VAL F CG2   1 
ATOM   4141  N  N     . LEU F 2 58  ? -7.325  -32.792 55.721 1.00 28.88  ? 58   LEU F N     1 
ATOM   4142  C  CA    . LEU F 2 58  ? -6.357  -32.468 54.704 1.00 29.58  ? 58   LEU F CA    1 
ATOM   4143  C  C     . LEU F 2 58  ? -6.435  -33.470 53.540 1.00 30.20  ? 58   LEU F C     1 
ATOM   4144  O  O     . LEU F 2 58  ? -6.480  -33.070 52.373 1.00 30.63  ? 58   LEU F O     1 
ATOM   4145  C  CB    . LEU F 2 58  ? -4.947  -32.408 55.298 1.00 29.46  ? 58   LEU F CB    1 
ATOM   4146  C  CG    . LEU F 2 58  ? -3.829  -32.119 54.294 1.00 29.70  ? 58   LEU F CG    1 
ATOM   4147  C  CD1   . LEU F 2 58  ? -4.098  -30.845 53.518 1.00 31.07  ? 58   LEU F CD1   1 
ATOM   4148  C  CD2   . LEU F 2 58  ? -2.481  -32.063 54.991 1.00 29.82  ? 58   LEU F CD2   1 
ATOM   4149  N  N     . LYS F 2 59  ? -6.476  -34.763 53.868 1.00 30.47  ? 59   LYS F N     1 
ATOM   4150  C  CA    . LYS F 2 59  ? -6.438  -35.833 52.882 1.00 30.67  ? 59   LYS F CA    1 
ATOM   4151  C  C     . LYS F 2 59  ? -7.601  -35.783 51.891 1.00 30.09  ? 59   LYS F C     1 
ATOM   4152  O  O     . LYS F 2 59  ? -7.423  -36.022 50.694 1.00 29.94  ? 59   LYS F O     1 
ATOM   4153  C  CB    . LYS F 2 59  ? -6.381  -37.183 53.594 1.00 31.76  ? 59   LYS F CB    1 
ATOM   4154  C  CG    . LYS F 2 59  ? -6.249  -38.376 52.664 1.00 35.39  ? 59   LYS F CG    1 
ATOM   4155  C  CD    . LYS F 2 59  ? -5.466  -39.512 53.268 1.00 40.21  ? 59   LYS F CD    1 
ATOM   4156  C  CE    . LYS F 2 59  ? -5.924  -40.850 52.652 1.00 44.63  ? 59   LYS F CE    1 
ATOM   4157  N  NZ    . LYS F 2 59  ? -7.401  -41.134 52.870 1.00 46.04  ? 59   LYS F NZ    1 
ATOM   4158  N  N     . VAL F 2 60  ? -8.791  -35.473 52.384 1.00 29.65  ? 60   VAL F N     1 
ATOM   4159  C  CA    . VAL F 2 60  ? -9.939  -35.347 51.498 1.00 28.94  ? 60   VAL F CA    1 
ATOM   4160  C  C     . VAL F 2 60  ? -9.723  -34.139 50.633 1.00 29.21  ? 60   VAL F C     1 
ATOM   4161  O  O     . VAL F 2 60  ? -10.063 -34.171 49.456 1.00 29.42  ? 60   VAL F O     1 
ATOM   4162  C  CB    . VAL F 2 60  ? -11.269 -35.150 52.249 1.00 28.95  ? 60   VAL F CB    1 
ATOM   4163  C  CG1   . VAL F 2 60  ? -12.316 -34.521 51.332 1.00 26.81  ? 60   VAL F CG1   1 
ATOM   4164  C  CG2   . VAL F 2 60  ? -11.766 -36.462 52.865 1.00 27.75  ? 60   VAL F CG2   1 
ATOM   4165  N  N     . PHE F 2 61  ? -9.166  -33.074 51.210 1.00 28.99  ? 61   PHE F N     1 
ATOM   4166  C  CA    . PHE F 2 61  ? -8.963  -31.862 50.439 1.00 29.21  ? 61   PHE F CA    1 
ATOM   4167  C  C     . PHE F 2 61  ? -8.040  -32.151 49.272 1.00 29.64  ? 61   PHE F C     1 
ATOM   4168  O  O     . PHE F 2 61  ? -8.354  -31.832 48.117 1.00 29.46  ? 61   PHE F O     1 
ATOM   4169  C  CB    . PHE F 2 61  ? -8.398  -30.726 51.288 1.00 29.23  ? 61   PHE F CB    1 
ATOM   4170  C  CG    . PHE F 2 61  ? -8.113  -29.485 50.502 1.00 28.75  ? 61   PHE F CG    1 
ATOM   4171  C  CD1   . PHE F 2 61  ? -9.097  -28.528 50.310 1.00 28.37  ? 61   PHE F CD1   1 
ATOM   4172  C  CD2   . PHE F 2 61  ? -6.871  -29.289 49.915 1.00 29.18  ? 61   PHE F CD2   1 
ATOM   4173  C  CE1   . PHE F 2 61  ? -8.843  -27.396 49.541 1.00 28.46  ? 61   PHE F CE1   1 
ATOM   4174  C  CE2   . PHE F 2 61  ? -6.610  -28.143 49.158 1.00 28.79  ? 61   PHE F CE2   1 
ATOM   4175  C  CZ    . PHE F 2 61  ? -7.599  -27.206 48.972 1.00 27.98  ? 61   PHE F CZ    1 
ATOM   4176  N  N     . LEU F 2 62  ? -6.914  -32.786 49.574 1.00 30.39  ? 62   LEU F N     1 
ATOM   4177  C  CA    . LEU F 2 62  ? -5.936  -33.109 48.547 1.00 31.24  ? 62   LEU F CA    1 
ATOM   4178  C  C     . LEU F 2 62  ? -6.458  -34.057 47.473 1.00 31.65  ? 62   LEU F C     1 
ATOM   4179  O  O     . LEU F 2 62  ? -6.315  -33.785 46.289 1.00 31.72  ? 62   LEU F O     1 
ATOM   4180  C  CB    . LEU F 2 62  ? -4.648  -33.612 49.172 1.00 31.20  ? 62   LEU F CB    1 
ATOM   4181  C  CG    . LEU F 2 62  ? -3.750  -32.428 49.541 1.00 32.00  ? 62   LEU F CG    1 
ATOM   4182  C  CD1   . LEU F 2 62  ? -2.660  -32.847 50.501 1.00 32.40  ? 62   LEU F CD1   1 
ATOM   4183  C  CD2   . LEU F 2 62  ? -3.151  -31.759 48.288 1.00 31.16  ? 62   LEU F CD2   1 
ATOM   4184  N  N     . GLU F 2 63  ? -7.090  -35.148 47.891 1.00 32.59  ? 63   GLU F N     1 
ATOM   4185  C  CA    . GLU F 2 63  ? -7.700  -36.095 46.957 1.00 33.26  ? 63   GLU F CA    1 
ATOM   4186  C  C     . GLU F 2 63  ? -8.479  -35.364 45.868 1.00 33.46  ? 63   GLU F C     1 
ATOM   4187  O  O     . GLU F 2 63  ? -8.245  -35.581 44.668 1.00 33.58  ? 63   GLU F O     1 
ATOM   4188  C  CB    . GLU F 2 63  ? -8.627  -37.052 47.701 1.00 33.33  ? 63   GLU F CB    1 
ATOM   4189  C  CG    . GLU F 2 63  ? -7.955  -38.322 48.191 1.00 35.14  ? 63   GLU F CG    1 
ATOM   4190  C  CD    . GLU F 2 63  ? -8.727  -39.012 49.327 1.00 37.78  ? 63   GLU F CD    1 
ATOM   4191  O  OE1   . GLU F 2 63  ? -9.984  -38.955 49.326 1.00 37.49  ? 63   GLU F OE1   1 
ATOM   4192  O  OE2   . GLU F 2 63  ? -8.065  -39.608 50.224 1.00 38.46  ? 63   GLU F OE2   1 
ATOM   4193  N  N     . ASN F 2 64  ? -9.385  -34.483 46.291 1.00 33.41  ? 64   ASN F N     1 
ATOM   4194  C  CA    . ASN F 2 64  ? -10.244 -33.763 45.367 1.00 33.50  ? 64   ASN F CA    1 
ATOM   4195  C  C     . ASN F 2 64  ? -9.501  -32.824 44.436 1.00 33.62  ? 64   ASN F C     1 
ATOM   4196  O  O     . ASN F 2 64  ? -9.822  -32.740 43.258 1.00 33.11  ? 64   ASN F O     1 
ATOM   4197  C  CB    . ASN F 2 64  ? -11.321 -33.020 46.133 1.00 33.66  ? 64   ASN F CB    1 
ATOM   4198  C  CG    . ASN F 2 64  ? -12.297 -33.956 46.787 1.00 34.73  ? 64   ASN F CG    1 
ATOM   4199  O  OD1   . ASN F 2 64  ? -12.672 -34.970 46.210 1.00 36.97  ? 64   ASN F OD1   1 
ATOM   4200  N  ND2   . ASN F 2 64  ? -12.718 -33.628 47.997 1.00 36.92  ? 64   ASN F ND2   1 
ATOM   4201  N  N     . VAL F 2 65  ? -8.502  -32.122 44.957 1.00 34.19  ? 65   VAL F N     1 
ATOM   4202  C  CA    . VAL F 2 65  ? -7.746  -31.213 44.107 1.00 35.01  ? 65   VAL F CA    1 
ATOM   4203  C  C     . VAL F 2 65  ? -6.813  -31.967 43.161 1.00 35.37  ? 65   VAL F C     1 
ATOM   4204  O  O     . VAL F 2 65  ? -6.641  -31.556 42.018 1.00 35.46  ? 65   VAL F O     1 
ATOM   4205  C  CB    . VAL F 2 65  ? -6.986  -30.143 44.908 1.00 35.02  ? 65   VAL F CB    1 
ATOM   4206  C  CG1   . VAL F 2 65  ? -6.178  -29.275 43.992 1.00 35.22  ? 65   VAL F CG1   1 
ATOM   4207  C  CG2   . VAL F 2 65  ? -7.960  -29.273 45.656 1.00 35.24  ? 65   VAL F CG2   1 
ATOM   4208  N  N     . ILE F 2 66  ? -6.237  -33.075 43.620 1.00 35.90  ? 66   ILE F N     1 
ATOM   4209  C  CA    . ILE F 2 66  ? -5.366  -33.875 42.766 1.00 36.43  ? 66   ILE F CA    1 
ATOM   4210  C  C     . ILE F 2 66  ? -6.137  -34.665 41.714 1.00 37.30  ? 66   ILE F C     1 
ATOM   4211  O  O     . ILE F 2 66  ? -5.730  -34.681 40.547 1.00 37.35  ? 66   ILE F O     1 
ATOM   4212  C  CB    . ILE F 2 66  ? -4.458  -34.775 43.565 1.00 36.37  ? 66   ILE F CB    1 
ATOM   4213  C  CG1   . ILE F 2 66  ? -3.341  -33.949 44.187 1.00 36.20  ? 66   ILE F CG1   1 
ATOM   4214  C  CG2   . ILE F 2 66  ? -3.836  -35.828 42.670 1.00 37.31  ? 66   ILE F CG2   1 
ATOM   4215  C  CD1   . ILE F 2 66  ? -3.061  -34.323 45.603 1.00 37.09  ? 66   ILE F CD1   1 
ATOM   4216  N  N     . ARG F 2 67  ? -7.247  -35.303 42.102 1.00 38.09  ? 67   ARG F N     1 
ATOM   4217  C  CA    . ARG F 2 67  ? -8.102  -35.995 41.118 1.00 39.17  ? 67   ARG F CA    1 
ATOM   4218  C  C     . ARG F 2 67  ? -8.342  -35.095 39.896 1.00 38.56  ? 67   ARG F C     1 
ATOM   4219  O  O     . ARG F 2 67  ? -7.959  -35.448 38.779 1.00 39.24  ? 67   ARG F O     1 
ATOM   4220  C  CB    . ARG F 2 67  ? -9.429  -36.466 41.734 1.00 39.07  ? 67   ARG F CB    1 
ATOM   4221  C  CG    . ARG F 2 67  ? -10.349 -37.233 40.752 1.00 40.92  ? 67   ARG F CG    1 
ATOM   4222  C  CD    . ARG F 2 67  ? -11.747 -37.546 41.343 1.00 42.00  ? 67   ARG F CD    1 
ATOM   4223  N  NE    . ARG F 2 67  ? -11.673 -38.471 42.482 1.00 49.28  ? 67   ARG F NE    1 
ATOM   4224  C  CZ    . ARG F 2 67  ? -11.977 -38.177 43.756 1.00 51.71  ? 67   ARG F CZ    1 
ATOM   4225  N  NH1   . ARG F 2 67  ? -12.429 -36.965 44.101 1.00 50.53  ? 67   ARG F NH1   1 
ATOM   4226  N  NH2   . ARG F 2 67  ? -11.852 -39.125 44.693 1.00 52.44  ? 67   ARG F NH2   1 
ATOM   4227  N  N     . ASP F 2 68  ? -8.926  -33.921 40.123 1.00 37.98  ? 68   ASP F N     1 
ATOM   4228  C  CA    . ASP F 2 68  ? -9.176  -32.947 39.052 1.00 37.49  ? 68   ASP F CA    1 
ATOM   4229  C  C     . ASP F 2 68  ? -7.928  -32.533 38.291 1.00 36.95  ? 68   ASP F C     1 
ATOM   4230  O  O     . ASP F 2 68  ? -7.969  -32.420 37.071 1.00 36.61  ? 68   ASP F O     1 
ATOM   4231  C  CB    . ASP F 2 68  ? -9.871  -31.693 39.583 1.00 37.52  ? 68   ASP F CB    1 
ATOM   4232  C  CG    . ASP F 2 68  ? -11.290 -31.950 39.996 1.00 37.51  ? 68   ASP F CG    1 
ATOM   4233  O  OD1   . ASP F 2 68  ? -11.700 -33.124 40.009 1.00 39.07  ? 68   ASP F OD1   1 
ATOM   4234  O  OD2   . ASP F 2 68  ? -11.995 -30.976 40.323 1.00 38.28  ? 68   ASP F OD2   1 
ATOM   4235  N  N     . ALA F 2 69  ? -6.830  -32.294 39.003 1.00 36.42  ? 69   ALA F N     1 
ATOM   4236  C  CA    . ALA F 2 69  ? -5.600  -31.866 38.339 1.00 36.29  ? 69   ALA F CA    1 
ATOM   4237  C  C     . ALA F 2 69  ? -5.163  -32.956 37.363 1.00 36.40  ? 69   ALA F C     1 
ATOM   4238  O  O     . ALA F 2 69  ? -5.006  -32.712 36.158 1.00 36.25  ? 69   ALA F O     1 
ATOM   4239  C  CB    . ALA F 2 69  ? -4.514  -31.575 39.349 1.00 35.84  ? 69   ALA F CB    1 
ATOM   4240  N  N     . VAL F 2 70  ? -5.020  -34.168 37.894 1.00 36.49  ? 70   VAL F N     1 
ATOM   4241  C  CA    . VAL F 2 70  ? -4.671  -35.339 37.105 1.00 36.20  ? 70   VAL F CA    1 
ATOM   4242  C  C     . VAL F 2 70  ? -5.700  -35.564 35.982 1.00 36.51  ? 70   VAL F C     1 
ATOM   4243  O  O     . VAL F 2 70  ? -5.354  -36.081 34.925 1.00 36.82  ? 70   VAL F O     1 
ATOM   4244  C  CB    . VAL F 2 70  ? -4.486  -36.594 37.996 1.00 35.84  ? 70   VAL F CB    1 
ATOM   4245  C  CG1   . VAL F 2 70  ? -4.143  -37.793 37.157 1.00 35.33  ? 70   VAL F CG1   1 
ATOM   4246  C  CG2   . VAL F 2 70  ? -3.389  -36.355 39.028 1.00 34.55  ? 70   VAL F CG2   1 
ATOM   4247  N  N     . THR F 2 71  ? -6.943  -35.139 36.169 1.00 36.38  ? 71   THR F N     1 
ATOM   4248  C  CA    . THR F 2 71  ? -7.862  -35.219 35.048 1.00 36.80  ? 71   THR F CA    1 
ATOM   4249  C  C     . THR F 2 71  ? -7.504  -34.250 33.894 1.00 38.12  ? 71   THR F C     1 
ATOM   4250  O  O     . THR F 2 71  ? -7.714  -34.585 32.725 1.00 39.29  ? 71   THR F O     1 
ATOM   4251  C  CB    . THR F 2 71  ? -9.319  -35.104 35.468 1.00 36.38  ? 71   THR F CB    1 
ATOM   4252  O  OG1   . THR F 2 71  ? -9.591  -36.035 36.515 1.00 34.66  ? 71   THR F OG1   1 
ATOM   4253  C  CG2   . THR F 2 71  ? -10.220 -35.425 34.314 1.00 35.35  ? 71   THR F CG2   1 
ATOM   4254  N  N     . TYR F 2 72  ? -6.955  -33.073 34.202 1.00 38.56  ? 72   TYR F N     1 
ATOM   4255  C  CA    . TYR F 2 72  ? -6.472  -32.157 33.158 1.00 38.88  ? 72   TYR F CA    1 
ATOM   4256  C  C     . TYR F 2 72  ? -5.191  -32.679 32.487 1.00 39.92  ? 72   TYR F C     1 
ATOM   4257  O  O     . TYR F 2 72  ? -5.003  -32.552 31.272 1.00 39.86  ? 72   TYR F O     1 
ATOM   4258  C  CB    . TYR F 2 72  ? -6.239  -30.745 33.723 1.00 38.23  ? 72   TYR F CB    1 
ATOM   4259  C  CG    . TYR F 2 72  ? -7.521  -29.984 34.000 1.00 37.08  ? 72   TYR F CG    1 
ATOM   4260  C  CD1   . TYR F 2 72  ? -7.891  -29.638 35.297 1.00 36.23  ? 72   TYR F CD1   1 
ATOM   4261  C  CD2   . TYR F 2 72  ? -8.365  -29.618 32.961 1.00 36.22  ? 72   TYR F CD2   1 
ATOM   4262  C  CE1   . TYR F 2 72  ? -9.073  -28.952 35.550 1.00 35.11  ? 72   TYR F CE1   1 
ATOM   4263  C  CE2   . TYR F 2 72  ? -9.530  -28.942 33.199 1.00 36.26  ? 72   TYR F CE2   1 
ATOM   4264  C  CZ    . TYR F 2 72  ? -9.889  -28.614 34.496 1.00 36.23  ? 72   TYR F CZ    1 
ATOM   4265  O  OH    . TYR F 2 72  ? -11.072 -27.945 34.709 1.00 36.26  ? 72   TYR F OH    1 
ATOM   4266  N  N     . THR F 2 73  ? -4.306  -33.266 33.287 1.00 41.02  ? 73   THR F N     1 
ATOM   4267  C  CA    . THR F 2 73  ? -3.057  -33.807 32.769 1.00 41.88  ? 73   THR F CA    1 
ATOM   4268  C  C     . THR F 2 73  ? -3.322  -34.867 31.727 1.00 42.53  ? 73   THR F C     1 
ATOM   4269  O  O     . THR F 2 73  ? -2.796  -34.786 30.630 1.00 42.27  ? 73   THR F O     1 
ATOM   4270  C  CB    . THR F 2 73  ? -2.246  -34.456 33.862 1.00 41.75  ? 73   THR F CB    1 
ATOM   4271  O  OG1   . THR F 2 73  ? -2.277  -33.622 35.018 1.00 42.04  ? 73   THR F OG1   1 
ATOM   4272  C  CG2   . THR F 2 73  ? -0.812  -34.657 33.400 1.00 42.05  ? 73   THR F CG2   1 
ATOM   4273  N  N     . GLU F 2 74  ? -4.143  -35.854 32.080 1.00 43.54  ? 74   GLU F N     1 
ATOM   4274  C  CA    . GLU F 2 74  ? -4.421  -36.966 31.181 1.00 45.02  ? 74   GLU F CA    1 
ATOM   4275  C  C     . GLU F 2 74  ? -5.108  -36.480 29.923 1.00 45.52  ? 74   GLU F C     1 
ATOM   4276  O  O     . GLU F 2 74  ? -4.820  -36.981 28.823 1.00 45.44  ? 74   GLU F O     1 
ATOM   4277  C  CB    . GLU F 2 74  ? -5.307  -38.015 31.836 1.00 45.41  ? 74   GLU F CB    1 
ATOM   4278  C  CG    . GLU F 2 74  ? -4.650  -38.873 32.913 1.00 47.45  ? 74   GLU F CG    1 
ATOM   4279  C  CD    . GLU F 2 74  ? -5.696  -39.700 33.647 1.00 50.40  ? 74   GLU F CD    1 
ATOM   4280  O  OE1   . GLU F 2 74  ? -6.779  -39.910 33.047 1.00 51.84  ? 74   GLU F OE1   1 
ATOM   4281  O  OE2   . GLU F 2 74  ? -5.460  -40.119 34.808 1.00 50.57  ? 74   GLU F OE2   1 
ATOM   4282  N  N     . HIS F 2 75  ? -6.020  -35.515 30.076 1.00 45.98  ? 75   HIS F N     1 
ATOM   4283  C  CA    . HIS F 2 75  ? -6.670  -34.947 28.904 1.00 46.46  ? 75   HIS F CA    1 
ATOM   4284  C  C     . HIS F 2 75  ? -5.672  -34.284 27.961 1.00 46.67  ? 75   HIS F C     1 
ATOM   4285  O  O     . HIS F 2 75  ? -5.851  -34.311 26.743 1.00 47.10  ? 75   HIS F O     1 
ATOM   4286  C  CB    . HIS F 2 75  ? -7.758  -33.956 29.252 1.00 46.59  ? 75   HIS F CB    1 
ATOM   4287  C  CG    . HIS F 2 75  ? -8.510  -33.494 28.049 1.00 47.98  ? 75   HIS F CG    1 
ATOM   4288  N  ND1   . HIS F 2 75  ? -9.762  -33.971 27.728 1.00 49.05  ? 75   HIS F ND1   1 
ATOM   4289  C  CD2   . HIS F 2 75  ? -8.158  -32.648 27.050 1.00 48.88  ? 75   HIS F CD2   1 
ATOM   4290  C  CE1   . HIS F 2 75  ? -10.165 -33.412 26.600 1.00 50.27  ? 75   HIS F CE1   1 
ATOM   4291  N  NE2   . HIS F 2 75  ? -9.207  -32.610 26.164 1.00 50.28  ? 75   HIS F NE2   1 
ATOM   4292  N  N     . ALA F 2 76  ? -4.627  -33.685 28.520 1.00 46.55  ? 76   ALA F N     1 
ATOM   4293  C  CA    . ALA F 2 76  ? -3.580  -33.096 27.704 1.00 46.45  ? 76   ALA F CA    1 
ATOM   4294  C  C     . ALA F 2 76  ? -2.624  -34.155 27.138 1.00 46.40  ? 76   ALA F C     1 
ATOM   4295  O  O     . ALA F 2 76  ? -1.769  -33.837 26.324 1.00 46.37  ? 76   ALA F O     1 
ATOM   4296  C  CB    . ALA F 2 76  ? -2.817  -32.050 28.502 1.00 46.65  ? 76   ALA F CB    1 
ATOM   4297  N  N     . LYS F 2 77  ? -2.783  -35.407 27.561 1.00 46.42  ? 77   LYS F N     1 
ATOM   4298  C  CA    . LYS F 2 77  ? -1.883  -36.508 27.156 1.00 46.96  ? 77   LYS F CA    1 
ATOM   4299  C  C     . LYS F 2 77  ? -0.455  -36.315 27.678 1.00 46.50  ? 77   LYS F C     1 
ATOM   4300  O  O     . LYS F 2 77  ? 0.523   -36.535 26.955 1.00 47.17  ? 77   LYS F O     1 
ATOM   4301  C  CB    . LYS F 2 77  ? -1.887  -36.731 25.626 1.00 46.82  ? 77   LYS F CB    1 
ATOM   4302  C  CG    . LYS F 2 77  ? -3.152  -37.390 25.085 1.00 47.39  ? 77   LYS F CG    1 
ATOM   4303  C  CD    . LYS F 2 77  ? -3.282  -37.195 23.579 1.00 48.13  ? 77   LYS F CD    1 
ATOM   4304  C  CE    . LYS F 2 77  ? -4.662  -37.668 23.081 1.00 51.32  ? 77   LYS F CE    1 
ATOM   4305  N  NZ    . LYS F 2 77  ? -4.995  -37.136 21.712 1.00 52.94  ? 77   LYS F NZ    1 
ATOM   4306  N  N     . ARG F 2 78  ? -0.342  -35.920 28.938 1.00 45.71  ? 78   ARG F N     1 
ATOM   4307  C  CA    . ARG F 2 78  ? 0.941   -35.680 29.544 1.00 45.07  ? 78   ARG F CA    1 
ATOM   4308  C  C     . ARG F 2 78  ? 1.205   -36.648 30.679 1.00 45.30  ? 78   ARG F C     1 
ATOM   4309  O  O     . ARG F 2 78  ? 0.284   -37.287 31.202 1.00 45.21  ? 78   ARG F O     1 
ATOM   4310  C  CB    . ARG F 2 78  ? 1.016   -34.250 30.058 1.00 45.11  ? 78   ARG F CB    1 
ATOM   4311  C  CG    . ARG F 2 78  ? 1.408   -33.234 29.005 1.00 44.49  ? 78   ARG F CG    1 
ATOM   4312  C  CD    . ARG F 2 78  ? 1.580   -31.838 29.604 1.00 42.78  ? 78   ARG F CD    1 
ATOM   4313  N  NE    . ARG F 2 78  ? 0.292   -31.185 29.863 1.00 41.21  ? 78   ARG F NE    1 
ATOM   4314  C  CZ    . ARG F 2 78  ? -0.237  -30.999 31.072 1.00 38.43  ? 78   ARG F CZ    1 
ATOM   4315  N  NH1   . ARG F 2 78  ? 0.406   -31.412 32.157 1.00 36.90  ? 78   ARG F NH1   1 
ATOM   4316  N  NH2   . ARG F 2 78  ? -1.404  -30.386 31.193 1.00 35.13  ? 78   ARG F NH2   1 
ATOM   4317  N  N     . LYS F 2 79  ? 2.480   -36.753 31.046 1.00 45.50  ? 79   LYS F N     1 
ATOM   4318  C  CA    . LYS F 2 79  ? 2.909   -37.519 32.202 1.00 45.80  ? 79   LYS F CA    1 
ATOM   4319  C  C     . LYS F 2 79  ? 3.190   -36.591 33.380 1.00 45.42  ? 79   LYS F C     1 
ATOM   4320  O  O     . LYS F 2 79  ? 3.341   -37.053 34.508 1.00 45.74  ? 79   LYS F O     1 
ATOM   4321  C  CB    . LYS F 2 79  ? 4.168   -38.327 31.879 1.00 46.32  ? 79   LYS F CB    1 
ATOM   4322  C  CG    . LYS F 2 79  ? 3.939   -39.728 31.292 1.00 48.80  ? 79   LYS F CG    1 
ATOM   4323  C  CD    . LYS F 2 79  ? 5.049   -40.698 31.779 1.00 52.61  ? 79   LYS F CD    1 
ATOM   4324  C  CE    . LYS F 2 79  ? 5.209   -41.924 30.850 1.00 55.51  ? 79   LYS F CE    1 
ATOM   4325  N  NZ    . LYS F 2 79  ? 6.604   -42.515 30.850 1.00 55.30  ? 79   LYS F NZ    1 
ATOM   4326  N  N     . THR F 2 80  ? 3.256   -35.288 33.122 1.00 45.07  ? 80   THR F N     1 
ATOM   4327  C  CA    . THR F 2 80  ? 3.612   -34.315 34.159 1.00 44.82  ? 80   THR F CA    1 
ATOM   4328  C  C     . THR F 2 80  ? 2.432   -33.456 34.581 1.00 44.29  ? 80   THR F C     1 
ATOM   4329  O  O     . THR F 2 80  ? 1.861   -32.726 33.766 1.00 44.40  ? 80   THR F O     1 
ATOM   4330  C  CB    . THR F 2 80  ? 4.706   -33.348 33.683 1.00 44.76  ? 80   THR F CB    1 
ATOM   4331  O  OG1   . THR F 2 80  ? 5.547   -34.001 32.730 1.00 46.55  ? 80   THR F OG1   1 
ATOM   4332  C  CG2   . THR F 2 80  ? 5.545   -32.888 34.850 1.00 45.33  ? 80   THR F CG2   1 
ATOM   4333  N  N     . VAL F 2 81  ? 2.072   -33.532 35.858 1.00 43.62  ? 81   VAL F N     1 
ATOM   4334  C  CA    . VAL F 2 81  ? 1.108   -32.595 36.418 1.00 42.61  ? 81   VAL F CA    1 
ATOM   4335  C  C     . VAL F 2 81  ? 1.771   -31.219 36.503 1.00 42.35  ? 81   VAL F C     1 
ATOM   4336  O  O     . VAL F 2 81  ? 2.826   -31.058 37.135 1.00 42.08  ? 81   VAL F O     1 
ATOM   4337  C  CB    . VAL F 2 81  ? 0.639   -33.012 37.806 1.00 42.47  ? 81   VAL F CB    1 
ATOM   4338  C  CG1   . VAL F 2 81  ? -0.403  -32.014 38.309 1.00 41.97  ? 81   VAL F CG1   1 
ATOM   4339  C  CG2   . VAL F 2 81  ? 0.082   -34.430 37.768 1.00 41.36  ? 81   VAL F CG2   1 
ATOM   4340  N  N     . THR F 2 82  ? 1.154   -30.242 35.845 1.00 41.75  ? 82   THR F N     1 
ATOM   4341  C  CA    . THR F 2 82  ? 1.676   -28.882 35.805 1.00 41.10  ? 82   THR F CA    1 
ATOM   4342  C  C     . THR F 2 82  ? 1.006   -28.010 36.861 1.00 40.90  ? 82   THR F C     1 
ATOM   4343  O  O     . THR F 2 82  ? -0.045  -28.365 37.399 1.00 40.56  ? 82   THR F O     1 
ATOM   4344  C  CB    . THR F 2 82  ? 1.467   -28.220 34.419 1.00 40.95  ? 82   THR F CB    1 
ATOM   4345  O  OG1   . THR F 2 82  ? 0.091   -28.316 34.040 1.00 40.30  ? 82   THR F OG1   1 
ATOM   4346  C  CG2   . THR F 2 82  ? 2.314   -28.880 33.375 1.00 40.30  ? 82   THR F CG2   1 
ATOM   4347  N  N     . ALA F 2 83  ? 1.620   -26.858 37.139 1.00 40.58  ? 83   ALA F N     1 
ATOM   4348  C  CA    . ALA F 2 83  ? 1.023   -25.862 38.014 1.00 39.79  ? 83   ALA F CA    1 
ATOM   4349  C  C     . ALA F 2 83  ? -0.302  -25.421 37.416 1.00 39.75  ? 83   ALA F C     1 
ATOM   4350  O  O     . ALA F 2 83  ? -1.286  -25.227 38.139 1.00 40.18  ? 83   ALA F O     1 
ATOM   4351  C  CB    . ALA F 2 83  ? 1.932   -24.708 38.172 1.00 39.32  ? 83   ALA F CB    1 
ATOM   4352  N  N     . MET F 2 84  ? -0.343  -25.293 36.091 1.00 39.23  ? 84   MET F N     1 
ATOM   4353  C  CA    . MET F 2 84  ? -1.576  -24.917 35.442 1.00 38.56  ? 84   MET F CA    1 
ATOM   4354  C  C     . MET F 2 84  ? -2.658  -25.947 35.712 1.00 38.34  ? 84   MET F C     1 
ATOM   4355  O  O     . MET F 2 84  ? -3.769  -25.567 36.068 1.00 38.60  ? 84   MET F O     1 
ATOM   4356  C  CB    . MET F 2 84  ? -1.383  -24.633 33.952 1.00 38.49  ? 84   MET F CB    1 
ATOM   4357  C  CG    . MET F 2 84  ? -0.823  -23.219 33.655 1.00 39.54  ? 84   MET F CG    1 
ATOM   4358  S  SD    . MET F 2 84  ? -1.353  -21.860 34.785 1.00 42.79  ? 84   MET F SD    1 
ATOM   4359  C  CE    . MET F 2 84  ? -3.018  -21.544 34.190 1.00 39.96  ? 84   MET F CE    1 
ATOM   4360  N  N     . ASP F 2 85  ? -2.334  -27.239 35.603 1.00 37.89  ? 85   ASP F N     1 
ATOM   4361  C  CA    . ASP F 2 85  ? -3.315  -28.290 35.903 1.00 37.48  ? 85   ASP F CA    1 
ATOM   4362  C  C     . ASP F 2 85  ? -3.916  -28.056 37.291 1.00 37.25  ? 85   ASP F C     1 
ATOM   4363  O  O     . ASP F 2 85  ? -5.125  -28.097 37.456 1.00 37.29  ? 85   ASP F O     1 
ATOM   4364  C  CB    . ASP F 2 85  ? -2.697  -29.699 35.838 1.00 37.89  ? 85   ASP F CB    1 
ATOM   4365  C  CG    . ASP F 2 85  ? -2.198  -30.095 34.437 1.00 39.00  ? 85   ASP F CG    1 
ATOM   4366  O  OD1   . ASP F 2 85  ? -2.767  -29.652 33.417 1.00 40.76  ? 85   ASP F OD1   1 
ATOM   4367  O  OD2   . ASP F 2 85  ? -1.234  -30.885 34.358 1.00 39.56  ? 85   ASP F OD2   1 
ATOM   4368  N  N     . VAL F 2 86  ? -3.060  -27.802 38.281 1.00 36.94  ? 86   VAL F N     1 
ATOM   4369  C  CA    . VAL F 2 86  ? -3.478  -27.517 39.659 1.00 36.77  ? 86   VAL F CA    1 
ATOM   4370  C  C     . VAL F 2 86  ? -4.278  -26.199 39.794 1.00 36.95  ? 86   VAL F C     1 
ATOM   4371  O  O     . VAL F 2 86  ? -5.321  -26.153 40.464 1.00 37.03  ? 86   VAL F O     1 
ATOM   4372  C  CB    . VAL F 2 86  ? -2.249  -27.444 40.572 1.00 36.78  ? 86   VAL F CB    1 
ATOM   4373  C  CG1   . VAL F 2 86  ? -2.649  -27.146 42.011 1.00 35.55  ? 86   VAL F CG1   1 
ATOM   4374  C  CG2   . VAL F 2 86  ? -1.464  -28.733 40.470 1.00 37.05  ? 86   VAL F CG2   1 
ATOM   4375  N  N     . VAL F 2 87  ? -3.782  -25.131 39.176 1.00 36.45  ? 87   VAL F N     1 
ATOM   4376  C  CA    . VAL F 2 87  ? -4.515  -23.879 39.164 1.00 36.28  ? 87   VAL F CA    1 
ATOM   4377  C  C     . VAL F 2 87  ? -5.894  -24.077 38.534 1.00 36.83  ? 87   VAL F C     1 
ATOM   4378  O  O     . VAL F 2 87  ? -6.882  -23.573 39.054 1.00 38.15  ? 87   VAL F O     1 
ATOM   4379  C  CB    . VAL F 2 87  ? -3.755  -22.732 38.444 1.00 35.98  ? 87   VAL F CB    1 
ATOM   4380  C  CG1   . VAL F 2 87  ? -4.644  -21.537 38.321 1.00 34.35  ? 87   VAL F CG1   1 
ATOM   4381  C  CG2   . VAL F 2 87  ? -2.483  -22.363 39.192 1.00 34.88  ? 87   VAL F CG2   1 
ATOM   4382  N  N     . TYR F 2 88  ? -5.986  -24.815 37.436 1.00 36.65  ? 88   TYR F N     1 
ATOM   4383  C  CA    . TYR F 2 88  ? -7.301  -25.076 36.856 1.00 36.70  ? 88   TYR F CA    1 
ATOM   4384  C  C     . TYR F 2 88  ? -8.188  -25.907 37.763 1.00 35.85  ? 88   TYR F C     1 
ATOM   4385  O  O     . TYR F 2 88  ? -9.407  -25.748 37.735 1.00 35.73  ? 88   TYR F O     1 
ATOM   4386  C  CB    . TYR F 2 88  ? -7.204  -25.758 35.484 1.00 37.61  ? 88   TYR F CB    1 
ATOM   4387  C  CG    . TYR F 2 88  ? -6.549  -24.917 34.429 1.00 38.89  ? 88   TYR F CG    1 
ATOM   4388  C  CD1   . TYR F 2 88  ? -5.650  -25.477 33.545 1.00 40.28  ? 88   TYR F CD1   1 
ATOM   4389  C  CD2   . TYR F 2 88  ? -6.808  -23.548 34.332 1.00 41.19  ? 88   TYR F CD2   1 
ATOM   4390  C  CE1   . TYR F 2 88  ? -5.041  -24.723 32.579 1.00 41.15  ? 88   TYR F CE1   1 
ATOM   4391  C  CE2   . TYR F 2 88  ? -6.190  -22.773 33.381 1.00 41.10  ? 88   TYR F CE2   1 
ATOM   4392  C  CZ    . TYR F 2 88  ? -5.313  -23.377 32.499 1.00 40.70  ? 88   TYR F CZ    1 
ATOM   4393  O  OH    . TYR F 2 88  ? -4.686  -22.645 31.530 1.00 40.67  ? 88   TYR F OH    1 
ATOM   4394  N  N     . ALA F 2 89  ? -7.575  -26.803 38.538 1.00 35.09  ? 89   ALA F N     1 
ATOM   4395  C  CA    . ALA F 2 89  ? -8.317  -27.724 39.397 1.00 34.46  ? 89   ALA F CA    1 
ATOM   4396  C  C     . ALA F 2 89  ? -8.875  -26.949 40.554 1.00 34.13  ? 89   ALA F C     1 
ATOM   4397  O  O     . ALA F 2 89  ? -10.035 -27.119 40.928 1.00 34.03  ? 89   ALA F O     1 
ATOM   4398  C  CB    . ALA F 2 89  ? -7.430  -28.821 39.895 1.00 34.35  ? 89   ALA F CB    1 
ATOM   4399  N  N     . LEU F 2 90  ? -8.041  -26.079 41.103 1.00 33.77  ? 90   LEU F N     1 
ATOM   4400  C  CA    . LEU F 2 90  ? -8.450  -25.220 42.186 1.00 33.75  ? 90   LEU F CA    1 
ATOM   4401  C  C     . LEU F 2 90  ? -9.583  -24.273 41.791 1.00 33.91  ? 90   LEU F C     1 
ATOM   4402  O  O     . LEU F 2 90  ? -10.494 -24.046 42.580 1.00 33.35  ? 90   LEU F O     1 
ATOM   4403  C  CB    . LEU F 2 90  ? -7.247  -24.457 42.729 1.00 33.78  ? 90   LEU F CB    1 
ATOM   4404  C  CG    . LEU F 2 90  ? -6.250  -25.255 43.568 1.00 32.98  ? 90   LEU F CG    1 
ATOM   4405  C  CD1   . LEU F 2 90  ? -4.984  -24.441 43.744 1.00 31.32  ? 90   LEU F CD1   1 
ATOM   4406  C  CD2   . LEU F 2 90  ? -6.856  -25.664 44.925 1.00 32.20  ? 90   LEU F CD2   1 
ATOM   4407  N  N     . LYS F 2 91  ? -9.539  -23.733 40.579 1.00 34.47  ? 91   LYS F N     1 
ATOM   4408  C  CA    . LYS F 2 91  ? -10.630 -22.879 40.119 1.00 35.90  ? 91   LYS F CA    1 
ATOM   4409  C  C     . LYS F 2 91  ? -11.954 -23.639 40.131 1.00 36.35  ? 91   LYS F C     1 
ATOM   4410  O  O     . LYS F 2 91  ? -12.962 -23.111 40.600 1.00 36.69  ? 91   LYS F O     1 
ATOM   4411  C  CB    . LYS F 2 91  ? -10.359 -22.284 38.734 1.00 35.58  ? 91   LYS F CB    1 
ATOM   4412  C  CG    . LYS F 2 91  ? -11.107 -20.985 38.478 1.00 36.23  ? 91   LYS F CG    1 
ATOM   4413  C  CD    . LYS F 2 91  ? -10.870 -20.427 37.077 1.00 37.11  ? 91   LYS F CD    1 
ATOM   4414  C  CE    . LYS F 2 91  ? -9.571  -19.628 36.974 1.00 41.84  ? 91   LYS F CE    1 
ATOM   4415  N  NZ    . LYS F 2 91  ? -9.649  -18.231 37.581 1.00 44.90  ? 91   LYS F NZ    1 
ATOM   4416  N  N     . ARG F 2 92  ? -11.934 -24.878 39.640 1.00 37.11  ? 92   ARG F N     1 
ATOM   4417  C  CA    . ARG F 2 92  ? -13.120 -25.730 39.567 1.00 38.07  ? 92   ARG F CA    1 
ATOM   4418  C  C     . ARG F 2 92  ? -13.791 -25.884 40.920 1.00 38.27  ? 92   ARG F C     1 
ATOM   4419  O  O     . ARG F 2 92  ? -15.000 -25.924 41.009 1.00 38.78  ? 92   ARG F O     1 
ATOM   4420  C  CB    . ARG F 2 92  ? -12.745 -27.134 39.102 1.00 38.52  ? 92   ARG F CB    1 
ATOM   4421  C  CG    . ARG F 2 92  ? -12.693 -27.362 37.623 1.00 40.52  ? 92   ARG F CG    1 
ATOM   4422  C  CD    . ARG F 2 92  ? -12.944 -28.849 37.315 1.00 41.94  ? 92   ARG F CD    1 
ATOM   4423  N  NE    . ARG F 2 92  ? -14.379 -29.110 37.341 1.00 44.39  ? 92   ARG F NE    1 
ATOM   4424  C  CZ    . ARG F 2 92  ? -15.031 -29.628 38.378 1.00 45.82  ? 92   ARG F CZ    1 
ATOM   4425  N  NH1   . ARG F 2 92  ? -14.368 -29.993 39.477 1.00 45.58  ? 92   ARG F NH1   1 
ATOM   4426  N  NH2   . ARG F 2 92  ? -16.350 -29.794 38.306 1.00 46.47  ? 92   ARG F NH2   1 
ATOM   4427  N  N     . GLN F 2 93  ? -13.004 -26.001 41.977 1.00 38.51  ? 93   GLN F N     1 
ATOM   4428  C  CA    . GLN F 2 93  ? -13.572 -26.197 43.296 1.00 38.87  ? 93   GLN F CA    1 
ATOM   4429  C  C     . GLN F 2 93  ? -13.827 -24.926 44.078 1.00 38.24  ? 93   GLN F C     1 
ATOM   4430  O  O     . GLN F 2 93  ? -14.063 -24.979 45.281 1.00 38.03  ? 93   GLN F O     1 
ATOM   4431  C  CB    . GLN F 2 93  ? -12.684 -27.128 44.086 1.00 39.49  ? 93   GLN F CB    1 
ATOM   4432  C  CG    . GLN F 2 93  ? -12.930 -28.562 43.687 1.00 43.65  ? 93   GLN F CG    1 
ATOM   4433  C  CD    . GLN F 2 93  ? -11.670 -29.350 43.676 1.00 47.86  ? 93   GLN F CD    1 
ATOM   4434  O  OE1   . GLN F 2 93  ? -10.832 -29.210 44.583 1.00 49.98  ? 93   GLN F OE1   1 
ATOM   4435  N  NE2   . GLN F 2 93  ? -11.506 -30.190 42.651 1.00 47.99  ? 93   GLN F NE2   1 
ATOM   4436  N  N     . GLY F 2 94  ? -13.789 -23.786 43.391 1.00 37.62  ? 94   GLY F N     1 
ATOM   4437  C  CA    . GLY F 2 94  ? -14.022 -22.505 44.033 1.00 37.46  ? 94   GLY F CA    1 
ATOM   4438  C  C     . GLY F 2 94  ? -12.981 -22.168 45.087 1.00 37.46  ? 94   GLY F C     1 
ATOM   4439  O  O     . GLY F 2 94  ? -13.313 -21.619 46.152 1.00 37.52  ? 94   GLY F O     1 
ATOM   4440  N  N     . ARG F 2 95  ? -11.726 -22.513 44.783 1.00 37.18  ? 95   ARG F N     1 
ATOM   4441  C  CA    . ARG F 2 95  ? -10.571 -22.213 45.628 1.00 36.55  ? 95   ARG F CA    1 
ATOM   4442  C  C     . ARG F 2 95  ? -9.495  -21.654 44.712 1.00 35.96  ? 95   ARG F C     1 
ATOM   4443  O  O     . ARG F 2 95  ? -8.344  -22.109 44.737 1.00 36.24  ? 95   ARG F O     1 
ATOM   4444  C  CB    . ARG F 2 95  ? -10.049 -23.466 46.348 1.00 36.61  ? 95   ARG F CB    1 
ATOM   4445  C  CG    . ARG F 2 95  ? -11.088 -24.324 47.079 1.00 38.26  ? 95   ARG F CG    1 
ATOM   4446  C  CD    . ARG F 2 95  ? -11.471 -23.760 48.453 1.00 43.80  ? 95   ARG F CD    1 
ATOM   4447  N  NE    . ARG F 2 95  ? -10.314 -23.265 49.231 1.00 46.61  ? 95   ARG F NE    1 
ATOM   4448  C  CZ    . ARG F 2 95  ? -10.401 -22.543 50.350 1.00 44.02  ? 95   ARG F CZ    1 
ATOM   4449  N  NH1   . ARG F 2 95  ? -11.583 -22.229 50.846 1.00 43.34  ? 95   ARG F NH1   1 
ATOM   4450  N  NH2   . ARG F 2 95  ? -9.303  -22.140 50.971 1.00 42.78  ? 95   ARG F NH2   1 
ATOM   4451  N  N     . THR F 2 96  ? -9.886  -20.681 43.891 1.00 35.24  ? 96   THR F N     1 
ATOM   4452  C  CA    . THR F 2 96  ? -8.991  -19.975 42.949 1.00 34.73  ? 96   THR F CA    1 
ATOM   4453  C  C     . THR F 2 96  ? -7.709  -19.521 43.574 1.00 33.87  ? 96   THR F C     1 
ATOM   4454  O  O     . THR F 2 96  ? -7.723  -18.947 44.657 1.00 34.36  ? 96   THR F O     1 
ATOM   4455  C  CB    . THR F 2 96  ? -9.655  -18.710 42.445 1.00 34.62  ? 96   THR F CB    1 
ATOM   4456  O  OG1   . THR F 2 96  ? -11.017 -19.006 42.109 1.00 36.69  ? 96   THR F OG1   1 
ATOM   4457  C  CG2   . THR F 2 96  ? -8.938  -18.195 41.231 1.00 34.83  ? 96   THR F CG2   1 
ATOM   4458  N  N     . LEU F 2 97  ? -6.600  -19.761 42.887 1.00 33.59  ? 97   LEU F N     1 
ATOM   4459  C  CA    . LEU F 2 97  ? -5.274  -19.425 43.420 1.00 33.07  ? 97   LEU F CA    1 
ATOM   4460  C  C     . LEU F 2 97  ? -4.535  -18.444 42.535 1.00 33.18  ? 97   LEU F C     1 
ATOM   4461  O  O     . LEU F 2 97  ? -4.490  -18.611 41.312 1.00 32.97  ? 97   LEU F O     1 
ATOM   4462  C  CB    . LEU F 2 97  ? -4.430  -20.682 43.606 1.00 32.68  ? 97   LEU F CB    1 
ATOM   4463  C  CG    . LEU F 2 97  ? -3.004  -20.524 44.124 1.00 32.66  ? 97   LEU F CG    1 
ATOM   4464  C  CD1   . LEU F 2 97  ? -2.941  -20.088 45.577 1.00 30.83  ? 97   LEU F CD1   1 
ATOM   4465  C  CD2   . LEU F 2 97  ? -2.274  -21.831 43.936 1.00 33.87  ? 97   LEU F CD2   1 
ATOM   4466  N  N     . TYR F 2 98  ? -3.973  -17.414 43.166 1.00 33.15  ? 98   TYR F N     1 
ATOM   4467  C  CA    . TYR F 2 98  ? -3.159  -16.436 42.483 1.00 33.21  ? 98   TYR F CA    1 
ATOM   4468  C  C     . TYR F 2 98  ? -1.712  -16.711 42.788 1.00 33.47  ? 98   TYR F C     1 
ATOM   4469  O  O     . TYR F 2 98  ? -1.379  -17.085 43.913 1.00 32.98  ? 98   TYR F O     1 
ATOM   4470  C  CB    . TYR F 2 98  ? -3.470  -15.048 43.001 1.00 33.55  ? 98   TYR F CB    1 
ATOM   4471  C  CG    . TYR F 2 98  ? -4.721  -14.392 42.475 1.00 33.68  ? 98   TYR F CG    1 
ATOM   4472  C  CD1   . TYR F 2 98  ? -5.591  -15.060 41.631 1.00 32.81  ? 98   TYR F CD1   1 
ATOM   4473  C  CD2   . TYR F 2 98  ? -5.051  -13.097 42.877 1.00 32.87  ? 98   TYR F CD2   1 
ATOM   4474  C  CE1   . TYR F 2 98  ? -6.735  -14.449 41.176 1.00 34.04  ? 98   TYR F CE1   1 
ATOM   4475  C  CE2   . TYR F 2 98  ? -6.191  -12.486 42.441 1.00 33.17  ? 98   TYR F CE2   1 
ATOM   4476  C  CZ    . TYR F 2 98  ? -7.030  -13.164 41.584 1.00 34.33  ? 98   TYR F CZ    1 
ATOM   4477  O  OH    . TYR F 2 98  ? -8.179  -12.552 41.138 1.00 35.23  ? 98   TYR F OH    1 
ATOM   4478  N  N     . GLY F 2 99  ? -0.851  -16.511 41.795 1.00 33.89  ? 99   GLY F N     1 
ATOM   4479  C  CA    . GLY F 2 99  ? 0.578   -16.594 42.015 1.00 34.51  ? 99   GLY F CA    1 
ATOM   4480  C  C     . GLY F 2 99  ? 1.317   -17.587 41.147 1.00 35.38  ? 99   GLY F C     1 
ATOM   4481  O  O     . GLY F 2 99  ? 2.533   -17.503 41.037 1.00 36.04  ? 99   GLY F O     1 
ATOM   4482  N  N     . PHE F 2 100 ? 0.609   -18.523 40.516 1.00 36.15  ? 100  PHE F N     1 
ATOM   4483  C  CA    . PHE F 2 100 ? 1.286   -19.624 39.794 1.00 36.32  ? 100  PHE F CA    1 
ATOM   4484  C  C     . PHE F 2 100 ? 0.940   -19.739 38.299 1.00 37.31  ? 100  PHE F C     1 
ATOM   4485  O  O     . PHE F 2 100 ? 1.027   -20.828 37.726 1.00 38.03  ? 100  PHE F O     1 
ATOM   4486  C  CB    . PHE F 2 100 ? 1.018   -20.971 40.499 1.00 35.27  ? 100  PHE F CB    1 
ATOM   4487  C  CG    . PHE F 2 100 ? 1.634   -21.084 41.864 1.00 33.57  ? 100  PHE F CG    1 
ATOM   4488  C  CD1   . PHE F 2 100 ? 1.001   -20.547 42.983 1.00 33.63  ? 100  PHE F CD1   1 
ATOM   4489  C  CD2   . PHE F 2 100 ? 2.844   -21.752 42.044 1.00 31.87  ? 100  PHE F CD2   1 
ATOM   4490  C  CE1   . PHE F 2 100 ? 1.585   -20.665 44.275 1.00 33.16  ? 100  PHE F CE1   1 
ATOM   4491  C  CE2   . PHE F 2 100 ? 3.435   -21.880 43.322 1.00 30.28  ? 100  PHE F CE2   1 
ATOM   4492  C  CZ    . PHE F 2 100 ? 2.806   -21.331 44.436 1.00 31.69  ? 100  PHE F CZ    1 
ATOM   4493  N  N     . GLY F 2 101 ? 0.578   -18.631 37.664 1.00 38.10  ? 101  GLY F N     1 
ATOM   4494  C  CA    . GLY F 2 101 ? 0.181   -18.639 36.261 1.00 39.83  ? 101  GLY F CA    1 
ATOM   4495  C  C     . GLY F 2 101 ? -1.327  -18.609 36.201 1.00 41.72  ? 101  GLY F C     1 
ATOM   4496  O  O     . GLY F 2 101 ? -1.950  -18.590 35.115 1.00 41.72  ? 101  GLY F O     1 
ATOM   4497  N  N     . GLY F 2 102 ? -1.917  -18.585 37.394 1.00 43.32  ? 102  GLY F N     1 
ATOM   4498  C  CA    . GLY F 2 102 ? -3.368  -18.615 37.546 1.00 45.21  ? 102  GLY F CA    1 
ATOM   4499  C  C     . GLY F 2 102 ? -4.028  -17.258 37.441 1.00 46.36  ? 102  GLY F C     1 
ATOM   4500  O  O     . GLY F 2 102 ? -3.768  -16.502 36.482 1.00 47.21  ? 102  GLY F O     1 
ATOM   4501  O  OXT   . GLY F 2 102 ? -4.844  -16.913 38.312 1.00 46.86  ? 102  GLY F OXT   1 
ATOM   4502  N  N     . ALA G 3 14  ? -33.875 -42.060 4.994  1.00 81.56  ? 14   ALA G N     1 
ATOM   4503  C  CA    . ALA G 3 14  ? -33.246 -41.009 5.847  1.00 81.66  ? 14   ALA G CA    1 
ATOM   4504  C  C     . ALA G 3 14  ? -33.768 -41.069 7.285  1.00 81.59  ? 14   ALA G C     1 
ATOM   4505  O  O     . ALA G 3 14  ? -34.977 -40.954 7.533  1.00 81.62  ? 14   ALA G O     1 
ATOM   4506  C  CB    . ALA G 3 14  ? -33.476 -39.618 5.248  1.00 81.82  ? 14   ALA G CB    1 
ATOM   4507  N  N     . LYS G 3 15  ? -32.843 -41.248 8.224  1.00 81.22  ? 15   LYS G N     1 
ATOM   4508  C  CA    . LYS G 3 15  ? -33.186 -41.398 9.637  1.00 80.73  ? 15   LYS G CA    1 
ATOM   4509  C  C     . LYS G 3 15  ? -32.522 -40.304 10.480 1.00 79.99  ? 15   LYS G C     1 
ATOM   4510  O  O     . LYS G 3 15  ? -31.469 -39.767 10.107 1.00 80.27  ? 15   LYS G O     1 
ATOM   4511  C  CB    . LYS G 3 15  ? -32.765 -42.791 10.130 1.00 81.04  ? 15   LYS G CB    1 
ATOM   4512  C  CG    . LYS G 3 15  ? -33.643 -43.374 11.241 1.00 81.58  ? 15   LYS G CG    1 
ATOM   4513  C  CD    . LYS G 3 15  ? -35.036 -43.778 10.729 1.00 82.17  ? 15   LYS G CD    1 
ATOM   4514  C  CE    . LYS G 3 15  ? -35.846 -44.503 11.802 1.00 81.70  ? 15   LYS G CE    1 
ATOM   4515  N  NZ    . LYS G 3 15  ? -35.277 -45.848 12.115 1.00 82.03  ? 15   LYS G NZ    1 
ATOM   4516  N  N     . THR G 3 16  ? -33.133 -39.972 11.613 1.00 78.77  ? 16   THR G N     1 
ATOM   4517  C  CA    . THR G 3 16  ? -32.560 -38.966 12.514 1.00 77.31  ? 16   THR G CA    1 
ATOM   4518  C  C     . THR G 3 16  ? -31.335 -39.513 13.244 1.00 76.51  ? 16   THR G C     1 
ATOM   4519  O  O     . THR G 3 16  ? -31.239 -40.716 13.514 1.00 76.42  ? 16   THR G O     1 
ATOM   4520  C  CB    . THR G 3 16  ? -33.581 -38.450 13.550 1.00 77.14  ? 16   THR G CB    1 
ATOM   4521  O  OG1   . THR G 3 16  ? -33.917 -39.499 14.466 1.00 76.38  ? 16   THR G OG1   1 
ATOM   4522  C  CG2   . THR G 3 16  ? -34.844 -37.938 12.863 1.00 77.20  ? 16   THR G CG2   1 
ATOM   4523  N  N     . ARG G 3 17  ? -30.407 -38.618 13.563 1.00 75.41  ? 17   ARG G N     1 
ATOM   4524  C  CA    . ARG G 3 17  ? -29.202 -38.976 14.306 1.00 74.33  ? 17   ARG G CA    1 
ATOM   4525  C  C     . ARG G 3 17  ? -29.499 -39.535 15.707 1.00 73.58  ? 17   ARG G C     1 
ATOM   4526  O  O     . ARG G 3 17  ? -28.707 -40.306 16.252 1.00 73.47  ? 17   ARG G O     1 
ATOM   4527  C  CB    . ARG G 3 17  ? -28.263 -37.777 14.393 1.00 74.36  ? 17   ARG G CB    1 
ATOM   4528  C  CG    . ARG G 3 17  ? -27.609 -37.402 13.075 1.00 74.00  ? 17   ARG G CG    1 
ATOM   4529  C  CD    . ARG G 3 17  ? -26.432 -36.468 13.302 1.00 73.65  ? 17   ARG G CD    1 
ATOM   4530  N  NE    . ARG G 3 17  ? -26.823 -35.060 13.368 1.00 73.79  ? 17   ARG G NE    1 
ATOM   4531  C  CZ    . ARG G 3 17  ? -26.025 -34.074 13.778 1.00 73.76  ? 17   ARG G CZ    1 
ATOM   4532  N  NH1   . ARG G 3 17  ? -24.783 -34.339 14.183 1.00 73.47  ? 17   ARG G NH1   1 
ATOM   4533  N  NH2   . ARG G 3 17  ? -26.471 -32.820 13.791 1.00 73.01  ? 17   ARG G NH2   1 
ATOM   4534  N  N     . SER G 3 18  ? -30.638 -39.153 16.278 1.00 72.56  ? 18   SER G N     1 
ATOM   4535  C  CA    . SER G 3 18  ? -31.068 -39.680 17.568 1.00 71.63  ? 18   SER G CA    1 
ATOM   4536  C  C     . SER G 3 18  ? -31.392 -41.166 17.481 1.00 71.17  ? 18   SER G C     1 
ATOM   4537  O  O     . SER G 3 18  ? -31.067 -41.937 18.386 1.00 71.15  ? 18   SER G O     1 
ATOM   4538  C  CB    . SER G 3 18  ? -32.264 -38.900 18.087 1.00 71.54  ? 18   SER G CB    1 
ATOM   4539  O  OG    . SER G 3 18  ? -31.973 -37.517 18.116 1.00 71.41  ? 18   SER G OG    1 
ATOM   4540  N  N     . SER G 3 19  ? -32.023 -41.566 16.382 1.00 70.48  ? 19   SER G N     1 
ATOM   4541  C  CA    . SER G 3 19  ? -32.304 -42.979 16.131 1.00 69.65  ? 19   SER G CA    1 
ATOM   4542  C  C     . SER G 3 19  ? -31.050 -43.785 15.777 1.00 68.95  ? 19   SER G C     1 
ATOM   4543  O  O     . SER G 3 19  ? -30.954 -44.952 16.143 1.00 68.87  ? 19   SER G O     1 
ATOM   4544  C  CB    . SER G 3 19  ? -33.387 -43.137 15.067 1.00 69.51  ? 19   SER G CB    1 
ATOM   4545  O  OG    . SER G 3 19  ? -33.530 -41.942 14.327 1.00 69.52  ? 19   SER G OG    1 
ATOM   4546  N  N     . ARG G 3 20  ? -30.096 -43.159 15.085 1.00 68.09  ? 20   ARG G N     1 
ATOM   4547  C  CA    . ARG G 3 20  ? -28.797 -43.783 14.797 1.00 67.50  ? 20   ARG G CA    1 
ATOM   4548  C  C     . ARG G 3 20  ? -27.984 -44.045 16.068 1.00 66.88  ? 20   ARG G C     1 
ATOM   4549  O  O     . ARG G 3 20  ? -27.145 -44.952 16.106 1.00 66.81  ? 20   ARG G O     1 
ATOM   4550  C  CB    . ARG G 3 20  ? -27.948 -42.899 13.876 1.00 67.68  ? 20   ARG G CB    1 
ATOM   4551  C  CG    . ARG G 3 20  ? -28.361 -42.834 12.436 1.00 68.76  ? 20   ARG G CG    1 
ATOM   4552  C  CD    . ARG G 3 20  ? -27.192 -42.385 11.581 1.00 71.88  ? 20   ARG G CD    1 
ATOM   4553  N  NE    . ARG G 3 20  ? -27.634 -41.770 10.327 1.00 75.90  ? 20   ARG G NE    1 
ATOM   4554  C  CZ    . ARG G 3 20  ? -28.020 -42.445 9.241  1.00 77.70  ? 20   ARG G CZ    1 
ATOM   4555  N  NH1   . ARG G 3 20  ? -28.033 -43.779 9.232  1.00 78.23  ? 20   ARG G NH1   1 
ATOM   4556  N  NH2   . ARG G 3 20  ? -28.402 -41.783 8.156  1.00 78.11  ? 20   ARG G NH2   1 
ATOM   4557  N  N     . ALA G 3 21  ? -28.213 -43.219 17.089 1.00 65.98  ? 21   ALA G N     1 
ATOM   4558  C  CA    . ALA G 3 21  ? -27.487 -43.314 18.354 1.00 65.04  ? 21   ALA G CA    1 
ATOM   4559  C  C     . ALA G 3 21  ? -28.274 -44.174 19.329 1.00 64.33  ? 21   ALA G C     1 
ATOM   4560  O  O     . ALA G 3 21  ? -27.778 -44.567 20.387 1.00 64.00  ? 21   ALA G O     1 
ATOM   4561  C  CB    . ALA G 3 21  ? -27.260 -41.931 18.927 1.00 65.13  ? 21   ALA G CB    1 
ATOM   4562  N  N     . GLY G 3 22  ? -29.514 -44.453 18.950 1.00 63.63  ? 22   GLY G N     1 
ATOM   4563  C  CA    . GLY G 3 22  ? -30.394 -45.284 19.741 1.00 63.06  ? 22   GLY G CA    1 
ATOM   4564  C  C     . GLY G 3 22  ? -30.917 -44.504 20.911 1.00 62.52  ? 22   GLY G C     1 
ATOM   4565  O  O     . GLY G 3 22  ? -31.133 -45.067 21.976 1.00 63.02  ? 22   GLY G O     1 
ATOM   4566  N  N     . LEU G 3 23  ? -31.139 -43.211 20.697 1.00 61.80  ? 23   LEU G N     1 
ATOM   4567  C  CA    . LEU G 3 23  ? -31.475 -42.297 21.769 1.00 61.22  ? 23   LEU G CA    1 
ATOM   4568  C  C     . LEU G 3 23  ? -32.796 -41.598 21.569 1.00 61.21  ? 23   LEU G C     1 
ATOM   4569  O  O     . LEU G 3 23  ? -33.233 -41.376 20.443 1.00 61.67  ? 23   LEU G O     1 
ATOM   4570  C  CB    . LEU G 3 23  ? -30.387 -41.238 21.907 1.00 61.27  ? 23   LEU G CB    1 
ATOM   4571  C  CG    . LEU G 3 23  ? -29.045 -41.658 22.503 1.00 60.60  ? 23   LEU G CG    1 
ATOM   4572  C  CD1   . LEU G 3 23  ? -28.026 -40.576 22.236 1.00 59.27  ? 23   LEU G CD1   1 
ATOM   4573  C  CD2   . LEU G 3 23  ? -29.182 -41.946 24.000 1.00 59.67  ? 23   LEU G CD2   1 
ATOM   4574  N  N     . GLN G 3 24  ? -33.411 -41.226 22.683 1.00 60.92  ? 24   GLN G N     1 
ATOM   4575  C  CA    . GLN G 3 24  ? -34.637 -40.460 22.685 1.00 60.61  ? 24   GLN G CA    1 
ATOM   4576  C  C     . GLN G 3 24  ? -34.359 -38.966 22.613 1.00 60.20  ? 24   GLN G C     1 
ATOM   4577  O  O     . GLN G 3 24  ? -35.175 -38.205 22.104 1.00 60.19  ? 24   GLN G O     1 
ATOM   4578  C  CB    . GLN G 3 24  ? -35.419 -40.764 23.955 1.00 61.06  ? 24   GLN G CB    1 
ATOM   4579  C  CG    . GLN G 3 24  ? -35.790 -42.230 24.126 1.00 62.29  ? 24   GLN G CG    1 
ATOM   4580  C  CD    . GLN G 3 24  ? -36.662 -42.743 22.999 1.00 63.69  ? 24   GLN G CD    1 
ATOM   4581  O  OE1   . GLN G 3 24  ? -37.540 -42.031 22.500 1.00 64.90  ? 24   GLN G OE1   1 
ATOM   4582  N  NE2   . GLN G 3 24  ? -36.419 -43.980 22.582 1.00 63.62  ? 24   GLN G NE2   1 
ATOM   4583  N  N     . PHE G 3 25  ? -33.204 -38.552 23.129 1.00 59.74  ? 25   PHE G N     1 
ATOM   4584  C  CA    . PHE G 3 25  ? -32.834 -37.132 23.186 1.00 58.97  ? 25   PHE G CA    1 
ATOM   4585  C  C     . PHE G 3 25  ? -32.374 -36.600 21.835 1.00 58.24  ? 25   PHE G C     1 
ATOM   4586  O  O     . PHE G 3 25  ? -31.807 -37.339 21.035 1.00 58.51  ? 25   PHE G O     1 
ATOM   4587  C  CB    . PHE G 3 25  ? -31.791 -36.881 24.283 1.00 59.19  ? 25   PHE G CB    1 
ATOM   4588  C  CG    . PHE G 3 25  ? -32.396 -36.499 25.605 1.00 59.25  ? 25   PHE G CG    1 
ATOM   4589  C  CD1   . PHE G 3 25  ? -33.255 -37.367 26.271 1.00 59.39  ? 25   PHE G CD1   1 
ATOM   4590  C  CD2   . PHE G 3 25  ? -32.133 -35.260 26.170 1.00 59.56  ? 25   PHE G CD2   1 
ATOM   4591  C  CE1   . PHE G 3 25  ? -33.835 -37.015 27.485 1.00 59.44  ? 25   PHE G CE1   1 
ATOM   4592  C  CE2   . PHE G 3 25  ? -32.706 -34.899 27.383 1.00 60.21  ? 25   PHE G CE2   1 
ATOM   4593  C  CZ    . PHE G 3 25  ? -33.560 -35.785 28.044 1.00 59.74  ? 25   PHE G CZ    1 
ATOM   4594  N  N     . PRO G 3 26  ? -32.629 -35.310 21.569 1.00 57.43  ? 26   PRO G N     1 
ATOM   4595  C  CA    . PRO G 3 26  ? -32.441 -34.834 20.211 1.00 56.49  ? 26   PRO G CA    1 
ATOM   4596  C  C     . PRO G 3 26  ? -30.994 -34.504 19.936 1.00 55.78  ? 26   PRO G C     1 
ATOM   4597  O  O     . PRO G 3 26  ? -30.531 -33.412 20.247 1.00 55.81  ? 26   PRO G O     1 
ATOM   4598  C  CB    . PRO G 3 26  ? -33.315 -33.585 20.156 1.00 56.63  ? 26   PRO G CB    1 
ATOM   4599  C  CG    . PRO G 3 26  ? -33.365 -33.089 21.567 1.00 56.87  ? 26   PRO G CG    1 
ATOM   4600  C  CD    . PRO G 3 26  ? -33.087 -34.242 22.479 1.00 57.28  ? 26   PRO G CD    1 
ATOM   4601  N  N     . VAL G 3 27  ? -30.290 -35.464 19.356 1.00 55.03  ? 27   VAL G N     1 
ATOM   4602  C  CA    . VAL G 3 27  ? -28.926 -35.268 18.892 1.00 54.23  ? 27   VAL G CA    1 
ATOM   4603  C  C     . VAL G 3 27  ? -28.821 -34.029 18.018 1.00 54.21  ? 27   VAL G C     1 
ATOM   4604  O  O     . VAL G 3 27  ? -27.882 -33.257 18.160 1.00 54.54  ? 27   VAL G O     1 
ATOM   4605  C  CB    . VAL G 3 27  ? -28.442 -36.496 18.127 1.00 54.13  ? 27   VAL G CB    1 
ATOM   4606  C  CG1   . VAL G 3 27  ? -26.972 -36.366 17.740 1.00 53.60  ? 27   VAL G CG1   1 
ATOM   4607  C  CG2   . VAL G 3 27  ? -28.672 -37.731 18.977 1.00 53.84  ? 27   VAL G CG2   1 
ATOM   4608  N  N     . GLY G 3 28  ? -29.793 -33.826 17.131 1.00 54.12  ? 28   GLY G N     1 
ATOM   4609  C  CA    . GLY G 3 28  ? -29.821 -32.627 16.287 1.00 53.81  ? 28   GLY G CA    1 
ATOM   4610  C  C     . GLY G 3 28  ? -29.732 -31.337 17.090 1.00 53.44  ? 28   GLY G C     1 
ATOM   4611  O  O     . GLY G 3 28  ? -28.828 -30.522 16.897 1.00 53.29  ? 28   GLY G O     1 
ATOM   4612  N  N     . ARG G 3 29  ? -30.668 -31.181 18.017 1.00 53.19  ? 29   ARG G N     1 
ATOM   4613  C  CA    . ARG G 3 29  ? -30.818 -29.961 18.792 1.00 52.83  ? 29   ARG G CA    1 
ATOM   4614  C  C     . ARG G 3 29  ? -29.593 -29.683 19.651 1.00 52.95  ? 29   ARG G C     1 
ATOM   4615  O  O     . ARG G 3 29  ? -29.098 -28.551 19.695 1.00 52.93  ? 29   ARG G O     1 
ATOM   4616  C  CB    . ARG G 3 29  ? -32.057 -30.070 19.663 1.00 52.39  ? 29   ARG G CB    1 
ATOM   4617  C  CG    . ARG G 3 29  ? -32.416 -28.817 20.369 1.00 52.22  ? 29   ARG G CG    1 
ATOM   4618  C  CD    . ARG G 3 29  ? -33.654 -29.038 21.179 1.00 52.58  ? 29   ARG G CD    1 
ATOM   4619  N  NE    . ARG G 3 29  ? -34.858 -28.926 20.365 1.00 52.80  ? 29   ARG G NE    1 
ATOM   4620  C  CZ    . ARG G 3 29  ? -36.081 -28.811 20.868 1.00 53.11  ? 29   ARG G CZ    1 
ATOM   4621  N  NH1   . ARG G 3 29  ? -36.258 -28.801 22.189 1.00 52.63  ? 29   ARG G NH1   1 
ATOM   4622  N  NH2   . ARG G 3 29  ? -37.125 -28.696 20.051 1.00 53.34  ? 29   ARG G NH2   1 
ATOM   4623  N  N     . VAL G 3 30  ? -29.106 -30.722 20.322 1.00 52.81  ? 30   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3 30  ? -27.933 -30.598 21.163 1.00 52.96  ? 30   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3 30  ? -26.798 -30.011 20.327 1.00 53.67  ? 30   VAL G C     1 
ATOM   4626  O  O     . VAL G 3 30  ? -26.134 -29.070 20.761 1.00 53.96  ? 30   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3 30  ? -27.556 -31.946 21.841 1.00 52.76  ? 30   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3 30  ? -26.188 -31.887 22.480 1.00 52.12  ? 30   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3 30  ? -28.589 -32.307 22.889 1.00 52.16  ? 30   VAL G CG2   1 
ATOM   4630  N  N     . HIS G 3 31  ? -26.614 -30.521 19.113 1.00 54.29  ? 31   HIS G N     1 
ATOM   4631  C  CA    . HIS G 3 31  ? -25.581 -29.998 18.219 1.00 55.09  ? 31   HIS G CA    1 
ATOM   4632  C  C     . HIS G 3 31  ? -25.761 -28.500 17.933 1.00 55.30  ? 31   HIS G C     1 
ATOM   4633  O  O     . HIS G 3 31  ? -24.791 -27.728 17.916 1.00 54.89  ? 31   HIS G O     1 
ATOM   4634  C  CB    . HIS G 3 31  ? -25.590 -30.762 16.898 1.00 55.29  ? 31   HIS G CB    1 
ATOM   4635  C  CG    . HIS G 3 31  ? -24.316 -30.644 16.123 1.00 56.45  ? 31   HIS G CG    1 
ATOM   4636  N  ND1   . HIS G 3 31  ? -23.355 -29.695 16.403 1.00 57.77  ? 31   HIS G ND1   1 
ATOM   4637  C  CD2   . HIS G 3 31  ? -23.850 -31.349 15.064 1.00 57.08  ? 31   HIS G CD2   1 
ATOM   4638  C  CE1   . HIS G 3 31  ? -22.349 -29.828 15.558 1.00 58.17  ? 31   HIS G CE1   1 
ATOM   4639  N  NE2   . HIS G 3 31  ? -22.626 -30.822 14.733 1.00 57.76  ? 31   HIS G NE2   1 
ATOM   4640  N  N     . ARG G 3 32  ? -27.012 -28.111 17.698 1.00 55.57  ? 32   ARG G N     1 
ATOM   4641  C  CA    . ARG G 3 32  ? -27.340 -26.748 17.328 1.00 56.01  ? 32   ARG G CA    1 
ATOM   4642  C  C     . ARG G 3 32  ? -27.062 -25.810 18.501 1.00 56.36  ? 32   ARG G C     1 
ATOM   4643  O  O     . ARG G 3 32  ? -26.452 -24.754 18.327 1.00 56.42  ? 32   ARG G O     1 
ATOM   4644  C  CB    . ARG G 3 32  ? -28.806 -26.670 16.888 1.00 56.03  ? 32   ARG G CB    1 
ATOM   4645  C  CG    . ARG G 3 32  ? -29.339 -25.270 16.618 1.00 55.71  ? 32   ARG G CG    1 
ATOM   4646  C  CD    . ARG G 3 32  ? -30.842 -25.268 16.745 1.00 55.95  ? 32   ARG G CD    1 
ATOM   4647  N  NE    . ARG G 3 32  ? -31.304 -24.808 18.055 1.00 56.16  ? 32   ARG G NE    1 
ATOM   4648  C  CZ    . ARG G 3 32  ? -32.467 -25.157 18.613 1.00 57.05  ? 32   ARG G CZ    1 
ATOM   4649  N  NH1   . ARG G 3 32  ? -33.291 -26.002 17.995 1.00 56.26  ? 32   ARG G NH1   1 
ATOM   4650  N  NH2   . ARG G 3 32  ? -32.808 -24.674 19.806 1.00 57.13  ? 32   ARG G NH2   1 
ATOM   4651  N  N     . LEU G 3 33  ? -27.496 -26.223 19.691 1.00 56.64  ? 33   LEU G N     1 
ATOM   4652  C  CA    . LEU G 3 33  ? -27.366 -25.411 20.893 1.00 56.85  ? 33   LEU G CA    1 
ATOM   4653  C  C     . LEU G 3 33  ? -25.916 -25.243 21.319 1.00 57.38  ? 33   LEU G C     1 
ATOM   4654  O  O     . LEU G 3 33  ? -25.588 -24.281 22.022 1.00 57.87  ? 33   LEU G O     1 
ATOM   4655  C  CB    . LEU G 3 33  ? -28.197 -25.989 22.039 1.00 56.55  ? 33   LEU G CB    1 
ATOM   4656  C  CG    . LEU G 3 33  ? -29.722 -25.891 21.918 1.00 55.85  ? 33   LEU G CG    1 
ATOM   4657  C  CD1   . LEU G 3 33  ? -30.383 -26.799 22.926 1.00 54.92  ? 33   LEU G CD1   1 
ATOM   4658  C  CD2   . LEU G 3 33  ? -30.237 -24.450 22.065 1.00 55.11  ? 33   LEU G CD2   1 
ATOM   4659  N  N     . LEU G 3 34  ? -25.056 -26.167 20.894 1.00 57.72  ? 34   LEU G N     1 
ATOM   4660  C  CA    . LEU G 3 34  ? -23.625 -26.056 21.143 1.00 58.26  ? 34   LEU G CA    1 
ATOM   4661  C  C     . LEU G 3 34  ? -23.009 -24.961 20.276 1.00 59.15  ? 34   LEU G C     1 
ATOM   4662  O  O     . LEU G 3 34  ? -22.293 -24.099 20.793 1.00 59.58  ? 34   LEU G O     1 
ATOM   4663  C  CB    . LEU G 3 34  ? -22.897 -27.389 20.912 1.00 58.01  ? 34   LEU G CB    1 
ATOM   4664  C  CG    . LEU G 3 34  ? -22.884 -28.471 22.001 1.00 57.37  ? 34   LEU G CG    1 
ATOM   4665  C  CD1   . LEU G 3 34  ? -22.554 -29.833 21.418 1.00 54.90  ? 34   LEU G CD1   1 
ATOM   4666  C  CD2   . LEU G 3 34  ? -21.921 -28.139 23.138 1.00 57.34  ? 34   LEU G CD2   1 
ATOM   4667  N  N     . ARG G 3 35  ? -23.285 -24.991 18.970 1.00 59.84  ? 35   ARG G N     1 
ATOM   4668  C  CA    . ARG G 3 35  ? -22.706 -24.019 18.034 1.00 60.61  ? 35   ARG G CA    1 
ATOM   4669  C  C     . ARG G 3 35  ? -23.093 -22.606 18.433 1.00 60.52  ? 35   ARG G C     1 
ATOM   4670  O  O     . ARG G 3 35  ? -22.256 -21.702 18.520 1.00 60.51  ? 35   ARG G O     1 
ATOM   4671  C  CB    . ARG G 3 35  ? -23.224 -24.244 16.619 1.00 61.10  ? 35   ARG G CB    1 
ATOM   4672  C  CG    . ARG G 3 35  ? -23.264 -25.662 16.147 1.00 63.60  ? 35   ARG G CG    1 
ATOM   4673  C  CD    . ARG G 3 35  ? -23.675 -25.664 14.686 1.00 68.75  ? 35   ARG G CD    1 
ATOM   4674  N  NE    . ARG G 3 35  ? -23.193 -26.855 13.989 1.00 73.07  ? 35   ARG G NE    1 
ATOM   4675  C  CZ    . ARG G 3 35  ? -21.936 -27.033 13.582 1.00 75.63  ? 35   ARG G CZ    1 
ATOM   4676  N  NH1   . ARG G 3 35  ? -21.007 -26.099 13.802 1.00 76.32  ? 35   ARG G NH1   1 
ATOM   4677  N  NH2   . ARG G 3 35  ? -21.604 -28.156 12.950 1.00 77.19  ? 35   ARG G NH2   1 
ATOM   4678  N  N     . LYS G 3 36  ? -24.387 -22.431 18.666 1.00 60.47  ? 36   LYS G N     1 
ATOM   4679  C  CA    . LYS G 3 36  ? -24.927 -21.150 19.040 1.00 60.52  ? 36   LYS G CA    1 
ATOM   4680  C  C     . LYS G 3 36  ? -24.752 -20.920 20.538 1.00 59.98  ? 36   LYS G C     1 
ATOM   4681  O  O     . LYS G 3 36  ? -25.547 -20.230 21.176 1.00 60.45  ? 36   LYS G O     1 
ATOM   4682  C  CB    . LYS G 3 36  ? -26.383 -21.042 18.568 1.00 61.22  ? 36   LYS G CB    1 
ATOM   4683  C  CG    . LYS G 3 36  ? -26.499 -20.413 17.165 1.00 62.55  ? 36   LYS G CG    1 
ATOM   4684  C  CD    . LYS G 3 36  ? -27.482 -21.136 16.233 1.00 64.51  ? 36   LYS G CD    1 
ATOM   4685  C  CE    . LYS G 3 36  ? -27.383 -20.564 14.805 1.00 64.69  ? 36   LYS G CE    1 
ATOM   4686  N  NZ    . LYS G 3 36  ? -28.007 -21.420 13.746 1.00 65.86  ? 36   LYS G NZ    1 
ATOM   4687  N  N     . GLY G 3 37  ? -23.687 -21.493 21.089 1.00 59.06  ? 37   GLY G N     1 
ATOM   4688  C  CA    . GLY G 3 37  ? -23.357 -21.312 22.493 1.00 58.00  ? 37   GLY G CA    1 
ATOM   4689  C  C     . GLY G 3 37  ? -21.960 -20.759 22.687 1.00 57.24  ? 37   GLY G C     1 
ATOM   4690  O  O     . GLY G 3 37  ? -21.535 -20.499 23.814 1.00 57.02  ? 37   GLY G O     1 
ATOM   4691  N  N     . ASN G 3 38  ? -21.239 -20.573 21.586 1.00 56.51  ? 38   ASN G N     1 
ATOM   4692  C  CA    . ASN G 3 38  ? -19.900 -20.010 21.657 1.00 55.98  ? 38   ASN G CA    1 
ATOM   4693  C  C     . ASN G 3 38  ? -19.090 -20.730 22.703 1.00 55.35  ? 38   ASN G C     1 
ATOM   4694  O  O     . ASN G 3 38  ? -18.570 -20.102 23.630 1.00 55.65  ? 38   ASN G O     1 
ATOM   4695  C  CB    . ASN G 3 38  ? -19.957 -18.521 22.025 1.00 56.05  ? 38   ASN G CB    1 
ATOM   4696  C  CG    . ASN G 3 38  ? -20.601 -17.692 20.960 1.00 55.21  ? 38   ASN G CG    1 
ATOM   4697  O  OD1   . ASN G 3 38  ? -21.760 -17.311 21.084 1.00 53.79  ? 38   ASN G OD1   1 
ATOM   4698  N  ND2   . ASN G 3 38  ? -19.859 -17.419 19.889 1.00 54.47  ? 38   ASN G ND2   1 
ATOM   4699  N  N     . TYR G 3 39  ? -19.017 -22.049 22.576 1.00 54.53  ? 39   TYR G N     1 
ATOM   4700  C  CA    . TYR G 3 39  ? -18.235 -22.852 23.500 1.00 53.72  ? 39   TYR G CA    1 
ATOM   4701  C  C     . TYR G 3 39  ? -16.898 -23.158 22.854 1.00 54.22  ? 39   TYR G C     1 
ATOM   4702  O  O     . TYR G 3 39  ? -15.874 -23.234 23.537 1.00 53.96  ? 39   TYR G O     1 
ATOM   4703  C  CB    . TYR G 3 39  ? -18.970 -24.130 23.861 1.00 52.60  ? 39   TYR G CB    1 
ATOM   4704  C  CG    . TYR G 3 39  ? -20.284 -23.930 24.574 1.00 50.98  ? 39   TYR G CG    1 
ATOM   4705  C  CD1   . TYR G 3 39  ? -21.483 -24.132 23.922 1.00 49.57  ? 39   TYR G CD1   1 
ATOM   4706  C  CD2   . TYR G 3 39  ? -20.324 -23.571 25.908 1.00 50.23  ? 39   TYR G CD2   1 
ATOM   4707  C  CE1   . TYR G 3 39  ? -22.694 -23.970 24.575 1.00 49.40  ? 39   TYR G CE1   1 
ATOM   4708  C  CE2   . TYR G 3 39  ? -21.527 -23.402 26.569 1.00 50.17  ? 39   TYR G CE2   1 
ATOM   4709  C  CZ    . TYR G 3 39  ? -22.712 -23.602 25.899 1.00 50.09  ? 39   TYR G CZ    1 
ATOM   4710  O  OH    . TYR G 3 39  ? -23.914 -23.439 26.560 1.00 50.07  ? 39   TYR G OH    1 
ATOM   4711  N  N     . ALA G 3 40  ? -16.921 -23.322 21.532 1.00 55.06  ? 40   ALA G N     1 
ATOM   4712  C  CA    . ALA G 3 40  ? -15.704 -23.414 20.725 1.00 56.22  ? 40   ALA G CA    1 
ATOM   4713  C  C     . ALA G 3 40  ? -15.980 -23.045 19.277 1.00 57.14  ? 40   ALA G C     1 
ATOM   4714  O  O     . ALA G 3 40  ? -17.136 -22.958 18.860 1.00 57.39  ? 40   ALA G O     1 
ATOM   4715  C  CB    . ALA G 3 40  ? -15.115 -24.795 20.801 1.00 56.10  ? 40   ALA G CB    1 
ATOM   4716  N  N     . GLU G 3 41  ? -14.910 -22.823 18.524 1.00 58.35  ? 41   GLU G N     1 
ATOM   4717  C  CA    . GLU G 3 41  ? -14.990 -22.616 17.079 1.00 60.00  ? 41   GLU G CA    1 
ATOM   4718  C  C     . GLU G 3 41  ? -15.734 -23.765 16.403 1.00 60.31  ? 41   GLU G C     1 
ATOM   4719  O  O     . GLU G 3 41  ? -16.889 -23.630 16.018 1.00 60.66  ? 41   GLU G O     1 
ATOM   4720  C  CB    . GLU G 3 41  ? -13.580 -22.526 16.499 1.00 60.26  ? 41   GLU G CB    1 
ATOM   4721  C  CG    . GLU G 3 41  ? -12.937 -21.172 16.632 1.00 62.84  ? 41   GLU G CG    1 
ATOM   4722  C  CD    . GLU G 3 41  ? -12.751 -20.496 15.294 1.00 66.03  ? 41   GLU G CD    1 
ATOM   4723  O  OE1   . GLU G 3 41  ? -12.220 -21.152 14.360 1.00 67.21  ? 41   GLU G OE1   1 
ATOM   4724  O  OE2   . GLU G 3 41  ? -13.122 -19.305 15.181 1.00 67.84  ? 41   GLU G OE2   1 
ATOM   4725  N  N     . ARG G 3 42  ? -15.054 -24.897 16.279 1.00 60.87  ? 42   ARG G N     1 
ATOM   4726  C  CA    . ARG G 3 42  ? -15.596 -26.074 15.628 1.00 61.32  ? 42   ARG G CA    1 
ATOM   4727  C  C     . ARG G 3 42  ? -16.181 -27.019 16.660 1.00 60.77  ? 42   ARG G C     1 
ATOM   4728  O  O     . ARG G 3 42  ? -15.826 -26.942 17.824 1.00 60.73  ? 42   ARG G O     1 
ATOM   4729  C  CB    . ARG G 3 42  ? -14.493 -26.794 14.862 1.00 61.80  ? 42   ARG G CB    1 
ATOM   4730  C  CG    . ARG G 3 42  ? -13.896 -26.002 13.721 1.00 64.29  ? 42   ARG G CG    1 
ATOM   4731  C  CD    . ARG G 3 42  ? -13.004 -26.903 12.889 1.00 69.13  ? 42   ARG G CD    1 
ATOM   4732  N  NE    . ARG G 3 42  ? -12.877 -26.428 11.514 1.00 72.66  ? 42   ARG G NE    1 
ATOM   4733  C  CZ    . ARG G 3 42  ? -12.148 -27.035 10.583 1.00 75.00  ? 42   ARG G CZ    1 
ATOM   4734  N  NH1   . ARG G 3 42  ? -11.484 -28.151 10.877 1.00 75.98  ? 42   ARG G NH1   1 
ATOM   4735  N  NH2   . ARG G 3 42  ? -12.085 -26.532 9.354  1.00 76.25  ? 42   ARG G NH2   1 
ATOM   4736  N  N     . VAL G 3 43  ? -17.065 -27.909 16.218 1.00 60.29  ? 43   VAL G N     1 
ATOM   4737  C  CA    . VAL G 3 43  ? -17.715 -28.883 17.090 1.00 59.90  ? 43   VAL G CA    1 
ATOM   4738  C  C     . VAL G 3 43  ? -17.859 -30.227 16.371 1.00 59.81  ? 43   VAL G C     1 
ATOM   4739  O  O     . VAL G 3 43  ? -18.621 -30.347 15.408 1.00 60.08  ? 43   VAL G O     1 
ATOM   4740  C  CB    . VAL G 3 43  ? -19.107 -28.386 17.547 1.00 60.02  ? 43   VAL G CB    1 
ATOM   4741  C  CG1   . VAL G 3 43  ? -19.862 -29.486 18.306 1.00 59.63  ? 43   VAL G CG1   1 
ATOM   4742  C  CG2   . VAL G 3 43  ? -18.980 -27.118 18.391 1.00 59.56  ? 43   VAL G CG2   1 
ATOM   4743  N  N     . GLY G 3 44  ? -17.135 -31.235 16.850 1.00 59.57  ? 44   GLY G N     1 
ATOM   4744  C  CA    . GLY G 3 44  ? -17.065 -32.545 16.189 1.00 59.19  ? 44   GLY G CA    1 
ATOM   4745  C  C     . GLY G 3 44  ? -18.354 -33.349 16.148 1.00 58.93  ? 44   GLY G C     1 
ATOM   4746  O  O     . GLY G 3 44  ? -19.192 -33.247 17.037 1.00 59.08  ? 44   GLY G O     1 
ATOM   4747  N  N     . ALA G 3 45  ? -18.485 -34.176 15.117 1.00 58.69  ? 45   ALA G N     1 
ATOM   4748  C  CA    . ALA G 3 45  ? -19.694 -34.963 14.853 1.00 58.31  ? 45   ALA G CA    1 
ATOM   4749  C  C     . ALA G 3 45  ? -20.226 -35.823 16.002 1.00 58.11  ? 45   ALA G C     1 
ATOM   4750  O  O     . ALA G 3 45  ? -21.429 -36.077 16.056 1.00 58.25  ? 45   ALA G O     1 
ATOM   4751  C  CB    . ALA G 3 45  ? -19.483 -35.831 13.621 1.00 58.47  ? 45   ALA G CB    1 
ATOM   4752  N  N     . GLY G 3 46  ? -19.345 -36.276 16.896 1.00 57.86  ? 46   GLY G N     1 
ATOM   4753  C  CA    . GLY G 3 46  ? -19.727 -37.204 17.975 1.00 57.42  ? 46   GLY G CA    1 
ATOM   4754  C  C     . GLY G 3 46  ? -19.943 -36.587 19.356 1.00 57.20  ? 46   GLY G C     1 
ATOM   4755  O  O     . GLY G 3 46  ? -20.303 -37.280 20.318 1.00 57.25  ? 46   GLY G O     1 
ATOM   4756  N  N     . ALA G 3 47  ? -19.730 -35.279 19.458 1.00 56.54  ? 47   ALA G N     1 
ATOM   4757  C  CA    . ALA G 3 47  ? -19.855 -34.599 20.734 1.00 55.84  ? 47   ALA G CA    1 
ATOM   4758  C  C     . ALA G 3 47  ? -21.304 -34.266 21.090 1.00 55.20  ? 47   ALA G C     1 
ATOM   4759  O  O     . ALA G 3 47  ? -21.648 -34.242 22.262 1.00 55.42  ? 47   ALA G O     1 
ATOM   4760  C  CB    . ALA G 3 47  ? -18.960 -33.351 20.783 1.00 56.04  ? 47   ALA G CB    1 
ATOM   4761  N  N     . PRO G 3 48  ? -22.161 -34.002 20.089 1.00 54.62  ? 48   PRO G N     1 
ATOM   4762  C  CA    . PRO G 3 48  ? -23.574 -33.868 20.454 1.00 54.04  ? 48   PRO G CA    1 
ATOM   4763  C  C     . PRO G 3 48  ? -24.156 -35.227 20.791 1.00 53.74  ? 48   PRO G C     1 
ATOM   4764  O  O     . PRO G 3 48  ? -25.114 -35.318 21.547 1.00 53.91  ? 48   PRO G O     1 
ATOM   4765  C  CB    . PRO G 3 48  ? -24.227 -33.340 19.175 1.00 54.03  ? 48   PRO G CB    1 
ATOM   4766  C  CG    . PRO G 3 48  ? -23.088 -32.953 18.262 1.00 54.05  ? 48   PRO G CG    1 
ATOM   4767  C  CD    . PRO G 3 48  ? -21.943 -33.802 18.646 1.00 54.31  ? 48   PRO G CD    1 
ATOM   4768  N  N     . VAL G 3 49  ? -23.566 -36.277 20.228 1.00 53.43  ? 49   VAL G N     1 
ATOM   4769  C  CA    . VAL G 3 49  ? -24.030 -37.643 20.440 1.00 53.09  ? 49   VAL G CA    1 
ATOM   4770  C  C     . VAL G 3 49  ? -23.835 -38.028 21.899 1.00 52.41  ? 49   VAL G C     1 
ATOM   4771  O  O     . VAL G 3 49  ? -24.796 -38.371 22.605 1.00 52.27  ? 49   VAL G O     1 
ATOM   4772  C  CB    . VAL G 3 49  ? -23.260 -38.642 19.547 1.00 53.16  ? 49   VAL G CB    1 
ATOM   4773  C  CG1   . VAL G 3 49  ? -23.711 -40.046 19.843 1.00 53.85  ? 49   VAL G CG1   1 
ATOM   4774  C  CG2   . VAL G 3 49  ? -23.475 -38.327 18.074 1.00 53.29  ? 49   VAL G CG2   1 
ATOM   4775  N  N     . TYR G 3 50  ? -22.577 -37.949 22.327 1.00 51.49  ? 50   TYR G N     1 
ATOM   4776  C  CA    . TYR G 3 50  ? -22.172 -38.238 23.688 1.00 50.69  ? 50   TYR G CA    1 
ATOM   4777  C  C     . TYR G 3 50  ? -22.964 -37.383 24.678 1.00 50.13  ? 50   TYR G C     1 
ATOM   4778  O  O     . TYR G 3 50  ? -23.505 -37.896 25.666 1.00 49.82  ? 50   TYR G O     1 
ATOM   4779  C  CB    . TYR G 3 50  ? -20.677 -37.960 23.820 1.00 50.83  ? 50   TYR G CB    1 
ATOM   4780  C  CG    . TYR G 3 50  ? -19.982 -38.619 24.999 1.00 50.96  ? 50   TYR G CG    1 
ATOM   4781  C  CD1   . TYR G 3 50  ? -18.947 -39.524 24.797 1.00 49.63  ? 50   TYR G CD1   1 
ATOM   4782  C  CD2   . TYR G 3 50  ? -20.337 -38.307 26.314 1.00 50.60  ? 50   TYR G CD2   1 
ATOM   4783  C  CE1   . TYR G 3 50  ? -18.301 -40.113 25.859 1.00 50.37  ? 50   TYR G CE1   1 
ATOM   4784  C  CE2   . TYR G 3 50  ? -19.691 -38.883 27.384 1.00 50.68  ? 50   TYR G CE2   1 
ATOM   4785  C  CZ    . TYR G 3 50  ? -18.672 -39.788 27.154 1.00 51.61  ? 50   TYR G CZ    1 
ATOM   4786  O  OH    . TYR G 3 50  ? -18.024 -40.369 28.234 1.00 52.61  ? 50   TYR G OH    1 
ATOM   4787  N  N     . LEU G 3 51  ? -23.043 -36.082 24.395 1.00 49.37  ? 51   LEU G N     1 
ATOM   4788  C  CA    . LEU G 3 51  ? -23.707 -35.147 25.288 1.00 48.46  ? 51   LEU G CA    1 
ATOM   4789  C  C     . LEU G 3 51  ? -25.178 -35.527 25.488 1.00 48.09  ? 51   LEU G C     1 
ATOM   4790  O  O     . LEU G 3 51  ? -25.646 -35.619 26.630 1.00 48.25  ? 51   LEU G O     1 
ATOM   4791  C  CB    . LEU G 3 51  ? -23.544 -33.702 24.809 1.00 47.91  ? 51   LEU G CB    1 
ATOM   4792  C  CG    . LEU G 3 51  ? -24.208 -32.571 25.615 1.00 48.53  ? 51   LEU G CG    1 
ATOM   4793  C  CD1   . LEU G 3 51  ? -24.142 -32.749 27.153 1.00 47.98  ? 51   LEU G CD1   1 
ATOM   4794  C  CD2   . LEU G 3 51  ? -23.619 -31.233 25.209 1.00 48.33  ? 51   LEU G CD2   1 
ATOM   4795  N  N     . ALA G 3 52  ? -25.885 -35.774 24.387 1.00 47.24  ? 52   ALA G N     1 
ATOM   4796  C  CA    . ALA G 3 52  ? -27.297 -36.128 24.444 1.00 46.54  ? 52   ALA G CA    1 
ATOM   4797  C  C     . ALA G 3 52  ? -27.513 -37.456 25.177 1.00 46.42  ? 52   ALA G C     1 
ATOM   4798  O  O     . ALA G 3 52  ? -28.503 -37.624 25.889 1.00 46.06  ? 52   ALA G O     1 
ATOM   4799  C  CB    . ALA G 3 52  ? -27.867 -36.187 23.061 1.00 46.49  ? 52   ALA G CB    1 
ATOM   4800  N  N     . ALA G 3 53  ? -26.581 -38.392 25.002 1.00 46.19  ? 53   ALA G N     1 
ATOM   4801  C  CA    . ALA G 3 53  ? -26.606 -39.642 25.741 1.00 46.07  ? 53   ALA G CA    1 
ATOM   4802  C  C     . ALA G 3 53  ? -26.630 -39.359 27.235 1.00 46.28  ? 53   ALA G C     1 
ATOM   4803  O  O     . ALA G 3 53  ? -27.515 -39.826 27.955 1.00 46.64  ? 53   ALA G O     1 
ATOM   4804  C  CB    . ALA G 3 53  ? -25.398 -40.468 25.396 1.00 46.10  ? 53   ALA G CB    1 
ATOM   4805  N  N     . VAL G 3 54  ? -25.656 -38.568 27.682 1.00 46.24  ? 54   VAL G N     1 
ATOM   4806  C  CA    . VAL G 3 54  ? -25.472 -38.256 29.089 1.00 45.85  ? 54   VAL G CA    1 
ATOM   4807  C  C     . VAL G 3 54  ? -26.695 -37.572 29.667 1.00 45.90  ? 54   VAL G C     1 
ATOM   4808  O  O     . VAL G 3 54  ? -27.081 -37.819 30.825 1.00 46.44  ? 54   VAL G O     1 
ATOM   4809  C  CB    . VAL G 3 54  ? -24.247 -37.372 29.293 1.00 45.77  ? 54   VAL G CB    1 
ATOM   4810  C  CG1   . VAL G 3 54  ? -24.173 -36.871 30.733 1.00 45.65  ? 54   VAL G CG1   1 
ATOM   4811  C  CG2   . VAL G 3 54  ? -22.989 -38.139 28.909 1.00 45.47  ? 54   VAL G CG2   1 
ATOM   4812  N  N     . LEU G 3 55  ? -27.313 -36.721 28.861 1.00 45.31  ? 55   LEU G N     1 
ATOM   4813  C  CA    . LEU G 3 55  ? -28.459 -35.994 29.338 1.00 45.20  ? 55   LEU G CA    1 
ATOM   4814  C  C     . LEU G 3 55  ? -29.609 -36.966 29.571 1.00 45.60  ? 55   LEU G C     1 
ATOM   4815  O  O     . LEU G 3 55  ? -30.190 -36.991 30.653 1.00 45.55  ? 55   LEU G O     1 
ATOM   4816  C  CB    . LEU G 3 55  ? -28.800 -34.834 28.400 1.00 44.88  ? 55   LEU G CB    1 
ATOM   4817  C  CG    . LEU G 3 55  ? -27.788 -33.671 28.435 1.00 44.14  ? 55   LEU G CG    1 
ATOM   4818  C  CD1   . LEU G 3 55  ? -27.952 -32.738 27.258 1.00 43.68  ? 55   LEU G CD1   1 
ATOM   4819  C  CD2   . LEU G 3 55  ? -27.846 -32.880 29.741 1.00 42.88  ? 55   LEU G CD2   1 
ATOM   4820  N  N     . GLU G 3 56  ? -29.873 -37.815 28.581 1.00 46.22  ? 56   GLU G N     1 
ATOM   4821  C  CA    . GLU G 3 56  ? -30.906 -38.846 28.679 1.00 46.43  ? 56   GLU G CA    1 
ATOM   4822  C  C     . GLU G 3 56  ? -30.729 -39.693 29.930 1.00 45.84  ? 56   GLU G C     1 
ATOM   4823  O  O     . GLU G 3 56  ? -31.616 -39.756 30.790 1.00 45.32  ? 56   GLU G O     1 
ATOM   4824  C  CB    . GLU G 3 56  ? -30.912 -39.739 27.435 1.00 46.18  ? 56   GLU G CB    1 
ATOM   4825  C  CG    . GLU G 3 56  ? -32.126 -40.679 27.389 1.00 47.57  ? 56   GLU G CG    1 
ATOM   4826  C  CD    . GLU G 3 56  ? -32.343 -41.368 26.043 1.00 47.86  ? 56   GLU G CD    1 
ATOM   4827  O  OE1   . GLU G 3 56  ? -32.048 -40.759 24.981 1.00 49.07  ? 56   GLU G OE1   1 
ATOM   4828  O  OE2   . GLU G 3 56  ? -32.831 -42.523 26.061 1.00 49.75  ? 56   GLU G OE2   1 
ATOM   4829  N  N     . TYR G 3 57  ? -29.571 -40.332 30.022 1.00 45.80  ? 57   TYR G N     1 
ATOM   4830  C  CA    . TYR G 3 57  ? -29.248 -41.175 31.167 1.00 46.06  ? 57   TYR G CA    1 
ATOM   4831  C  C     . TYR G 3 57  ? -29.589 -40.495 32.501 1.00 46.39  ? 57   TYR G C     1 
ATOM   4832  O  O     . TYR G 3 57  ? -30.215 -41.106 33.373 1.00 46.42  ? 57   TYR G O     1 
ATOM   4833  C  CB    . TYR G 3 57  ? -27.766 -41.575 31.145 1.00 45.84  ? 57   TYR G CB    1 
ATOM   4834  C  CG    . TYR G 3 57  ? -27.301 -42.098 32.476 1.00 45.64  ? 57   TYR G CG    1 
ATOM   4835  C  CD1   . TYR G 3 57  ? -27.667 -43.372 32.908 1.00 45.13  ? 57   TYR G CD1   1 
ATOM   4836  C  CD2   . TYR G 3 57  ? -26.530 -41.307 33.324 1.00 45.19  ? 57   TYR G CD2   1 
ATOM   4837  C  CE1   . TYR G 3 57  ? -27.270 -43.843 34.132 1.00 44.63  ? 57   TYR G CE1   1 
ATOM   4838  C  CE2   . TYR G 3 57  ? -26.124 -41.772 34.551 1.00 44.41  ? 57   TYR G CE2   1 
ATOM   4839  C  CZ    . TYR G 3 57  ? -26.503 -43.037 34.945 1.00 45.25  ? 57   TYR G CZ    1 
ATOM   4840  O  OH    . TYR G 3 57  ? -26.109 -43.504 36.167 1.00 47.01  ? 57   TYR G OH    1 
ATOM   4841  N  N     . LEU G 3 58  ? -29.166 -39.236 32.646 1.00 46.56  ? 58   LEU G N     1 
ATOM   4842  C  CA    . LEU G 3 58  ? -29.345 -38.499 33.886 1.00 46.50  ? 58   LEU G CA    1 
ATOM   4843  C  C     . LEU G 3 58  ? -30.808 -38.182 34.103 1.00 46.72  ? 58   LEU G C     1 
ATOM   4844  O  O     . LEU G 3 58  ? -31.299 -38.166 35.229 1.00 46.51  ? 58   LEU G O     1 
ATOM   4845  C  CB    . LEU G 3 58  ? -28.492 -37.225 33.893 1.00 46.25  ? 58   LEU G CB    1 
ATOM   4846  C  CG    . LEU G 3 58  ? -27.014 -37.380 34.280 1.00 45.54  ? 58   LEU G CG    1 
ATOM   4847  C  CD1   . LEU G 3 58  ? -26.218 -36.112 34.035 1.00 44.89  ? 58   LEU G CD1   1 
ATOM   4848  C  CD2   . LEU G 3 58  ? -26.864 -37.804 35.716 1.00 43.33  ? 58   LEU G CD2   1 
ATOM   4849  N  N     . THR G 3 59  ? -31.506 -37.945 33.007 1.00 47.52  ? 59   THR G N     1 
ATOM   4850  C  CA    . THR G 3 59  ? -32.937 -37.725 33.060 1.00 48.58  ? 59   THR G CA    1 
ATOM   4851  C  C     . THR G 3 59  ? -33.610 -39.008 33.544 1.00 49.10  ? 59   THR G C     1 
ATOM   4852  O  O     . THR G 3 59  ? -34.469 -38.975 34.434 1.00 49.38  ? 59   THR G O     1 
ATOM   4853  C  CB    . THR G 3 59  ? -33.471 -37.357 31.688 1.00 48.36  ? 59   THR G CB    1 
ATOM   4854  O  OG1   . THR G 3 59  ? -32.591 -36.409 31.090 1.00 49.09  ? 59   THR G OG1   1 
ATOM   4855  C  CG2   . THR G 3 59  ? -34.825 -36.752 31.797 1.00 48.53  ? 59   THR G CG2   1 
ATOM   4856  N  N     . ALA G 3 60  ? -33.187 -40.135 32.973 1.00 49.35  ? 60   ALA G N     1 
ATOM   4857  C  CA    . ALA G 3 60  ? -33.737 -41.438 33.330 1.00 49.51  ? 60   ALA G CA    1 
ATOM   4858  C  C     . ALA G 3 60  ? -33.604 -41.727 34.821 1.00 49.54  ? 60   ALA G C     1 
ATOM   4859  O  O     . ALA G 3 60  ? -34.578 -42.101 35.465 1.00 49.44  ? 60   ALA G O     1 
ATOM   4860  C  CB    . ALA G 3 60  ? -33.091 -42.538 32.498 1.00 49.59  ? 60   ALA G CB    1 
ATOM   4861  N  N     . GLU G 3 61  ? -32.409 -41.523 35.367 1.00 49.83  ? 61   GLU G N     1 
ATOM   4862  C  CA    . GLU G 3 61  ? -32.161 -41.737 36.789 1.00 50.23  ? 61   GLU G CA    1 
ATOM   4863  C  C     . GLU G 3 61  ? -33.149 -40.953 37.659 1.00 50.12  ? 61   GLU G C     1 
ATOM   4864  O  O     . GLU G 3 61  ? -33.871 -41.546 38.451 1.00 50.26  ? 61   GLU G O     1 
ATOM   4865  C  CB    . GLU G 3 61  ? -30.724 -41.371 37.127 1.00 50.40  ? 61   GLU G CB    1 
ATOM   4866  C  CG    . GLU G 3 61  ? -30.266 -41.785 38.516 1.00 53.56  ? 61   GLU G CG    1 
ATOM   4867  C  CD    . GLU G 3 61  ? -29.900 -43.268 38.640 1.00 56.85  ? 61   GLU G CD    1 
ATOM   4868  O  OE1   . GLU G 3 61  ? -29.861 -43.993 37.615 1.00 56.78  ? 61   GLU G OE1   1 
ATOM   4869  O  OE2   . GLU G 3 61  ? -29.639 -43.699 39.787 1.00 57.96  ? 61   GLU G OE2   1 
ATOM   4870  N  N     . ILE G 3 62  ? -33.206 -39.634 37.489 1.00 50.06  ? 62   ILE G N     1 
ATOM   4871  C  CA    . ILE G 3 62  ? -34.091 -38.794 38.296 1.00 49.97  ? 62   ILE G CA    1 
ATOM   4872  C  C     . ILE G 3 62  ? -35.553 -39.180 38.130 1.00 50.17  ? 62   ILE G C     1 
ATOM   4873  O  O     . ILE G 3 62  ? -36.294 -39.236 39.110 1.00 50.16  ? 62   ILE G O     1 
ATOM   4874  C  CB    . ILE G 3 62  ? -33.872 -37.279 38.016 1.00 50.25  ? 62   ILE G CB    1 
ATOM   4875  C  CG1   . ILE G 3 62  ? -32.701 -36.776 38.841 1.00 50.55  ? 62   ILE G CG1   1 
ATOM   4876  C  CG2   . ILE G 3 62  ? -35.105 -36.433 38.370 1.00 49.22  ? 62   ILE G CG2   1 
ATOM   4877  C  CD1   . ILE G 3 62  ? -32.499 -35.286 38.767 1.00 53.72  ? 62   ILE G CD1   1 
ATOM   4878  N  N     . LEU G 3 63  ? -35.964 -39.452 36.895 1.00 50.36  ? 63   LEU G N     1 
ATOM   4879  C  CA    . LEU G 3 63  ? -37.327 -39.894 36.635 1.00 50.61  ? 63   LEU G CA    1 
ATOM   4880  C  C     . LEU G 3 63  ? -37.580 -41.250 37.265 1.00 51.19  ? 63   LEU G C     1 
ATOM   4881  O  O     . LEU G 3 63  ? -38.610 -41.463 37.898 1.00 51.15  ? 63   LEU G O     1 
ATOM   4882  C  CB    . LEU G 3 63  ? -37.598 -39.964 35.143 1.00 50.41  ? 63   LEU G CB    1 
ATOM   4883  C  CG    . LEU G 3 63  ? -37.733 -38.629 34.427 1.00 49.82  ? 63   LEU G CG    1 
ATOM   4884  C  CD1   . LEU G 3 63  ? -37.731 -38.914 32.964 1.00 50.50  ? 63   LEU G CD1   1 
ATOM   4885  C  CD2   . LEU G 3 63  ? -38.990 -37.876 34.833 1.00 48.42  ? 63   LEU G CD2   1 
ATOM   4886  N  N     . GLU G 3 64  ? -36.627 -42.160 37.098 1.00 52.06  ? 64   GLU G N     1 
ATOM   4887  C  CA    . GLU G 3 64  ? -36.679 -43.452 37.753 1.00 53.19  ? 64   GLU G CA    1 
ATOM   4888  C  C     . GLU G 3 64  ? -36.990 -43.257 39.226 1.00 53.46  ? 64   GLU G C     1 
ATOM   4889  O  O     . GLU G 3 64  ? -38.024 -43.721 39.719 1.00 53.87  ? 64   GLU G O     1 
ATOM   4890  C  CB    . GLU G 3 64  ? -35.340 -44.174 37.589 1.00 53.47  ? 64   GLU G CB    1 
ATOM   4891  C  CG    . GLU G 3 64  ? -35.064 -45.280 38.603 1.00 55.82  ? 64   GLU G CG    1 
ATOM   4892  C  CD    . GLU G 3 64  ? -35.749 -46.577 38.254 1.00 59.17  ? 64   GLU G CD    1 
ATOM   4893  O  OE1   . GLU G 3 64  ? -36.991 -46.573 38.058 1.00 60.37  ? 64   GLU G OE1   1 
ATOM   4894  O  OE2   . GLU G 3 64  ? -35.033 -47.604 38.188 1.00 60.50  ? 64   GLU G OE2   1 
ATOM   4895  N  N     . LEU G 3 65  ? -36.100 -42.542 39.910 1.00 53.47  ? 65   LEU G N     1 
ATOM   4896  C  CA    . LEU G 3 65  ? -36.159 -42.421 41.350 1.00 53.63  ? 65   LEU G CA    1 
ATOM   4897  C  C     . LEU G 3 65  ? -37.386 -41.650 41.786 1.00 54.12  ? 65   LEU G C     1 
ATOM   4898  O  O     . LEU G 3 65  ? -38.058 -42.055 42.737 1.00 54.43  ? 65   LEU G O     1 
ATOM   4899  C  CB    . LEU G 3 65  ? -34.871 -41.806 41.893 1.00 53.37  ? 65   LEU G CB    1 
ATOM   4900  C  CG    . LEU G 3 65  ? -33.659 -42.734 41.720 1.00 53.48  ? 65   LEU G CG    1 
ATOM   4901  C  CD1   . LEU G 3 65  ? -32.342 -41.985 41.754 1.00 53.47  ? 65   LEU G CD1   1 
ATOM   4902  C  CD2   . LEU G 3 65  ? -33.657 -43.865 42.746 1.00 54.19  ? 65   LEU G CD2   1 
ATOM   4903  N  N     . ALA G 3 66  ? -37.696 -40.563 41.075 1.00 54.40  ? 66   ALA G N     1 
ATOM   4904  C  CA    . ALA G 3 66  ? -38.876 -39.758 41.382 1.00 54.80  ? 66   ALA G CA    1 
ATOM   4905  C  C     . ALA G 3 66  ? -40.130 -40.623 41.268 1.00 55.21  ? 66   ALA G C     1 
ATOM   4906  O  O     . ALA G 3 66  ? -41.008 -40.581 42.137 1.00 55.06  ? 66   ALA G O     1 
ATOM   4907  C  CB    . ALA G 3 66  ? -38.960 -38.548 40.475 1.00 54.63  ? 66   ALA G CB    1 
ATOM   4908  N  N     . GLY G 3 67  ? -40.178 -41.428 40.207 1.00 55.68  ? 67   GLY G N     1 
ATOM   4909  C  CA    . GLY G 3 67  ? -41.222 -42.430 40.017 1.00 56.17  ? 67   GLY G CA    1 
ATOM   4910  C  C     . GLY G 3 67  ? -41.412 -43.314 41.235 1.00 56.33  ? 67   GLY G C     1 
ATOM   4911  O  O     . GLY G 3 67  ? -42.534 -43.492 41.704 1.00 56.19  ? 67   GLY G O     1 
ATOM   4912  N  N     . ASN G 3 68  ? -40.314 -43.855 41.756 1.00 56.62  ? 68   ASN G N     1 
ATOM   4913  C  CA    . ASN G 3 68  ? -40.375 -44.702 42.941 1.00 57.17  ? 68   ASN G CA    1 
ATOM   4914  C  C     . ASN G 3 68  ? -41.061 -43.966 44.074 1.00 57.67  ? 68   ASN G C     1 
ATOM   4915  O  O     . ASN G 3 68  ? -41.912 -44.516 44.756 1.00 57.39  ? 68   ASN G O     1 
ATOM   4916  C  CB    . ASN G 3 68  ? -38.970 -45.144 43.378 1.00 57.12  ? 68   ASN G CB    1 
ATOM   4917  C  CG    . ASN G 3 68  ? -38.267 -46.018 42.337 1.00 57.12  ? 68   ASN G CG    1 
ATOM   4918  O  OD1   . ASN G 3 68  ? -38.836 -46.369 41.295 1.00 56.83  ? 68   ASN G OD1   1 
ATOM   4919  N  ND2   . ASN G 3 68  ? -37.015 -46.368 42.620 1.00 56.40  ? 68   ASN G ND2   1 
ATOM   4920  N  N     . ALA G 3 69  ? -40.687 -42.702 44.246 1.00 58.85  ? 69   ALA G N     1 
ATOM   4921  C  CA    . ALA G 3 69  ? -41.211 -41.861 45.308 1.00 59.60  ? 69   ALA G CA    1 
ATOM   4922  C  C     . ALA G 3 69  ? -42.673 -41.550 45.065 1.00 60.28  ? 69   ALA G C     1 
ATOM   4923  O  O     . ALA G 3 69  ? -43.423 -41.330 46.007 1.00 60.30  ? 69   ALA G O     1 
ATOM   4924  C  CB    . ALA G 3 69  ? -40.410 -40.593 45.403 1.00 59.58  ? 69   ALA G CB    1 
ATOM   4925  N  N     . ALA G 3 70  ? -43.068 -41.525 43.796 1.00 61.32  ? 70   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3 70  ? -44.476 -41.422 43.435 1.00 62.40  ? 70   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3 70  ? -45.229 -42.655 43.946 1.00 63.28  ? 70   ALA G C     1 
ATOM   4928  O  O     . ALA G 3 70  ? -46.248 -42.527 44.632 1.00 63.50  ? 70   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3 70  ? -44.633 -41.278 41.932 1.00 62.20  ? 70   ALA G CB    1 
ATOM   4930  N  N     . ARG G 3 71  ? -44.716 -43.839 43.621 1.00 64.24  ? 71   ARG G N     1 
ATOM   4931  C  CA    . ARG G 3 71  ? -45.258 -45.077 44.151 1.00 65.58  ? 71   ARG G CA    1 
ATOM   4932  C  C     . ARG G 3 71  ? -45.360 -44.953 45.673 1.00 65.98  ? 71   ARG G C     1 
ATOM   4933  O  O     . ARG G 3 71  ? -46.468 -44.904 46.215 1.00 66.35  ? 71   ARG G O     1 
ATOM   4934  C  CB    . ARG G 3 71  ? -44.388 -46.276 43.738 1.00 65.71  ? 71   ARG G CB    1 
ATOM   4935  C  CG    . ARG G 3 71  ? -44.959 -47.661 44.080 1.00 66.59  ? 71   ARG G CG    1 
ATOM   4936  C  CD    . ARG G 3 71  ? -43.907 -48.770 43.941 1.00 66.76  ? 71   ARG G CD    1 
ATOM   4937  N  NE    . ARG G 3 71  ? -44.454 -50.087 44.296 1.00 70.44  ? 71   ARG G NE    1 
ATOM   4938  C  CZ    . ARG G 3 71  ? -43.733 -51.203 44.454 1.00 72.16  ? 71   ARG G CZ    1 
ATOM   4939  N  NH1   . ARG G 3 71  ? -42.412 -51.187 44.298 1.00 72.47  ? 71   ARG G NH1   1 
ATOM   4940  N  NH2   . ARG G 3 71  ? -44.333 -52.346 44.782 1.00 72.63  ? 71   ARG G NH2   1 
ATOM   4941  N  N     . ASP G 3 72  ? -44.214 -44.845 46.347 1.00 66.47  ? 72   ASP G N     1 
ATOM   4942  C  CA    . ASP G 3 72  ? -44.156 -44.843 47.809 1.00 67.00  ? 72   ASP G CA    1 
ATOM   4943  C  C     . ASP G 3 72  ? -45.258 -44.007 48.438 1.00 67.39  ? 72   ASP G C     1 
ATOM   4944  O  O     . ASP G 3 72  ? -45.712 -44.298 49.538 1.00 67.63  ? 72   ASP G O     1 
ATOM   4945  C  CB    . ASP G 3 72  ? -42.809 -44.307 48.311 1.00 67.27  ? 72   ASP G CB    1 
ATOM   4946  C  CG    . ASP G 3 72  ? -41.620 -45.163 47.887 1.00 67.84  ? 72   ASP G CG    1 
ATOM   4947  O  OD1   . ASP G 3 72  ? -41.796 -46.351 47.547 1.00 68.45  ? 72   ASP G OD1   1 
ATOM   4948  O  OD2   . ASP G 3 72  ? -40.487 -44.632 47.900 1.00 68.84  ? 72   ASP G OD2   1 
ATOM   4949  N  N     . ASN G 3 73  ? -45.685 -42.962 47.740 1.00 67.86  ? 73   ASN G N     1 
ATOM   4950  C  CA    . ASN G 3 73  ? -46.602 -41.990 48.324 1.00 68.43  ? 73   ASN G CA    1 
ATOM   4951  C  C     . ASN G 3 73  ? -48.057 -42.157 47.859 1.00 68.63  ? 73   ASN G C     1 
ATOM   4952  O  O     . ASN G 3 73  ? -48.903 -41.288 48.115 1.00 68.53  ? 73   ASN G O     1 
ATOM   4953  C  CB    . ASN G 3 73  ? -46.076 -40.562 48.105 1.00 68.53  ? 73   ASN G CB    1 
ATOM   4954  C  CG    . ASN G 3 73  ? -44.727 -40.318 48.799 1.00 69.34  ? 73   ASN G CG    1 
ATOM   4955  O  OD1   . ASN G 3 73  ? -44.654 -39.613 49.807 1.00 70.62  ? 73   ASN G OD1   1 
ATOM   4956  N  ND2   . ASN G 3 73  ? -43.659 -40.912 48.266 1.00 69.52  ? 73   ASN G ND2   1 
ATOM   4957  N  N     . LYS G 3 74  ? -48.334 -43.300 47.216 1.00 68.65  ? 74   LYS G N     1 
ATOM   4958  C  CA    . LYS G 3 74  ? -49.673 -43.669 46.714 1.00 68.76  ? 74   LYS G CA    1 
ATOM   4959  C  C     . LYS G 3 74  ? -50.090 -42.855 45.487 1.00 68.17  ? 74   LYS G C     1 
ATOM   4960  O  O     . LYS G 3 74  ? -51.282 -42.613 45.268 1.00 68.07  ? 74   LYS G O     1 
ATOM   4961  C  CB    . LYS G 3 74  ? -50.767 -43.562 47.810 1.00 69.49  ? 74   LYS G CB    1 
ATOM   4962  C  CG    . LYS G 3 74  ? -50.539 -44.360 49.114 1.00 70.44  ? 74   LYS G CG    1 
ATOM   4963  C  CD    . LYS G 3 74  ? -50.598 -45.883 48.913 1.00 71.93  ? 74   LYS G CD    1 
ATOM   4964  C  CE    . LYS G 3 74  ? -50.433 -46.615 50.253 1.00 72.14  ? 74   LYS G CE    1 
ATOM   4965  N  NZ    . LYS G 3 74  ? -49.617 -47.867 50.131 1.00 72.76  ? 74   LYS G NZ    1 
ATOM   4966  N  N     . LYS G 3 75  ? -49.111 -42.443 44.684 1.00 67.47  ? 75   LYS G N     1 
ATOM   4967  C  CA    . LYS G 3 75  ? -49.373 -41.575 43.534 1.00 66.68  ? 75   LYS G CA    1 
ATOM   4968  C  C     . LYS G 3 75  ? -48.822 -42.118 42.226 1.00 65.82  ? 75   LYS G C     1 
ATOM   4969  O  O     . LYS G 3 75  ? -47.841 -42.863 42.207 1.00 65.66  ? 75   LYS G O     1 
ATOM   4970  C  CB    . LYS G 3 75  ? -48.826 -40.164 43.786 1.00 66.96  ? 75   LYS G CB    1 
ATOM   4971  C  CG    . LYS G 3 75  ? -49.814 -39.222 44.470 1.00 67.78  ? 75   LYS G CG    1 
ATOM   4972  C  CD    . LYS G 3 75  ? -49.631 -39.209 45.980 1.00 69.01  ? 75   LYS G CD    1 
ATOM   4973  C  CE    . LYS G 3 75  ? -50.833 -38.596 46.690 1.00 70.30  ? 75   LYS G CE    1 
ATOM   4974  N  NZ    . LYS G 3 75  ? -51.001 -37.147 46.385 1.00 71.67  ? 75   LYS G NZ    1 
ATOM   4975  N  N     . THR G 3 76  ? -49.458 -41.729 41.129 1.00 64.95  ? 76   THR G N     1 
ATOM   4976  C  CA    . THR G 3 76  ? -49.004 -42.145 39.801 1.00 64.27  ? 76   THR G CA    1 
ATOM   4977  C  C     . THR G 3 76  ? -48.378 -40.992 39.015 1.00 63.49  ? 76   THR G C     1 
ATOM   4978  O  O     . THR G 3 76  ? -47.616 -41.213 38.068 1.00 63.45  ? 76   THR G O     1 
ATOM   4979  C  CB    . THR G 3 76  ? -50.151 -42.753 38.972 1.00 64.23  ? 76   THR G CB    1 
ATOM   4980  O  OG1   . THR G 3 76  ? -51.258 -41.842 38.957 1.00 64.94  ? 76   THR G OG1   1 
ATOM   4981  C  CG2   . THR G 3 76  ? -50.589 -44.088 39.563 1.00 63.99  ? 76   THR G CG2   1 
ATOM   4982  N  N     . ARG G 3 77  ? -48.705 -39.765 39.410 1.00 62.38  ? 77   ARG G N     1 
ATOM   4983  C  CA    . ARG G 3 77  ? -48.203 -38.582 38.720 1.00 61.37  ? 77   ARG G CA    1 
ATOM   4984  C  C     . ARG G 3 77  ? -47.103 -37.890 39.529 1.00 59.93  ? 77   ARG G C     1 
ATOM   4985  O  O     . ARG G 3 77  ? -47.332 -37.486 40.676 1.00 59.69  ? 77   ARG G O     1 
ATOM   4986  C  CB    . ARG G 3 77  ? -49.360 -37.621 38.439 1.00 61.71  ? 77   ARG G CB    1 
ATOM   4987  C  CG    . ARG G 3 77  ? -48.984 -36.334 37.722 1.00 62.96  ? 77   ARG G CG    1 
ATOM   4988  C  CD    . ARG G 3 77  ? -50.149 -35.370 37.762 1.00 65.39  ? 77   ARG G CD    1 
ATOM   4989  N  NE    . ARG G 3 77  ? -51.258 -35.846 36.937 1.00 67.74  ? 77   ARG G NE    1 
ATOM   4990  C  CZ    . ARG G 3 77  ? -52.531 -35.529 37.137 1.00 68.89  ? 77   ARG G CZ    1 
ATOM   4991  N  NH1   . ARG G 3 77  ? -52.876 -34.728 38.139 1.00 68.64  ? 77   ARG G NH1   1 
ATOM   4992  N  NH2   . ARG G 3 77  ? -53.462 -36.013 36.327 1.00 70.38  ? 77   ARG G NH2   1 
ATOM   4993  N  N     . ILE G 3 78  ? -45.923 -37.765 38.916 1.00 58.19  ? 78   ILE G N     1 
ATOM   4994  C  CA    . ILE G 3 78  ? -44.766 -37.084 39.514 1.00 56.73  ? 78   ILE G CA    1 
ATOM   4995  C  C     . ILE G 3 78  ? -44.984 -35.572 39.650 1.00 55.77  ? 78   ILE G C     1 
ATOM   4996  O  O     . ILE G 3 78  ? -45.360 -34.893 38.680 1.00 55.06  ? 78   ILE G O     1 
ATOM   4997  C  CB    . ILE G 3 78  ? -43.477 -37.309 38.687 1.00 56.65  ? 78   ILE G CB    1 
ATOM   4998  C  CG1   . ILE G 3 78  ? -43.028 -38.770 38.764 1.00 56.78  ? 78   ILE G CG1   1 
ATOM   4999  C  CG2   . ILE G 3 78  ? -42.373 -36.372 39.152 1.00 56.48  ? 78   ILE G CG2   1 
ATOM   5000  C  CD1   . ILE G 3 78  ? -42.014 -39.170 37.696 1.00 56.65  ? 78   ILE G CD1   1 
ATOM   5001  N  N     . ILE G 3 79  ? -44.745 -35.077 40.866 1.00 54.63  ? 79   ILE G N     1 
ATOM   5002  C  CA    . ILE G 3 79  ? -44.776 -33.650 41.197 1.00 53.64  ? 79   ILE G CA    1 
ATOM   5003  C  C     . ILE G 3 79  ? -43.453 -33.231 41.889 1.00 53.19  ? 79   ILE G C     1 
ATOM   5004  O  O     . ILE G 3 79  ? -42.738 -34.088 42.430 1.00 53.56  ? 79   ILE G O     1 
ATOM   5005  C  CB    . ILE G 3 79  ? -45.988 -33.308 42.095 1.00 53.45  ? 79   ILE G CB    1 
ATOM   5006  C  CG1   . ILE G 3 79  ? -45.879 -34.021 43.445 1.00 53.14  ? 79   ILE G CG1   1 
ATOM   5007  C  CG2   . ILE G 3 79  ? -47.290 -33.661 41.391 1.00 53.06  ? 79   ILE G CG2   1 
ATOM   5008  C  CD1   . ILE G 3 79  ? -46.593 -33.313 44.577 1.00 52.35  ? 79   ILE G CD1   1 
ATOM   5009  N  N     . PRO G 3 80  ? -43.117 -31.921 41.874 1.00 52.08  ? 80   PRO G N     1 
ATOM   5010  C  CA    . PRO G 3 80  ? -41.894 -31.399 42.471 1.00 51.25  ? 80   PRO G CA    1 
ATOM   5011  C  C     . PRO G 3 80  ? -41.428 -32.125 43.734 1.00 50.57  ? 80   PRO G C     1 
ATOM   5012  O  O     . PRO G 3 80  ? -40.269 -32.535 43.815 1.00 50.83  ? 80   PRO G O     1 
ATOM   5013  C  CB    . PRO G 3 80  ? -42.283 -29.964 42.795 1.00 51.30  ? 80   PRO G CB    1 
ATOM   5014  C  CG    . PRO G 3 80  ? -43.112 -29.587 41.640 1.00 51.67  ? 80   PRO G CG    1 
ATOM   5015  C  CD    . PRO G 3 80  ? -43.893 -30.832 41.259 1.00 52.24  ? 80   PRO G CD    1 
ATOM   5016  N  N     . ARG G 3 81  ? -42.321 -32.301 44.704 1.00 49.42  ? 81   ARG G N     1 
ATOM   5017  C  CA    . ARG G 3 81  ? -41.986 -33.046 45.909 1.00 48.03  ? 81   ARG G CA    1 
ATOM   5018  C  C     . ARG G 3 81  ? -41.290 -34.361 45.561 1.00 47.43  ? 81   ARG G C     1 
ATOM   5019  O  O     . ARG G 3 81  ? -40.327 -34.751 46.216 1.00 47.37  ? 81   ARG G O     1 
ATOM   5020  C  CB    . ARG G 3 81  ? -43.241 -33.316 46.738 1.00 47.81  ? 81   ARG G CB    1 
ATOM   5021  C  CG    . ARG G 3 81  ? -42.988 -34.038 48.037 1.00 46.78  ? 81   ARG G CG    1 
ATOM   5022  C  CD    . ARG G 3 81  ? -42.034 -33.276 48.908 1.00 45.11  ? 81   ARG G CD    1 
ATOM   5023  N  NE    . ARG G 3 81  ? -42.039 -33.763 50.284 1.00 45.62  ? 81   ARG G NE    1 
ATOM   5024  C  CZ    . ARG G 3 81  ? -41.203 -33.339 51.235 1.00 46.55  ? 81   ARG G CZ    1 
ATOM   5025  N  NH1   . ARG G 3 81  ? -40.273 -32.411 50.968 1.00 46.33  ? 81   ARG G NH1   1 
ATOM   5026  N  NH2   . ARG G 3 81  ? -41.287 -33.848 52.459 1.00 45.62  ? 81   ARG G NH2   1 
ATOM   5027  N  N     . HIS G 3 82  ? -41.763 -35.038 44.522 1.00 46.29  ? 82   HIS G N     1 
ATOM   5028  C  CA    . HIS G 3 82  ? -41.189 -36.329 44.191 1.00 45.62  ? 82   HIS G CA    1 
ATOM   5029  C  C     . HIS G 3 82  ? -39.807 -36.197 43.579 1.00 45.42  ? 82   HIS G C     1 
ATOM   5030  O  O     . HIS G 3 82  ? -39.023 -37.156 43.603 1.00 45.65  ? 82   HIS G O     1 
ATOM   5031  C  CB    . HIS G 3 82  ? -42.123 -37.156 43.310 1.00 45.29  ? 82   HIS G CB    1 
ATOM   5032  C  CG    . HIS G 3 82  ? -43.484 -37.344 43.905 1.00 44.71  ? 82   HIS G CG    1 
ATOM   5033  N  ND1   . HIS G 3 82  ? -44.645 -37.189 43.178 1.00 43.65  ? 82   HIS G ND1   1 
ATOM   5034  C  CD2   . HIS G 3 82  ? -43.867 -37.632 45.170 1.00 43.15  ? 82   HIS G CD2   1 
ATOM   5035  C  CE1   . HIS G 3 82  ? -45.683 -37.396 43.967 1.00 42.81  ? 82   HIS G CE1   1 
ATOM   5036  N  NE2   . HIS G 3 82  ? -45.239 -37.661 45.181 1.00 42.63  ? 82   HIS G NE2   1 
ATOM   5037  N  N     . LEU G 3 83  ? -39.495 -35.016 43.044 1.00 44.58  ? 83   LEU G N     1 
ATOM   5038  C  CA    . LEU G 3 83  ? -38.163 -34.788 42.492 1.00 43.32  ? 83   LEU G CA    1 
ATOM   5039  C  C     . LEU G 3 83  ? -37.242 -34.456 43.647 1.00 42.77  ? 83   LEU G C     1 
ATOM   5040  O  O     . LEU G 3 83  ? -36.087 -34.896 43.682 1.00 42.86  ? 83   LEU G O     1 
ATOM   5041  C  CB    . LEU G 3 83  ? -38.172 -33.687 41.444 1.00 43.07  ? 83   LEU G CB    1 
ATOM   5042  C  CG    . LEU G 3 83  ? -39.014 -33.930 40.181 1.00 42.99  ? 83   LEU G CG    1 
ATOM   5043  C  CD1   . LEU G 3 83  ? -39.289 -32.611 39.453 1.00 42.72  ? 83   LEU G CD1   1 
ATOM   5044  C  CD2   . LEU G 3 83  ? -38.362 -34.924 39.243 1.00 41.18  ? 83   LEU G CD2   1 
ATOM   5045  N  N     . GLN G 3 84  ? -37.777 -33.728 44.619 1.00 41.68  ? 84   GLN G N     1 
ATOM   5046  C  CA    . GLN G 3 84  ? -37.011 -33.368 45.801 1.00 41.03  ? 84   GLN G CA    1 
ATOM   5047  C  C     . GLN G 3 84  ? -36.615 -34.590 46.633 1.00 41.16  ? 84   GLN G C     1 
ATOM   5048  O  O     . GLN G 3 84  ? -35.422 -34.817 46.863 1.00 41.56  ? 84   GLN G O     1 
ATOM   5049  C  CB    . GLN G 3 84  ? -37.769 -32.351 46.639 1.00 40.59  ? 84   GLN G CB    1 
ATOM   5050  C  CG    . GLN G 3 84  ? -37.089 -31.977 47.907 1.00 39.47  ? 84   GLN G CG    1 
ATOM   5051  C  CD    . GLN G 3 84  ? -35.823 -31.193 47.693 1.00 39.14  ? 84   GLN G CD    1 
ATOM   5052  O  OE1   . GLN G 3 84  ? -35.233 -31.199 46.605 1.00 38.83  ? 84   GLN G OE1   1 
ATOM   5053  N  NE2   . GLN G 3 84  ? -35.378 -30.517 48.746 1.00 38.59  ? 84   GLN G NE2   1 
ATOM   5054  N  N     . LEU G 3 85  ? -37.598 -35.387 47.052 1.00 40.93  ? 85   LEU G N     1 
ATOM   5055  C  CA    . LEU G 3 85  ? -37.318 -36.625 47.771 1.00 40.79  ? 85   LEU G CA    1 
ATOM   5056  C  C     . LEU G 3 85  ? -36.361 -37.516 46.976 1.00 41.25  ? 85   LEU G C     1 
ATOM   5057  O  O     . LEU G 3 85  ? -35.418 -38.071 47.543 1.00 41.17  ? 85   LEU G O     1 
ATOM   5058  C  CB    . LEU G 3 85  ? -38.596 -37.401 48.113 1.00 40.58  ? 85   LEU G CB    1 
ATOM   5059  C  CG    . LEU G 3 85  ? -39.778 -36.787 48.887 1.00 39.77  ? 85   LEU G CG    1 
ATOM   5060  C  CD1   . LEU G 3 85  ? -40.902 -37.803 48.990 1.00 39.61  ? 85   LEU G CD1   1 
ATOM   5061  C  CD2   . LEU G 3 85  ? -39.414 -36.290 50.259 1.00 37.90  ? 85   LEU G CD2   1 
ATOM   5062  N  N     . ALA G 3 86  ? -36.572 -37.630 45.667 1.00 41.81  ? 86   ALA G N     1 
ATOM   5063  C  CA    . ALA G 3 86  ? -35.677 -38.443 44.836 1.00 42.68  ? 86   ALA G CA    1 
ATOM   5064  C  C     . ALA G 3 86  ? -34.243 -37.954 44.914 1.00 43.43  ? 86   ALA G C     1 
ATOM   5065  O  O     . ALA G 3 86  ? -33.337 -38.710 45.273 1.00 43.50  ? 86   ALA G O     1 
ATOM   5066  C  CB    . ALA G 3 86  ? -36.132 -38.458 43.410 1.00 42.86  ? 86   ALA G CB    1 
ATOM   5067  N  N     . VAL G 3 87  ? -34.045 -36.674 44.600 1.00 44.33  ? 87   VAL G N     1 
ATOM   5068  C  CA    . VAL G 3 87  ? -32.709 -36.076 44.616 1.00 44.45  ? 87   VAL G CA    1 
ATOM   5069  C  C     . VAL G 3 87  ? -32.101 -36.093 46.027 1.00 44.79  ? 87   VAL G C     1 
ATOM   5070  O  O     . VAL G 3 87  ? -31.073 -36.733 46.244 1.00 44.93  ? 87   VAL G O     1 
ATOM   5071  C  CB    . VAL G 3 87  ? -32.692 -34.679 43.946 1.00 44.11  ? 87   VAL G CB    1 
ATOM   5072  C  CG1   . VAL G 3 87  ? -31.402 -33.960 44.224 1.00 44.55  ? 87   VAL G CG1   1 
ATOM   5073  C  CG2   . VAL G 3 87  ? -32.859 -34.828 42.456 1.00 43.36  ? 87   VAL G CG2   1 
ATOM   5074  N  N     . ARG G 3 88  ? -32.751 -35.459 46.993 1.00 45.18  ? 88   ARG G N     1 
ATOM   5075  C  CA    . ARG G 3 88  ? -32.148 -35.356 48.333 1.00 46.11  ? 88   ARG G CA    1 
ATOM   5076  C  C     . ARG G 3 88  ? -31.913 -36.682 49.095 1.00 46.49  ? 88   ARG G C     1 
ATOM   5077  O  O     . ARG G 3 88  ? -31.124 -36.715 50.027 1.00 46.94  ? 88   ARG G O     1 
ATOM   5078  C  CB    . ARG G 3 88  ? -32.898 -34.335 49.194 1.00 45.90  ? 88   ARG G CB    1 
ATOM   5079  C  CG    . ARG G 3 88  ? -33.129 -32.986 48.491 1.00 46.77  ? 88   ARG G CG    1 
ATOM   5080  C  CD    . ARG G 3 88  ? -31.982 -31.976 48.645 1.00 47.64  ? 88   ARG G CD    1 
ATOM   5081  N  NE    . ARG G 3 88  ? -31.064 -31.852 47.500 1.00 47.88  ? 88   ARG G NE    1 
ATOM   5082  C  CZ    . ARG G 3 88  ? -31.150 -30.919 46.547 1.00 47.65  ? 88   ARG G CZ    1 
ATOM   5083  N  NH1   . ARG G 3 88  ? -32.126 -30.022 46.542 1.00 48.21  ? 88   ARG G NH1   1 
ATOM   5084  N  NH2   . ARG G 3 88  ? -30.257 -30.887 45.579 1.00 47.52  ? 88   ARG G NH2   1 
ATOM   5085  N  N     . ASN G 3 89  ? -32.575 -37.769 48.693 1.00 46.82  ? 89   ASN G N     1 
ATOM   5086  C  CA    . ASN G 3 89  ? -32.317 -39.098 49.282 1.00 46.85  ? 89   ASN G CA    1 
ATOM   5087  C  C     . ASN G 3 89  ? -31.198 -39.902 48.624 1.00 47.14  ? 89   ASN G C     1 
ATOM   5088  O  O     . ASN G 3 89  ? -30.986 -41.044 48.999 1.00 47.14  ? 89   ASN G O     1 
ATOM   5089  C  CB    . ASN G 3 89  ? -33.586 -39.962 49.310 1.00 46.50  ? 89   ASN G CB    1 
ATOM   5090  C  CG    . ASN G 3 89  ? -34.470 -39.673 50.506 1.00 46.44  ? 89   ASN G CG    1 
ATOM   5091  O  OD1   . ASN G 3 89  ? -34.026 -39.709 51.657 1.00 46.95  ? 89   ASN G OD1   1 
ATOM   5092  N  ND2   . ASN G 3 89  ? -35.731 -39.382 50.241 1.00 45.51  ? 89   ASN G ND2   1 
ATOM   5093  N  N     . ASP G 3 90  ? -30.493 -39.319 47.655 1.00 47.70  ? 90   ASP G N     1 
ATOM   5094  C  CA    . ASP G 3 90  ? -29.442 -40.023 46.916 1.00 48.18  ? 90   ASP G CA    1 
ATOM   5095  C  C     . ASP G 3 90  ? -28.135 -39.233 46.961 1.00 48.63  ? 90   ASP G C     1 
ATOM   5096  O  O     . ASP G 3 90  ? -27.988 -38.224 46.263 1.00 48.47  ? 90   ASP G O     1 
ATOM   5097  C  CB    . ASP G 3 90  ? -29.869 -40.247 45.469 1.00 48.25  ? 90   ASP G CB    1 
ATOM   5098  C  CG    . ASP G 3 90  ? -28.759 -40.841 44.608 1.00 50.20  ? 90   ASP G CG    1 
ATOM   5099  O  OD1   . ASP G 3 90  ? -28.415 -42.029 44.799 1.00 51.84  ? 90   ASP G OD1   1 
ATOM   5100  O  OD2   . ASP G 3 90  ? -28.231 -40.123 43.725 1.00 51.50  ? 90   ASP G OD2   1 
ATOM   5101  N  N     . GLU G 3 91  ? -27.191 -39.712 47.772 1.00 48.97  ? 91   GLU G N     1 
ATOM   5102  C  CA    . GLU G 3 91  ? -25.922 -39.034 48.014 1.00 50.01  ? 91   GLU G CA    1 
ATOM   5103  C  C     . GLU G 3 91  ? -25.374 -38.311 46.781 1.00 49.45  ? 91   GLU G C     1 
ATOM   5104  O  O     . GLU G 3 91  ? -24.913 -37.167 46.886 1.00 49.66  ? 91   GLU G O     1 
ATOM   5105  C  CB    . GLU G 3 91  ? -24.883 -40.018 48.565 1.00 49.73  ? 91   GLU G CB    1 
ATOM   5106  C  CG    . GLU G 3 91  ? -23.807 -39.360 49.431 1.00 51.90  ? 91   GLU G CG    1 
ATOM   5107  C  CD    . GLU G 3 91  ? -22.803 -40.363 50.033 1.00 53.21  ? 91   GLU G CD    1 
ATOM   5108  O  OE1   . GLU G 3 91  ? -22.048 -41.019 49.268 1.00 57.08  ? 91   GLU G OE1   1 
ATOM   5109  O  OE2   . GLU G 3 91  ? -22.748 -40.481 51.284 1.00 57.48  ? 91   GLU G OE2   1 
ATOM   5110  N  N     . GLU G 3 92  ? -25.460 -38.967 45.619 1.00 48.89  ? 92   GLU G N     1 
ATOM   5111  C  CA    . GLU G 3 92  ? -24.856 -38.461 44.385 1.00 47.90  ? 92   GLU G CA    1 
ATOM   5112  C  C     . GLU G 3 92  ? -25.668 -37.381 43.652 1.00 47.02  ? 92   GLU G C     1 
ATOM   5113  O  O     . GLU G 3 92  ? -25.168 -36.295 43.400 1.00 46.55  ? 92   GLU G O     1 
ATOM   5114  C  CB    . GLU G 3 92  ? -24.521 -39.616 43.456 1.00 48.11  ? 92   GLU G CB    1 
ATOM   5115  C  CG    . GLU G 3 92  ? -23.335 -40.440 43.908 1.00 49.16  ? 92   GLU G CG    1 
ATOM   5116  C  CD    . GLU G 3 92  ? -22.698 -41.230 42.769 1.00 52.01  ? 92   GLU G CD    1 
ATOM   5117  O  OE1   . GLU G 3 92  ? -23.360 -41.442 41.728 1.00 53.35  ? 92   GLU G OE1   1 
ATOM   5118  O  OE2   . GLU G 3 92  ? -21.527 -41.642 42.911 1.00 53.55  ? 92   GLU G OE2   1 
ATOM   5119  N  N     . LEU G 3 93  ? -26.916 -37.680 43.309 1.00 46.55  ? 93   LEU G N     1 
ATOM   5120  C  CA    . LEU G 3 93  ? -27.815 -36.654 42.764 1.00 45.71  ? 93   LEU G CA    1 
ATOM   5121  C  C     . LEU G 3 93  ? -27.897 -35.464 43.701 1.00 45.89  ? 93   LEU G C     1 
ATOM   5122  O  O     . LEU G 3 93  ? -27.953 -34.321 43.234 1.00 46.25  ? 93   LEU G O     1 
ATOM   5123  C  CB    . LEU G 3 93  ? -29.218 -37.199 42.498 1.00 45.15  ? 93   LEU G CB    1 
ATOM   5124  C  CG    . LEU G 3 93  ? -29.428 -38.149 41.311 1.00 43.73  ? 93   LEU G CG    1 
ATOM   5125  C  CD1   . LEU G 3 93  ? -30.799 -38.787 41.368 1.00 42.01  ? 93   LEU G CD1   1 
ATOM   5126  C  CD2   . LEU G 3 93  ? -29.217 -37.472 39.964 1.00 41.86  ? 93   LEU G CD2   1 
ATOM   5127  N  N     . ASN G 3 94  ? -27.884 -35.726 45.014 1.00 45.58  ? 94   ASN G N     1 
ATOM   5128  C  CA    . ASN G 3 94  ? -27.834 -34.649 45.996 1.00 45.26  ? 94   ASN G CA    1 
ATOM   5129  C  C     . ASN G 3 94  ? -26.561 -33.813 45.909 1.00 45.16  ? 94   ASN G C     1 
ATOM   5130  O  O     . ASN G 3 94  ? -26.620 -32.601 46.087 1.00 45.53  ? 94   ASN G O     1 
ATOM   5131  C  CB    . ASN G 3 94  ? -28.022 -35.153 47.428 1.00 45.38  ? 94   ASN G CB    1 
ATOM   5132  C  CG    . ASN G 3 94  ? -28.031 -34.013 48.458 1.00 45.00  ? 94   ASN G CG    1 
ATOM   5133  O  OD1   . ASN G 3 94  ? -28.650 -32.965 48.246 1.00 46.76  ? 94   ASN G OD1   1 
ATOM   5134  N  ND2   . ASN G 3 94  ? -27.349 -34.216 49.566 1.00 42.58  ? 94   ASN G ND2   1 
ATOM   5135  N  N     . LYS G 3 95  ? -25.413 -34.434 45.655 1.00 44.71  ? 95   LYS G N     1 
ATOM   5136  C  CA    . LYS G 3 95  ? -24.181 -33.648 45.566 1.00 44.25  ? 95   LYS G CA    1 
ATOM   5137  C  C     . LYS G 3 95  ? -24.189 -32.825 44.286 1.00 43.37  ? 95   LYS G C     1 
ATOM   5138  O  O     . LYS G 3 95  ? -23.896 -31.630 44.306 1.00 43.18  ? 95   LYS G O     1 
ATOM   5139  C  CB    . LYS G 3 95  ? -22.922 -34.507 45.654 1.00 44.53  ? 95   LYS G CB    1 
ATOM   5140  C  CG    . LYS G 3 95  ? -21.628 -33.677 45.675 1.00 47.19  ? 95   LYS G CG    1 
ATOM   5141  C  CD    . LYS G 3 95  ? -20.391 -34.544 45.417 1.00 51.87  ? 95   LYS G CD    1 
ATOM   5142  C  CE    . LYS G 3 95  ? -19.429 -33.850 44.453 1.00 54.03  ? 95   LYS G CE    1 
ATOM   5143  N  NZ    . LYS G 3 95  ? -18.910 -34.813 43.418 1.00 55.72  ? 95   LYS G NZ    1 
ATOM   5144  N  N     . LEU G 3 96  ? -24.560 -33.462 43.184 1.00 42.44  ? 96   LEU G N     1 
ATOM   5145  C  CA    . LEU G 3 96  ? -24.646 -32.788 41.900 1.00 41.67  ? 96   LEU G CA    1 
ATOM   5146  C  C     . LEU G 3 96  ? -25.553 -31.566 41.960 1.00 41.89  ? 96   LEU G C     1 
ATOM   5147  O  O     . LEU G 3 96  ? -25.292 -30.558 41.300 1.00 42.38  ? 96   LEU G O     1 
ATOM   5148  C  CB    . LEU G 3 96  ? -25.151 -33.748 40.827 1.00 41.23  ? 96   LEU G CB    1 
ATOM   5149  C  CG    . LEU G 3 96  ? -25.193 -33.295 39.373 1.00 40.35  ? 96   LEU G CG    1 
ATOM   5150  C  CD1   . LEU G 3 96  ? -23.806 -32.954 38.849 1.00 39.13  ? 96   LEU G CD1   1 
ATOM   5151  C  CD2   . LEU G 3 96  ? -25.854 -34.365 38.510 1.00 40.78  ? 96   LEU G CD2   1 
ATOM   5152  N  N     . LEU G 3 97  ? -26.620 -31.652 42.747 1.00 41.57  ? 97   LEU G N     1 
ATOM   5153  C  CA    . LEU G 3 97  ? -27.575 -30.556 42.827 1.00 41.10  ? 97   LEU G CA    1 
ATOM   5154  C  C     . LEU G 3 97  ? -27.506 -29.866 44.179 1.00 40.95  ? 97   LEU G C     1 
ATOM   5155  O  O     . LEU G 3 97  ? -28.444 -29.188 44.585 1.00 41.26  ? 97   LEU G O     1 
ATOM   5156  C  CB    . LEU G 3 97  ? -28.994 -31.055 42.516 1.00 40.84  ? 97   LEU G CB    1 
ATOM   5157  C  CG    . LEU G 3 97  ? -29.256 -31.648 41.119 1.00 41.06  ? 97   LEU G CG    1 
ATOM   5158  C  CD1   . LEU G 3 97  ? -30.717 -32.057 40.965 1.00 40.42  ? 97   LEU G CD1   1 
ATOM   5159  C  CD2   . LEU G 3 97  ? -28.845 -30.702 39.974 1.00 39.62  ? 97   LEU G CD2   1 
ATOM   5160  N  N     . GLY G 3 98  ? -26.383 -30.030 44.865 1.00 40.68  ? 98   GLY G N     1 
ATOM   5161  C  CA    . GLY G 3 98  ? -26.201 -29.487 46.203 1.00 40.54  ? 98   GLY G CA    1 
ATOM   5162  C  C     . GLY G 3 98  ? -26.252 -27.976 46.293 1.00 40.70  ? 98   GLY G C     1 
ATOM   5163  O  O     . GLY G 3 98  ? -26.276 -27.428 47.385 1.00 40.49  ? 98   GLY G O     1 
ATOM   5164  N  N     . ARG G 3 99  ? -26.253 -27.304 45.147 1.00 40.93  ? 99   ARG G N     1 
ATOM   5165  C  CA    . ARG G 3 99  ? -26.426 -25.857 45.117 1.00 41.39  ? 99   ARG G CA    1 
ATOM   5166  C  C     . ARG G 3 99  ? -27.577 -25.445 44.197 1.00 40.74  ? 99   ARG G C     1 
ATOM   5167  O  O     . ARG G 3 99  ? -27.503 -24.434 43.485 1.00 40.42  ? 99   ARG G O     1 
ATOM   5168  C  CB    . ARG G 3 99  ? -25.105 -25.163 44.779 1.00 41.76  ? 99   ARG G CB    1 
ATOM   5169  C  CG    . ARG G 3 99  ? -24.419 -24.692 46.032 1.00 45.21  ? 99   ARG G CG    1 
ATOM   5170  C  CD    . ARG G 3 99  ? -22.969 -25.060 46.088 1.00 51.67  ? 99   ARG G CD    1 
ATOM   5171  N  NE    . ARG G 3 99  ? -22.498 -25.002 47.475 1.00 57.81  ? 99   ARG G NE    1 
ATOM   5172  C  CZ    . ARG G 3 99  ? -21.218 -25.082 47.859 1.00 60.94  ? 99   ARG G CZ    1 
ATOM   5173  N  NH1   . ARG G 3 99  ? -20.238 -25.217 46.956 1.00 61.07  ? 99   ARG G NH1   1 
ATOM   5174  N  NH2   . ARG G 3 99  ? -20.916 -25.022 49.158 1.00 61.30  ? 99   ARG G NH2   1 
ATOM   5175  N  N     . VAL G 3 100 ? -28.638 -26.252 44.244 1.00 39.87  ? 100  VAL G N     1 
ATOM   5176  C  CA    . VAL G 3 100 ? -29.827 -26.067 43.442 1.00 39.30  ? 100  VAL G CA    1 
ATOM   5177  C  C     . VAL G 3 100 ? -31.070 -26.197 44.308 1.00 39.66  ? 100  VAL G C     1 
ATOM   5178  O  O     . VAL G 3 100 ? -31.118 -26.985 45.254 1.00 39.69  ? 100  VAL G O     1 
ATOM   5179  C  CB    . VAL G 3 100 ? -29.892 -27.084 42.284 1.00 39.14  ? 100  VAL G CB    1 
ATOM   5180  C  CG1   . VAL G 3 100 ? -31.296 -27.171 41.685 1.00 38.77  ? 100  VAL G CG1   1 
ATOM   5181  C  CG2   . VAL G 3 100 ? -28.912 -26.709 41.201 1.00 39.21  ? 100  VAL G CG2   1 
ATOM   5182  N  N     . THR G 3 101 ? -32.083 -25.413 43.967 1.00 39.96  ? 101  THR G N     1 
ATOM   5183  C  CA    . THR G 3 101 ? -33.350 -25.445 44.663 1.00 39.91  ? 101  THR G CA    1 
ATOM   5184  C  C     . THR G 3 101 ? -34.402 -25.904 43.677 1.00 40.03  ? 101  THR G C     1 
ATOM   5185  O  O     . THR G 3 101 ? -34.513 -25.345 42.588 1.00 40.47  ? 101  THR G O     1 
ATOM   5186  C  CB    . THR G 3 101 ? -33.696 -24.056 45.196 1.00 39.90  ? 101  THR G CB    1 
ATOM   5187  O  OG1   . THR G 3 101 ? -32.811 -23.742 46.279 1.00 39.78  ? 101  THR G OG1   1 
ATOM   5188  C  CG2   . THR G 3 101 ? -35.123 -24.027 45.687 1.00 40.40  ? 101  THR G CG2   1 
ATOM   5189  N  N     . ILE G 3 102 ? -35.142 -26.944 44.052 1.00 39.99  ? 102  ILE G N     1 
ATOM   5190  C  CA    . ILE G 3 102 ? -36.233 -27.471 43.250 1.00 39.63  ? 102  ILE G CA    1 
ATOM   5191  C  C     . ILE G 3 102 ? -37.467 -26.790 43.786 1.00 40.11  ? 102  ILE G C     1 
ATOM   5192  O  O     . ILE G 3 102 ? -37.920 -27.100 44.879 1.00 40.38  ? 102  ILE G O     1 
ATOM   5193  C  CB    . ILE G 3 102 ? -36.350 -29.009 43.422 1.00 39.61  ? 102  ILE G CB    1 
ATOM   5194  C  CG1   . ILE G 3 102 ? -35.163 -29.704 42.750 1.00 39.64  ? 102  ILE G CG1   1 
ATOM   5195  C  CG2   . ILE G 3 102 ? -37.650 -29.560 42.840 1.00 38.40  ? 102  ILE G CG2   1 
ATOM   5196  C  CD1   . ILE G 3 102 ? -34.825 -31.048 43.351 1.00 39.27  ? 102  ILE G CD1   1 
ATOM   5197  N  N     . ALA G 3 103 ? -38.004 -25.836 43.039 1.00 40.64  ? 103  ALA G N     1 
ATOM   5198  C  CA    . ALA G 3 103 ? -39.168 -25.103 43.514 1.00 41.23  ? 103  ALA G CA    1 
ATOM   5199  C  C     . ALA G 3 103 ? -40.322 -26.044 43.895 1.00 41.86  ? 103  ALA G C     1 
ATOM   5200  O  O     . ALA G 3 103 ? -40.579 -27.057 43.218 1.00 41.53  ? 103  ALA G O     1 
ATOM   5201  C  CB    . ALA G 3 103 ? -39.611 -24.094 42.489 1.00 41.17  ? 103  ALA G CB    1 
ATOM   5202  N  N     . GLN G 3 104 ? -40.998 -25.705 44.994 1.00 42.35  ? 104  GLN G N     1 
ATOM   5203  C  CA    . GLN G 3 104 ? -42.143 -26.480 45.495 1.00 42.88  ? 104  GLN G CA    1 
ATOM   5204  C  C     . GLN G 3 104 ? -41.765 -27.886 45.948 1.00 42.52  ? 104  GLN G C     1 
ATOM   5205  O  O     . GLN G 3 104 ? -42.613 -28.770 45.984 1.00 42.77  ? 104  GLN G O     1 
ATOM   5206  C  CB    . GLN G 3 104 ? -43.269 -26.556 44.447 1.00 43.20  ? 104  GLN G CB    1 
ATOM   5207  C  CG    . GLN G 3 104 ? -44.308 -25.464 44.548 1.00 45.42  ? 104  GLN G CG    1 
ATOM   5208  C  CD    . GLN G 3 104 ? -45.005 -25.413 45.919 1.00 49.33  ? 104  GLN G CD    1 
ATOM   5209  O  OE1   . GLN G 3 104 ? -45.678 -26.379 46.346 1.00 49.10  ? 104  GLN G OE1   1 
ATOM   5210  N  NE2   . GLN G 3 104 ? -44.847 -24.271 46.616 1.00 49.60  ? 104  GLN G NE2   1 
ATOM   5211  N  N     . GLY G 3 105 ? -40.501 -28.076 46.310 1.00 42.43  ? 105  GLY G N     1 
ATOM   5212  C  CA    . GLY G 3 105 ? -39.994 -29.377 46.746 1.00 41.92  ? 105  GLY G CA    1 
ATOM   5213  C  C     . GLY G 3 105 ? -40.023 -29.649 48.240 1.00 41.47  ? 105  GLY G C     1 
ATOM   5214  O  O     . GLY G 3 105 ? -40.050 -30.802 48.662 1.00 41.73  ? 105  GLY G O     1 
ATOM   5215  N  N     . GLY G 3 106 ? -40.012 -28.603 49.051 1.00 41.31  ? 106  GLY G N     1 
ATOM   5216  C  CA    . GLY G 3 106 ? -39.908 -28.777 50.500 1.00 41.28  ? 106  GLY G CA    1 
ATOM   5217  C  C     . GLY G 3 106 ? -38.604 -29.411 50.951 1.00 41.41  ? 106  GLY G C     1 
ATOM   5218  O  O     . GLY G 3 106 ? -37.583 -29.347 50.266 1.00 40.93  ? 106  GLY G O     1 
ATOM   5219  N  N     . VAL G 3 107 ? -38.644 -30.040 52.118 1.00 42.05  ? 107  VAL G N     1 
ATOM   5220  C  CA    . VAL G 3 107 ? -37.442 -30.611 52.720 1.00 42.23  ? 107  VAL G CA    1 
ATOM   5221  C  C     . VAL G 3 107 ? -37.725 -32.002 53.245 1.00 43.10  ? 107  VAL G C     1 
ATOM   5222  O  O     . VAL G 3 107 ? -38.883 -32.342 53.507 1.00 43.94  ? 107  VAL G O     1 
ATOM   5223  C  CB    . VAL G 3 107 ? -36.908 -29.734 53.854 1.00 41.80  ? 107  VAL G CB    1 
ATOM   5224  C  CG1   . VAL G 3 107 ? -36.462 -28.394 53.323 1.00 41.17  ? 107  VAL G CG1   1 
ATOM   5225  C  CG2   . VAL G 3 107 ? -37.947 -29.543 54.934 1.00 41.83  ? 107  VAL G CG2   1 
ATOM   5226  N  N     . LEU G 3 108 ? -36.674 -32.807 53.386 1.00 43.87  ? 108  LEU G N     1 
ATOM   5227  C  CA    . LEU G 3 108 ? -36.791 -34.169 53.915 1.00 44.22  ? 108  LEU G CA    1 
ATOM   5228  C  C     . LEU G 3 108 ? -37.184 -34.107 55.371 1.00 45.30  ? 108  LEU G C     1 
ATOM   5229  O  O     . LEU G 3 108 ? -36.648 -33.289 56.113 1.00 45.60  ? 108  LEU G O     1 
ATOM   5230  C  CB    . LEU G 3 108 ? -35.462 -34.905 53.813 1.00 43.78  ? 108  LEU G CB    1 
ATOM   5231  C  CG    . LEU G 3 108 ? -34.882 -35.186 52.436 1.00 42.92  ? 108  LEU G CG    1 
ATOM   5232  C  CD1   . LEU G 3 108 ? -33.617 -36.012 52.581 1.00 41.03  ? 108  LEU G CD1   1 
ATOM   5233  C  CD2   . LEU G 3 108 ? -35.911 -35.895 51.558 1.00 41.86  ? 108  LEU G CD2   1 
ATOM   5234  N  N     . PRO G 3 109 ? -38.125 -34.969 55.793 1.00 46.59  ? 109  PRO G N     1 
ATOM   5235  C  CA    . PRO G 3 109 ? -38.478 -35.044 57.210 1.00 47.12  ? 109  PRO G CA    1 
ATOM   5236  C  C     . PRO G 3 109 ? -37.256 -35.474 57.974 1.00 48.00  ? 109  PRO G C     1 
ATOM   5237  O  O     . PRO G 3 109 ? -36.742 -36.556 57.744 1.00 48.15  ? 109  PRO G O     1 
ATOM   5238  C  CB    . PRO G 3 109 ? -39.524 -36.158 57.249 1.00 47.08  ? 109  PRO G CB    1 
ATOM   5239  C  CG    . PRO G 3 109 ? -40.080 -36.215 55.851 1.00 46.69  ? 109  PRO G CG    1 
ATOM   5240  C  CD    . PRO G 3 109 ? -38.906 -35.923 54.980 1.00 46.70  ? 109  PRO G CD    1 
ATOM   5241  N  N     . ASN G 3 110 ? -36.767 -34.610 58.845 1.00 49.49  ? 110  ASN G N     1 
ATOM   5242  C  CA    . ASN G 3 110 ? -35.613 -34.922 59.676 1.00 51.15  ? 110  ASN G CA    1 
ATOM   5243  C  C     . ASN G 3 110 ? -35.654 -34.037 60.917 1.00 51.65  ? 110  ASN G C     1 
ATOM   5244  O  O     . ASN G 3 110 ? -35.699 -32.810 60.793 1.00 52.13  ? 110  ASN G O     1 
ATOM   5245  C  CB    . ASN G 3 110 ? -34.305 -34.712 58.885 1.00 51.32  ? 110  ASN G CB    1 
ATOM   5246  C  CG    . ASN G 3 110 ? -33.046 -35.015 59.709 1.00 53.25  ? 110  ASN G CG    1 
ATOM   5247  O  OD1   . ASN G 3 110 ? -33.104 -35.671 60.755 1.00 56.15  ? 110  ASN G OD1   1 
ATOM   5248  N  ND2   . ASN G 3 110 ? -31.897 -34.541 59.226 1.00 54.56  ? 110  ASN G ND2   1 
ATOM   5249  N  N     . ILE G 3 111 ? -35.668 -34.658 62.097 1.00 52.08  ? 111  ILE G N     1 
ATOM   5250  C  CA    . ILE G 3 111 ? -35.619 -33.923 63.366 1.00 52.91  ? 111  ILE G CA    1 
ATOM   5251  C  C     . ILE G 3 111 ? -34.391 -34.313 64.177 1.00 53.40  ? 111  ILE G C     1 
ATOM   5252  O  O     . ILE G 3 111 ? -34.184 -35.484 64.455 1.00 53.55  ? 111  ILE G O     1 
ATOM   5253  C  CB    . ILE G 3 111 ? -36.867 -34.172 64.247 1.00 52.61  ? 111  ILE G CB    1 
ATOM   5254  C  CG1   . ILE G 3 111 ? -38.152 -33.969 63.456 1.00 53.06  ? 111  ILE G CG1   1 
ATOM   5255  C  CG2   . ILE G 3 111 ? -36.872 -33.235 65.447 1.00 52.85  ? 111  ILE G CG2   1 
ATOM   5256  C  CD1   . ILE G 3 111 ? -39.417 -34.306 64.246 1.00 53.33  ? 111  ILE G CD1   1 
ATOM   5257  N  N     . GLN G 3 112 ? -33.586 -33.332 64.568 1.00 54.41  ? 112  GLN G N     1 
ATOM   5258  C  CA    . GLN G 3 112 ? -32.428 -33.591 65.426 1.00 55.35  ? 112  GLN G CA    1 
ATOM   5259  C  C     . GLN G 3 112 ? -32.847 -34.373 66.669 1.00 56.44  ? 112  GLN G C     1 
ATOM   5260  O  O     . GLN G 3 112 ? -33.825 -34.013 67.333 1.00 56.85  ? 112  GLN G O     1 
ATOM   5261  C  CB    . GLN G 3 112 ? -31.771 -32.282 65.847 1.00 55.04  ? 112  GLN G CB    1 
ATOM   5262  C  CG    . GLN G 3 112 ? -31.221 -31.476 64.701 1.00 54.05  ? 112  GLN G CG    1 
ATOM   5263  C  CD    . GLN G 3 112 ? -30.294 -32.276 63.827 1.00 51.79  ? 112  GLN G CD    1 
ATOM   5264  O  OE1   . GLN G 3 112 ? -29.314 -32.854 64.295 1.00 51.54  ? 112  GLN G OE1   1 
ATOM   5265  N  NE2   . GLN G 3 112 ? -30.596 -32.309 62.545 1.00 51.41  ? 112  GLN G NE2   1 
ATOM   5266  N  N     . SER G 3 113 ? -32.110 -35.433 66.982 1.00 57.30  ? 113  SER G N     1 
ATOM   5267  C  CA    . SER G 3 113 ? -32.537 -36.376 68.010 1.00 58.47  ? 113  SER G CA    1 
ATOM   5268  C  C     . SER G 3 113 ? -32.692 -35.752 69.403 1.00 59.10  ? 113  SER G C     1 
ATOM   5269  O  O     . SER G 3 113 ? -33.660 -36.024 70.108 1.00 58.92  ? 113  SER G O     1 
ATOM   5270  C  CB    . SER G 3 113 ? -31.608 -37.591 68.045 1.00 58.37  ? 113  SER G CB    1 
ATOM   5271  O  OG    . SER G 3 113 ? -30.263 -37.190 68.239 1.00 59.03  ? 113  SER G OG    1 
ATOM   5272  N  N     . VAL G 3 114 ? -31.754 -34.892 69.779 1.00 60.32  ? 114  VAL G N     1 
ATOM   5273  C  CA    . VAL G 3 114 ? -31.781 -34.242 71.089 1.00 61.49  ? 114  VAL G CA    1 
ATOM   5274  C  C     . VAL G 3 114 ? -33.045 -33.396 71.288 1.00 62.52  ? 114  VAL G C     1 
ATOM   5275  O  O     . VAL G 3 114 ? -33.336 -32.937 72.395 1.00 62.57  ? 114  VAL G O     1 
ATOM   5276  C  CB    . VAL G 3 114 ? -30.513 -33.393 71.314 1.00 61.27  ? 114  VAL G CB    1 
ATOM   5277  C  CG1   . VAL G 3 114 ? -30.614 -32.073 70.572 1.00 61.47  ? 114  VAL G CG1   1 
ATOM   5278  C  CG2   . VAL G 3 114 ? -30.271 -33.171 72.806 1.00 61.24  ? 114  VAL G CG2   1 
ATOM   5279  N  N     . LEU G 3 115 ? -33.798 -33.206 70.209 1.00 63.89  ? 115  LEU G N     1 
ATOM   5280  C  CA    . LEU G 3 115 ? -35.047 -32.451 70.272 1.00 65.04  ? 115  LEU G CA    1 
ATOM   5281  C  C     . LEU G 3 115 ? -36.249 -33.326 70.614 1.00 66.12  ? 115  LEU G C     1 
ATOM   5282  O  O     . LEU G 3 115 ? -37.349 -32.813 70.821 1.00 66.34  ? 115  LEU G O     1 
ATOM   5283  C  CB    . LEU G 3 115 ? -35.279 -31.662 68.974 1.00 64.63  ? 115  LEU G CB    1 
ATOM   5284  C  CG    . LEU G 3 115 ? -34.298 -30.511 68.723 1.00 64.23  ? 115  LEU G CG    1 
ATOM   5285  C  CD1   . LEU G 3 115 ? -34.647 -29.744 67.457 1.00 64.26  ? 115  LEU G CD1   1 
ATOM   5286  C  CD2   . LEU G 3 115 ? -34.242 -29.565 69.905 1.00 62.76  ? 115  LEU G CD2   1 
ATOM   5287  N  N     . LEU G 3 116 ? -36.031 -34.640 70.682 1.00 67.65  ? 116  LEU G N     1 
ATOM   5288  C  CA    . LEU G 3 116 ? -37.079 -35.593 71.053 1.00 69.05  ? 116  LEU G CA    1 
ATOM   5289  C  C     . LEU G 3 116 ? -37.233 -35.691 72.575 1.00 70.63  ? 116  LEU G C     1 
ATOM   5290  O  O     . LEU G 3 116 ? -36.229 -35.691 73.301 1.00 70.67  ? 116  LEU G O     1 
ATOM   5291  C  CB    . LEU G 3 116 ? -36.791 -36.970 70.447 1.00 68.68  ? 116  LEU G CB    1 
ATOM   5292  C  CG    . LEU G 3 116 ? -36.653 -37.037 68.918 1.00 68.37  ? 116  LEU G CG    1 
ATOM   5293  C  CD1   . LEU G 3 116 ? -36.173 -38.412 68.469 1.00 68.57  ? 116  LEU G CD1   1 
ATOM   5294  C  CD2   . LEU G 3 116 ? -37.940 -36.645 68.188 1.00 67.15  ? 116  LEU G CD2   1 
ATOM   5295  N  N     . PRO G 3 117 ? -38.490 -35.768 73.063 1.00 72.24  ? 117  PRO G N     1 
ATOM   5296  C  CA    . PRO G 3 117 ? -38.804 -35.827 74.500 1.00 73.59  ? 117  PRO G CA    1 
ATOM   5297  C  C     . PRO G 3 117 ? -38.320 -37.114 75.146 1.00 75.08  ? 117  PRO G C     1 
ATOM   5298  O  O     . PRO G 3 117 ? -38.203 -38.132 74.458 1.00 75.24  ? 117  PRO G O     1 
ATOM   5299  C  CB    . PRO G 3 117 ? -40.334 -35.788 74.530 1.00 73.59  ? 117  PRO G CB    1 
ATOM   5300  C  CG    . PRO G 3 117 ? -40.758 -36.312 73.180 1.00 73.15  ? 117  PRO G CG    1 
ATOM   5301  C  CD    . PRO G 3 117 ? -39.710 -35.810 72.232 1.00 72.52  ? 117  PRO G CD    1 
ATOM   5302  N  N     . LYS G 3 118 ? -38.048 -37.062 76.453 1.00 76.91  ? 118  LYS G N     1 
ATOM   5303  C  CA    . LYS G 3 118 ? -37.536 -38.220 77.207 1.00 78.79  ? 118  LYS G CA    1 
ATOM   5304  C  C     . LYS G 3 118 ? -38.565 -39.350 77.304 1.00 79.60  ? 118  LYS G C     1 
ATOM   5305  O  O     . LYS G 3 118 ? -39.581 -39.224 78.003 1.00 80.00  ? 118  LYS G O     1 
ATOM   5306  C  CB    . LYS G 3 118 ? -37.063 -37.792 78.601 1.00 79.05  ? 118  LYS G CB    1 
ATOM   5307  C  CG    . LYS G 3 118 ? -35.590 -37.441 78.664 1.00 80.64  ? 118  LYS G CG    1 
ATOM   5308  C  CD    . LYS G 3 118 ? -35.373 -36.047 79.249 1.00 82.94  ? 118  LYS G CD    1 
ATOM   5309  C  CE    . LYS G 3 118 ? -34.101 -35.419 78.659 1.00 83.92  ? 118  LYS G CE    1 
ATOM   5310  N  NZ    . LYS G 3 118 ? -34.238 -33.949 78.402 1.00 83.92  ? 118  LYS G NZ    1 
ATOM   5311  N  N     . LYS G 3 119 ? -38.293 -40.448 76.598 1.00 80.39  ? 119  LYS G N     1 
ATOM   5312  C  CA    . LYS G 3 119 ? -39.259 -41.551 76.455 1.00 81.13  ? 119  LYS G CA    1 
ATOM   5313  C  C     . LYS G 3 119 ? -39.290 -42.472 77.687 1.00 81.29  ? 119  LYS G C     1 
ATOM   5314  O  O     . LYS G 3 119 ? -40.240 -42.449 78.476 1.00 81.30  ? 119  LYS G O     1 
ATOM   5315  C  CB    . LYS G 3 119 ? -38.979 -42.366 75.177 1.00 81.17  ? 119  LYS G CB    1 
ATOM   5316  C  CG    . LYS G 3 119 ? -39.063 -41.565 73.862 1.00 81.48  ? 119  LYS G CG    1 
ATOM   5317  C  CD    . LYS G 3 119 ? -39.050 -42.482 72.642 1.00 81.44  ? 119  LYS G CD    1 
ATOM   5318  C  CE    . LYS G 3 119 ? -40.446 -43.030 72.343 1.00 81.71  ? 119  LYS G CE    1 
ATOM   5319  N  NZ    . LYS G 3 119 ? -40.388 -44.292 71.559 1.00 81.35  ? 119  LYS G NZ    1 
ATOM   5320  N  N     . LYS H 4 31  ? -46.550 -16.089 19.999 1.00 81.75  ? 28   LYS H N     1 
ATOM   5321  C  CA    . LYS H 4 31  ? -46.452 -16.615 18.604 1.00 81.98  ? 28   LYS H CA    1 
ATOM   5322  C  C     . LYS H 4 31  ? -45.114 -17.318 18.371 1.00 81.59  ? 28   LYS H C     1 
ATOM   5323  O  O     . LYS H 4 31  ? -45.086 -18.437 17.855 1.00 81.68  ? 28   LYS H O     1 
ATOM   5324  C  CB    . LYS H 4 31  ? -46.660 -15.487 17.577 1.00 82.09  ? 28   LYS H CB    1 
ATOM   5325  C  CG    . LYS H 4 31  ? -46.734 -15.938 16.107 1.00 82.21  ? 28   LYS H CG    1 
ATOM   5326  C  CD    . LYS H 4 31  ? -46.726 -14.737 15.141 1.00 82.47  ? 28   LYS H CD    1 
ATOM   5327  C  CE    . LYS H 4 31  ? -48.088 -14.018 15.074 1.00 82.86  ? 28   LYS H CE    1 
ATOM   5328  N  NZ    . LYS H 4 31  ? -48.016 -12.696 14.389 1.00 81.68  ? 28   LYS H NZ    1 
ATOM   5329  N  N     . THR H 4 32  ? -44.015 -16.662 18.749 1.00 81.15  ? 29   THR H N     1 
ATOM   5330  C  CA    . THR H 4 32  ? -42.684 -17.236 18.556 1.00 80.75  ? 29   THR H CA    1 
ATOM   5331  C  C     . THR H 4 32  ? -42.569 -18.530 19.355 1.00 80.37  ? 29   THR H C     1 
ATOM   5332  O  O     . THR H 4 32  ? -43.141 -18.650 20.444 1.00 80.32  ? 29   THR H O     1 
ATOM   5333  C  CB    . THR H 4 32  ? -41.536 -16.240 18.897 1.00 80.84  ? 29   THR H CB    1 
ATOM   5334  O  OG1   . THR H 4 32  ? -40.411 -16.483 18.040 1.00 80.35  ? 29   THR H OG1   1 
ATOM   5335  C  CG2   . THR H 4 32  ? -41.102 -16.352 20.364 1.00 81.12  ? 29   THR H CG2   1 
ATOM   5336  N  N     . ARG H 4 33  ? -41.853 -19.499 18.796 1.00 79.79  ? 30   ARG H N     1 
ATOM   5337  C  CA    . ARG H 4 33  ? -41.805 -20.838 19.377 1.00 79.42  ? 30   ARG H CA    1 
ATOM   5338  C  C     . ARG H 4 33  ? -41.098 -20.838 20.733 1.00 78.58  ? 30   ARG H C     1 
ATOM   5339  O  O     . ARG H 4 33  ? -40.150 -20.075 20.949 1.00 78.49  ? 30   ARG H O     1 
ATOM   5340  C  CB    . ARG H 4 33  ? -41.119 -21.827 18.424 1.00 79.68  ? 30   ARG H CB    1 
ATOM   5341  C  CG    . ARG H 4 33  ? -41.742 -21.917 17.041 1.00 80.86  ? 30   ARG H CG    1 
ATOM   5342  C  CD    . ARG H 4 33  ? -40.977 -22.892 16.166 1.00 83.49  ? 30   ARG H CD    1 
ATOM   5343  N  NE    . ARG H 4 33  ? -41.582 -24.225 16.166 1.00 85.75  ? 30   ARG H NE    1 
ATOM   5344  C  CZ    . ARG H 4 33  ? -42.389 -24.691 15.208 1.00 87.16  ? 30   ARG H CZ    1 
ATOM   5345  N  NH1   . ARG H 4 33  ? -42.698 -23.940 14.150 1.00 86.73  ? 30   ARG H NH1   1 
ATOM   5346  N  NH2   . ARG H 4 33  ? -42.888 -25.922 15.306 1.00 88.15  ? 30   ARG H NH2   1 
ATOM   5347  N  N     . LYS H 4 34  ? -41.580 -21.681 21.643 1.00 77.46  ? 31   LYS H N     1 
ATOM   5348  C  CA    . LYS H 4 34  ? -40.876 -21.938 22.895 1.00 76.46  ? 31   LYS H CA    1 
ATOM   5349  C  C     . LYS H 4 34  ? -40.376 -23.380 22.981 1.00 75.39  ? 31   LYS H C     1 
ATOM   5350  O  O     . LYS H 4 34  ? -41.120 -24.290 23.367 1.00 75.54  ? 31   LYS H O     1 
ATOM   5351  C  CB    . LYS H 4 34  ? -41.736 -21.569 24.110 1.00 76.86  ? 31   LYS H CB    1 
ATOM   5352  C  CG    . LYS H 4 34  ? -41.137 -20.465 24.979 1.00 77.50  ? 31   LYS H CG    1 
ATOM   5353  C  CD    . LYS H 4 34  ? -40.049 -21.030 25.908 1.00 78.94  ? 31   LYS H CD    1 
ATOM   5354  C  CE    . LYS H 4 34  ? -39.495 -19.981 26.881 1.00 78.82  ? 31   LYS H CE    1 
ATOM   5355  N  NZ    . LYS H 4 34  ? -38.494 -19.084 26.225 1.00 79.39  ? 31   LYS H NZ    1 
ATOM   5356  N  N     . GLU H 4 35  ? -39.111 -23.579 22.614 1.00 73.71  ? 32   GLU H N     1 
ATOM   5357  C  CA    . GLU H 4 35  ? -38.490 -24.902 22.660 1.00 72.00  ? 32   GLU H CA    1 
ATOM   5358  C  C     . GLU H 4 35  ? -38.214 -25.375 24.087 1.00 70.58  ? 32   GLU H C     1 
ATOM   5359  O  O     . GLU H 4 35  ? -38.032 -24.570 25.003 1.00 70.60  ? 32   GLU H O     1 
ATOM   5360  C  CB    . GLU H 4 35  ? -37.217 -24.928 21.823 1.00 72.15  ? 32   GLU H CB    1 
ATOM   5361  C  CG    . GLU H 4 35  ? -37.487 -24.954 20.333 1.00 72.60  ? 32   GLU H CG    1 
ATOM   5362  C  CD    . GLU H 4 35  ? -36.224 -25.120 19.513 1.00 73.93  ? 32   GLU H CD    1 
ATOM   5363  O  OE1   . GLU H 4 35  ? -36.192 -24.618 18.371 1.00 74.41  ? 32   GLU H OE1   1 
ATOM   5364  O  OE2   . GLU H 4 35  ? -35.259 -25.746 20.003 1.00 74.49  ? 32   GLU H OE2   1 
ATOM   5365  N  N     . SER H 4 36  ? -38.177 -26.690 24.257 1.00 68.70  ? 33   SER H N     1 
ATOM   5366  C  CA    . SER H 4 36  ? -38.156 -27.314 25.567 1.00 66.86  ? 33   SER H CA    1 
ATOM   5367  C  C     . SER H 4 36  ? -37.745 -28.759 25.376 1.00 65.75  ? 33   SER H C     1 
ATOM   5368  O  O     . SER H 4 36  ? -38.009 -29.334 24.324 1.00 65.52  ? 33   SER H O     1 
ATOM   5369  C  CB    . SER H 4 36  ? -39.562 -27.254 26.171 1.00 66.82  ? 33   SER H CB    1 
ATOM   5370  O  OG    . SER H 4 36  ? -39.670 -28.036 27.339 1.00 66.23  ? 33   SER H OG    1 
ATOM   5371  N  N     . TYR H 4 37  ? -37.109 -29.348 26.386 1.00 64.43  ? 34   TYR H N     1 
ATOM   5372  C  CA    . TYR H 4 37  ? -36.785 -30.784 26.357 1.00 63.24  ? 34   TYR H CA    1 
ATOM   5373  C  C     . TYR H 4 37  ? -37.975 -31.660 26.749 1.00 62.81  ? 34   TYR H C     1 
ATOM   5374  O  O     . TYR H 4 37  ? -37.854 -32.883 26.796 1.00 62.51  ? 34   TYR H O     1 
ATOM   5375  C  CB    . TYR H 4 37  ? -35.587 -31.102 27.259 1.00 62.57  ? 34   TYR H CB    1 
ATOM   5376  C  CG    . TYR H 4 37  ? -34.276 -30.489 26.808 1.00 62.00  ? 34   TYR H CG    1 
ATOM   5377  C  CD1   . TYR H 4 37  ? -33.836 -29.279 27.334 1.00 61.35  ? 34   TYR H CD1   1 
ATOM   5378  C  CD2   . TYR H 4 37  ? -33.470 -31.126 25.861 1.00 61.15  ? 34   TYR H CD2   1 
ATOM   5379  C  CE1   . TYR H 4 37  ? -32.634 -28.717 26.932 1.00 60.89  ? 34   TYR H CE1   1 
ATOM   5380  C  CE2   . TYR H 4 37  ? -32.270 -30.566 25.446 1.00 60.36  ? 34   TYR H CE2   1 
ATOM   5381  C  CZ    . TYR H 4 37  ? -31.858 -29.362 25.987 1.00 61.23  ? 34   TYR H CZ    1 
ATOM   5382  O  OH    . TYR H 4 37  ? -30.663 -28.797 25.595 1.00 61.61  ? 34   TYR H OH    1 
ATOM   5383  N  N     . ALA H 4 38  ? -39.119 -31.024 26.999 1.00 62.73  ? 35   ALA H N     1 
ATOM   5384  C  CA    . ALA H 4 38  ? -40.293 -31.668 27.593 1.00 63.07  ? 35   ALA H CA    1 
ATOM   5385  C  C     . ALA H 4 38  ? -40.706 -33.017 26.988 1.00 63.47  ? 35   ALA H C     1 
ATOM   5386  O  O     . ALA H 4 38  ? -40.917 -33.980 27.734 1.00 63.77  ? 35   ALA H O     1 
ATOM   5387  C  CB    . ALA H 4 38  ? -41.479 -30.707 27.625 1.00 62.75  ? 35   ALA H CB    1 
ATOM   5388  N  N     . ILE H 4 39  ? -40.817 -33.103 25.661 1.00 63.54  ? 36   ILE H N     1 
ATOM   5389  C  CA    . ILE H 4 39  ? -41.284 -34.349 25.035 1.00 63.62  ? 36   ILE H CA    1 
ATOM   5390  C  C     . ILE H 4 39  ? -40.300 -35.500 25.186 1.00 63.70  ? 36   ILE H C     1 
ATOM   5391  O  O     . ILE H 4 39  ? -40.706 -36.638 25.452 1.00 64.01  ? 36   ILE H O     1 
ATOM   5392  C  CB    . ILE H 4 39  ? -41.690 -34.191 23.547 1.00 63.67  ? 36   ILE H CB    1 
ATOM   5393  C  CG1   . ILE H 4 39  ? -40.662 -33.359 22.782 1.00 63.55  ? 36   ILE H CG1   1 
ATOM   5394  C  CG2   . ILE H 4 39  ? -43.110 -33.617 23.444 1.00 63.39  ? 36   ILE H CG2   1 
ATOM   5395  C  CD1   . ILE H 4 39  ? -40.878 -33.359 21.305 1.00 63.33  ? 36   ILE H CD1   1 
ATOM   5396  N  N     . TYR H 4 40  ? -39.015 -35.192 25.031 1.00 63.56  ? 37   TYR H N     1 
ATOM   5397  C  CA    . TYR H 4 40  ? -37.945 -36.163 25.224 1.00 63.22  ? 37   TYR H CA    1 
ATOM   5398  C  C     . TYR H 4 40  ? -37.877 -36.612 26.674 1.00 63.04  ? 37   TYR H C     1 
ATOM   5399  O  O     . TYR H 4 40  ? -37.504 -37.745 26.954 1.00 63.02  ? 37   TYR H O     1 
ATOM   5400  C  CB    . TYR H 4 40  ? -36.612 -35.575 24.795 1.00 63.37  ? 37   TYR H CB    1 
ATOM   5401  C  CG    . TYR H 4 40  ? -36.700 -34.785 23.513 1.00 63.90  ? 37   TYR H CG    1 
ATOM   5402  C  CD1   . TYR H 4 40  ? -37.049 -33.439 23.530 1.00 64.86  ? 37   TYR H CD1   1 
ATOM   5403  C  CD2   . TYR H 4 40  ? -36.440 -35.377 22.286 1.00 63.90  ? 37   TYR H CD2   1 
ATOM   5404  C  CE1   . TYR H 4 40  ? -37.142 -32.704 22.359 1.00 65.20  ? 37   TYR H CE1   1 
ATOM   5405  C  CE2   . TYR H 4 40  ? -36.524 -34.649 21.107 1.00 64.38  ? 37   TYR H CE2   1 
ATOM   5406  C  CZ    . TYR H 4 40  ? -36.878 -33.311 21.152 1.00 64.73  ? 37   TYR H CZ    1 
ATOM   5407  O  OH    . TYR H 4 40  ? -36.968 -32.568 19.997 1.00 64.67  ? 37   TYR H OH    1 
ATOM   5408  N  N     . VAL H 4 41  ? -38.241 -35.731 27.597 1.00 62.80  ? 38   VAL H N     1 
ATOM   5409  C  CA    . VAL H 4 41  ? -38.357 -36.130 28.992 1.00 63.02  ? 38   VAL H CA    1 
ATOM   5410  C  C     . VAL H 4 41  ? -39.514 -37.125 29.117 1.00 63.32  ? 38   VAL H C     1 
ATOM   5411  O  O     . VAL H 4 41  ? -39.381 -38.178 29.759 1.00 63.15  ? 38   VAL H O     1 
ATOM   5412  C  CB    . VAL H 4 41  ? -38.547 -34.908 29.936 1.00 63.07  ? 38   VAL H CB    1 
ATOM   5413  C  CG1   . VAL H 4 41  ? -38.848 -35.346 31.367 1.00 62.24  ? 38   VAL H CG1   1 
ATOM   5414  C  CG2   . VAL H 4 41  ? -37.315 -34.035 29.918 1.00 62.63  ? 38   VAL H CG2   1 
ATOM   5415  N  N     . TYR H 4 42  ? -40.634 -36.795 28.473 1.00 63.71  ? 39   TYR H N     1 
ATOM   5416  C  CA    . TYR H 4 42  ? -41.828 -37.638 28.509 1.00 64.13  ? 39   TYR H CA    1 
ATOM   5417  C  C     . TYR H 4 42  ? -41.568 -39.010 27.884 1.00 63.83  ? 39   TYR H C     1 
ATOM   5418  O  O     . TYR H 4 42  ? -41.946 -40.025 28.456 1.00 63.65  ? 39   TYR H O     1 
ATOM   5419  C  CB    . TYR H 4 42  ? -43.020 -36.947 27.838 1.00 64.82  ? 39   TYR H CB    1 
ATOM   5420  C  CG    . TYR H 4 42  ? -44.358 -37.480 28.303 1.00 65.79  ? 39   TYR H CG    1 
ATOM   5421  C  CD1   . TYR H 4 42  ? -45.073 -36.842 29.320 1.00 66.48  ? 39   TYR H CD1   1 
ATOM   5422  C  CD2   . TYR H 4 42  ? -44.909 -38.632 27.730 1.00 67.12  ? 39   TYR H CD2   1 
ATOM   5423  C  CE1   . TYR H 4 42  ? -46.306 -37.343 29.761 1.00 67.27  ? 39   TYR H CE1   1 
ATOM   5424  C  CE2   . TYR H 4 42  ? -46.137 -39.139 28.153 1.00 67.20  ? 39   TYR H CE2   1 
ATOM   5425  C  CZ    . TYR H 4 42  ? -46.828 -38.495 29.169 1.00 67.23  ? 39   TYR H CZ    1 
ATOM   5426  O  OH    . TYR H 4 42  ? -48.042 -39.006 29.580 1.00 67.24  ? 39   TYR H OH    1 
ATOM   5427  N  N     . LYS H 4 43  ? -40.909 -39.039 26.728 1.00 63.52  ? 40   LYS H N     1 
ATOM   5428  C  CA    . LYS H 4 43  ? -40.516 -40.304 26.119 1.00 63.49  ? 40   LYS H CA    1 
ATOM   5429  C  C     . LYS H 4 43  ? -39.714 -41.161 27.095 1.00 63.60  ? 40   LYS H C     1 
ATOM   5430  O  O     . LYS H 4 43  ? -39.981 -42.355 27.248 1.00 64.00  ? 40   LYS H O     1 
ATOM   5431  C  CB    . LYS H 4 43  ? -39.719 -40.081 24.839 1.00 63.37  ? 40   LYS H CB    1 
ATOM   5432  C  CG    . LYS H 4 43  ? -40.526 -39.521 23.688 1.00 63.72  ? 40   LYS H CG    1 
ATOM   5433  C  CD    . LYS H 4 43  ? -39.690 -39.501 22.418 1.00 64.13  ? 40   LYS H CD    1 
ATOM   5434  C  CE    . LYS H 4 43  ? -40.399 -38.782 21.280 1.00 64.39  ? 40   LYS H CE    1 
ATOM   5435  N  NZ    . LYS H 4 43  ? -39.394 -38.131 20.374 1.00 64.76  ? 40   LYS H NZ    1 
ATOM   5436  N  N     . VAL H 4 44  ? -38.746 -40.546 27.766 1.00 63.72  ? 41   VAL H N     1 
ATOM   5437  C  CA    . VAL H 4 44  ? -37.909 -41.245 28.737 1.00 63.63  ? 41   VAL H CA    1 
ATOM   5438  C  C     . VAL H 4 44  ? -38.740 -41.732 29.924 1.00 63.81  ? 41   VAL H C     1 
ATOM   5439  O  O     . VAL H 4 44  ? -38.602 -42.888 30.350 1.00 63.48  ? 41   VAL H O     1 
ATOM   5440  C  CB    . VAL H 4 44  ? -36.724 -40.368 29.204 1.00 63.59  ? 41   VAL H CB    1 
ATOM   5441  C  CG1   . VAL H 4 44  ? -35.987 -41.020 30.350 1.00 63.61  ? 41   VAL H CG1   1 
ATOM   5442  C  CG2   . VAL H 4 44  ? -35.757 -40.114 28.048 1.00 63.50  ? 41   VAL H CG2   1 
ATOM   5443  N  N     . LEU H 4 45  ? -39.617 -40.866 30.438 1.00 64.02  ? 42   LEU H N     1 
ATOM   5444  C  CA    . LEU H 4 45  ? -40.472 -41.241 31.562 1.00 64.33  ? 42   LEU H CA    1 
ATOM   5445  C  C     . LEU H 4 45  ? -41.138 -42.583 31.315 1.00 65.02  ? 42   LEU H C     1 
ATOM   5446  O  O     . LEU H 4 45  ? -41.020 -43.499 32.130 1.00 65.27  ? 42   LEU H O     1 
ATOM   5447  C  CB    . LEU H 4 45  ? -41.532 -40.182 31.843 1.00 63.93  ? 42   LEU H CB    1 
ATOM   5448  C  CG    . LEU H 4 45  ? -42.485 -40.476 33.005 1.00 63.37  ? 42   LEU H CG    1 
ATOM   5449  C  CD1   . LEU H 4 45  ? -41.748 -40.833 34.281 1.00 62.93  ? 42   LEU H CD1   1 
ATOM   5450  C  CD2   . LEU H 4 45  ? -43.390 -39.290 33.265 1.00 64.42  ? 42   LEU H CD2   1 
ATOM   5451  N  N     . LYS H 4 46  ? -41.814 -42.696 30.176 1.00 65.72  ? 43   LYS H N     1 
ATOM   5452  C  CA    . LYS H 4 46  ? -42.553 -43.904 29.831 1.00 66.43  ? 43   LYS H CA    1 
ATOM   5453  C  C     . LYS H 4 46  ? -41.660 -45.133 29.611 1.00 66.90  ? 43   LYS H C     1 
ATOM   5454  O  O     . LYS H 4 46  ? -42.069 -46.257 29.898 1.00 67.11  ? 43   LYS H O     1 
ATOM   5455  C  CB    . LYS H 4 46  ? -43.458 -43.655 28.626 1.00 66.51  ? 43   LYS H CB    1 
ATOM   5456  C  CG    . LYS H 4 46  ? -44.531 -42.567 28.832 1.00 66.66  ? 43   LYS H CG    1 
ATOM   5457  C  CD    . LYS H 4 46  ? -45.263 -42.663 30.183 1.00 66.73  ? 43   LYS H CD    1 
ATOM   5458  C  CE    . LYS H 4 46  ? -46.690 -42.136 30.047 1.00 67.55  ? 43   LYS H CE    1 
ATOM   5459  N  NZ    . LYS H 4 46  ? -47.278 -41.533 31.282 1.00 67.38  ? 43   LYS H NZ    1 
ATOM   5460  N  N     . GLN H 4 47  ? -40.441 -44.920 29.121 1.00 67.21  ? 44   GLN H N     1 
ATOM   5461  C  CA    . GLN H 4 47  ? -39.458 -46.004 29.023 1.00 67.66  ? 44   GLN H CA    1 
ATOM   5462  C  C     . GLN H 4 47  ? -39.072 -46.577 30.401 1.00 67.34  ? 44   GLN H C     1 
ATOM   5463  O  O     . GLN H 4 47  ? -38.596 -47.704 30.494 1.00 67.71  ? 44   GLN H O     1 
ATOM   5464  C  CB    . GLN H 4 47  ? -38.194 -45.527 28.295 1.00 67.75  ? 44   GLN H CB    1 
ATOM   5465  C  CG    . GLN H 4 47  ? -38.057 -45.930 26.832 1.00 68.14  ? 44   GLN H CG    1 
ATOM   5466  C  CD    . GLN H 4 47  ? -36.582 -45.961 26.378 1.00 68.79  ? 44   GLN H CD    1 
ATOM   5467  O  OE1   . GLN H 4 47  ? -35.804 -46.845 26.771 1.00 69.82  ? 44   GLN H OE1   1 
ATOM   5468  N  NE2   . GLN H 4 47  ? -36.200 -44.995 25.549 1.00 69.71  ? 44   GLN H NE2   1 
ATOM   5469  N  N     . VAL H 4 48  ? -39.273 -45.801 31.464 1.00 66.97  ? 45   VAL H N     1 
ATOM   5470  C  CA    . VAL H 4 48  ? -38.849 -46.201 32.810 1.00 66.55  ? 45   VAL H CA    1 
ATOM   5471  C  C     . VAL H 4 48  ? -40.034 -46.409 33.752 1.00 66.25  ? 45   VAL H C     1 
ATOM   5472  O  O     . VAL H 4 48  ? -39.953 -47.163 34.716 1.00 66.13  ? 45   VAL H O     1 
ATOM   5473  C  CB    . VAL H 4 48  ? -37.900 -45.148 33.441 1.00 66.57  ? 45   VAL H CB    1 
ATOM   5474  C  CG1   . VAL H 4 48  ? -37.293 -45.683 34.708 1.00 66.88  ? 45   VAL H CG1   1 
ATOM   5475  C  CG2   . VAL H 4 48  ? -36.791 -44.764 32.476 1.00 66.96  ? 45   VAL H CG2   1 
ATOM   5476  N  N     . HIS H 4 49  ? -41.128 -45.714 33.487 1.00 66.06  ? 46   HIS H N     1 
ATOM   5477  C  CA    . HIS H 4 49  ? -42.304 -45.828 34.322 1.00 66.14  ? 46   HIS H CA    1 
ATOM   5478  C  C     . HIS H 4 49  ? -43.528 -45.557 33.464 1.00 65.97  ? 46   HIS H C     1 
ATOM   5479  O  O     . HIS H 4 49  ? -44.140 -44.494 33.602 1.00 66.11  ? 46   HIS H O     1 
ATOM   5480  C  CB    . HIS H 4 49  ? -42.229 -44.830 35.481 1.00 66.26  ? 46   HIS H CB    1 
ATOM   5481  C  CG    . HIS H 4 49  ? -41.293 -45.238 36.575 1.00 66.67  ? 46   HIS H CG    1 
ATOM   5482  N  ND1   . HIS H 4 49  ? -41.677 -46.049 37.621 1.00 67.60  ? 46   HIS H ND1   1 
ATOM   5483  C  CD2   . HIS H 4 49  ? -39.991 -44.941 36.791 1.00 67.28  ? 46   HIS H CD2   1 
ATOM   5484  C  CE1   . HIS H 4 49  ? -40.652 -46.238 38.431 1.00 67.84  ? 46   HIS H CE1   1 
ATOM   5485  N  NE2   . HIS H 4 49  ? -39.615 -45.576 37.950 1.00 68.13  ? 46   HIS H NE2   1 
ATOM   5486  N  N     . PRO H 4 50  ? -43.910 -46.527 32.592 1.00 65.76  ? 47   PRO H N     1 
ATOM   5487  C  CA    . PRO H 4 50  ? -44.910 -46.259 31.538 1.00 65.26  ? 47   PRO H CA    1 
ATOM   5488  C  C     . PRO H 4 50  ? -46.248 -45.864 32.140 1.00 64.86  ? 47   PRO H C     1 
ATOM   5489  O  O     . PRO H 4 50  ? -47.003 -45.097 31.545 1.00 64.86  ? 47   PRO H O     1 
ATOM   5490  C  CB    . PRO H 4 50  ? -45.028 -47.593 30.796 1.00 65.20  ? 47   PRO H CB    1 
ATOM   5491  C  CG    . PRO H 4 50  ? -43.818 -48.394 31.211 1.00 65.30  ? 47   PRO H CG    1 
ATOM   5492  C  CD    . PRO H 4 50  ? -43.468 -47.937 32.584 1.00 65.56  ? 47   PRO H CD    1 
ATOM   5493  N  N     . ASP H 4 51  ? -46.513 -46.354 33.340 1.00 64.32  ? 48   ASP H N     1 
ATOM   5494  C  CA    . ASP H 4 51  ? -47.756 -46.039 34.014 1.00 64.21  ? 48   ASP H CA    1 
ATOM   5495  C  C     . ASP H 4 51  ? -47.653 -44.829 34.954 1.00 63.58  ? 48   ASP H C     1 
ATOM   5496  O  O     . ASP H 4 51  ? -48.556 -44.582 35.766 1.00 63.65  ? 48   ASP H O     1 
ATOM   5497  C  CB    . ASP H 4 51  ? -48.265 -47.285 34.743 1.00 64.61  ? 48   ASP H CB    1 
ATOM   5498  C  CG    . ASP H 4 51  ? -48.535 -48.441 33.788 1.00 65.37  ? 48   ASP H CG    1 
ATOM   5499  O  OD1   . ASP H 4 51  ? -49.235 -48.218 32.772 1.00 65.59  ? 48   ASP H OD1   1 
ATOM   5500  O  OD2   . ASP H 4 51  ? -48.043 -49.565 34.050 1.00 66.32  ? 48   ASP H OD2   1 
ATOM   5501  N  N     . THR H 4 52  ? -46.562 -44.071 34.828 1.00 62.59  ? 49   THR H N     1 
ATOM   5502  C  CA    . THR H 4 52  ? -46.340 -42.887 35.659 1.00 61.32  ? 49   THR H CA    1 
ATOM   5503  C  C     . THR H 4 52  ? -46.425 -41.610 34.825 1.00 60.55  ? 49   THR H C     1 
ATOM   5504  O  O     . THR H 4 52  ? -45.897 -41.554 33.717 1.00 60.13  ? 49   THR H O     1 
ATOM   5505  C  CB    . THR H 4 52  ? -44.991 -42.965 36.387 1.00 61.31  ? 49   THR H CB    1 
ATOM   5506  O  OG1   . THR H 4 52  ? -44.936 -44.177 37.145 1.00 61.35  ? 49   THR H OG1   1 
ATOM   5507  C  CG2   . THR H 4 52  ? -44.798 -41.787 37.324 1.00 60.83  ? 49   THR H CG2   1 
ATOM   5508  N  N     . GLY H 4 53  ? -47.112 -40.604 35.368 1.00 59.78  ? 50   GLY H N     1 
ATOM   5509  C  CA    . GLY H 4 53  ? -47.248 -39.297 34.733 1.00 58.97  ? 50   GLY H CA    1 
ATOM   5510  C  C     . GLY H 4 53  ? -46.410 -38.223 35.409 1.00 58.44  ? 50   GLY H C     1 
ATOM   5511  O  O     . GLY H 4 53  ? -45.651 -38.499 36.338 1.00 58.58  ? 50   GLY H O     1 
ATOM   5512  N  N     . ILE H 4 54  ? -46.562 -36.991 34.941 1.00 57.68  ? 51   ILE H N     1 
ATOM   5513  C  CA    . ILE H 4 54  ? -45.765 -35.870 35.411 1.00 56.71  ? 51   ILE H CA    1 
ATOM   5514  C  C     . ILE H 4 54  ? -46.544 -34.569 35.243 1.00 56.20  ? 51   ILE H C     1 
ATOM   5515  O  O     . ILE H 4 54  ? -47.120 -34.314 34.181 1.00 56.00  ? 51   ILE H O     1 
ATOM   5516  C  CB    . ILE H 4 54  ? -44.399 -35.802 34.651 1.00 57.07  ? 51   ILE H CB    1 
ATOM   5517  C  CG1   . ILE H 4 54  ? -43.422 -34.844 35.344 1.00 56.21  ? 51   ILE H CG1   1 
ATOM   5518  C  CG2   . ILE H 4 54  ? -44.587 -35.472 33.143 1.00 57.22  ? 51   ILE H CG2   1 
ATOM   5519  C  CD1   . ILE H 4 54  ? -41.978 -35.120 35.020 1.00 55.22  ? 51   ILE H CD1   1 
ATOM   5520  N  N     . SER H 4 55  ? -46.560 -33.752 36.294 1.00 55.48  ? 52   SER H N     1 
ATOM   5521  C  CA    . SER H 4 55  ? -47.218 -32.448 36.236 1.00 54.31  ? 52   SER H CA    1 
ATOM   5522  C  C     . SER H 4 55  ? -46.349 -31.424 35.528 1.00 53.71  ? 52   SER H C     1 
ATOM   5523  O  O     . SER H 4 55  ? -45.177 -31.674 35.245 1.00 53.33  ? 52   SER H O     1 
ATOM   5524  C  CB    . SER H 4 55  ? -47.599 -31.956 37.633 1.00 54.33  ? 52   SER H CB    1 
ATOM   5525  O  OG    . SER H 4 55  ? -46.479 -31.463 38.326 1.00 53.86  ? 52   SER H OG    1 
ATOM   5526  N  N     . SER H 4 56  ? -46.944 -30.272 35.247 1.00 53.35  ? 53   SER H N     1 
ATOM   5527  C  CA    . SER H 4 56  ? -46.282 -29.198 34.532 1.00 53.12  ? 53   SER H CA    1 
ATOM   5528  C  C     . SER H 4 56  ? -45.084 -28.702 35.283 1.00 52.85  ? 53   SER H C     1 
ATOM   5529  O  O     . SER H 4 56  ? -44.000 -28.562 34.709 1.00 53.17  ? 53   SER H O     1 
ATOM   5530  C  CB    . SER H 4 56  ? -47.231 -28.031 34.321 1.00 53.07  ? 53   SER H CB    1 
ATOM   5531  O  OG    . SER H 4 56  ? -47.700 -28.045 32.991 1.00 55.20  ? 53   SER H OG    1 
ATOM   5532  N  N     . LYS H 4 57  ? -45.291 -28.425 36.566 1.00 52.05  ? 54   LYS H N     1 
ATOM   5533  C  CA    . LYS H 4 57  ? -44.246 -27.892 37.393 1.00 51.75  ? 54   LYS H CA    1 
ATOM   5534  C  C     . LYS H 4 57  ? -43.106 -28.898 37.492 1.00 51.36  ? 54   LYS H C     1 
ATOM   5535  O  O     . LYS H 4 57  ? -41.919 -28.533 37.363 1.00 51.82  ? 54   LYS H O     1 
ATOM   5536  C  CB    . LYS H 4 57  ? -44.796 -27.513 38.760 1.00 52.20  ? 54   LYS H CB    1 
ATOM   5537  C  CG    . LYS H 4 57  ? -45.685 -26.273 38.732 1.00 53.93  ? 54   LYS H CG    1 
ATOM   5538  C  CD    . LYS H 4 57  ? -46.418 -26.094 40.064 1.00 57.42  ? 54   LYS H CD    1 
ATOM   5539  C  CE    . LYS H 4 57  ? -47.597 -25.137 39.926 1.00 59.01  ? 54   LYS H CE    1 
ATOM   5540  N  NZ    . LYS H 4 57  ? -48.817 -25.728 40.572 1.00 60.69  ? 54   LYS H NZ    1 
ATOM   5541  N  N     . ALA H 4 58  ? -43.457 -30.165 37.683 1.00 50.16  ? 55   ALA H N     1 
ATOM   5542  C  CA    . ALA H 4 58  ? -42.467 -31.218 37.634 1.00 49.36  ? 55   ALA H CA    1 
ATOM   5543  C  C     . ALA H 4 58  ? -41.741 -31.202 36.297 1.00 48.88  ? 55   ALA H C     1 
ATOM   5544  O  O     . ALA H 4 58  ? -40.515 -31.253 36.247 1.00 48.63  ? 55   ALA H O     1 
ATOM   5545  C  CB    . ALA H 4 58  ? -43.105 -32.537 37.867 1.00 49.58  ? 55   ALA H CB    1 
ATOM   5546  N  N     . MET H 4 59  ? -42.492 -31.106 35.207 1.00 48.49  ? 56   MET H N     1 
ATOM   5547  C  CA    . MET H 4 59  ? -41.862 -31.116 33.893 1.00 48.23  ? 56   MET H CA    1 
ATOM   5548  C  C     . MET H 4 59  ? -40.898 -29.940 33.753 1.00 48.02  ? 56   MET H C     1 
ATOM   5549  O  O     . MET H 4 59  ? -39.778 -30.078 33.237 1.00 47.82  ? 56   MET H O     1 
ATOM   5550  C  CB    . MET H 4 59  ? -42.898 -31.112 32.773 1.00 48.01  ? 56   MET H CB    1 
ATOM   5551  C  CG    . MET H 4 59  ? -42.278 -31.045 31.394 1.00 48.03  ? 56   MET H CG    1 
ATOM   5552  S  SD    . MET H 4 59  ? -41.082 -32.361 31.097 1.00 49.13  ? 56   MET H SD    1 
ATOM   5553  C  CE    . MET H 4 59  ? -42.148 -33.672 30.497 1.00 49.16  ? 56   MET H CE    1 
ATOM   5554  N  N     . SER H 4 60  ? -41.340 -28.789 34.244 1.00 47.60  ? 57   SER H N     1 
ATOM   5555  C  CA    . SER H 4 60  ? -40.559 -27.581 34.165 1.00 47.10  ? 57   SER H CA    1 
ATOM   5556  C  C     . SER H 4 60  ? -39.212 -27.795 34.836 1.00 46.61  ? 57   SER H C     1 
ATOM   5557  O  O     . SER H 4 60  ? -38.182 -27.514 34.233 1.00 46.65  ? 57   SER H O     1 
ATOM   5558  C  CB    . SER H 4 60  ? -41.316 -26.430 34.803 1.00 47.25  ? 57   SER H CB    1 
ATOM   5559  O  OG    . SER H 4 60  ? -41.063 -25.235 34.092 1.00 48.56  ? 57   SER H OG    1 
ATOM   5560  N  N     . ILE H 4 61  ? -39.223 -28.333 36.060 1.00 46.14  ? 58   ILE H N     1 
ATOM   5561  C  CA    . ILE H 4 61  ? -37.983 -28.644 36.804 1.00 45.35  ? 58   ILE H CA    1 
ATOM   5562  C  C     . ILE H 4 61  ? -37.053 -29.564 36.037 1.00 45.04  ? 58   ILE H C     1 
ATOM   5563  O  O     . ILE H 4 61  ? -35.848 -29.324 35.970 1.00 45.28  ? 58   ILE H O     1 
ATOM   5564  C  CB    . ILE H 4 61  ? -38.269 -29.258 38.171 1.00 45.27  ? 58   ILE H CB    1 
ATOM   5565  C  CG1   . ILE H 4 61  ? -38.907 -28.210 39.079 1.00 45.28  ? 58   ILE H CG1   1 
ATOM   5566  C  CG2   . ILE H 4 61  ? -36.985 -29.746 38.805 1.00 45.14  ? 58   ILE H CG2   1 
ATOM   5567  C  CD1   . ILE H 4 61  ? -39.887 -28.774 40.038 1.00 45.53  ? 58   ILE H CD1   1 
ATOM   5568  N  N     . MET H 4 62  ? -37.607 -30.608 35.441 1.00 44.65  ? 59   MET H N     1 
ATOM   5569  C  CA    . MET H 4 62  ? -36.801 -31.448 34.588 1.00 44.62  ? 59   MET H CA    1 
ATOM   5570  C  C     . MET H 4 62  ? -36.149 -30.593 33.506 1.00 44.69  ? 59   MET H C     1 
ATOM   5571  O  O     . MET H 4 62  ? -34.982 -30.776 33.160 1.00 44.96  ? 59   MET H O     1 
ATOM   5572  C  CB    . MET H 4 62  ? -37.636 -32.573 33.976 1.00 44.79  ? 59   MET H CB    1 
ATOM   5573  C  CG    . MET H 4 62  ? -38.060 -33.660 34.965 1.00 43.70  ? 59   MET H CG    1 
ATOM   5574  S  SD    . MET H 4 62  ? -36.633 -34.311 35.846 1.00 42.78  ? 59   MET H SD    1 
ATOM   5575  C  CE    . MET H 4 62  ? -35.842 -35.294 34.590 1.00 40.21  ? 59   MET H CE    1 
ATOM   5576  N  N     . ASN H 4 63  ? -36.893 -29.626 32.993 1.00 44.72  ? 60   ASN H N     1 
ATOM   5577  C  CA    . ASN H 4 63  ? -36.367 -28.802 31.916 1.00 44.47  ? 60   ASN H CA    1 
ATOM   5578  C  C     . ASN H 4 63  ? -35.195 -27.944 32.377 1.00 44.13  ? 60   ASN H C     1 
ATOM   5579  O  O     . ASN H 4 63  ? -34.147 -27.916 31.724 1.00 44.18  ? 60   ASN H O     1 
ATOM   5580  C  CB    . ASN H 4 63  ? -37.467 -27.969 31.253 1.00 44.25  ? 60   ASN H CB    1 
ATOM   5581  C  CG    . ASN H 4 63  ? -37.125 -27.624 29.832 1.00 44.32  ? 60   ASN H CG    1 
ATOM   5582  O  OD1   . ASN H 4 63  ? -36.671 -28.480 29.066 1.00 42.83  ? 60   ASN H OD1   1 
ATOM   5583  N  ND2   . ASN H 4 63  ? -37.297 -26.354 29.473 1.00 45.12  ? 60   ASN H ND2   1 
ATOM   5584  N  N     . SER H 4 64  ? -35.373 -27.259 33.502 1.00 43.72  ? 61   SER H N     1 
ATOM   5585  C  CA    . SER H 4 64  ? -34.266 -26.598 34.183 1.00 43.75  ? 61   SER H CA    1 
ATOM   5586  C  C     . SER H 4 64  ? -33.071 -27.551 34.307 1.00 43.56  ? 61   SER H C     1 
ATOM   5587  O  O     . SER H 4 64  ? -31.978 -27.270 33.797 1.00 43.17  ? 61   SER H O     1 
ATOM   5588  C  CB    . SER H 4 64  ? -34.713 -26.147 35.565 1.00 43.72  ? 61   SER H CB    1 
ATOM   5589  O  OG    . SER H 4 64  ? -35.830 -25.286 35.464 1.00 44.42  ? 61   SER H OG    1 
ATOM   5590  N  N     . PHE H 4 65  ? -33.307 -28.702 34.935 1.00 43.37  ? 62   PHE H N     1 
ATOM   5591  C  CA    . PHE H 4 65  ? -32.266 -29.710 35.114 1.00 43.33  ? 62   PHE H CA    1 
ATOM   5592  C  C     . PHE H 4 65  ? -31.476 -30.058 33.855 1.00 43.10  ? 62   PHE H C     1 
ATOM   5593  O  O     . PHE H 4 65  ? -30.250 -30.167 33.899 1.00 43.00  ? 62   PHE H O     1 
ATOM   5594  C  CB    . PHE H 4 65  ? -32.840 -30.990 35.694 1.00 43.66  ? 62   PHE H CB    1 
ATOM   5595  C  CG    . PHE H 4 65  ? -31.845 -32.109 35.740 1.00 44.28  ? 62   PHE H CG    1 
ATOM   5596  C  CD1   . PHE H 4 65  ? -30.902 -32.174 36.767 1.00 44.61  ? 62   PHE H CD1   1 
ATOM   5597  C  CD2   . PHE H 4 65  ? -31.823 -33.074 34.743 1.00 43.44  ? 62   PHE H CD2   1 
ATOM   5598  C  CE1   . PHE H 4 65  ? -29.968 -33.198 36.808 1.00 44.59  ? 62   PHE H CE1   1 
ATOM   5599  C  CE2   . PHE H 4 65  ? -30.890 -34.098 34.773 1.00 43.63  ? 62   PHE H CE2   1 
ATOM   5600  C  CZ    . PHE H 4 65  ? -29.963 -34.164 35.809 1.00 44.25  ? 62   PHE H CZ    1 
ATOM   5601  N  N     . VAL H 4 66  ? -32.176 -30.255 32.744 1.00 42.89  ? 63   VAL H N     1 
ATOM   5602  C  CA    . VAL H 4 66  ? -31.502 -30.610 31.505 1.00 42.73  ? 63   VAL H CA    1 
ATOM   5603  C  C     . VAL H 4 66  ? -30.685 -29.441 30.953 1.00 42.81  ? 63   VAL H C     1 
ATOM   5604  O  O     . VAL H 4 66  ? -29.541 -29.640 30.512 1.00 43.00  ? 63   VAL H O     1 
ATOM   5605  C  CB    . VAL H 4 66  ? -32.465 -31.158 30.445 1.00 42.76  ? 63   VAL H CB    1 
ATOM   5606  C  CG1   . VAL H 4 66  ? -31.695 -31.579 29.203 1.00 41.98  ? 63   VAL H CG1   1 
ATOM   5607  C  CG2   . VAL H 4 66  ? -33.238 -32.352 31.007 1.00 43.24  ? 63   VAL H CG2   1 
ATOM   5608  N  N     . ASN H 4 67  ? -31.248 -28.230 31.003 1.00 42.23  ? 64   ASN H N     1 
ATOM   5609  C  CA    . ASN H 4 67  ? -30.512 -27.047 30.565 1.00 41.80  ? 64   ASN H CA    1 
ATOM   5610  C  C     . ASN H 4 67  ? -29.287 -26.796 31.428 1.00 41.33  ? 64   ASN H C     1 
ATOM   5611  O  O     . ASN H 4 67  ? -28.207 -26.512 30.912 1.00 41.22  ? 64   ASN H O     1 
ATOM   5612  C  CB    . ASN H 4 67  ? -31.405 -25.810 30.541 1.00 41.99  ? 64   ASN H CB    1 
ATOM   5613  C  CG    . ASN H 4 67  ? -32.329 -25.788 29.345 1.00 43.65  ? 64   ASN H CG    1 
ATOM   5614  O  OD1   . ASN H 4 67  ? -31.893 -25.964 28.200 1.00 45.37  ? 64   ASN H OD1   1 
ATOM   5615  N  ND2   . ASN H 4 67  ? -33.620 -25.585 29.599 1.00 44.43  ? 64   ASN H ND2   1 
ATOM   5616  N  N     . ASP H 4 68  ? -29.459 -26.915 32.741 1.00 40.58  ? 65   ASP H N     1 
ATOM   5617  C  CA    . ASP H 4 68  ? -28.381 -26.656 33.656 1.00 40.17  ? 65   ASP H CA    1 
ATOM   5618  C  C     . ASP H 4 68  ? -27.261 -27.622 33.326 1.00 39.93  ? 65   ASP H C     1 
ATOM   5619  O  O     . ASP H 4 68  ? -26.157 -27.201 32.973 1.00 39.80  ? 65   ASP H O     1 
ATOM   5620  C  CB    . ASP H 4 68  ? -28.865 -26.827 35.091 1.00 40.48  ? 65   ASP H CB    1 
ATOM   5621  C  CG    . ASP H 4 68  ? -27.764 -26.634 36.122 1.00 41.77  ? 65   ASP H CG    1 
ATOM   5622  O  OD1   . ASP H 4 68  ? -26.597 -26.366 35.755 1.00 42.42  ? 65   ASP H OD1   1 
ATOM   5623  O  OD2   . ASP H 4 68  ? -28.075 -26.756 37.324 1.00 43.66  ? 65   ASP H OD2   1 
ATOM   5624  N  N     . VAL H 4 69  ? -27.542 -28.921 33.402 1.00 39.55  ? 66   VAL H N     1 
ATOM   5625  C  CA    . VAL H 4 69  ? -26.477 -29.894 33.216 1.00 39.01  ? 66   VAL H CA    1 
ATOM   5626  C  C     . VAL H 4 69  ? -25.836 -29.668 31.863 1.00 38.95  ? 66   VAL H C     1 
ATOM   5627  O  O     . VAL H 4 69  ? -24.613 -29.739 31.735 1.00 39.05  ? 66   VAL H O     1 
ATOM   5628  C  CB    . VAL H 4 69  ? -26.948 -31.350 33.367 1.00 39.12  ? 66   VAL H CB    1 
ATOM   5629  C  CG1   . VAL H 4 69  ? -25.806 -32.292 33.053 1.00 38.68  ? 66   VAL H CG1   1 
ATOM   5630  C  CG2   . VAL H 4 69  ? -27.452 -31.614 34.789 1.00 38.69  ? 66   VAL H CG2   1 
ATOM   5631  N  N     . PHE H 4 70  ? -26.663 -29.365 30.861 1.00 38.69  ? 67   PHE H N     1 
ATOM   5632  C  CA    . PHE H 4 70  ? -26.159 -29.017 29.541 1.00 38.29  ? 67   PHE H CA    1 
ATOM   5633  C  C     . PHE H 4 70  ? -25.040 -27.969 29.647 1.00 38.62  ? 67   PHE H C     1 
ATOM   5634  O  O     . PHE H 4 70  ? -23.914 -28.237 29.233 1.00 38.40  ? 67   PHE H O     1 
ATOM   5635  C  CB    . PHE H 4 70  ? -27.290 -28.526 28.629 1.00 37.91  ? 67   PHE H CB    1 
ATOM   5636  C  CG    . PHE H 4 70  ? -26.833 -28.198 27.240 1.00 37.66  ? 67   PHE H CG    1 
ATOM   5637  C  CD1   . PHE H 4 70  ? -26.881 -29.159 26.237 1.00 37.32  ? 67   PHE H CD1   1 
ATOM   5638  C  CD2   . PHE H 4 70  ? -26.321 -26.937 26.940 1.00 37.15  ? 67   PHE H CD2   1 
ATOM   5639  C  CE1   . PHE H 4 70  ? -26.433 -28.871 24.942 1.00 36.94  ? 67   PHE H CE1   1 
ATOM   5640  C  CE2   . PHE H 4 70  ? -25.870 -26.640 25.667 1.00 37.40  ? 67   PHE H CE2   1 
ATOM   5641  C  CZ    . PHE H 4 70  ? -25.925 -27.622 24.654 1.00 37.48  ? 67   PHE H CZ    1 
ATOM   5642  N  N     . GLU H 4 71  ? -25.366 -26.806 30.230 1.00 38.72  ? 68   GLU H N     1 
ATOM   5643  C  CA    . GLU H 4 71  ? -24.456 -25.676 30.375 1.00 39.57  ? 68   GLU H CA    1 
ATOM   5644  C  C     . GLU H 4 71  ? -23.205 -26.024 31.165 1.00 39.03  ? 68   GLU H C     1 
ATOM   5645  O  O     . GLU H 4 71  ? -22.077 -25.729 30.727 1.00 39.09  ? 68   GLU H O     1 
ATOM   5646  C  CB    . GLU H 4 71  ? -25.167 -24.471 31.000 1.00 39.24  ? 68   GLU H CB    1 
ATOM   5647  C  CG    . GLU H 4 71  ? -26.085 -23.719 30.016 1.00 41.81  ? 68   GLU H CG    1 
ATOM   5648  C  CD    . GLU H 4 71  ? -27.171 -22.819 30.680 1.00 42.98  ? 68   GLU H CD    1 
ATOM   5649  O  OE1   . GLU H 4 71  ? -27.287 -22.760 31.944 1.00 46.64  ? 68   GLU H OE1   1 
ATOM   5650  O  OE2   . GLU H 4 71  ? -27.923 -22.160 29.910 1.00 47.06  ? 68   GLU H OE2   1 
ATOM   5651  N  N     . ARG H 4 72  ? -23.386 -26.658 32.317 1.00 38.65  ? 69   ARG H N     1 
ATOM   5652  C  CA    . ARG H 4 72  ? -22.242 -27.115 33.091 1.00 38.65  ? 69   ARG H CA    1 
ATOM   5653  C  C     . ARG H 4 72  ? -21.311 -28.004 32.256 1.00 38.94  ? 69   ARG H C     1 
ATOM   5654  O  O     . ARG H 4 72  ? -20.111 -27.729 32.156 1.00 39.12  ? 69   ARG H O     1 
ATOM   5655  C  CB    . ARG H 4 72  ? -22.688 -27.850 34.344 1.00 38.69  ? 69   ARG H CB    1 
ATOM   5656  C  CG    . ARG H 4 72  ? -23.673 -27.094 35.195 1.00 39.13  ? 69   ARG H CG    1 
ATOM   5657  C  CD    . ARG H 4 72  ? -23.504 -27.540 36.590 1.00 39.40  ? 69   ARG H CD    1 
ATOM   5658  N  NE    . ARG H 4 72  ? -24.753 -27.650 37.305 1.00 40.99  ? 69   ARG H NE    1 
ATOM   5659  C  CZ    . ARG H 4 72  ? -24.882 -28.350 38.427 1.00 43.19  ? 69   ARG H CZ    1 
ATOM   5660  N  NH1   . ARG H 4 72  ? -23.839 -29.005 38.934 1.00 42.06  ? 69   ARG H NH1   1 
ATOM   5661  N  NH2   . ARG H 4 72  ? -26.055 -28.404 39.041 1.00 45.18  ? 69   ARG H NH2   1 
ATOM   5662  N  N     . ILE H 4 73  ? -21.851 -29.057 31.644 1.00 38.82  ? 70   ILE H N     1 
ATOM   5663  C  CA    . ILE H 4 73  ? -20.994 -29.939 30.866 1.00 39.24  ? 70   ILE H CA    1 
ATOM   5664  C  C     . ILE H 4 73  ? -20.332 -29.174 29.708 1.00 39.39  ? 70   ILE H C     1 
ATOM   5665  O  O     . ILE H 4 73  ? -19.120 -29.238 29.554 1.00 39.40  ? 70   ILE H O     1 
ATOM   5666  C  CB    . ILE H 4 73  ? -21.706 -31.235 30.387 1.00 39.29  ? 70   ILE H CB    1 
ATOM   5667  C  CG1   . ILE H 4 73  ? -22.146 -32.081 31.579 1.00 38.71  ? 70   ILE H CG1   1 
ATOM   5668  C  CG2   . ILE H 4 73  ? -20.771 -32.076 29.540 1.00 38.63  ? 70   ILE H CG2   1 
ATOM   5669  C  CD1   . ILE H 4 73  ? -22.975 -33.282 31.181 1.00 37.04  ? 70   ILE H CD1   1 
ATOM   5670  N  N     . ALA H 4 74  ? -21.121 -28.441 28.927 1.00 39.52  ? 71   ALA H N     1 
ATOM   5671  C  CA    . ALA H 4 74  ? -20.586 -27.615 27.839 1.00 40.13  ? 71   ALA H CA    1 
ATOM   5672  C  C     . ALA H 4 74  ? -19.568 -26.572 28.338 1.00 40.77  ? 71   ALA H C     1 
ATOM   5673  O  O     . ALA H 4 74  ? -18.553 -26.302 27.671 1.00 40.65  ? 71   ALA H O     1 
ATOM   5674  C  CB    . ALA H 4 74  ? -21.716 -26.931 27.072 1.00 39.68  ? 71   ALA H CB    1 
ATOM   5675  N  N     . GLY H 4 75  ? -19.843 -25.993 29.506 1.00 40.95  ? 72   GLY H N     1 
ATOM   5676  C  CA    . GLY H 4 75  ? -18.953 -24.996 30.073 1.00 41.69  ? 72   GLY H CA    1 
ATOM   5677  C  C     . GLY H 4 75  ? -17.569 -25.567 30.274 1.00 42.06  ? 72   GLY H C     1 
ATOM   5678  O  O     . GLY H 4 75  ? -16.574 -25.005 29.817 1.00 42.30  ? 72   GLY H O     1 
ATOM   5679  N  N     . GLU H 4 76  ? -17.510 -26.708 30.947 1.00 42.59  ? 73   GLU H N     1 
ATOM   5680  C  CA    . GLU H 4 76  ? -16.238 -27.344 31.241 1.00 42.60  ? 73   GLU H CA    1 
ATOM   5681  C  C     . GLU H 4 76  ? -15.551 -27.800 29.978 1.00 42.27  ? 73   GLU H C     1 
ATOM   5682  O  O     . GLU H 4 76  ? -14.329 -27.687 29.863 1.00 42.91  ? 73   GLU H O     1 
ATOM   5683  C  CB    . GLU H 4 76  ? -16.420 -28.529 32.171 1.00 42.71  ? 73   GLU H CB    1 
ATOM   5684  C  CG    . GLU H 4 76  ? -15.117 -29.105 32.612 1.00 43.96  ? 73   GLU H CG    1 
ATOM   5685  C  CD    . GLU H 4 76  ? -14.305 -28.136 33.457 1.00 47.11  ? 73   GLU H CD    1 
ATOM   5686  O  OE1   . GLU H 4 76  ? -13.163 -27.809 33.041 1.00 45.42  ? 73   GLU H OE1   1 
ATOM   5687  O  OE2   . GLU H 4 76  ? -14.820 -27.710 34.535 1.00 49.48  ? 73   GLU H OE2   1 
ATOM   5688  N  N     . ALA H 4 77  ? -16.326 -28.308 29.030 1.00 41.68  ? 74   ALA H N     1 
ATOM   5689  C  CA    . ALA H 4 77  ? -15.744 -28.846 27.816 1.00 41.72  ? 74   ALA H CA    1 
ATOM   5690  C  C     . ALA H 4 77  ? -15.098 -27.695 27.068 1.00 41.96  ? 74   ALA H C     1 
ATOM   5691  O  O     . ALA H 4 77  ? -13.960 -27.795 26.611 1.00 41.55  ? 74   ALA H O     1 
ATOM   5692  C  CB    . ALA H 4 77  ? -16.793 -29.529 26.982 1.00 41.59  ? 74   ALA H CB    1 
ATOM   5693  N  N     . SER H 4 78  ? -15.827 -26.586 26.991 1.00 42.57  ? 75   SER H N     1 
ATOM   5694  C  CA    . SER H 4 78  ? -15.309 -25.345 26.435 1.00 43.11  ? 75   SER H CA    1 
ATOM   5695  C  C     . SER H 4 78  ? -13.975 -24.973 27.066 1.00 43.61  ? 75   SER H C     1 
ATOM   5696  O  O     . SER H 4 78  ? -12.983 -24.750 26.357 1.00 43.58  ? 75   SER H O     1 
ATOM   5697  C  CB    . SER H 4 78  ? -16.307 -24.218 26.656 1.00 42.94  ? 75   SER H CB    1 
ATOM   5698  O  OG    . SER H 4 78  ? -15.757 -22.995 26.218 1.00 44.03  ? 75   SER H OG    1 
ATOM   5699  N  N     . ARG H 4 79  ? -13.959 -24.909 28.398 1.00 43.92  ? 76   ARG H N     1 
ATOM   5700  C  CA    . ARG H 4 79  ? -12.750 -24.618 29.130 1.00 44.60  ? 76   ARG H CA    1 
ATOM   5701  C  C     . ARG H 4 79  ? -11.583 -25.563 28.773 1.00 45.12  ? 76   ARG H C     1 
ATOM   5702  O  O     . ARG H 4 79  ? -10.519 -25.099 28.364 1.00 45.01  ? 76   ARG H O     1 
ATOM   5703  C  CB    . ARG H 4 79  ? -13.044 -24.602 30.622 1.00 44.93  ? 76   ARG H CB    1 
ATOM   5704  C  CG    . ARG H 4 79  ? -13.204 -23.203 31.207 1.00 46.00  ? 76   ARG H CG    1 
ATOM   5705  C  CD    . ARG H 4 79  ? -13.895 -23.221 32.582 1.00 47.20  ? 76   ARG H CD    1 
ATOM   5706  N  NE    . ARG H 4 79  ? -15.318 -22.873 32.519 1.00 47.57  ? 76   ARG H NE    1 
ATOM   5707  C  CZ    . ARG H 4 79  ? -16.296 -23.631 33.007 1.00 50.16  ? 76   ARG H CZ    1 
ATOM   5708  N  NH1   . ARG H 4 79  ? -16.008 -24.790 33.591 1.00 51.69  ? 76   ARG H NH1   1 
ATOM   5709  N  NH2   . ARG H 4 79  ? -17.565 -23.241 32.912 1.00 50.99  ? 76   ARG H NH2   1 
ATOM   5710  N  N     . LEU H 4 80  ? -11.779 -26.875 28.903 1.00 45.79  ? 77   LEU H N     1 
ATOM   5711  C  CA    . LEU H 4 80  ? -10.761 -27.848 28.484 1.00 46.75  ? 77   LEU H CA    1 
ATOM   5712  C  C     . LEU H 4 80  ? -10.119 -27.514 27.140 1.00 47.43  ? 77   LEU H C     1 
ATOM   5713  O  O     . LEU H 4 80  ? -8.885  -27.415 27.028 1.00 47.70  ? 77   LEU H O     1 
ATOM   5714  C  CB    . LEU H 4 80  ? -11.369 -29.235 28.363 1.00 46.64  ? 77   LEU H CB    1 
ATOM   5715  C  CG    . LEU H 4 80  ? -11.461 -30.069 29.626 1.00 47.36  ? 77   LEU H CG    1 
ATOM   5716  C  CD1   . LEU H 4 80  ? -12.494 -31.186 29.435 1.00 45.98  ? 77   LEU H CD1   1 
ATOM   5717  C  CD2   . LEU H 4 80  ? -10.076 -30.609 29.979 1.00 47.79  ? 77   LEU H CD2   1 
ATOM   5718  N  N     . ALA H 4 81  ? -10.965 -27.356 26.123 1.00 47.83  ? 78   ALA H N     1 
ATOM   5719  C  CA    . ALA H 4 81  ? -10.508 -27.066 24.780 1.00 48.50  ? 78   ALA H CA    1 
ATOM   5720  C  C     . ALA H 4 81  ? -9.583  -25.865 24.745 1.00 49.43  ? 78   ALA H C     1 
ATOM   5721  O  O     . ALA H 4 81  ? -8.513  -25.949 24.144 1.00 49.85  ? 78   ALA H O     1 
ATOM   5722  C  CB    . ALA H 4 81  ? -11.678 -26.876 23.844 1.00 48.36  ? 78   ALA H CB    1 
ATOM   5723  N  N     . HIS H 4 82  ? -9.965  -24.761 25.396 1.00 50.44  ? 79   HIS H N     1 
ATOM   5724  C  CA    . HIS H 4 82  ? -9.114  -23.570 25.409 1.00 51.66  ? 79   HIS H CA    1 
ATOM   5725  C  C     . HIS H 4 82  ? -7.790  -23.855 26.114 1.00 52.22  ? 79   HIS H C     1 
ATOM   5726  O  O     . HIS H 4 82  ? -6.732  -23.572 25.556 1.00 52.21  ? 79   HIS H O     1 
ATOM   5727  C  CB    . HIS H 4 82  ? -9.810  -22.349 26.025 1.00 52.02  ? 79   HIS H CB    1 
ATOM   5728  C  CG    . HIS H 4 82  ? -10.995 -21.855 25.241 1.00 54.62  ? 79   HIS H CG    1 
ATOM   5729  N  ND1   . HIS H 4 82  ? -10.913 -21.472 23.915 1.00 56.26  ? 79   HIS H ND1   1 
ATOM   5730  C  CD2   . HIS H 4 82  ? -12.287 -21.658 25.608 1.00 55.39  ? 79   HIS H CD2   1 
ATOM   5731  C  CE1   . HIS H 4 82  ? -12.105 -21.082 23.495 1.00 55.55  ? 79   HIS H CE1   1 
ATOM   5732  N  NE2   . HIS H 4 82  ? -12.955 -21.183 24.503 1.00 56.45  ? 79   HIS H NE2   1 
ATOM   5733  N  N     . TYR H 4 83  ? -7.848  -24.438 27.315 1.00 53.16  ? 80   TYR H N     1 
ATOM   5734  C  CA    . TYR H 4 83  ? -6.639  -24.782 28.083 1.00 54.31  ? 80   TYR H CA    1 
ATOM   5735  C  C     . TYR H 4 83  ? -5.594  -25.496 27.250 1.00 54.50  ? 80   TYR H C     1 
ATOM   5736  O  O     . TYR H 4 83  ? -4.405  -25.257 27.403 1.00 54.55  ? 80   TYR H O     1 
ATOM   5737  C  CB    . TYR H 4 83  ? -6.967  -25.618 29.327 1.00 54.97  ? 80   TYR H CB    1 
ATOM   5738  C  CG    . TYR H 4 83  ? -7.863  -24.891 30.333 1.00 56.91  ? 80   TYR H CG    1 
ATOM   5739  C  CD1   . TYR H 4 83  ? -7.898  -23.491 30.384 1.00 56.03  ? 80   TYR H CD1   1 
ATOM   5740  C  CD2   . TYR H 4 83  ? -8.670  -25.606 31.239 1.00 57.05  ? 80   TYR H CD2   1 
ATOM   5741  C  CE1   . TYR H 4 83  ? -8.704  -22.831 31.281 1.00 56.06  ? 80   TYR H CE1   1 
ATOM   5742  C  CE2   . TYR H 4 83  ? -9.481  -24.943 32.146 1.00 56.33  ? 80   TYR H CE2   1 
ATOM   5743  C  CZ    . TYR H 4 83  ? -9.491  -23.554 32.156 1.00 56.72  ? 80   TYR H CZ    1 
ATOM   5744  O  OH    . TYR H 4 83  ? -10.288 -22.863 33.046 1.00 57.91  ? 80   TYR H OH    1 
ATOM   5745  N  N     . ASN H 4 84  ? -6.050  -26.355 26.348 1.00 54.95  ? 81   ASN H N     1 
ATOM   5746  C  CA    . ASN H 4 84  ? -5.159  -27.069 25.454 1.00 55.13  ? 81   ASN H CA    1 
ATOM   5747  C  C     . ASN H 4 84  ? -4.988  -26.439 24.080 1.00 55.39  ? 81   ASN H C     1 
ATOM   5748  O  O     . ASN H 4 84  ? -4.349  -27.025 23.209 1.00 55.34  ? 81   ASN H O     1 
ATOM   5749  C  CB    . ASN H 4 84  ? -5.631  -28.507 25.324 1.00 55.14  ? 81   ASN H CB    1 
ATOM   5750  C  CG    . ASN H 4 84  ? -5.708  -29.190 26.655 1.00 55.17  ? 81   ASN H CG    1 
ATOM   5751  O  OD1   . ASN H 4 84  ? -4.689  -29.643 27.200 1.00 54.36  ? 81   ASN H OD1   1 
ATOM   5752  N  ND2   . ASN H 4 84  ? -6.917  -29.246 27.215 1.00 54.51  ? 81   ASN H ND2   1 
ATOM   5753  N  N     . LYS H 4 85  ? -5.554  -25.250 23.895 1.00 55.94  ? 82   LYS H N     1 
ATOM   5754  C  CA    . LYS H 4 85  ? -5.393  -24.486 22.657 1.00 56.88  ? 82   LYS H CA    1 
ATOM   5755  C  C     . LYS H 4 85  ? -5.864  -25.282 21.449 1.00 56.86  ? 82   LYS H C     1 
ATOM   5756  O  O     . LYS H 4 85  ? -5.089  -25.539 20.520 1.00 56.92  ? 82   LYS H O     1 
ATOM   5757  C  CB    . LYS H 4 85  ? -3.937  -24.045 22.465 1.00 56.80  ? 82   LYS H CB    1 
ATOM   5758  C  CG    . LYS H 4 85  ? -3.458  -23.023 23.479 1.00 57.55  ? 82   LYS H CG    1 
ATOM   5759  C  CD    . LYS H 4 85  ? -2.033  -22.572 23.183 1.00 58.21  ? 82   LYS H CD    1 
ATOM   5760  C  CE    . LYS H 4 85  ? -0.986  -23.433 23.895 1.00 60.37  ? 82   LYS H CE    1 
ATOM   5761  N  NZ    . LYS H 4 85  ? 0.379   -22.839 23.718 1.00 61.10  ? 82   LYS H NZ    1 
ATOM   5762  N  N     . ARG H 4 86  ? -7.133  -25.675 21.487 1.00 56.94  ? 83   ARG H N     1 
ATOM   5763  C  CA    . ARG H 4 86  ? -7.751  -26.462 20.436 1.00 57.21  ? 83   ARG H CA    1 
ATOM   5764  C  C     . ARG H 4 86  ? -9.011  -25.768 19.945 1.00 57.27  ? 83   ARG H C     1 
ATOM   5765  O  O     . ARG H 4 86  ? -9.693  -25.084 20.708 1.00 57.45  ? 83   ARG H O     1 
ATOM   5766  C  CB    . ARG H 4 86  ? -8.109  -27.855 20.951 1.00 57.31  ? 83   ARG H CB    1 
ATOM   5767  C  CG    . ARG H 4 86  ? -6.940  -28.697 21.408 1.00 58.66  ? 83   ARG H CG    1 
ATOM   5768  C  CD    . ARG H 4 86  ? -6.312  -29.490 20.271 1.00 62.30  ? 83   ARG H CD    1 
ATOM   5769  N  NE    . ARG H 4 86  ? -5.473  -30.592 20.764 1.00 65.70  ? 83   ARG H NE    1 
ATOM   5770  C  CZ    . ARG H 4 86  ? -4.191  -30.472 21.129 1.00 67.08  ? 83   ARG H CZ    1 
ATOM   5771  N  NH1   . ARG H 4 86  ? -3.569  -29.296 21.062 1.00 67.18  ? 83   ARG H NH1   1 
ATOM   5772  N  NH2   . ARG H 4 86  ? -3.524  -31.536 21.563 1.00 67.41  ? 83   ARG H NH2   1 
ATOM   5773  N  N     . SER H 4 87  ? -9.328  -25.960 18.670 1.00 57.47  ? 84   SER H N     1 
ATOM   5774  C  CA    . SER H 4 87  ? -10.468 -25.292 18.052 1.00 57.55  ? 84   SER H CA    1 
ATOM   5775  C  C     . SER H 4 87  ? -11.789 -26.044 18.245 1.00 57.44  ? 84   SER H C     1 
ATOM   5776  O  O     . SER H 4 87  ? -12.860 -25.488 17.982 1.00 57.62  ? 84   SER H O     1 
ATOM   5777  C  CB    . SER H 4 87  ? -10.205 -25.089 16.557 1.00 57.67  ? 84   SER H CB    1 
ATOM   5778  O  OG    . SER H 4 87  ? -9.067  -24.271 16.327 1.00 58.21  ? 84   SER H OG    1 
ATOM   5779  N  N     . THR H 4 88  ? -11.715 -27.294 18.713 1.00 56.98  ? 85   THR H N     1 
ATOM   5780  C  CA    . THR H 4 88  ? -12.859 -28.213 18.649 1.00 56.28  ? 85   THR H CA    1 
ATOM   5781  C  C     . THR H 4 88  ? -13.277 -28.852 19.981 1.00 55.83  ? 85   THR H C     1 
ATOM   5782  O  O     . THR H 4 88  ? -12.447 -29.412 20.694 1.00 55.98  ? 85   THR H O     1 
ATOM   5783  C  CB    . THR H 4 88  ? -12.577 -29.361 17.663 1.00 56.14  ? 85   THR H CB    1 
ATOM   5784  O  OG1   . THR H 4 88  ? -11.685 -28.914 16.636 1.00 56.53  ? 85   THR H OG1   1 
ATOM   5785  C  CG2   . THR H 4 88  ? -13.862 -29.849 17.035 1.00 56.34  ? 85   THR H CG2   1 
ATOM   5786  N  N     . ILE H 4 89  ? -14.570 -28.778 20.291 1.00 55.09  ? 86   ILE H N     1 
ATOM   5787  C  CA    . ILE H 4 89  ? -15.166 -29.559 21.362 1.00 54.62  ? 86   ILE H CA    1 
ATOM   5788  C  C     . ILE H 4 89  ? -15.549 -30.937 20.806 1.00 54.84  ? 86   ILE H C     1 
ATOM   5789  O  O     . ILE H 4 89  ? -16.537 -31.075 20.074 1.00 54.96  ? 86   ILE H O     1 
ATOM   5790  C  CB    . ILE H 4 89  ? -16.400 -28.846 21.970 1.00 54.51  ? 86   ILE H CB    1 
ATOM   5791  C  CG1   . ILE H 4 89  ? -15.955 -27.607 22.755 1.00 54.22  ? 86   ILE H CG1   1 
ATOM   5792  C  CG2   . ILE H 4 89  ? -17.187 -29.785 22.893 1.00 54.23  ? 86   ILE H CG2   1 
ATOM   5793  C  CD1   . ILE H 4 89  ? -17.075 -26.769 23.304 1.00 51.81  ? 86   ILE H CD1   1 
ATOM   5794  N  N     . THR H 4 90  ? -14.751 -31.950 21.138 1.00 54.58  ? 87   THR H N     1 
ATOM   5795  C  CA    . THR H 4 90  ? -15.003 -33.299 20.654 1.00 54.37  ? 87   THR H CA    1 
ATOM   5796  C  C     . THR H 4 90  ? -15.610 -34.108 21.778 1.00 54.27  ? 87   THR H C     1 
ATOM   5797  O  O     . THR H 4 90  ? -15.743 -33.609 22.912 1.00 54.52  ? 87   THR H O     1 
ATOM   5798  C  CB    . THR H 4 90  ? -13.711 -34.031 20.235 1.00 54.48  ? 87   THR H CB    1 
ATOM   5799  O  OG1   . THR H 4 90  ? -13.055 -34.532 21.409 1.00 55.06  ? 87   THR H OG1   1 
ATOM   5800  C  CG2   . THR H 4 90  ? -12.769 -33.124 19.456 1.00 53.81  ? 87   THR H CG2   1 
ATOM   5801  N  N     . SER H 4 91  ? -15.942 -35.364 21.466 1.00 53.42  ? 88   SER H N     1 
ATOM   5802  C  CA    . SER H 4 91  ? -16.460 -36.303 22.444 1.00 52.66  ? 88   SER H CA    1 
ATOM   5803  C  C     . SER H 4 91  ? -15.432 -36.516 23.556 1.00 52.07  ? 88   SER H C     1 
ATOM   5804  O  O     . SER H 4 91  ? -15.792 -36.768 24.705 1.00 51.87  ? 88   SER H O     1 
ATOM   5805  C  CB    . SER H 4 91  ? -16.828 -37.629 21.775 1.00 52.81  ? 88   SER H CB    1 
ATOM   5806  O  OG    . SER H 4 91  ? -15.685 -38.244 21.192 1.00 53.80  ? 88   SER H OG    1 
ATOM   5807  N  N     . ARG H 4 92  ? -14.152 -36.388 23.221 1.00 51.33  ? 89   ARG H N     1 
ATOM   5808  C  CA    . ARG H 4 92  ? -13.115 -36.518 24.233 1.00 50.89  ? 89   ARG H CA    1 
ATOM   5809  C  C     . ARG H 4 92  ? -13.274 -35.439 25.315 1.00 50.55  ? 89   ARG H C     1 
ATOM   5810  O  O     . ARG H 4 92  ? -13.238 -35.735 26.515 1.00 50.26  ? 89   ARG H O     1 
ATOM   5811  C  CB    . ARG H 4 92  ? -11.718 -36.482 23.606 1.00 50.81  ? 89   ARG H CB    1 
ATOM   5812  C  CG    . ARG H 4 92  ? -10.654 -36.878 24.577 1.00 51.27  ? 89   ARG H CG    1 
ATOM   5813  C  CD    . ARG H 4 92  ? -9.344  -37.197 23.920 1.00 53.91  ? 89   ARG H CD    1 
ATOM   5814  N  NE    . ARG H 4 92  ? -8.473  -37.832 24.905 1.00 56.04  ? 89   ARG H NE    1 
ATOM   5815  C  CZ    . ARG H 4 92  ? -7.652  -37.174 25.719 1.00 57.28  ? 89   ARG H CZ    1 
ATOM   5816  N  NH1   . ARG H 4 92  ? -7.569  -35.850 25.652 1.00 56.54  ? 89   ARG H NH1   1 
ATOM   5817  N  NH2   . ARG H 4 92  ? -6.916  -37.846 26.603 1.00 58.46  ? 89   ARG H NH2   1 
ATOM   5818  N  N     . GLU H 4 93  ? -13.471 -34.197 24.872 1.00 49.99  ? 90   GLU H N     1 
ATOM   5819  C  CA    . GLU H 4 93  ? -13.729 -33.083 25.769 1.00 49.46  ? 90   GLU H CA    1 
ATOM   5820  C  C     . GLU H 4 93  ? -15.009 -33.283 26.586 1.00 48.78  ? 90   GLU H C     1 
ATOM   5821  O  O     . GLU H 4 93  ? -14.980 -33.182 27.803 1.00 48.78  ? 90   GLU H O     1 
ATOM   5822  C  CB    . GLU H 4 93  ? -13.749 -31.759 24.997 1.00 49.67  ? 90   GLU H CB    1 
ATOM   5823  C  CG    . GLU H 4 93  ? -12.356 -31.214 24.644 1.00 50.85  ? 90   GLU H CG    1 
ATOM   5824  C  CD    . GLU H 4 93  ? -11.644 -31.985 23.524 1.00 53.12  ? 90   GLU H CD    1 
ATOM   5825  O  OE1   . GLU H 4 93  ? -12.257 -32.218 22.461 1.00 54.25  ? 90   GLU H OE1   1 
ATOM   5826  O  OE2   . GLU H 4 93  ? -10.460 -32.345 23.699 1.00 53.78  ? 90   GLU H OE2   1 
ATOM   5827  N  N     . ILE H 4 94  ? -16.121 -33.603 25.936 1.00 48.20  ? 91   ILE H N     1 
ATOM   5828  C  CA    . ILE H 4 94  ? -17.359 -33.869 26.680 1.00 47.97  ? 91   ILE H CA    1 
ATOM   5829  C  C     . ILE H 4 94  ? -17.182 -34.931 27.771 1.00 47.72  ? 91   ILE H C     1 
ATOM   5830  O  O     . ILE H 4 94  ? -17.701 -34.778 28.878 1.00 47.98  ? 91   ILE H O     1 
ATOM   5831  C  CB    . ILE H 4 94  ? -18.533 -34.276 25.755 1.00 48.10  ? 91   ILE H CB    1 
ATOM   5832  C  CG1   . ILE H 4 94  ? -18.941 -33.105 24.849 1.00 48.06  ? 91   ILE H CG1   1 
ATOM   5833  C  CG2   . ILE H 4 94  ? -19.732 -34.800 26.578 1.00 47.40  ? 91   ILE H CG2   1 
ATOM   5834  C  CD1   . ILE H 4 94  ? -19.663 -31.981 25.549 1.00 46.33  ? 91   ILE H CD1   1 
ATOM   5835  N  N     . GLN H 4 95  ? -16.450 -36.000 27.457 1.00 47.15  ? 92   GLN H N     1 
ATOM   5836  C  CA    . GLN H 4 95  ? -16.198 -37.075 28.419 1.00 46.48  ? 92   GLN H CA    1 
ATOM   5837  C  C     . GLN H 4 95  ? -15.414 -36.626 29.656 1.00 45.65  ? 92   GLN H C     1 
ATOM   5838  O  O     . GLN H 4 95  ? -15.872 -36.836 30.780 1.00 45.36  ? 92   GLN H O     1 
ATOM   5839  C  CB    . GLN H 4 95  ? -15.491 -38.247 27.751 1.00 46.87  ? 92   GLN H CB    1 
ATOM   5840  C  CG    . GLN H 4 95  ? -15.354 -39.465 28.644 1.00 47.39  ? 92   GLN H CG    1 
ATOM   5841  C  CD    . GLN H 4 95  ? -14.790 -40.636 27.904 1.00 47.70  ? 92   GLN H CD    1 
ATOM   5842  O  OE1   . GLN H 4 95  ? -13.577 -40.734 27.696 1.00 47.76  ? 92   GLN H OE1   1 
ATOM   5843  N  NE2   . GLN H 4 95  ? -15.665 -41.535 27.488 1.00 48.11  ? 92   GLN H NE2   1 
ATOM   5844  N  N     . THR H 4 96  ? -14.250 -36.012 29.445 1.00 44.73  ? 93   THR H N     1 
ATOM   5845  C  CA    . THR H 4 96  ? -13.489 -35.422 30.539 1.00 44.37  ? 93   THR H CA    1 
ATOM   5846  C  C     . THR H 4 96  ? -14.378 -34.454 31.324 1.00 44.28  ? 93   THR H C     1 
ATOM   5847  O  O     . THR H 4 96  ? -14.375 -34.446 32.563 1.00 44.20  ? 93   THR H O     1 
ATOM   5848  C  CB    . THR H 4 96  ? -12.256 -34.669 30.037 1.00 44.26  ? 93   THR H CB    1 
ATOM   5849  O  OG1   . THR H 4 96  ? -11.543 -35.477 29.100 1.00 44.93  ? 93   THR H OG1   1 
ATOM   5850  C  CG2   . THR H 4 96  ? -11.331 -34.331 31.186 1.00 44.15  ? 93   THR H CG2   1 
ATOM   5851  N  N     . ALA H 4 97  ? -15.157 -33.658 30.600 1.00 43.85  ? 94   ALA H N     1 
ATOM   5852  C  CA    . ALA H 4 97  ? -16.060 -32.731 31.238 1.00 43.78  ? 94   ALA H CA    1 
ATOM   5853  C  C     . ALA H 4 97  ? -17.009 -33.471 32.176 1.00 44.03  ? 94   ALA H C     1 
ATOM   5854  O  O     . ALA H 4 97  ? -17.235 -33.030 33.319 1.00 44.48  ? 94   ALA H O     1 
ATOM   5855  C  CB    . ALA H 4 97  ? -16.831 -31.959 30.212 1.00 43.68  ? 94   ALA H CB    1 
ATOM   5856  N  N     . VAL H 4 98  ? -17.558 -34.590 31.698 1.00 43.63  ? 95   VAL H N     1 
ATOM   5857  C  CA    . VAL H 4 98  ? -18.502 -35.376 32.482 1.00 43.21  ? 95   VAL H CA    1 
ATOM   5858  C  C     . VAL H 4 98  ? -17.799 -35.919 33.727 1.00 43.20  ? 95   VAL H C     1 
ATOM   5859  O  O     . VAL H 4 98  ? -18.377 -35.936 34.820 1.00 42.65  ? 95   VAL H O     1 
ATOM   5860  C  CB    . VAL H 4 98  ? -19.136 -36.516 31.626 1.00 43.38  ? 95   VAL H CB    1 
ATOM   5861  C  CG1   . VAL H 4 98  ? -19.731 -37.620 32.502 1.00 42.97  ? 95   VAL H CG1   1 
ATOM   5862  C  CG2   . VAL H 4 98  ? -20.205 -35.956 30.683 1.00 42.99  ? 95   VAL H CG2   1 
ATOM   5863  N  N     . ARG H 4 99  ? -16.542 -36.335 33.548 1.00 43.31  ? 96   ARG H N     1 
ATOM   5864  C  CA    . ARG H 4 99  ? -15.739 -36.906 34.627 1.00 43.65  ? 96   ARG H CA    1 
ATOM   5865  C  C     . ARG H 4 99  ? -15.504 -35.895 35.732 1.00 43.09  ? 96   ARG H C     1 
ATOM   5866  O  O     . ARG H 4 99  ? -15.585 -36.231 36.914 1.00 43.10  ? 96   ARG H O     1 
ATOM   5867  C  CB    . ARG H 4 99  ? -14.395 -37.423 34.109 1.00 43.94  ? 96   ARG H CB    1 
ATOM   5868  C  CG    . ARG H 4 99  ? -14.436 -38.861 33.621 1.00 47.12  ? 96   ARG H CG    1 
ATOM   5869  C  CD    . ARG H 4 99  ? -13.108 -39.607 33.840 1.00 51.68  ? 96   ARG H CD    1 
ATOM   5870  N  NE    . ARG H 4 99  ? -13.172 -40.958 33.280 1.00 56.20  ? 96   ARG H NE    1 
ATOM   5871  C  CZ    . ARG H 4 99  ? -12.756 -41.288 32.052 1.00 60.16  ? 96   ARG H CZ    1 
ATOM   5872  N  NH1   . ARG H 4 99  ? -12.225 -40.371 31.241 1.00 61.23  ? 96   ARG H NH1   1 
ATOM   5873  N  NH2   . ARG H 4 99  ? -12.867 -42.545 31.625 1.00 61.50  ? 96   ARG H NH2   1 
ATOM   5874  N  N     . LEU H 4 100 ? -15.225 -34.661 35.325 1.00 42.64  ? 97   LEU H N     1 
ATOM   5875  C  CA    . LEU H 4 100 ? -14.950 -33.561 36.239 1.00 42.25  ? 97   LEU H CA    1 
ATOM   5876  C  C     . LEU H 4 100 ? -16.175 -33.116 37.036 1.00 42.55  ? 97   LEU H C     1 
ATOM   5877  O  O     . LEU H 4 100 ? -16.055 -32.769 38.206 1.00 42.45  ? 97   LEU H O     1 
ATOM   5878  C  CB    . LEU H 4 100 ? -14.373 -32.376 35.468 1.00 41.67  ? 97   LEU H CB    1 
ATOM   5879  C  CG    . LEU H 4 100 ? -12.945 -32.508 34.943 1.00 40.77  ? 97   LEU H CG    1 
ATOM   5880  C  CD1   . LEU H 4 100 ? -12.664 -31.399 33.951 1.00 40.00  ? 97   LEU H CD1   1 
ATOM   5881  C  CD2   . LEU H 4 100 ? -11.899 -32.517 36.069 1.00 38.36  ? 97   LEU H CD2   1 
ATOM   5882  N  N     . LEU H 4 101 ? -17.345 -33.154 36.407 1.00 43.07  ? 98   LEU H N     1 
ATOM   5883  C  CA    . LEU H 4 101 ? -18.569 -32.665 37.022 1.00 44.17  ? 98   LEU H CA    1 
ATOM   5884  C  C     . LEU H 4 101 ? -19.398 -33.676 37.796 1.00 44.49  ? 98   LEU H C     1 
ATOM   5885  O  O     . LEU H 4 101 ? -20.026 -33.319 38.798 1.00 44.52  ? 98   LEU H O     1 
ATOM   5886  C  CB    . LEU H 4 101 ? -19.453 -32.006 35.972 1.00 44.55  ? 98   LEU H CB    1 
ATOM   5887  C  CG    . LEU H 4 101 ? -18.960 -30.609 35.601 1.00 46.06  ? 98   LEU H CG    1 
ATOM   5888  C  CD1   . LEU H 4 101 ? -19.358 -30.281 34.171 1.00 48.11  ? 98   LEU H CD1   1 
ATOM   5889  C  CD2   . LEU H 4 101 ? -19.474 -29.561 36.598 1.00 45.29  ? 98   LEU H CD2   1 
ATOM   5890  N  N     . LEU H 4 102 ? -19.420 -34.926 37.338 1.00 44.92  ? 99   LEU H N     1 
ATOM   5891  C  CA    . LEU H 4 102 ? -20.302 -35.919 37.954 1.00 45.22  ? 99   LEU H CA    1 
ATOM   5892  C  C     . LEU H 4 102 ? -19.646 -36.748 39.069 1.00 45.81  ? 99   LEU H C     1 
ATOM   5893  O  O     . LEU H 4 102 ? -18.469 -37.107 38.981 1.00 46.14  ? 99   LEU H O     1 
ATOM   5894  C  CB    . LEU H 4 102 ? -20.946 -36.811 36.896 1.00 44.93  ? 99   LEU H CB    1 
ATOM   5895  C  CG    . LEU H 4 102 ? -21.753 -36.143 35.777 1.00 44.36  ? 99   LEU H CG    1 
ATOM   5896  C  CD1   . LEU H 4 102 ? -22.579 -37.174 35.035 1.00 44.24  ? 99   LEU H CD1   1 
ATOM   5897  C  CD2   . LEU H 4 102 ? -22.652 -35.066 36.299 1.00 43.97  ? 99   LEU H CD2   1 
ATOM   5898  N  N     . PRO H 4 103 ? -20.401 -37.002 40.147 1.00 46.20  ? 100  PRO H N     1 
ATOM   5899  C  CA    . PRO H 4 103 ? -20.001 -37.900 41.218 1.00 46.87  ? 100  PRO H CA    1 
ATOM   5900  C  C     . PRO H 4 103 ? -19.752 -39.348 40.748 1.00 47.61  ? 100  PRO H C     1 
ATOM   5901  O  O     . PRO H 4 103 ? -20.565 -39.920 40.013 1.00 47.48  ? 100  PRO H O     1 
ATOM   5902  C  CB    . PRO H 4 103 ? -21.199 -37.863 42.182 1.00 46.71  ? 100  PRO H CB    1 
ATOM   5903  C  CG    . PRO H 4 103 ? -21.945 -36.647 41.854 1.00 46.43  ? 100  PRO H CG    1 
ATOM   5904  C  CD    . PRO H 4 103 ? -21.713 -36.383 40.404 1.00 46.45  ? 100  PRO H CD    1 
ATOM   5905  N  N     . GLY H 4 104 ? -18.632 -39.912 41.205 1.00 48.43  ? 101  GLY H N     1 
ATOM   5906  C  CA    . GLY H 4 104 ? -18.215 -41.294 40.935 1.00 49.69  ? 101  GLY H CA    1 
ATOM   5907  C  C     . GLY H 4 104 ? -19.122 -42.203 40.120 1.00 50.32  ? 101  GLY H C     1 
ATOM   5908  O  O     . GLY H 4 104 ? -18.851 -42.478 38.950 1.00 50.11  ? 101  GLY H O     1 
ATOM   5909  N  N     . GLU H 4 105 ? -20.197 -42.672 40.740 1.00 51.05  ? 102  GLU H N     1 
ATOM   5910  C  CA    . GLU H 4 105 ? -21.047 -43.670 40.114 1.00 52.12  ? 102  GLU H CA    1 
ATOM   5911  C  C     . GLU H 4 105 ? -21.806 -43.068 38.947 1.00 52.21  ? 102  GLU H C     1 
ATOM   5912  O  O     . GLU H 4 105 ? -21.914 -43.679 37.888 1.00 52.80  ? 102  GLU H O     1 
ATOM   5913  C  CB    . GLU H 4 105 ? -22.013 -44.280 41.135 1.00 52.52  ? 102  GLU H CB    1 
ATOM   5914  C  CG    . GLU H 4 105 ? -22.362 -45.751 40.887 1.00 54.73  ? 102  GLU H CG    1 
ATOM   5915  C  CD    . GLU H 4 105 ? -21.157 -46.692 40.985 1.00 57.66  ? 102  GLU H CD    1 
ATOM   5916  O  OE1   . GLU H 4 105 ? -21.256 -47.808 40.433 1.00 58.49  ? 102  GLU H OE1   1 
ATOM   5917  O  OE2   . GLU H 4 105 ? -20.122 -46.325 41.604 1.00 58.79  ? 102  GLU H OE2   1 
ATOM   5918  N  N     . LEU H 4 106 ? -22.310 -41.857 39.135 1.00 52.34  ? 103  LEU H N     1 
ATOM   5919  C  CA    . LEU H 4 106 ? -23.060 -41.166 38.095 1.00 52.09  ? 103  LEU H CA    1 
ATOM   5920  C  C     . LEU H 4 106 ? -22.162 -40.920 36.883 1.00 52.00  ? 103  LEU H C     1 
ATOM   5921  O  O     . LEU H 4 106 ? -22.560 -41.162 35.737 1.00 51.82  ? 103  LEU H O     1 
ATOM   5922  C  CB    . LEU H 4 106 ? -23.605 -39.851 38.650 1.00 51.96  ? 103  LEU H CB    1 
ATOM   5923  C  CG    . LEU H 4 106 ? -25.096 -39.566 38.482 1.00 51.92  ? 103  LEU H CG    1 
ATOM   5924  C  CD1   . LEU H 4 106 ? -25.940 -40.832 38.541 1.00 52.04  ? 103  LEU H CD1   1 
ATOM   5925  C  CD2   . LEU H 4 106 ? -25.560 -38.569 39.534 1.00 51.56  ? 103  LEU H CD2   1 
ATOM   5926  N  N     . ALA H 4 107 ? -20.942 -40.462 37.152 1.00 51.90  ? 104  ALA H N     1 
ATOM   5927  C  CA    . ALA H 4 107 ? -19.947 -40.254 36.114 1.00 51.96  ? 104  ALA H CA    1 
ATOM   5928  C  C     . ALA H 4 107 ? -19.767 -41.534 35.319 1.00 52.20  ? 104  ALA H C     1 
ATOM   5929  O  O     . ALA H 4 107 ? -19.977 -41.557 34.099 1.00 52.31  ? 104  ALA H O     1 
ATOM   5930  C  CB    . ALA H 4 107 ? -18.630 -39.818 36.724 1.00 51.75  ? 104  ALA H CB    1 
ATOM   5931  N  N     . LYS H 4 108 ? -19.411 -42.600 36.031 1.00 52.37  ? 105  LYS H N     1 
ATOM   5932  C  CA    . LYS H 4 108 ? -19.122 -43.891 35.434 1.00 52.57  ? 105  LYS H CA    1 
ATOM   5933  C  C     . LYS H 4 108 ? -20.160 -44.305 34.381 1.00 52.51  ? 105  LYS H C     1 
ATOM   5934  O  O     . LYS H 4 108 ? -19.807 -44.581 33.232 1.00 52.31  ? 105  LYS H O     1 
ATOM   5935  C  CB    . LYS H 4 108 ? -19.029 -44.940 36.524 1.00 52.73  ? 105  LYS H CB    1 
ATOM   5936  C  CG    . LYS H 4 108 ? -18.066 -46.044 36.212 1.00 54.49  ? 105  LYS H CG    1 
ATOM   5937  C  CD    . LYS H 4 108 ? -18.710 -47.398 36.431 1.00 56.81  ? 105  LYS H CD    1 
ATOM   5938  C  CE    . LYS H 4 108 ? -18.229 -48.386 35.377 1.00 59.01  ? 105  LYS H CE    1 
ATOM   5939  N  NZ    . LYS H 4 108 ? -19.210 -49.502 35.215 1.00 61.85  ? 105  LYS H NZ    1 
ATOM   5940  N  N     . HIS H 4 109 ? -21.434 -44.322 34.769 1.00 52.60  ? 106  HIS H N     1 
ATOM   5941  C  CA    . HIS H 4 109 ? -22.517 -44.689 33.858 1.00 52.98  ? 106  HIS H CA    1 
ATOM   5942  C  C     . HIS H 4 109 ? -22.662 -43.756 32.664 1.00 53.14  ? 106  HIS H C     1 
ATOM   5943  O  O     . HIS H 4 109 ? -22.812 -44.217 31.531 1.00 52.97  ? 106  HIS H O     1 
ATOM   5944  C  CB    . HIS H 4 109 ? -23.835 -44.732 34.598 1.00 52.99  ? 106  HIS H CB    1 
ATOM   5945  C  CG    . HIS H 4 109 ? -24.024 -45.958 35.426 1.00 54.48  ? 106  HIS H CG    1 
ATOM   5946  N  ND1   . HIS H 4 109 ? -25.040 -46.861 35.192 1.00 55.64  ? 106  HIS H ND1   1 
ATOM   5947  C  CD2   . HIS H 4 109 ? -23.327 -46.434 36.486 1.00 55.31  ? 106  HIS H CD2   1 
ATOM   5948  C  CE1   . HIS H 4 109 ? -24.966 -47.836 36.082 1.00 56.90  ? 106  HIS H CE1   1 
ATOM   5949  N  NE2   . HIS H 4 109 ? -23.932 -47.604 36.873 1.00 56.61  ? 106  HIS H NE2   1 
ATOM   5950  N  N     . ALA H 4 110 ? -22.627 -42.447 32.925 1.00 53.39  ? 107  ALA H N     1 
ATOM   5951  C  CA    . ALA H 4 110 ? -22.757 -41.446 31.873 1.00 53.18  ? 107  ALA H CA    1 
ATOM   5952  C  C     . ALA H 4 110 ? -21.689 -41.693 30.838 1.00 53.44  ? 107  ALA H C     1 
ATOM   5953  O  O     . ALA H 4 110 ? -21.937 -41.589 29.632 1.00 53.45  ? 107  ALA H O     1 
ATOM   5954  C  CB    . ALA H 4 110 ? -22.627 -40.065 32.436 1.00 53.15  ? 107  ALA H CB    1 
ATOM   5955  N  N     . VAL H 4 111 ? -20.498 -42.045 31.307 1.00 53.66  ? 108  VAL H N     1 
ATOM   5956  C  CA    . VAL H 4 111 ? -19.422 -42.345 30.381 1.00 54.07  ? 108  VAL H CA    1 
ATOM   5957  C  C     . VAL H 4 111 ? -19.825 -43.537 29.524 1.00 54.73  ? 108  VAL H C     1 
ATOM   5958  O  O     . VAL H 4 111 ? -19.753 -43.468 28.294 1.00 54.90  ? 108  VAL H O     1 
ATOM   5959  C  CB    . VAL H 4 111 ? -18.078 -42.575 31.091 1.00 53.69  ? 108  VAL H CB    1 
ATOM   5960  C  CG1   . VAL H 4 111 ? -17.081 -43.203 30.152 1.00 52.47  ? 108  VAL H CG1   1 
ATOM   5961  C  CG2   . VAL H 4 111 ? -17.550 -41.259 31.608 1.00 53.41  ? 108  VAL H CG2   1 
ATOM   5962  N  N     . SER H 4 112 ? -20.289 -44.603 30.175 1.00 55.11  ? 109  SER H N     1 
ATOM   5963  C  CA    . SER H 4 112 ? -20.598 -45.821 29.471 1.00 55.75  ? 109  SER H CA    1 
ATOM   5964  C  C     . SER H 4 112 ? -21.752 -45.559 28.523 1.00 56.32  ? 109  SER H C     1 
ATOM   5965  O  O     . SER H 4 112 ? -21.747 -46.045 27.399 1.00 56.58  ? 109  SER H O     1 
ATOM   5966  C  CB    . SER H 4 112 ? -20.923 -46.954 30.441 1.00 55.77  ? 109  SER H CB    1 
ATOM   5967  O  OG    . SER H 4 112 ? -22.323 -47.173 30.540 1.00 56.55  ? 109  SER H OG    1 
ATOM   5968  N  N     . GLU H 4 113 ? -22.722 -44.763 28.965 1.00 57.23  ? 110  GLU H N     1 
ATOM   5969  C  CA    . GLU H 4 113 ? -23.891 -44.451 28.140 1.00 57.93  ? 110  GLU H CA    1 
ATOM   5970  C  C     . GLU H 4 113 ? -23.500 -43.650 26.937 1.00 58.41  ? 110  GLU H C     1 
ATOM   5971  O  O     . GLU H 4 113 ? -24.095 -43.800 25.876 1.00 58.61  ? 110  GLU H O     1 
ATOM   5972  C  CB    . GLU H 4 113 ? -24.949 -43.682 28.923 1.00 57.76  ? 110  GLU H CB    1 
ATOM   5973  C  CG    . GLU H 4 113 ? -25.733 -44.524 29.911 1.00 59.16  ? 110  GLU H CG    1 
ATOM   5974  C  CD    . GLU H 4 113 ? -26.368 -45.756 29.288 1.00 60.80  ? 110  GLU H CD    1 
ATOM   5975  O  OE1   . GLU H 4 113 ? -26.649 -45.752 28.064 1.00 61.91  ? 110  GLU H OE1   1 
ATOM   5976  O  OE2   . GLU H 4 113 ? -26.586 -46.734 30.033 1.00 61.51  ? 110  GLU H OE2   1 
ATOM   5977  N  N     . GLY H 4 114 ? -22.494 -42.803 27.120 1.00 59.22  ? 111  GLY H N     1 
ATOM   5978  C  CA    . GLY H 4 114 ? -22.035 -41.886 26.092 1.00 60.28  ? 111  GLY H CA    1 
ATOM   5979  C  C     . GLY H 4 114 ? -21.062 -42.495 25.111 1.00 61.06  ? 111  GLY H C     1 
ATOM   5980  O  O     . GLY H 4 114 ? -20.954 -42.019 23.993 1.00 61.22  ? 111  GLY H O     1 
ATOM   5981  N  N     . THR H 4 115 ? -20.338 -43.533 25.523 1.00 61.98  ? 112  THR H N     1 
ATOM   5982  C  CA    . THR H 4 115 ? -19.482 -44.277 24.590 1.00 62.86  ? 112  THR H CA    1 
ATOM   5983  C  C     . THR H 4 115 ? -20.363 -45.176 23.730 1.00 63.24  ? 112  THR H C     1 
ATOM   5984  O  O     . THR H 4 115 ? -20.091 -45.382 22.548 1.00 63.17  ? 112  THR H O     1 
ATOM   5985  C  CB    . THR H 4 115 ? -18.413 -45.126 25.311 1.00 62.74  ? 112  THR H CB    1 
ATOM   5986  O  OG1   . THR H 4 115 ? -17.650 -44.287 26.184 1.00 64.02  ? 112  THR H OG1   1 
ATOM   5987  C  CG2   . THR H 4 115 ? -17.461 -45.756 24.313 1.00 62.73  ? 112  THR H CG2   1 
ATOM   5988  N  N     . LYS H 4 116 ? -21.430 -45.685 24.334 1.00 63.85  ? 113  LYS H N     1 
ATOM   5989  C  CA    . LYS H 4 116 ? -22.344 -46.579 23.655 1.00 64.69  ? 113  LYS H CA    1 
ATOM   5990  C  C     . LYS H 4 116 ? -22.978 -45.865 22.466 1.00 65.39  ? 113  LYS H C     1 
ATOM   5991  O  O     . LYS H 4 116 ? -22.970 -46.378 21.338 1.00 65.45  ? 113  LYS H O     1 
ATOM   5992  C  CB    . LYS H 4 116 ? -23.412 -47.071 24.632 1.00 64.58  ? 113  LYS H CB    1 
ATOM   5993  C  CG    . LYS H 4 116 ? -24.226 -48.263 24.152 1.00 64.87  ? 113  LYS H CG    1 
ATOM   5994  C  CD    . LYS H 4 116 ? -24.570 -49.193 25.313 1.00 65.17  ? 113  LYS H CD    1 
ATOM   5995  C  CE    . LYS H 4 116 ? -25.628 -48.607 26.241 1.00 64.43  ? 113  LYS H CE    1 
ATOM   5996  N  NZ    . LYS H 4 116 ? -26.983 -48.763 25.653 1.00 64.21  ? 113  LYS H NZ    1 
ATOM   5997  N  N     . ALA H 4 117 ? -23.496 -44.667 22.722 1.00 66.14  ? 114  ALA H N     1 
ATOM   5998  C  CA    . ALA H 4 117 ? -24.220 -43.898 21.712 1.00 66.82  ? 114  ALA H CA    1 
ATOM   5999  C  C     . ALA H 4 117 ? -23.348 -43.509 20.512 1.00 67.36  ? 114  ALA H C     1 
ATOM   6000  O  O     . ALA H 4 117 ? -23.843 -43.436 19.385 1.00 67.16  ? 114  ALA H O     1 
ATOM   6001  C  CB    . ALA H 4 117 ? -24.852 -42.669 22.344 1.00 66.54  ? 114  ALA H CB    1 
ATOM   6002  N  N     . VAL H 4 118 ? -22.062 -43.261 20.764 1.00 68.13  ? 115  VAL H N     1 
ATOM   6003  C  CA    . VAL H 4 118 ? -21.118 -42.887 19.712 1.00 69.08  ? 115  VAL H CA    1 
ATOM   6004  C  C     . VAL H 4 118 ? -20.749 -44.114 18.878 1.00 69.90  ? 115  VAL H C     1 
ATOM   6005  O  O     . VAL H 4 118 ? -20.680 -44.042 17.650 1.00 70.17  ? 115  VAL H O     1 
ATOM   6006  C  CB    . VAL H 4 118 ? -19.846 -42.208 20.289 1.00 69.13  ? 115  VAL H CB    1 
ATOM   6007  C  CG1   . VAL H 4 118 ? -18.811 -41.932 19.193 1.00 68.95  ? 115  VAL H CG1   1 
ATOM   6008  C  CG2   . VAL H 4 118 ? -20.206 -40.917 21.001 1.00 68.92  ? 115  VAL H CG2   1 
ATOM   6009  N  N     . THR H 4 119 ? -20.520 -45.235 19.555 1.00 70.80  ? 116  THR H N     1 
ATOM   6010  C  CA    . THR H 4 119 ? -20.318 -46.516 18.893 1.00 71.71  ? 116  THR H CA    1 
ATOM   6011  C  C     . THR H 4 119 ? -21.513 -46.820 17.987 1.00 72.34  ? 116  THR H C     1 
ATOM   6012  O  O     . THR H 4 119 ? -21.358 -46.908 16.770 1.00 72.69  ? 116  THR H O     1 
ATOM   6013  C  CB    . THR H 4 119 ? -20.079 -47.628 19.930 1.00 71.73  ? 116  THR H CB    1 
ATOM   6014  O  OG1   . THR H 4 119 ? -18.753 -47.496 20.459 1.00 71.91  ? 116  THR H OG1   1 
ATOM   6015  C  CG2   . THR H 4 119 ? -20.238 -49.015 19.317 1.00 72.43  ? 116  THR H CG2   1 
ATOM   6016  N  N     . LYS H 4 120 ? -22.700 -46.927 18.580 1.00 73.17  ? 117  LYS H N     1 
ATOM   6017  C  CA    . LYS H 4 120 ? -23.955 -47.154 17.851 1.00 74.10  ? 117  LYS H CA    1 
ATOM   6018  C  C     . LYS H 4 120 ? -24.127 -46.207 16.658 1.00 74.67  ? 117  LYS H C     1 
ATOM   6019  O  O     . LYS H 4 120 ? -24.762 -46.554 15.668 1.00 74.73  ? 117  LYS H O     1 
ATOM   6020  C  CB    . LYS H 4 120 ? -25.138 -46.994 18.809 1.00 74.04  ? 117  LYS H CB    1 
ATOM   6021  C  CG    . LYS H 4 120 ? -26.140 -48.133 18.800 1.00 74.72  ? 117  LYS H CG    1 
ATOM   6022  C  CD    . LYS H 4 120 ? -26.465 -48.555 20.242 1.00 75.78  ? 117  LYS H CD    1 
ATOM   6023  C  CE    . LYS H 4 120 ? -27.431 -49.732 20.315 1.00 76.26  ? 117  LYS H CE    1 
ATOM   6024  N  NZ    . LYS H 4 120 ? -28.840 -49.286 20.150 1.00 76.64  ? 117  LYS H NZ    1 
ATOM   6025  N  N     . TYR H 4 121 ? -23.554 -45.014 16.760 1.00 75.69  ? 118  TYR H N     1 
ATOM   6026  C  CA    . TYR H 4 121 ? -23.675 -44.013 15.707 1.00 76.88  ? 118  TYR H CA    1 
ATOM   6027  C  C     . TYR H 4 121 ? -22.669 -44.263 14.575 1.00 77.87  ? 118  TYR H C     1 
ATOM   6028  O  O     . TYR H 4 121 ? -23.064 -44.293 13.402 1.00 78.02  ? 118  TYR H O     1 
ATOM   6029  C  CB    . TYR H 4 121 ? -23.539 -42.598 16.290 1.00 76.60  ? 118  TYR H CB    1 
ATOM   6030  C  CG    . TYR H 4 121 ? -23.696 -41.451 15.298 1.00 76.31  ? 118  TYR H CG    1 
ATOM   6031  C  CD1   . TYR H 4 121 ? -24.954 -41.070 14.829 1.00 76.37  ? 118  TYR H CD1   1 
ATOM   6032  C  CD2   . TYR H 4 121 ? -22.583 -40.723 14.858 1.00 75.54  ? 118  TYR H CD2   1 
ATOM   6033  C  CE1   . TYR H 4 121 ? -25.097 -40.008 13.924 1.00 76.15  ? 118  TYR H CE1   1 
ATOM   6034  C  CE2   . TYR H 4 121 ? -22.714 -39.664 13.965 1.00 74.98  ? 118  TYR H CE2   1 
ATOM   6035  C  CZ    . TYR H 4 121 ? -23.972 -39.313 13.500 1.00 75.80  ? 118  TYR H CZ    1 
ATOM   6036  O  OH    . TYR H 4 121 ? -24.109 -38.268 12.613 1.00 75.92  ? 118  TYR H OH    1 
ATOM   6037  N  N     . THR H 4 122 ? -21.389 -44.445 14.916 1.00 78.86  ? 119  THR H N     1 
ATOM   6038  C  CA    . THR H 4 122 ? -20.364 -44.715 13.904 1.00 80.13  ? 119  THR H CA    1 
ATOM   6039  C  C     . THR H 4 122 ? -20.723 -45.992 13.149 1.00 81.13  ? 119  THR H C     1 
ATOM   6040  O  O     . THR H 4 122 ? -20.904 -45.973 11.926 1.00 81.20  ? 119  THR H O     1 
ATOM   6041  C  CB    . THR H 4 122 ? -18.946 -44.836 14.501 1.00 80.09  ? 119  THR H CB    1 
ATOM   6042  O  OG1   . THR H 4 122 ? -18.627 -43.650 15.233 1.00 79.85  ? 119  THR H OG1   1 
ATOM   6043  C  CG2   . THR H 4 122 ? -17.906 -45.026 13.393 1.00 80.29  ? 119  THR H CG2   1 
ATOM   6044  N  N     . SER H 4 123 ? -20.839 -47.093 13.887 1.00 82.32  ? 120  SER H N     1 
ATOM   6045  C  CA    . SER H 4 123 ? -21.349 -48.337 13.330 1.00 83.44  ? 120  SER H CA    1 
ATOM   6046  C  C     . SER H 4 123 ? -22.823 -48.129 12.958 1.00 84.33  ? 120  SER H C     1 
ATOM   6047  O  O     . SER H 4 123 ? -23.729 -48.452 13.735 1.00 84.45  ? 120  SER H O     1 
ATOM   6048  C  CB    . SER H 4 123 ? -21.176 -49.488 14.329 1.00 83.35  ? 120  SER H CB    1 
ATOM   6049  O  OG    . SER H 4 123 ? -19.880 -49.477 14.909 1.00 83.30  ? 120  SER H OG    1 
ATOM   6050  N  N     . ALA H 4 124 ? -23.030 -47.547 11.773 1.00 85.37  ? 121  ALA H N     1 
ATOM   6051  C  CA    . ALA H 4 124 ? -24.349 -47.253 11.189 1.00 86.47  ? 121  ALA H CA    1 
ATOM   6052  C  C     . ALA H 4 124 ? -24.156 -46.359 9.960  1.00 87.24  ? 121  ALA H C     1 
ATOM   6053  O  O     . ALA H 4 124 ? -23.385 -45.390 10.005 1.00 87.35  ? 121  ALA H O     1 
ATOM   6054  C  CB    . ALA H 4 124 ? -25.283 -46.574 12.207 1.00 86.35  ? 121  ALA H CB    1 
ATOM   6055  N  N     . LYS H 4 125 ? -24.849 -46.683 8.868  1.00 88.04  ? 122  LYS H N     1 
ATOM   6056  C  CA    . LYS H 4 125 ? -24.668 -45.948 7.605  1.00 88.81  ? 122  LYS H CA    1 
ATOM   6057  C  C     . LYS H 4 125 ? -25.492 -44.650 7.510  1.00 88.94  ? 122  LYS H C     1 
ATOM   6058  O  O     . LYS H 4 125 ? -25.228 -43.694 8.248  1.00 89.02  ? 122  LYS H O     1 
ATOM   6059  C  CB    . LYS H 4 125 ? -24.887 -46.855 6.378  1.00 88.92  ? 122  LYS H CB    1 
ATOM   6060  C  CG    . LYS H 4 125 ? -26.183 -47.660 6.366  1.00 89.23  ? 122  LYS H CG    1 
ATOM   6061  C  CD    . LYS H 4 125 ? -26.396 -48.297 4.994  1.00 89.26  ? 122  LYS H CD    1 
ATOM   6062  C  CE    . LYS H 4 125 ? -27.712 -49.060 4.932  1.00 89.81  ? 122  LYS H CE    1 
ATOM   6063  N  NZ    . LYS H 4 125 ? -28.217 -49.170 3.535  1.00 89.54  ? 122  LYS H NZ    1 
ATOM   6064  O  OXT   . LYS H 4 125 ? -26.421 -44.512 6.706  1.00 88.94  ? 122  LYS H OXT   1 
ATOM   6065  O  "O5'" . DA  I 5 1   ? 2.496   0.938   94.594 1.00 136.70 ? -72  DA  I "O5'" 1 
ATOM   6066  C  "C5'" . DA  I 5 1   ? 3.623   0.778   93.733 1.00 136.59 ? -72  DA  I "C5'" 1 
ATOM   6067  C  "C4'" . DA  I 5 1   ? 4.668   -0.144  94.341 1.00 136.43 ? -72  DA  I "C4'" 1 
ATOM   6068  O  "O4'" . DA  I 5 1   ? 4.036   -1.393  94.741 1.00 136.62 ? -72  DA  I "O4'" 1 
ATOM   6069  C  "C3'" . DA  I 5 1   ? 5.820   -0.497  93.398 1.00 136.10 ? -72  DA  I "C3'" 1 
ATOM   6070  O  "O3'" . DA  I 5 1   ? 7.102   -0.182  93.988 1.00 135.39 ? -72  DA  I "O3'" 1 
ATOM   6071  C  "C2'" . DA  I 5 1   ? 5.617   -1.988  93.152 1.00 136.52 ? -72  DA  I "C2'" 1 
ATOM   6072  C  "C1'" . DA  I 5 1   ? 4.873   -2.472  94.388 1.00 137.13 ? -72  DA  I "C1'" 1 
ATOM   6073  N  N9    . DA  I 5 1   ? 4.101   -3.669  94.051 1.00 137.40 ? -72  DA  I N9    1 
ATOM   6074  C  C8    . DA  I 5 1   ? 2.845   -3.722  93.509 1.00 137.51 ? -72  DA  I C8    1 
ATOM   6075  N  N7    . DA  I 5 1   ? 2.407   -4.939  93.283 1.00 137.57 ? -72  DA  I N7    1 
ATOM   6076  C  C5    . DA  I 5 1   ? 3.452   -5.748  93.693 1.00 137.56 ? -72  DA  I C5    1 
ATOM   6077  C  C6    . DA  I 5 1   ? 3.615   -7.153  93.714 1.00 137.43 ? -72  DA  I C6    1 
ATOM   6078  N  N6    . DA  I 5 1   ? 2.679   -8.010  93.290 1.00 137.29 ? -72  DA  I N6    1 
ATOM   6079  N  N1    . DA  I 5 1   ? 4.782   -7.642  94.192 1.00 137.47 ? -72  DA  I N1    1 
ATOM   6080  C  C2    . DA  I 5 1   ? 5.720   -6.781  94.618 1.00 137.48 ? -72  DA  I C2    1 
ATOM   6081  N  N3    . DA  I 5 1   ? 5.680   -5.446  94.648 1.00 137.50 ? -72  DA  I N3    1 
ATOM   6082  C  C4    . DA  I 5 1   ? 4.508   -4.983  94.167 1.00 137.54 ? -72  DA  I C4    1 
ATOM   6083  P  P     . DT  I 5 2   ? 8.470   -0.987  93.697 1.00 134.71 ? -71  DT  I P     1 
ATOM   6084  O  OP1   . DT  I 5 2   ? 9.603   -0.133  94.117 1.00 134.86 ? -71  DT  I OP1   1 
ATOM   6085  O  OP2   . DT  I 5 2   ? 8.467   -1.503  92.307 1.00 134.64 ? -71  DT  I OP2   1 
ATOM   6086  O  "O5'" . DT  I 5 2   ? 8.326   -2.212  94.721 1.00 133.72 ? -71  DT  I "O5'" 1 
ATOM   6087  C  "C5'" . DT  I 5 2   ? 9.324   -2.510  95.694 1.00 132.22 ? -71  DT  I "C5'" 1 
ATOM   6088  C  "C4'" . DT  I 5 2   ? 10.082  -3.771  95.309 1.00 131.09 ? -71  DT  I "C4'" 1 
ATOM   6089  O  "O4'" . DT  I 5 2   ? 9.164   -4.767  94.781 1.00 131.01 ? -71  DT  I "O4'" 1 
ATOM   6090  C  "C3'" . DT  I 5 2   ? 11.161  -3.585  94.246 1.00 130.08 ? -71  DT  I "C3'" 1 
ATOM   6091  O  "O3'" . DT  I 5 2   ? 12.278  -4.400  94.580 1.00 128.42 ? -71  DT  I "O3'" 1 
ATOM   6092  C  "C2'" . DT  I 5 2   ? 10.484  -4.087  92.973 1.00 130.55 ? -71  DT  I "C2'" 1 
ATOM   6093  C  "C1'" . DT  I 5 2   ? 9.665   -5.242  93.545 1.00 130.83 ? -71  DT  I "C1'" 1 
ATOM   6094  N  N1    . DT  I 5 2   ? 8.528   -5.766  92.698 1.00 130.84 ? -71  DT  I N1    1 
ATOM   6095  C  C2    . DT  I 5 2   ? 8.428   -7.133  92.513 1.00 130.80 ? -71  DT  I C2    1 
ATOM   6096  O  O2    . DT  I 5 2   ? 9.210   -7.940  92.990 1.00 130.80 ? -71  DT  I O2    1 
ATOM   6097  N  N3    . DT  I 5 2   ? 7.365   -7.528  91.734 1.00 130.81 ? -71  DT  I N3    1 
ATOM   6098  C  C4    . DT  I 5 2   ? 6.409   -6.724  91.135 1.00 130.81 ? -71  DT  I C4    1 
ATOM   6099  O  O4    . DT  I 5 2   ? 5.494   -7.182  90.455 1.00 130.82 ? -71  DT  I O4    1 
ATOM   6100  C  C5    . DT  I 5 2   ? 6.565   -5.309  91.366 1.00 130.90 ? -71  DT  I C5    1 
ATOM   6101  C  C7    . DT  I 5 2   ? 5.585   -4.348  90.758 1.00 130.87 ? -71  DT  I C7    1 
ATOM   6102  C  C6    . DT  I 5 2   ? 7.602   -4.902  92.124 1.00 130.96 ? -71  DT  I C6    1 
ATOM   6103  P  P     . DC  I 5 3   ? 13.749  -4.077  94.039 1.00 127.37 ? -70  DC  I P     1 
ATOM   6104  O  OP1   . DC  I 5 3   ? 14.605  -3.894  95.231 1.00 127.61 ? -70  DC  I OP1   1 
ATOM   6105  O  OP2   . DC  I 5 3   ? 13.649  -3.006  93.021 1.00 127.42 ? -70  DC  I OP2   1 
ATOM   6106  O  "O5'" . DC  I 5 3   ? 14.205  -5.418  93.290 1.00 126.24 ? -70  DC  I "O5'" 1 
ATOM   6107  C  "C5'" . DC  I 5 3   ? 14.294  -6.669  93.992 1.00 124.21 ? -70  DC  I "C5'" 1 
ATOM   6108  C  "C4'" . DC  I 5 3   ? 14.079  -7.881  93.084 1.00 122.38 ? -70  DC  I "C4'" 1 
ATOM   6109  O  "O4'" . DC  I 5 3   ? 12.736  -7.909  92.517 1.00 122.12 ? -70  DC  I "O4'" 1 
ATOM   6110  C  "C3'" . DC  I 5 3   ? 15.037  -7.997  91.902 1.00 120.55 ? -70  DC  I "C3'" 1 
ATOM   6111  O  "O3'" . DC  I 5 3   ? 15.406  -9.357  91.741 1.00 117.89 ? -70  DC  I "O3'" 1 
ATOM   6112  C  "C2'" . DC  I 5 3   ? 14.201  -7.507  90.724 1.00 121.05 ? -70  DC  I "C2'" 1 
ATOM   6113  C  "C1'" . DC  I 5 3   ? 12.832  -8.067  91.111 1.00 121.64 ? -70  DC  I "C1'" 1 
ATOM   6114  N  N1    . DC  I 5 3   ? 11.642  -7.423  90.442 1.00 121.68 ? -70  DC  I N1    1 
ATOM   6115  C  C2    . DC  I 5 3   ? 10.532  -8.219  90.114 1.00 121.55 ? -70  DC  I C2    1 
ATOM   6116  O  O2    . DC  I 5 3   ? 10.551  -9.428  90.384 1.00 121.61 ? -70  DC  I O2    1 
ATOM   6117  N  N3    . DC  I 5 3   ? 9.460   -7.637  89.510 1.00 121.34 ? -70  DC  I N3    1 
ATOM   6118  C  C4    . DC  I 5 3   ? 9.470   -6.328  89.235 1.00 121.39 ? -70  DC  I C4    1 
ATOM   6119  N  N4    . DC  I 5 3   ? 8.392   -5.807  88.642 1.00 121.45 ? -70  DC  I N4    1 
ATOM   6120  C  C5    . DC  I 5 3   ? 10.588  -5.498  89.556 1.00 121.49 ? -70  DC  I C5    1 
ATOM   6121  C  C6    . DC  I 5 3   ? 11.639  -6.081  90.153 1.00 121.63 ? -70  DC  I C6    1 
ATOM   6122  P  P     . DA  I 5 4   ? 16.863  -9.700  91.187 1.00 116.01 ? -69  DA  I P     1 
ATOM   6123  O  OP1   . DA  I 5 4   ? 17.793  -9.412  92.302 1.00 115.95 ? -69  DA  I OP1   1 
ATOM   6124  O  OP2   . DA  I 5 4   ? 17.027  -9.012  89.882 1.00 115.73 ? -69  DA  I OP2   1 
ATOM   6125  O  "O5'" . DA  I 5 4   ? 16.874  -11.284 90.924 1.00 113.58 ? -69  DA  I "O5'" 1 
ATOM   6126  C  "C5'" . DA  I 5 4   ? 15.693  -12.050 90.647 1.00 109.87 ? -69  DA  I "C5'" 1 
ATOM   6127  C  "C4'" . DA  I 5 4   ? 15.431  -12.287 89.162 1.00 106.76 ? -69  DA  I "C4'" 1 
ATOM   6128  O  "O4'" . DA  I 5 4   ? 14.317  -11.463 88.740 1.00 105.89 ? -69  DA  I "O4'" 1 
ATOM   6129  C  "C3'" . DA  I 5 4   ? 16.557  -12.004 88.162 1.00 105.25 ? -69  DA  I "C3'" 1 
ATOM   6130  O  "O3'" . DA  I 5 4   ? 16.586  -13.046 87.201 1.00 103.53 ? -69  DA  I "O3'" 1 
ATOM   6131  C  "C2'" . DA  I 5 4   ? 16.114  -10.707 87.492 1.00 105.09 ? -69  DA  I "C2'" 1 
ATOM   6132  C  "C1'" . DA  I 5 4   ? 14.612  -10.957 87.459 1.00 104.97 ? -69  DA  I "C1'" 1 
ATOM   6133  N  N9    . DA  I 5 4   ? 13.749  -9.806  87.224 1.00 104.68 ? -69  DA  I N9    1 
ATOM   6134  C  C8    . DA  I 5 4   ? 14.010  -8.484  87.446 1.00 104.72 ? -69  DA  I C8    1 
ATOM   6135  N  N7    . DA  I 5 4   ? 13.017  -7.687  87.134 1.00 104.72 ? -69  DA  I N7    1 
ATOM   6136  C  C5    . DA  I 5 4   ? 12.035  -8.549  86.675 1.00 104.87 ? -69  DA  I C5    1 
ATOM   6137  C  C6    . DA  I 5 4   ? 10.725  -8.340  86.184 1.00 104.68 ? -69  DA  I C6    1 
ATOM   6138  N  N6    . DA  I 5 4   ? 10.159  -7.136  86.075 1.00 104.53 ? -69  DA  I N6    1 
ATOM   6139  N  N1    . DA  I 5 4   ? 10.012  -9.424  85.811 1.00 104.66 ? -69  DA  I N1    1 
ATOM   6140  C  C2    . DA  I 5 4   ? 10.573  -10.637 85.921 1.00 104.70 ? -69  DA  I C2    1 
ATOM   6141  N  N3    . DA  I 5 4   ? 11.790  -10.960 86.360 1.00 104.50 ? -69  DA  I N3    1 
ATOM   6142  C  C4    . DA  I 5 4   ? 12.474  -9.861  86.726 1.00 104.66 ? -69  DA  I C4    1 
ATOM   6143  P  P     . DA  I 5 5   ? 17.601  -14.276 87.296 1.00 101.98 ? -68  DA  I P     1 
ATOM   6144  O  OP1   . DA  I 5 5   ? 17.432  -14.938 88.608 1.00 101.71 ? -68  DA  I OP1   1 
ATOM   6145  O  OP2   . DA  I 5 5   ? 18.925  -13.773 86.881 1.00 102.22 ? -68  DA  I OP2   1 
ATOM   6146  O  "O5'" . DA  I 5 5   ? 17.091  -15.251 86.130 1.00 101.52 ? -68  DA  I "O5'" 1 
ATOM   6147  C  "C5'" . DA  I 5 5   ? 15.858  -15.985 86.239 1.00 100.61 ? -68  DA  I "C5'" 1 
ATOM   6148  C  "C4'" . DA  I 5 5   ? 14.951  -15.797 85.024 1.00 99.97  ? -68  DA  I "C4'" 1 
ATOM   6149  O  "O4'" . DA  I 5 5   ? 14.418  -14.448 84.955 1.00 100.04 ? -68  DA  I "O4'" 1 
ATOM   6150  C  "C3'" . DA  I 5 5   ? 15.586  -16.062 83.660 1.00 99.12  ? -68  DA  I "C3'" 1 
ATOM   6151  O  "O3'" . DA  I 5 5   ? 14.730  -16.945 82.959 1.00 98.04  ? -68  DA  I "O3'" 1 
ATOM   6152  C  "C2'" . DA  I 5 5   ? 15.648  -14.690 82.992 1.00 99.09  ? -68  DA  I "C2'" 1 
ATOM   6153  C  "C1'" . DA  I 5 5   ? 14.419  -14.036 83.609 1.00 99.74  ? -68  DA  I "C1'" 1 
ATOM   6154  N  N9    . DA  I 5 5   ? 14.401  -12.582 83.626 1.00 100.00 ? -68  DA  I N9    1 
ATOM   6155  C  C8    . DA  I 5 5   ? 15.412  -11.742 84.002 1.00 100.31 ? -68  DA  I C8    1 
ATOM   6156  N  N7    . DA  I 5 5   ? 15.097  -10.468 83.920 1.00 100.71 ? -68  DA  I N7    1 
ATOM   6157  C  C5    . DA  I 5 5   ? 13.787  -10.473 83.468 1.00 100.41 ? -68  DA  I C5    1 
ATOM   6158  C  C6    . DA  I 5 5   ? 12.871  -9.438  83.174 1.00 100.06 ? -68  DA  I C6    1 
ATOM   6159  N  N6    . DA  I 5 5   ? 13.157  -8.142  83.304 1.00 99.98  ? -68  DA  I N6    1 
ATOM   6160  N  N1    . DA  I 5 5   ? 11.640  -9.786  82.739 1.00 100.06 ? -68  DA  I N1    1 
ATOM   6161  C  C2    . DA  I 5 5   ? 11.349  -11.091 82.604 1.00 100.15 ? -68  DA  I C2    1 
ATOM   6162  N  N3    . DA  I 5 5   ? 12.121  -12.153 82.850 1.00 99.99  ? -68  DA  I N3    1 
ATOM   6163  C  C4    . DA  I 5 5   ? 13.340  -11.773 83.284 1.00 100.37 ? -68  DA  I C4    1 
ATOM   6164  P  P     . DT  I 5 6   ? 15.287  -17.982 81.872 1.00 97.03  ? -67  DT  I P     1 
ATOM   6165  O  OP1   . DT  I 5 6   ? 14.844  -19.331 82.299 1.00 96.57  ? -67  DT  I OP1   1 
ATOM   6166  O  OP2   . DT  I 5 6   ? 16.723  -17.694 81.629 1.00 96.34  ? -67  DT  I OP2   1 
ATOM   6167  O  "O5'" . DT  I 5 6   ? 14.485  -17.572 80.543 1.00 95.87  ? -67  DT  I "O5'" 1 
ATOM   6168  C  "C5'" . DT  I 5 6   ? 13.089  -17.267 80.566 1.00 93.40  ? -67  DT  I "C5'" 1 
ATOM   6169  C  "C4'" . DT  I 5 6   ? 12.745  -16.150 79.595 1.00 91.88  ? -67  DT  I "C4'" 1 
ATOM   6170  O  "O4'" . DT  I 5 6   ? 13.079  -14.858 80.150 1.00 91.68  ? -67  DT  I "O4'" 1 
ATOM   6171  C  "C3'" . DT  I 5 6   ? 13.452  -16.193 78.243 1.00 91.19  ? -67  DT  I "C3'" 1 
ATOM   6172  O  "O3'" . DT  I 5 6   ? 12.529  -16.750 77.306 1.00 90.71  ? -67  DT  I "O3'" 1 
ATOM   6173  C  "C2'" . DT  I 5 6   ? 13.828  -14.734 77.954 1.00 91.01  ? -67  DT  I "C2'" 1 
ATOM   6174  C  "C1'" . DT  I 5 6   ? 13.131  -13.955 79.067 1.00 91.17  ? -67  DT  I "C1'" 1 
ATOM   6175  N  N1    . DT  I 5 6   ? 13.814  -12.694 79.510 1.00 90.94  ? -67  DT  I N1    1 
ATOM   6176  C  C2    . DT  I 5 6   ? 13.146  -11.480 79.462 1.00 90.97  ? -67  DT  I C2    1 
ATOM   6177  O  O2    . DT  I 5 6   ? 12.003  -11.339 79.070 1.00 91.08  ? -67  DT  I O2    1 
ATOM   6178  N  N3    . DT  I 5 6   ? 13.877  -10.402 79.897 1.00 91.20  ? -67  DT  I N3    1 
ATOM   6179  C  C4    . DT  I 5 6   ? 15.180  -10.415 80.370 1.00 91.28  ? -67  DT  I C4    1 
ATOM   6180  O  O4    . DT  I 5 6   ? 15.738  -9.389  80.737 1.00 91.44  ? -67  DT  I O4    1 
ATOM   6181  C  C5    . DT  I 5 6   ? 15.823  -11.710 80.397 1.00 91.04  ? -67  DT  I C5    1 
ATOM   6182  C  C7    . DT  I 5 6   ? 17.233  -11.870 80.879 1.00 90.96  ? -67  DT  I C7    1 
ATOM   6183  C  C6    . DT  I 5 6   ? 15.118  -12.766 79.973 1.00 91.22  ? -67  DT  I C6    1 
ATOM   6184  P  P     . DA  I 5 7   ? 12.752  -16.754 75.716 1.00 90.51  ? -66  DA  I P     1 
ATOM   6185  O  OP1   . DA  I 5 7   ? 12.050  -17.943 75.188 1.00 90.34  ? -66  DA  I OP1   1 
ATOM   6186  O  OP2   . DA  I 5 7   ? 14.181  -16.542 75.396 1.00 90.57  ? -66  DA  I OP2   1 
ATOM   6187  O  "O5'" . DA  I 5 7   ? 11.949  -15.457 75.265 1.00 89.63  ? -66  DA  I "O5'" 1 
ATOM   6188  C  "C5'" . DA  I 5 7   ? 10.584  -15.355 75.626 1.00 88.89  ? -66  DA  I "C5'" 1 
ATOM   6189  C  "C4'" . DA  I 5 7   ? 10.075  -13.982 75.261 1.00 88.56  ? -66  DA  I "C4'" 1 
ATOM   6190  O  "O4'" . DA  I 5 7   ? 10.872  -12.986 75.942 1.00 88.77  ? -66  DA  I "O4'" 1 
ATOM   6191  C  "C3'" . DA  I 5 7   ? 10.143  -13.643 73.778 1.00 88.52  ? -66  DA  I "C3'" 1 
ATOM   6192  O  "O3'" . DA  I 5 7   ? 8.918   -13.006 73.459 1.00 88.27  ? -66  DA  I "O3'" 1 
ATOM   6193  C  "C2'" . DA  I 5 7   ? 11.345  -12.705 73.676 1.00 88.57  ? -66  DA  I "C2'" 1 
ATOM   6194  C  "C1'" . DA  I 5 7   ? 11.264  -11.994 75.022 1.00 88.92  ? -66  DA  I "C1'" 1 
ATOM   6195  N  N9    . DA  I 5 7   ? 12.521  -11.419 75.491 1.00 88.99  ? -66  DA  I N9    1 
ATOM   6196  C  C8    . DA  I 5 7   ? 13.711  -12.071 75.639 1.00 88.97  ? -66  DA  I C8    1 
ATOM   6197  N  N7    . DA  I 5 7   ? 14.677  -11.304 76.081 1.00 89.24  ? -66  DA  I N7    1 
ATOM   6198  C  C5    . DA  I 5 7   ? 14.082  -10.065 76.237 1.00 89.10  ? -66  DA  I C5    1 
ATOM   6199  C  C6    . DA  I 5 7   ? 14.577  -8.820  76.676 1.00 89.21  ? -66  DA  I C6    1 
ATOM   6200  N  N6    . DA  I 5 7   ? 15.847  -8.647  77.052 1.00 89.32  ? -66  DA  I N6    1 
ATOM   6201  N  N1    . DA  I 5 7   ? 13.725  -7.767  76.717 1.00 88.98  ? -66  DA  I N1    1 
ATOM   6202  C  C2    . DA  I 5 7   ? 12.458  -7.957  76.333 1.00 88.97  ? -66  DA  I C2    1 
ATOM   6203  N  N3    . DA  I 5 7   ? 11.873  -9.082  75.911 1.00 89.31  ? -66  DA  I N3    1 
ATOM   6204  C  C4    . DA  I 5 7   ? 12.747  -10.113 75.881 1.00 89.27  ? -66  DA  I C4    1 
ATOM   6205  P  P     . DT  I 5 8   ? 8.539   -12.577 71.973 1.00 87.80  ? -65  DT  I P     1 
ATOM   6206  O  OP1   . DT  I 5 8   ? 7.060   -12.508 71.912 1.00 87.67  ? -65  DT  I OP1   1 
ATOM   6207  O  OP2   . DT  I 5 8   ? 9.326   -13.400 71.020 1.00 87.35  ? -65  DT  I OP2   1 
ATOM   6208  O  "O5'" . DT  I 5 8   ? 9.056   -11.074 71.925 1.00 88.53  ? -65  DT  I "O5'" 1 
ATOM   6209  C  "C5'" . DT  I 5 8   ? 8.425   -10.094 72.755 1.00 89.75  ? -65  DT  I "C5'" 1 
ATOM   6210  C  "C4'" . DT  I 5 8   ? 8.987   -8.724  72.448 1.00 90.56  ? -65  DT  I "C4'" 1 
ATOM   6211  O  "O4'" . DT  I 5 8   ? 10.298  -8.618  73.054 1.00 90.44  ? -65  DT  I "O4'" 1 
ATOM   6212  C  "C3'" . DT  I 5 8   ? 9.179   -8.453  70.957 1.00 91.85  ? -65  DT  I "C3'" 1 
ATOM   6213  O  "O3'" . DT  I 5 8   ? 8.644   -7.175  70.638 1.00 93.80  ? -65  DT  I "O3'" 1 
ATOM   6214  C  "C2'" . DT  I 5 8   ? 10.694  -8.535  70.759 1.00 91.18  ? -65  DT  I "C2'" 1 
ATOM   6215  C  "C1'" . DT  I 5 8   ? 11.175  -8.038  72.115 1.00 90.74  ? -65  DT  I "C1'" 1 
ATOM   6216  N  N1    . DT  I 5 8   ? 12.588  -8.374  72.471 1.00 90.54  ? -65  DT  I N1    1 
ATOM   6217  C  C2    . DT  I 5 8   ? 13.395  -7.360  72.965 1.00 90.60  ? -65  DT  I C2    1 
ATOM   6218  O  O2    . DT  I 5 8   ? 13.015  -6.204  73.119 1.00 90.58  ? -65  DT  I O2    1 
ATOM   6219  N  N3    . DT  I 5 8   ? 14.678  -7.754  73.269 1.00 90.44  ? -65  DT  I N3    1 
ATOM   6220  C  C4    . DT  I 5 8   ? 15.219  -9.025  73.132 1.00 90.63  ? -65  DT  I C4    1 
ATOM   6221  O  O4    . DT  I 5 8   ? 16.384  -9.272  73.432 1.00 90.73  ? -65  DT  I O4    1 
ATOM   6222  C  C5    . DT  I 5 8   ? 14.323  -10.036 72.611 1.00 90.67  ? -65  DT  I C5    1 
ATOM   6223  C  C7    . DT  I 5 8   ? 14.799  -11.450 72.420 1.00 90.45  ? -65  DT  I C7    1 
ATOM   6224  C  C6    . DT  I 5 8   ? 13.065  -9.666  72.311 1.00 90.34  ? -65  DT  I C6    1 
ATOM   6225  P  P     . DC  I 5 9   ? 8.430   -6.687  69.125 1.00 95.66  ? -64  DC  I P     1 
ATOM   6226  O  OP1   . DC  I 5 9   ? 7.016   -6.261  69.018 1.00 95.63  ? -64  DC  I OP1   1 
ATOM   6227  O  OP2   . DC  I 5 9   ? 8.990   -7.666  68.167 1.00 95.12  ? -64  DC  I OP2   1 
ATOM   6228  O  "O5'" . DC  I 5 9   ? 9.364   -5.396  69.064 1.00 98.13  ? -64  DC  I "O5'" 1 
ATOM   6229  C  "C5'" . DC  I 5 9   ? 9.281   -4.397  70.083 1.00 101.45 ? -64  DC  I "C5'" 1 
ATOM   6230  C  "C4'" . DC  I 5 9   ? 10.588  -3.636  70.148 1.00 103.67 ? -64  DC  I "C4'" 1 
ATOM   6231  O  "O4'" . DC  I 5 9   ? 11.603  -4.518  70.684 1.00 103.81 ? -64  DC  I "O4'" 1 
ATOM   6232  C  "C3'" . DC  I 5 9   ? 11.080  -3.177  68.778 1.00 104.95 ? -64  DC  I "C3'" 1 
ATOM   6233  O  "O3'" . DC  I 5 9   ? 10.915  -1.763  68.640 1.00 107.31 ? -64  DC  I "O3'" 1 
ATOM   6234  C  "C2'" . DC  I 5 9   ? 12.549  -3.587  68.725 1.00 104.58 ? -64  DC  I "C2'" 1 
ATOM   6235  C  "C1'" . DC  I 5 9   ? 12.837  -4.173  70.103 1.00 104.06 ? -64  DC  I "C1'" 1 
ATOM   6236  N  N1    . DC  I 5 9   ? 13.691  -5.391  70.062 1.00 103.96 ? -64  DC  I N1    1 
ATOM   6237  C  C2    . DC  I 5 9   ? 14.963  -5.362  70.653 1.00 104.22 ? -64  DC  I C2    1 
ATOM   6238  O  O2    . DC  I 5 9   ? 15.354  -4.322  71.199 1.00 104.34 ? -64  DC  I O2    1 
ATOM   6239  N  N3    . DC  I 5 9   ? 15.738  -6.479  70.609 1.00 104.11 ? -64  DC  I N3    1 
ATOM   6240  C  C4    . DC  I 5 9   ? 15.284  -7.585  70.009 1.00 104.01 ? -64  DC  I C4    1 
ATOM   6241  N  N4    . DC  I 5 9   ? 16.077  -8.662  69.988 1.00 103.98 ? -64  DC  I N4    1 
ATOM   6242  C  C5    . DC  I 5 9   ? 13.992  -7.630  69.400 1.00 104.14 ? -64  DC  I C5    1 
ATOM   6243  C  C6    . DC  I 5 9   ? 13.240  -6.524  69.448 1.00 103.85 ? -64  DC  I C6    1 
ATOM   6244  P  P     . DC  I 5 10  ? 10.679  -1.074  67.208 1.00 108.76 ? -63  DC  I P     1 
ATOM   6245  O  OP1   . DC  I 5 10  ? 9.303   -0.523  67.220 1.00 108.33 ? -63  DC  I OP1   1 
ATOM   6246  O  OP2   . DC  I 5 10  ? 11.089  -2.014  66.139 1.00 108.17 ? -63  DC  I OP2   1 
ATOM   6247  O  "O5'" . DC  I 5 10  ? 11.726  0.142   67.200 1.00 110.22 ? -63  DC  I "O5'" 1 
ATOM   6248  C  "C5'" . DC  I 5 10  ? 12.845  0.196   68.098 1.00 112.37 ? -63  DC  I "C5'" 1 
ATOM   6249  C  "C4'" . DC  I 5 10  ? 14.184  0.006   67.396 1.00 113.98 ? -63  DC  I "C4'" 1 
ATOM   6250  O  "O4'" . DC  I 5 10  ? 14.826  -1.204  67.879 1.00 114.01 ? -63  DC  I "O4'" 1 
ATOM   6251  C  "C3'" . DC  I 5 10  ? 14.157  -0.110  65.867 1.00 115.53 ? -63  DC  I "C3'" 1 
ATOM   6252  O  "O3'" . DC  I 5 10  ? 15.208  0.672   65.271 1.00 118.10 ? -63  DC  I "O3'" 1 
ATOM   6253  C  "C2'" . DC  I 5 10  ? 14.422  -1.594  65.657 1.00 115.14 ? -63  DC  I "C2'" 1 
ATOM   6254  C  "C1'" . DC  I 5 10  ? 15.458  -1.781  66.759 1.00 114.69 ? -63  DC  I "C1'" 1 
ATOM   6255  N  N1    . DC  I 5 10  ? 15.923  -3.193  67.010 1.00 114.82 ? -63  DC  I N1    1 
ATOM   6256  C  C2    . DC  I 5 10  ? 17.123  -3.432  67.719 1.00 114.80 ? -63  DC  I C2    1 
ATOM   6257  O  O2    . DC  I 5 10  ? 17.803  -2.493  68.158 1.00 114.69 ? -63  DC  I O2    1 
ATOM   6258  N  N3    . DC  I 5 10  ? 17.519  -4.716  67.920 1.00 114.91 ? -63  DC  I N3    1 
ATOM   6259  C  C4    . DC  I 5 10  ? 16.783  -5.730  67.445 1.00 115.00 ? -63  DC  I C4    1 
ATOM   6260  N  N4    . DC  I 5 10  ? 17.223  -6.972  67.670 1.00 114.91 ? -63  DC  I N4    1 
ATOM   6261  C  C5    . DC  I 5 10  ? 15.568  -5.514  66.718 1.00 114.76 ? -63  DC  I C5    1 
ATOM   6262  C  C6    . DC  I 5 10  ? 15.185  -4.245  66.524 1.00 114.65 ? -63  DC  I C6    1 
ATOM   6263  P  P     . DA  I 5 11  ? 14.978  2.088   64.541 1.00 119.43 ? -62  DA  I P     1 
ATOM   6264  O  OP1   . DA  I 5 11  ? 13.556  2.485   64.690 1.00 119.04 ? -62  DA  I OP1   1 
ATOM   6265  O  OP2   . DA  I 5 11  ? 15.554  1.970   63.184 1.00 118.97 ? -62  DA  I OP2   1 
ATOM   6266  O  "O5'" . DA  I 5 11  ? 15.907  3.106   65.372 1.00 120.61 ? -62  DA  I "O5'" 1 
ATOM   6267  C  "C5'" . DA  I 5 11  ? 16.777  2.681   66.437 1.00 123.00 ? -62  DA  I "C5'" 1 
ATOM   6268  C  "C4'" . DA  I 5 11  ? 18.182  2.283   65.979 1.00 124.71 ? -62  DA  I "C4'" 1 
ATOM   6269  O  "O4'" . DA  I 5 11  ? 18.356  0.847   66.104 1.00 125.03 ? -62  DA  I "O4'" 1 
ATOM   6270  C  "C3'" . DA  I 5 11  ? 18.584  2.631   64.540 1.00 126.02 ? -62  DA  I "C3'" 1 
ATOM   6271  O  "O3'" . DA  I 5 11  ? 19.900  3.201   64.498 1.00 127.85 ? -62  DA  I "O3'" 1 
ATOM   6272  C  "C2'" . DA  I 5 11  ? 18.552  1.282   63.830 1.00 125.79 ? -62  DA  I "C2'" 1 
ATOM   6273  C  "C1'" . DA  I 5 11  ? 19.030  0.376   64.952 1.00 125.47 ? -62  DA  I "C1'" 1 
ATOM   6274  N  N9    . DA  I 5 11  ? 18.736  -1.040  64.731 1.00 125.54 ? -62  DA  I N9    1 
ATOM   6275  C  C8    . DA  I 5 11  ? 17.593  -1.583  64.207 1.00 125.39 ? -62  DA  I C8    1 
ATOM   6276  N  N7    . DA  I 5 11  ? 17.611  -2.893  64.129 1.00 125.23 ? -62  DA  I N7    1 
ATOM   6277  C  C5    . DA  I 5 11  ? 18.856  -3.234  64.632 1.00 125.39 ? -62  DA  I C5    1 
ATOM   6278  C  C6    . DA  I 5 11  ? 19.506  -4.475  64.816 1.00 125.58 ? -62  DA  I C6    1 
ATOM   6279  N  N6    . DA  I 5 11  ? 18.945  -5.646  64.498 1.00 125.55 ? -62  DA  I N6    1 
ATOM   6280  N  N1    . DA  I 5 11  ? 20.756  -4.469  65.340 1.00 125.52 ? -62  DA  I N1    1 
ATOM   6281  C  C2    . DA  I 5 11  ? 21.319  -3.294  65.659 1.00 125.34 ? -62  DA  I C2    1 
ATOM   6282  N  N3    . DA  I 5 11  ? 20.806  -2.068  65.529 1.00 125.37 ? -62  DA  I N3    1 
ATOM   6283  C  C4    . DA  I 5 11  ? 19.565  -2.105  65.006 1.00 125.45 ? -62  DA  I C4    1 
ATOM   6284  P  P     . DC  I 5 12  ? 20.470  3.987   63.210 1.00 129.09 ? -61  DC  I P     1 
ATOM   6285  O  OP1   . DC  I 5 12  ? 20.856  5.345   63.664 1.00 128.95 ? -61  DC  I OP1   1 
ATOM   6286  O  OP2   . DC  I 5 12  ? 19.515  3.861   62.075 1.00 128.50 ? -61  DC  I OP2   1 
ATOM   6287  O  "O5'" . DC  I 5 12  ? 21.796  3.141   62.873 1.00 129.06 ? -61  DC  I "O5'" 1 
ATOM   6288  C  "C5'" . DC  I 5 12  ? 22.909  3.098   63.778 1.00 129.48 ? -61  DC  I "C5'" 1 
ATOM   6289  C  "C4'" . DC  I 5 12  ? 23.757  1.848   63.583 1.00 129.87 ? -61  DC  I "C4'" 1 
ATOM   6290  O  "O4'" . DC  I 5 12  ? 22.910  0.669   63.693 1.00 129.83 ? -61  DC  I "O4'" 1 
ATOM   6291  C  "C3'" . DC  I 5 12  ? 24.475  1.736   62.232 1.00 130.44 ? -61  DC  I "C3'" 1 
ATOM   6292  O  "O3'" . DC  I 5 12  ? 25.839  1.290   62.399 1.00 131.23 ? -61  DC  I "O3'" 1 
ATOM   6293  C  "C2'" . DC  I 5 12  ? 23.615  0.710   61.496 1.00 130.12 ? -61  DC  I "C2'" 1 
ATOM   6294  C  "C1'" . DC  I 5 12  ? 23.287  -0.220  62.659 1.00 129.33 ? -61  DC  I "C1'" 1 
ATOM   6295  N  N1    . DC  I 5 12  ? 22.238  -1.263  62.344 1.00 128.93 ? -61  DC  I N1    1 
ATOM   6296  C  C2    . DC  I 5 12  ? 22.570  -2.625  62.465 1.00 128.69 ? -61  DC  I C2    1 
ATOM   6297  O  O2    . DC  I 5 12  ? 23.706  -2.944  62.838 1.00 128.73 ? -61  DC  I O2    1 
ATOM   6298  N  N3    . DC  I 5 12  ? 21.629  -3.563  62.169 1.00 128.45 ? -61  DC  I N3    1 
ATOM   6299  C  C4    . DC  I 5 12  ? 20.412  -3.186  61.765 1.00 128.52 ? -61  DC  I C4    1 
ATOM   6300  N  N4    . DC  I 5 12  ? 19.523  -4.142  61.489 1.00 128.55 ? -61  DC  I N4    1 
ATOM   6301  C  C5    . DC  I 5 12  ? 20.051  -1.810  61.630 1.00 128.42 ? -61  DC  I C5    1 
ATOM   6302  C  C6    . DC  I 5 12  ? 20.985  -0.895  61.925 1.00 128.62 ? -61  DC  I C6    1 
ATOM   6303  P  P     . DC  I 5 13  ? 26.764  0.753   61.190 1.00 131.94 ? -60  DC  I P     1 
ATOM   6304  O  OP1   . DC  I 5 13  ? 28.167  0.817   61.665 1.00 131.98 ? -60  DC  I OP1   1 
ATOM   6305  O  OP2   . DC  I 5 13  ? 26.385  1.460   59.942 1.00 131.47 ? -60  DC  I OP2   1 
ATOM   6306  O  "O5'" . DC  I 5 13  ? 26.336  -0.788  61.034 1.00 132.36 ? -60  DC  I "O5'" 1 
ATOM   6307  C  "C5'" . DC  I 5 13  ? 27.099  -1.862  61.619 1.00 132.83 ? -60  DC  I "C5'" 1 
ATOM   6308  C  "C4'" . DC  I 5 13  ? 27.291  -3.039  60.665 1.00 132.95 ? -60  DC  I "C4'" 1 
ATOM   6309  O  "O4'" . DC  I 5 13  ? 26.028  -3.733  60.454 1.00 132.86 ? -60  DC  I "O4'" 1 
ATOM   6310  C  "C3'" . DC  I 5 13  ? 27.826  -2.699  59.273 1.00 133.03 ? -60  DC  I "C3'" 1 
ATOM   6311  O  "O3'" . DC  I 5 13  ? 28.800  -3.663  58.863 1.00 133.41 ? -60  DC  I "O3'" 1 
ATOM   6312  C  "C2'" . DC  I 5 13  ? 26.576  -2.747  58.393 1.00 132.77 ? -60  DC  I "C2'" 1 
ATOM   6313  C  "C1'" . DC  I 5 13  ? 25.758  -3.845  59.066 1.00 132.31 ? -60  DC  I "C1'" 1 
ATOM   6314  N  N1    . DC  I 5 13  ? 24.272  -3.749  58.808 1.00 131.99 ? -60  DC  I N1    1 
ATOM   6315  C  C2    . DC  I 5 13  ? 23.580  -4.803  58.186 1.00 131.65 ? -60  DC  I C2    1 
ATOM   6316  O  O2    . DC  I 5 13  ? 24.188  -5.822  57.846 1.00 131.59 ? -60  DC  I O2    1 
ATOM   6317  N  N3    . DC  I 5 13  ? 22.244  -4.680  57.969 1.00 131.54 ? -60  DC  I N3    1 
ATOM   6318  C  C4    . DC  I 5 13  ? 21.601  -3.570  58.342 1.00 131.67 ? -60  DC  I C4    1 
ATOM   6319  N  N4    . DC  I 5 13  ? 20.289  -3.487  58.111 1.00 131.65 ? -60  DC  I N4    1 
ATOM   6320  C  C5    . DC  I 5 13  ? 22.280  -2.487  58.970 1.00 131.76 ? -60  DC  I C5    1 
ATOM   6321  C  C6    . DC  I 5 13  ? 23.595  -2.619  59.181 1.00 131.99 ? -60  DC  I C6    1 
ATOM   6322  P  P     . DT  I 5 14  ? 29.798  -3.364  57.641 1.00 134.00 ? -59  DT  I P     1 
ATOM   6323  O  OP1   . DT  I 5 14  ? 30.777  -2.353  58.096 1.00 134.25 ? -59  DT  I OP1   1 
ATOM   6324  O  OP2   . DT  I 5 14  ? 29.003  -3.095  56.420 1.00 134.11 ? -59  DT  I OP2   1 
ATOM   6325  O  "O5'" . DT  I 5 14  ? 30.551  -4.766  57.454 1.00 133.79 ? -59  DT  I "O5'" 1 
ATOM   6326  C  "C5'" . DT  I 5 14  ? 30.980  -5.180  56.164 1.00 133.60 ? -59  DT  I "C5'" 1 
ATOM   6327  C  "C4'" . DT  I 5 14  ? 30.079  -6.275  55.619 1.00 133.61 ? -59  DT  I "C4'" 1 
ATOM   6328  O  "O4'" . DT  I 5 14  ? 28.672  -5.995  55.880 1.00 133.82 ? -59  DT  I "O4'" 1 
ATOM   6329  C  "C3'" . DT  I 5 14  ? 30.213  -6.517  54.113 1.00 133.12 ? -59  DT  I "C3'" 1 
ATOM   6330  O  "O3'" . DT  I 5 14  ? 30.762  -7.845  53.914 1.00 132.09 ? -59  DT  I "O3'" 1 
ATOM   6331  C  "C2'" . DT  I 5 14  ? 28.798  -6.272  53.579 1.00 133.57 ? -59  DT  I "C2'" 1 
ATOM   6332  C  "C1'" . DT  I 5 14  ? 27.926  -6.536  54.807 1.00 133.71 ? -59  DT  I "C1'" 1 
ATOM   6333  N  N1    . DT  I 5 14  ? 26.522  -5.952  54.751 1.00 133.73 ? -59  DT  I N1    1 
ATOM   6334  C  C2    . DT  I 5 14  ? 25.420  -6.791  54.889 1.00 133.71 ? -59  DT  I C2    1 
ATOM   6335  O  O2    . DT  I 5 14  ? 25.491  -8.000  55.062 1.00 133.54 ? -59  DT  I O2    1 
ATOM   6336  N  N3    . DT  I 5 14  ? 24.200  -6.153  54.818 1.00 133.71 ? -59  DT  I N3    1 
ATOM   6337  C  C4    . DT  I 5 14  ? 23.966  -4.798  54.626 1.00 133.66 ? -59  DT  I C4    1 
ATOM   6338  O  O4    . DT  I 5 14  ? 22.828  -4.338  54.580 1.00 133.54 ? -59  DT  I O4    1 
ATOM   6339  C  C5    . DT  I 5 14  ? 25.152  -3.979  54.486 1.00 133.60 ? -59  DT  I C5    1 
ATOM   6340  C  C7    . DT  I 5 14  ? 25.041  -2.496  54.272 1.00 133.56 ? -59  DT  I C7    1 
ATOM   6341  C  C6    . DT  I 5 14  ? 26.350  -4.587  54.554 1.00 133.66 ? -59  DT  I C6    1 
ATOM   6342  P  P     . DG  I 5 15  ? 30.250  -8.971  52.885 1.00 131.26 ? -58  DG  I P     1 
ATOM   6343  O  OP1   . DG  I 5 15  ? 31.282  -10.031 52.889 1.00 131.34 ? -58  DG  I OP1   1 
ATOM   6344  O  OP2   . DG  I 5 15  ? 29.885  -8.333  51.597 1.00 131.11 ? -58  DG  I OP2   1 
ATOM   6345  O  "O5'" . DG  I 5 15  ? 28.924  -9.539  53.594 1.00 130.40 ? -58  DG  I "O5'" 1 
ATOM   6346  C  "C5'" . DG  I 5 15  ? 28.663  -10.944 53.698 1.00 128.88 ? -58  DG  I "C5'" 1 
ATOM   6347  C  "C4'" . DG  I 5 15  ? 27.594  -11.393 52.710 1.00 127.58 ? -58  DG  I "C4'" 1 
ATOM   6348  O  "O4'" . DG  I 5 15  ? 26.535  -10.405 52.614 1.00 127.59 ? -58  DG  I "O4'" 1 
ATOM   6349  C  "C3'" . DG  I 5 15  ? 28.079  -11.669 51.287 1.00 126.36 ? -58  DG  I "C3'" 1 
ATOM   6350  O  "O3'" . DG  I 5 15  ? 27.587  -12.949 50.873 1.00 124.32 ? -58  DG  I "O3'" 1 
ATOM   6351  C  "C2'" . DG  I 5 15  ? 27.510  -10.509 50.463 1.00 126.85 ? -58  DG  I "C2'" 1 
ATOM   6352  C  "C1'" . DG  I 5 15  ? 26.275  -10.094 51.257 1.00 127.58 ? -58  DG  I "C1'" 1 
ATOM   6353  N  N9    . DG  I 5 15  ? 25.940  -8.668  51.211 1.00 127.83 ? -58  DG  I N9    1 
ATOM   6354  C  C8    . DG  I 5 15  ? 26.804  -7.598  51.138 1.00 127.81 ? -58  DG  I C8    1 
ATOM   6355  N  N7    . DG  I 5 15  ? 26.209  -6.436  51.125 1.00 127.77 ? -58  DG  I N7    1 
ATOM   6356  C  C5    . DG  I 5 15  ? 24.859  -6.752  51.202 1.00 127.70 ? -58  DG  I C5    1 
ATOM   6357  C  C6    . DG  I 5 15  ? 23.726  -5.905  51.224 1.00 127.59 ? -58  DG  I C6    1 
ATOM   6358  O  O6    . DG  I 5 15  ? 23.695  -4.669  51.187 1.00 127.69 ? -58  DG  I O6    1 
ATOM   6359  N  N1    . DG  I 5 15  ? 22.538  -6.629  51.303 1.00 127.69 ? -58  DG  I N1    1 
ATOM   6360  C  C2    . DG  I 5 15  ? 22.456  -8.001  51.355 1.00 127.64 ? -58  DG  I C2    1 
ATOM   6361  N  N2    . DG  I 5 15  ? 21.227  -8.524  51.426 1.00 127.70 ? -58  DG  I N2    1 
ATOM   6362  N  N3    . DG  I 5 15  ? 23.507  -8.809  51.334 1.00 127.64 ? -58  DG  I N3    1 
ATOM   6363  C  C4    . DG  I 5 15  ? 24.675  -8.120  51.256 1.00 127.86 ? -58  DG  I C4    1 
ATOM   6364  P  P     . DC  I 5 16  ? 27.936  -13.610 49.452 1.00 123.06 ? -57  DC  I P     1 
ATOM   6365  O  OP1   . DC  I 5 16  ? 28.115  -15.063 49.678 1.00 122.66 ? -57  DC  I OP1   1 
ATOM   6366  O  OP2   . DC  I 5 16  ? 28.999  -12.820 48.787 1.00 122.63 ? -57  DC  I OP2   1 
ATOM   6367  O  "O5'" . DC  I 5 16  ? 26.595  -13.379 48.603 1.00 121.93 ? -57  DC  I "O5'" 1 
ATOM   6368  C  "C5'" . DC  I 5 16  ? 25.299  -13.717 49.117 1.00 119.57 ? -57  DC  I "C5'" 1 
ATOM   6369  C  "C4'" . DC  I 5 16  ? 24.178  -13.036 48.338 1.00 117.80 ? -57  DC  I "C4'" 1 
ATOM   6370  O  "O4'" . DC  I 5 16  ? 24.105  -11.623 48.653 1.00 117.43 ? -57  DC  I "O4'" 1 
ATOM   6371  C  "C3'" . DC  I 5 16  ? 24.281  -13.129 46.813 1.00 116.93 ? -57  DC  I "C3'" 1 
ATOM   6372  O  "O3'" . DC  I 5 16  ? 23.090  -13.695 46.294 1.00 115.77 ? -57  DC  I "O3'" 1 
ATOM   6373  C  "C2'" . DC  I 5 16  ? 24.445  -11.687 46.342 1.00 116.86 ? -57  DC  I "C2'" 1 
ATOM   6374  C  "C1'" . DC  I 5 16  ? 23.760  -10.929 47.472 1.00 116.70 ? -57  DC  I "C1'" 1 
ATOM   6375  N  N1    . DC  I 5 16  ? 24.170  -9.505  47.630 1.00 116.28 ? -57  DC  I N1    1 
ATOM   6376  C  C2    . DC  I 5 16  ? 23.221  -8.589  48.086 1.00 116.11 ? -57  DC  I C2    1 
ATOM   6377  O  O2    . DC  I 5 16  ? 22.083  -8.995  48.337 1.00 116.08 ? -57  DC  I O2    1 
ATOM   6378  N  N3    . DC  I 5 16  ? 23.581  -7.286  48.238 1.00 116.27 ? -57  DC  I N3    1 
ATOM   6379  C  C4    . DC  I 5 16  ? 24.830  -6.898  47.954 1.00 116.34 ? -57  DC  I C4    1 
ATOM   6380  N  N4    . DC  I 5 16  ? 25.140  -5.610  48.120 1.00 116.27 ? -57  DC  I N4    1 
ATOM   6381  C  C5    . DC  I 5 16  ? 25.819  -7.818  47.490 1.00 116.25 ? -57  DC  I C5    1 
ATOM   6382  C  C6    . DC  I 5 16  ? 25.447  -9.098  47.346 1.00 116.36 ? -57  DC  I C6    1 
ATOM   6383  P  P     . DA  I 5 17  ? 23.025  -15.264 45.993 1.00 114.74 ? -56  DA  I P     1 
ATOM   6384  O  OP1   . DA  I 5 17  ? 23.607  -15.987 47.144 1.00 114.59 ? -56  DA  I OP1   1 
ATOM   6385  O  OP2   . DA  I 5 17  ? 23.580  -15.436 44.635 1.00 114.53 ? -56  DA  I OP2   1 
ATOM   6386  O  "O5'" . DA  I 5 17  ? 21.462  -15.628 45.946 1.00 114.14 ? -56  DA  I "O5'" 1 
ATOM   6387  C  "C5'" . DA  I 5 17  ? 20.488  -15.012 46.806 1.00 112.52 ? -56  DA  I "C5'" 1 
ATOM   6388  C  "C4'" . DA  I 5 17  ? 19.634  -14.003 46.045 1.00 111.15 ? -56  DA  I "C4'" 1 
ATOM   6389  O  "O4'" . DA  I 5 17  ? 20.358  -12.749 45.895 1.00 110.76 ? -56  DA  I "O4'" 1 
ATOM   6390  C  "C3'" . DA  I 5 17  ? 19.213  -14.422 44.631 1.00 110.19 ? -56  DA  I "C3'" 1 
ATOM   6391  O  "O3'" . DA  I 5 17  ? 17.860  -14.055 44.362 1.00 108.54 ? -56  DA  I "O3'" 1 
ATOM   6392  C  "C2'" . DA  I 5 17  ? 20.170  -13.621 43.750 1.00 110.42 ? -56  DA  I "C2'" 1 
ATOM   6393  C  "C1'" . DA  I 5 17  ? 20.230  -12.327 44.555 1.00 110.63 ? -56  DA  I "C1'" 1 
ATOM   6394  N  N9    . DA  I 5 17  ? 21.303  -11.395 44.196 1.00 110.80 ? -56  DA  I N9    1 
ATOM   6395  C  C8    . DA  I 5 17  ? 22.414  -11.637 43.428 1.00 110.93 ? -56  DA  I C8    1 
ATOM   6396  N  N7    . DA  I 5 17  ? 23.198  -10.596 43.274 1.00 110.65 ? -56  DA  I N7    1 
ATOM   6397  C  C5    . DA  I 5 17  ? 22.553  -9.602  43.986 1.00 110.55 ? -56  DA  I C5    1 
ATOM   6398  C  C6    . DA  I 5 17  ? 22.862  -8.250  44.217 1.00 110.56 ? -56  DA  I C6    1 
ATOM   6399  N  N6    . DA  I 5 17  ? 23.953  -7.666  43.726 1.00 110.60 ? -56  DA  I N6    1 
ATOM   6400  N  N1    . DA  I 5 17  ? 22.011  -7.520  44.970 1.00 110.70 ? -56  DA  I N1    1 
ATOM   6401  C  C2    . DA  I 5 17  ? 20.916  -8.110  45.461 1.00 110.62 ? -56  DA  I C2    1 
ATOM   6402  N  N3    . DA  I 5 17  ? 20.520  -9.372  45.310 1.00 110.41 ? -56  DA  I N3    1 
ATOM   6403  C  C4    . DA  I 5 17  ? 21.385  -10.071 44.557 1.00 110.53 ? -56  DA  I C4    1 
ATOM   6404  P  P     . DG  I 5 18  ? 16.627  -15.028 44.663 1.00 107.12 ? -55  DG  I P     1 
ATOM   6405  O  OP1   . DG  I 5 18  ? 16.543  -15.224 46.129 1.00 106.61 ? -55  DG  I OP1   1 
ATOM   6406  O  OP2   . DG  I 5 18  ? 16.748  -16.178 43.742 1.00 106.75 ? -55  DG  I OP2   1 
ATOM   6407  O  "O5'" . DG  I 5 18  ? 15.355  -14.183 44.199 1.00 106.29 ? -55  DG  I "O5'" 1 
ATOM   6408  C  "C5'" . DG  I 5 18  ? 15.002  -13.011 44.908 1.00 105.21 ? -55  DG  I "C5'" 1 
ATOM   6409  C  "C4'" . DG  I 5 18  ? 15.400  -11.759 44.146 1.00 104.37 ? -55  DG  I "C4'" 1 
ATOM   6410  O  "O4'" . DG  I 5 18  ? 16.774  -11.783 43.700 1.00 104.29 ? -55  DG  I "O4'" 1 
ATOM   6411  C  "C3'" . DG  I 5 18  ? 14.621  -11.471 42.870 1.00 103.97 ? -55  DG  I "C3'" 1 
ATOM   6412  O  "O3'" . DG  I 5 18  ? 13.598  -10.559 43.209 1.00 103.55 ? -55  DG  I "O3'" 1 
ATOM   6413  C  "C2'" . DG  I 5 18  ? 15.654  -10.846 41.925 1.00 103.86 ? -55  DG  I "C2'" 1 
ATOM   6414  C  "C1'" . DG  I 5 18  ? 16.846  -10.661 42.854 1.00 103.70 ? -55  DG  I "C1'" 1 
ATOM   6415  N  N9    . DG  I 5 18  ? 18.143  -10.555 42.189 1.00 103.50 ? -55  DG  I N9    1 
ATOM   6416  C  C8    . DG  I 5 18  ? 18.804  -11.515 41.463 1.00 103.42 ? -55  DG  I C8    1 
ATOM   6417  N  N7    . DG  I 5 18  ? 19.948  -11.111 40.990 1.00 103.48 ? -55  DG  I N7    1 
ATOM   6418  C  C5    . DG  I 5 18  ? 20.048  -9.792  41.422 1.00 103.72 ? -55  DG  I C5    1 
ATOM   6419  C  C6    . DG  I 5 18  ? 21.069  -8.827  41.216 1.00 103.65 ? -55  DG  I C6    1 
ATOM   6420  O  O6    . DG  I 5 18  ? 22.126  -8.956  40.588 1.00 103.58 ? -55  DG  I O6    1 
ATOM   6421  N  N1    . DG  I 5 18  ? 20.779  -7.607  41.829 1.00 103.57 ? -55  DG  I N1    1 
ATOM   6422  C  C2    . DG  I 5 18  ? 19.638  -7.349  42.554 1.00 103.52 ? -55  DG  I C2    1 
ATOM   6423  N  N2    . DG  I 5 18  ? 19.527  -6.121  43.076 1.00 103.55 ? -55  DG  I N2    1 
ATOM   6424  N  N3    . DG  I 5 18  ? 18.674  -8.240  42.755 1.00 103.50 ? -55  DG  I N3    1 
ATOM   6425  C  C4    . DG  I 5 18  ? 18.943  -9.436  42.163 1.00 103.57 ? -55  DG  I C4    1 
ATOM   6426  P  P     . DA  I 5 19  ? 12.458  -10.138 42.179 1.00 103.23 ? -54  DA  I P     1 
ATOM   6427  O  OP1   . DA  I 5 19  ? 11.255  -9.944  43.010 1.00 102.84 ? -54  DA  I OP1   1 
ATOM   6428  O  OP2   . DA  I 5 19  ? 12.411  -11.069 41.029 1.00 102.68 ? -54  DA  I OP2   1 
ATOM   6429  O  "O5'" . DA  I 5 19  ? 13.024  -8.749  41.619 1.00 104.54 ? -54  DA  I "O5'" 1 
ATOM   6430  C  "C5'" . DA  I 5 19  ? 13.053  -7.591  42.448 1.00 107.04 ? -54  DA  I "C5'" 1 
ATOM   6431  C  "C4'" . DA  I 5 19  ? 13.844  -6.457  41.816 1.00 108.79 ? -54  DA  I "C4'" 1 
ATOM   6432  O  "O4'" . DA  I 5 19  ? 15.190  -6.920  41.540 1.00 109.14 ? -54  DA  I "O4'" 1 
ATOM   6433  C  "C3'" . DA  I 5 19  ? 13.301  -5.907  40.493 1.00 109.94 ? -54  DA  I "C3'" 1 
ATOM   6434  O  "O3'" . DA  I 5 19  ? 13.389  -4.478  40.473 1.00 111.66 ? -54  DA  I "O3'" 1 
ATOM   6435  C  "C2'" . DA  I 5 19  ? 14.247  -6.528  39.473 1.00 109.85 ? -54  DA  I "C2'" 1 
ATOM   6436  C  "C1'" . DA  I 5 19  ? 15.532  -6.400  40.278 1.00 109.97 ? -54  DA  I "C1'" 1 
ATOM   6437  N  N9    . DA  I 5 19  ? 16.686  -7.103  39.739 1.00 109.94 ? -54  DA  I N9    1 
ATOM   6438  C  C8    . DA  I 5 19  ? 16.821  -8.437  39.481 1.00 109.99 ? -54  DA  I C8    1 
ATOM   6439  N  N7    . DA  I 5 19  ? 17.991  -8.760  38.991 1.00 109.97 ? -54  DA  I N7    1 
ATOM   6440  C  C5    . DA  I 5 19  ? 18.668  -7.554  38.926 1.00 110.27 ? -54  DA  I C5    1 
ATOM   6441  C  C6    . DA  I 5 19  ? 19.967  -7.203  38.493 1.00 110.25 ? -54  DA  I C6    1 
ATOM   6442  N  N6    . DA  I 5 19  ? 20.848  -8.095  38.027 1.00 110.02 ? -54  DA  I N6    1 
ATOM   6443  N  N1    . DA  I 5 19  ? 20.327  -5.897  38.565 1.00 110.21 ? -54  DA  I N1    1 
ATOM   6444  C  C2    . DA  I 5 19  ? 19.447  -5.000  39.038 1.00 110.15 ? -54  DA  I C2    1 
ATOM   6445  N  N3    . DA  I 5 19  ? 18.200  -5.208  39.466 1.00 110.29 ? -54  DA  I N3    1 
ATOM   6446  C  C4    . DA  I 5 19  ? 17.874  -6.517  39.384 1.00 110.30 ? -54  DA  I C4    1 
ATOM   6447  P  P     . DT  I 5 20  ? 12.501  -3.608  39.460 1.00 113.47 ? -53  DT  I P     1 
ATOM   6448  O  OP1   . DT  I 5 20  ? 11.122  -3.579  40.002 1.00 113.27 ? -53  DT  I OP1   1 
ATOM   6449  O  OP2   . DT  I 5 20  ? 12.740  -4.105  38.088 1.00 113.50 ? -53  DT  I OP2   1 
ATOM   6450  O  "O5'" . DT  I 5 20  ? 13.116  -2.128  39.533 1.00 114.80 ? -53  DT  I "O5'" 1 
ATOM   6451  C  "C5'" . DT  I 5 20  ? 14.458  -1.879  39.959 1.00 117.25 ? -53  DT  I "C5'" 1 
ATOM   6452  C  "C4'" . DT  I 5 20  ? 15.477  -1.853  38.822 1.00 119.13 ? -53  DT  I "C4'" 1 
ATOM   6453  O  "O4'" . DT  I 5 20  ? 15.956  -3.187  38.501 1.00 119.38 ? -53  DT  I "O4'" 1 
ATOM   6454  C  "C3'" . DT  I 5 20  ? 15.048  -1.226  37.483 1.00 120.17 ? -53  DT  I "C3'" 1 
ATOM   6455  O  "O3'" . DT  I 5 20  ? 15.814  -0.028  37.229 1.00 121.37 ? -53  DT  I "O3'" 1 
ATOM   6456  C  "C2'" . DT  I 5 20  ? 15.338  -2.333  36.468 1.00 119.95 ? -53  DT  I "C2'" 1 
ATOM   6457  C  "C1'" . DT  I 5 20  ? 16.469  -3.039  37.198 1.00 120.07 ? -53  DT  I "C1'" 1 
ATOM   6458  N  N1    . DT  I 5 20  ? 16.895  -4.342  36.623 1.00 120.18 ? -53  DT  I N1    1 
ATOM   6459  C  C2    . DT  I 5 20  ? 18.180  -4.446  36.132 1.00 120.36 ? -53  DT  I C2    1 
ATOM   6460  O  O2    . DT  I 5 20  ? 18.990  -3.534  36.145 1.00 120.46 ? -53  DT  I O2    1 
ATOM   6461  N  N3    . DT  I 5 20  ? 18.491  -5.682  35.622 1.00 120.43 ? -53  DT  I N3    1 
ATOM   6462  C  C4    . DT  I 5 20  ? 17.672  -6.796  35.547 1.00 120.53 ? -53  DT  I C4    1 
ATOM   6463  O  O4    . DT  I 5 20  ? 18.069  -7.852  35.062 1.00 120.28 ? -53  DT  I O4    1 
ATOM   6464  C  C5    . DT  I 5 20  ? 16.333  -6.617  36.076 1.00 120.73 ? -53  DT  I C5    1 
ATOM   6465  C  C7    . DT  I 5 20  ? 15.335  -7.742  36.060 1.00 120.48 ? -53  DT  I C7    1 
ATOM   6466  C  C6    . DT  I 5 20  ? 16.017  -5.411  36.580 1.00 120.58 ? -53  DT  I C6    1 
ATOM   6467  P  P     . DA  I 5 21  ? 15.821  0.758   35.824 1.00 122.23 ? -52  DA  I P     1 
ATOM   6468  O  OP1   . DA  I 5 21  ? 16.290  2.134   36.094 1.00 122.17 ? -52  DA  I OP1   1 
ATOM   6469  O  OP2   . DA  I 5 21  ? 14.524  0.563   35.137 1.00 122.12 ? -52  DA  I OP2   1 
ATOM   6470  O  "O5'" . DA  I 5 21  ? 16.941  -0.021  34.989 1.00 123.20 ? -52  DA  I "O5'" 1 
ATOM   6471  C  "C5'" . DA  I 5 21  ? 18.309  0.046   35.390 1.00 125.08 ? -52  DA  I "C5'" 1 
ATOM   6472  C  "C4'" . DA  I 5 21  ? 19.269  -0.182  34.230 1.00 126.33 ? -52  DA  I "C4'" 1 
ATOM   6473  O  "O4'" . DA  I 5 21  ? 19.508  -1.602  34.036 1.00 126.46 ? -52  DA  I "O4'" 1 
ATOM   6474  C  "C3'" . DA  I 5 21  ? 18.834  0.374   32.873 1.00 127.08 ? -52  DA  I "C3'" 1 
ATOM   6475  O  "O3'" . DA  I 5 21  ? 19.941  1.079   32.305 1.00 128.51 ? -52  DA  I "O3'" 1 
ATOM   6476  C  "C2'" . DA  I 5 21  ? 18.458  -0.883  32.086 1.00 126.90 ? -52  DA  I "C2'" 1 
ATOM   6477  C  "C1'" . DA  I 5 21  ? 19.455  -1.887  32.654 1.00 126.52 ? -52  DA  I "C1'" 1 
ATOM   6478  N  N9    . DA  I 5 21  ? 19.095  -3.293  32.484 1.00 126.44 ? -52  DA  I N9    1 
ATOM   6479  C  C8    . DA  I 5 21  ? 17.948  -3.918  32.893 1.00 126.36 ? -52  DA  I C8    1 
ATOM   6480  N  N7    . DA  I 5 21  ? 17.908  -5.197  32.607 1.00 126.25 ? -52  DA  I N7    1 
ATOM   6481  C  C5    . DA  I 5 21  ? 19.115  -5.430  31.965 1.00 126.38 ? -52  DA  I C5    1 
ATOM   6482  C  C6    . DA  I 5 21  ? 19.696  -6.591  31.404 1.00 126.42 ? -52  DA  I C6    1 
ATOM   6483  N  N6    . DA  I 5 21  ? 19.103  -7.789  31.405 1.00 126.32 ? -52  DA  I N6    1 
ATOM   6484  N  N1    . DA  I 5 21  ? 20.919  -6.476  30.833 1.00 126.51 ? -52  DA  I N1    1 
ATOM   6485  C  C2    . DA  I 5 21  ? 21.523  -5.277  30.823 1.00 126.48 ? -52  DA  I C2    1 
ATOM   6486  N  N3    . DA  I 5 21  ? 21.078  -4.119  31.321 1.00 126.40 ? -52  DA  I N3    1 
ATOM   6487  C  C4    . DA  I 5 21  ? 19.859  -4.264  31.880 1.00 126.36 ? -52  DA  I C4    1 
ATOM   6488  P  P     . DC  I 5 22  ? 19.836  1.938   30.956 1.00 129.84 ? -51  DC  I P     1 
ATOM   6489  O  OP1   . DC  I 5 22  ? 19.935  3.363   31.339 1.00 129.38 ? -51  DC  I OP1   1 
ATOM   6490  O  OP2   . DC  I 5 22  ? 18.665  1.479   30.171 1.00 129.63 ? -51  DC  I OP2   1 
ATOM   6491  O  "O5'" . DC  I 5 22  ? 21.171  1.523   30.164 1.00 130.90 ? -51  DC  I "O5'" 1 
ATOM   6492  C  "C5'" . DC  I 5 22  ? 21.562  0.149   30.000 1.00 132.89 ? -51  DC  I "C5'" 1 
ATOM   6493  C  "C4'" . DC  I 5 22  ? 21.602  -0.319  28.548 1.00 134.34 ? -51  DC  I "C4'" 1 
ATOM   6494  O  "O4'" . DC  I 5 22  ? 21.309  -1.740  28.516 1.00 134.60 ? -51  DC  I "O4'" 1 
ATOM   6495  C  "C3'" . DC  I 5 22  ? 20.614  0.362   27.592 1.00 135.49 ? -51  DC  I "C3'" 1 
ATOM   6496  O  "O3'" . DC  I 5 22  ? 21.290  1.080   26.514 1.00 137.06 ? -51  DC  I "O3'" 1 
ATOM   6497  C  "C2'" . DC  I 5 22  ? 19.650  -0.735  27.135 1.00 135.28 ? -51  DC  I "C2'" 1 
ATOM   6498  C  "C1'" . DC  I 5 22  ? 20.342  -2.040  27.526 1.00 135.08 ? -51  DC  I "C1'" 1 
ATOM   6499  N  N1    . DC  I 5 22  ? 19.397  -3.103  28.032 1.00 135.24 ? -51  DC  I N1    1 
ATOM   6500  C  C2    . DC  I 5 22  ? 19.773  -4.463  28.030 1.00 135.37 ? -51  DC  I C2    1 
ATOM   6501  O  O2    . DC  I 5 22  ? 20.892  -4.809  27.623 1.00 135.42 ? -51  DC  I O2    1 
ATOM   6502  N  N3    . DC  I 5 22  ? 18.888  -5.387  28.489 1.00 135.29 ? -51  DC  I N3    1 
ATOM   6503  C  C4    . DC  I 5 22  ? 17.682  -5.011  28.928 1.00 135.28 ? -51  DC  I C4    1 
ATOM   6504  N  N4    . DC  I 5 22  ? 16.855  -5.960  29.372 1.00 135.29 ? -51  DC  I N4    1 
ATOM   6505  C  C5    . DC  I 5 22  ? 17.276  -3.643  28.936 1.00 135.38 ? -51  DC  I C5    1 
ATOM   6506  C  C6    . DC  I 5 22  ? 18.155  -2.739  28.485 1.00 135.34 ? -51  DC  I C6    1 
ATOM   6507  P  P     . DT  I 5 23  ? 21.796  0.479   25.107 1.00 138.15 ? -50  DT  I P     1 
ATOM   6508  O  OP1   . DT  I 5 23  ? 22.799  1.432   24.584 1.00 138.03 ? -50  DT  I OP1   1 
ATOM   6509  O  OP2   . DT  I 5 23  ? 20.612  0.165   24.270 1.00 137.94 ? -50  DT  I OP2   1 
ATOM   6510  O  "O5'" . DT  I 5 23  ? 22.534  -0.891  25.505 1.00 138.94 ? -50  DT  I "O5'" 1 
ATOM   6511  C  "C5'" . DT  I 5 23  ? 23.734  -1.326  24.870 1.00 139.98 ? -50  DT  I "C5'" 1 
ATOM   6512  C  "C4'" . DT  I 5 23  ? 23.437  -2.393  23.834 1.00 140.79 ? -50  DT  I "C4'" 1 
ATOM   6513  O  "O4'" . DT  I 5 23  ? 22.357  -3.249  24.291 1.00 141.27 ? -50  DT  I "O4'" 1 
ATOM   6514  C  "C3'" . DT  I 5 23  ? 23.019  -1.843  22.475 1.00 141.25 ? -50  DT  I "C3'" 1 
ATOM   6515  O  "O3'" . DT  I 5 23  ? 23.924  -2.343  21.498 1.00 141.60 ? -50  DT  I "O3'" 1 
ATOM   6516  C  "C2'" . DT  I 5 23  ? 21.585  -2.338  22.268 1.00 141.49 ? -50  DT  I "C2'" 1 
ATOM   6517  C  "C1'" . DT  I 5 23  ? 21.473  -3.524  23.222 1.00 141.55 ? -50  DT  I "C1'" 1 
ATOM   6518  N  N1    . DT  I 5 23  ? 20.092  -3.774  23.788 1.00 141.57 ? -50  DT  I N1    1 
ATOM   6519  C  C2    . DT  I 5 23  ? 19.760  -5.038  24.251 1.00 141.54 ? -50  DT  I C2    1 
ATOM   6520  O  O2    . DT  I 5 23  ? 20.519  -5.991  24.233 1.00 141.56 ? -50  DT  I O2    1 
ATOM   6521  N  N3    . DT  I 5 23  ? 18.484  -5.155  24.749 1.00 141.53 ? -50  DT  I N3    1 
ATOM   6522  C  C4    . DT  I 5 23  ? 17.523  -4.161  24.833 1.00 141.61 ? -50  DT  I C4    1 
ATOM   6523  O  O4    . DT  I 5 23  ? 16.409  -4.385  25.300 1.00 141.57 ? -50  DT  I O4    1 
ATOM   6524  C  C5    . DT  I 5 23  ? 17.927  -2.862  24.334 1.00 141.67 ? -50  DT  I C5    1 
ATOM   6525  C  C7    . DT  I 5 23  ? 16.987  -1.691  24.361 1.00 141.59 ? -50  DT  I C7    1 
ATOM   6526  C  C6    . DT  I 5 23  ? 19.173  -2.737  23.847 1.00 141.66 ? -50  DT  I C6    1 
ATOM   6527  P  P     . DA  I 5 24  ? 23.816  -1.975  19.941 1.00 141.98 ? -49  DA  I P     1 
ATOM   6528  O  OP1   . DA  I 5 24  ? 25.203  -1.914  19.424 1.00 142.04 ? -49  DA  I OP1   1 
ATOM   6529  O  OP2   . DA  I 5 24  ? 22.904  -0.819  19.755 1.00 141.73 ? -49  DA  I OP2   1 
ATOM   6530  O  "O5'" . DA  I 5 24  ? 23.095  -3.267  19.330 1.00 141.77 ? -49  DA  I "O5'" 1 
ATOM   6531  C  "C5'" . DA  I 5 24  ? 23.620  -4.580  19.541 1.00 141.41 ? -49  DA  I "C5'" 1 
ATOM   6532  C  "C4'" . DA  I 5 24  ? 22.612  -5.633  19.113 1.00 141.25 ? -49  DA  I "C4'" 1 
ATOM   6533  O  "O4'" . DA  I 5 24  ? 21.588  -5.786  20.132 1.00 141.44 ? -49  DA  I "O4'" 1 
ATOM   6534  C  "C3'" . DA  I 5 24  ? 21.876  -5.337  17.804 1.00 140.94 ? -49  DA  I "C3'" 1 
ATOM   6535  O  "O3'" . DA  I 5 24  ? 21.990  -6.466  16.935 1.00 140.36 ? -49  DA  I "O3'" 1 
ATOM   6536  C  "C2'" . DA  I 5 24  ? 20.434  -5.084  18.245 1.00 141.13 ? -49  DA  I "C2'" 1 
ATOM   6537  C  "C1'" . DA  I 5 24  ? 20.351  -5.976  19.476 1.00 141.42 ? -49  DA  I "C1'" 1 
ATOM   6538  N  N9    . DA  I 5 24  ? 19.228  -5.675  20.369 1.00 141.54 ? -49  DA  I N9    1 
ATOM   6539  C  C8    . DA  I 5 24  ? 18.785  -4.444  20.781 1.00 141.49 ? -49  DA  I C8    1 
ATOM   6540  N  N7    . DA  I 5 24  ? 17.744  -4.490  21.578 1.00 141.35 ? -49  DA  I N7    1 
ATOM   6541  C  C5    . DA  I 5 24  ? 17.485  -5.844  21.704 1.00 141.46 ? -49  DA  I C5    1 
ATOM   6542  C  C6    . DA  I 5 24  ? 16.503  -6.565  22.417 1.00 141.43 ? -49  DA  I C6    1 
ATOM   6543  N  N6    . DA  I 5 24  ? 15.570  -5.979  23.172 1.00 141.43 ? -49  DA  I N6    1 
ATOM   6544  N  N1    . DA  I 5 24  ? 16.517  -7.915  22.326 1.00 141.46 ? -49  DA  I N1    1 
ATOM   6545  C  C2    . DA  I 5 24  ? 17.451  -8.506  21.565 1.00 141.43 ? -49  DA  I C2    1 
ATOM   6546  N  N3    . DA  I 5 24  ? 18.424  -7.934  20.852 1.00 141.40 ? -49  DA  I N3    1 
ATOM   6547  C  C4    . DA  I 5 24  ? 18.386  -6.591  20.962 1.00 141.46 ? -49  DA  I C4    1 
ATOM   6548  P  P     . DC  I 5 25  ? 21.380  -6.500  15.448 1.00 139.46 ? -48  DC  I P     1 
ATOM   6549  O  OP1   . DC  I 5 25  ? 22.366  -7.201  14.592 1.00 139.31 ? -48  DC  I OP1   1 
ATOM   6550  O  OP2   . DC  I 5 25  ? 20.896  -5.146  15.081 1.00 139.20 ? -48  DC  I OP2   1 
ATOM   6551  O  "O5'" . DC  I 5 25  ? 20.104  -7.449  15.608 1.00 138.02 ? -48  DC  I "O5'" 1 
ATOM   6552  C  "C5'" . DC  I 5 25  ? 20.209  -8.718  16.249 1.00 135.74 ? -48  DC  I "C5'" 1 
ATOM   6553  C  "C4'" . DC  I 5 25  ? 18.821  -9.261  16.528 1.00 134.25 ? -48  DC  I "C4'" 1 
ATOM   6554  O  "O4'" . DC  I 5 25  ? 18.172  -8.481  17.568 1.00 133.99 ? -48  DC  I "O4'" 1 
ATOM   6555  C  "C3'" . DC  I 5 25  ? 17.874  -9.227  15.330 1.00 133.21 ? -48  DC  I "C3'" 1 
ATOM   6556  O  "O3'" . DC  I 5 25  ? 17.326  -10.523 15.134 1.00 131.72 ? -48  DC  I "O3'" 1 
ATOM   6557  C  "C2'" . DC  I 5 25  ? 16.800  -8.216  15.733 1.00 133.29 ? -48  DC  I "C2'" 1 
ATOM   6558  C  "C1'" . DC  I 5 25  ? 16.797  -8.411  17.245 1.00 133.35 ? -48  DC  I "C1'" 1 
ATOM   6559  N  N1    . DC  I 5 25  ? 16.095  -7.352  18.068 1.00 133.12 ? -48  DC  I N1    1 
ATOM   6560  C  C2    . DC  I 5 25  ? 15.024  -7.713  18.908 1.00 132.87 ? -48  DC  I C2    1 
ATOM   6561  O  O2    . DC  I 5 25  ? 14.657  -8.895  18.969 1.00 132.68 ? -48  DC  I O2    1 
ATOM   6562  N  N3    . DC  I 5 25  ? 14.409  -6.746  19.643 1.00 132.98 ? -48  DC  I N3    1 
ATOM   6563  C  C4    . DC  I 5 25  ? 14.818  -5.474  19.572 1.00 133.07 ? -48  DC  I C4    1 
ATOM   6564  N  N4    . DC  I 5 25  ? 14.178  -4.563  20.314 1.00 132.86 ? -48  DC  I N4    1 
ATOM   6565  C  C5    . DC  I 5 25  ? 15.901  -5.083  18.725 1.00 133.11 ? -48  DC  I C5    1 
ATOM   6566  C  C6    . DC  I 5 25  ? 16.503  -6.043  18.004 1.00 133.24 ? -48  DC  I C6    1 
ATOM   6567  P  P     . DC  I 5 26  ? 16.802  -10.986 13.695 1.00 130.30 ? -47  DC  I P     1 
ATOM   6568  O  OP1   . DC  I 5 26  ? 17.448  -12.285 13.404 1.00 130.03 ? -47  DC  I OP1   1 
ATOM   6569  O  OP2   . DC  I 5 26  ? 16.934  -9.845  12.758 1.00 129.96 ? -47  DC  I OP2   1 
ATOM   6570  O  "O5'" . DC  I 5 26  ? 15.236  -11.230 13.918 1.00 129.14 ? -47  DC  I "O5'" 1 
ATOM   6571  C  "C5'" . DC  I 5 26  ? 14.732  -12.058 14.974 1.00 127.24 ? -47  DC  I "C5'" 1 
ATOM   6572  C  "C4'" . DC  I 5 26  ? 13.225  -11.906 15.065 1.00 125.67 ? -47  DC  I "C4'" 1 
ATOM   6573  O  "O4'" . DC  I 5 26  ? 12.874  -10.825 15.964 1.00 125.36 ? -47  DC  I "O4'" 1 
ATOM   6574  C  "C3'" . DC  I 5 26  ? 12.555  -11.585 13.731 1.00 124.81 ? -47  DC  I "C3'" 1 
ATOM   6575  O  "O3'" . DC  I 5 26  ? 11.438  -12.443 13.553 1.00 123.68 ? -47  DC  I "O3'" 1 
ATOM   6576  C  "C2'" . DC  I 5 26  ? 12.170  -10.110 13.829 1.00 124.78 ? -47  DC  I "C2'" 1 
ATOM   6577  C  "C1'" . DC  I 5 26  ? 11.963  -9.946  15.331 1.00 124.97 ? -47  DC  I "C1'" 1 
ATOM   6578  N  N1    . DC  I 5 26  ? 12.215  -8.573  15.875 1.00 124.90 ? -47  DC  I N1    1 
ATOM   6579  C  C2    . DC  I 5 26  ? 11.405  -8.092  16.910 1.00 124.72 ? -47  DC  I C2    1 
ATOM   6580  O  O2    . DC  I 5 26  ? 10.500  -8.809  17.343 1.00 124.87 ? -47  DC  I O2    1 
ATOM   6581  N  N3    . DC  I 5 26  ? 11.635  -6.853  17.415 1.00 124.56 ? -47  DC  I N3    1 
ATOM   6582  C  C4    . DC  I 5 26  ? 12.629  -6.109  16.923 1.00 124.70 ? -47  DC  I C4    1 
ATOM   6583  N  N4    . DC  I 5 26  ? 12.813  -4.895  17.446 1.00 124.70 ? -47  DC  I N4    1 
ATOM   6584  C  C5    . DC  I 5 26  ? 13.471  -6.572  15.868 1.00 124.74 ? -47  DC  I C5    1 
ATOM   6585  C  C6    . DC  I 5 26  ? 13.231  -7.798  15.382 1.00 124.94 ? -47  DC  I C6    1 
ATOM   6586  P  P     . DA  I 5 27  ? 11.623  -13.817 12.748 1.00 122.64 ? -46  DA  I P     1 
ATOM   6587  O  OP1   . DA  I 5 27  ? 13.073  -14.104 12.678 1.00 122.62 ? -46  DA  I OP1   1 
ATOM   6588  O  OP2   . DA  I 5 27  ? 10.819  -13.712 11.509 1.00 122.07 ? -46  DA  I OP2   1 
ATOM   6589  O  "O5'" . DA  I 5 27  ? 10.943  -14.941 13.669 1.00 121.53 ? -46  DA  I "O5'" 1 
ATOM   6590  C  "C5'" . DA  I 5 27  ? 10.794  -14.781 15.084 1.00 119.67 ? -46  DA  I "C5'" 1 
ATOM   6591  C  "C4'" . DA  I 5 27  ? 9.376   -14.371 15.468 1.00 117.94 ? -46  DA  I "C4'" 1 
ATOM   6592  O  "O4'" . DA  I 5 27  ? 9.306   -12.935 15.663 1.00 117.43 ? -46  DA  I "O4'" 1 
ATOM   6593  C  "C3'" . DA  I 5 27  ? 8.279   -14.734 14.469 1.00 116.75 ? -46  DA  I "C3'" 1 
ATOM   6594  O  "O3'" . DA  I 5 27  ? 7.303   -15.490 15.184 1.00 115.74 ? -46  DA  I "O3'" 1 
ATOM   6595  C  "C2'" . DA  I 5 27  ? 7.791   -13.382 13.940 1.00 116.69 ? -46  DA  I "C2'" 1 
ATOM   6596  C  "C1'" . DA  I 5 27  ? 8.112   -12.442 15.095 1.00 117.02 ? -46  DA  I "C1'" 1 
ATOM   6597  N  N9    . DA  I 5 27  ? 8.344   -11.036 14.747 1.00 117.01 ? -46  DA  I N9    1 
ATOM   6598  C  C8    . DA  I 5 27  ? 8.855   -10.526 13.585 1.00 117.00 ? -46  DA  I C8    1 
ATOM   6599  N  N7    . DA  I 5 27  ? 8.957   -9.218  13.572 1.00 116.82 ? -46  DA  I N7    1 
ATOM   6600  C  C5    . DA  I 5 27  ? 8.481   -8.842  14.811 1.00 116.76 ? -46  DA  I C5    1 
ATOM   6601  C  C6    . DA  I 5 27  ? 8.321   -7.585  15.425 1.00 116.95 ? -46  DA  I C6    1 
ATOM   6602  N  N6    . DA  I 5 27  ? 8.643   -6.434  14.831 1.00 117.03 ? -46  DA  I N6    1 
ATOM   6603  N  N1    . DA  I 5 27  ? 7.809   -7.550  16.675 1.00 117.06 ? -46  DA  I N1    1 
ATOM   6604  C  C2    . DA  I 5 27  ? 7.480   -8.704  17.275 1.00 117.04 ? -46  DA  I C2    1 
ATOM   6605  N  N3    . DA  I 5 27  ? 7.589   -9.944  16.797 1.00 116.95 ? -46  DA  I N3    1 
ATOM   6606  C  C4    . DA  I 5 27  ? 8.098   -9.945  15.550 1.00 116.91 ? -46  DA  I C4    1 
ATOM   6607  P  P     . DA  I 5 28  ? 5.802   -15.773 14.689 1.00 115.21 ? -45  DA  I P     1 
ATOM   6608  O  OP1   . DA  I 5 28  ? 5.348   -17.040 15.304 1.00 114.85 ? -45  DA  I OP1   1 
ATOM   6609  O  OP2   . DA  I 5 28  ? 5.699   -15.576 13.223 1.00 115.18 ? -45  DA  I OP2   1 
ATOM   6610  O  "O5'" . DA  I 5 28  ? 5.009   -14.584 15.397 1.00 113.91 ? -45  DA  I "O5'" 1 
ATOM   6611  C  "C5'" . DA  I 5 28  ? 4.921   -14.508 16.819 1.00 111.36 ? -45  DA  I "C5'" 1 
ATOM   6612  C  "C4'" . DA  I 5 28  ? 4.180   -13.244 17.216 1.00 109.26 ? -45  DA  I "C4'" 1 
ATOM   6613  O  "O4'" . DA  I 5 28  ? 4.844   -12.087 16.640 1.00 108.92 ? -45  DA  I "O4'" 1 
ATOM   6614  C  "C3'" . DA  I 5 28  ? 2.729   -13.188 16.749 1.00 107.91 ? -45  DA  I "C3'" 1 
ATOM   6615  O  "O3'" . DA  I 5 28  ? 1.960   -12.541 17.729 1.00 105.81 ? -45  DA  I "O3'" 1 
ATOM   6616  C  "C2'" . DA  I 5 28  ? 2.800   -12.318 15.501 1.00 108.48 ? -45  DA  I "C2'" 1 
ATOM   6617  C  "C1'" . DA  I 5 28  ? 3.914   -11.343 15.876 1.00 109.06 ? -45  DA  I "C1'" 1 
ATOM   6618  N  N9    . DA  I 5 28  ? 4.559   -10.713 14.718 1.00 109.20 ? -45  DA  I N9    1 
ATOM   6619  C  C8    . DA  I 5 28  ? 4.946   -11.325 13.558 1.00 109.31 ? -45  DA  I C8    1 
ATOM   6620  N  N7    . DA  I 5 28  ? 5.496   -10.517 12.684 1.00 109.65 ? -45  DA  I N7    1 
ATOM   6621  C  C5    . DA  I 5 28  ? 5.466   -9.283  13.307 1.00 109.47 ? -45  DA  I C5    1 
ATOM   6622  C  C6    . DA  I 5 28  ? 5.898   -8.002  12.900 1.00 109.26 ? -45  DA  I C6    1 
ATOM   6623  N  N6    . DA  I 5 28  ? 6.470   -7.763  11.718 1.00 109.12 ? -45  DA  I N6    1 
ATOM   6624  N  N1    . DA  I 5 28  ? 5.722   -6.975  13.758 1.00 109.27 ? -45  DA  I N1    1 
ATOM   6625  C  C2    . DA  I 5 28  ? 5.156   -7.221  14.944 1.00 109.21 ? -45  DA  I C2    1 
ATOM   6626  N  N3    . DA  I 5 28  ? 4.707   -8.376  15.434 1.00 109.21 ? -45  DA  I N3    1 
ATOM   6627  C  C4    . DA  I 5 28  ? 4.890   -9.382  14.561 1.00 109.32 ? -45  DA  I C4    1 
ATOM   6628  P  P     . DA  I 5 29  ? 0.753   -13.266 18.468 1.00 103.70 ? -44  DA  I P     1 
ATOM   6629  O  OP1   . DA  I 5 29  ? 1.354   -14.208 19.438 1.00 103.94 ? -44  DA  I OP1   1 
ATOM   6630  O  OP2   . DA  I 5 29  ? -0.241  -13.700 17.460 1.00 103.44 ? -44  DA  I OP2   1 
ATOM   6631  O  "O5'" . DA  I 5 29  ? 0.101   -12.057 19.269 1.00 102.91 ? -44  DA  I "O5'" 1 
ATOM   6632  C  "C5'" . DA  I 5 29  ? -0.559  -11.055 18.529 1.00 101.66 ? -44  DA  I "C5'" 1 
ATOM   6633  C  "C4'" . DA  I 5 29  ? 0.295   -9.815  18.426 1.00 100.55 ? -44  DA  I "C4'" 1 
ATOM   6634  O  "O4'" . DA  I 5 29  ? 1.139   -9.891  17.261 1.00 101.15 ? -44  DA  I "O4'" 1 
ATOM   6635  C  "C3'" . DA  I 5 29  ? -0.552  -8.589  18.194 1.00 100.11 ? -44  DA  I "C3'" 1 
ATOM   6636  O  "O3'" . DA  I 5 29  ? -0.774  -7.982  19.432 1.00 98.53  ? -44  DA  I "O3'" 1 
ATOM   6637  C  "C2'" . DA  I 5 29  ? 0.295   -7.686  17.311 1.00 100.94 ? -44  DA  I "C2'" 1 
ATOM   6638  C  "C1'" . DA  I 5 29  ? 1.428   -8.577  16.827 1.00 101.75 ? -44  DA  I "C1'" 1 
ATOM   6639  N  N9    . DA  I 5 29  ? 1.609   -8.527  15.373 1.00 102.04 ? -44  DA  I N9    1 
ATOM   6640  C  C8    . DA  I 5 29  ? 1.441   -9.544  14.477 1.00 102.20 ? -44  DA  I C8    1 
ATOM   6641  N  N7    . DA  I 5 29  ? 1.685   -9.215  13.233 1.00 102.35 ? -44  DA  I N7    1 
ATOM   6642  C  C5    . DA  I 5 29  ? 2.030   -7.881  13.315 1.00 102.26 ? -44  DA  I C5    1 
ATOM   6643  C  C6    . DA  I 5 29  ? 2.403   -6.941  12.340 1.00 102.16 ? -44  DA  I C6    1 
ATOM   6644  N  N6    . DA  I 5 29  ? 2.481   -7.238  11.043 1.00 102.20 ? -44  DA  I N6    1 
ATOM   6645  N  N1    . DA  I 5 29  ? 2.681   -5.682  12.744 1.00 102.24 ? -44  DA  I N1    1 
ATOM   6646  C  C2    . DA  I 5 29  ? 2.602   -5.383  14.046 1.00 102.22 ? -44  DA  I C2    1 
ATOM   6647  N  N3    . DA  I 5 29  ? 2.267   -6.188  15.054 1.00 102.43 ? -44  DA  I N3    1 
ATOM   6648  C  C4    . DA  I 5 29  ? 1.984   -7.434  14.622 1.00 102.24 ? -44  DA  I C4    1 
ATOM   6649  P  P     . DA  I 5 30  ? -2.218  -7.396  19.770 1.00 97.38  ? -43  DA  I P     1 
ATOM   6650  O  OP1   . DA  I 5 30  ? -2.231  -7.218  21.237 1.00 97.19  ? -43  DA  I OP1   1 
ATOM   6651  O  OP2   . DA  I 5 30  ? -3.239  -8.226  19.082 1.00 96.96  ? -43  DA  I OP2   1 
ATOM   6652  O  "O5'" . DA  I 5 30  ? -2.233  -5.955  19.081 1.00 95.62  ? -43  DA  I "O5'" 1 
ATOM   6653  C  "C5'" . DA  I 5 30  ? -1.200  -5.023  19.345 1.00 93.96  ? -43  DA  I "C5'" 1 
ATOM   6654  C  "C4'" . DA  I 5 30  ? -1.138  -4.015  18.218 1.00 93.28  ? -43  DA  I "C4'" 1 
ATOM   6655  O  "O4'" . DA  I 5 30  ? -0.567  -4.634  17.038 1.00 93.23  ? -43  DA  I "O4'" 1 
ATOM   6656  C  "C3'" . DA  I 5 30  ? -2.498  -3.452  17.814 1.00 92.50  ? -43  DA  I "C3'" 1 
ATOM   6657  O  "O3'" . DA  I 5 30  ? -2.538  -2.084  18.202 1.00 91.34  ? -43  DA  I "O3'" 1 
ATOM   6658  C  "C2'" . DA  I 5 30  ? -2.576  -3.671  16.300 1.00 92.52  ? -43  DA  I "C2'" 1 
ATOM   6659  C  "C1'" . DA  I 5 30  ? -1.161  -4.074  15.888 1.00 92.61  ? -43  DA  I "C1'" 1 
ATOM   6660  N  N9    . DA  I 5 30  ? -1.123  -5.045  14.790 1.00 92.66  ? -43  DA  I N9    1 
ATOM   6661  C  C8    . DA  I 5 30  ? -1.547  -6.348  14.808 1.00 92.59  ? -43  DA  I C8    1 
ATOM   6662  N  N7    . DA  I 5 30  ? -1.394  -6.981  13.672 1.00 92.37  ? -43  DA  I N7    1 
ATOM   6663  C  C5    . DA  I 5 30  ? -0.835  -6.026  12.846 1.00 92.35  ? -43  DA  I C5    1 
ATOM   6664  C  C6    . DA  I 5 30  ? -0.430  -6.056  11.503 1.00 92.24  ? -43  DA  I C6    1 
ATOM   6665  N  N6    . DA  I 5 30  ? -0.533  -7.135  10.732 1.00 92.53  ? -43  DA  I N6    1 
ATOM   6666  N  N1    . DA  I 5 30  ? 0.096   -4.937  10.971 1.00 92.59  ? -43  DA  I N1    1 
ATOM   6667  C  C2    . DA  I 5 30  ? 0.211   -3.846  11.737 1.00 92.57  ? -43  DA  I C2    1 
ATOM   6668  N  N3    . DA  I 5 30  ? -0.140  -3.693  13.011 1.00 92.73  ? -43  DA  I N3    1 
ATOM   6669  C  C4    . DA  I 5 30  ? -0.658  -4.829  13.514 1.00 92.72  ? -43  DA  I C4    1 
ATOM   6670  P  P     . DG  I 5 31  ? -3.793  -1.135  17.948 1.00 91.25  ? -42  DG  I P     1 
ATOM   6671  O  OP1   . DG  I 5 31  ? -3.762  -0.062  18.964 1.00 91.93  ? -42  DG  I OP1   1 
ATOM   6672  O  OP2   . DG  I 5 31  ? -5.025  -1.930  17.766 1.00 91.33  ? -42  DG  I OP2   1 
ATOM   6673  O  "O5'" . DG  I 5 31  ? -3.411  -0.504  16.540 1.00 93.28  ? -42  DG  I "O5'" 1 
ATOM   6674  C  "C5'" . DG  I 5 31  ? -2.108  0.032   16.335 1.00 96.06  ? -42  DG  I "C5'" 1 
ATOM   6675  C  "C4'" . DG  I 5 31  ? -1.969  0.607   14.936 1.00 97.73  ? -42  DG  I "C4'" 1 
ATOM   6676  O  "O4'" . DG  I 5 31  ? -1.665  -0.442  13.984 1.00 98.21  ? -42  DG  I "O4'" 1 
ATOM   6677  C  "C3'" . DG  I 5 31  ? -3.198  1.343   14.410 1.00 98.45  ? -42  DG  I "C3'" 1 
ATOM   6678  O  "O3'" . DG  I 5 31  ? -2.742  2.555   13.833 1.00 99.27  ? -42  DG  I "O3'" 1 
ATOM   6679  C  "C2'" . DG  I 5 31  ? -3.800  0.378   13.390 1.00 98.65  ? -42  DG  I "C2'" 1 
ATOM   6680  C  "C1'" . DG  I 5 31  ? -2.562  -0.363  12.898 1.00 99.66  ? -42  DG  I "C1'" 1 
ATOM   6681  N  N9    . DG  I 5 31  ? -2.825  -1.722  12.452 1.00 99.93  ? -42  DG  I N9    1 
ATOM   6682  C  C8    . DG  I 5 31  ? -3.394  -2.741  13.173 1.00 100.14 ? -42  DG  I C8    1 
ATOM   6683  N  N7    . DG  I 5 31  ? -3.500  -3.858  12.510 1.00 100.40 ? -42  DG  I N7    1 
ATOM   6684  C  C5    . DG  I 5 31  ? -2.968  -3.557  11.264 1.00 100.45 ? -42  DG  I C5    1 
ATOM   6685  C  C6    . DG  I 5 31  ? -2.815  -4.371  10.115 1.00 100.24 ? -42  DG  I C6    1 
ATOM   6686  O  O6    . DG  I 5 31  ? -3.132  -5.559  9.986  1.00 100.20 ? -42  DG  I O6    1 
ATOM   6687  N  N1    . DG  I 5 31  ? -2.222  -3.682  9.052  1.00 100.23 ? -42  DG  I N1    1 
ATOM   6688  C  C2    . DG  I 5 31  ? -1.831  -2.358  9.098  1.00 100.30 ? -42  DG  I C2    1 
ATOM   6689  N  N2    . DG  I 5 31  ? -1.283  -1.850  7.985  1.00 100.28 ? -42  DG  I N2    1 
ATOM   6690  N  N3    . DG  I 5 31  ? -1.974  -1.581  10.169 1.00 100.52 ? -42  DG  I N3    1 
ATOM   6691  C  C4    . DG  I 5 31  ? -2.546  -2.244  11.212 1.00 100.43 ? -42  DG  I C4    1 
ATOM   6692  P  P     . DT  I 5 32  ? -3.727  3.648   13.214 1.00 99.51  ? -41  DT  I P     1 
ATOM   6693  O  OP1   . DT  I 5 32  ? -3.009  4.937   13.309 1.00 99.56  ? -41  DT  I OP1   1 
ATOM   6694  O  OP2   . DT  I 5 32  ? -5.073  3.515   13.812 1.00 99.33  ? -41  DT  I OP2   1 
ATOM   6695  O  "O5'" . DT  I 5 32  ? -3.815  3.188   11.683 1.00 101.23 ? -41  DT  I "O5'" 1 
ATOM   6696  C  "C5'" . DT  I 5 32  ? -2.628  2.898   10.928 1.00 103.26 ? -41  DT  I "C5'" 1 
ATOM   6697  C  "C4'" . DT  I 5 32  ? -2.878  2.808   9.426  1.00 104.77 ? -41  DT  I "C4'" 1 
ATOM   6698  O  "O4'" . DT  I 5 32  ? -3.038  1.430   9.001  1.00 104.81 ? -41  DT  I "O4'" 1 
ATOM   6699  C  "C3'" . DT  I 5 32  ? -4.092  3.560   8.892  1.00 105.91 ? -41  DT  I "C3'" 1 
ATOM   6700  O  "O3'" . DT  I 5 32  ? -3.693  4.251   7.726  1.00 107.95 ? -41  DT  I "O3'" 1 
ATOM   6701  C  "C2'" . DT  I 5 32  ? -5.121  2.471   8.593  1.00 105.30 ? -41  DT  I "C2'" 1 
ATOM   6702  C  "C1'" . DT  I 5 32  ? -4.252  1.257   8.297  1.00 104.81 ? -41  DT  I "C1'" 1 
ATOM   6703  N  N1    . DT  I 5 32  ? -4.825  -0.042  8.761  1.00 104.88 ? -41  DT  I N1    1 
ATOM   6704  C  C2    . DT  I 5 32  ? -4.608  -1.187  8.016  1.00 104.81 ? -41  DT  I C2    1 
ATOM   6705  O  O2    . DT  I 5 32  ? -3.974  -1.211  6.976  1.00 104.71 ? -41  DT  I O2    1 
ATOM   6706  N  N3    . DT  I 5 32  ? -5.168  -2.326  8.544  1.00 104.69 ? -41  DT  I N3    1 
ATOM   6707  C  C4    . DT  I 5 32  ? -5.904  -2.429  9.712  1.00 104.59 ? -41  DT  I C4    1 
ATOM   6708  O  O4    . DT  I 5 32  ? -6.366  -3.496  10.096 1.00 104.69 ? -41  DT  I O4    1 
ATOM   6709  C  C5    . DT  I 5 32  ? -6.093  -1.200  10.443 1.00 104.73 ? -41  DT  I C5    1 
ATOM   6710  C  C7    . DT  I 5 32  ? -6.873  -1.186  11.726 1.00 104.90 ? -41  DT  I C7    1 
ATOM   6711  C  C6    . DT  I 5 32  ? -5.549  -0.082  9.942  1.00 104.82 ? -41  DT  I C6    1 
ATOM   6712  P  P     . DG  I 5 33  ? -4.680  5.241   6.957  1.00 109.53 ? -40  DG  I P     1 
ATOM   6713  O  OP1   . DG  I 5 33  ? -3.817  6.249   6.306  1.00 109.48 ? -40  DG  I OP1   1 
ATOM   6714  O  OP2   . DG  I 5 33  ? -5.761  5.688   7.869  1.00 108.88 ? -40  DG  I OP2   1 
ATOM   6715  O  "O5'" . DG  I 5 33  ? -5.326  4.268   5.856  1.00 111.76 ? -40  DG  I "O5'" 1 
ATOM   6716  C  "C5'" . DG  I 5 33  ? -4.562  3.756   4.752  1.00 115.03 ? -40  DG  I "C5'" 1 
ATOM   6717  C  "C4'" . DG  I 5 33  ? -5.412  2.887   3.831  1.00 117.53 ? -40  DG  I "C4'" 1 
ATOM   6718  O  "O4'" . DG  I 5 33  ? -5.577  1.571   4.428  1.00 118.37 ? -40  DG  I "O4'" 1 
ATOM   6719  C  "C3'" . DG  I 5 33  ? -6.823  3.408   3.529  1.00 118.93 ? -40  DG  I "C3'" 1 
ATOM   6720  O  "O3'" . DG  I 5 33  ? -7.115  3.336   2.136  1.00 120.69 ? -40  DG  I "O3'" 1 
ATOM   6721  C  "C2'" . DG  I 5 33  ? -7.736  2.469   4.307  1.00 119.24 ? -40  DG  I "C2'" 1 
ATOM   6722  C  "C1'" . DG  I 5 33  ? -6.927  1.176   4.278  1.00 119.39 ? -40  DG  I "C1'" 1 
ATOM   6723  N  N9    . DG  I 5 33  ? -7.320  0.229   5.323  1.00 119.49 ? -40  DG  I N9    1 
ATOM   6724  C  C8    . DG  I 5 33  ? -7.683  0.525   6.616  1.00 119.45 ? -40  DG  I C8    1 
ATOM   6725  N  N7    . DG  I 5 33  ? -7.996  -0.521  7.323  1.00 119.44 ? -40  DG  I N7    1 
ATOM   6726  C  C5    . DG  I 5 33  ? -7.836  -1.582  6.445  1.00 119.61 ? -40  DG  I C5    1 
ATOM   6727  C  C6    . DG  I 5 33  ? -8.031  -2.973  6.646  1.00 119.73 ? -40  DG  I C6    1 
ATOM   6728  O  O6    . DG  I 5 33  ? -8.397  -3.543  7.680  1.00 119.67 ? -40  DG  I O6    1 
ATOM   6729  N  N1    . DG  I 5 33  ? -7.760  -3.725  5.501  1.00 119.62 ? -40  DG  I N1    1 
ATOM   6730  C  C2    . DG  I 5 33  ? -7.350  -3.189  4.303  1.00 119.51 ? -40  DG  I C2    1 
ATOM   6731  N  N2    . DG  I 5 33  ? -7.134  -4.060  3.307  1.00 119.54 ? -40  DG  I N2    1 
ATOM   6732  N  N3    . DG  I 5 33  ? -7.162  -1.887  4.101  1.00 119.74 ? -40  DG  I N3    1 
ATOM   6733  C  C4    . DG  I 5 33  ? -7.422  -1.140  5.208  1.00 119.63 ? -40  DG  I C4    1 
ATOM   6734  P  P     . DT  I 5 34  ? -8.206  4.304   1.461  1.00 122.23 ? -39  DT  I P     1 
ATOM   6735  O  OP1   . DT  I 5 34  ? -8.038  4.133   0.002  1.00 122.49 ? -39  DT  I OP1   1 
ATOM   6736  O  OP2   . DT  I 5 34  ? -8.070  5.658   2.049  1.00 122.31 ? -39  DT  I OP2   1 
ATOM   6737  O  "O5'" . DT  I 5 34  ? -9.626  3.716   1.929  1.00 122.63 ? -39  DT  I "O5'" 1 
ATOM   6738  C  "C5'" . DT  I 5 34  ? -10.730 3.601   1.023  1.00 123.27 ? -39  DT  I "C5'" 1 
ATOM   6739  C  "C4'" . DT  I 5 34  ? -10.650 2.301   0.223  1.00 123.98 ? -39  DT  I "C4'" 1 
ATOM   6740  O  "O4'" . DT  I 5 34  ? -10.123 1.219   1.046  1.00 124.16 ? -39  DT  I "O4'" 1 
ATOM   6741  C  "C3'" . DT  I 5 34  ? -11.962 1.795   -0.375 1.00 124.07 ? -39  DT  I "C3'" 1 
ATOM   6742  O  "O3'" . DT  I 5 34  ? -11.701 1.284   -1.699 1.00 123.68 ? -39  DT  I "O3'" 1 
ATOM   6743  C  "C2'" . DT  I 5 34  ? -12.401 0.743   0.647  1.00 124.42 ? -39  DT  I "C2'" 1 
ATOM   6744  C  "C1'" . DT  I 5 34  ? -11.070 0.168   1.139  1.00 124.54 ? -39  DT  I "C1'" 1 
ATOM   6745  N  N1    . DT  I 5 34  ? -11.082 -0.394  2.554  1.00 124.77 ? -39  DT  I N1    1 
ATOM   6746  C  C2    . DT  I 5 34  ? -10.254 -1.460  2.876  1.00 124.60 ? -39  DT  I C2    1 
ATOM   6747  O  O2    . DT  I 5 34  ? -9.494  -1.995  2.088  1.00 124.65 ? -39  DT  I O2    1 
ATOM   6748  N  N3    . DT  I 5 34  ? -10.344 -1.890  4.178  1.00 124.35 ? -39  DT  I N3    1 
ATOM   6749  C  C4    . DT  I 5 34  ? -11.156 -1.380  5.175  1.00 124.51 ? -39  DT  I C4    1 
ATOM   6750  O  O4    . DT  I 5 34  ? -11.147 -1.852  6.307  1.00 124.58 ? -39  DT  I O4    1 
ATOM   6751  C  C5    . DT  I 5 34  ? -12.003 -0.272  4.785  1.00 124.70 ? -39  DT  I C5    1 
ATOM   6752  C  C7    . DT  I 5 34  ? -12.935 0.378   5.770  1.00 124.62 ? -39  DT  I C7    1 
ATOM   6753  C  C6    . DT  I 5 34  ? -11.922 0.159   3.515  1.00 124.83 ? -39  DT  I C6    1 
ATOM   6754  P  P     . DA  I 5 35  ? -12.518 0.110   -2.433 1.00 123.51 ? -38  DA  I P     1 
ATOM   6755  O  OP1   . DA  I 5 35  ? -12.112 0.158   -3.853 1.00 123.71 ? -38  DA  I OP1   1 
ATOM   6756  O  OP2   . DA  I 5 35  ? -13.952 0.233   -2.085 1.00 123.37 ? -38  DA  I OP2   1 
ATOM   6757  O  "O5'" . DA  I 5 35  ? -11.939 -1.249  -1.797 1.00 123.17 ? -38  DA  I "O5'" 1 
ATOM   6758  C  "C5'" . DA  I 5 35  ? -11.832 -2.461  -2.559 1.00 122.37 ? -38  DA  I "C5'" 1 
ATOM   6759  C  "C4'" . DA  I 5 35  ? -12.760 -3.558  -2.047 1.00 121.83 ? -38  DA  I "C4'" 1 
ATOM   6760  O  "O4'" . DA  I 5 35  ? -12.753 -3.602  -0.588 1.00 122.03 ? -38  DA  I "O4'" 1 
ATOM   6761  C  "C3'" . DA  I 5 35  ? -14.228 -3.426  -2.476 1.00 121.13 ? -38  DA  I "C3'" 1 
ATOM   6762  O  "O3'" . DA  I 5 35  ? -14.718 -4.684  -3.011 1.00 119.61 ? -38  DA  I "O3'" 1 
ATOM   6763  C  "C2'" . DA  I 5 35  ? -14.912 -2.996  -1.178 1.00 121.65 ? -38  DA  I "C2'" 1 
ATOM   6764  C  "C1'" . DA  I 5 35  ? -14.090 -3.775  -0.155 1.00 122.20 ? -38  DA  I "C1'" 1 
ATOM   6765  N  N9    . DA  I 5 35  ? -14.308 -3.349  1.235  1.00 122.40 ? -38  DA  I N9    1 
ATOM   6766  C  C8    . DA  I 5 35  ? -14.123 -2.101  1.773  1.00 122.52 ? -38  DA  I C8    1 
ATOM   6767  N  N7    . DA  I 5 35  ? -14.416 -2.010  3.051  1.00 122.50 ? -38  DA  I N7    1 
ATOM   6768  C  C5    . DA  I 5 35  ? -14.824 -3.290  3.382  1.00 122.35 ? -38  DA  I C5    1 
ATOM   6769  C  C6    . DA  I 5 35  ? -15.265 -3.863  4.593  1.00 122.19 ? -38  DA  I C6    1 
ATOM   6770  N  N6    . DA  I 5 35  ? -15.367 -3.176  5.732  1.00 122.28 ? -38  DA  I N6    1 
ATOM   6771  N  N1    . DA  I 5 35  ? -15.602 -5.171  4.591  1.00 122.38 ? -38  DA  I N1    1 
ATOM   6772  C  C2    . DA  I 5 35  ? -15.502 -5.864  3.445  1.00 122.48 ? -38  DA  I C2    1 
ATOM   6773  N  N3    . DA  I 5 35  ? -15.096 -5.435  2.246  1.00 122.34 ? -38  DA  I N3    1 
ATOM   6774  C  C4    . DA  I 5 35  ? -14.769 -4.128  2.278  1.00 122.38 ? -38  DA  I C4    1 
ATOM   6775  P  P     . DT  I 5 36  ? -16.270 -5.121  -3.086 1.00 118.41 ? -37  DT  I P     1 
ATOM   6776  O  OP1   . DT  I 5 36  ? -16.344 -6.224  -4.069 1.00 118.04 ? -37  DT  I OP1   1 
ATOM   6777  O  OP2   . DT  I 5 36  ? -17.134 -3.927  -3.258 1.00 118.04 ? -37  DT  I OP2   1 
ATOM   6778  O  "O5'" . DT  I 5 36  ? -16.568 -5.692  -1.615 1.00 117.74 ? -37  DT  I "O5'" 1 
ATOM   6779  C  "C5'" . DT  I 5 36  ? -16.559 -7.089  -1.297 1.00 116.11 ? -37  DT  I "C5'" 1 
ATOM   6780  C  "C4'" . DT  I 5 36  ? -17.669 -7.435  -0.309 1.00 115.03 ? -37  DT  I "C4'" 1 
ATOM   6781  O  "O4'" . DT  I 5 36  ? -17.488 -6.694  0.931  1.00 114.61 ? -37  DT  I "O4'" 1 
ATOM   6782  C  "C3'" . DT  I 5 36  ? -19.098 -7.152  -0.791 1.00 114.20 ? -37  DT  I "C3'" 1 
ATOM   6783  O  "O3'" . DT  I 5 36  ? -19.910 -8.351  -0.656 1.00 112.89 ? -37  DT  I "O3'" 1 
ATOM   6784  C  "C2'" . DT  I 5 36  ? -19.528 -5.949  0.052  1.00 114.26 ? -37  DT  I "C2'" 1 
ATOM   6785  C  "C1'" . DT  I 5 36  ? -18.729 -6.147  1.340  1.00 114.11 ? -37  DT  I "C1'" 1 
ATOM   6786  N  N1    . DT  I 5 36  ? -18.513 -4.891  2.158  1.00 113.97 ? -37  DT  I N1    1 
ATOM   6787  C  C2    . DT  I 5 36  ? -18.686 -4.912  3.539  1.00 113.70 ? -37  DT  I C2    1 
ATOM   6788  O  O2    . DT  I 5 36  ? -19.003 -5.899  4.185  1.00 113.39 ? -37  DT  I O2    1 
ATOM   6789  N  N3    . DT  I 5 36  ? -18.459 -3.706  4.158  1.00 113.57 ? -37  DT  I N3    1 
ATOM   6790  C  C4    . DT  I 5 36  ? -18.090 -2.512  3.560  1.00 113.61 ? -37  DT  I C4    1 
ATOM   6791  O  O4    . DT  I 5 36  ? -17.909 -1.490  4.211  1.00 113.51 ? -37  DT  I O4    1 
ATOM   6792  C  C5    . DT  I 5 36  ? -17.930 -2.555  2.125  1.00 113.70 ? -37  DT  I C5    1 
ATOM   6793  C  C7    . DT  I 5 36  ? -17.536 -1.325  1.360  1.00 113.75 ? -37  DT  I C7    1 
ATOM   6794  C  C6    . DT  I 5 36  ? -18.147 -3.723  1.504  1.00 113.83 ? -37  DT  I C6    1 
ATOM   6795  P  P     . DT  I 5 37  ? -21.388 -8.452  -0.025 1.00 111.95 ? -36  DT  I P     1 
ATOM   6796  O  OP1   . DT  I 5 37  ? -21.933 -9.779  -0.390 1.00 111.61 ? -36  DT  I OP1   1 
ATOM   6797  O  OP2   . DT  I 5 37  ? -22.183 -7.240  -0.340 1.00 112.20 ? -36  DT  I OP2   1 
ATOM   6798  O  "O5'" . DT  I 5 37  ? -21.070 -8.437  1.541  1.00 110.94 ? -36  DT  I "O5'" 1 
ATOM   6799  C  "C5'" . DT  I 5 37  ? -20.480 -9.569  2.180  1.00 108.93 ? -36  DT  I "C5'" 1 
ATOM   6800  C  "C4'" . DT  I 5 37  ? -20.937 -9.648  3.627  1.00 107.19 ? -36  DT  I "C4'" 1 
ATOM   6801  O  "O4'" . DT  I 5 37  ? -20.724 -8.365  4.272  1.00 107.66 ? -36  DT  I "O4'" 1 
ATOM   6802  C  "C3'" . DT  I 5 37  ? -22.412 -9.983  3.842  1.00 105.53 ? -36  DT  I "C3'" 1 
ATOM   6803  O  "O3'" . DT  I 5 37  ? -22.496 -10.856 4.964  1.00 102.30 ? -36  DT  I "O3'" 1 
ATOM   6804  C  "C2'" . DT  I 5 37  ? -23.070 -8.623  4.101  1.00 106.42 ? -36  DT  I "C2'" 1 
ATOM   6805  C  "C1'" . DT  I 5 37  ? -21.942 -7.887  4.822  1.00 107.67 ? -36  DT  I "C1'" 1 
ATOM   6806  N  N1    . DT  I 5 37  ? -21.936 -6.393  4.712  1.00 107.80 ? -36  DT  I N1    1 
ATOM   6807  C  C2    . DT  I 5 37  ? -21.844 -5.636  5.868  1.00 108.12 ? -36  DT  I C2    1 
ATOM   6808  O  O2    . DT  I 5 37  ? -21.784 -6.098  6.998  1.00 108.31 ? -36  DT  I O2    1 
ATOM   6809  N  N3    . DT  I 5 37  ? -21.830 -4.281  5.658  1.00 108.21 ? -36  DT  I N3    1 
ATOM   6810  C  C4    . DT  I 5 37  ? -21.890 -3.617  4.448  1.00 107.98 ? -36  DT  I C4    1 
ATOM   6811  O  O4    . DT  I 5 37  ? -21.872 -2.392  4.399  1.00 107.83 ? -36  DT  I O4    1 
ATOM   6812  C  C5    . DT  I 5 37  ? -21.980 -4.463  3.276  1.00 108.23 ? -36  DT  I C5    1 
ATOM   6813  C  C7    . DT  I 5 37  ? -22.053 -3.870  1.897  1.00 108.09 ? -36  DT  I C7    1 
ATOM   6814  C  C6    . DT  I 5 37  ? -21.995 -5.794  3.464  1.00 108.06 ? -36  DT  I C6    1 
ATOM   6815  P  P     . DT  I 5 38  ? -23.873 -11.511 5.436  1.00 99.63  ? -35  DT  I P     1 
ATOM   6816  O  OP1   . DT  I 5 38  ? -23.537 -12.827 6.020  1.00 99.70  ? -35  DT  I OP1   1 
ATOM   6817  O  OP2   . DT  I 5 38  ? -24.849 -11.416 4.330  1.00 99.73  ? -35  DT  I OP2   1 
ATOM   6818  O  "O5'" . DT  I 5 38  ? -24.379 -10.512 6.588  1.00 98.70  ? -35  DT  I "O5'" 1 
ATOM   6819  C  "C5'" . DT  I 5 38  ? -23.766 -10.443 7.888  1.00 95.04  ? -35  DT  I "C5'" 1 
ATOM   6820  C  "C4'" . DT  I 5 38  ? -24.380 -9.340  8.745  1.00 92.35  ? -35  DT  I "C4'" 1 
ATOM   6821  O  "O4'" . DT  I 5 38  ? -24.209 -8.048  8.109  1.00 91.99  ? -35  DT  I "O4'" 1 
ATOM   6822  C  "C3'" . DT  I 5 38  ? -25.879 -9.464  9.046  1.00 90.55  ? -35  DT  I "C3'" 1 
ATOM   6823  O  "O3'" . DT  I 5 38  ? -26.125 -9.435  10.463 1.00 87.35  ? -35  DT  I "O3'" 1 
ATOM   6824  C  "C2'" . DT  I 5 38  ? -26.493 -8.243  8.366  1.00 91.10  ? -35  DT  I "C2'" 1 
ATOM   6825  C  "C1'" . DT  I 5 38  ? -25.332 -7.264  8.439  1.00 92.24  ? -35  DT  I "C1'" 1 
ATOM   6826  N  N1    . DT  I 5 38  ? -25.438 -6.115  7.497  1.00 92.57  ? -35  DT  I N1    1 
ATOM   6827  C  C2    . DT  I 5 38  ? -25.506 -4.827  7.995  1.00 92.91  ? -35  DT  I C2    1 
ATOM   6828  O  O2    . DT  I 5 38  ? -25.487 -4.550  9.181  1.00 92.85  ? -35  DT  I O2    1 
ATOM   6829  N  N3    . DT  I 5 38  ? -25.604 -3.852  7.033  1.00 93.14  ? -35  DT  I N3    1 
ATOM   6830  C  C4    . DT  I 5 38  ? -25.638 -4.027  5.659  1.00 92.86  ? -35  DT  I C4    1 
ATOM   6831  O  O4    . DT  I 5 38  ? -25.732 -3.073  4.892  1.00 92.56  ? -35  DT  I O4    1 
ATOM   6832  C  C5    . DT  I 5 38  ? -25.564 -5.402  5.206  1.00 93.11  ? -35  DT  I C5    1 
ATOM   6833  C  C7    . DT  I 5 38  ? -25.594 -5.749  3.745  1.00 92.92  ? -35  DT  I C7    1 
ATOM   6834  C  C6    . DT  I 5 38  ? -25.468 -6.361  6.137  1.00 93.08  ? -35  DT  I C6    1 
ATOM   6835  P  P     . DG  I 5 39  ? -26.133 -10.771 11.348 1.00 83.73  ? -34  DG  I P     1 
ATOM   6836  O  OP1   . DG  I 5 39  ? -24.988 -11.615 10.948 1.00 83.33  ? -34  DG  I OP1   1 
ATOM   6837  O  OP2   . DG  I 5 39  ? -27.508 -11.312 11.325 1.00 83.75  ? -34  DG  I OP2   1 
ATOM   6838  O  "O5'" . DG  I 5 39  ? -25.845 -10.227 12.812 1.00 83.23  ? -34  DG  I "O5'" 1 
ATOM   6839  C  "C5'" . DG  I 5 39  ? -24.731 -9.384  13.039 1.00 83.38  ? -34  DG  I "C5'" 1 
ATOM   6840  C  "C4'" . DG  I 5 39  ? -25.098 -8.234  13.963 1.00 83.59  ? -34  DG  I "C4'" 1 
ATOM   6841  O  "O4'" . DG  I 5 39  ? -25.597 -7.113  13.192 1.00 84.14  ? -34  DG  I "O4'" 1 
ATOM   6842  C  "C3'" . DG  I 5 39  ? -26.170 -8.545  15.001 1.00 82.86  ? -34  DG  I "C3'" 1 
ATOM   6843  O  "O3'" . DG  I 5 39  ? -25.861 -7.864  16.209 1.00 81.11  ? -34  DG  I "O3'" 1 
ATOM   6844  C  "C2'" . DG  I 5 39  ? -27.450 -8.032  14.347 1.00 84.00  ? -34  DG  I "C2'" 1 
ATOM   6845  C  "C1'" . DG  I 5 39  ? -26.945 -6.853  13.528 1.00 85.84  ? -34  DG  I "C1'" 1 
ATOM   6846  N  N9    . DG  I 5 39  ? -27.675 -6.634  12.282 1.00 86.84  ? -34  DG  I N9    1 
ATOM   6847  C  C8    . DG  I 5 39  ? -28.369 -7.550  11.518 1.00 86.91  ? -34  DG  I C8    1 
ATOM   6848  N  N7    . DG  I 5 39  ? -28.911 -7.031  10.449 1.00 87.06  ? -34  DG  I N7    1 
ATOM   6849  C  C5    . DG  I 5 39  ? -28.545 -5.689  10.501 1.00 87.06  ? -34  DG  I C5    1 
ATOM   6850  C  C6    . DG  I 5 39  ? -28.834 -4.621  9.620  1.00 86.67  ? -34  DG  I C6    1 
ATOM   6851  O  O6    . DG  I 5 39  ? -29.497 -4.649  8.578  1.00 86.84  ? -34  DG  I O6    1 
ATOM   6852  N  N1    . DG  I 5 39  ? -28.279 -3.419  10.051 1.00 86.73  ? -34  DG  I N1    1 
ATOM   6853  C  C2    . DG  I 5 39  ? -27.531 -3.261  11.193 1.00 86.68  ? -34  DG  I C2    1 
ATOM   6854  N  N2    . DG  I 5 39  ? -27.071 -2.030  11.453 1.00 86.66  ? -34  DG  I N2    1 
ATOM   6855  N  N3    . DG  I 5 39  ? -27.253 -4.249  12.028 1.00 87.06  ? -34  DG  I N3    1 
ATOM   6856  C  C4    . DG  I 5 39  ? -27.789 -5.429  11.623 1.00 87.24  ? -34  DG  I C4    1 
ATOM   6857  P  P     . DG  I 5 40  ? -26.743 -8.040  17.524 1.00 79.91  ? -33  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5 40  ? -25.801 -8.117  18.650 1.00 81.42  ? -33  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5 40  ? -27.744 -9.108  17.345 1.00 80.68  ? -33  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5 40  ? -27.564 -6.685  17.612 1.00 81.54  ? -33  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5 40  ? -26.925 -5.422  17.691 1.00 84.13  ? -33  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5 40  ? -27.944 -4.332  17.416 1.00 86.15  ? -33  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5 40  ? -28.375 -4.448  16.042 1.00 87.15  ? -33  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5 40  ? -29.222 -4.403  18.254 1.00 87.17  ? -33  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5 40  ? -29.634 -3.100  18.587 1.00 87.94  ? -33  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5 40  ? -30.238 -5.040  17.320 1.00 87.64  ? -33  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5 40  ? -29.785 -4.388  16.026 1.00 89.37  ? -33  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5 40  ? -30.302 -4.967  14.790 1.00 90.21  ? -33  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5 40  ? -30.620 -6.277  14.507 1.00 90.44  ? -33  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5 40  ? -31.064 -6.451  13.291 1.00 90.46  ? -33  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5 40  ? -31.042 -5.174  12.736 1.00 90.73  ? -33  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5 40  ? -31.411 -4.720  11.442 1.00 90.44  ? -33  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5 40  ? -31.837 -5.395  10.493 1.00 90.51  ? -33  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5 40  ? -31.227 -3.342  11.288 1.00 90.12  ? -33  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5 40  ? -30.749 -2.504  12.271 1.00 90.39  ? -33  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5 40  ? -30.642 -1.205  11.960 1.00 90.52  ? -33  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5 40  ? -30.402 -2.910  13.487 1.00 90.66  ? -33  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5 40  ? -30.574 -4.251  13.648 1.00 90.80  ? -33  DG  I C4    1 
ATOM   6879  P  P     . DA  I 5 41  ? -29.876 -2.674  20.105 1.00 89.04  ? -32  DA  I P     1 
ATOM   6880  O  OP1   . DA  I 5 41  ? -28.661 -3.004  20.877 1.00 89.16  ? -32  DA  I OP1   1 
ATOM   6881  O  OP2   . DA  I 5 41  ? -31.197 -3.177  20.539 1.00 88.57  ? -32  DA  I OP2   1 
ATOM   6882  O  "O5'" . DA  I 5 41  ? -29.973 -1.085  19.981 1.00 90.70  ? -32  DA  I "O5'" 1 
ATOM   6883  C  "C5'" . DA  I 5 41  ? -29.112 -0.352  19.089 1.00 92.05  ? -32  DA  I "C5'" 1 
ATOM   6884  C  "C4'" . DA  I 5 41  ? -29.871 0.745   18.355 1.00 92.85  ? -32  DA  I "C4'" 1 
ATOM   6885  O  "O4'" . DA  I 5 41  ? -30.369 0.226   17.097 1.00 92.92  ? -32  DA  I "O4'" 1 
ATOM   6886  C  "C3'" . DA  I 5 41  ? -31.082 1.322   19.091 1.00 93.73  ? -32  DA  I "C3'" 1 
ATOM   6887  O  "O3'" . DA  I 5 41  ? -31.082 2.749   18.960 1.00 94.93  ? -32  DA  I "O3'" 1 
ATOM   6888  C  "C2'" . DA  I 5 41  ? -32.270 0.603   18.444 1.00 93.54  ? -32  DA  I "C2'" 1 
ATOM   6889  C  "C1'" . DA  I 5 41  ? -31.779 0.336   17.026 1.00 93.53  ? -32  DA  I "C1'" 1 
ATOM   6890  N  N9    . DA  I 5 41  ? -32.316 -0.884  16.421 1.00 93.61  ? -32  DA  I N9    1 
ATOM   6891  C  C8    . DA  I 5 41  ? -32.401 -2.122  16.998 1.00 93.75  ? -32  DA  I C8    1 
ATOM   6892  N  N7    . DA  I 5 41  ? -32.923 -3.042  16.223 1.00 93.80  ? -32  DA  I N7    1 
ATOM   6893  C  C5    . DA  I 5 41  ? -33.201 -2.365  15.048 1.00 94.00  ? -32  DA  I C5    1 
ATOM   6894  C  C6    . DA  I 5 41  ? -33.767 -2.778  13.821 1.00 93.80  ? -32  DA  I C6    1 
ATOM   6895  N  N6    . DA  I 5 41  ? -34.169 -4.029  13.580 1.00 93.69  ? -32  DA  I N6    1 
ATOM   6896  N  N1    . DA  I 5 41  ? -33.913 -1.848  12.848 1.00 93.79  ? -32  DA  I N1    1 
ATOM   6897  C  C2    . DA  I 5 41  ? -33.514 -0.588  13.084 1.00 93.86  ? -32  DA  I C2    1 
ATOM   6898  N  N3    . DA  I 5 41  ? -32.964 -0.085  14.193 1.00 94.16  ? -32  DA  I N3    1 
ATOM   6899  C  C4    . DA  I 5 41  ? -32.832 -1.030  15.149 1.00 94.07  ? -32  DA  I C4    1 
ATOM   6900  P  P     . DA  I 5 42  ? -32.383 3.653   18.712 1.00 96.31  ? -31  DA  I P     1 
ATOM   6901  O  OP1   . DA  I 5 42  ? -31.981 5.029   19.060 1.00 96.61  ? -31  DA  I OP1   1 
ATOM   6902  O  OP2   . DA  I 5 42  ? -33.574 3.064   19.368 1.00 96.12  ? -31  DA  I OP2   1 
ATOM   6903  O  "O5'" . DA  I 5 42  ? -32.575 3.545   17.128 1.00 98.33  ? -31  DA  I "O5'" 1 
ATOM   6904  C  "C5'" . DA  I 5 42  ? -32.944 4.668   16.340 1.00 101.19 ? -31  DA  I "C5'" 1 
ATOM   6905  C  "C4'" . DA  I 5 42  ? -34.231 4.389   15.579 1.00 103.51 ? -31  DA  I "C4'" 1 
ATOM   6906  O  "O4'" . DA  I 5 42  ? -34.344 2.967   15.271 1.00 103.54 ? -31  DA  I "O4'" 1 
ATOM   6907  C  "C3'" . DA  I 5 42  ? -35.510 4.778   16.323 1.00 104.69 ? -31  DA  I "C3'" 1 
ATOM   6908  O  "O3'" . DA  I 5 42  ? -36.441 5.431   15.443 1.00 106.88 ? -31  DA  I "O3'" 1 
ATOM   6909  C  "C2'" . DA  I 5 42  ? -36.038 3.423   16.771 1.00 104.30 ? -31  DA  I "C2'" 1 
ATOM   6910  C  "C1'" . DA  I 5 42  ? -35.671 2.587   15.551 1.00 103.80 ? -31  DA  I "C1'" 1 
ATOM   6911  N  N9    . DA  I 5 42  ? -35.775 1.149   15.767 1.00 103.86 ? -31  DA  I N9    1 
ATOM   6912  C  C8    . DA  I 5 42  ? -35.425 0.452   16.889 1.00 103.81 ? -31  DA  I C8    1 
ATOM   6913  N  N7    . DA  I 5 42  ? -35.642 -0.836  16.807 1.00 103.86 ? -31  DA  I N7    1 
ATOM   6914  C  C5    . DA  I 5 42  ? -36.183 -0.998  15.543 1.00 103.94 ? -31  DA  I C5    1 
ATOM   6915  C  C6    . DA  I 5 42  ? -36.634 -2.136  14.839 1.00 103.77 ? -31  DA  I C6    1 
ATOM   6916  N  N6    . DA  I 5 42  ? -36.600 -3.369  15.348 1.00 103.61 ? -31  DA  I N6    1 
ATOM   6917  N  N1    . DA  I 5 42  ? -37.114 -1.959  13.589 1.00 103.82 ? -31  DA  I N1    1 
ATOM   6918  C  C2    . DA  I 5 42  ? -37.142 -0.718  13.083 1.00 103.90 ? -31  DA  I C2    1 
ATOM   6919  N  N3    . DA  I 5 42  ? -36.745 0.428   13.647 1.00 103.92 ? -31  DA  I N3    1 
ATOM   6920  C  C4    . DA  I 5 42  ? -36.274 0.218   14.888 1.00 103.93 ? -31  DA  I C4    1 
ATOM   6921  P  P     . DA  I 5 43  ? -37.552 6.450   15.999 1.00 108.69 ? -30  DA  I P     1 
ATOM   6922  O  OP1   . DA  I 5 43  ? -36.869 7.750   16.189 1.00 108.85 ? -30  DA  I OP1   1 
ATOM   6923  O  OP2   . DA  I 5 43  ? -38.250 5.802   17.139 1.00 108.63 ? -30  DA  I OP2   1 
ATOM   6924  O  "O5'" . DA  I 5 43  ? -38.622 6.620   14.811 1.00 109.37 ? -30  DA  I "O5'" 1 
ATOM   6925  C  "C5'" . DA  I 5 43  ? -38.606 5.792   13.643 1.00 110.63 ? -30  DA  I "C5'" 1 
ATOM   6926  C  "C4'" . DA  I 5 43  ? -39.826 4.884   13.528 1.00 111.20 ? -30  DA  I "C4'" 1 
ATOM   6927  O  "O4'" . DA  I 5 43  ? -39.452 3.529   13.893 1.00 111.06 ? -30  DA  I "O4'" 1 
ATOM   6928  C  "C3'" . DA  I 5 43  ? -41.043 5.222   14.392 1.00 111.75 ? -30  DA  I "C3'" 1 
ATOM   6929  O  "O3'" . DA  I 5 43  ? -42.241 4.998   13.632 1.00 113.00 ? -30  DA  I "O3'" 1 
ATOM   6930  C  "C2'" . DA  I 5 43  ? -40.906 4.231   15.545 1.00 111.41 ? -30  DA  I "C2'" 1 
ATOM   6931  C  "C1'" . DA  I 5 43  ? -40.456 3.016   14.745 1.00 111.17 ? -30  DA  I "C1'" 1 
ATOM   6932  N  N9    . DA  I 5 43  ? -39.958 1.863   15.509 1.00 111.38 ? -30  DA  I N9    1 
ATOM   6933  C  C8    . DA  I 5 43  ? -39.105 1.847   16.583 1.00 111.06 ? -30  DA  I C8    1 
ATOM   6934  N  N7    . DA  I 5 43  ? -38.849 0.646   17.045 1.00 110.69 ? -30  DA  I N7    1 
ATOM   6935  C  C5    . DA  I 5 43  ? -39.586 -0.188  16.220 1.00 110.94 ? -30  DA  I C5    1 
ATOM   6936  C  C6    . DA  I 5 43  ? -39.759 -1.588  16.172 1.00 111.07 ? -30  DA  I C6    1 
ATOM   6937  N  N6    . DA  I 5 43  ? -39.164 -2.429  17.019 1.00 111.28 ? -30  DA  I N6    1 
ATOM   6938  N  N1    . DA  I 5 43  ? -40.569 -2.106  15.218 1.00 111.20 ? -30  DA  I N1    1 
ATOM   6939  C  C2    . DA  I 5 43  ? -41.174 -1.277  14.358 1.00 110.95 ? -30  DA  I C2    1 
ATOM   6940  N  N3    . DA  I 5 43  ? -41.090 0.053   14.306 1.00 111.13 ? -30  DA  I N3    1 
ATOM   6941  C  C4    . DA  I 5 43  ? -40.275 0.542   15.268 1.00 111.26 ? -30  DA  I C4    1 
ATOM   6942  P  P     . DC  I 5 44  ? -43.664 5.491   14.182 1.00 113.74 ? -29  DC  I P     1 
ATOM   6943  O  OP1   . DC  I 5 44  ? -43.590 6.963   14.308 1.00 113.73 ? -29  DC  I OP1   1 
ATOM   6944  O  OP2   . DC  I 5 44  ? -43.998 4.668   15.366 1.00 113.96 ? -29  DC  I OP2   1 
ATOM   6945  O  "O5'" . DC  I 5 44  ? -44.730 5.133   13.038 1.00 113.87 ? -29  DC  I "O5'" 1 
ATOM   6946  C  "C5'" . DC  I 5 44  ? -44.576 4.025   12.154 1.00 114.39 ? -29  DC  I "C5'" 1 
ATOM   6947  C  "C4'" . DC  I 5 44  ? -45.158 2.725   12.699 1.00 114.73 ? -29  DC  I "C4'" 1 
ATOM   6948  O  "O4'" . DC  I 5 44  ? -44.217 2.141   13.636 1.00 114.74 ? -29  DC  I "O4'" 1 
ATOM   6949  C  "C3'" . DC  I 5 44  ? -46.514 2.756   13.430 1.00 114.84 ? -29  DC  I "C3'" 1 
ATOM   6950  O  "O3'" . DC  I 5 44  ? -47.434 1.814   12.818 1.00 115.34 ? -29  DC  I "O3'" 1 
ATOM   6951  C  "C2'" . DC  I 5 44  ? -46.136 2.330   14.846 1.00 114.70 ? -29  DC  I "C2'" 1 
ATOM   6952  C  "C1'" . DC  I 5 44  ? -45.028 1.356   14.477 1.00 114.71 ? -29  DC  I "C1'" 1 
ATOM   6953  N  N1    . DC  I 5 44  ? -44.263 0.747   15.602 1.00 114.54 ? -29  DC  I N1    1 
ATOM   6954  C  C2    . DC  I 5 44  ? -44.263 -0.653  15.729 1.00 114.55 ? -29  DC  I C2    1 
ATOM   6955  O  O2    . DC  I 5 44  ? -44.882 -1.347  14.914 1.00 114.62 ? -29  DC  I O2    1 
ATOM   6956  N  N3    . DC  I 5 44  ? -43.573 -1.220  16.752 1.00 114.71 ? -29  DC  I N3    1 
ATOM   6957  C  C4    . DC  I 5 44  ? -42.907 -0.447  17.616 1.00 114.90 ? -29  DC  I C4    1 
ATOM   6958  N  N4    . DC  I 5 44  ? -42.242 -1.054  18.603 1.00 114.87 ? -29  DC  I N4    1 
ATOM   6959  C  C5    . DC  I 5 44  ? -42.894 0.981   17.505 1.00 114.85 ? -29  DC  I C5    1 
ATOM   6960  C  C6    . DC  I 5 44  ? -43.579 1.531   16.491 1.00 114.71 ? -29  DC  I C6    1 
ATOM   6961  P  P     . DT  I 5 45  ? -48.866 1.381   13.429 1.00 115.73 ? -28  DT  I P     1 
ATOM   6962  O  OP1   . DT  I 5 45  ? -49.747 1.056   12.285 1.00 115.57 ? -28  DT  I OP1   1 
ATOM   6963  O  OP2   . DT  I 5 45  ? -49.315 2.380   14.428 1.00 115.35 ? -28  DT  I OP2   1 
ATOM   6964  O  "O5'" . DT  I 5 45  ? -48.525 0.028   14.221 1.00 116.28 ? -28  DT  I "O5'" 1 
ATOM   6965  C  "C5'" . DT  I 5 45  ? -48.893 -1.268  13.719 1.00 116.25 ? -28  DT  I "C5'" 1 
ATOM   6966  C  "C4'" . DT  I 5 45  ? -49.185 -2.244  14.854 1.00 116.04 ? -28  DT  I "C4'" 1 
ATOM   6967  O  "O4'" . DT  I 5 45  ? -48.130 -2.180  15.856 1.00 116.20 ? -28  DT  I "O4'" 1 
ATOM   6968  C  "C3'" . DT  I 5 45  ? -50.497 -2.005  15.603 1.00 115.54 ? -28  DT  I "C3'" 1 
ATOM   6969  O  "O3'" . DT  I 5 45  ? -51.168 -3.243  15.833 1.00 114.36 ? -28  DT  I "O3'" 1 
ATOM   6970  C  "C2'" . DT  I 5 45  ? -50.051 -1.365  16.918 1.00 115.96 ? -28  DT  I "C2'" 1 
ATOM   6971  C  "C1'" . DT  I 5 45  ? -48.717 -2.074  17.141 1.00 116.05 ? -28  DT  I "C1'" 1 
ATOM   6972  N  N1    . DT  I 5 45  ? -47.751 -1.428  18.112 1.00 115.96 ? -28  DT  I N1    1 
ATOM   6973  C  C2    . DT  I 5 45  ? -46.974 -2.256  18.899 1.00 115.94 ? -28  DT  I C2    1 
ATOM   6974  O  O2    . DT  I 5 45  ? -47.030 -3.472  18.845 1.00 116.07 ? -28  DT  I O2    1 
ATOM   6975  N  N3    . DT  I 5 45  ? -46.118 -1.611  19.759 1.00 115.92 ? -28  DT  I N3    1 
ATOM   6976  C  C4    . DT  I 5 45  ? -45.960 -0.243  19.912 1.00 116.00 ? -28  DT  I C4    1 
ATOM   6977  O  O4    . DT  I 5 45  ? -45.158 0.230   20.717 1.00 115.81 ? -28  DT  I O4    1 
ATOM   6978  C  C5    . DT  I 5 45  ? -46.802 0.574   19.062 1.00 116.01 ? -28  DT  I C5    1 
ATOM   6979  C  C7    . DT  I 5 45  ? -46.727 2.074   19.132 1.00 116.00 ? -28  DT  I C7    1 
ATOM   6980  C  C6    . DT  I 5 45  ? -47.644 -0.048  18.215 1.00 115.94 ? -28  DT  I C6    1 
ATOM   6981  P  P     . DG  I 5 46  ? -52.753 -3.380  15.628 1.00 113.45 ? -27  DG  I P     1 
ATOM   6982  O  OP1   . DG  I 5 46  ? -53.162 -2.413  14.583 1.00 113.40 ? -27  DG  I OP1   1 
ATOM   6983  O  OP2   . DG  I 5 46  ? -53.409 -3.333  16.954 1.00 112.49 ? -27  DG  I OP2   1 
ATOM   6984  O  "O5'" . DG  I 5 46  ? -52.918 -4.870  15.047 1.00 112.64 ? -27  DG  I "O5'" 1 
ATOM   6985  C  "C5'" . DG  I 5 46  ? -51.813 -5.773  14.874 1.00 111.18 ? -27  DG  I "C5'" 1 
ATOM   6986  C  "C4'" . DG  I 5 46  ? -51.638 -6.765  16.026 1.00 110.12 ? -27  DG  I "C4'" 1 
ATOM   6987  O  "O4'" . DG  I 5 46  ? -50.754 -6.205  17.033 1.00 110.26 ? -27  DG  I "O4'" 1 
ATOM   6988  C  "C3'" . DG  I 5 46  ? -52.883 -7.221  16.791 1.00 109.35 ? -27  DG  I "C3'" 1 
ATOM   6989  O  "O3'" . DG  I 5 46  ? -52.749 -8.604  17.120 1.00 108.26 ? -27  DG  I "O3'" 1 
ATOM   6990  C  "C2'" . DG  I 5 46  ? -52.859 -6.343  18.042 1.00 109.39 ? -27  DG  I "C2'" 1 
ATOM   6991  C  "C1'" . DG  I 5 46  ? -51.361 -6.319  18.307 1.00 109.74 ? -27  DG  I "C1'" 1 
ATOM   6992  N  N9    . DG  I 5 46  ? -50.876 -5.224  19.142 1.00 109.74 ? -27  DG  I N9    1 
ATOM   6993  C  C8    . DG  I 5 46  ? -51.307 -3.920  19.179 1.00 109.77 ? -27  DG  I C8    1 
ATOM   6994  N  N7    . DG  I 5 46  ? -50.658 -3.178  20.033 1.00 109.79 ? -27  DG  I N7    1 
ATOM   6995  C  C5    . DG  I 5 46  ? -49.729 -4.043  20.598 1.00 109.78 ? -27  DG  I C5    1 
ATOM   6996  C  C6    . DG  I 5 46  ? -48.741 -3.813  21.592 1.00 109.64 ? -27  DG  I C6    1 
ATOM   6997  O  O6    . DG  I 5 46  ? -48.476 -2.760  22.192 1.00 109.49 ? -27  DG  I O6    1 
ATOM   6998  N  N1    . DG  I 5 46  ? -48.017 -4.975  21.870 1.00 109.69 ? -27  DG  I N1    1 
ATOM   6999  C  C2    . DG  I 5 46  ? -48.222 -6.197  21.264 1.00 109.67 ? -27  DG  I C2    1 
ATOM   7000  N  N2    . DG  I 5 46  ? -47.432 -7.207  21.648 1.00 109.78 ? -27  DG  I N2    1 
ATOM   7001  N  N3    . DG  I 5 46  ? -49.139 -6.422  20.335 1.00 109.60 ? -27  DG  I N3    1 
ATOM   7002  C  C4    . DG  I 5 46  ? -49.853 -5.305  20.054 1.00 109.72 ? -27  DG  I C4    1 
ATOM   7003  P  P     . DC  I 5 47  ? -53.966 -9.501  17.668 1.00 107.63 ? -26  DC  I P     1 
ATOM   7004  O  OP1   . DC  I 5 47  ? -54.270 -10.468 16.591 1.00 107.31 ? -26  DC  I OP1   1 
ATOM   7005  O  OP2   . DC  I 5 47  ? -55.036 -8.639  18.224 1.00 107.58 ? -26  DC  I OP2   1 
ATOM   7006  O  "O5'" . DC  I 5 47  ? -53.360 -10.311 18.913 1.00 107.22 ? -26  DC  I "O5'" 1 
ATOM   7007  C  "C5'" . DC  I 5 47  ? -52.067 -10.038 19.474 1.00 106.15 ? -26  DC  I "C5'" 1 
ATOM   7008  C  "C4'" . DC  I 5 47  ? -52.040 -10.164 20.994 1.00 104.71 ? -26  DC  I "C4'" 1 
ATOM   7009  O  "O4'" . DC  I 5 47  ? -51.829 -8.848  21.566 1.00 104.63 ? -26  DC  I "O4'" 1 
ATOM   7010  C  "C3'" . DC  I 5 47  ? -53.293 -10.722 21.667 1.00 103.57 ? -26  DC  I "C3'" 1 
ATOM   7011  O  "O3'" . DC  I 5 47  ? -52.929 -11.605 22.728 1.00 102.24 ? -26  DC  I "O3'" 1 
ATOM   7012  C  "C2'" . DC  I 5 47  ? -53.993 -9.471  22.188 1.00 103.98 ? -26  DC  I "C2'" 1 
ATOM   7013  C  "C1'" . DC  I 5 47  ? -52.801 -8.591  22.558 1.00 104.44 ? -26  DC  I "C1'" 1 
ATOM   7014  N  N1    . DC  I 5 47  ? -53.060 -7.114  22.593 1.00 104.46 ? -26  DC  I N1    1 
ATOM   7015  C  C2    . DC  I 5 47  ? -52.014 -6.222  22.882 1.00 104.70 ? -26  DC  I C2    1 
ATOM   7016  O  O2    . DC  I 5 47  ? -50.876 -6.658  23.107 1.00 104.93 ? -26  DC  I O2    1 
ATOM   7017  N  N3    . DC  I 5 47  ? -52.276 -4.886  22.907 1.00 104.67 ? -26  DC  I N3    1 
ATOM   7018  C  C4    . DC  I 5 47  ? -53.509 -4.436  22.665 1.00 104.64 ? -26  DC  I C4    1 
ATOM   7019  N  N4    . DC  I 5 47  ? -53.720 -3.119  22.705 1.00 104.70 ? -26  DC  I N4    1 
ATOM   7020  C  C5    . DC  I 5 47  ? -54.588 -5.322  22.371 1.00 105.02 ? -26  DC  I C5    1 
ATOM   7021  C  C6    . DC  I 5 47  ? -54.317 -6.634  22.347 1.00 104.97 ? -26  DC  I C6    1 
ATOM   7022  P  P     . DT  I 5 48  ? -53.188 -13.184 22.602 1.00 101.27 ? -25  DT  I P     1 
ATOM   7023  O  OP1   . DT  I 5 48  ? -52.624 -13.660 21.318 1.00 101.29 ? -25  DT  I OP1   1 
ATOM   7024  O  OP2   . DT  I 5 48  ? -54.605 -13.426 22.944 1.00 101.22 ? -25  DT  I OP2   1 
ATOM   7025  O  "O5'" . DT  I 5 48  ? -52.292 -13.834 23.751 1.00 99.70  ? -25  DT  I "O5'" 1 
ATOM   7026  C  "C5'" . DT  I 5 48  ? -52.428 -13.430 25.093 1.00 96.64  ? -25  DT  I "C5'" 1 
ATOM   7027  C  "C4'" . DT  I 5 48  ? -51.082 -12.965 25.615 1.00 94.22  ? -25  DT  I "C4'" 1 
ATOM   7028  O  "O4'" . DT  I 5 48  ? -50.945 -11.544 25.375 1.00 94.21  ? -25  DT  I "O4'" 1 
ATOM   7029  C  "C3'" . DT  I 5 48  ? -50.901 -13.158 27.114 1.00 92.59  ? -25  DT  I "C3'" 1 
ATOM   7030  O  "O3'" . DT  I 5 48  ? -49.539 -13.418 27.450 1.00 89.25  ? -25  DT  I "O3'" 1 
ATOM   7031  C  "C2'" . DT  I 5 48  ? -51.366 -11.835 27.701 1.00 93.28  ? -25  DT  I "C2'" 1 
ATOM   7032  C  "C1'" . DT  I 5 48  ? -51.056 -10.832 26.596 1.00 95.07  ? -25  DT  I "C1'" 1 
ATOM   7033  N  N1    . DT  I 5 48  ? -52.111 -9.789  26.469 1.00 95.30  ? -25  DT  I N1    1 
ATOM   7034  C  C2    . DT  I 5 48  ? -51.789 -8.471  26.720 1.00 95.67  ? -25  DT  I C2    1 
ATOM   7035  O  O2    . DT  I 5 48  ? -50.679 -8.087  27.040 1.00 96.21  ? -25  DT  I O2    1 
ATOM   7036  N  N3    . DT  I 5 48  ? -52.829 -7.594  26.577 1.00 95.89  ? -25  DT  I N3    1 
ATOM   7037  C  C4    . DT  I 5 48  ? -54.130 -7.898  26.220 1.00 96.18  ? -25  DT  I C4    1 
ATOM   7038  O  O4    . DT  I 5 48  ? -54.976 -7.011  26.125 1.00 96.36  ? -25  DT  I O4    1 
ATOM   7039  C  C5    . DT  I 5 48  ? -54.404 -9.304  25.973 1.00 96.12  ? -25  DT  I C5    1 
ATOM   7040  C  C7    . DT  I 5 48  ? -55.769 -9.797  25.574 1.00 95.88  ? -25  DT  I C7    1 
ATOM   7041  C  C6    . DT  I 5 48  ? -53.391 -10.164 26.109 1.00 95.55  ? -25  DT  I C6    1 
ATOM   7042  P  P     . DC  I 5 49  ? -49.188 -14.402 28.664 1.00 86.02  ? -24  DC  I P     1 
ATOM   7043  O  OP1   . DC  I 5 49  ? -47.856 -14.975 28.372 1.00 85.45  ? -24  DC  I OP1   1 
ATOM   7044  O  OP2   . DC  I 5 49  ? -50.372 -15.261 28.910 1.00 85.48  ? -24  DC  I OP2   1 
ATOM   7045  O  "O5'" . DC  I 5 49  ? -49.066 -13.469 29.946 1.00 83.84  ? -24  DC  I "O5'" 1 
ATOM   7046  C  "C5'" . DC  I 5 49  ? -48.190 -12.367 29.976 1.00 80.96  ? -24  DC  I "C5'" 1 
ATOM   7047  C  "C4'" . DC  I 5 49  ? -48.779 -11.346 30.922 1.00 79.11  ? -24  DC  I "C4'" 1 
ATOM   7048  O  "O4'" . DC  I 5 49  ? -49.944 -10.754 30.305 1.00 79.98  ? -24  DC  I "O4'" 1 
ATOM   7049  C  "C3'" . DC  I 5 49  ? -49.271 -11.888 32.264 1.00 77.46  ? -24  DC  I "C3'" 1 
ATOM   7050  O  "O3'" . DC  I 5 49  ? -48.951 -10.951 33.274 1.00 74.02  ? -24  DC  I "O3'" 1 
ATOM   7051  C  "C2'" . DC  I 5 49  ? -50.784 -11.955 32.080 1.00 78.69  ? -24  DC  I "C2'" 1 
ATOM   7052  C  "C1'" . DC  I 5 49  ? -50.934 -10.650 31.305 1.00 80.15  ? -24  DC  I "C1'" 1 
ATOM   7053  N  N1    . DC  I 5 49  ? -52.260 -10.325 30.677 1.00 80.61  ? -24  DC  I N1    1 
ATOM   7054  C  C2    . DC  I 5 49  ? -52.590 -8.975  30.466 1.00 80.71  ? -24  DC  I C2    1 
ATOM   7055  O  O2    . DC  I 5 49  ? -51.810 -8.077  30.807 1.00 80.72  ? -24  DC  I O2    1 
ATOM   7056  N  N3    . DC  I 5 49  ? -53.785 -8.685  29.895 1.00 81.46  ? -24  DC  I N3    1 
ATOM   7057  C  C4    . DC  I 5 49  ? -54.624 -9.663  29.537 1.00 80.85  ? -24  DC  I C4    1 
ATOM   7058  N  N4    . DC  I 5 49  ? -55.776 -9.302  28.975 1.00 80.64  ? -24  DC  I N4    1 
ATOM   7059  C  C5    . DC  I 5 49  ? -54.315 -11.042 29.736 1.00 80.74  ? -24  DC  I C5    1 
ATOM   7060  C  C6    . DC  I 5 49  ? -53.132 -11.320 30.306 1.00 81.06  ? -24  DC  I C6    1 
ATOM   7061  P  P     . DC  I 5 50  ? -47.536 -10.974 34.001 1.00 70.75  ? -23  DC  I P     1 
ATOM   7062  O  OP1   . DC  I 5 50  ? -46.458 -10.836 32.988 1.00 70.08  ? -23  DC  I OP1   1 
ATOM   7063  O  OP2   . DC  I 5 50  ? -47.601 -12.125 34.924 1.00 70.87  ? -23  DC  I OP2   1 
ATOM   7064  O  "O5'" . DC  I 5 50  ? -47.561 -9.641  34.877 1.00 70.39  ? -23  DC  I "O5'" 1 
ATOM   7065  C  "C5'" . DC  I 5 50  ? -47.127 -8.424  34.287 1.00 70.84  ? -23  DC  I "C5'" 1 
ATOM   7066  C  "C4'" . DC  I 5 50  ? -48.023 -7.272  34.683 1.00 71.28  ? -23  DC  I "C4'" 1 
ATOM   7067  O  "O4'" . DC  I 5 50  ? -49.277 -7.357  33.979 1.00 72.40  ? -23  DC  I "O4'" 1 
ATOM   7068  C  "C3'" . DC  I 5 50  ? -48.366 -7.249  36.159 1.00 71.86  ? -23  DC  I "C3'" 1 
ATOM   7069  O  "O3'" . DC  I 5 50  ? -47.893 -6.027  36.660 1.00 71.57  ? -23  DC  I "O3'" 1 
ATOM   7070  C  "C2'" . DC  I 5 50  ? -49.889 -7.379  36.243 1.00 72.53  ? -23  DC  I "C2'" 1 
ATOM   7071  C  "C1'" . DC  I 5 50  ? -50.343 -7.012  34.841 1.00 73.77  ? -23  DC  I "C1'" 1 
ATOM   7072  N  N1    . DC  I 5 50  ? -51.558 -7.727  34.325 1.00 74.57  ? -23  DC  I N1    1 
ATOM   7073  C  C2    . DC  I 5 50  ? -52.638 -6.994  33.795 1.00 74.88  ? -23  DC  I C2    1 
ATOM   7074  O  O2    . DC  I 5 50  ? -52.607 -5.760  33.770 1.00 75.63  ? -23  DC  I O2    1 
ATOM   7075  N  N3    . DC  I 5 50  ? -53.714 -7.658  33.313 1.00 74.87  ? -23  DC  I N3    1 
ATOM   7076  C  C4    . DC  I 5 50  ? -53.746 -8.989  33.346 1.00 74.92  ? -23  DC  I C4    1 
ATOM   7077  N  N4    . DC  I 5 50  ? -54.833 -9.589  32.859 1.00 74.96  ? -23  DC  I N4    1 
ATOM   7078  C  C5    . DC  I 5 50  ? -52.664 -9.758  33.878 1.00 75.50  ? -23  DC  I C5    1 
ATOM   7079  C  C6    . DC  I 5 50  ? -51.596 -9.096  34.342 1.00 74.84  ? -23  DC  I C6    1 
ATOM   7080  P  P     . DA  I 5 51  ? -47.776 -5.795  38.225 1.00 71.32  ? -22  DA  I P     1 
ATOM   7081  O  OP1   . DA  I 5 51  ? -46.410 -5.322  38.491 1.00 70.93  ? -22  DA  I OP1   1 
ATOM   7082  O  OP2   . DA  I 5 51  ? -48.338 -6.945  38.956 1.00 70.57  ? -22  DA  I OP2   1 
ATOM   7083  O  "O5'" . DA  I 5 51  ? -48.784 -4.586  38.466 1.00 75.43  ? -22  DA  I "O5'" 1 
ATOM   7084  C  "C5'" . DA  I 5 51  ? -48.991 -3.584  37.467 1.00 79.06  ? -22  DA  I "C5'" 1 
ATOM   7085  C  "C4'" . DA  I 5 51  ? -50.207 -2.725  37.777 1.00 81.89  ? -22  DA  I "C4'" 1 
ATOM   7086  O  "O4'" . DA  I 5 51  ? -51.420 -3.364  37.314 1.00 82.99  ? -22  DA  I "O4'" 1 
ATOM   7087  C  "C3'" . DA  I 5 51  ? -50.435 -2.398  39.246 1.00 83.60  ? -22  DA  I "C3'" 1 
ATOM   7088  O  "O3'" . DA  I 5 51  ? -50.765 -1.017  39.289 1.00 86.89  ? -22  DA  I "O3'" 1 
ATOM   7089  C  "C2'" . DA  I 5 51  ? -51.551 -3.346  39.685 1.00 83.15  ? -22  DA  I "C2'" 1 
ATOM   7090  C  "C1'" . DA  I 5 51  ? -52.306 -3.627  38.389 1.00 83.98  ? -22  DA  I "C1'" 1 
ATOM   7091  N  N9    . DA  I 5 51  ? -52.722 -5.012  38.192 1.00 84.20  ? -22  DA  I N9    1 
ATOM   7092  C  C8    . DA  I 5 51  ? -52.095 -6.128  38.670 1.00 84.72  ? -22  DA  I C8    1 
ATOM   7093  N  N7    . DA  I 5 51  ? -52.665 -7.253  38.319 1.00 84.97  ? -22  DA  I N7    1 
ATOM   7094  C  C5    . DA  I 5 51  ? -53.738 -6.853  37.546 1.00 84.65  ? -22  DA  I C5    1 
ATOM   7095  C  C6    . DA  I 5 51  ? -54.743 -7.577  36.877 1.00 84.21  ? -22  DA  I C6    1 
ATOM   7096  N  N6    . DA  I 5 51  ? -54.816 -8.907  36.888 1.00 84.36  ? -22  DA  I N6    1 
ATOM   7097  N  N1    . DA  I 5 51  ? -55.673 -6.883  36.193 1.00 84.41  ? -22  DA  I N1    1 
ATOM   7098  C  C2    . DA  I 5 51  ? -55.603 -5.545  36.182 1.00 84.71  ? -22  DA  I C2    1 
ATOM   7099  N  N3    . DA  I 5 51  ? -54.706 -4.753  36.773 1.00 85.12  ? -22  DA  I N3    1 
ATOM   7100  C  C4    . DA  I 5 51  ? -53.788 -5.473  37.450 1.00 84.70  ? -22  DA  I C4    1 
ATOM   7101  P  P     . DT  I 5 52  ? -51.467 -0.309  40.540 1.00 90.20  ? -21  DT  I P     1 
ATOM   7102  O  OP1   . DT  I 5 52  ? -51.386 1.153   40.314 1.00 90.78  ? -21  DT  I OP1   1 
ATOM   7103  O  OP2   . DT  I 5 52  ? -50.981 -0.892  41.815 1.00 89.51  ? -21  DT  I OP2   1 
ATOM   7104  O  "O5'" . DT  I 5 52  ? -52.980 -0.764  40.332 1.00 92.02  ? -21  DT  I "O5'" 1 
ATOM   7105  C  "C5'" . DT  I 5 52  ? -53.797 -0.186  39.329 1.00 94.32  ? -21  DT  I "C5'" 1 
ATOM   7106  C  "C4'" . DT  I 5 52  ? -55.216 -0.631  39.602 1.00 96.52  ? -21  DT  I "C4'" 1 
ATOM   7107  O  "O4'" . DT  I 5 52  ? -55.322 -2.042  39.294 1.00 96.52  ? -21  DT  I "O4'" 1 
ATOM   7108  C  "C3'" . DT  I 5 52  ? -55.659 -0.481  41.059 1.00 98.11  ? -21  DT  I "C3'" 1 
ATOM   7109  O  "O3'" . DT  I 5 52  ? -56.848 0.303   41.099 1.00 101.07 ? -21  DT  I "O3'" 1 
ATOM   7110  C  "C2'" . DT  I 5 52  ? -55.889 -1.922  41.527 1.00 97.40  ? -21  DT  I "C2'" 1 
ATOM   7111  C  "C1'" . DT  I 5 52  ? -56.233 -2.601  40.211 1.00 96.71  ? -21  DT  I "C1'" 1 
ATOM   7112  N  N1    . DT  I 5 52  ? -56.092 -4.080  40.170 1.00 96.56  ? -21  DT  I N1    1 
ATOM   7113  C  C2    . DT  I 5 52  ? -56.920 -4.799  39.330 1.00 96.61  ? -21  DT  I C2    1 
ATOM   7114  O  O2    . DT  I 5 52  ? -57.766 -4.290  38.619 1.00 96.77  ? -21  DT  I O2    1 
ATOM   7115  N  N3    . DT  I 5 52  ? -56.723 -6.158  39.347 1.00 96.73  ? -21  DT  I N3    1 
ATOM   7116  C  C4    . DT  I 5 52  ? -55.799 -6.861  40.105 1.00 96.90  ? -21  DT  I C4    1 
ATOM   7117  O  O4    . DT  I 5 52  ? -55.716 -8.088  40.030 1.00 96.77  ? -21  DT  I O4    1 
ATOM   7118  C  C5    . DT  I 5 52  ? -54.956 -6.045  40.964 1.00 96.72  ? -21  DT  I C5    1 
ATOM   7119  C  C7    . DT  I 5 52  ? -53.906 -6.658  41.847 1.00 96.54  ? -21  DT  I C7    1 
ATOM   7120  C  C6    . DT  I 5 52  ? -55.144 -4.715  40.951 1.00 96.71  ? -21  DT  I C6    1 
ATOM   7121  P  P     . DC  I 5 53  ? -57.464 0.935   42.442 1.00 103.35 ? -20  DC  I P     1 
ATOM   7122  O  OP1   . DC  I 5 53  ? -56.879 2.286   42.607 1.00 102.76 ? -20  DC  I OP1   1 
ATOM   7123  O  OP2   . DC  I 5 53  ? -57.372 -0.030  43.560 1.00 103.23 ? -20  DC  I OP2   1 
ATOM   7124  O  "O5'" . DC  I 5 53  ? -59.014 1.037   42.044 1.00 105.30 ? -20  DC  I "O5'" 1 
ATOM   7125  C  "C5'" . DC  I 5 53  ? -59.584 0.178   41.034 1.00 108.43 ? -20  DC  I "C5'" 1 
ATOM   7126  C  "C4'" . DC  I 5 53  ? -60.689 -0.752  41.538 1.00 110.72 ? -20  DC  I "C4'" 1 
ATOM   7127  O  "O4'" . DC  I 5 53  ? -60.246 -2.134  41.430 1.00 110.92 ? -20  DC  I "O4'" 1 
ATOM   7128  C  "C3'" . DC  I 5 53  ? -61.155 -0.593  42.989 1.00 112.29 ? -20  DC  I "C3'" 1 
ATOM   7129  O  "O3'" . DC  I 5 53  ? -62.553 -0.918  43.110 1.00 114.40 ? -20  DC  I "O3'" 1 
ATOM   7130  C  "C2'" . DC  I 5 53  ? -60.274 -1.618  43.693 1.00 111.78 ? -20  DC  I "C2'" 1 
ATOM   7131  C  "C1'" . DC  I 5 53  ? -60.433 -2.750  42.688 1.00 111.44 ? -20  DC  I "C1'" 1 
ATOM   7132  N  N1    . DC  I 5 53  ? -59.493 -3.896  42.853 1.00 111.61 ? -20  DC  I N1    1 
ATOM   7133  C  C2    . DC  I 5 53  ? -59.702 -5.049  42.084 1.00 111.42 ? -20  DC  I C2    1 
ATOM   7134  O  O2    . DC  I 5 53  ? -60.645 -5.093  41.282 1.00 111.43 ? -20  DC  I O2    1 
ATOM   7135  N  N3    . DC  I 5 53  ? -58.851 -6.094  42.244 1.00 111.43 ? -20  DC  I N3    1 
ATOM   7136  C  C4    . DC  I 5 53  ? -57.842 -6.013  43.117 1.00 111.47 ? -20  DC  I C4    1 
ATOM   7137  N  N4    . DC  I 5 53  ? -57.038 -7.074  43.232 1.00 111.55 ? -20  DC  I N4    1 
ATOM   7138  C  C5    . DC  I 5 53  ? -57.614 -4.849  43.916 1.00 111.45 ? -20  DC  I C5    1 
ATOM   7139  C  C6    . DC  I 5 53  ? -58.459 -3.825  43.752 1.00 111.52 ? -20  DC  I C6    1 
ATOM   7140  P  P     . DA  I 5 54  ? -63.317 -0.884  44.526 1.00 115.95 ? -19  DA  I P     1 
ATOM   7141  O  OP1   . DA  I 5 54  ? -63.451 0.545   44.900 1.00 115.62 ? -19  DA  I OP1   1 
ATOM   7142  O  OP2   . DA  I 5 54  ? -62.664 -1.810  45.476 1.00 115.97 ? -19  DA  I OP2   1 
ATOM   7143  O  "O5'" . DA  I 5 54  ? -64.747 -1.526  44.197 1.00 116.72 ? -19  DA  I "O5'" 1 
ATOM   7144  C  "C5'" . DA  I 5 54  ? -64.918 -2.506  43.163 1.00 118.37 ? -19  DA  I "C5'" 1 
ATOM   7145  C  "C4'" . DA  I 5 54  ? -65.374 -3.868  43.673 1.00 119.59 ? -19  DA  I "C4'" 1 
ATOM   7146  O  "O4'" . DA  I 5 54  ? -64.224 -4.754  43.744 1.00 120.63 ? -19  DA  I "O4'" 1 
ATOM   7147  C  "C3'" . DA  I 5 54  ? -66.049 -3.954  45.044 1.00 119.83 ? -19  DA  I "C3'" 1 
ATOM   7148  O  "O3'" . DA  I 5 54  ? -67.041 -4.990  45.007 1.00 119.56 ? -19  DA  I "O3'" 1 
ATOM   7149  C  "C2'" . DA  I 5 54  ? -64.886 -4.326  45.958 1.00 120.46 ? -19  DA  I "C2'" 1 
ATOM   7150  C  "C1'" . DA  I 5 54  ? -64.112 -5.284  45.052 1.00 121.56 ? -19  DA  I "C1'" 1 
ATOM   7151  N  N9    . DA  I 5 54  ? -62.694 -5.474  45.386 1.00 122.05 ? -19  DA  I N9    1 
ATOM   7152  C  C8    . DA  I 5 54  ? -61.825 -4.565  45.935 1.00 122.16 ? -19  DA  I C8    1 
ATOM   7153  N  N7    . DA  I 5 54  ? -60.610 -5.021  46.128 1.00 122.09 ? -19  DA  I N7    1 
ATOM   7154  C  C5    . DA  I 5 54  ? -60.685 -6.326  45.675 1.00 122.13 ? -19  DA  I C5    1 
ATOM   7155  C  C6    . DA  I 5 54  ? -59.728 -7.360  45.604 1.00 122.07 ? -19  DA  I C6    1 
ATOM   7156  N  N6    . DA  I 5 54  ? -58.464 -7.206  46.013 1.00 122.05 ? -19  DA  I N6    1 
ATOM   7157  N  N1    . DA  I 5 54  ? -60.123 -8.553  45.095 1.00 122.11 ? -19  DA  I N1    1 
ATOM   7158  C  C2    . DA  I 5 54  ? -61.393 -8.706  44.687 1.00 122.01 ? -19  DA  I C2    1 
ATOM   7159  N  N3    . DA  I 5 54  ? -62.379 -7.806  44.706 1.00 122.19 ? -19  DA  I N3    1 
ATOM   7160  C  C4    . DA  I 5 54  ? -61.959 -6.627  45.214 1.00 122.19 ? -19  DA  I C4    1 
ATOM   7161  P  P     . DA  I 5 55  ? -68.257 -5.116  46.049 1.00 119.23 ? -18  DA  I P     1 
ATOM   7162  O  OP1   . DA  I 5 55  ? -69.495 -4.762  45.320 1.00 118.73 ? -18  DA  I OP1   1 
ATOM   7163  O  OP2   . DA  I 5 55  ? -67.899 -4.404  47.298 1.00 118.91 ? -18  DA  I OP2   1 
ATOM   7164  O  "O5'" . DA  I 5 55  ? -68.289 -6.685  46.388 1.00 119.35 ? -18  DA  I "O5'" 1 
ATOM   7165  C  "C5'" . DA  I 5 55  ? -68.450 -7.683  45.363 1.00 119.65 ? -18  DA  I "C5'" 1 
ATOM   7166  C  "C4'" . DA  I 5 55  ? -68.147 -9.087  45.877 1.00 120.00 ? -18  DA  I "C4'" 1 
ATOM   7167  O  "O4'" . DA  I 5 55  ? -66.714 -9.254  46.078 1.00 120.13 ? -18  DA  I "O4'" 1 
ATOM   7168  C  "C3'" . DA  I 5 55  ? -68.823 -9.469  47.197 1.00 120.15 ? -18  DA  I "C3'" 1 
ATOM   7169  O  "O3'" . DA  I 5 55  ? -69.332 -10.809 47.137 1.00 120.07 ? -18  DA  I "O3'" 1 
ATOM   7170  C  "C2'" . DA  I 5 55  ? -67.709 -9.319  48.233 1.00 120.13 ? -18  DA  I "C2'" 1 
ATOM   7171  C  "C1'" . DA  I 5 55  ? -66.442 -9.601  47.428 1.00 120.06 ? -18  DA  I "C1'" 1 
ATOM   7172  N  N9    . DA  I 5 55  ? -65.285 -8.847  47.925 1.00 120.15 ? -18  DA  I N9    1 
ATOM   7173  C  C8    . DA  I 5 55  ? -65.285 -7.585  48.467 1.00 119.97 ? -18  DA  I C8    1 
ATOM   7174  N  N7    . DA  I 5 55  ? -64.102 -7.157  48.838 1.00 119.95 ? -18  DA  I N7    1 
ATOM   7175  C  C5    . DA  I 5 55  ? -63.262 -8.211  48.522 1.00 119.98 ? -18  DA  I C5    1 
ATOM   7176  C  C6    . DA  I 5 55  ? -61.870 -8.389  48.666 1.00 119.70 ? -18  DA  I C6    1 
ATOM   7177  N  N6    . DA  I 5 55  ? -61.058 -7.469  49.189 1.00 119.75 ? -18  DA  I N6    1 
ATOM   7178  N  N1    . DA  I 5 55  ? -61.345 -9.560  48.256 1.00 119.86 ? -18  DA  I N1    1 
ATOM   7179  C  C2    . DA  I 5 55  ? -62.159 -10.489 47.731 1.00 120.02 ? -18  DA  I C2    1 
ATOM   7180  N  N3    . DA  I 5 55  ? -63.478 -10.441 47.541 1.00 120.00 ? -18  DA  I N3    1 
ATOM   7181  C  C4    . DA  I 5 55  ? -63.974 -9.263  47.963 1.00 120.09 ? -18  DA  I C4    1 
ATOM   7182  P  P     . DA  I 5 56  ? -69.920 -11.574 48.423 1.00 120.16 ? -17  DA  I P     1 
ATOM   7183  O  OP1   . DA  I 5 56  ? -70.963 -12.506 47.937 1.00 120.17 ? -17  DA  I OP1   1 
ATOM   7184  O  OP2   . DA  I 5 56  ? -70.229 -10.597 49.497 1.00 119.49 ? -17  DA  I OP2   1 
ATOM   7185  O  "O5'" . DA  I 5 56  ? -68.671 -12.440 48.916 1.00 120.10 ? -17  DA  I "O5'" 1 
ATOM   7186  C  "C5'" . DA  I 5 56  ? -68.141 -13.507 48.130 1.00 119.49 ? -17  DA  I "C5'" 1 
ATOM   7187  C  "C4'" . DA  I 5 56  ? -66.954 -14.128 48.849 1.00 119.11 ? -17  DA  I "C4'" 1 
ATOM   7188  O  "O4'" . DA  I 5 56  ? -65.926 -13.120 49.054 1.00 119.23 ? -17  DA  I "O4'" 1 
ATOM   7189  C  "C3'" . DA  I 5 56  ? -67.272 -14.718 50.224 1.00 118.66 ? -17  DA  I "C3'" 1 
ATOM   7190  O  "O3'" . DA  I 5 56  ? -66.654 -16.002 50.335 1.00 117.55 ? -17  DA  I "O3'" 1 
ATOM   7191  C  "C2'" . DA  I 5 56  ? -66.694 -13.692 51.199 1.00 118.90 ? -17  DA  I "C2'" 1 
ATOM   7192  C  "C1'" . DA  I 5 56  ? -65.515 -13.137 50.407 1.00 119.46 ? -17  DA  I "C1'" 1 
ATOM   7193  N  N9    . DA  I 5 56  ? -65.115 -11.796 50.832 1.00 119.49 ? -17  DA  I N9    1 
ATOM   7194  C  C8    . DA  I 5 56  ? -65.938 -10.752 51.151 1.00 119.61 ? -17  DA  I C8    1 
ATOM   7195  N  N7    . DA  I 5 56  ? -65.304 -9.660  51.508 1.00 119.67 ? -17  DA  I N7    1 
ATOM   7196  C  C5    . DA  I 5 56  ? -63.971 -10.011 51.421 1.00 119.67 ? -17  DA  I C5    1 
ATOM   7197  C  C6    . DA  I 5 56  ? -62.782 -9.293  51.674 1.00 119.67 ? -17  DA  I C6    1 
ATOM   7198  N  N6    . DA  I 5 56  ? -62.768 -8.020  52.076 1.00 119.60 ? -17  DA  I N6    1 
ATOM   7199  N  N1    . DA  I 5 56  ? -61.605 -9.934  51.489 1.00 119.73 ? -17  DA  I N1    1 
ATOM   7200  C  C2    . DA  I 5 56  ? -61.620 -11.214 51.084 1.00 119.75 ? -17  DA  I C2    1 
ATOM   7201  N  N3    . DA  I 5 56  ? -62.675 -11.991 50.819 1.00 119.85 ? -17  DA  I N3    1 
ATOM   7202  C  C4    . DA  I 5 56  ? -63.833 -11.326 51.007 1.00 119.69 ? -17  DA  I C4    1 
ATOM   7203  P  P     . DA  I 5 57  ? -66.790 -16.948 51.627 1.00 116.70 ? -16  DA  I P     1 
ATOM   7204  O  OP1   . DA  I 5 57  ? -68.055 -17.704 51.505 1.00 116.61 ? -16  DA  I OP1   1 
ATOM   7205  O  OP2   . DA  I 5 57  ? -66.520 -16.149 52.849 1.00 116.68 ? -16  DA  I OP2   1 
ATOM   7206  O  "O5'" . DA  I 5 57  ? -65.567 -17.968 51.430 1.00 115.47 ? -16  DA  I "O5'" 1 
ATOM   7207  C  "C5'" . DA  I 5 57  ? -64.425 -17.598 50.637 1.00 113.21 ? -16  DA  I "C5'" 1 
ATOM   7208  C  "C4'" . DA  I 5 57  ? -63.184 -17.304 51.471 1.00 111.17 ? -16  DA  I "C4'" 1 
ATOM   7209  O  "O4'" . DA  I 5 57  ? -63.040 -15.878 51.731 1.00 110.54 ? -16  DA  I "O4'" 1 
ATOM   7210  C  "C3'" . DA  I 5 57  ? -63.121 -17.985 52.834 1.00 109.89 ? -16  DA  I "C3'" 1 
ATOM   7211  O  "O3'" . DA  I 5 57  ? -61.838 -18.544 52.944 1.00 108.79 ? -16  DA  I "O3'" 1 
ATOM   7212  C  "C2'" . DA  I 5 57  ? -63.304 -16.838 53.825 1.00 109.60 ? -16  DA  I "C2'" 1 
ATOM   7213  C  "C1'" . DA  I 5 57  ? -62.599 -15.719 53.066 1.00 109.58 ? -16  DA  I "C1'" 1 
ATOM   7214  N  N9    . DA  I 5 57  ? -62.884 -14.356 53.511 1.00 109.36 ? -16  DA  I N9    1 
ATOM   7215  C  C8    . DA  I 5 57  ? -64.110 -13.788 53.718 1.00 109.47 ? -16  DA  I C8    1 
ATOM   7216  N  N7    . DA  I 5 57  ? -64.057 -12.537 54.114 1.00 109.47 ? -16  DA  I N7    1 
ATOM   7217  C  C5    . DA  I 5 57  ? -62.704 -12.260 54.170 1.00 109.22 ? -16  DA  I C5    1 
ATOM   7218  C  C6    . DA  I 5 57  ? -61.977 -11.098 54.520 1.00 109.31 ? -16  DA  I C6    1 
ATOM   7219  N  N6    . DA  I 5 57  ? -62.546 -9.952  54.899 1.00 109.17 ? -16  DA  I N6    1 
ATOM   7220  N  N1    . DA  I 5 57  ? -60.629 -11.156 54.474 1.00 109.44 ? -16  DA  I N1    1 
ATOM   7221  C  C2    . DA  I 5 57  ? -60.051 -12.303 54.092 1.00 109.44 ? -16  DA  I C2    1 
ATOM   7222  N  N3    . DA  I 5 57  ? -60.627 -13.454 53.739 1.00 109.25 ? -16  DA  I N3    1 
ATOM   7223  C  C4    . DA  I 5 57  ? -61.967 -13.371 53.800 1.00 109.21 ? -16  DA  I C4    1 
ATOM   7224  P  P     . DG  I 5 58  ? -61.628 -20.006 53.539 1.00 108.01 ? -15  DG  I P     1 
ATOM   7225  O  OP1   . DG  I 5 58  ? -61.549 -20.940 52.391 1.00 107.65 ? -15  DG  I OP1   1 
ATOM   7226  O  OP2   . DG  I 5 58  ? -62.640 -20.202 54.604 1.00 107.89 ? -15  DG  I OP2   1 
ATOM   7227  O  "O5'" . DG  I 5 58  ? -60.188 -19.924 54.251 1.00 106.55 ? -15  DG  I "O5'" 1 
ATOM   7228  C  "C5'" . DG  I 5 58  ? -59.270 -18.850 54.010 1.00 103.85 ? -15  DG  I "C5'" 1 
ATOM   7229  C  "C4'" . DG  I 5 58  ? -58.839 -18.125 55.281 1.00 102.11 ? -15  DG  I "C4'" 1 
ATOM   7230  O  "O4'" . DG  I 5 58  ? -59.566 -16.870 55.378 1.00 102.03 ? -15  DG  I "O4'" 1 
ATOM   7231  C  "C3'" . DG  I 5 58  ? -59.016 -18.838 56.628 1.00 100.56 ? -15  DG  I "C3'" 1 
ATOM   7232  O  "O3'" . DG  I 5 58  ? -57.826 -18.749 57.422 1.00 98.35  ? -15  DG  I "O3'" 1 
ATOM   7233  C  "C2'" . DG  I 5 58  ? -60.116 -18.019 57.293 1.00 101.24 ? -15  DG  I "C2'" 1 
ATOM   7234  C  "C1'" . DG  I 5 58  ? -59.812 -16.627 56.744 1.00 102.01 ? -15  DG  I "C1'" 1 
ATOM   7235  N  N9    . DG  I 5 58  ? -60.901 -15.661 56.912 1.00 102.14 ? -15  DG  I N9    1 
ATOM   7236  C  C8    . DG  I 5 58  ? -62.242 -15.955 56.926 1.00 102.16 ? -15  DG  I C8    1 
ATOM   7237  N  N7    . DG  I 5 58  ? -63.013 -14.922 57.099 1.00 102.07 ? -15  DG  I N7    1 
ATOM   7238  C  C5    . DG  I 5 58  ? -62.128 -13.864 57.205 1.00 102.15 ? -15  DG  I C5    1 
ATOM   7239  C  C6    . DG  I 5 58  ? -62.397 -12.490 57.407 1.00 102.25 ? -15  DG  I C6    1 
ATOM   7240  O  O6    . DG  I 5 58  ? -63.501 -11.950 57.523 1.00 102.26 ? -15  DG  I O6    1 
ATOM   7241  N  N1    . DG  I 5 58  ? -61.237 -11.719 57.459 1.00 102.31 ? -15  DG  I N1    1 
ATOM   7242  C  C2    . DG  I 5 58  ? -59.965 -12.227 57.332 1.00 102.18 ? -15  DG  I C2    1 
ATOM   7243  N  N2    . DG  I 5 58  ? -58.977 -11.325 57.408 1.00 102.12 ? -15  DG  I N2    1 
ATOM   7244  N  N3    . DG  I 5 58  ? -59.695 -13.523 57.151 1.00 102.09 ? -15  DG  I N3    1 
ATOM   7245  C  C4    . DG  I 5 58  ? -60.820 -14.290 57.092 1.00 102.15 ? -15  DG  I C4    1 
ATOM   7246  P  P     . DG  I 5 59  ? -56.631 -19.820 57.384 1.00 95.92  ? -14  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5 59  ? -56.322 -20.161 55.976 1.00 95.58  ? -14  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5 59  ? -56.922 -20.877 58.372 1.00 94.97  ? -14  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5 59  ? -55.419 -18.958 57.949 1.00 94.58  ? -14  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5 59  ? -54.926 -17.853 57.200 1.00 93.25  ? -14  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5 59  ? -54.551 -16.748 58.164 1.00 92.45  ? -14  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5 59  ? -55.749 -16.350 58.874 1.00 92.58  ? -14  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5 59  ? -53.537 -17.154 59.237 1.00 91.65  ? -14  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5 59  ? -52.624 -16.089 59.483 1.00 89.59  ? -14  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5 59  ? -54.406 -17.405 60.465 1.00 92.32  ? -14  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5 59  ? -55.466 -16.331 60.258 1.00 93.14  ? -14  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5 59  ? -56.700 -16.548 61.007 1.00 93.33  ? -14  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5 59  ? -57.469 -17.688 61.031 1.00 93.59  ? -14  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5 59  ? -58.517 -17.589 61.802 1.00 93.74  ? -14  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5 59  ? -58.437 -16.302 62.322 1.00 93.60  ? -14  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5 59  ? -59.304 -15.620 63.216 1.00 93.64  ? -14  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5 59  ? -60.341 -16.053 63.738 1.00 93.45  ? -14  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5 59  ? -58.862 -14.317 63.490 1.00 93.58  ? -14  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5 59  ? -57.718 -13.753 62.964 1.00 93.47  ? -14  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5 59  ? -57.434 -12.495 63.328 1.00 93.36  ? -14  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5 59  ? -56.906 -14.383 62.122 1.00 93.50  ? -14  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5 59  ? -57.324 -15.647 61.841 1.00 93.39  ? -14  DG  I C4    1 
ATOM   7268  P  P     . DC  I 5 60  ? -51.116 -16.363 59.943 1.00 86.77  ? -13  DC  I P     1 
ATOM   7269  O  OP1   . DC  I 5 60  ? -50.325 -16.618 58.722 1.00 86.51  ? -13  DC  I OP1   1 
ATOM   7270  O  OP2   . DC  I 5 60  ? -51.125 -17.321 61.070 1.00 86.53  ? -13  DC  I OP2   1 
ATOM   7271  O  "O5'" . DC  I 5 60  ? -50.676 -14.960 60.551 1.00 86.22  ? -13  DC  I "O5'" 1 
ATOM   7272  C  "C5'" . DC  I 5 60  ? -51.112 -13.735 59.973 1.00 85.13  ? -13  DC  I "C5'" 1 
ATOM   7273  C  "C4'" . DC  I 5 60  ? -51.609 -12.779 61.040 1.00 84.53  ? -13  DC  I "C4'" 1 
ATOM   7274  O  "O4'" . DC  I 5 60  ? -52.852 -13.278 61.593 1.00 84.51  ? -13  DC  I "O4'" 1 
ATOM   7275  C  "C3'" . DC  I 5 60  ? -50.681 -12.567 62.236 1.00 84.16  ? -13  DC  I "C3'" 1 
ATOM   7276  O  "O3'" . DC  I 5 60  ? -50.684 -11.202 62.586 1.00 83.61  ? -13  DC  I "O3'" 1 
ATOM   7277  C  "C2'" . DC  I 5 60  ? -51.335 -13.379 63.345 1.00 84.16  ? -13  DC  I "C2'" 1 
ATOM   7278  C  "C1'" . DC  I 5 60  ? -52.786 -13.102 62.990 1.00 85.08  ? -13  DC  I "C1'" 1 
ATOM   7279  N  N1    . DC  I 5 60  ? -53.766 -13.983 63.671 1.00 85.52  ? -13  DC  I N1    1 
ATOM   7280  C  C2    . DC  I 5 60  ? -54.679 -13.409 64.564 1.00 85.95  ? -13  DC  I C2    1 
ATOM   7281  O  O2    . DC  I 5 60  ? -54.654 -12.185 64.772 1.00 86.59  ? -13  DC  I O2    1 
ATOM   7282  N  N3    . DC  I 5 60  ? -55.571 -14.216 65.188 1.00 85.92  ? -13  DC  I N3    1 
ATOM   7283  C  C4    . DC  I 5 60  ? -55.574 -15.529 64.942 1.00 85.97  ? -13  DC  I C4    1 
ATOM   7284  N  N4    . DC  I 5 60  ? -56.472 -16.278 65.587 1.00 86.12  ? -13  DC  I N4    1 
ATOM   7285  C  C5    . DC  I 5 60  ? -54.653 -16.134 64.033 1.00 86.22  ? -13  DC  I C5    1 
ATOM   7286  C  C6    . DC  I 5 60  ? -53.773 -15.328 63.427 1.00 85.95  ? -13  DC  I C6    1 
ATOM   7287  P  P     . DA  I 5 61  ? -49.440 -10.547 63.331 1.00 82.96  ? -12  DA  I P     1 
ATOM   7288  O  OP1   . DA  I 5 61  ? -48.856 -9.574  62.380 1.00 82.19  ? -12  DA  I OP1   1 
ATOM   7289  O  OP2   . DA  I 5 61  ? -48.630 -11.622 63.941 1.00 82.60  ? -12  DA  I OP2   1 
ATOM   7290  O  "O5'" . DA  I 5 61  ? -50.103 -9.765  64.557 1.00 83.85  ? -12  DA  I "O5'" 1 
ATOM   7291  C  "C5'" . DA  I 5 61  ? -50.712 -8.485  64.403 1.00 84.50  ? -12  DA  I "C5'" 1 
ATOM   7292  C  "C4'" . DA  I 5 61  ? -51.513 -8.188  65.651 1.00 85.27  ? -12  DA  I "C4'" 1 
ATOM   7293  O  "O4'" . DA  I 5 61  ? -52.432 -9.281  65.881 1.00 86.01  ? -12  DA  I "O4'" 1 
ATOM   7294  C  "C3'" . DA  I 5 61  ? -50.656 -8.079  66.902 1.00 86.16  ? -12  DA  I "C3'" 1 
ATOM   7295  O  "O3'" . DA  I 5 61  ? -50.942 -6.854  67.560 1.00 86.77  ? -12  DA  I "O3'" 1 
ATOM   7296  C  "C2'" . DA  I 5 61  ? -51.008 -9.297  67.757 1.00 86.12  ? -12  DA  I "C2'" 1 
ATOM   7297  C  "C1'" . DA  I 5 61  ? -52.356 -9.730  67.214 1.00 87.48  ? -12  DA  I "C1'" 1 
ATOM   7298  N  N9    . DA  I 5 61  ? -52.511 -11.174 67.175 1.00 88.08  ? -12  DA  I N9    1 
ATOM   7299  C  C8    . DA  I 5 61  ? -51.665 -12.067 66.580 1.00 88.66  ? -12  DA  I C8    1 
ATOM   7300  N  N7    . DA  I 5 61  ? -52.043 -13.319 66.692 1.00 88.83  ? -12  DA  I N7    1 
ATOM   7301  C  C5    . DA  I 5 61  ? -53.219 -13.239 67.410 1.00 88.48  ? -12  DA  I C5    1 
ATOM   7302  C  C6    . DA  I 5 61  ? -54.118 -14.225 67.856 1.00 88.32  ? -12  DA  I C6    1 
ATOM   7303  N  N6    . DA  I 5 61  ? -53.935 -15.523 67.622 1.00 88.52  ? -12  DA  I N6    1 
ATOM   7304  N  N1    . DA  I 5 61  ? -55.206 -13.829 68.553 1.00 88.49  ? -12  DA  I N1    1 
ATOM   7305  C  C2    . DA  I 5 61  ? -55.378 -12.519 68.780 1.00 88.59  ? -12  DA  I C2    1 
ATOM   7306  N  N3    . DA  I 5 61  ? -54.602 -11.496 68.408 1.00 88.75  ? -12  DA  I N3    1 
ATOM   7307  C  C4    . DA  I 5 61  ? -53.527 -11.925 67.719 1.00 88.61  ? -12  DA  I C4    1 
ATOM   7308  P  P     . DT  I 5 62  ? -50.034 -6.380  68.787 1.00 87.22  ? -11  DT  I P     1 
ATOM   7309  O  OP1   . DT  I 5 62  ? -50.086 -4.906  68.832 1.00 87.52  ? -11  DT  I OP1   1 
ATOM   7310  O  OP2   . DT  I 5 62  ? -48.719 -7.058  68.730 1.00 86.42  ? -11  DT  I OP2   1 
ATOM   7311  O  "O5'" . DT  I 5 62  ? -50.844 -6.966  70.033 1.00 88.21  ? -11  DT  I "O5'" 1 
ATOM   7312  C  "C5'" . DT  I 5 62  ? -52.223 -6.675  70.182 1.00 90.39  ? -11  DT  I "C5'" 1 
ATOM   7313  C  "C4'" . DT  I 5 62  ? -52.795 -7.356  71.412 1.00 92.11  ? -11  DT  I "C4'" 1 
ATOM   7314  O  "O4'" . DT  I 5 62  ? -53.164 -8.713  71.061 1.00 92.80  ? -11  DT  I "O4'" 1 
ATOM   7315  C  "C3'" . DT  I 5 62  ? -51.862 -7.460  72.616 1.00 93.04  ? -11  DT  I "C3'" 1 
ATOM   7316  O  "O3'" . DT  I 5 62  ? -52.566 -7.110  73.802 1.00 94.75  ? -11  DT  I "O3'" 1 
ATOM   7317  C  "C2'" . DT  I 5 62  ? -51.476 -8.936  72.622 1.00 93.30  ? -11  DT  I "C2'" 1 
ATOM   7318  C  "C1'" . DT  I 5 62  ? -52.749 -9.575  72.094 1.00 93.32  ? -11  DT  I "C1'" 1 
ATOM   7319  N  N1    . DT  I 5 62  ? -52.582 -10.955 71.546 1.00 93.65  ? -11  DT  I N1    1 
ATOM   7320  C  C2    . DT  I 5 62  ? -53.634 -11.840 71.650 1.00 93.86  ? -11  DT  I C2    1 
ATOM   7321  O  O2    . DT  I 5 62  ? -54.696 -11.554 72.167 1.00 94.10  ? -11  DT  I O2    1 
ATOM   7322  N  N3    . DT  I 5 62  ? -53.395 -13.087 71.123 1.00 94.13  ? -11  DT  I N3    1 
ATOM   7323  C  C4    . DT  I 5 62  ? -52.231 -13.529 70.515 1.00 93.87  ? -11  DT  I C4    1 
ATOM   7324  O  O4    . DT  I 5 62  ? -52.115 -14.667 70.073 1.00 93.88  ? -11  DT  I O4    1 
ATOM   7325  C  C5    . DT  I 5 62  ? -51.168 -12.559 70.434 1.00 93.86  ? -11  DT  I C5    1 
ATOM   7326  C  C7    . DT  I 5 62  ? -49.860 -12.923 69.796 1.00 93.71  ? -11  DT  I C7    1 
ATOM   7327  C  C6    . DT  I 5 62  ? -51.392 -11.337 70.946 1.00 93.93  ? -11  DT  I C6    1 
ATOM   7328  P  P     . DG  I 5 63  ? -51.815 -6.882  75.206 1.00 96.06  ? -10  DG  I P     1 
ATOM   7329  O  OP1   . DG  I 5 63  ? -51.258 -5.517  75.160 1.00 95.90  ? -10  DG  I OP1   1 
ATOM   7330  O  OP2   . DG  I 5 63  ? -50.932 -8.027  75.526 1.00 95.75  ? -10  DG  I OP2   1 
ATOM   7331  O  "O5'" . DG  I 5 63  ? -53.015 -6.908  76.264 1.00 97.27  ? -10  DG  I "O5'" 1 
ATOM   7332  C  "C5'" . DG  I 5 63  ? -54.105 -7.815  76.127 1.00 98.79  ? -10  DG  I "C5'" 1 
ATOM   7333  C  "C4'" . DG  I 5 63  ? -53.929 -9.052  76.993 1.00 99.99  ? -10  DG  I "C4'" 1 
ATOM   7334  O  "O4'" . DG  I 5 63  ? -53.498 -10.158 76.164 1.00 100.34 ? -10  DG  I "O4'" 1 
ATOM   7335  C  "C3'" . DG  I 5 63  ? -52.917 -8.966  78.141 1.00 100.72 ? -10  DG  I "C3'" 1 
ATOM   7336  O  "O3'" . DG  I 5 63  ? -53.628 -9.131  79.372 1.00 101.71 ? -10  DG  I "O3'" 1 
ATOM   7337  C  "C2'" . DG  I 5 63  ? -51.934 -10.109 77.874 1.00 100.49 ? -10  DG  I "C2'" 1 
ATOM   7338  C  "C1'" . DG  I 5 63  ? -52.759 -11.033 76.988 1.00 100.25 ? -10  DG  I "C1'" 1 
ATOM   7339  N  N9    . DG  I 5 63  ? -51.972 -11.927 76.139 1.00 100.17 ? -10  DG  I N9    1 
ATOM   7340  C  C8    . DG  I 5 63  ? -50.874 -11.593 75.380 1.00 100.00 ? -10  DG  I C8    1 
ATOM   7341  N  N7    . DG  I 5 63  ? -50.371 -12.594 74.718 1.00 99.77  ? -10  DG  I N7    1 
ATOM   7342  C  C5    . DG  I 5 63  ? -51.192 -13.659 75.053 1.00 100.00 ? -10  DG  I C5    1 
ATOM   7343  C  C6    . DG  I 5 63  ? -51.133 -15.008 74.634 1.00 100.21 ? -10  DG  I C6    1 
ATOM   7344  O  O6    . DG  I 5 63  ? -50.315 -15.520 73.859 1.00 100.10 ? -10  DG  I O6    1 
ATOM   7345  N  N1    . DG  I 5 63  ? -52.151 -15.779 75.204 1.00 100.14 ? -10  DG  I N1    1 
ATOM   7346  C  C2    . DG  I 5 63  ? -53.103 -15.301 76.074 1.00 99.79  ? -10  DG  I C2    1 
ATOM   7347  N  N2    . DG  I 5 63  ? -53.996 -16.194 76.512 1.00 99.85  ? -10  DG  I N2    1 
ATOM   7348  N  N3    . DG  I 5 63  ? -53.171 -14.035 76.476 1.00 99.76  ? -10  DG  I N3    1 
ATOM   7349  C  C4    . DG  I 5 63  ? -52.187 -13.271 75.928 1.00 99.99  ? -10  DG  I C4    1 
ATOM   7350  P  P     . DT  I 5 64  ? -52.949 -9.139  80.828 1.00 101.81 ? -9   DT  I P     1 
ATOM   7351  O  OP1   . DT  I 5 64  ? -53.734 -8.200  81.661 1.00 101.99 ? -9   DT  I OP1   1 
ATOM   7352  O  OP2   . DT  I 5 64  ? -51.483 -8.929  80.724 1.00 101.92 ? -9   DT  I OP2   1 
ATOM   7353  O  "O5'" . DT  I 5 64  ? -53.227 -10.653 81.289 1.00 101.20 ? -9   DT  I "O5'" 1 
ATOM   7354  C  "C5'" . DT  I 5 64  ? -54.338 -11.412 80.764 1.00 100.65 ? -9   DT  I "C5'" 1 
ATOM   7355  C  "C4'" . DT  I 5 64  ? -54.296 -12.885 81.161 1.00 100.46 ? -9   DT  I "C4'" 1 
ATOM   7356  O  "O4'" . DT  I 5 64  ? -53.683 -13.684 80.104 1.00 100.36 ? -9   DT  I "O4'" 1 
ATOM   7357  C  "C3'" . DT  I 5 64  ? -53.528 -13.216 82.446 1.00 100.44 ? -9   DT  I "C3'" 1 
ATOM   7358  O  "O3'" . DT  I 5 64  ? -54.246 -14.189 83.239 1.00 100.14 ? -9   DT  I "O3'" 1 
ATOM   7359  C  "C2'" . DT  I 5 64  ? -52.183 -13.727 81.918 1.00 100.26 ? -9   DT  I "C2'" 1 
ATOM   7360  C  "C1'" . DT  I 5 64  ? -52.611 -14.448 80.642 1.00 99.49  ? -9   DT  I "C1'" 1 
ATOM   7361  N  N1    . DT  I 5 64  ? -51.501 -14.611 79.630 1.00 99.18  ? -9   DT  I N1    1 
ATOM   7362  C  C2    . DT  I 5 64  ? -51.279 -15.851 79.062 1.00 98.78  ? -9   DT  I C2    1 
ATOM   7363  O  O2    . DT  I 5 64  ? -51.934 -16.846 79.326 1.00 98.73  ? -9   DT  I O2    1 
ATOM   7364  N  N3    . DT  I 5 64  ? -50.242 -15.886 78.159 1.00 98.50  ? -9   DT  I N3    1 
ATOM   7365  C  C4    . DT  I 5 64  ? -49.424 -14.838 77.769 1.00 98.73  ? -9   DT  I C4    1 
ATOM   7366  O  O4    . DT  I 5 64  ? -48.524 -14.985 76.949 1.00 98.89  ? -9   DT  I O4    1 
ATOM   7367  C  C5    . DT  I 5 64  ? -49.700 -13.570 78.401 1.00 98.71  ? -9   DT  I C5    1 
ATOM   7368  C  C7    . DT  I 5 64  ? -48.877 -12.359 78.071 1.00 98.55  ? -9   DT  I C7    1 
ATOM   7369  C  C6    . DT  I 5 64  ? -50.710 -13.521 79.285 1.00 99.12  ? -9   DT  I C6    1 
ATOM   7370  P  P     . DT  I 5 65  ? -53.563 -15.005 84.446 1.00 100.46 ? -8   DT  I P     1 
ATOM   7371  O  OP1   . DT  I 5 65  ? -54.643 -15.597 85.269 1.00 100.55 ? -8   DT  I OP1   1 
ATOM   7372  O  OP2   . DT  I 5 65  ? -52.504 -14.181 85.080 1.00 100.31 ? -8   DT  I OP2   1 
ATOM   7373  O  "O5'" . DT  I 5 65  ? -52.829 -16.183 83.669 1.00 99.67  ? -8   DT  I "O5'" 1 
ATOM   7374  C  "C5'" . DT  I 5 65  ? -53.530 -17.384 83.372 1.00 98.62  ? -8   DT  I "C5'" 1 
ATOM   7375  C  "C4'" . DT  I 5 65  ? -52.522 -18.507 83.241 1.00 97.15  ? -8   DT  I "C4'" 1 
ATOM   7376  O  "O4'" . DT  I 5 65  ? -51.623 -18.202 82.139 1.00 96.89  ? -8   DT  I "O4'" 1 
ATOM   7377  C  "C3'" . DT  I 5 65  ? -51.668 -18.680 84.494 1.00 95.90  ? -8   DT  I "C3'" 1 
ATOM   7378  O  "O3'" . DT  I 5 65  ? -51.692 -20.051 84.904 1.00 94.29  ? -8   DT  I "O3'" 1 
ATOM   7379  C  "C2'" . DT  I 5 65  ? -50.285 -18.167 84.071 1.00 96.25  ? -8   DT  I "C2'" 1 
ATOM   7380  C  "C1'" . DT  I 5 65  ? -50.299 -18.433 82.566 1.00 96.06  ? -8   DT  I "C1'" 1 
ATOM   7381  N  N1    . DT  I 5 65  ? -49.352 -17.632 81.722 1.00 95.73  ? -8   DT  I N1    1 
ATOM   7382  C  C2    . DT  I 5 65  ? -48.739 -18.275 80.665 1.00 95.75  ? -8   DT  I C2    1 
ATOM   7383  O  O2    . DT  I 5 65  ? -48.923 -19.448 80.385 1.00 95.81  ? -8   DT  I O2    1 
ATOM   7384  N  N3    . DT  I 5 65  ? -47.887 -17.491 79.931 1.00 95.74  ? -8   DT  I N3    1 
ATOM   7385  C  C4    . DT  I 5 65  ? -47.583 -16.159 80.134 1.00 95.72  ? -8   DT  I C4    1 
ATOM   7386  O  O4    . DT  I 5 65  ? -46.796 -15.564 79.401 1.00 95.64  ? -8   DT  I O4    1 
ATOM   7387  C  C5    . DT  I 5 65  ? -48.258 -15.540 81.254 1.00 95.75  ? -8   DT  I C5    1 
ATOM   7388  C  C7    . DT  I 5 65  ? -48.016 -14.094 81.578 1.00 95.60  ? -8   DT  I C7    1 
ATOM   7389  C  C6    . DT  I 5 65  ? -49.100 -16.296 81.984 1.00 95.84  ? -8   DT  I C6    1 
ATOM   7390  P  P     . DC  I 5 66  ? -51.024 -20.526 86.284 1.00 93.64  ? -7   DC  I P     1 
ATOM   7391  O  OP1   . DC  I 5 66  ? -51.910 -21.529 86.911 1.00 93.44  ? -7   DC  I OP1   1 
ATOM   7392  O  OP2   . DC  I 5 66  ? -50.609 -19.315 87.032 1.00 93.52  ? -7   DC  I OP2   1 
ATOM   7393  O  "O5'" . DC  I 5 66  ? -49.685 -21.280 85.828 1.00 93.16  ? -7   DC  I "O5'" 1 
ATOM   7394  C  "C5'" . DC  I 5 66  ? -49.670 -22.278 84.793 1.00 91.02  ? -7   DC  I "C5'" 1 
ATOM   7395  C  "C4'" . DC  I 5 66  ? -48.264 -22.462 84.230 1.00 89.53  ? -7   DC  I "C4'" 1 
ATOM   7396  O  "O4'" . DC  I 5 66  ? -47.829 -21.272 83.516 1.00 89.70  ? -7   DC  I "O4'" 1 
ATOM   7397  C  "C3'" . DC  I 5 66  ? -47.176 -22.757 85.267 1.00 87.89  ? -7   DC  I "C3'" 1 
ATOM   7398  O  "O3'" . DC  I 5 66  ? -46.443 -23.907 84.892 1.00 85.05  ? -7   DC  I "O3'" 1 
ATOM   7399  C  "C2'" . DC  I 5 66  ? -46.275 -21.529 85.242 1.00 88.47  ? -7   DC  I "C2'" 1 
ATOM   7400  C  "C1'" . DC  I 5 66  ? -46.467 -21.034 83.814 1.00 89.60  ? -7   DC  I "C1'" 1 
ATOM   7401  N  N1    . DC  I 5 66  ? -46.155 -19.576 83.620 1.00 89.99  ? -7   DC  I N1    1 
ATOM   7402  C  C2    . DC  I 5 66  ? -45.702 -19.115 82.369 1.00 89.80  ? -7   DC  I C2    1 
ATOM   7403  O  O2    . DC  I 5 66  ? -45.561 -19.911 81.434 1.00 89.84  ? -7   DC  I O2    1 
ATOM   7404  N  N3    . DC  I 5 66  ? -45.425 -17.793 82.218 1.00 89.85  ? -7   DC  I N3    1 
ATOM   7405  C  C4    . DC  I 5 66  ? -45.584 -16.954 83.249 1.00 90.14  ? -7   DC  I C4    1 
ATOM   7406  N  N4    . DC  I 5 66  ? -45.300 -15.663 83.057 1.00 90.16  ? -7   DC  I N4    1 
ATOM   7407  C  C5    . DC  I 5 66  ? -46.042 -17.397 84.529 1.00 90.13  ? -7   DC  I C5    1 
ATOM   7408  C  C6    . DC  I 5 66  ? -46.314 -18.701 84.666 1.00 90.08  ? -7   DC  I C6    1 
ATOM   7409  P  P     . DA  I 5 67  ? -46.906 -25.341 85.406 1.00 82.38  ? -6   DA  I P     1 
ATOM   7410  O  OP1   . DA  I 5 67  ? -48.352 -25.479 85.103 1.00 82.54  ? -6   DA  I OP1   1 
ATOM   7411  O  OP2   . DA  I 5 67  ? -46.403 -25.461 86.787 1.00 82.57  ? -6   DA  I OP2   1 
ATOM   7412  O  "O5'" . DA  I 5 67  ? -46.074 -26.358 84.488 1.00 80.64  ? -6   DA  I "O5'" 1 
ATOM   7413  C  "C5'" . DA  I 5 67  ? -46.469 -26.568 83.123 1.00 78.17  ? -6   DA  I "C5'" 1 
ATOM   7414  C  "C4'" . DA  I 5 67  ? -45.315 -26.507 82.128 1.00 75.67  ? -6   DA  I "C4'" 1 
ATOM   7415  O  "O4'" . DA  I 5 67  ? -44.756 -25.169 82.042 1.00 74.43  ? -6   DA  I "O4'" 1 
ATOM   7416  C  "C3'" . DA  I 5 67  ? -44.159 -27.445 82.431 1.00 74.46  ? -6   DA  I "C3'" 1 
ATOM   7417  O  "O3'" . DA  I 5 67  ? -43.790 -28.080 81.234 1.00 74.52  ? -6   DA  I "O3'" 1 
ATOM   7418  C  "C2'" . DA  I 5 67  ? -43.061 -26.528 82.960 1.00 74.03  ? -6   DA  I "C2'" 1 
ATOM   7419  C  "C1'" . DA  I 5 67  ? -43.370 -25.184 82.308 1.00 73.61  ? -6   DA  I "C1'" 1 
ATOM   7420  N  N9    . DA  I 5 67  ? -43.098 -24.027 83.149 1.00 73.07  ? -6   DA  I N9    1 
ATOM   7421  C  C8    . DA  I 5 67  ? -43.246 -23.952 84.500 1.00 73.35  ? -6   DA  I C8    1 
ATOM   7422  N  N7    . DA  I 5 67  ? -42.938 -22.783 85.011 1.00 73.56  ? -6   DA  I N7    1 
ATOM   7423  C  C5    . DA  I 5 67  ? -42.573 -22.035 83.916 1.00 73.21  ? -6   DA  I C5    1 
ATOM   7424  C  C6    . DA  I 5 67  ? -42.146 -20.701 83.789 1.00 73.31  ? -6   DA  I C6    1 
ATOM   7425  N  N6    . DA  I 5 67  ? -42.012 -19.879 84.831 1.00 73.31  ? -6   DA  I N6    1 
ATOM   7426  N  N1    . DA  I 5 67  ? -41.853 -20.249 82.550 1.00 73.47  ? -6   DA  I N1    1 
ATOM   7427  C  C2    . DA  I 5 67  ? -41.982 -21.082 81.512 1.00 73.16  ? -6   DA  I C2    1 
ATOM   7428  N  N3    . DA  I 5 67  ? -42.378 -22.355 81.516 1.00 73.39  ? -6   DA  I N3    1 
ATOM   7429  C  C4    . DA  I 5 67  ? -42.664 -22.782 82.758 1.00 73.26  ? -6   DA  I C4    1 
ATOM   7430  P  P     . DG  I 5 68  ? -42.825 -29.349 81.266 1.00 76.36  ? -5   DG  I P     1 
ATOM   7431  O  OP1   . DG  I 5 68  ? -43.490 -30.431 80.515 1.00 77.11  ? -5   DG  I OP1   1 
ATOM   7432  O  OP2   . DG  I 5 68  ? -42.411 -29.598 82.664 1.00 75.73  ? -5   DG  I OP2   1 
ATOM   7433  O  "O5'" . DG  I 5 68  ? -41.536 -28.890 80.429 1.00 75.81  ? -5   DG  I "O5'" 1 
ATOM   7434  C  "C5'" . DG  I 5 68  ? -41.521 -27.670 79.696 1.00 75.61  ? -5   DG  I "C5'" 1 
ATOM   7435  C  "C4'" . DG  I 5 68  ? -40.200 -26.929 79.836 1.00 75.29  ? -5   DG  I "C4'" 1 
ATOM   7436  O  "O4'" . DG  I 5 68  ? -40.320 -25.817 80.769 1.00 75.81  ? -5   DG  I "O4'" 1 
ATOM   7437  C  "C3'" . DG  I 5 68  ? -39.003 -27.745 80.317 1.00 74.58  ? -5   DG  I "C3'" 1 
ATOM   7438  O  "O3'" . DG  I 5 68  ? -37.873 -27.301 79.598 1.00 73.73  ? -5   DG  I "O3'" 1 
ATOM   7439  C  "C2'" . DG  I 5 68  ? -38.861 -27.310 81.766 1.00 74.80  ? -5   DG  I "C2'" 1 
ATOM   7440  C  "C1'" . DG  I 5 68  ? -39.169 -25.829 81.593 1.00 76.12  ? -5   DG  I "C1'" 1 
ATOM   7441  N  N9    . DG  I 5 68  ? -39.416 -25.106 82.837 1.00 76.44  ? -5   DG  I N9    1 
ATOM   7442  C  C8    . DG  I 5 68  ? -39.869 -25.629 84.026 1.00 76.67  ? -5   DG  I C8    1 
ATOM   7443  N  N7    . DG  I 5 68  ? -39.995 -24.746 84.974 1.00 76.80  ? -5   DG  I N7    1 
ATOM   7444  C  C5    . DG  I 5 68  ? -39.601 -23.559 84.380 1.00 76.62  ? -5   DG  I C5    1 
ATOM   7445  C  C6    . DG  I 5 68  ? -39.531 -22.258 84.931 1.00 76.56  ? -5   DG  I C6    1 
ATOM   7446  O  O6    . DG  I 5 68  ? -39.819 -21.912 86.085 1.00 76.50  ? -5   DG  I O6    1 
ATOM   7447  N  N1    . DG  I 5 68  ? -39.079 -21.320 83.997 1.00 76.66  ? -5   DG  I N1    1 
ATOM   7448  C  C2    . DG  I 5 68  ? -38.738 -21.623 82.692 1.00 76.68  ? -5   DG  I C2    1 
ATOM   7449  N  N2    . DG  I 5 68  ? -38.324 -20.605 81.928 1.00 76.59  ? -5   DG  I N2    1 
ATOM   7450  N  N3    . DG  I 5 68  ? -38.799 -22.844 82.166 1.00 76.60  ? -5   DG  I N3    1 
ATOM   7451  C  C4    . DG  I 5 68  ? -39.238 -23.761 83.065 1.00 76.55  ? -5   DG  I C4    1 
ATOM   7452  P  P     . DC  I 5 69  ? -36.879 -28.287 78.829 1.00 71.97  ? -4   DC  I P     1 
ATOM   7453  O  OP1   . DC  I 5 69  ? -37.678 -29.007 77.806 1.00 71.77  ? -4   DC  I OP1   1 
ATOM   7454  O  OP2   . DC  I 5 69  ? -36.071 -29.027 79.825 1.00 71.21  ? -4   DC  I OP2   1 
ATOM   7455  O  "O5'" . DC  I 5 69  ? -35.923 -27.224 78.118 1.00 69.61  ? -4   DC  I "O5'" 1 
ATOM   7456  C  "C5'" . DC  I 5 69  ? -36.500 -26.199 77.336 1.00 67.13  ? -4   DC  I "C5'" 1 
ATOM   7457  C  "C4'" . DC  I 5 69  ? -35.733 -24.917 77.544 1.00 65.81  ? -4   DC  I "C4'" 1 
ATOM   7458  O  "O4'" . DC  I 5 69  ? -36.043 -24.340 78.834 1.00 65.82  ? -4   DC  I "O4'" 1 
ATOM   7459  C  "C3'" . DC  I 5 69  ? -34.230 -25.110 77.496 1.00 64.88  ? -4   DC  I "C3'" 1 
ATOM   7460  O  "O3'" . DC  I 5 69  ? -33.708 -24.187 76.546 1.00 62.08  ? -4   DC  I "O3'" 1 
ATOM   7461  C  "C2'" . DC  I 5 69  ? -33.777 -24.856 78.933 1.00 65.69  ? -4   DC  I "C2'" 1 
ATOM   7462  C  "C1'" . DC  I 5 69  ? -34.861 -23.948 79.485 1.00 67.06  ? -4   DC  I "C1'" 1 
ATOM   7463  N  N1    . DC  I 5 69  ? -35.136 -24.146 80.929 1.00 68.25  ? -4   DC  I N1    1 
ATOM   7464  C  C2    . DC  I 5 69  ? -35.083 -23.079 81.843 1.00 68.18  ? -4   DC  I C2    1 
ATOM   7465  O  O2    . DC  I 5 69  ? -34.789 -21.939 81.474 1.00 68.65  ? -4   DC  I O2    1 
ATOM   7466  N  N3    . DC  I 5 69  ? -35.354 -23.328 83.139 1.00 68.29  ? -4   DC  I N3    1 
ATOM   7467  C  C4    . DC  I 5 69  ? -35.672 -24.564 83.534 1.00 68.32  ? -4   DC  I C4    1 
ATOM   7468  N  N4    . DC  I 5 69  ? -35.954 -24.771 84.826 1.00 68.62  ? -4   DC  I N4    1 
ATOM   7469  C  C5    . DC  I 5 69  ? -35.728 -25.657 82.626 1.00 68.61  ? -4   DC  I C5    1 
ATOM   7470  C  C6    . DC  I 5 69  ? -35.461 -25.405 81.347 1.00 68.46  ? -4   DC  I C6    1 
ATOM   7471  P  P     . DT  I 5 70  ? -32.153 -24.092 76.229 1.00 59.80  ? -3   DT  I P     1 
ATOM   7472  O  OP1   . DT  I 5 70  ? -32.053 -23.851 74.774 1.00 59.36  ? -3   DT  I OP1   1 
ATOM   7473  O  OP2   . DT  I 5 70  ? -31.403 -25.213 76.849 1.00 59.01  ? -3   DT  I OP2   1 
ATOM   7474  O  "O5'" . DT  I 5 70  ? -31.749 -22.810 77.083 1.00 58.58  ? -3   DT  I "O5'" 1 
ATOM   7475  C  "C5'" . DT  I 5 70  ? -32.222 -21.514 76.810 1.00 58.43  ? -3   DT  I "C5'" 1 
ATOM   7476  C  "C4'" . DT  I 5 70  ? -31.598 -20.561 77.815 1.00 59.66  ? -3   DT  I "C4'" 1 
ATOM   7477  O  "O4'" . DT  I 5 70  ? -31.951 -20.956 79.168 1.00 62.05  ? -3   DT  I "O4'" 1 
ATOM   7478  C  "C3'" . DT  I 5 70  ? -30.082 -20.502 77.832 1.00 59.54  ? -3   DT  I "C3'" 1 
ATOM   7479  O  "O3'" . DT  I 5 70  ? -29.740 -19.179 78.096 1.00 59.08  ? -3   DT  I "O3'" 1 
ATOM   7480  C  "C2'" . DT  I 5 70  ? -29.674 -21.399 78.998 1.00 60.33  ? -3   DT  I "C2'" 1 
ATOM   7481  C  "C1'" . DT  I 5 70  ? -30.798 -21.088 79.974 1.00 61.98  ? -3   DT  I "C1'" 1 
ATOM   7482  N  N1    . DT  I 5 70  ? -31.081 -22.132 81.012 1.00 62.38  ? -3   DT  I N1    1 
ATOM   7483  C  C2    . DT  I 5 70  ? -31.402 -21.752 82.307 1.00 62.49  ? -3   DT  I C2    1 
ATOM   7484  O  O2    . DT  I 5 70  ? -31.474 -20.596 82.688 1.00 62.79  ? -3   DT  I O2    1 
ATOM   7485  N  N3    . DT  I 5 70  ? -31.644 -22.791 83.166 1.00 62.27  ? -3   DT  I N3    1 
ATOM   7486  C  C4    . DT  I 5 70  ? -31.602 -24.139 82.866 1.00 62.66  ? -3   DT  I C4    1 
ATOM   7487  O  O4    . DT  I 5 70  ? -31.833 -25.004 83.704 1.00 63.19  ? -3   DT  I O4    1 
ATOM   7488  C  C5    . DT  I 5 70  ? -31.260 -24.468 81.505 1.00 62.64  ? -3   DT  I C5    1 
ATOM   7489  C  C7    . DT  I 5 70  ? -31.185 -25.902 81.070 1.00 62.36  ? -3   DT  I C7    1 
ATOM   7490  C  C6    . DT  I 5 70  ? -31.026 -23.462 80.653 1.00 62.50  ? -3   DT  I C6    1 
ATOM   7491  P  P     . DG  I 5 71  ? -28.319 -18.610 77.662 1.00 58.55  ? -2   DG  I P     1 
ATOM   7492  O  OP1   . DG  I 5 71  ? -28.581 -17.304 77.010 1.00 56.85  ? -2   DG  I OP1   1 
ATOM   7493  O  OP2   . DG  I 5 71  ? -27.516 -19.696 77.064 1.00 57.37  ? -2   DG  I OP2   1 
ATOM   7494  O  "O5'" . DG  I 5 71  ? -27.589 -18.371 79.050 1.00 60.11  ? -2   DG  I "O5'" 1 
ATOM   7495  C  "C5'" . DG  I 5 71  ? -28.006 -17.358 79.939 1.00 62.73  ? -2   DG  I "C5'" 1 
ATOM   7496  C  "C4'" . DG  I 5 71  ? -27.547 -17.757 81.317 1.00 63.67  ? -2   DG  I "C4'" 1 
ATOM   7497  O  "O4'" . DG  I 5 71  ? -28.056 -19.079 81.584 1.00 63.97  ? -2   DG  I "O4'" 1 
ATOM   7498  C  "C3'" . DG  I 5 71  ? -26.039 -17.886 81.439 1.00 65.21  ? -2   DG  I "C3'" 1 
ATOM   7499  O  "O3'" . DG  I 5 71  ? -25.670 -17.266 82.625 1.00 67.04  ? -2   DG  I "O3'" 1 
ATOM   7500  C  "C2'" . DG  I 5 71  ? -25.783 -19.386 81.534 1.00 65.22  ? -2   DG  I "C2'" 1 
ATOM   7501  C  "C1'" . DG  I 5 71  ? -27.048 -19.741 82.291 1.00 65.06  ? -2   DG  I "C1'" 1 
ATOM   7502  N  N9    . DG  I 5 71  ? -27.392 -21.142 82.385 1.00 65.14  ? -2   DG  I N9    1 
ATOM   7503  C  C8    . DG  I 5 71  ? -27.279 -22.142 81.454 1.00 65.72  ? -2   DG  I C8    1 
ATOM   7504  N  N7    . DG  I 5 71  ? -27.686 -23.305 81.886 1.00 65.70  ? -2   DG  I N7    1 
ATOM   7505  C  C5    . DG  I 5 71  ? -28.090 -23.043 83.184 1.00 65.87  ? -2   DG  I C5    1 
ATOM   7506  C  C6    . DG  I 5 71  ? -28.625 -23.896 84.167 1.00 65.63  ? -2   DG  I C6    1 
ATOM   7507  O  O6    . DG  I 5 71  ? -28.856 -25.100 84.079 1.00 66.21  ? -2   DG  I O6    1 
ATOM   7508  N  N1    . DG  I 5 71  ? -28.901 -23.233 85.357 1.00 65.64  ? -2   DG  I N1    1 
ATOM   7509  C  C2    . DG  I 5 71  ? -28.688 -21.896 85.574 1.00 65.70  ? -2   DG  I C2    1 
ATOM   7510  N  N2    . DG  I 5 71  ? -29.016 -21.426 86.780 1.00 65.80  ? -2   DG  I N2    1 
ATOM   7511  N  N3    . DG  I 5 71  ? -28.188 -21.077 84.665 1.00 66.24  ? -2   DG  I N3    1 
ATOM   7512  C  C4    . DG  I 5 71  ? -27.915 -21.720 83.502 1.00 65.78  ? -2   DG  I C4    1 
ATOM   7513  P  P     . DA  I 5 72  ? -24.602 -16.093 82.577 1.00 67.73  ? -1   DA  I P     1 
ATOM   7514  O  OP1   . DA  I 5 72  ? -25.251 -14.952 81.905 1.00 66.84  ? -1   DA  I OP1   1 
ATOM   7515  O  OP2   . DA  I 5 72  ? -23.325 -16.693 82.115 1.00 66.33  ? -1   DA  I OP2   1 
ATOM   7516  O  "O5'" . DA  I 5 72  ? -24.435 -15.722 84.122 1.00 69.93  ? -1   DA  I "O5'" 1 
ATOM   7517  C  "C5'" . DA  I 5 72  ? -25.568 -15.735 84.982 1.00 72.68  ? -1   DA  I "C5'" 1 
ATOM   7518  C  "C4'" . DA  I 5 72  ? -25.279 -16.474 86.277 1.00 74.44  ? -1   DA  I "C4'" 1 
ATOM   7519  O  "O4'" . DA  I 5 72  ? -25.656 -17.866 86.163 1.00 74.53  ? -1   DA  I "O4'" 1 
ATOM   7520  C  "C3'" . DA  I 5 72  ? -23.829 -16.482 86.746 1.00 76.30  ? -1   DA  I "C3'" 1 
ATOM   7521  O  "O3'" . DA  I 5 72  ? -23.832 -16.242 88.140 1.00 80.04  ? -1   DA  I "O3'" 1 
ATOM   7522  C  "C2'" . DA  I 5 72  ? -23.347 -17.895 86.464 1.00 75.43  ? -1   DA  I "C2'" 1 
ATOM   7523  C  "C1'" . DA  I 5 72  ? -24.629 -18.675 86.714 1.00 74.24  ? -1   DA  I "C1'" 1 
ATOM   7524  N  N9    . DA  I 5 72  ? -24.711 -19.960 86.032 1.00 73.69  ? -1   DA  I N9    1 
ATOM   7525  C  C8    . DA  I 5 72  ? -24.367 -20.214 84.736 1.00 73.55  ? -1   DA  I C8    1 
ATOM   7526  N  N7    . DA  I 5 72  ? -24.568 -21.452 84.366 1.00 73.55  ? -1   DA  I N7    1 
ATOM   7527  C  C5    . DA  I 5 72  ? -25.089 -22.049 85.494 1.00 73.74  ? -1   DA  I C5    1 
ATOM   7528  C  C6    . DA  I 5 72  ? -25.509 -23.364 85.752 1.00 73.65  ? -1   DA  I C6    1 
ATOM   7529  N  N6    . DA  I 5 72  ? -25.456 -24.331 84.837 1.00 73.64  ? -1   DA  I N6    1 
ATOM   7530  N  N1    . DA  I 5 72  ? -25.976 -23.643 86.988 1.00 73.50  ? -1   DA  I N1    1 
ATOM   7531  C  C2    . DA  I 5 72  ? -26.023 -22.666 87.899 1.00 73.51  ? -1   DA  I C2    1 
ATOM   7532  N  N3    . DA  I 5 72  ? -25.658 -21.389 87.770 1.00 73.91  ? -1   DA  I N3    1 
ATOM   7533  C  C4    . DA  I 5 72  ? -25.192 -21.143 86.533 1.00 73.79  ? -1   DA  I C4    1 
ATOM   7534  P  P     . DA  I 5 73  ? -22.553 -15.627 88.876 1.00 81.56  ? 0    DA  I P     1 
ATOM   7535  O  OP1   . DA  I 5 73  ? -23.019 -14.413 89.585 1.00 80.93  ? 0    DA  I OP1   1 
ATOM   7536  O  OP2   . DA  I 5 73  ? -21.423 -15.544 87.918 1.00 81.65  ? 0    DA  I OP2   1 
ATOM   7537  O  "O5'" . DA  I 5 73  ? -22.212 -16.787 89.916 1.00 81.66  ? 0    DA  I "O5'" 1 
ATOM   7538  C  "C5'" . DA  I 5 73  ? -23.198 -17.265 90.807 1.00 82.78  ? 0    DA  I "C5'" 1 
ATOM   7539  C  "C4'" . DA  I 5 73  ? -22.733 -18.592 91.360 1.00 83.99  ? 0    DA  I "C4'" 1 
ATOM   7540  O  "O4'" . DA  I 5 73  ? -23.036 -19.617 90.390 1.00 85.01  ? 0    DA  I "O4'" 1 
ATOM   7541  C  "C3'" . DA  I 5 73  ? -21.234 -18.685 91.648 1.00 84.36  ? 0    DA  I "C3'" 1 
ATOM   7542  O  "O3'" . DA  I 5 73  ? -21.074 -19.107 92.999 1.00 84.31  ? 0    DA  I "O3'" 1 
ATOM   7543  C  "C2'" . DA  I 5 73  ? -20.701 -19.680 90.618 1.00 85.04  ? 0    DA  I "C2'" 1 
ATOM   7544  C  "C1'" . DA  I 5 73  ? -21.939 -20.505 90.304 1.00 85.94  ? 0    DA  I "C1'" 1 
ATOM   7545  N  N9    . DA  I 5 73  ? -21.938 -21.080 88.961 1.00 86.41  ? 0    DA  I N9    1 
ATOM   7546  C  C8    . DA  I 5 73  ? -21.691 -20.438 87.776 1.00 86.51  ? 0    DA  I C8    1 
ATOM   7547  N  N7    . DA  I 5 73  ? -21.773 -21.209 86.719 1.00 86.38  ? 0    DA  I N7    1 
ATOM   7548  C  C5    . DA  I 5 73  ? -22.097 -22.445 87.256 1.00 86.26  ? 0    DA  I C5    1 
ATOM   7549  C  C6    . DA  I 5 73  ? -22.325 -23.701 86.669 1.00 86.15  ? 0    DA  I C6    1 
ATOM   7550  N  N6    . DA  I 5 73  ? -22.252 -23.913 85.354 1.00 86.19  ? 0    DA  I N6    1 
ATOM   7551  N  N1    . DA  I 5 73  ? -22.631 -24.732 87.487 1.00 86.70  ? 0    DA  I N1    1 
ATOM   7552  C  C2    . DA  I 5 73  ? -22.703 -24.522 88.810 1.00 86.53  ? 0    DA  I C2    1 
ATOM   7553  N  N3    . DA  I 5 73  ? -22.507 -23.386 89.475 1.00 86.25  ? 0    DA  I N3    1 
ATOM   7554  C  C4    . DA  I 5 73  ? -22.207 -22.384 88.633 1.00 86.09  ? 0    DA  I C4    1 
ATOM   7555  P  P     . DT  I 5 74  ? -19.745 -19.746 93.630 1.00 84.33  ? 1    DT  I P     1 
ATOM   7556  O  OP1   . DT  I 5 74  ? -19.920 -19.544 95.088 1.00 84.40  ? 1    DT  I OP1   1 
ATOM   7557  O  OP2   . DT  I 5 74  ? -18.513 -19.290 92.937 1.00 83.39  ? 1    DT  I OP2   1 
ATOM   7558  O  "O5'" . DT  I 5 74  ? -19.915 -21.294 93.279 1.00 83.30  ? 1    DT  I "O5'" 1 
ATOM   7559  C  "C5'" . DT  I 5 74  ? -20.690 -22.136 94.109 1.00 82.52  ? 1    DT  I "C5'" 1 
ATOM   7560  C  "C4'" . DT  I 5 74  ? -20.149 -23.529 93.937 1.00 82.40  ? 1    DT  I "C4'" 1 
ATOM   7561  O  "O4'" . DT  I 5 74  ? -20.344 -23.902 92.552 1.00 82.35  ? 1    DT  I "O4'" 1 
ATOM   7562  C  "C3'" . DT  I 5 74  ? -18.654 -23.633 94.211 1.00 82.72  ? 1    DT  I "C3'" 1 
ATOM   7563  O  "O3'" . DT  I 5 74  ? -18.467 -24.624 95.204 1.00 84.43  ? 1    DT  I "O3'" 1 
ATOM   7564  C  "C2'" . DT  I 5 74  ? -18.017 -24.004 92.867 1.00 81.84  ? 1    DT  I "C2'" 1 
ATOM   7565  C  "C1'" . DT  I 5 74  ? -19.194 -24.569 92.077 1.00 80.29  ? 1    DT  I "C1'" 1 
ATOM   7566  N  N1    . DT  I 5 74  ? -19.147 -24.423 90.578 1.00 79.18  ? 1    DT  I N1    1 
ATOM   7567  C  C2    . DT  I 5 74  ? -19.467 -25.523 89.803 1.00 78.96  ? 1    DT  I C2    1 
ATOM   7568  O  O2    . DT  I 5 74  ? -19.776 -26.615 90.260 1.00 78.74  ? 1    DT  I O2    1 
ATOM   7569  N  N3    . DT  I 5 74  ? -19.409 -25.307 88.448 1.00 78.65  ? 1    DT  I N3    1 
ATOM   7570  C  C4    . DT  I 5 74  ? -19.074 -24.138 87.793 1.00 79.17  ? 1    DT  I C4    1 
ATOM   7571  O  O4    . DT  I 5 74  ? -19.054 -24.063 86.563 1.00 79.04  ? 1    DT  I O4    1 
ATOM   7572  C  C5    . DT  I 5 74  ? -18.755 -23.025 88.664 1.00 79.16  ? 1    DT  I C5    1 
ATOM   7573  C  C7    . DT  I 5 74  ? -18.376 -21.693 88.074 1.00 79.06  ? 1    DT  I C7    1 
ATOM   7574  C  C6    . DT  I 5 74  ? -18.811 -23.217 89.995 1.00 78.68  ? 1    DT  I C6    1 
ATOM   7575  P  P     . DC  I 5 75  ? -17.035 -24.893 95.865 1.00 85.51  ? 2    DC  I P     1 
ATOM   7576  O  OP1   . DC  I 5 75  ? -17.265 -25.338 97.257 1.00 85.45  ? 2    DC  I OP1   1 
ATOM   7577  O  OP2   . DC  I 5 75  ? -16.162 -23.724 95.603 1.00 85.39  ? 2    DC  I OP2   1 
ATOM   7578  O  "O5'" . DC  I 5 75  ? -16.499 -26.129 94.996 1.00 85.73  ? 2    DC  I "O5'" 1 
ATOM   7579  C  "C5'" . DC  I 5 75  ? -17.263 -27.326 94.871 1.00 86.00  ? 2    DC  I "C5'" 1 
ATOM   7580  C  "C4'" . DC  I 5 75  ? -16.859 -28.092 93.627 1.00 86.64  ? 2    DC  I "C4'" 1 
ATOM   7581  O  "O4'" . DC  I 5 75  ? -17.084 -27.297 92.444 1.00 87.18  ? 2    DC  I "O4'" 1 
ATOM   7582  C  "C3'" . DC  I 5 75  ? -15.378 -28.384 93.512 1.00 86.94  ? 2    DC  I "C3'" 1 
ATOM   7583  O  "O3'" . DC  I 5 75  ? -15.079 -29.520 94.272 1.00 87.36  ? 2    DC  I "O3'" 1 
ATOM   7584  C  "C2'" . DC  I 5 75  ? -15.157 -28.619 92.017 1.00 87.10  ? 2    DC  I "C2'" 1 
ATOM   7585  C  "C1'" . DC  I 5 75  ? -16.331 -27.874 91.386 1.00 86.86  ? 2    DC  I "C1'" 1 
ATOM   7586  N  N1    . DC  I 5 75  ? -15.992 -26.802 90.381 1.00 86.40  ? 2    DC  I N1    1 
ATOM   7587  C  C2    . DC  I 5 75  ? -16.167 -27.052 89.007 1.00 86.27  ? 2    DC  I C2    1 
ATOM   7588  O  O2    . DC  I 5 75  ? -16.571 -28.165 88.633 1.00 85.76  ? 2    DC  I O2    1 
ATOM   7589  N  N3    . DC  I 5 75  ? -15.875 -26.059 88.120 1.00 86.14  ? 2    DC  I N3    1 
ATOM   7590  C  C4    . DC  I 5 75  ? -15.435 -24.871 88.555 1.00 86.23  ? 2    DC  I C4    1 
ATOM   7591  N  N4    . DC  I 5 75  ? -15.154 -23.925 87.654 1.00 86.17  ? 2    DC  I N4    1 
ATOM   7592  C  C5    . DC  I 5 75  ? -15.257 -24.599 89.943 1.00 86.08  ? 2    DC  I C5    1 
ATOM   7593  C  C6    . DC  I 5 75  ? -15.545 -25.581 90.808 1.00 86.18  ? 2    DC  I C6    1 
ATOM   7594  P  P     . DA  I 5 76  ? -13.624 -29.598 94.932 1.00 88.14  ? 3    DA  I P     1 
ATOM   7595  O  OP1   . DA  I 5 76  ? -13.832 -29.639 96.396 1.00 88.32  ? 3    DA  I OP1   1 
ATOM   7596  O  OP2   . DA  I 5 76  ? -12.767 -28.530 94.351 1.00 86.85  ? 3    DA  I OP2   1 
ATOM   7597  O  "O5'" . DA  I 5 76  ? -13.092 -31.033 94.444 1.00 87.39  ? 3    DA  I "O5'" 1 
ATOM   7598  C  "C5'" . DA  I 5 76  ? -14.026 -32.075 94.122 1.00 87.49  ? 3    DA  I "C5'" 1 
ATOM   7599  C  "C4'" . DA  I 5 76  ? -13.758 -32.712 92.758 1.00 87.43  ? 3    DA  I "C4'" 1 
ATOM   7600  O  "O4'" . DA  I 5 76  ? -13.918 -31.763 91.665 1.00 86.77  ? 3    DA  I "O4'" 1 
ATOM   7601  C  "C3'" . DA  I 5 76  ? -12.367 -33.308 92.564 1.00 87.29  ? 3    DA  I "C3'" 1 
ATOM   7602  O  "O3'" . DA  I 5 76  ? -12.523 -34.488 91.805 1.00 87.64  ? 3    DA  I "O3'" 1 
ATOM   7603  C  "C2'" . DA  I 5 76  ? -11.634 -32.239 91.758 1.00 86.61  ? 3    DA  I "C2'" 1 
ATOM   7604  C  "C1'" . DA  I 5 76  ? -12.768 -31.802 90.842 1.00 86.31  ? 3    DA  I "C1'" 1 
ATOM   7605  N  N9    . DA  I 5 76  ? -12.614 -30.478 90.263 1.00 86.64  ? 3    DA  I N9    1 
ATOM   7606  C  C8    . DA  I 5 76  ? -12.120 -29.354 90.868 1.00 86.58  ? 3    DA  I C8    1 
ATOM   7607  N  N7    . DA  I 5 76  ? -12.117 -28.289 90.101 1.00 86.53  ? 3    DA  I N7    1 
ATOM   7608  C  C5    . DA  I 5 76  ? -12.645 -28.748 88.906 1.00 86.54  ? 3    DA  I C5    1 
ATOM   7609  C  C6    . DA  I 5 76  ? -12.902 -28.110 87.679 1.00 86.07  ? 3    DA  I C6    1 
ATOM   7610  N  N6    . DA  I 5 76  ? -12.649 -26.819 87.455 1.00 86.08  ? 3    DA  I N6    1 
ATOM   7611  N  N1    . DA  I 5 76  ? -13.436 -28.856 86.692 1.00 86.29  ? 3    DA  I N1    1 
ATOM   7612  C  C2    . DA  I 5 76  ? -13.690 -30.153 86.914 1.00 86.26  ? 3    DA  I C2    1 
ATOM   7613  N  N3    . DA  I 5 76  ? -13.491 -30.866 88.019 1.00 86.21  ? 3    DA  I N3    1 
ATOM   7614  C  C4    . DA  I 5 76  ? -12.960 -30.097 88.987 1.00 86.77  ? 3    DA  I C4    1 
ATOM   7615  P  P     . DG  I 5 77  ? -11.559 -35.749 91.999 1.00 87.63  ? 4    DG  I P     1 
ATOM   7616  O  OP1   . DG  I 5 77  ? -12.112 -36.459 93.177 1.00 88.70  ? 4    DG  I OP1   1 
ATOM   7617  O  OP2   . DG  I 5 77  ? -10.148 -35.277 91.974 1.00 86.40  ? 4    DG  I OP2   1 
ATOM   7618  O  "O5'" . DG  I 5 77  ? -11.821 -36.695 90.721 1.00 85.73  ? 4    DG  I "O5'" 1 
ATOM   7619  C  "C5'" . DG  I 5 77  ? -12.872 -36.437 89.774 1.00 83.42  ? 4    DG  I "C5'" 1 
ATOM   7620  C  "C4'" . DG  I 5 77  ? -12.344 -36.202 88.358 1.00 81.30  ? 4    DG  I "C4'" 1 
ATOM   7621  O  "O4'" . DG  I 5 77  ? -12.006 -34.810 88.106 1.00 80.31  ? 4    DG  I "O4'" 1 
ATOM   7622  C  "C3'" . DG  I 5 77  ? -11.099 -36.982 87.967 1.00 79.95  ? 4    DG  I "C3'" 1 
ATOM   7623  O  "O3'" . DG  I 5 77  ? -11.304 -37.390 86.636 1.00 78.83  ? 4    DG  I "O3'" 1 
ATOM   7624  C  "C2'" . DG  I 5 77  ? -9.985  -35.943 88.091 1.00 79.60  ? 4    DG  I "C2'" 1 
ATOM   7625  C  "C1'" . DG  I 5 77  ? -10.714 -34.732 87.533 1.00 80.05  ? 4    DG  I "C1'" 1 
ATOM   7626  N  N9    . DG  I 5 77  ? -10.166 -33.420 87.869 1.00 80.18  ? 4    DG  I N9    1 
ATOM   7627  C  C8    . DG  I 5 77  ? -9.467  -33.055 88.994 1.00 80.27  ? 4    DG  I C8    1 
ATOM   7628  N  N7    . DG  I 5 77  ? -9.125  -31.797 89.020 1.00 80.05  ? 4    DG  I N7    1 
ATOM   7629  C  C5    . DG  I 5 77  ? -9.630  -31.290 87.838 1.00 80.08  ? 4    DG  I C5    1 
ATOM   7630  C  C6    . DG  I 5 77  ? -9.564  -29.980 87.316 1.00 80.24  ? 4    DG  I C6    1 
ATOM   7631  O  O6    . DG  I 5 77  ? -9.030  -28.987 87.825 1.00 80.39  ? 4    DG  I O6    1 
ATOM   7632  N  N1    . DG  I 5 77  ? -10.202 -29.874 86.081 1.00 80.28  ? 4    DG  I N1    1 
ATOM   7633  C  C2    . DG  I 5 77  ? -10.822 -30.917 85.431 1.00 80.23  ? 4    DG  I C2    1 
ATOM   7634  N  N2    . DG  I 5 77  ? -11.385 -30.632 84.250 1.00 80.29  ? 4    DG  I N2    1 
ATOM   7635  N  N3    . DG  I 5 77  ? -10.894 -32.155 85.909 1.00 80.48  ? 4    DG  I N3    1 
ATOM   7636  C  C4    . DG  I 5 77  ? -10.275 -32.271 87.116 1.00 80.44  ? 4    DG  I C4    1 
ATOM   7637  P  P     . DC  I 5 78  ? -10.364 -38.488 85.971 1.00 78.83  ? 5    DC  I P     1 
ATOM   7638  O  OP1   . DC  I 5 78  ? -11.204 -39.690 85.825 1.00 79.35  ? 5    DC  I OP1   1 
ATOM   7639  O  OP2   . DC  I 5 78  ? -9.079  -38.561 86.701 1.00 78.19  ? 5    DC  I OP2   1 
ATOM   7640  O  "O5'" . DC  I 5 78  ? -10.057 -37.916 84.502 1.00 79.56  ? 5    DC  I "O5'" 1 
ATOM   7641  C  "C5'" . DC  I 5 78  ? -10.523 -36.637 84.053 1.00 79.62  ? 5    DC  I "C5'" 1 
ATOM   7642  C  "C4'" . DC  I 5 78  ? -9.406  -35.824 83.409 1.00 79.72  ? 5    DC  I "C4'" 1 
ATOM   7643  O  "O4'" . DC  I 5 78  ? -8.960  -34.778 84.311 1.00 80.25  ? 5    DC  I "O4'" 1 
ATOM   7644  C  "C3'" . DC  I 5 78  ? -8.128  -36.572 83.009 1.00 79.15  ? 5    DC  I "C3'" 1 
ATOM   7645  O  "O3'" . DC  I 5 78  ? -7.718  -36.141 81.723 1.00 77.16  ? 5    DC  I "O3'" 1 
ATOM   7646  C  "C2'" . DC  I 5 78  ? -7.098  -36.118 84.035 1.00 80.11  ? 5    DC  I "C2'" 1 
ATOM   7647  C  "C1'" . DC  I 5 78  ? -7.556  -34.678 84.203 1.00 81.25  ? 5    DC  I "C1'" 1 
ATOM   7648  N  N1    . DC  I 5 78  ? -7.083  -33.986 85.417 1.00 82.21  ? 5    DC  I N1    1 
ATOM   7649  C  C2    . DC  I 5 78  ? -7.120  -32.584 85.447 1.00 82.87  ? 5    DC  I C2    1 
ATOM   7650  O  O2    . DC  I 5 78  ? -7.534  -31.968 84.452 1.00 83.07  ? 5    DC  I O2    1 
ATOM   7651  N  N3    . DC  I 5 78  ? -6.696  -31.949 86.573 1.00 82.76  ? 5    DC  I N3    1 
ATOM   7652  C  C4    . DC  I 5 78  ? -6.261  -32.663 87.621 1.00 82.42  ? 5    DC  I C4    1 
ATOM   7653  N  N4    . DC  I 5 78  ? -5.853  -32.006 88.711 1.00 82.73  ? 5    DC  I N4    1 
ATOM   7654  C  C5    . DC  I 5 78  ? -6.218  -34.089 87.604 1.00 82.57  ? 5    DC  I C5    1 
ATOM   7655  C  C6    . DC  I 5 78  ? -6.639  -34.703 86.495 1.00 82.53  ? 5    DC  I C6    1 
ATOM   7656  P  P     . DT  I 5 79  ? -7.864  -37.106 80.465 1.00 75.40  ? 6    DT  I P     1 
ATOM   7657  O  OP1   . DT  I 5 79  ? -9.183  -37.797 80.535 1.00 76.00  ? 6    DT  I OP1   1 
ATOM   7658  O  OP2   . DT  I 5 79  ? -6.569  -37.824 80.344 1.00 73.61  ? 6    DT  I OP2   1 
ATOM   7659  O  "O5'" . DT  I 5 79  ? -8.001  -36.099 79.240 1.00 72.45  ? 6    DT  I "O5'" 1 
ATOM   7660  C  "C5'" . DT  I 5 79  ? -8.956  -35.057 79.239 1.00 67.74  ? 6    DT  I "C5'" 1 
ATOM   7661  C  "C4'" . DT  I 5 79  ? -8.223  -33.802 78.805 1.00 64.53  ? 6    DT  I "C4'" 1 
ATOM   7662  O  "O4'" . DT  I 5 79  ? -7.511  -33.233 79.932 1.00 64.63  ? 6    DT  I "O4'" 1 
ATOM   7663  C  "C3'" . DT  I 5 79  ? -7.147  -33.998 77.743 1.00 62.23  ? 6    DT  I "C3'" 1 
ATOM   7664  O  "O3'" . DT  I 5 79  ? -7.024  -32.798 77.070 1.00 58.85  ? 6    DT  I "O3'" 1 
ATOM   7665  C  "C2'" . DT  I 5 79  ? -5.886  -34.178 78.569 1.00 62.96  ? 6    DT  I "C2'" 1 
ATOM   7666  C  "C1'" . DT  I 5 79  ? -6.158  -33.060 79.557 1.00 64.20  ? 6    DT  I "C1'" 1 
ATOM   7667  N  N1    . DT  I 5 79  ? -5.318  -33.033 80.767 1.00 64.33  ? 6    DT  I N1    1 
ATOM   7668  C  C2    . DT  I 5 79  ? -5.093  -31.812 81.349 1.00 64.66  ? 6    DT  I C2    1 
ATOM   7669  O  O2    . DT  I 5 79  ? -5.555  -30.778 80.907 1.00 65.34  ? 6    DT  I O2    1 
ATOM   7670  N  N3    . DT  I 5 79  ? -4.312  -31.844 82.473 1.00 64.67  ? 6    DT  I N3    1 
ATOM   7671  C  C4    . DT  I 5 79  ? -3.744  -32.954 83.069 1.00 65.06  ? 6    DT  I C4    1 
ATOM   7672  O  O4    . DT  I 5 79  ? -3.051  -32.851 84.084 1.00 65.11  ? 6    DT  I O4    1 
ATOM   7673  C  C5    . DT  I 5 79  ? -4.026  -34.215 82.406 1.00 65.08  ? 6    DT  I C5    1 
ATOM   7674  C  C7    . DT  I 5 79  ? -3.482  -35.514 82.925 1.00 64.74  ? 6    DT  I C7    1 
ATOM   7675  C  C6    . DT  I 5 79  ? -4.793  -34.190 81.305 1.00 64.76  ? 6    DT  I C6    1 
ATOM   7676  P  P     . DG  I 5 80  ? -7.285  -32.634 75.519 1.00 55.98  ? 7    DG  I P     1 
ATOM   7677  O  OP1   . DG  I 5 80  ? -8.697  -32.230 75.364 1.00 54.06  ? 7    DG  I OP1   1 
ATOM   7678  O  OP2   . DG  I 5 80  ? -6.696  -33.782 74.788 1.00 55.40  ? 7    DG  I OP2   1 
ATOM   7679  O  "O5'" . DG  I 5 80  ? -6.325  -31.387 75.230 1.00 55.04  ? 7    DG  I "O5'" 1 
ATOM   7680  C  "C5'" . DG  I 5 80  ? -6.524  -30.127 75.865 1.00 52.37  ? 7    DG  I "C5'" 1 
ATOM   7681  C  "C4'" . DG  I 5 80  ? -5.218  -29.465 76.270 1.00 51.11  ? 7    DG  I "C4'" 1 
ATOM   7682  O  "O4'" . DG  I 5 80  ? -4.686  -30.157 77.422 1.00 52.99  ? 7    DG  I "O4'" 1 
ATOM   7683  C  "C3'" . DG  I 5 80  ? -4.071  -29.413 75.260 1.00 49.56  ? 7    DG  I "C3'" 1 
ATOM   7684  O  "O3'" . DG  I 5 80  ? -3.447  -28.162 75.380 1.00 46.19  ? 7    DG  I "O3'" 1 
ATOM   7685  C  "C2'" . DG  I 5 80  ? -3.125  -30.493 75.757 1.00 50.90  ? 7    DG  I "C2'" 1 
ATOM   7686  C  "C1'" . DG  I 5 80  ? -3.297  -30.284 77.255 1.00 54.27  ? 7    DG  I "C1'" 1 
ATOM   7687  N  N9    . DG  I 5 80  ? -2.859  -31.367 78.125 1.00 55.13  ? 7    DG  I N9    1 
ATOM   7688  C  C8    . DG  I 5 80  ? -2.954  -32.724 77.925 1.00 55.75  ? 7    DG  I C8    1 
ATOM   7689  N  N7    . DG  I 5 80  ? -2.465  -33.446 78.887 1.00 55.55  ? 7    DG  I N7    1 
ATOM   7690  C  C5    . DG  I 5 80  ? -2.020  -32.496 79.798 1.00 56.06  ? 7    DG  I C5    1 
ATOM   7691  C  C6    . DG  I 5 80  ? -1.394  -32.655 81.055 1.00 55.47  ? 7    DG  I C6    1 
ATOM   7692  O  O6    . DG  I 5 80  ? -1.114  -33.709 81.637 1.00 55.41  ? 7    DG  I O6    1 
ATOM   7693  N  N1    . DG  I 5 80  ? -1.102  -31.425 81.649 1.00 55.65  ? 7    DG  I N1    1 
ATOM   7694  C  C2    . DG  I 5 80  ? -1.376  -30.194 81.105 1.00 55.35  ? 7    DG  I C2    1 
ATOM   7695  N  N2    . DG  I 5 80  ? -1.027  -29.117 81.812 1.00 55.49  ? 7    DG  I N2    1 
ATOM   7696  N  N3    . DG  I 5 80  ? -1.962  -30.030 79.932 1.00 56.32  ? 7    DG  I N3    1 
ATOM   7697  C  C4    . DG  I 5 80  ? -2.257  -31.217 79.341 1.00 56.13  ? 7    DG  I C4    1 
ATOM   7698  P  P     . DA  I 5 81  ? -2.571  -27.526 74.214 1.00 44.67  ? 8    DA  I P     1 
ATOM   7699  O  OP1   . DA  I 5 81  ? -3.519  -27.113 73.160 1.00 44.96  ? 8    DA  I OP1   1 
ATOM   7700  O  OP2   . DA  I 5 81  ? -1.407  -28.380 73.884 1.00 44.61  ? 8    DA  I OP2   1 
ATOM   7701  O  "O5'" . DA  I 5 81  ? -1.950  -26.229 74.892 1.00 45.03  ? 8    DA  I "O5'" 1 
ATOM   7702  C  "C5'" . DA  I 5 81  ? -2.315  -25.838 76.214 1.00 46.89  ? 8    DA  I "C5'" 1 
ATOM   7703  C  "C4'" . DA  I 5 81  ? -1.144  -25.177 76.923 1.00 47.43  ? 8    DA  I "C4'" 1 
ATOM   7704  O  "O4'" . DA  I 5 81  ? -0.561  -26.112 77.863 1.00 48.16  ? 8    DA  I "O4'" 1 
ATOM   7705  C  "C3'" . DA  I 5 81  ? 0.015   -24.705 76.052 1.00 46.67  ? 8    DA  I "C3'" 1 
ATOM   7706  O  "O3'" . DA  I 5 81  ? 0.630   -23.621 76.708 1.00 46.06  ? 8    DA  I "O3'" 1 
ATOM   7707  C  "C2'" . DA  I 5 81  ? 0.929   -25.923 76.017 1.00 48.41  ? 8    DA  I "C2'" 1 
ATOM   7708  C  "C1'" . DA  I 5 81  ? 0.718   -26.525 77.403 1.00 50.84  ? 8    DA  I "C1'" 1 
ATOM   7709  N  N9    . DA  I 5 81  ? 0.715   -27.985 77.500 1.00 51.58  ? 8    DA  I N9    1 
ATOM   7710  C  C8    . DA  I 5 81  ? 0.164   -28.908 76.662 1.00 51.81  ? 8    DA  I C8    1 
ATOM   7711  N  N7    . DA  I 5 81  ? 0.311   -30.147 77.057 1.00 51.86  ? 8    DA  I N7    1 
ATOM   7712  C  C5    . DA  I 5 81  ? 1.005   -30.032 78.244 1.00 52.67  ? 8    DA  I C5    1 
ATOM   7713  C  C6    . DA  I 5 81  ? 1.490   -30.978 79.180 1.00 52.66  ? 8    DA  I C6    1 
ATOM   7714  N  N6    . DA  I 5 81  ? 1.338   -32.299 79.066 1.00 52.32  ? 8    DA  I N6    1 
ATOM   7715  N  N1    . DA  I 5 81  ? 2.152   -30.509 80.258 1.00 52.29  ? 8    DA  I N1    1 
ATOM   7716  C  C2    . DA  I 5 81  ? 2.312   -29.188 80.401 1.00 52.04  ? 8    DA  I C2    1 
ATOM   7717  N  N3    . DA  I 5 81  ? 1.908   -28.205 79.602 1.00 52.42  ? 8    DA  I N3    1 
ATOM   7718  C  C4    . DA  I 5 81  ? 1.250   -28.701 78.535 1.00 52.67  ? 8    DA  I C4    1 
ATOM   7719  P  P     . DA  I 5 82  ? 1.767   -22.748 76.017 1.00 46.89  ? 9    DA  I P     1 
ATOM   7720  O  OP1   . DA  I 5 82  ? 1.403   -21.318 76.138 1.00 48.10  ? 9    DA  I OP1   1 
ATOM   7721  O  OP2   . DA  I 5 82  ? 2.061   -23.289 74.670 1.00 48.96  ? 9    DA  I OP2   1 
ATOM   7722  O  "O5'" . DA  I 5 82  ? 3.060   -23.054 76.889 1.00 49.40  ? 9    DA  I "O5'" 1 
ATOM   7723  C  "C5'" . DA  I 5 82  ? 3.052   -23.012 78.318 1.00 51.26  ? 9    DA  I "C5'" 1 
ATOM   7724  C  "C4'" . DA  I 5 82  ? 4.314   -23.647 78.890 1.00 52.79  ? 9    DA  I "C4'" 1 
ATOM   7725  O  "O4'" . DA  I 5 82  ? 4.183   -25.090 78.921 1.00 54.03  ? 9    DA  I "O4'" 1 
ATOM   7726  C  "C3'" . DA  I 5 82  ? 5.618   -23.360 78.157 1.00 53.13  ? 9    DA  I "C3'" 1 
ATOM   7727  O  "O3'" . DA  I 5 82  ? 6.457   -22.730 79.098 1.00 54.17  ? 9    DA  I "O3'" 1 
ATOM   7728  C  "C2'" . DA  I 5 82  ? 6.132   -24.729 77.711 1.00 54.19  ? 9    DA  I "C2'" 1 
ATOM   7729  C  "C1'" . DA  I 5 82  ? 5.408   -25.717 78.614 1.00 56.02  ? 9    DA  I "C1'" 1 
ATOM   7730  N  N9    . DA  I 5 82  ? 4.967   -26.979 78.032 1.00 57.14  ? 9    DA  I N9    1 
ATOM   7731  C  C8    . DA  I 5 82  ? 4.291   -27.146 76.852 1.00 58.69  ? 9    DA  I C8    1 
ATOM   7732  N  N7    . DA  I 5 82  ? 3.973   -28.390 76.570 1.00 59.06  ? 9    DA  I N7    1 
ATOM   7733  C  C5    . DA  I 5 82  ? 4.460   -29.090 77.658 1.00 58.35  ? 9    DA  I C5    1 
ATOM   7734  C  C6    . DA  I 5 82  ? 4.446   -30.457 77.981 1.00 57.69  ? 9    DA  I C6    1 
ATOM   7735  N  N6    . DA  I 5 82  ? 3.903   -31.395 77.211 1.00 57.69  ? 9    DA  I N6    1 
ATOM   7736  N  N1    . DA  I 5 82  ? 5.013   -30.836 79.137 1.00 58.37  ? 9    DA  I N1    1 
ATOM   7737  C  C2    . DA  I 5 82  ? 5.569   -29.908 79.920 1.00 58.25  ? 9    DA  I C2    1 
ATOM   7738  N  N3    . DA  I 5 82  ? 5.637   -28.595 79.719 1.00 58.43  ? 9    DA  I N3    1 
ATOM   7739  C  C4    . DA  I 5 82  ? 5.066   -28.240 78.563 1.00 57.83  ? 9    DA  I C4    1 
ATOM   7740  P  P     . DC  I 5 83  ? 7.961   -22.265 78.826 1.00 55.26  ? 10   DC  I P     1 
ATOM   7741  O  OP1   . DC  I 5 83  ? 8.240   -21.334 79.944 1.00 55.60  ? 10   DC  I OP1   1 
ATOM   7742  O  OP2   . DC  I 5 83  ? 8.112   -21.861 77.410 1.00 55.73  ? 10   DC  I OP2   1 
ATOM   7743  O  "O5'" . DC  I 5 83  ? 8.876   -23.568 78.964 1.00 56.89  ? 10   DC  I "O5'" 1 
ATOM   7744  C  "C5'" . DC  I 5 83  ? 8.892   -24.402 80.121 1.00 58.83  ? 10   DC  I "C5'" 1 
ATOM   7745  C  "C4'" . DC  I 5 83  ? 9.879   -25.546 79.943 1.00 60.79  ? 10   DC  I "C4'" 1 
ATOM   7746  O  "O4'" . DC  I 5 83  ? 9.199   -26.741 79.485 1.00 61.71  ? 10   DC  I "O4'" 1 
ATOM   7747  C  "C3'" . DC  I 5 83  ? 11.001  -25.332 78.935 1.00 62.05  ? 10   DC  I "C3'" 1 
ATOM   7748  O  "O3'" . DC  I 5 83  ? 12.091  -26.093 79.388 1.00 64.13  ? 10   DC  I "O3'" 1 
ATOM   7749  C  "C2'" . DC  I 5 83  ? 10.440  -25.969 77.670 1.00 62.64  ? 10   DC  I "C2'" 1 
ATOM   7750  C  "C1'" . DC  I 5 83  ? 9.856   -27.211 78.326 1.00 63.55  ? 10   DC  I "C1'" 1 
ATOM   7751  N  N1    . DC  I 5 83  ? 8.907   -28.022 77.517 1.00 64.44  ? 10   DC  I N1    1 
ATOM   7752  C  C2    . DC  I 5 83  ? 8.645   -29.342 77.919 1.00 65.00  ? 10   DC  I C2    1 
ATOM   7753  O  O2    . DC  I 5 83  ? 9.199   -29.789 78.917 1.00 65.32  ? 10   DC  I O2    1 
ATOM   7754  N  N3    . DC  I 5 83  ? 7.791   -30.109 77.207 1.00 64.95  ? 10   DC  I N3    1 
ATOM   7755  C  C4    . DC  I 5 83  ? 7.219   -29.590 76.127 1.00 64.78  ? 10   DC  I C4    1 
ATOM   7756  N  N4    . DC  I 5 83  ? 6.386   -30.378 75.459 1.00 65.23  ? 10   DC  I N4    1 
ATOM   7757  C  C5    . DC  I 5 83  ? 7.455   -28.251 75.689 1.00 64.89  ? 10   DC  I C5    1 
ATOM   7758  C  C6    . DC  I 5 83  ? 8.305   -27.506 76.406 1.00 64.61  ? 10   DC  I C6    1 
ATOM   7759  P  P     . DA  I 5 84  ? 13.556  -25.486 79.521 1.00 65.93  ? 11   DA  I P     1 
ATOM   7760  O  OP1   . DA  I 5 84  ? 13.500  -24.462 80.584 1.00 64.82  ? 11   DA  I OP1   1 
ATOM   7761  O  OP2   . DA  I 5 84  ? 14.076  -25.151 78.179 1.00 65.74  ? 11   DA  I OP2   1 
ATOM   7762  O  "O5'" . DA  I 5 84  ? 14.387  -26.759 80.010 1.00 68.33  ? 11   DA  I "O5'" 1 
ATOM   7763  C  "C5'" . DA  I 5 84  ? 13.840  -27.661 80.966 1.00 72.02  ? 11   DA  I "C5'" 1 
ATOM   7764  C  "C4'" . DA  I 5 84  ? 14.447  -29.047 80.802 1.00 74.53  ? 11   DA  I "C4'" 1 
ATOM   7765  O  "O4'" . DA  I 5 84  ? 13.566  -29.895 80.021 1.00 75.14  ? 11   DA  I "O4'" 1 
ATOM   7766  C  "C3'" . DA  I 5 84  ? 15.801  -29.087 80.107 1.00 76.09  ? 11   DA  I "C3'" 1 
ATOM   7767  O  "O3'" . DA  I 5 84  ? 16.613  -30.085 80.721 1.00 78.35  ? 11   DA  I "O3'" 1 
ATOM   7768  C  "C2'" . DA  I 5 84  ? 15.447  -29.441 78.665 1.00 76.61  ? 11   DA  I "C2'" 1 
ATOM   7769  C  "C1'" . DA  I 5 84  ? 14.202  -30.309 78.826 1.00 76.53  ? 11   DA  I "C1'" 1 
ATOM   7770  N  N9    . DA  I 5 84  ? 13.281  -30.176 77.694 1.00 76.81  ? 11   DA  I N9    1 
ATOM   7771  C  C8    . DA  I 5 84  ? 12.925  -29.018 77.055 1.00 76.99  ? 11   DA  I C8    1 
ATOM   7772  N  N7    . DA  I 5 84  ? 12.089  -29.184 76.065 1.00 77.11  ? 11   DA  I N7    1 
ATOM   7773  C  C5    . DA  I 5 84  ? 11.878  -30.552 76.050 1.00 77.24  ? 11   DA  I C5    1 
ATOM   7774  C  C6    . DA  I 5 84  ? 11.082  -31.379 75.226 1.00 77.14  ? 11   DA  I C6    1 
ATOM   7775  N  N6    . DA  I 5 84  ? 10.333  -30.900 74.229 1.00 76.93  ? 11   DA  I N6    1 
ATOM   7776  N  N1    . DA  I 5 84  ? 11.085  -32.710 75.469 1.00 76.81  ? 11   DA  I N1    1 
ATOM   7777  C  C2    . DA  I 5 84  ? 11.837  -33.180 76.474 1.00 76.94  ? 11   DA  I C2    1 
ATOM   7778  N  N3    . DA  I 5 84  ? 12.631  -32.505 77.311 1.00 77.07  ? 11   DA  I N3    1 
ATOM   7779  C  C4    . DA  I 5 84  ? 12.606  -31.182 77.044 1.00 77.00  ? 11   DA  I C4    1 
ATOM   7780  P  P     . DT  I 5 85  ? 18.119  -30.370 80.250 1.00 79.53  ? 12   DT  I P     1 
ATOM   7781  O  OP1   . DT  I 5 85  ? 18.889  -30.747 81.459 1.00 79.72  ? 12   DT  I OP1   1 
ATOM   7782  O  OP2   . DT  I 5 85  ? 18.582  -29.251 79.392 1.00 78.47  ? 12   DT  I OP2   1 
ATOM   7783  O  "O5'" . DT  I 5 85  ? 17.962  -31.667 79.327 1.00 79.93  ? 12   DT  I "O5'" 1 
ATOM   7784  C  "C5'" . DT  I 5 85  ? 17.224  -32.806 79.746 1.00 81.57  ? 12   DT  I "C5'" 1 
ATOM   7785  C  "C4'" . DT  I 5 85  ? 17.027  -33.744 78.566 1.00 83.48  ? 12   DT  I "C4'" 1 
ATOM   7786  O  "O4'" . DT  I 5 85  ? 15.947  -33.269 77.711 1.00 84.24  ? 12   DT  I "O4'" 1 
ATOM   7787  C  "C3'" . DT  I 5 85  ? 18.246  -33.894 77.657 1.00 84.25  ? 12   DT  I "C3'" 1 
ATOM   7788  O  "O3'" . DT  I 5 85  ? 18.474  -35.264 77.380 1.00 85.16  ? 12   DT  I "O3'" 1 
ATOM   7789  C  "C2'" . DT  I 5 85  ? 17.855  -33.147 76.384 1.00 84.40  ? 12   DT  I "C2'" 1 
ATOM   7790  C  "C1'" . DT  I 5 85  ? 16.348  -33.391 76.360 1.00 84.59  ? 12   DT  I "C1'" 1 
ATOM   7791  N  N1    . DT  I 5 85  ? 15.567  -32.454 75.460 1.00 84.89  ? 12   DT  I N1    1 
ATOM   7792  C  C2    . DT  I 5 85  ? 14.546  -32.953 74.666 1.00 84.71  ? 12   DT  I C2    1 
ATOM   7793  O  O2    . DT  I 5 85  ? 14.203  -34.120 74.647 1.00 84.46  ? 12   DT  I O2    1 
ATOM   7794  N  N3    . DT  I 5 85  ? 13.916  -32.015 73.886 1.00 84.89  ? 12   DT  I N3    1 
ATOM   7795  C  C4    . DT  I 5 85  ? 14.195  -30.663 73.808 1.00 84.65  ? 12   DT  I C4    1 
ATOM   7796  O  O4    . DT  I 5 85  ? 13.555  -29.926 73.069 1.00 84.78  ? 12   DT  I O4    1 
ATOM   7797  C  C5    . DT  I 5 85  ? 15.272  -30.201 74.655 1.00 84.53  ? 12   DT  I C5    1 
ATOM   7798  C  C7    . DT  I 5 85  ? 15.691  -28.761 74.674 1.00 84.63  ? 12   DT  I C7    1 
ATOM   7799  C  C6    . DT  I 5 85  ? 15.894  -31.105 75.423 1.00 84.84  ? 12   DT  I C6    1 
ATOM   7800  P  P     . DG  I 5 86  ? 19.954  -35.756 77.038 1.00 85.69  ? 13   DG  I P     1 
ATOM   7801  O  OP1   . DG  I 5 86  ? 20.550  -36.095 78.348 1.00 85.87  ? 13   DG  I OP1   1 
ATOM   7802  O  OP2   . DG  I 5 86  ? 20.617  -34.778 76.129 1.00 84.74  ? 13   DG  I OP2   1 
ATOM   7803  O  "O5'" . DG  I 5 86  ? 19.742  -37.121 76.225 1.00 86.20  ? 13   DG  I "O5'" 1 
ATOM   7804  C  "C5'" . DG  I 5 86  ? 18.453  -37.684 75.958 1.00 86.35  ? 13   DG  I "C5'" 1 
ATOM   7805  C  "C4'" . DG  I 5 86  ? 18.293  -38.058 74.488 1.00 86.33  ? 13   DG  I "C4'" 1 
ATOM   7806  O  "O4'" . DG  I 5 86  ? 17.501  -37.040 73.820 1.00 87.32  ? 13   DG  I "O4'" 1 
ATOM   7807  C  "C3'" . DG  I 5 86  ? 19.577  -38.226 73.668 1.00 85.39  ? 13   DG  I "C3'" 1 
ATOM   7808  O  "O3'" . DG  I 5 86  ? 19.498  -39.474 72.936 1.00 82.98  ? 13   DG  I "O3'" 1 
ATOM   7809  C  "C2'" . DG  I 5 86  ? 19.623  -36.949 72.812 1.00 86.60  ? 13   DG  I "C2'" 1 
ATOM   7810  C  "C1'" . DG  I 5 86  ? 18.138  -36.628 72.625 1.00 88.57  ? 13   DG  I "C1'" 1 
ATOM   7811  N  N9    . DG  I 5 86  ? 17.769  -35.220 72.411 1.00 89.27  ? 13   DG  I N9    1 
ATOM   7812  C  C8    . DG  I 5 86  ? 18.269  -34.104 73.049 1.00 89.54  ? 13   DG  I C8    1 
ATOM   7813  N  N7    . DG  I 5 86  ? 17.736  -32.977 72.658 1.00 89.33  ? 13   DG  I N7    1 
ATOM   7814  C  C5    . DG  I 5 86  ? 16.810  -33.362 71.697 1.00 89.35  ? 13   DG  I C5    1 
ATOM   7815  C  C6    . DG  I 5 86  ? 15.922  -32.577 70.916 1.00 89.17  ? 13   DG  I C6    1 
ATOM   7816  O  O6    . DG  I 5 86  ? 15.770  -31.347 70.921 1.00 89.26  ? 13   DG  I O6    1 
ATOM   7817  N  N1    . DG  I 5 86  ? 15.155  -33.360 70.058 1.00 89.26  ? 13   DG  I N1    1 
ATOM   7818  C  C2    . DG  I 5 86  ? 15.235  -34.729 69.966 1.00 89.21  ? 13   DG  I C2    1 
ATOM   7819  N  N2    . DG  I 5 86  ? 14.418  -35.313 69.086 1.00 89.28  ? 13   DG  I N2    1 
ATOM   7820  N  N3    . DG  I 5 86  ? 16.053  -35.478 70.691 1.00 89.59  ? 13   DG  I N3    1 
ATOM   7821  C  C4    . DG  I 5 86  ? 16.815  -34.734 71.535 1.00 89.52  ? 13   DG  I C4    1 
ATOM   7822  P  P     . DC  I 5 87  ? 20.482  -39.912 71.736 1.00 81.53  ? 14   DC  I P     1 
ATOM   7823  O  OP1   . DC  I 5 87  ? 20.389  -41.380 71.621 1.00 81.25  ? 14   DC  I OP1   1 
ATOM   7824  O  OP2   . DC  I 5 87  ? 21.788  -39.222 71.815 1.00 80.10  ? 14   DC  I OP2   1 
ATOM   7825  O  "O5'" . DC  I 5 87  ? 19.771  -39.256 70.472 1.00 82.18  ? 14   DC  I "O5'" 1 
ATOM   7826  C  "C5'" . DC  I 5 87  ? 18.654  -39.837 69.810 1.00 81.29  ? 14   DC  I "C5'" 1 
ATOM   7827  C  "C4'" . DC  I 5 87  ? 18.463  -39.036 68.544 1.00 80.62  ? 14   DC  I "C4'" 1 
ATOM   7828  O  "O4'" . DC  I 5 87  ? 18.205  -37.667 68.939 1.00 80.19  ? 14   DC  I "O4'" 1 
ATOM   7829  C  "C3'" . DC  I 5 87  ? 19.698  -38.990 67.639 1.00 80.10  ? 14   DC  I "C3'" 1 
ATOM   7830  O  "O3'" . DC  I 5 87  ? 19.359  -39.257 66.282 1.00 79.87  ? 14   DC  I "O3'" 1 
ATOM   7831  C  "C2'" . DC  I 5 87  ? 20.191  -37.557 67.775 1.00 80.26  ? 14   DC  I "C2'" 1 
ATOM   7832  C  "C1'" . DC  I 5 87  ? 18.858  -36.856 67.995 1.00 80.78  ? 14   DC  I "C1'" 1 
ATOM   7833  N  N1    . DC  I 5 87  ? 18.955  -35.445 68.468 1.00 81.27  ? 14   DC  I N1    1 
ATOM   7834  C  C2    . DC  I 5 87  ? 18.187  -34.461 67.828 1.00 81.87  ? 14   DC  I C2    1 
ATOM   7835  O  O2    . DC  I 5 87  ? 17.435  -34.780 66.890 1.00 82.10  ? 14   DC  I O2    1 
ATOM   7836  N  N3    . DC  I 5 87  ? 18.290  -33.175 68.260 1.00 81.81  ? 14   DC  I N3    1 
ATOM   7837  C  C4    . DC  I 5 87  ? 19.106  -32.857 69.269 1.00 81.59  ? 14   DC  I C4    1 
ATOM   7838  N  N4    . DC  I 5 87  ? 19.164  -31.575 69.653 1.00 81.45  ? 14   DC  I N4    1 
ATOM   7839  C  C5    . DC  I 5 87  ? 19.894  -33.846 69.931 1.00 81.98  ? 14   DC  I C5    1 
ATOM   7840  C  C6    . DC  I 5 87  ? 19.787  -35.111 69.502 1.00 81.75  ? 14   DC  I C6    1 
ATOM   7841  P  P     . DC  I 5 88  ? 19.417  -40.735 65.682 1.00 79.40  ? 15   DC  I P     1 
ATOM   7842  O  OP1   . DC  I 5 88  ? 19.170  -41.681 66.791 1.00 79.00  ? 15   DC  I OP1   1 
ATOM   7843  O  OP2   . DC  I 5 88  ? 20.639  -40.831 64.852 1.00 79.21  ? 15   DC  I OP2   1 
ATOM   7844  O  "O5'" . DC  I 5 88  ? 18.168  -40.788 64.686 1.00 80.67  ? 15   DC  I "O5'" 1 
ATOM   7845  C  "C5'" . DC  I 5 88  ? 16.847  -40.410 65.130 1.00 82.02  ? 15   DC  I "C5'" 1 
ATOM   7846  C  "C4'" . DC  I 5 88  ? 16.131  -39.566 64.081 1.00 82.41  ? 15   DC  I "C4'" 1 
ATOM   7847  O  "O4'" . DC  I 5 88  ? 16.806  -38.283 63.958 1.00 82.72  ? 15   DC  I "O4'" 1 
ATOM   7848  C  "C3'" . DC  I 5 88  ? 16.101  -40.162 62.672 1.00 82.45  ? 15   DC  I "C3'" 1 
ATOM   7849  O  "O3'" . DC  I 5 88  ? 14.898  -39.766 61.995 1.00 82.06  ? 15   DC  I "O3'" 1 
ATOM   7850  C  "C2'" . DC  I 5 88  ? 17.354  -39.554 62.045 1.00 82.23  ? 15   DC  I "C2'" 1 
ATOM   7851  C  "C1'" . DC  I 5 88  ? 17.274  -38.145 62.631 1.00 82.82  ? 15   DC  I "C1'" 1 
ATOM   7852  N  N1    . DC  I 5 88  ? 18.554  -37.351 62.569 1.00 83.29  ? 15   DC  I N1    1 
ATOM   7853  C  C2    . DC  I 5 88  ? 18.480  -35.951 62.513 1.00 83.15  ? 15   DC  I C2    1 
ATOM   7854  O  O2    . DC  I 5 88  ? 17.374  -35.396 62.545 1.00 83.17  ? 15   DC  I O2    1 
ATOM   7855  N  N3    . DC  I 5 88  ? 19.632  -35.238 62.434 1.00 83.26  ? 15   DC  I N3    1 
ATOM   7856  C  C4    . DC  I 5 88  ? 20.814  -35.856 62.408 1.00 83.09  ? 15   DC  I C4    1 
ATOM   7857  N  N4    . DC  I 5 88  ? 21.909  -35.094 62.335 1.00 82.95  ? 15   DC  I N4    1 
ATOM   7858  C  C5    . DC  I 5 88  ? 20.919  -37.279 62.459 1.00 83.09  ? 15   DC  I C5    1 
ATOM   7859  C  C6    . DC  I 5 88  ? 19.776  -37.977 62.536 1.00 83.55  ? 15   DC  I C6    1 
ATOM   7860  P  P     . DT  I 5 89  ? 14.429  -40.404 60.587 1.00 81.77  ? 16   DT  I P     1 
ATOM   7861  O  OP1   . DT  I 5 89  ? 13.831  -41.726 60.899 1.00 81.77  ? 16   DT  I OP1   1 
ATOM   7862  O  OP2   . DT  I 5 89  ? 15.522  -40.267 59.582 1.00 80.01  ? 16   DT  I OP2   1 
ATOM   7863  O  "O5'" . DT  I 5 89  ? 13.216  -39.459 60.135 1.00 79.66  ? 16   DT  I "O5'" 1 
ATOM   7864  C  "C5'" . DT  I 5 89  ? 13.056  -38.157 60.669 1.00 76.57  ? 16   DT  I "C5'" 1 
ATOM   7865  C  "C4'" . DT  I 5 89  ? 13.441  -37.073 59.676 1.00 74.36  ? 16   DT  I "C4'" 1 
ATOM   7866  O  "O4'" . DT  I 5 89  ? 14.821  -36.664 59.831 1.00 73.98  ? 16   DT  I "O4'" 1 
ATOM   7867  C  "C3'" . DT  I 5 89  ? 13.259  -37.340 58.186 1.00 72.97  ? 16   DT  I "C3'" 1 
ATOM   7868  O  "O3'" . DT  I 5 89  ? 12.530  -36.202 57.781 1.00 71.44  ? 16   DT  I "O3'" 1 
ATOM   7869  C  "C2'" . DT  I 5 89  ? 14.685  -37.308 57.639 1.00 73.20  ? 16   DT  I "C2'" 1 
ATOM   7870  C  "C1'" . DT  I 5 89  ? 15.252  -36.240 58.562 1.00 74.48  ? 16   DT  I "C1'" 1 
ATOM   7871  N  N1    . DT  I 5 89  ? 16.722  -36.081 58.639 1.00 75.11  ? 16   DT  I N1    1 
ATOM   7872  C  C2    . DT  I 5 89  ? 17.249  -34.798 58.655 1.00 75.42  ? 16   DT  I C2    1 
ATOM   7873  O  O2    . DT  I 5 89  ? 16.576  -33.780 58.590 1.00 75.15  ? 16   DT  I O2    1 
ATOM   7874  N  N3    . DT  I 5 89  ? 18.622  -34.747 58.741 1.00 75.88  ? 16   DT  I N3    1 
ATOM   7875  C  C4    . DT  I 5 89  ? 19.497  -35.824 58.823 1.00 75.61  ? 16   DT  I C4    1 
ATOM   7876  O  O4    . DT  I 5 89  ? 20.714  -35.655 58.895 1.00 75.29  ? 16   DT  I O4    1 
ATOM   7877  C  C5    . DT  I 5 89  ? 18.874  -37.136 58.809 1.00 75.24  ? 16   DT  I C5    1 
ATOM   7878  C  C7    . DT  I 5 89  ? 19.692  -38.390 58.885 1.00 74.83  ? 16   DT  I C7    1 
ATOM   7879  C  C6    . DT  I 5 89  ? 17.536  -37.200 58.723 1.00 75.21  ? 16   DT  I C6    1 
ATOM   7880  P  P     . DT  I 5 90  ? 11.667  -36.072 56.455 1.00 69.07  ? 17   DT  I P     1 
ATOM   7881  O  OP1   . DT  I 5 90  ? 10.269  -36.327 56.864 1.00 68.67  ? 17   DT  I OP1   1 
ATOM   7882  O  OP2   . DT  I 5 90  ? 12.328  -36.801 55.349 1.00 67.60  ? 17   DT  I OP2   1 
ATOM   7883  O  "O5'" . DT  I 5 90  ? 11.835  -34.523 56.115 1.00 70.32  ? 17   DT  I "O5'" 1 
ATOM   7884  C  "C5'" . DT  I 5 90  ? 11.757  -33.536 57.132 1.00 71.36  ? 17   DT  I "C5'" 1 
ATOM   7885  C  "C4'" . DT  I 5 90  ? 12.744  -32.427 56.834 1.00 72.89  ? 17   DT  I "C4'" 1 
ATOM   7886  O  "O4'" . DT  I 5 90  ? 14.082  -32.985 56.815 1.00 74.40  ? 17   DT  I "O4'" 1 
ATOM   7887  C  "C3'" . DT  I 5 90  ? 12.534  -31.737 55.485 1.00 72.28  ? 17   DT  I "C3'" 1 
ATOM   7888  O  "O3'" . DT  I 5 90  ? 12.397  -30.330 55.637 1.00 69.68  ? 17   DT  I "O3'" 1 
ATOM   7889  C  "C2'" . DT  I 5 90  ? 13.790  -32.093 54.695 1.00 74.34  ? 17   DT  I "C2'" 1 
ATOM   7890  C  "C1'" . DT  I 5 90  ? 14.802  -32.310 55.806 1.00 77.23  ? 17   DT  I "C1'" 1 
ATOM   7891  N  N1    . DT  I 5 90  ? 15.996  -33.118 55.383 1.00 78.60  ? 17   DT  I N1    1 
ATOM   7892  C  C2    . DT  I 5 90  ? 17.260  -32.568 55.489 1.00 78.67  ? 17   DT  I C2    1 
ATOM   7893  O  O2    . DT  I 5 90  ? 17.489  -31.449 55.911 1.00 79.07  ? 17   DT  I O2    1 
ATOM   7894  N  N3    . DT  I 5 90  ? 18.272  -33.391 55.075 1.00 79.10  ? 17   DT  I N3    1 
ATOM   7895  C  C4    . DT  I 5 90  ? 18.164  -34.680 54.579 1.00 79.06  ? 17   DT  I C4    1 
ATOM   7896  O  O4    . DT  I 5 90  ? 19.150  -35.329 54.239 1.00 79.59  ? 17   DT  I O4    1 
ATOM   7897  C  C5    . DT  I 5 90  ? 16.821  -35.200 54.492 1.00 79.07  ? 17   DT  I C5    1 
ATOM   7898  C  C7    . DT  I 5 90  ? 16.572  -36.585 53.966 1.00 78.72  ? 17   DT  I C7    1 
ATOM   7899  C  C6    . DT  I 5 90  ? 15.816  -34.404 54.893 1.00 79.18  ? 17   DT  I C6    1 
ATOM   7900  P  P     . DT  I 5 91  ? 12.051  -29.393 54.388 1.00 68.60  ? 18   DT  I P     1 
ATOM   7901  O  OP1   . DT  I 5 91  ? 11.015  -28.474 54.874 1.00 68.64  ? 18   DT  I OP1   1 
ATOM   7902  O  OP2   . DT  I 5 91  ? 11.810  -30.185 53.167 1.00 68.04  ? 18   DT  I OP2   1 
ATOM   7903  O  "O5'" . DT  I 5 91  ? 13.412  -28.598 54.096 1.00 71.44  ? 18   DT  I "O5'" 1 
ATOM   7904  C  "C5'" . DT  I 5 91  ? 14.204  -27.954 55.109 1.00 74.84  ? 18   DT  I "C5'" 1 
ATOM   7905  C  "C4'" . DT  I 5 91  ? 15.591  -27.593 54.590 1.00 78.29  ? 18   DT  I "C4'" 1 
ATOM   7906  O  "O4'" . DT  I 5 91  ? 16.386  -28.791 54.395 1.00 79.72  ? 18   DT  I "O4'" 1 
ATOM   7907  C  "C3'" . DT  I 5 91  ? 15.645  -26.851 53.253 1.00 80.56  ? 18   DT  I "C3'" 1 
ATOM   7908  O  "O3'" . DT  I 5 91  ? 16.581  -25.785 53.323 1.00 83.08  ? 18   DT  I "O3'" 1 
ATOM   7909  C  "C2'" . DT  I 5 91  ? 16.131  -27.891 52.247 1.00 80.64  ? 18   DT  I "C2'" 1 
ATOM   7910  C  "C1'" . DT  I 5 91  ? 17.027  -28.749 53.128 1.00 81.33  ? 18   DT  I "C1'" 1 
ATOM   7911  N  N1    . DT  I 5 91  ? 17.246  -30.160 52.640 1.00 82.22  ? 18   DT  I N1    1 
ATOM   7912  C  C2    . DT  I 5 91  ? 18.524  -30.706 52.656 1.00 82.51  ? 18   DT  I C2    1 
ATOM   7913  O  O2    . DT  I 5 91  ? 19.516  -30.107 53.042 1.00 82.70  ? 18   DT  I O2    1 
ATOM   7914  N  N3    . DT  I 5 91  ? 18.609  -32.002 52.203 1.00 82.12  ? 18   DT  I N3    1 
ATOM   7915  C  C4    . DT  I 5 91  ? 17.568  -32.792 51.749 1.00 82.22  ? 18   DT  I C4    1 
ATOM   7916  O  O4    . DT  I 5 91  ? 17.745  -33.939 51.361 1.00 82.36  ? 18   DT  I O4    1 
ATOM   7917  C  C5    . DT  I 5 91  ? 16.262  -32.175 51.757 1.00 82.51  ? 18   DT  I C5    1 
ATOM   7918  C  C7    . DT  I 5 91  ? 15.061  -32.941 51.281 1.00 82.33  ? 18   DT  I C7    1 
ATOM   7919  C  C6    . DT  I 5 91  ? 16.165  -30.910 52.198 1.00 82.51  ? 18   DT  I C6    1 
ATOM   7920  P  P     . DT  I 5 92  ? 16.472  -24.528 52.339 1.00 84.63  ? 19   DT  I P     1 
ATOM   7921  O  OP1   . DT  I 5 92  ? 16.256  -23.379 53.247 1.00 84.27  ? 19   DT  I OP1   1 
ATOM   7922  O  OP2   . DT  I 5 92  ? 15.517  -24.824 51.246 1.00 83.86  ? 19   DT  I OP2   1 
ATOM   7923  O  "O5'" . DT  I 5 92  ? 17.905  -24.402 51.630 1.00 86.77  ? 19   DT  I "O5'" 1 
ATOM   7924  C  "C5'" . DT  I 5 92  ? 19.112  -24.926 52.184 1.00 90.67  ? 19   DT  I "C5'" 1 
ATOM   7925  C  "C4'" . DT  I 5 92  ? 19.997  -25.501 51.088 1.00 94.03  ? 19   DT  I "C4'" 1 
ATOM   7926  O  "O4'" . DT  I 5 92  ? 19.822  -26.944 50.998 1.00 94.73  ? 19   DT  I "O4'" 1 
ATOM   7927  C  "C3'" . DT  I 5 92  ? 19.742  -24.977 49.671 1.00 96.02  ? 19   DT  I "C3'" 1 
ATOM   7928  O  "O3'" . DT  I 5 92  ? 20.976  -24.853 48.985 1.00 99.66  ? 19   DT  I "O3'" 1 
ATOM   7929  C  "C2'" . DT  I 5 92  ? 18.942  -26.103 49.033 1.00 95.51  ? 19   DT  I "C2'" 1 
ATOM   7930  C  "C1'" . DT  I 5 92  ? 19.762  -27.247 49.617 1.00 95.23  ? 19   DT  I "C1'" 1 
ATOM   7931  N  N1    . DT  I 5 92  ? 19.277  -28.644 49.368 1.00 95.31  ? 19   DT  I N1    1 
ATOM   7932  C  C2    . DT  I 5 92  ? 20.193  -29.672 49.468 1.00 95.42  ? 19   DT  I C2    1 
ATOM   7933  O  O2    . DT  I 5 92  ? 21.366  -29.501 49.757 1.00 95.48  ? 19   DT  I O2    1 
ATOM   7934  N  N3    . DT  I 5 92  ? 19.679  -30.922 49.220 1.00 95.27  ? 19   DT  I N3    1 
ATOM   7935  C  C4    . DT  I 5 92  ? 18.374  -31.238 48.886 1.00 95.35  ? 19   DT  I C4    1 
ATOM   7936  O  O4    . DT  I 5 92  ? 18.026  -32.397 48.684 1.00 95.50  ? 19   DT  I O4    1 
ATOM   7937  C  C5    . DT  I 5 92  ? 17.464  -30.117 48.791 1.00 95.46  ? 19   DT  I C5    1 
ATOM   7938  C  C7    . DT  I 5 92  ? 16.019  -30.325 48.434 1.00 95.34  ? 19   DT  I C7    1 
ATOM   7939  C  C6    . DT  I 5 92  ? 17.956  -28.891 49.031 1.00 95.53  ? 19   DT  I C6    1 
ATOM   7940  P  P     . DG  I 5 93  ? 21.636  -23.428 48.707 1.00 102.27 ? 20   DG  I P     1 
ATOM   7941  O  OP1   . DG  I 5 93  ? 22.042  -22.847 50.009 1.00 101.78 ? 20   DG  I OP1   1 
ATOM   7942  O  OP2   . DG  I 5 93  ? 20.729  -22.687 47.798 1.00 101.88 ? 20   DG  I OP2   1 
ATOM   7943  O  "O5'" . DG  I 5 93  ? 22.941  -23.817 47.867 1.00 104.68 ? 20   DG  I "O5'" 1 
ATOM   7944  C  "C5'" . DG  I 5 93  ? 23.862  -24.803 48.339 1.00 108.23 ? 20   DG  I "C5'" 1 
ATOM   7945  C  "C4'" . DG  I 5 93  ? 24.346  -25.726 47.223 1.00 110.93 ? 20   DG  I "C4'" 1 
ATOM   7946  O  "O4'" . DG  I 5 93  ? 23.599  -26.973 47.275 1.00 111.75 ? 20   DG  I "O4'" 1 
ATOM   7947  C  "C3'" . DG  I 5 93  ? 24.245  -25.211 45.779 1.00 112.07 ? 20   DG  I "C3'" 1 
ATOM   7948  O  "O3'" . DG  I 5 93  ? 25.497  -25.459 45.095 1.00 113.80 ? 20   DG  I "O3'" 1 
ATOM   7949  C  "C2'" . DG  I 5 93  ? 23.066  -26.011 45.227 1.00 112.18 ? 20   DG  I "C2'" 1 
ATOM   7950  C  "C1'" . DG  I 5 93  ? 23.247  -27.338 45.959 1.00 112.46 ? 20   DG  I "C1'" 1 
ATOM   7951  N  N9    . DG  I 5 93  ? 22.059  -28.193 45.975 1.00 112.64 ? 20   DG  I N9    1 
ATOM   7952  C  C8    . DG  I 5 93  ? 20.767  -27.810 46.240 1.00 112.71 ? 20   DG  I C8    1 
ATOM   7953  N  N7    . DG  I 5 93  ? 19.910  -28.789 46.179 1.00 112.74 ? 20   DG  I N7    1 
ATOM   7954  C  C5    . DG  I 5 93  ? 20.675  -29.896 45.850 1.00 112.67 ? 20   DG  I C5    1 
ATOM   7955  C  C6    . DG  I 5 93  ? 20.290  -31.245 45.647 1.00 112.68 ? 20   DG  I C6    1 
ATOM   7956  O  O6    . DG  I 5 93  ? 19.153  -31.727 45.725 1.00 112.77 ? 20   DG  I O6    1 
ATOM   7957  N  N1    . DG  I 5 93  ? 21.373  -32.067 45.324 1.00 112.63 ? 20   DG  I N1    1 
ATOM   7958  C  C2    . DG  I 5 93  ? 22.672  -31.624 45.214 1.00 112.75 ? 20   DG  I C2    1 
ATOM   7959  N  N2    . DG  I 5 93  ? 23.594  -32.542 44.897 1.00 112.81 ? 20   DG  I N2    1 
ATOM   7960  N  N3    . DG  I 5 93  ? 23.045  -30.363 45.408 1.00 112.97 ? 20   DG  I N3    1 
ATOM   7961  C  C4    . DG  I 5 93  ? 22.001  -29.549 45.721 1.00 112.77 ? 20   DG  I C4    1 
ATOM   7962  P  P     . DA  I 5 94  ? 25.796  -25.311 43.511 1.00 115.04 ? 21   DA  I P     1 
ATOM   7963  O  OP1   . DA  I 5 94  ? 27.121  -24.665 43.399 1.00 115.01 ? 21   DA  I OP1   1 
ATOM   7964  O  OP2   . DA  I 5 94  ? 24.645  -24.713 42.796 1.00 114.52 ? 21   DA  I OP2   1 
ATOM   7965  O  "O5'" . DA  I 5 94  ? 25.938  -26.833 43.033 1.00 115.59 ? 21   DA  I "O5'" 1 
ATOM   7966  C  "C5'" . DA  I 5 94  ? 26.903  -27.705 43.633 1.00 117.44 ? 21   DA  I "C5'" 1 
ATOM   7967  C  "C4'" . DA  I 5 94  ? 26.963  -29.042 42.910 1.00 118.95 ? 21   DA  I "C4'" 1 
ATOM   7968  O  "O4'" . DA  I 5 94  ? 25.755  -29.801 43.192 1.00 119.53 ? 21   DA  I "O4'" 1 
ATOM   7969  C  "C3'" . DA  I 5 94  ? 27.072  -28.954 41.385 1.00 119.84 ? 21   DA  I "C3'" 1 
ATOM   7970  O  "O3'" . DA  I 5 94  ? 27.999  -29.924 40.878 1.00 120.46 ? 21   DA  I "O3'" 1 
ATOM   7971  C  "C2'" . DA  I 5 94  ? 25.640  -29.218 40.925 1.00 120.08 ? 21   DA  I "C2'" 1 
ATOM   7972  C  "C1'" . DA  I 5 94  ? 25.166  -30.217 41.973 1.00 120.14 ? 21   DA  I "C1'" 1 
ATOM   7973  N  N9    . DA  I 5 94  ? 23.709  -30.254 42.085 1.00 120.19 ? 21   DA  I N9    1 
ATOM   7974  C  C8    . DA  I 5 94  ? 22.886  -29.224 42.452 1.00 120.13 ? 21   DA  I C8    1 
ATOM   7975  N  N7    . DA  I 5 94  ? 21.615  -29.535 42.457 1.00 120.03 ? 21   DA  I N7    1 
ATOM   7976  C  C5    . DA  I 5 94  ? 21.606  -30.857 42.055 1.00 120.11 ? 21   DA  I C5    1 
ATOM   7977  C  C6    . DA  I 5 94  ? 20.559  -31.770 41.860 1.00 120.15 ? 21   DA  I C6    1 
ATOM   7978  N  N6    . DA  I 5 94  ? 19.288  -31.431 42.062 1.00 120.24 ? 21   DA  I N6    1 
ATOM   7979  N  N1    . DA  I 5 94  ? 20.864  -33.024 41.454 1.00 120.21 ? 21   DA  I N1    1 
ATOM   7980  C  C2    . DA  I 5 94  ? 22.153  -33.337 41.256 1.00 120.26 ? 21   DA  I C2    1 
ATOM   7981  N  N3    . DA  I 5 94  ? 23.229  -32.560 41.410 1.00 120.36 ? 21   DA  I N3    1 
ATOM   7982  C  C4    . DA  I 5 94  ? 22.884  -31.321 41.814 1.00 120.20 ? 21   DA  I C4    1 
ATOM   7983  P  P     . DT  I 5 95  ? 28.143  -30.249 39.313 1.00 121.07 ? 22   DT  I P     1 
ATOM   7984  O  OP1   . DT  I 5 95  ? 29.557  -30.626 39.092 1.00 121.38 ? 22   DT  I OP1   1 
ATOM   7985  O  OP2   . DT  I 5 95  ? 27.539  -29.159 38.509 1.00 120.36 ? 22   DT  I OP2   1 
ATOM   7986  O  "O5'" . DT  I 5 95  ? 27.211  -31.540 39.150 1.00 122.40 ? 22   DT  I "O5'" 1 
ATOM   7987  C  "C5'" . DT  I 5 95  ? 27.739  -32.855 38.998 1.00 124.30 ? 22   DT  I "C5'" 1 
ATOM   7988  C  "C4'" . DT  I 5 95  ? 26.885  -33.642 38.017 1.00 125.91 ? 22   DT  I "C4'" 1 
ATOM   7989  O  "O4'" . DT  I 5 95  ? 25.469  -33.501 38.342 1.00 126.75 ? 22   DT  I "O4'" 1 
ATOM   7990  C  "C3'" . DT  I 5 95  ? 27.020  -33.232 36.547 1.00 126.63 ? 22   DT  I "C3'" 1 
ATOM   7991  O  "O3'" . DT  I 5 95  ? 27.110  -34.422 35.746 1.00 126.99 ? 22   DT  I "O3'" 1 
ATOM   7992  C  "C2'" . DT  I 5 95  ? 25.727  -32.448 36.313 1.00 127.00 ? 22   DT  I "C2'" 1 
ATOM   7993  C  "C1'" . DT  I 5 95  ? 24.777  -33.335 37.116 1.00 127.43 ? 22   DT  I "C1'" 1 
ATOM   7994  N  N1    . DT  I 5 95  ? 23.366  -32.819 37.300 1.00 127.63 ? 22   DT  I N1    1 
ATOM   7995  C  C2    . DT  I 5 95  ? 22.292  -33.707 37.271 1.00 127.68 ? 22   DT  I C2    1 
ATOM   7996  O  O2    . DT  I 5 95  ? 22.391  -34.915 37.110 1.00 127.56 ? 22   DT  I O2    1 
ATOM   7997  N  N3    . DT  I 5 95  ? 21.060  -33.117 37.446 1.00 127.65 ? 22   DT  I N3    1 
ATOM   7998  C  C4    . DT  I 5 95  ? 20.802  -31.767 37.638 1.00 127.65 ? 22   DT  I C4    1 
ATOM   7999  O  O4    . DT  I 5 95  ? 19.660  -31.346 37.784 1.00 127.63 ? 22   DT  I O4    1 
ATOM   8000  C  C5    . DT  I 5 95  ? 21.960  -30.896 37.652 1.00 127.72 ? 22   DT  I C5    1 
ATOM   8001  C  C7    . DT  I 5 95  ? 21.818  -29.413 37.850 1.00 127.58 ? 22   DT  I C7    1 
ATOM   8002  C  C6    . DT  I 5 95  ? 23.166  -31.458 37.483 1.00 127.67 ? 22   DT  I C6    1 
ATOM   8003  P  P     . DG  I 5 96  ? 26.856  -34.469 34.158 1.00 127.23 ? 23   DG  I P     1 
ATOM   8004  O  OP1   . DG  I 5 96  ? 28.108  -33.998 33.524 1.00 127.46 ? 23   DG  I OP1   1 
ATOM   8005  O  OP2   . DG  I 5 96  ? 25.587  -33.792 33.799 1.00 127.17 ? 23   DG  I OP2   1 
ATOM   8006  O  "O5'" . DG  I 5 96  ? 26.657  -36.053 33.939 1.00 126.75 ? 23   DG  I "O5'" 1 
ATOM   8007  C  "C5'" . DG  I 5 96  ? 26.057  -36.614 32.762 1.00 125.72 ? 23   DG  I "C5'" 1 
ATOM   8008  C  "C4'" . DG  I 5 96  ? 24.941  -37.580 33.138 1.00 125.04 ? 23   DG  I "C4'" 1 
ATOM   8009  O  "O4'" . DG  I 5 96  ? 23.988  -36.891 33.995 1.00 125.15 ? 23   DG  I "O4'" 1 
ATOM   8010  C  "C3'" . DG  I 5 96  ? 24.117  -38.143 31.977 1.00 124.29 ? 23   DG  I "C3'" 1 
ATOM   8011  O  "O3'" . DG  I 5 96  ? 23.647  -39.474 32.287 1.00 122.75 ? 23   DG  I "O3'" 1 
ATOM   8012  C  "C2'" . DG  I 5 96  ? 22.989  -37.121 31.892 1.00 124.62 ? 23   DG  I "C2'" 1 
ATOM   8013  C  "C1'" . DG  I 5 96  ? 22.713  -36.903 33.376 1.00 125.24 ? 23   DG  I "C1'" 1 
ATOM   8014  N  N9    . DG  I 5 96  ? 21.984  -35.665 33.640 1.00 125.45 ? 23   DG  I N9    1 
ATOM   8015  C  C8    . DG  I 5 96  ? 22.423  -34.379 33.424 1.00 125.48 ? 23   DG  I C8    1 
ATOM   8016  N  N7    . DG  I 5 96  ? 21.550  -33.465 33.744 1.00 125.60 ? 23   DG  I N7    1 
ATOM   8017  C  C5    . DG  I 5 96  ? 20.456  -34.190 34.201 1.00 125.64 ? 23   DG  I C5    1 
ATOM   8018  C  C6    . DG  I 5 96  ? 19.206  -33.738 34.685 1.00 125.19 ? 23   DG  I C6    1 
ATOM   8019  O  O6    . DG  I 5 96  ? 18.814  -32.573 34.809 1.00 125.22 ? 23   DG  I O6    1 
ATOM   8020  N  N1    . DG  I 5 96  ? 18.375  -34.794 35.041 1.00 125.15 ? 23   DG  I N1    1 
ATOM   8021  C  C2    . DG  I 5 96  ? 18.713  -36.125 34.946 1.00 125.39 ? 23   DG  I C2    1 
ATOM   8022  N  N2    . DG  I 5 96  ? 17.781  -37.004 35.342 1.00 125.48 ? 23   DG  I N2    1 
ATOM   8023  N  N3    . DG  I 5 96  ? 19.883  -36.567 34.497 1.00 125.49 ? 23   DG  I N3    1 
ATOM   8024  C  C4    . DG  I 5 96  ? 20.705  -35.547 34.140 1.00 125.66 ? 23   DG  I C4    1 
ATOM   8025  P  P     . DG  I 5 97  ? 22.313  -40.139 31.669 1.00 121.68 ? 24   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5 97  ? 22.420  -41.606 31.851 1.00 121.83 ? 24   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5 97  ? 22.106  -39.604 30.304 1.00 121.71 ? 24   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5 97  ? 21.131  -39.613 32.621 1.00 120.10 ? 24   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5 97  ? 20.040  -40.475 32.983 1.00 117.42 ? 24   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5 97  ? 18.698  -39.995 32.429 1.00 115.02 ? 24   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5 97  ? 18.692  -38.564 32.195 1.00 114.74 ? 24   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5 97  ? 18.246  -40.582 31.097 1.00 113.18 ? 24   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5 97  ? 16.829  -40.622 31.133 1.00 110.37 ? 24   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5 97  ? 18.738  -39.544 30.089 1.00 113.36 ? 24   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5 97  ? 18.312  -38.301 30.856 1.00 113.95 ? 24   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5 97  ? 18.955  -37.034 30.540 1.00 113.89 ? 24   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5 97  ? 20.132  -36.797 29.875 1.00 113.93 ? 24   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5 97  ? 20.425  -35.529 29.794 1.00 113.94 ? 24   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5 97  ? 19.382  -34.891 30.453 1.00 113.87 ? 24   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5 97  ? 19.142  -33.514 30.694 1.00 114.09 ? 24   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5 97  ? 19.831  -32.540 30.357 1.00 114.07 ? 24   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5 97  ? 17.959  -33.305 31.405 1.00 114.00 ? 24   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5 97  ? 17.115  -34.301 31.833 1.00 113.94 ? 24   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5 97  ? 16.026  -33.913 32.503 1.00 113.83 ? 24   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5 97  ? 17.328  -35.590 31.612 1.00 114.01 ? 24   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5 97  ? 18.474  -35.809 30.922 1.00 113.86 ? 24   DG  I C4    1 
ATOM   8047  P  P     . DA  I 5 98  ? 16.028  -41.403 30.000 1.00 108.76 ? 25   DA  I P     1 
ATOM   8048  O  OP1   . DA  I 5 98  ? 16.459  -42.813 30.100 1.00 108.94 ? 25   DA  I OP1   1 
ATOM   8049  O  OP2   . DA  I 5 98  ? 16.156  -40.652 28.729 1.00 108.40 ? 25   DA  I OP2   1 
ATOM   8050  O  "O5'" . DA  I 5 98  ? 14.493  -41.345 30.439 1.00 107.54 ? 25   DA  I "O5'" 1 
ATOM   8051  C  "C5'" . DA  I 5 98  ? 14.064  -41.042 31.768 1.00 104.26 ? 25   DA  I "C5'" 1 
ATOM   8052  C  "C4'" . DA  I 5 98  ? 12.978  -39.984 31.691 1.00 101.33 ? 25   DA  I "C4'" 1 
ATOM   8053  O  "O4'" . DA  I 5 98  ? 13.568  -38.730 31.264 1.00 100.59 ? 25   DA  I "O4'" 1 
ATOM   8054  C  "C3'" . DA  I 5 98  ? 11.857  -40.281 30.698 1.00 99.59  ? 25   DA  I "C3'" 1 
ATOM   8055  O  "O3'" . DA  I 5 98  ? 10.623  -39.874 31.269 1.00 97.50  ? 25   DA  I "O3'" 1 
ATOM   8056  C  "C2'" . DA  I 5 98  ? 12.219  -39.445 29.470 1.00 99.66  ? 25   DA  I "C2'" 1 
ATOM   8057  C  "C1'" . DA  I 5 98  ? 12.896  -38.247 30.118 1.00 99.98  ? 25   DA  I "C1'" 1 
ATOM   8058  N  N9    . DA  I 5 98  ? 13.882  -37.577 29.280 1.00 100.13 ? 25   DA  I N9    1 
ATOM   8059  C  C8    . DA  I 5 98  ? 14.685  -38.119 28.313 1.00 100.13 ? 25   DA  I C8    1 
ATOM   8060  N  N7    . DA  I 5 98  ? 15.482  -37.252 27.732 1.00 99.99  ? 25   DA  I N7    1 
ATOM   8061  C  C5    . DA  I 5 98  ? 15.181  -36.060 28.368 1.00 100.11 ? 25   DA  I C5    1 
ATOM   8062  C  C6    . DA  I 5 98  ? 15.673  -34.748 28.224 1.00 99.94  ? 25   DA  I C6    1 
ATOM   8063  N  N6    . DA  I 5 98  ? 16.617  -34.416 27.344 1.00 99.90  ? 25   DA  I N6    1 
ATOM   8064  N  N1    . DA  I 5 98  ? 15.150  -33.785 29.016 1.00 100.02 ? 25   DA  I N1    1 
ATOM   8065  C  C2    . DA  I 5 98  ? 14.200  -34.105 29.902 1.00 99.89  ? 25   DA  I C2    1 
ATOM   8066  N  N3    . DA  I 5 98  ? 13.663  -35.302 30.130 1.00 99.97  ? 25   DA  I N3    1 
ATOM   8067  C  C4    . DA  I 5 98  ? 14.199  -36.241 29.326 1.00 100.25 ? 25   DA  I C4    1 
ATOM   8068  P  P     . DG  I 5 99  ? 9.207   -40.192 30.584 1.00 96.11  ? 26   DG  I P     1 
ATOM   8069  O  OP1   . DG  I 5 99  ? 8.329   -40.703 31.665 1.00 95.45  ? 26   DG  I OP1   1 
ATOM   8070  O  OP2   . DG  I 5 99  ? 9.417   -40.969 29.337 1.00 95.87  ? 26   DG  I OP2   1 
ATOM   8071  O  "O5'" . DG  I 5 99  ? 8.685   -38.754 30.116 1.00 93.81  ? 26   DG  I "O5'" 1 
ATOM   8072  C  "C5'" . DG  I 5 99  ? 8.774   -37.632 30.975 1.00 90.51  ? 26   DG  I "C5'" 1 
ATOM   8073  C  "C4'" . DG  I 5 99  ? 8.606   -36.351 30.191 1.00 88.30  ? 26   DG  I "C4'" 1 
ATOM   8074  O  "O4'" . DG  I 5 99  ? 9.795   -36.136 29.399 1.00 88.75  ? 26   DG  I "O4'" 1 
ATOM   8075  C  "C3'" . DG  I 5 99  ? 7.440   -36.343 29.211 1.00 86.78  ? 26   DG  I "C3'" 1 
ATOM   8076  O  "O3'" . DG  I 5 99  ? 6.806   -35.090 29.284 1.00 83.69  ? 26   DG  I "O3'" 1 
ATOM   8077  C  "C2'" . DG  I 5 99  ? 8.110   -36.538 27.856 1.00 87.79  ? 26   DG  I "C2'" 1 
ATOM   8078  C  "C1'" . DG  I 5 99  ? 9.410   -35.781 28.089 1.00 89.91  ? 26   DG  I "C1'" 1 
ATOM   8079  N  N9    . DG  I 5 99  ? 10.519  -36.078 27.173 1.00 90.56  ? 26   DG  I N9    1 
ATOM   8080  C  C8    . DG  I 5 99  ? 10.750  -37.228 26.447 1.00 90.93  ? 26   DG  I C8    1 
ATOM   8081  N  N7    . DG  I 5 99  ? 11.835  -37.183 25.723 1.00 91.03  ? 26   DG  I N7    1 
ATOM   8082  C  C5    . DG  I 5 99  ? 12.362  -35.926 25.981 1.00 90.78  ? 26   DG  I C5    1 
ATOM   8083  C  C6    . DG  I 5 99  ? 13.537  -35.303 25.484 1.00 90.79  ? 26   DG  I C6    1 
ATOM   8084  O  O6    . DG  I 5 99  ? 14.366  -35.767 24.686 1.00 90.61  ? 26   DG  I O6    1 
ATOM   8085  N  N1    . DG  I 5 99  ? 13.706  -34.013 26.002 1.00 90.80  ? 26   DG  I N1    1 
ATOM   8086  C  C2    . DG  I 5 99  ? 12.840  -33.410 26.893 1.00 90.79  ? 26   DG  I C2    1 
ATOM   8087  N  N2    . DG  I 5 99  ? 13.142  -32.170 27.303 1.00 90.68  ? 26   DG  I N2    1 
ATOM   8088  N  N3    . DG  I 5 99  ? 11.745  -33.989 27.366 1.00 90.73  ? 26   DG  I N3    1 
ATOM   8089  C  C4    . DG  I 5 99  ? 11.566  -35.237 26.870 1.00 90.59  ? 26   DG  I C4    1 
ATOM   8090  P  P     . DC  I 5 100 ? 5.218   -34.936 29.330 1.00 81.37  ? 27   DC  I P     1 
ATOM   8091  O  OP1   . DC  I 5 100 ? 4.752   -35.327 30.666 1.00 80.89  ? 27   DC  I OP1   1 
ATOM   8092  O  OP2   . DC  I 5 100 ? 4.616   -35.511 28.116 1.00 81.07  ? 27   DC  I OP2   1 
ATOM   8093  O  "O5'" . DC  I 5 100 ? 5.056   -33.363 29.184 1.00 83.71  ? 27   DC  I "O5'" 1 
ATOM   8094  C  "C5'" . DC  I 5 100 ? 6.018   -32.500 29.795 1.00 85.65  ? 27   DC  I "C5'" 1 
ATOM   8095  C  "C4'" . DC  I 5 100 ? 6.674   -31.583 28.782 1.00 86.72  ? 27   DC  I "C4'" 1 
ATOM   8096  O  "O4'" . DC  I 5 100 ? 7.641   -32.305 27.978 1.00 86.59  ? 27   DC  I "O4'" 1 
ATOM   8097  C  "C3'" . DC  I 5 100 ? 5.707   -30.931 27.798 1.00 87.97  ? 27   DC  I "C3'" 1 
ATOM   8098  O  "O3'" . DC  I 5 100 ? 6.033   -29.558 27.737 1.00 90.15  ? 27   DC  I "O3'" 1 
ATOM   8099  C  "C2'" . DC  I 5 100 ? 6.016   -31.636 26.480 1.00 87.41  ? 27   DC  I "C2'" 1 
ATOM   8100  C  "C1'" . DC  I 5 100 ? 7.517   -31.819 26.658 1.00 86.94  ? 27   DC  I "C1'" 1 
ATOM   8101  N  N1    . DC  I 5 100 ? 8.227   -32.747 25.733 1.00 86.70  ? 27   DC  I N1    1 
ATOM   8102  C  C2    . DC  I 5 100 ? 9.459   -32.337 25.192 1.00 86.79  ? 27   DC  I C2    1 
ATOM   8103  O  O2    . DC  I 5 100 ? 9.919   -31.221 25.473 1.00 86.66  ? 27   DC  I O2    1 
ATOM   8104  N  N3    . DC  I 5 100 ? 10.124  -33.179 24.361 1.00 86.96  ? 27   DC  I N3    1 
ATOM   8105  C  C4    . DC  I 5 100 ? 9.608   -34.376 24.075 1.00 87.13  ? 27   DC  I C4    1 
ATOM   8106  N  N4    . DC  I 5 100 ? 10.307  -35.165 23.250 1.00 87.06  ? 27   DC  I N4    1 
ATOM   8107  C  C5    . DC  I 5 100 ? 8.357   -34.810 24.621 1.00 86.87  ? 27   DC  I C5    1 
ATOM   8108  C  C6    . DC  I 5 100 ? 7.705   -33.975 25.438 1.00 86.24  ? 27   DC  I C6    1 
ATOM   8109  P  P     . DA  I 5 101 ? 4.922   -28.413 27.720 1.00 91.65  ? 28   DA  I P     1 
ATOM   8110  O  OP1   . DA  I 5 101 ? 4.618   -28.097 29.133 1.00 90.82  ? 28   DA  I OP1   1 
ATOM   8111  O  OP2   . DA  I 5 101 ? 3.855   -28.800 26.757 1.00 91.24  ? 28   DA  I OP2   1 
ATOM   8112  O  "O5'" . DA  I 5 101 ? 5.721   -27.178 27.079 1.00 94.11  ? 28   DA  I "O5'" 1 
ATOM   8113  C  "C5'" . DA  I 5 101 ? 7.119   -27.276 26.755 1.00 97.18  ? 28   DA  I "C5'" 1 
ATOM   8114  C  "C4'" . DA  I 5 101 ? 7.402   -27.345 25.257 1.00 99.36  ? 28   DA  I "C4'" 1 
ATOM   8115  O  "O4'" . DA  I 5 101 ? 7.581   -28.716 24.820 1.00 99.86  ? 28   DA  I "O4'" 1 
ATOM   8116  C  "C3'" . DA  I 5 101 ? 6.353   -26.758 24.312 1.00 101.07 ? 28   DA  I "C3'" 1 
ATOM   8117  O  "O3'" . DA  I 5 101 ? 7.030   -25.833 23.475 1.00 104.73 ? 28   DA  I "O3'" 1 
ATOM   8118  C  "C2'" . DA  I 5 101 ? 5.856   -27.966 23.517 1.00 100.46 ? 28   DA  I "C2'" 1 
ATOM   8119  C  "C1'" . DA  I 5 101 ? 7.154   -28.757 23.477 1.00 99.93  ? 28   DA  I "C1'" 1 
ATOM   8120  N  N9    . DA  I 5 101 ? 7.096   -30.151 23.048 1.00 99.85  ? 28   DA  I N9    1 
ATOM   8121  C  C8    . DA  I 5 101 ? 6.177   -31.110 23.384 1.00 99.97  ? 28   DA  I C8    1 
ATOM   8122  N  N7    . DA  I 5 101 ? 6.406   -32.287 22.846 1.00 99.99  ? 28   DA  I N7    1 
ATOM   8123  C  C5    . DA  I 5 101 ? 7.560   -32.083 22.103 1.00 100.05 ? 28   DA  I C5    1 
ATOM   8124  C  C6    . DA  I 5 101 ? 8.334   -32.931 21.281 1.00 99.84  ? 28   DA  I C6    1 
ATOM   8125  N  N6    . DA  I 5 101 ? 8.038   -34.215 21.069 1.00 99.71  ? 28   DA  I N6    1 
ATOM   8126  N  N1    . DA  I 5 101 ? 9.426   -32.406 20.680 1.00 99.96  ? 28   DA  I N1    1 
ATOM   8127  C  C2    . DA  I 5 101 ? 9.725   -31.117 20.889 1.00 99.71  ? 28   DA  I C2    1 
ATOM   8128  N  N3    . DA  I 5 101 ? 9.075   -30.225 21.636 1.00 99.34  ? 28   DA  I N3    1 
ATOM   8129  C  C4    . DA  I 5 101 ? 7.997   -30.773 22.221 1.00 99.68  ? 28   DA  I C4    1 
ATOM   8130  P  P     . DG  I 5 102 ? 6.300   -24.580 22.789 1.00 107.16 ? 29   DG  I P     1 
ATOM   8131  O  OP1   . DG  I 5 102 ? 6.638   -23.387 23.595 1.00 106.89 ? 29   DG  I OP1   1 
ATOM   8132  O  OP2   . DG  I 5 102 ? 4.886   -24.930 22.519 1.00 106.52 ? 29   DG  I OP2   1 
ATOM   8133  O  "O5'" . DG  I 5 102 ? 7.057   -24.481 21.380 1.00 109.55 ? 29   DG  I "O5'" 1 
ATOM   8134  C  "C5'" . DG  I 5 102 ? 8.472   -24.250 21.321 1.00 113.50 ? 29   DG  I "C5'" 1 
ATOM   8135  C  "C4'" . DG  I 5 102 ? 9.077   -24.820 20.046 1.00 116.47 ? 29   DG  I "C4'" 1 
ATOM   8136  O  "O4'" . DG  I 5 102 ? 8.986   -26.267 20.076 1.00 117.38 ? 29   DG  I "O4'" 1 
ATOM   8137  C  "C3'" . DG  I 5 102 ? 8.400   -24.364 18.756 1.00 118.41 ? 29   DG  I "C3'" 1 
ATOM   8138  O  "O3'" . DG  I 5 102 ? 9.366   -23.913 17.810 1.00 120.90 ? 29   DG  I "O3'" 1 
ATOM   8139  C  "C2'" . DG  I 5 102 ? 7.657   -25.597 18.249 1.00 118.44 ? 29   DG  I "C2'" 1 
ATOM   8140  C  "C1'" . DG  I 5 102 ? 8.424   -26.753 18.876 1.00 118.49 ? 29   DG  I "C1'" 1 
ATOM   8141  N  N9    . DG  I 5 102 ? 7.556   -27.884 19.187 1.00 118.77 ? 29   DG  I N9    1 
ATOM   8142  C  C8    . DG  I 5 102 ? 6.409   -27.876 19.949 1.00 119.05 ? 29   DG  I C8    1 
ATOM   8143  N  N7    . DG  I 5 102 ? 5.836   -29.045 20.049 1.00 119.20 ? 29   DG  I N7    1 
ATOM   8144  C  C5    . DG  I 5 102 ? 6.653   -29.886 19.302 1.00 119.07 ? 29   DG  I C5    1 
ATOM   8145  C  C6    . DG  I 5 102 ? 6.543   -31.278 19.038 1.00 118.91 ? 29   DG  I C6    1 
ATOM   8146  O  O6    . DG  I 5 102 ? 5.672   -32.073 19.430 1.00 118.78 ? 29   DG  I O6    1 
ATOM   8147  N  N1    . DG  I 5 102 ? 7.592   -31.734 18.236 1.00 118.97 ? 29   DG  I N1    1 
ATOM   8148  C  C2    . DG  I 5 102 ? 8.611   -30.942 17.746 1.00 119.00 ? 29   DG  I C2    1 
ATOM   8149  N  N2    . DG  I 5 102 ? 9.534   -31.544 16.987 1.00 118.98 ? 29   DG  I N2    1 
ATOM   8150  N  N3    . DG  I 5 102 ? 8.724   -29.642 17.987 1.00 118.87 ? 29   DG  I N3    1 
ATOM   8151  C  C4    . DG  I 5 102 ? 7.716   -29.182 18.767 1.00 118.89 ? 29   DG  I C4    1 
ATOM   8152  P  P     . DT  I 5 103 ? 8.946   -22.895 16.645 1.00 122.65 ? 30   DT  I P     1 
ATOM   8153  O  OP1   . DT  I 5 103 ? 10.167  -22.593 15.858 1.00 122.43 ? 30   DT  I OP1   1 
ATOM   8154  O  OP2   . DT  I 5 103 ? 8.178   -21.795 17.279 1.00 122.72 ? 30   DT  I OP2   1 
ATOM   8155  O  "O5'" . DT  I 5 103 ? 7.928   -23.750 15.750 1.00 123.72 ? 30   DT  I "O5'" 1 
ATOM   8156  C  "C5'" . DT  I 5 103 ? 8.172   -23.986 14.367 1.00 126.00 ? 30   DT  I "C5'" 1 
ATOM   8157  C  "C4'" . DT  I 5 103 ? 8.760   -25.366 14.114 1.00 127.81 ? 30   DT  I "C4'" 1 
ATOM   8158  O  "O4'" . DT  I 5 103 ? 8.180   -26.363 14.990 1.00 128.31 ? 30   DT  I "O4'" 1 
ATOM   8159  C  "C3'" . DT  I 5 103 ? 8.474   -25.925 12.729 1.00 128.94 ? 30   DT  I "C3'" 1 
ATOM   8160  O  "O3'" . DT  I 5 103 ? 9.454   -25.471 11.801 1.00 130.48 ? 30   DT  I "O3'" 1 
ATOM   8161  C  "C2'" . DT  I 5 103 ? 8.553   -27.439 12.924 1.00 128.80 ? 30   DT  I "C2'" 1 
ATOM   8162  C  "C1'" . DT  I 5 103 ? 8.447   -27.642 14.436 1.00 128.58 ? 30   DT  I "C1'" 1 
ATOM   8163  N  N1    . DT  I 5 103 ? 7.399   -28.649 14.873 1.00 128.59 ? 30   DT  I N1    1 
ATOM   8164  C  C2    . DT  I 5 103 ? 7.473   -29.980 14.475 1.00 128.69 ? 30   DT  I C2    1 
ATOM   8165  O  O2    . DT  I 5 103 ? 8.342   -30.451 13.761 1.00 128.73 ? 30   DT  I O2    1 
ATOM   8166  N  N3    . DT  I 5 103 ? 6.462   -30.779 14.948 1.00 128.76 ? 30   DT  I N3    1 
ATOM   8167  C  C4    . DT  I 5 103 ? 5.408   -30.408 15.762 1.00 128.67 ? 30   DT  I C4    1 
ATOM   8168  O  O4    . DT  I 5 103 ? 4.561   -31.221 16.119 1.00 128.78 ? 30   DT  I O4    1 
ATOM   8169  C  C5    . DT  I 5 103 ? 5.385   -29.014 16.149 1.00 128.65 ? 30   DT  I C5    1 
ATOM   8170  C  C7    . DT  I 5 103 ? 4.298   -28.469 17.031 1.00 128.71 ? 30   DT  I C7    1 
ATOM   8171  C  C6    . DT  I 5 103 ? 6.366   -28.221 15.692 1.00 128.60 ? 30   DT  I C6    1 
ATOM   8172  P  P     . DT  I 5 104 ? 9.024   -24.863 10.382 1.00 131.68 ? 31   DT  I P     1 
ATOM   8173  O  OP1   . DT  I 5 104 ? 10.275  -24.469 9.691  1.00 131.69 ? 31   DT  I OP1   1 
ATOM   8174  O  OP2   . DT  I 5 104 ? 7.952   -23.862 10.605 1.00 131.37 ? 31   DT  I OP2   1 
ATOM   8175  O  "O5'" . DT  I 5 104 ? 8.375   -26.111 9.620  1.00 132.17 ? 31   DT  I "O5'" 1 
ATOM   8176  C  "C5'" . DT  I 5 104 ? 9.186   -27.195 9.179  1.00 133.26 ? 31   DT  I "C5'" 1 
ATOM   8177  C  "C4'" . DT  I 5 104 ? 8.330   -28.406 8.852  1.00 134.15 ? 31   DT  I "C4'" 1 
ATOM   8178  O  "O4'" . DT  I 5 104 ? 7.568   -28.810 10.018 1.00 134.57 ? 31   DT  I "O4'" 1 
ATOM   8179  C  "C3'" . DT  I 5 104 ? 7.309   -28.199 7.736  1.00 134.49 ? 31   DT  I "C3'" 1 
ATOM   8180  O  "O3'" . DT  I 5 104 ? 7.389   -29.281 6.828  1.00 134.47 ? 31   DT  I "O3'" 1 
ATOM   8181  C  "C2'" . DT  I 5 104 ? 5.960   -28.195 8.452  1.00 134.75 ? 31   DT  I "C2'" 1 
ATOM   8182  C  "C1'" . DT  I 5 104 ? 6.254   -29.141 9.610  1.00 135.03 ? 31   DT  I "C1'" 1 
ATOM   8183  N  N1    . DT  I 5 104 ? 5.329   -29.023 10.782 1.00 135.15 ? 31   DT  I N1    1 
ATOM   8184  C  C2    . DT  I 5 104 ? 4.783   -30.168 11.341 1.00 135.25 ? 31   DT  I C2    1 
ATOM   8185  O  O2    . DT  I 5 104 ? 5.001   -31.299 10.935 1.00 135.23 ? 31   DT  I O2    1 
ATOM   8186  N  N3    . DT  I 5 104 ? 3.957   -29.937 12.414 1.00 135.36 ? 31   DT  I N3    1 
ATOM   8187  C  C4    . DT  I 5 104 ? 3.628   -28.709 12.971 1.00 135.29 ? 31   DT  I C4    1 
ATOM   8188  O  O4    . DT  I 5 104 ? 2.872   -28.628 13.936 1.00 135.29 ? 31   DT  I O4    1 
ATOM   8189  C  C5    . DT  I 5 104 ? 4.233   -27.552 12.338 1.00 135.26 ? 31   DT  I C5    1 
ATOM   8190  C  C7    . DT  I 5 104 ? 3.973   -26.154 12.828 1.00 135.16 ? 31   DT  I C7    1 
ATOM   8191  C  C6    . DT  I 5 104 ? 5.043   -27.768 11.293 1.00 135.20 ? 31   DT  I C6    1 
ATOM   8192  P  P     . DT  I 5 105 ? 6.961   -29.096 5.301  1.00 134.51 ? 32   DT  I P     1 
ATOM   8193  O  OP1   . DT  I 5 105 ? 8.192   -29.252 4.495  1.00 134.63 ? 32   DT  I OP1   1 
ATOM   8194  O  OP2   . DT  I 5 105 ? 6.144   -27.867 5.168  1.00 134.14 ? 32   DT  I OP2   1 
ATOM   8195  O  "O5'" . DT  I 5 105 ? 6.012   -30.361 5.054  1.00 134.88 ? 32   DT  I "O5'" 1 
ATOM   8196  C  "C5'" . DT  I 5 105 ? 6.509   -31.683 5.259  1.00 135.44 ? 32   DT  I "C5'" 1 
ATOM   8197  C  "C4'" . DT  I 5 105 ? 5.420   -32.597 5.793  1.00 135.73 ? 32   DT  I "C4'" 1 
ATOM   8198  O  "O4'" . DT  I 5 105 ? 4.845   -32.054 7.008  1.00 136.06 ? 32   DT  I "O4'" 1 
ATOM   8199  C  "C3'" . DT  I 5 105 ? 4.245   -32.823 4.841  1.00 135.50 ? 32   DT  I "C3'" 1 
ATOM   8200  O  "O3'" . DT  I 5 105 ? 4.219   -34.191 4.462  1.00 134.43 ? 32   DT  I "O3'" 1 
ATOM   8201  C  "C2'" . DT  I 5 105 ? 3.003   -32.443 5.647  1.00 136.01 ? 32   DT  I "C2'" 1 
ATOM   8202  C  "C1'" . DT  I 5 105 ? 3.526   -32.554 7.075  1.00 136.56 ? 32   DT  I "C1'" 1 
ATOM   8203  N  N1    . DT  I 5 105 ? 2.721   -31.817 8.113  1.00 136.84 ? 32   DT  I N1    1 
ATOM   8204  C  C2    . DT  I 5 105 ? 1.961   -32.545 9.015  1.00 136.86 ? 32   DT  I C2    1 
ATOM   8205  O  O2    . DT  I 5 105 ? 1.899   -33.766 9.026  1.00 136.85 ? 32   DT  I O2    1 
ATOM   8206  N  N3    . DT  I 5 105 ? 1.265   -31.778 9.919  1.00 136.81 ? 32   DT  I N3    1 
ATOM   8207  C  C4    . DT  I 5 105 ? 1.249   -30.395 10.014 1.00 136.74 ? 32   DT  I C4    1 
ATOM   8208  O  O4    . DT  I 5 105 ? 0.587   -29.817 10.868 1.00 136.69 ? 32   DT  I O4    1 
ATOM   8209  C  C5    . DT  I 5 105 ? 2.062   -29.694 9.045  1.00 136.89 ? 32   DT  I C5    1 
ATOM   8210  C  C7    . DT  I 5 105 ? 2.132   -28.193 9.040  1.00 136.83 ? 32   DT  I C7    1 
ATOM   8211  C  C6    . DT  I 5 105 ? 2.748   -30.430 8.154  1.00 136.94 ? 32   DT  I C6    1 
ATOM   8212  P  P     . DC  I 5 106 ? 3.616   -34.630 3.048  1.00 133.42 ? 33   DC  I P     1 
ATOM   8213  O  OP1   . DC  I 5 106 ? 4.214   -35.942 2.702  1.00 133.26 ? 33   DC  I OP1   1 
ATOM   8214  O  OP2   . DC  I 5 106 ? 3.723   -33.479 2.120  1.00 133.23 ? 33   DC  I OP2   1 
ATOM   8215  O  "O5'" . DC  I 5 106 ? 2.062   -34.829 3.368  1.00 132.09 ? 33   DC  I "O5'" 1 
ATOM   8216  C  "C5'" . DC  I 5 106 ? 1.621   -35.717 4.398  1.00 129.72 ? 33   DC  I "C5'" 1 
ATOM   8217  C  "C4'" . DC  I 5 106 ? 0.174   -35.420 4.754  1.00 127.75 ? 33   DC  I "C4'" 1 
ATOM   8218  O  "O4'" . DC  I 5 106 ? 0.095   -34.202 5.537  1.00 127.81 ? 33   DC  I "O4'" 1 
ATOM   8219  C  "C3'" . DC  I 5 106 ? -0.748  -35.223 3.549  1.00 125.92 ? 33   DC  I "C3'" 1 
ATOM   8220  O  "O3'" . DC  I 5 106 ? -1.832  -36.128 3.622  1.00 123.02 ? 33   DC  I "O3'" 1 
ATOM   8221  C  "C2'" . DC  I 5 106 ? -1.216  -33.776 3.645  1.00 126.65 ? 33   DC  I "C2'" 1 
ATOM   8222  C  "C1'" . DC  I 5 106 ? -1.054  -33.487 5.135  1.00 127.27 ? 33   DC  I "C1'" 1 
ATOM   8223  N  N1    . DC  I 5 106 ? -0.867  -32.044 5.505  1.00 127.27 ? 33   DC  I N1    1 
ATOM   8224  C  C2    . DC  I 5 106 ? -1.094  -31.648 6.834  1.00 127.16 ? 33   DC  I C2    1 
ATOM   8225  O  O2    . DC  I 5 106 ? -1.445  -32.492 7.668  1.00 127.13 ? 33   DC  I O2    1 
ATOM   8226  N  N3    . DC  I 5 106 ? -0.922  -30.341 7.170  1.00 127.17 ? 33   DC  I N3    1 
ATOM   8227  C  C4    . DC  I 5 106 ? -0.543  -29.451 6.243  1.00 127.33 ? 33   DC  I C4    1 
ATOM   8228  N  N4    . DC  I 5 106 ? -0.387  -28.178 6.623  1.00 127.02 ? 33   DC  I N4    1 
ATOM   8229  C  C5    . DC  I 5 106 ? -0.304  -29.832 4.884  1.00 127.44 ? 33   DC  I C5    1 
ATOM   8230  C  C6    . DC  I 5 106 ? -0.475  -31.124 4.565  1.00 127.43 ? 33   DC  I C6    1 
ATOM   8231  P  P     . DC  I 5 107 ? -1.696  -37.517 2.853  1.00 120.67 ? 34   DC  I P     1 
ATOM   8232  O  OP1   . DC  I 5 107 ? -0.649  -38.316 3.528  1.00 120.49 ? 34   DC  I OP1   1 
ATOM   8233  O  OP2   . DC  I 5 107 ? -1.563  -37.182 1.418  1.00 120.91 ? 34   DC  I OP2   1 
ATOM   8234  O  "O5'" . DC  I 5 107 ? -3.112  -38.230 3.084  1.00 118.76 ? 34   DC  I "O5'" 1 
ATOM   8235  C  "C5'" . DC  I 5 107 ? -3.381  -38.940 4.299  1.00 115.61 ? 34   DC  I "C5'" 1 
ATOM   8236  C  "C4'" . DC  I 5 107 ? -4.605  -38.385 5.012  1.00 112.90 ? 34   DC  I "C4'" 1 
ATOM   8237  O  "O4'" . DC  I 5 107 ? -4.382  -37.010 5.408  1.00 112.28 ? 34   DC  I "O4'" 1 
ATOM   8238  C  "C3'" . DC  I 5 107 ? -5.889  -38.373 4.187  1.00 111.54 ? 34   DC  I "C3'" 1 
ATOM   8239  O  "O3'" . DC  I 5 107 ? -6.972  -38.767 5.008  1.00 109.88 ? 34   DC  I "O3'" 1 
ATOM   8240  C  "C2'" . DC  I 5 107 ? -6.025  -36.914 3.770  1.00 111.60 ? 34   DC  I "C2'" 1 
ATOM   8241  C  "C1'" . DC  I 5 107 ? -5.512  -36.245 5.040  1.00 112.05 ? 34   DC  I "C1'" 1 
ATOM   8242  N  N1    . DC  I 5 107 ? -5.096  -34.807 4.928  1.00 112.05 ? 34   DC  I N1    1 
ATOM   8243  C  C2    . DC  I 5 107 ? -4.836  -34.073 6.101  1.00 112.19 ? 34   DC  I C2    1 
ATOM   8244  O  O2    . DC  I 5 107 ? -4.958  -34.610 7.208  1.00 112.18 ? 34   DC  I O2    1 
ATOM   8245  N  N3    . DC  I 5 107 ? -4.453  -32.775 5.996  1.00 112.26 ? 34   DC  I N3    1 
ATOM   8246  C  C4    . DC  I 5 107 ? -4.330  -32.209 4.792  1.00 112.19 ? 34   DC  I C4    1 
ATOM   8247  N  N4    . DC  I 5 107 ? -3.950  -30.929 4.744  1.00 111.96 ? 34   DC  I N4    1 
ATOM   8248  C  C5    . DC  I 5 107 ? -4.590  -32.935 3.587  1.00 112.18 ? 34   DC  I C5    1 
ATOM   8249  C  C6    . DC  I 5 107 ? -4.963  -34.216 3.701  1.00 111.95 ? 34   DC  I C6    1 
ATOM   8250  P  P     . DA  I 5 108 ? -7.372  -40.309 5.163  1.00 108.53 ? 35   DA  I P     1 
ATOM   8251  O  OP1   . DA  I 5 108 ? -6.139  -41.097 5.414  1.00 108.37 ? 35   DA  I OP1   1 
ATOM   8252  O  OP2   . DA  I 5 108 ? -8.253  -40.632 4.022  1.00 107.87 ? 35   DA  I OP2   1 
ATOM   8253  O  "O5'" . DA  I 5 108 ? -8.272  -40.333 6.489  1.00 107.07 ? 35   DA  I "O5'" 1 
ATOM   8254  C  "C5'" . DA  I 5 108 ? -7.715  -40.016 7.768  1.00 105.03 ? 35   DA  I "C5'" 1 
ATOM   8255  C  "C4'" . DA  I 5 108 ? -8.604  -39.068 8.563  1.00 103.62 ? 35   DA  I "C4'" 1 
ATOM   8256  O  "O4'" . DA  I 5 108 ? -8.363  -37.696 8.161  1.00 103.25 ? 35   DA  I "O4'" 1 
ATOM   8257  C  "C3'" . DA  I 5 108 ? -10.112 -39.278 8.447  1.00 102.76 ? 35   DA  I "C3'" 1 
ATOM   8258  O  "O3'" . DA  I 5 108 ? -10.682 -39.139 9.755  1.00 101.35 ? 35   DA  I "O3'" 1 
ATOM   8259  C  "C2'" . DA  I 5 108 ? -10.544 -38.191 7.459  1.00 102.69 ? 35   DA  I "C2'" 1 
ATOM   8260  C  "C1'" . DA  I 5 108 ? -9.580  -37.071 7.804  1.00 103.56 ? 35   DA  I "C1'" 1 
ATOM   8261  N  N9    . DA  I 5 108 ? -9.261  -36.182 6.700  1.00 103.78 ? 35   DA  I N9    1 
ATOM   8262  C  C8    . DA  I 5 108 ? -9.182  -36.502 5.375  1.00 104.06 ? 35   DA  I C8    1 
ATOM   8263  N  N7    . DA  I 5 108 ? -8.852  -35.491 4.608  1.00 104.44 ? 35   DA  I N7    1 
ATOM   8264  C  C5    . DA  I 5 108 ? -8.691  -34.433 5.490  1.00 104.44 ? 35   DA  I C5    1 
ATOM   8265  C  C6    . DA  I 5 108 ? -8.338  -33.070 5.313  1.00 104.23 ? 35   DA  I C6    1 
ATOM   8266  N  N6    . DA  I 5 108 ? -8.072  -32.520 4.125  1.00 104.03 ? 35   DA  I N6    1 
ATOM   8267  N  N1    . DA  I 5 108 ? -8.273  -32.282 6.410  1.00 104.00 ? 35   DA  I N1    1 
ATOM   8268  C  C2    . DA  I 5 108 ? -8.540  -32.826 7.605  1.00 104.07 ? 35   DA  I C2    1 
ATOM   8269  N  N3    . DA  I 5 108 ? -8.876  -34.084 7.896  1.00 104.21 ? 35   DA  I N3    1 
ATOM   8270  C  C4    . DA  I 5 108 ? -8.937  -34.847 6.788  1.00 104.16 ? 35   DA  I C4    1 
ATOM   8271  P  P     . DA  I 5 109 ? -12.258 -39.080 10.058 1.00 100.24 ? 36   DA  I P     1 
ATOM   8272  O  OP1   . DA  I 5 109 ? -12.608 -40.337 10.750 1.00 100.10 ? 36   DA  I OP1   1 
ATOM   8273  O  OP2   . DA  I 5 109 ? -13.018 -38.685 8.851  1.00 100.04 ? 36   DA  I OP2   1 
ATOM   8274  O  "O5'" . DA  I 5 109 ? -12.368 -37.866 11.094 1.00 99.74  ? 36   DA  I "O5'" 1 
ATOM   8275  C  "C5'" . DA  I 5 109 ? -11.452 -36.771 11.072 1.00 98.68  ? 36   DA  I "C5'" 1 
ATOM   8276  C  "C4'" . DA  I 5 109 ? -12.153 -35.427 11.205 1.00 98.07  ? 36   DA  I "C4'" 1 
ATOM   8277  O  "O4'" . DA  I 5 109 ? -11.741 -34.585 10.100 1.00 98.70  ? 36   DA  I "O4'" 1 
ATOM   8278  C  "C3'" . DA  I 5 109 ? -13.682 -35.423 11.177 1.00 97.54  ? 36   DA  I "C3'" 1 
ATOM   8279  O  "O3'" . DA  I 5 109 ? -14.172 -34.329 11.964 1.00 96.02  ? 36   DA  I "O3'" 1 
ATOM   8280  C  "C2'" . DA  I 5 109 ? -13.966 -35.215 9.695  1.00 98.50  ? 36   DA  I "C2'" 1 
ATOM   8281  C  "C1'" . DA  I 5 109 ? -12.880 -34.201 9.352  1.00 99.82  ? 36   DA  I "C1'" 1 
ATOM   8282  N  N9    . DA  I 5 109 ? -12.533 -34.155 7.934  1.00 100.26 ? 36   DA  I N9    1 
ATOM   8283  C  C8    . DA  I 5 109 ? -12.555 -35.197 7.047  1.00 100.53 ? 36   DA  I C8    1 
ATOM   8284  N  N7    . DA  I 5 109 ? -12.189 -34.872 5.834  1.00 100.75 ? 36   DA  I N7    1 
ATOM   8285  C  C5    . DA  I 5 109 ? -11.910 -33.519 5.928  1.00 100.89 ? 36   DA  I C5    1 
ATOM   8286  C  C6    . DA  I 5 109 ? -11.468 -32.571 4.976  1.00 100.71 ? 36   DA  I C6    1 
ATOM   8287  N  N6    . DA  I 5 109 ? -11.229 -32.891 3.699  1.00 100.41 ? 36   DA  I N6    1 
ATOM   8288  N  N1    . DA  I 5 109 ? -11.278 -31.294 5.391  1.00 100.49 ? 36   DA  I N1    1 
ATOM   8289  C  C2    . DA  I 5 109 ? -11.510 -30.990 6.677  1.00 100.41 ? 36   DA  I C2    1 
ATOM   8290  N  N3    . DA  I 5 109 ? -11.930 -31.796 7.657  1.00 100.59 ? 36   DA  I N3    1 
ATOM   8291  C  C4    . DA  I 5 109 ? -12.112 -33.057 7.217  1.00 100.57 ? 36   DA  I C4    1 
ATOM   8292  P  P     . DA  I 5 110 ? -15.685 -34.184 12.492 1.00 94.64  ? 37   DA  I P     1 
ATOM   8293  O  OP1   . DA  I 5 110 ? -15.671 -34.409 13.950 1.00 94.41  ? 37   DA  I OP1   1 
ATOM   8294  O  OP2   . DA  I 5 110 ? -16.616 -34.961 11.650 1.00 94.20  ? 37   DA  I OP2   1 
ATOM   8295  O  "O5'" . DA  I 5 110 ? -15.954 -32.634 12.210 1.00 95.12  ? 37   DA  I "O5'" 1 
ATOM   8296  C  "C5'" . DA  I 5 110 ? -15.118 -31.651 12.809 1.00 95.16  ? 37   DA  I "C5'" 1 
ATOM   8297  C  "C4'" . DA  I 5 110 ? -15.153 -30.343 12.043 1.00 95.47  ? 37   DA  I "C4'" 1 
ATOM   8298  O  "O4'" . DA  I 5 110 ? -14.549 -30.555 10.745 1.00 96.30  ? 37   DA  I "O4'" 1 
ATOM   8299  C  "C3'" . DA  I 5 110 ? -16.546 -29.759 11.823 1.00 95.02  ? 37   DA  I "C3'" 1 
ATOM   8300  O  "O3'" . DA  I 5 110 ? -16.653 -28.460 12.408 1.00 94.04  ? 37   DA  I "O3'" 1 
ATOM   8301  C  "C2'" . DA  I 5 110 ? -16.705 -29.711 10.305 1.00 96.26  ? 37   DA  I "C2'" 1 
ATOM   8302  C  "C1'" . DA  I 5 110 ? -15.312 -29.941 9.727  1.00 97.29  ? 37   DA  I "C1'" 1 
ATOM   8303  N  N9    . DA  I 5 110 ? -15.289 -30.817 8.551  1.00 97.50  ? 37   DA  I N9    1 
ATOM   8304  C  C8    . DA  I 5 110 ? -15.640 -32.140 8.503  1.00 97.82  ? 37   DA  I C8    1 
ATOM   8305  N  N7    . DA  I 5 110 ? -15.518 -32.692 7.320  1.00 97.91  ? 37   DA  I N7    1 
ATOM   8306  C  C5    . DA  I 5 110 ? -15.055 -31.658 6.529  1.00 98.05  ? 37   DA  I C5    1 
ATOM   8307  C  C6    . DA  I 5 110 ? -14.719 -31.586 5.159  1.00 98.05  ? 37   DA  I C6    1 
ATOM   8308  N  N6    . DA  I 5 110 ? -14.820 -32.633 4.339  1.00 98.01  ? 37   DA  I N6    1 
ATOM   8309  N  N1    . DA  I 5 110 ? -14.279 -30.406 4.660  1.00 97.85  ? 37   DA  I N1    1 
ATOM   8310  C  C2    . DA  I 5 110 ? -14.188 -29.359 5.491  1.00 97.97  ? 37   DA  I C2    1 
ATOM   8311  N  N3    . DA  I 5 110 ? -14.473 -29.308 6.801  1.00 98.24  ? 37   DA  I N3    1 
ATOM   8312  C  C4    . DA  I 5 110 ? -14.906 -30.495 7.267  1.00 97.85  ? 37   DA  I C4    1 
ATOM   8313  P  P     . DT  I 5 111 ? -18.050 -27.678 12.465 1.00 93.50  ? 38   DT  I P     1 
ATOM   8314  O  OP1   . DT  I 5 111 ? -18.101 -26.892 13.709 1.00 93.32  ? 38   DT  I OP1   1 
ATOM   8315  O  OP2   . DT  I 5 111 ? -19.141 -28.625 12.168 1.00 93.23  ? 38   DT  I OP2   1 
ATOM   8316  O  "O5'" . DT  I 5 111 ? -17.922 -26.669 11.242 1.00 95.66  ? 38   DT  I "O5'" 1 
ATOM   8317  C  "C5'" . DT  I 5 111 ? -16.803 -25.789 11.169 1.00 99.22  ? 38   DT  I "C5'" 1 
ATOM   8318  C  "C4'" . DT  I 5 111 ? -16.656 -25.200 9.778  1.00 101.64 ? 38   DT  I "C4'" 1 
ATOM   8319  O  "O4'" . DT  I 5 111 ? -16.429 -26.262 8.811  1.00 102.52 ? 38   DT  I "O4'" 1 
ATOM   8320  C  "C3'" . DT  I 5 111 ? -17.869 -24.404 9.292  1.00 102.73 ? 38   DT  I "C3'" 1 
ATOM   8321  O  "O3'" . DT  I 5 111 ? -17.433 -23.125 8.821  1.00 103.92 ? 38   DT  I "O3'" 1 
ATOM   8322  C  "C2'" . DT  I 5 111 ? -18.463 -25.283 8.187  1.00 103.19 ? 38   DT  I "C2'" 1 
ATOM   8323  C  "C1'" . DT  I 5 111 ? -17.229 -26.021 7.667  1.00 103.65 ? 38   DT  I "C1'" 1 
ATOM   8324  N  N1    . DT  I 5 111 ? -17.485 -27.318 6.912  1.00 104.15 ? 38   DT  I N1    1 
ATOM   8325  C  C2    . DT  I 5 111 ? -17.124 -27.412 5.570  1.00 104.33 ? 38   DT  I C2    1 
ATOM   8326  O  O2    . DT  I 5 111 ? -16.604 -26.502 4.936  1.00 104.42 ? 38   DT  I O2    1 
ATOM   8327  N  N3    . DT  I 5 111 ? -17.394 -28.628 4.980  1.00 103.97 ? 38   DT  I N3    1 
ATOM   8328  C  C4    . DT  I 5 111 ? -17.972 -29.737 5.575  1.00 103.97 ? 38   DT  I C4    1 
ATOM   8329  O  O4    . DT  I 5 111 ? -18.168 -30.779 4.956  1.00 104.07 ? 38   DT  I O4    1 
ATOM   8330  C  C5    . DT  I 5 111 ? -18.325 -29.580 6.969  1.00 104.26 ? 38   DT  I C5    1 
ATOM   8331  C  C7    . DT  I 5 111 ? -18.963 -30.715 7.718  1.00 104.29 ? 38   DT  I C7    1 
ATOM   8332  C  C6    . DT  I 5 111 ? -18.070 -28.398 7.559  1.00 104.16 ? 38   DT  I C6    1 
ATOM   8333  P  P     . DA  I 5 112 ? -18.436 -21.891 8.606  1.00 104.50 ? 39   DA  I P     1 
ATOM   8334  O  OP1   . DA  I 5 112 ? -17.621 -20.655 8.603  1.00 104.33 ? 39   DA  I OP1   1 
ATOM   8335  O  OP2   . DA  I 5 112 ? -19.590 -22.042 9.522  1.00 103.98 ? 39   DA  I OP2   1 
ATOM   8336  O  "O5'" . DA  I 5 112 ? -18.959 -22.114 7.117  1.00 106.85 ? 39   DA  I "O5'" 1 
ATOM   8337  C  "C5'" . DA  I 5 112 ? -18.057 -22.040 6.006  1.00 109.94 ? 39   DA  I "C5'" 1 
ATOM   8338  C  "C4'" . DA  I 5 112 ? -18.809 -22.208 4.696  1.00 112.02 ? 39   DA  I "C4'" 1 
ATOM   8339  O  "O4'" . DA  I 5 112 ? -18.920 -23.617 4.371  1.00 112.25 ? 39   DA  I "O4'" 1 
ATOM   8340  C  "C3'" . DA  I 5 112 ? -20.238 -21.662 4.693  1.00 113.53 ? 39   DA  I "C3'" 1 
ATOM   8341  O  "O3'" . DA  I 5 112 ? -20.473 -20.960 3.475  1.00 116.15 ? 39   DA  I "O3'" 1 
ATOM   8342  C  "C2'" . DA  I 5 112 ? -21.095 -22.920 4.810  1.00 113.18 ? 39   DA  I "C2'" 1 
ATOM   8343  C  "C1'" . DA  I 5 112 ? -20.252 -23.875 3.971  1.00 112.99 ? 39   DA  I "C1'" 1 
ATOM   8344  N  N9    . DA  I 5 112 ? -20.544 -25.301 4.122  1.00 113.00 ? 39   DA  I N9    1 
ATOM   8345  C  C8    . DA  I 5 112 ? -20.915 -25.976 5.254  1.00 112.99 ? 39   DA  I C8    1 
ATOM   8346  N  N7    . DA  I 5 112 ? -21.104 -27.260 5.070  1.00 112.89 ? 39   DA  I N7    1 
ATOM   8347  C  C5    . DA  I 5 112 ? -20.836 -27.444 3.726  1.00 112.90 ? 39   DA  I C5    1 
ATOM   8348  C  C6    . DA  I 5 112 ? -20.855 -28.588 2.902  1.00 113.07 ? 39   DA  I C6    1 
ATOM   8349  N  N6    . DA  I 5 112 ? -21.172 -29.804 3.353  1.00 113.09 ? 39   DA  I N6    1 
ATOM   8350  N  N1    . DA  I 5 112 ? -20.537 -28.432 1.595  1.00 113.21 ? 39   DA  I N1    1 
ATOM   8351  C  C2    . DA  I 5 112 ? -20.225 -27.204 1.147  1.00 113.26 ? 39   DA  I C2    1 
ATOM   8352  N  N3    . DA  I 5 112 ? -20.167 -26.056 1.827  1.00 113.22 ? 39   DA  I N3    1 
ATOM   8353  C  C4    . DA  I 5 112 ? -20.490 -26.247 3.123  1.00 113.09 ? 39   DA  I C4    1 
ATOM   8354  P  P     . DC  I 5 113 ? -21.504 -19.738 3.405  1.00 118.32 ? 40   DC  I P     1 
ATOM   8355  O  OP1   . DC  I 5 113 ? -21.520 -19.255 2.005  1.00 118.39 ? 40   DC  I OP1   1 
ATOM   8356  O  OP2   . DC  I 5 113 ? -21.152 -18.779 4.477  1.00 118.47 ? 40   DC  I OP2   1 
ATOM   8357  O  "O5'" . DC  I 5 113 ? -22.907 -20.433 3.783  1.00 119.48 ? 40   DC  I "O5'" 1 
ATOM   8358  C  "C5'" . DC  I 5 113 ? -23.942 -20.672 2.815  1.00 121.19 ? 40   DC  I "C5'" 1 
ATOM   8359  C  "C4'" . DC  I 5 113 ? -23.471 -21.525 1.645  1.00 122.18 ? 40   DC  I "C4'" 1 
ATOM   8360  O  "O4'" . DC  I 5 113 ? -22.913 -22.768 2.125  1.00 122.70 ? 40   DC  I "O4'" 1 
ATOM   8361  C  "C3'" . DC  I 5 113 ? -24.566 -21.888 0.663  1.00 122.89 ? 40   DC  I "C3'" 1 
ATOM   8362  O  "O3'" . DC  I 5 113 ? -24.391 -21.089 -0.488 1.00 123.93 ? 40   DC  I "O3'" 1 
ATOM   8363  C  "C2'" . DC  I 5 113 ? -24.338 -23.355 0.320  1.00 122.90 ? 40   DC  I "C2'" 1 
ATOM   8364  C  "C1'" . DC  I 5 113 ? -23.267 -23.845 1.284  1.00 122.73 ? 40   DC  I "C1'" 1 
ATOM   8365  N  N1    . DC  I 5 113 ? -23.722 -25.001 2.129  1.00 122.75 ? 40   DC  I N1    1 
ATOM   8366  C  C2    . DC  I 5 113 ? -23.717 -26.306 1.603  1.00 122.83 ? 40   DC  I C2    1 
ATOM   8367  O  O2    . DC  I 5 113 ? -23.339 -26.507 0.443  1.00 122.93 ? 40   DC  I O2    1 
ATOM   8368  N  N3    . DC  I 5 113 ? -24.133 -27.333 2.389  1.00 122.81 ? 40   DC  I N3    1 
ATOM   8369  C  C4    . DC  I 5 113 ? -24.539 -27.101 3.639  1.00 122.72 ? 40   DC  I C4    1 
ATOM   8370  N  N4    . DC  I 5 113 ? -24.933 -28.149 4.365  1.00 122.75 ? 40   DC  I N4    1 
ATOM   8371  C  C5    . DC  I 5 113 ? -24.556 -25.787 4.198  1.00 122.67 ? 40   DC  I C5    1 
ATOM   8372  C  C6    . DC  I 5 113 ? -24.144 -24.781 3.414  1.00 122.62 ? 40   DC  I C6    1 
ATOM   8373  P  P     . DA  I 5 114 ? -25.644 -20.423 -1.221 1.00 124.80 ? 41   DA  I P     1 
ATOM   8374  O  OP1   . DA  I 5 114 ? -25.100 -19.642 -2.357 1.00 124.83 ? 41   DA  I OP1   1 
ATOM   8375  O  OP2   . DA  I 5 114 ? -26.485 -19.759 -0.198 1.00 124.34 ? 41   DA  I OP2   1 
ATOM   8376  O  "O5'" . DA  I 5 114 ? -26.480 -21.667 -1.779 1.00 125.39 ? 41   DA  I "O5'" 1 
ATOM   8377  C  "C5'" . DA  I 5 114 ? -25.942 -22.588 -2.734 1.00 126.67 ? 41   DA  I "C5'" 1 
ATOM   8378  C  "C4'" . DA  I 5 114 ? -26.762 -23.871 -2.746 1.00 127.63 ? 41   DA  I "C4'" 1 
ATOM   8379  O  "O4'" . DA  I 5 114 ? -26.492 -24.655 -1.549 1.00 127.98 ? 41   DA  I "O4'" 1 
ATOM   8380  C  "C3'" . DA  I 5 114 ? -28.281 -23.668 -2.784 1.00 128.08 ? 41   DA  I "C3'" 1 
ATOM   8381  O  "O3'" . DA  I 5 114 ? -28.883 -24.559 -3.724 1.00 128.43 ? 41   DA  I "O3'" 1 
ATOM   8382  C  "C2'" . DA  I 5 114 ? -28.704 -23.997 -1.354 1.00 128.11 ? 41   DA  I "C2'" 1 
ATOM   8383  C  "C1'" . DA  I 5 114 ? -27.735 -25.134 -1.067 1.00 128.26 ? 41   DA  I "C1'" 1 
ATOM   8384  N  N9    . DA  I 5 114 ? -27.691 -25.547 0.340  1.00 128.29 ? 41   DA  I N9    1 
ATOM   8385  C  C8    . DA  I 5 114 ? -27.493 -24.755 1.438  1.00 128.26 ? 41   DA  I C8    1 
ATOM   8386  N  N7    . DA  I 5 114 ? -27.519 -25.411 2.575  1.00 128.42 ? 41   DA  I N7    1 
ATOM   8387  C  C5    . DA  I 5 114 ? -27.756 -26.725 2.200  1.00 128.47 ? 41   DA  I C5    1 
ATOM   8388  C  C6    . DA  I 5 114 ? -27.897 -27.925 2.936  1.00 128.43 ? 41   DA  I C6    1 
ATOM   8389  N  N6    . DA  I 5 114 ? -27.812 -27.973 4.269  1.00 128.28 ? 41   DA  I N6    1 
ATOM   8390  N  N1    . DA  I 5 114 ? -28.131 -29.076 2.258  1.00 128.32 ? 41   DA  I N1    1 
ATOM   8391  C  C2    . DA  I 5 114 ? -28.220 -29.029 0.923  1.00 128.27 ? 41   DA  I C2    1 
ATOM   8392  N  N3    . DA  I 5 114 ? -28.101 -27.962 0.125  1.00 128.42 ? 41   DA  I N3    1 
ATOM   8393  C  C4    . DA  I 5 114 ? -27.870 -26.829 0.825  1.00 128.40 ? 41   DA  I C4    1 
ATOM   8394  P  P     . DC  I 5 115 ? -30.405 -24.376 -4.200 1.00 128.77 ? 42   DC  I P     1 
ATOM   8395  O  OP1   . DC  I 5 115 ? -30.436 -23.199 -5.100 1.00 128.40 ? 42   DC  I OP1   1 
ATOM   8396  O  OP2   . DC  I 5 115 ? -31.307 -24.411 -3.020 1.00 128.29 ? 42   DC  I OP2   1 
ATOM   8397  O  "O5'" . DC  I 5 115 ? -30.663 -25.712 -5.055 1.00 128.58 ? 42   DC  I "O5'" 1 
ATOM   8398  C  "C5'" . DC  I 5 115 ? -30.191 -27.006 -4.631 1.00 128.09 ? 42   DC  I "C5'" 1 
ATOM   8399  C  "C4'" . DC  I 5 115 ? -31.181 -27.799 -3.775 1.00 127.66 ? 42   DC  I "C4'" 1 
ATOM   8400  O  "O4'" . DC  I 5 115 ? -30.776 -27.719 -2.384 1.00 127.71 ? 42   DC  I "O4'" 1 
ATOM   8401  C  "C3'" . DC  I 5 115 ? -32.658 -27.382 -3.810 1.00 126.98 ? 42   DC  I "C3'" 1 
ATOM   8402  O  "O3'" . DC  I 5 115 ? -33.412 -28.316 -4.620 1.00 125.97 ? 42   DC  I "O3'" 1 
ATOM   8403  C  "C2'" . DC  I 5 115 ? -33.083 -27.276 -2.339 1.00 127.21 ? 42   DC  I "C2'" 1 
ATOM   8404  C  "C1'" . DC  I 5 115 ? -31.918 -27.907 -1.573 1.00 127.56 ? 42   DC  I "C1'" 1 
ATOM   8405  N  N1    . DC  I 5 115 ? -31.658 -27.336 -0.190 1.00 127.65 ? 42   DC  I N1    1 
ATOM   8406  C  C2    . DC  I 5 115 ? -31.530 -28.187 0.934  1.00 127.62 ? 42   DC  I C2    1 
ATOM   8407  O  O2    . DC  I 5 115 ? -31.626 -29.418 0.812  1.00 127.43 ? 42   DC  I O2    1 
ATOM   8408  N  N3    . DC  I 5 115 ? -31.296 -27.629 2.155  1.00 127.47 ? 42   DC  I N3    1 
ATOM   8409  C  C4    . DC  I 5 115 ? -31.188 -26.301 2.284  1.00 127.36 ? 42   DC  I C4    1 
ATOM   8410  N  N4    . DC  I 5 115 ? -30.957 -25.806 3.502  1.00 127.27 ? 42   DC  I N4    1 
ATOM   8411  C  C5    . DC  I 5 115 ? -31.312 -25.422 1.166  1.00 127.46 ? 42   DC  I C5    1 
ATOM   8412  C  C6    . DC  I 5 115 ? -31.542 -25.976 -0.033 1.00 127.65 ? 42   DC  I C6    1 
ATOM   8413  P  P     . DT  I 5 116 ? -34.482 -29.411 -4.122 1.00 125.39 ? 43   DT  I P     1 
ATOM   8414  O  OP1   . DT  I 5 116 ? -34.884 -30.157 -5.337 1.00 125.25 ? 43   DT  I OP1   1 
ATOM   8415  O  OP2   . DT  I 5 116 ? -35.520 -28.728 -3.316 1.00 124.96 ? 43   DT  I OP2   1 
ATOM   8416  O  "O5'" . DT  I 5 116 ? -33.659 -30.397 -3.158 1.00 124.89 ? 43   DT  I "O5'" 1 
ATOM   8417  C  "C5'" . DT  I 5 116 ? -33.838 -31.820 -3.225 1.00 124.02 ? 43   DT  I "C5'" 1 
ATOM   8418  C  "C4'" . DT  I 5 116 ? -34.485 -32.425 -1.979 1.00 123.21 ? 43   DT  I "C4'" 1 
ATOM   8419  O  "O4'" . DT  I 5 116 ? -34.060 -31.722 -0.778 1.00 123.52 ? 43   DT  I "O4'" 1 
ATOM   8420  C  "C3'" . DT  I 5 116 ? -36.019 -32.449 -1.946 1.00 122.28 ? 43   DT  I "C3'" 1 
ATOM   8421  O  "O3'" . DT  I 5 116 ? -36.470 -33.769 -1.546 1.00 120.67 ? 43   DT  I "O3'" 1 
ATOM   8422  C  "C2'" . DT  I 5 116 ? -36.348 -31.340 -0.948 1.00 122.75 ? 43   DT  I "C2'" 1 
ATOM   8423  C  "C1'" . DT  I 5 116 ? -35.197 -31.513 0.041  1.00 123.54 ? 43   DT  I "C1'" 1 
ATOM   8424  N  N1    . DT  I 5 116 ? -34.961 -30.377 1.023  1.00 123.80 ? 43   DT  I N1    1 
ATOM   8425  C  C2    . DT  I 5 116 ? -34.605 -30.673 2.334  1.00 123.61 ? 43   DT  I C2    1 
ATOM   8426  O  O2    . DT  I 5 116 ? -34.466 -31.806 2.768  1.00 123.42 ? 43   DT  I O2    1 
ATOM   8427  N  N3    . DT  I 5 116 ? -34.412 -29.572 3.136  1.00 123.43 ? 43   DT  I N3    1 
ATOM   8428  C  C4    . DT  I 5 116 ? -34.534 -28.238 2.777  1.00 123.48 ? 43   DT  I C4    1 
ATOM   8429  O  O4    . DT  I 5 116 ? -34.335 -27.332 3.580  1.00 123.46 ? 43   DT  I O4    1 
ATOM   8430  C  C5    . DT  I 5 116 ? -34.908 -27.996 1.401  1.00 123.63 ? 43   DT  I C5    1 
ATOM   8431  C  C7    . DT  I 5 116 ? -35.074 -26.595 0.885  1.00 123.59 ? 43   DT  I C7    1 
ATOM   8432  C  C6    . DT  I 5 116 ? -35.097 -29.059 0.603  1.00 123.74 ? 43   DT  I C6    1 
ATOM   8433  P  P     . DT  I 5 117 ? -37.847 -34.113 -0.779 1.00 119.28 ? 44   DT  I P     1 
ATOM   8434  O  OP1   . DT  I 5 117 ? -38.100 -35.558 -0.976 1.00 118.95 ? 44   DT  I OP1   1 
ATOM   8435  O  OP2   . DT  I 5 117 ? -38.906 -33.149 -1.157 1.00 119.01 ? 44   DT  I OP2   1 
ATOM   8436  O  "O5'" . DT  I 5 117 ? -37.467 -33.855 0.757  1.00 118.24 ? 44   DT  I "O5'" 1 
ATOM   8437  C  "C5'" . DT  I 5 117 ? -36.517 -34.692 1.434  1.00 116.13 ? 44   DT  I "C5'" 1 
ATOM   8438  C  "C4'" . DT  I 5 117 ? -36.990 -35.088 2.828  1.00 114.32 ? 44   DT  I "C4'" 1 
ATOM   8439  O  "O4'" . DT  I 5 117 ? -36.833 -33.967 3.735  1.00 114.21 ? 44   DT  I "O4'" 1 
ATOM   8440  C  "C3'" . DT  I 5 117 ? -38.444 -35.542 2.957  1.00 113.09 ? 44   DT  I "C3'" 1 
ATOM   8441  O  "O3'" . DT  I 5 117 ? -38.498 -36.679 3.837  1.00 111.35 ? 44   DT  I "O3'" 1 
ATOM   8442  C  "C2'" . DT  I 5 117 ? -39.161 -34.292 3.466  1.00 113.55 ? 44   DT  I "C2'" 1 
ATOM   8443  C  "C1'" . DT  I 5 117 ? -38.083 -33.558 4.259  1.00 113.92 ? 44   DT  I "C1'" 1 
ATOM   8444  N  N1    . DT  I 5 117 ? -38.145 -32.060 4.170  1.00 113.98 ? 44   DT  I N1    1 
ATOM   8445  C  C2    . DT  I 5 117 ? -38.034 -31.295 5.320  1.00 113.95 ? 44   DT  I C2    1 
ATOM   8446  O  O2    . DT  I 5 117 ? -37.896 -31.755 6.440  1.00 113.98 ? 44   DT  I O2    1 
ATOM   8447  N  N3    . DT  I 5 117 ? -38.096 -29.939 5.110  1.00 113.90 ? 44   DT  I N3    1 
ATOM   8448  C  C4    . DT  I 5 117 ? -38.249 -29.285 3.897  1.00 113.83 ? 44   DT  I C4    1 
ATOM   8449  O  O4    . DT  I 5 117 ? -38.291 -28.062 3.821  1.00 113.72 ? 44   DT  I O4    1 
ATOM   8450  C  C5    . DT  I 5 117 ? -38.356 -30.142 2.739  1.00 113.96 ? 44   DT  I C5    1 
ATOM   8451  C  C7    . DT  I 5 117 ? -38.529 -29.559 1.367  1.00 114.09 ? 44   DT  I C7    1 
ATOM   8452  C  C6    . DT  I 5 117 ? -38.297 -31.467 2.927  1.00 113.93 ? 44   DT  I C6    1 
ATOM   8453  P  P     . DT  I 5 118 ? -39.623 -36.965 4.947  1.00 110.06 ? 45   DT  I P     1 
ATOM   8454  O  OP1   . DT  I 5 118 ? -39.466 -38.390 5.316  1.00 110.14 ? 45   DT  I OP1   1 
ATOM   8455  O  OP2   . DT  I 5 118 ? -40.944 -36.470 4.490  1.00 109.67 ? 45   DT  I OP2   1 
ATOM   8456  O  "O5'" . DT  I 5 118 ? -39.151 -36.041 6.167  1.00 109.52 ? 45   DT  I "O5'" 1 
ATOM   8457  C  "C5'" . DT  I 5 118 ? -38.568 -36.578 7.360  1.00 108.75 ? 45   DT  I "C5'" 1 
ATOM   8458  C  "C4'" . DT  I 5 118 ? -38.948 -35.717 8.547  1.00 107.91 ? 45   DT  I "C4'" 1 
ATOM   8459  O  "O4'" . DT  I 5 118 ? -38.868 -34.327 8.144  1.00 108.41 ? 45   DT  I "O4'" 1 
ATOM   8460  C  "C3'" . DT  I 5 118 ? -40.390 -35.911 9.001  1.00 107.12 ? 45   DT  I "C3'" 1 
ATOM   8461  O  "O3'" . DT  I 5 118 ? -40.547 -36.934 10.004 1.00 105.40 ? 45   DT  I "O3'" 1 
ATOM   8462  C  "C2'" . DT  I 5 118 ? -40.829 -34.533 9.485  1.00 108.05 ? 45   DT  I "C2'" 1 
ATOM   8463  C  "C1'" . DT  I 5 118 ? -39.826 -33.569 8.857  1.00 109.24 ? 45   DT  I "C1'" 1 
ATOM   8464  N  N1    . DT  I 5 118 ? -40.501 -32.570 7.967  1.00 109.67 ? 45   DT  I N1    1 
ATOM   8465  C  C2    . DT  I 5 118 ? -40.698 -31.279 8.432  1.00 110.10 ? 45   DT  I C2    1 
ATOM   8466  O  O2    . DT  I 5 118 ? -40.338 -30.894 9.529  1.00 110.15 ? 45   DT  I O2    1 
ATOM   8467  N  N3    . DT  I 5 118 ? -41.335 -30.434 7.552  1.00 110.25 ? 45   DT  I N3    1 
ATOM   8468  C  C4    . DT  I 5 118 ? -41.787 -30.749 6.280  1.00 110.01 ? 45   DT  I C4    1 
ATOM   8469  O  O4    . DT  I 5 118 ? -42.344 -29.920 5.567  1.00 109.82 ? 45   DT  I O4    1 
ATOM   8470  C  C5    . DT  I 5 118 ? -41.557 -32.114 5.857  1.00 110.16 ? 45   DT  I C5    1 
ATOM   8471  C  C7    . DT  I 5 118 ? -42.006 -32.577 4.503  1.00 110.06 ? 45   DT  I C7    1 
ATOM   8472  C  C6    . DT  I 5 118 ? -40.937 -32.949 6.708  1.00 110.04 ? 45   DT  I C6    1 
ATOM   8473  P  P     . DT  I 5 119 ? -39.819 -37.010 11.431 1.00 104.44 ? 46   DT  I P     1 
ATOM   8474  O  OP1   . DT  I 5 119 ? -38.545 -37.733 11.200 1.00 104.55 ? 46   DT  I OP1   1 
ATOM   8475  O  OP2   . DT  I 5 119 ? -40.810 -37.521 12.403 1.00 103.79 ? 46   DT  I OP2   1 
ATOM   8476  O  "O5'" . DT  I 5 119 ? -39.518 -35.495 11.865 1.00 105.04 ? 46   DT  I "O5'" 1 
ATOM   8477  C  "C5'" . DT  I 5 119 ? -38.641 -35.159 12.960 1.00 104.29 ? 46   DT  I "C5'" 1 
ATOM   8478  C  "C4'" . DT  I 5 119 ? -39.191 -34.019 13.812 1.00 103.47 ? 46   DT  I "C4'" 1 
ATOM   8479  O  "O4'" . DT  I 5 119 ? -39.852 -33.028 12.976 1.00 103.40 ? 46   DT  I "O4'" 1 
ATOM   8480  C  "C3'" . DT  I 5 119 ? -40.217 -34.431 14.873 1.00 103.19 ? 46   DT  I "C3'" 1 
ATOM   8481  O  "O3'" . DT  I 5 119 ? -40.086 -33.649 16.046 1.00 102.05 ? 46   DT  I "O3'" 1 
ATOM   8482  C  "C2'" . DT  I 5 119 ? -41.540 -34.079 14.206 1.00 103.92 ? 46   DT  I "C2'" 1 
ATOM   8483  C  "C1'" . DT  I 5 119 ? -41.155 -32.787 13.486 1.00 104.20 ? 46   DT  I "C1'" 1 
ATOM   8484  N  N1    . DT  I 5 119 ? -42.056 -32.385 12.355 1.00 104.38 ? 46   DT  I N1    1 
ATOM   8485  C  C2    . DT  I 5 119 ? -42.015 -31.086 11.876 1.00 104.48 ? 46   DT  I C2    1 
ATOM   8486  O  O2    . DT  I 5 119 ? -41.286 -30.216 12.315 1.00 104.43 ? 46   DT  I O2    1 
ATOM   8487  N  N3    . DT  I 5 119 ? -42.876 -30.831 10.838 1.00 104.62 ? 46   DT  I N3    1 
ATOM   8488  C  C4    . DT  I 5 119 ? -43.757 -31.720 10.242 1.00 104.64 ? 46   DT  I C4    1 
ATOM   8489  O  O4    . DT  I 5 119 ? -44.480 -31.366 9.315  1.00 104.60 ? 46   DT  I O4    1 
ATOM   8490  C  C5    . DT  I 5 119 ? -43.758 -33.065 10.793 1.00 104.64 ? 46   DT  I C5    1 
ATOM   8491  C  C7    . DT  I 5 119 ? -44.658 -34.147 10.259 1.00 104.40 ? 46   DT  I C7    1 
ATOM   8492  C  C6    . DT  I 5 119 ? -42.919 -33.321 11.806 1.00 104.51 ? 46   DT  I C6    1 
ATOM   8493  P  P     . DG  I 5 120 ? -39.077 -34.020 17.227 1.00 101.74 ? 47   DG  I P     1 
ATOM   8494  O  OP1   . DG  I 5 120 ? -37.743 -34.355 16.688 1.00 101.80 ? 47   DG  I OP1   1 
ATOM   8495  O  OP2   . DG  I 5 120 ? -39.784 -34.988 18.089 1.00 102.15 ? 47   DG  I OP2   1 
ATOM   8496  O  "O5'" . DG  I 5 120 ? -38.956 -32.634 18.011 1.00 101.00 ? 47   DG  I "O5'" 1 
ATOM   8497  C  "C5'" . DG  I 5 120 ? -38.658 -31.414 17.325 1.00 99.82  ? 47   DG  I "C5'" 1 
ATOM   8498  C  "C4'" . DG  I 5 120 ? -39.751 -30.371 17.514 1.00 98.88  ? 47   DG  I "C4'" 1 
ATOM   8499  O  "O4'" . DG  I 5 120 ? -40.815 -30.630 16.569 1.00 99.70  ? 47   DG  I "O4'" 1 
ATOM   8500  C  "C3'" . DG  I 5 120 ? -40.425 -30.304 18.885 1.00 98.10  ? 47   DG  I "C3'" 1 
ATOM   8501  O  "O3'" . DG  I 5 120 ? -40.525 -28.944 19.305 1.00 96.14  ? 47   DG  I "O3'" 1 
ATOM   8502  C  "C2'" . DG  I 5 120 ? -41.800 -30.927 18.644 1.00 98.88  ? 47   DG  I "C2'" 1 
ATOM   8503  C  "C1'" . DG  I 5 120 ? -42.064 -30.491 17.211 1.00 100.59 ? 47   DG  I "C1'" 1 
ATOM   8504  N  N9    . DG  I 5 120 ? -43.027 -31.277 16.440 1.00 100.99 ? 47   DG  I N9    1 
ATOM   8505  C  C8    . DG  I 5 120 ? -43.464 -32.563 16.662 1.00 101.34 ? 47   DG  I C8    1 
ATOM   8506  N  N7    . DG  I 5 120 ? -44.320 -32.989 15.773 1.00 101.37 ? 47   DG  I N7    1 
ATOM   8507  C  C5    . DG  I 5 120 ? -44.456 -31.918 14.899 1.00 101.37 ? 47   DG  I C5    1 
ATOM   8508  C  C6    . DG  I 5 120 ? -45.255 -31.779 13.732 1.00 101.32 ? 47   DG  I C6    1 
ATOM   8509  O  O6    . DG  I 5 120 ? -46.023 -32.610 13.223 1.00 101.36 ? 47   DG  I O6    1 
ATOM   8510  N  N1    . DG  I 5 120 ? -45.098 -30.524 13.139 1.00 101.09 ? 47   DG  I N1    1 
ATOM   8511  C  C2    . DG  I 5 120 ? -44.274 -29.531 13.621 1.00 101.24 ? 47   DG  I C2    1 
ATOM   8512  N  N2    . DG  I 5 120 ? -44.245 -28.390 12.927 1.00 101.33 ? 47   DG  I N2    1 
ATOM   8513  N  N3    . DG  I 5 120 ? -43.524 -29.648 14.709 1.00 101.32 ? 47   DG  I N3    1 
ATOM   8514  C  C4    . DG  I 5 120 ? -43.665 -30.861 15.297 1.00 101.14 ? 47   DG  I C4    1 
ATOM   8515  P  P     . DG  I 5 121 ? -40.570 -28.538 20.850 1.00 94.21  ? 48   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5 121 ? -39.205 -28.147 21.232 1.00 94.08  ? 48   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5 121 ? -41.295 -29.572 21.615 1.00 94.02  ? 48   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5 121 ? -41.486 -27.234 20.874 1.00 96.42  ? 48   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5 121 ? -41.253 -26.137 19.996 1.00 99.35  ? 48   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5 121 ? -42.562 -25.489 19.566 1.00 101.69 ? 48   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5 121 ? -43.192 -26.296 18.537 1.00 101.98 ? 48   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5 121 ? -43.606 -25.297 20.670 1.00 103.15 ? 48   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5 121 ? -44.081 -23.958 20.643 1.00 105.69 ? 48   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5 121 ? -44.703 -26.300 20.322 1.00 102.98 ? 48   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5 121 ? -44.576 -26.342 18.806 1.00 103.06 ? 48   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5 121 ? -45.169 -27.506 18.149 1.00 103.27 ? 48   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5 121 ? -45.070 -28.843 18.471 1.00 103.34 ? 48   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5 121 ? -45.732 -29.627 17.660 1.00 103.21 ? 48   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5 121 ? -46.304 -28.751 16.745 1.00 103.35 ? 48   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5 121 ? -47.134 -28.995 15.622 1.00 103.44 ? 48   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5 121 ? -47.551 -30.087 15.199 1.00 103.42 ? 48   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5 121 ? -47.484 -27.805 14.967 1.00 103.71 ? 48   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5 121 ? -47.087 -26.534 15.342 1.00 103.42 ? 48   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5 121 ? -47.511 -25.497 14.603 1.00 103.15 ? 48   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5 121 ? -46.314 -26.301 16.389 1.00 103.62 ? 48   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5 121 ? -45.965 -27.446 17.035 1.00 103.48 ? 48   DG  I C4    1 
ATOM   8537  P  P     . DT  I 5 122 ? -45.053 -23.374 21.773 1.00 108.00 ? 49   DT  I P     1 
ATOM   8538  O  OP1   . DT  I 5 122 ? -44.475 -22.089 22.225 1.00 107.80 ? 49   DT  I OP1   1 
ATOM   8539  O  OP2   . DT  I 5 122 ? -45.397 -24.432 22.753 1.00 107.65 ? 49   DT  I OP2   1 
ATOM   8540  O  "O5'" . DT  I 5 122 ? -46.375 -23.074 20.934 1.00 110.41 ? 49   DT  I "O5'" 1 
ATOM   8541  C  "C5'" . DT  I 5 122 ? -46.368 -22.132 19.871 1.00 113.80 ? 49   DT  I "C5'" 1 
ATOM   8542  C  "C4'" . DT  I 5 122 ? -47.681 -22.224 19.120 1.00 116.56 ? 49   DT  I "C4'" 1 
ATOM   8543  O  "O4'" . DT  I 5 122 ? -47.874 -23.585 18.667 1.00 116.77 ? 49   DT  I "O4'" 1 
ATOM   8544  C  "C3'" . DT  I 5 122 ? -48.925 -21.860 19.926 1.00 118.72 ? 49   DT  I "C3'" 1 
ATOM   8545  O  "O3'" . DT  I 5 122 ? -49.756 -21.051 19.112 1.00 122.54 ? 49   DT  I "O3'" 1 
ATOM   8546  C  "C2'" . DT  I 5 122 ? -49.584 -23.204 20.225 1.00 117.98 ? 49   DT  I "C2'" 1 
ATOM   8547  C  "C1'" . DT  I 5 122 ? -49.168 -24.027 19.011 1.00 117.48 ? 49   DT  I "C1'" 1 
ATOM   8548  N  N1    . DT  I 5 122 ? -49.098 -25.509 19.219 1.00 117.65 ? 49   DT  I N1    1 
ATOM   8549  C  C2    . DT  I 5 122 ? -49.420 -26.351 18.168 1.00 117.62 ? 49   DT  I C2    1 
ATOM   8550  O  O2    . DT  I 5 122 ? -49.769 -25.957 17.070 1.00 117.66 ? 49   DT  I O2    1 
ATOM   8551  N  N3    . DT  I 5 122 ? -49.322 -27.692 18.451 1.00 117.45 ? 49   DT  I N3    1 
ATOM   8552  C  C4    . DT  I 5 122 ? -48.939 -28.266 19.652 1.00 117.56 ? 49   DT  I C4    1 
ATOM   8553  O  O4    . DT  I 5 122 ? -48.889 -29.486 19.785 1.00 117.45 ? 49   DT  I O4    1 
ATOM   8554  C  C5    . DT  I 5 122 ? -48.613 -27.330 20.714 1.00 117.86 ? 49   DT  I C5    1 
ATOM   8555  C  C7    . DT  I 5 122 ? -48.181 -27.805 22.076 1.00 117.78 ? 49   DT  I C7    1 
ATOM   8556  C  C6    . DT  I 5 122 ? -48.703 -26.017 20.446 1.00 117.85 ? 49   DT  I C6    1 
ATOM   8557  P  P     . DA  I 5 123 ? -50.701 -19.901 19.699 1.00 125.29 ? 50   DA  I P     1 
ATOM   8558  O  OP1   . DA  I 5 123 ? -49.976 -18.614 19.592 1.00 125.18 ? 50   DA  I OP1   1 
ATOM   8559  O  OP2   . DA  I 5 123 ? -51.240 -20.342 21.006 1.00 124.99 ? 50   DA  I OP2   1 
ATOM   8560  O  "O5'" . DA  I 5 123 ? -51.904 -19.895 18.638 1.00 128.03 ? 50   DA  I "O5'" 1 
ATOM   8561  C  "C5'" . DA  I 5 123 ? -52.083 -20.966 17.701 1.00 131.92 ? 50   DA  I "C5'" 1 
ATOM   8562  C  "C4'" . DA  I 5 123 ? -53.265 -21.859 18.048 1.00 134.99 ? 50   DA  I "C4'" 1 
ATOM   8563  O  "O4'" . DA  I 5 123 ? -52.807 -23.230 18.192 1.00 135.76 ? 50   DA  I "O4'" 1 
ATOM   8564  C  "C3'" . DA  I 5 123 ? -54.024 -21.540 19.341 1.00 137.06 ? 50   DA  I "C3'" 1 
ATOM   8565  O  "O3'" . DA  I 5 123 ? -55.428 -21.591 19.101 1.00 140.04 ? 50   DA  I "O3'" 1 
ATOM   8566  C  "C2'" . DA  I 5 123 ? -53.605 -22.666 20.280 1.00 136.83 ? 50   DA  I "C2'" 1 
ATOM   8567  C  "C1'" . DA  I 5 123 ? -53.556 -23.786 19.251 1.00 136.51 ? 50   DA  I "C1'" 1 
ATOM   8568  N  N9    . DA  I 5 123 ? -53.000 -25.064 19.695 1.00 136.61 ? 50   DA  I N9    1 
ATOM   8569  C  C8    . DA  I 5 123 ? -52.304 -25.340 20.842 1.00 136.65 ? 50   DA  I C8    1 
ATOM   8570  N  N7    . DA  I 5 123 ? -51.947 -26.597 20.959 1.00 136.59 ? 50   DA  I N7    1 
ATOM   8571  C  C5    . DA  I 5 123 ? -52.448 -27.184 19.811 1.00 136.56 ? 50   DA  I C5    1 
ATOM   8572  C  C6    . DA  I 5 123 ? -52.408 -28.505 19.324 1.00 136.70 ? 50   DA  I C6    1 
ATOM   8573  N  N6    . DA  I 5 123 ? -51.815 -29.505 19.983 1.00 136.72 ? 50   DA  I N6    1 
ATOM   8574  N  N1    . DA  I 5 123 ? -53.014 -28.760 18.141 1.00 136.67 ? 50   DA  I N1    1 
ATOM   8575  C  C2    . DA  I 5 123 ? -53.616 -27.756 17.489 1.00 136.55 ? 50   DA  I C2    1 
ATOM   8576  N  N3    . DA  I 5 123 ? -53.714 -26.475 17.842 1.00 136.44 ? 50   DA  I N3    1 
ATOM   8577  C  C4    . DA  I 5 123 ? -53.101 -26.255 19.021 1.00 136.54 ? 50   DA  I C4    1 
ATOM   8578  P  P     . DG  I 5 124 ? -56.299 -20.259 18.921 1.00 142.33 ? 51   DG  I P     1 
ATOM   8579  O  OP1   . DG  I 5 124 ? -55.563 -19.322 18.034 1.00 142.19 ? 51   DG  I OP1   1 
ATOM   8580  O  OP2   . DG  I 5 124 ? -56.733 -19.820 20.268 1.00 142.25 ? 51   DG  I OP2   1 
ATOM   8581  O  "O5'" . DG  I 5 124 ? -57.582 -20.803 18.140 1.00 143.20 ? 51   DG  I "O5'" 1 
ATOM   8582  C  "C5'" . DG  I 5 124 ? -57.404 -21.561 16.950 1.00 145.32 ? 51   DG  I "C5'" 1 
ATOM   8583  C  "C4'" . DG  I 5 124 ? -58.055 -22.920 17.088 1.00 146.87 ? 51   DG  I "C4'" 1 
ATOM   8584  O  "O4'" . DG  I 5 124 ? -57.108 -23.887 17.605 1.00 147.12 ? 51   DG  I "O4'" 1 
ATOM   8585  C  "C3'" . DG  I 5 124 ? -59.254 -22.947 18.033 1.00 147.97 ? 51   DG  I "C3'" 1 
ATOM   8586  O  "O3'" . DG  I 5 124 ? -60.415 -23.294 17.280 1.00 149.39 ? 51   DG  I "O3'" 1 
ATOM   8587  C  "C2'" . DG  I 5 124 ? -58.884 -24.008 19.069 1.00 147.88 ? 51   DG  I "C2'" 1 
ATOM   8588  C  "C1'" . DG  I 5 124 ? -57.869 -24.843 18.304 1.00 147.74 ? 51   DG  I "C1'" 1 
ATOM   8589  N  N9    . DG  I 5 124 ? -57.012 -25.631 19.182 1.00 147.87 ? 51   DG  I N9    1 
ATOM   8590  C  C8    . DG  I 5 124 ? -56.286 -25.166 20.253 1.00 147.95 ? 51   DG  I C8    1 
ATOM   8591  N  N7    . DG  I 5 124 ? -55.609 -26.091 20.872 1.00 147.94 ? 51   DG  I N7    1 
ATOM   8592  C  C5    . DG  I 5 124 ? -55.913 -27.248 20.168 1.00 147.95 ? 51   DG  I C5    1 
ATOM   8593  C  C6    . DG  I 5 124 ? -55.469 -28.574 20.383 1.00 147.93 ? 51   DG  I C6    1 
ATOM   8594  O  O6    . DG  I 5 124 ? -54.697 -28.973 21.266 1.00 147.86 ? 51   DG  I O6    1 
ATOM   8595  N  N1    . DG  I 5 124 ? -56.009 -29.463 19.449 1.00 147.89 ? 51   DG  I N1    1 
ATOM   8596  C  C2    . DG  I 5 124 ? -56.874 -29.110 18.434 1.00 147.84 ? 51   DG  I C2    1 
ATOM   8597  N  N2    . DG  I 5 124 ? -57.290 -30.102 17.633 1.00 147.83 ? 51   DG  I N2    1 
ATOM   8598  N  N3    . DG  I 5 124 ? -57.297 -27.865 18.222 1.00 147.76 ? 51   DG  I N3    1 
ATOM   8599  C  C4    . DG  I 5 124 ? -56.778 -26.987 19.123 1.00 147.89 ? 51   DG  I C4    1 
ATOM   8600  P  P     . DT  I 5 125 ? -61.903 -23.280 17.886 1.00 150.30 ? 52   DT  I P     1 
ATOM   8601  O  OP1   . DT  I 5 125 ? -62.678 -22.314 17.075 1.00 150.45 ? 52   DT  I OP1   1 
ATOM   8602  O  OP2   . DT  I 5 125 ? -61.854 -23.116 19.360 1.00 150.09 ? 52   DT  I OP2   1 
ATOM   8603  O  "O5'" . DT  I 5 125 ? -62.432 -24.761 17.549 1.00 150.46 ? 52   DT  I "O5'" 1 
ATOM   8604  C  "C5'" . DT  I 5 125 ? -61.559 -25.905 17.515 1.00 150.51 ? 52   DT  I "C5'" 1 
ATOM   8605  C  "C4'" . DT  I 5 125 ? -61.731 -26.797 18.735 1.00 150.55 ? 52   DT  I "C4'" 1 
ATOM   8606  O  "O4'" . DT  I 5 125 ? -60.457 -27.084 19.356 1.00 150.91 ? 52   DT  I "O4'" 1 
ATOM   8607  C  "C3'" . DT  I 5 125 ? -62.573 -26.228 19.872 1.00 150.42 ? 52   DT  I "C3'" 1 
ATOM   8608  O  "O3'" . DT  I 5 125 ? -63.959 -26.522 19.583 1.00 150.05 ? 52   DT  I "O3'" 1 
ATOM   8609  C  "C2'" . DT  I 5 125 ? -61.972 -26.853 21.138 1.00 150.70 ? 52   DT  I "C2'" 1 
ATOM   8610  C  "C1'" . DT  I 5 125 ? -60.764 -27.637 20.619 1.00 151.09 ? 52   DT  I "C1'" 1 
ATOM   8611  N  N1    . DT  I 5 125 ? -59.552 -27.611 21.524 1.00 151.36 ? 52   DT  I N1    1 
ATOM   8612  C  C2    . DT  I 5 125 ? -58.819 -28.775 21.713 1.00 151.32 ? 52   DT  I C2    1 
ATOM   8613  O  O2    . DT  I 5 125 ? -59.090 -29.845 21.189 1.00 151.21 ? 52   DT  I O2    1 
ATOM   8614  N  N3    . DT  I 5 125 ? -57.741 -28.644 22.563 1.00 151.27 ? 52   DT  I N3    1 
ATOM   8615  C  C4    . DT  I 5 125 ? -57.324 -27.496 23.224 1.00 151.26 ? 52   DT  I C4    1 
ATOM   8616  O  O4    . DT  I 5 125 ? -56.335 -27.497 23.956 1.00 151.19 ? 52   DT  I O4    1 
ATOM   8617  C  C5    . DT  I 5 125 ? -58.130 -26.314 22.983 1.00 151.30 ? 52   DT  I C5    1 
ATOM   8618  C  C7    . DT  I 5 125 ? -57.794 -25.000 23.633 1.00 151.19 ? 52   DT  I C7    1 
ATOM   8619  C  C6    . DT  I 5 125 ? -59.186 -26.429 22.159 1.00 151.36 ? 52   DT  I C6    1 
ATOM   8620  P  P     . DA  I 5 126 ? -65.017 -27.220 20.571 1.00 149.63 ? 53   DA  I P     1 
ATOM   8621  O  OP1   . DA  I 5 126 ? -66.265 -27.467 19.810 1.00 149.60 ? 53   DA  I OP1   1 
ATOM   8622  O  OP2   . DA  I 5 126 ? -65.085 -26.422 21.817 1.00 149.55 ? 53   DA  I OP2   1 
ATOM   8623  O  "O5'" . DA  I 5 126 ? -64.332 -28.627 20.905 1.00 148.42 ? 53   DA  I "O5'" 1 
ATOM   8624  C  "C5'" . DA  I 5 126 ? -63.989 -29.598 19.909 1.00 146.18 ? 53   DA  I "C5'" 1 
ATOM   8625  C  "C4'" . DA  I 5 126 ? -63.552 -30.852 20.636 1.00 144.48 ? 53   DA  I "C4'" 1 
ATOM   8626  O  "O4'" . DA  I 5 126 ? -62.253 -30.632 21.253 1.00 144.18 ? 53   DA  I "O4'" 1 
ATOM   8627  C  "C3'" . DA  I 5 126 ? -64.513 -31.208 21.767 1.00 143.31 ? 53   DA  I "C3'" 1 
ATOM   8628  O  "O3'" . DA  I 5 126 ? -64.896 -32.577 21.657 1.00 141.62 ? 53   DA  I "O3'" 1 
ATOM   8629  C  "C2'" . DA  I 5 126 ? -63.719 -30.871 23.032 1.00 143.53 ? 53   DA  I "C2'" 1 
ATOM   8630  C  "C1'" . DA  I 5 126 ? -62.296 -31.148 22.569 1.00 143.83 ? 53   DA  I "C1'" 1 
ATOM   8631  N  N9    . DA  I 5 126 ? -61.273 -30.554 23.439 1.00 143.90 ? 53   DA  I N9    1 
ATOM   8632  C  C8    . DA  I 5 126 ? -61.183 -29.249 23.852 1.00 143.83 ? 53   DA  I C8    1 
ATOM   8633  N  N7    . DA  I 5 126 ? -60.162 -29.006 24.642 1.00 143.85 ? 53   DA  I N7    1 
ATOM   8634  C  C5    . DA  I 5 126 ? -59.539 -30.236 24.770 1.00 143.76 ? 53   DA  I C5    1 
ATOM   8635  C  C6    . DA  I 5 126 ? -58.393 -30.655 25.480 1.00 143.62 ? 53   DA  I C6    1 
ATOM   8636  N  N6    . DA  I 5 126 ? -57.650 -29.833 26.223 1.00 143.66 ? 53   DA  I N6    1 
ATOM   8637  N  N1    . DA  I 5 126 ? -58.039 -31.957 25.399 1.00 143.73 ? 53   DA  I N1    1 
ATOM   8638  C  C2    . DA  I 5 126 ? -58.785 -32.785 24.652 1.00 143.77 ? 53   DA  I C2    1 
ATOM   8639  N  N3    . DA  I 5 126 ? -59.880 -32.508 23.941 1.00 143.73 ? 53   DA  I N3    1 
ATOM   8640  C  C4    . DA  I 5 126 ? -60.212 -31.205 24.040 1.00 143.86 ? 53   DA  I C4    1 
ATOM   8641  P  P     . DT  I 5 127 ? -65.383 -33.421 22.931 1.00 140.51 ? 54   DT  I P     1 
ATOM   8642  O  OP1   . DT  I 5 127 ? -66.091 -34.627 22.442 1.00 140.61 ? 54   DT  I OP1   1 
ATOM   8643  O  OP2   . DT  I 5 127 ? -66.069 -32.521 23.890 1.00 140.10 ? 54   DT  I OP2   1 
ATOM   8644  O  "O5'" . DT  I 5 127 ? -63.981 -33.878 23.550 1.00 138.85 ? 54   DT  I "O5'" 1 
ATOM   8645  C  "C5'" . DT  I 5 127 ? -63.146 -34.814 22.861 1.00 135.87 ? 54   DT  I "C5'" 1 
ATOM   8646  C  "C4'" . DT  I 5 127 ? -62.544 -35.801 23.847 1.00 133.64 ? 54   DT  I "C4'" 1 
ATOM   8647  O  "O4'" . DT  I 5 127 ? -61.476 -35.146 24.579 1.00 133.35 ? 54   DT  I "O4'" 1 
ATOM   8648  C  "C3'" . DT  I 5 127 ? -63.519 -36.359 24.884 1.00 132.07 ? 54   DT  I "C3'" 1 
ATOM   8649  O  "O3'" . DT  I 5 127 ? -63.335 -37.776 24.978 1.00 129.69 ? 54   DT  I "O3'" 1 
ATOM   8650  C  "C2'" . DT  I 5 127 ? -63.178 -35.606 26.173 1.00 132.24 ? 54   DT  I "C2'" 1 
ATOM   8651  C  "C1'" . DT  I 5 127 ? -61.718 -35.201 25.973 1.00 132.57 ? 54   DT  I "C1'" 1 
ATOM   8652  N  N1    . DT  I 5 127 ? -61.364 -33.869 26.576 1.00 132.45 ? 54   DT  I N1    1 
ATOM   8653  C  C2    . DT  I 5 127 ? -60.151 -33.702 27.229 1.00 132.26 ? 54   DT  I C2    1 
ATOM   8654  O  O2    . DT  I 5 127 ? -59.312 -34.581 27.360 1.00 131.93 ? 54   DT  I O2    1 
ATOM   8655  N  N3    . DT  I 5 127 ? -59.954 -32.436 27.732 1.00 132.24 ? 54   DT  I N3    1 
ATOM   8656  C  C4    . DT  I 5 127 ? -60.818 -31.354 27.653 1.00 132.14 ? 54   DT  I C4    1 
ATOM   8657  O  O4    . DT  I 5 127 ? -60.536 -30.265 28.137 1.00 132.14 ? 54   DT  I O4    1 
ATOM   8658  C  C5    . DT  I 5 127 ? -62.061 -31.596 26.961 1.00 132.16 ? 54   DT  I C5    1 
ATOM   8659  C  C7    . DT  I 5 127 ? -63.085 -30.509 26.805 1.00 132.16 ? 54   DT  I C7    1 
ATOM   8660  C  C6    . DT  I 5 127 ? -62.268 -32.823 26.463 1.00 132.34 ? 54   DT  I C6    1 
ATOM   8661  P  P     . DC  I 5 128 ? -63.966 -38.677 26.145 1.00 127.81 ? 55   DC  I P     1 
ATOM   8662  O  OP1   . DC  I 5 128 ? -64.077 -40.064 25.636 1.00 127.88 ? 55   DC  I OP1   1 
ATOM   8663  O  OP2   . DC  I 5 128 ? -65.152 -37.996 26.714 1.00 127.93 ? 55   DC  I OP2   1 
ATOM   8664  O  "O5'" . DC  I 5 128 ? -62.816 -38.653 27.249 1.00 126.15 ? 55   DC  I "O5'" 1 
ATOM   8665  C  "C5'" . DC  I 5 128 ? -61.457 -38.917 26.891 1.00 122.75 ? 55   DC  I "C5'" 1 
ATOM   8666  C  "C4'" . DC  I 5 128 ? -60.548 -38.836 28.107 1.00 119.91 ? 55   DC  I "C4'" 1 
ATOM   8667  O  "O4'" . DC  I 5 128 ? -60.379 -37.453 28.511 1.00 119.67 ? 55   DC  I "O4'" 1 
ATOM   8668  C  "C3'" . DC  I 5 128 ? -61.034 -39.580 29.351 1.00 117.61 ? 55   DC  I "C3'" 1 
ATOM   8669  O  "O3'" . DC  I 5 128 ? -59.924 -40.310 29.852 1.00 113.85 ? 55   DC  I "O3'" 1 
ATOM   8670  C  "C2'" . DC  I 5 128 ? -61.501 -38.463 30.288 1.00 118.11 ? 55   DC  I "C2'" 1 
ATOM   8671  C  "C1'" . DC  I 5 128 ? -60.507 -37.369 29.920 1.00 119.29 ? 55   DC  I "C1'" 1 
ATOM   8672  N  N1    . DC  I 5 128 ? -60.843 -35.944 30.273 1.00 119.47 ? 55   DC  I N1    1 
ATOM   8673  C  C2    . DC  I 5 128 ? -60.096 -35.266 31.258 1.00 119.56 ? 55   DC  I C2    1 
ATOM   8674  O  O2    . DC  I 5 128 ? -59.179 -35.843 31.861 1.00 119.74 ? 55   DC  I O2    1 
ATOM   8675  N  N3    . DC  I 5 128 ? -60.402 -33.973 31.542 1.00 119.54 ? 55   DC  I N3    1 
ATOM   8676  C  C4    . DC  I 5 128 ? -61.392 -33.361 30.885 1.00 119.58 ? 55   DC  I C4    1 
ATOM   8677  N  N4    . DC  I 5 128 ? -61.658 -32.091 31.199 1.00 119.58 ? 55   DC  I N4    1 
ATOM   8678  C  C5    . DC  I 5 128 ? -62.159 -34.027 29.879 1.00 119.69 ? 55   DC  I C5    1 
ATOM   8679  C  C6    . DC  I 5 128 ? -61.851 -35.301 29.606 1.00 119.43 ? 55   DC  I C6    1 
ATOM   8680  P  P     . DT  I 5 129 ? -60.000 -41.206 31.172 1.00 110.94 ? 56   DT  I P     1 
ATOM   8681  O  OP1   . DT  I 5 129 ? -59.106 -42.370 30.953 1.00 110.83 ? 56   DT  I OP1   1 
ATOM   8682  O  OP2   . DT  I 5 129 ? -61.415 -41.414 31.554 1.00 110.75 ? 56   DT  I OP2   1 
ATOM   8683  O  "O5'" . DT  I 5 129 ? -59.347 -40.227 32.254 1.00 108.29 ? 56   DT  I "O5'" 1 
ATOM   8684  C  "C5'" . DT  I 5 129 ? -57.950 -40.282 32.552 1.00 103.53 ? 56   DT  I "C5'" 1 
ATOM   8685  C  "C4'" . DT  I 5 129 ? -57.688 -39.730 33.939 1.00 100.10 ? 56   DT  I "C4'" 1 
ATOM   8686  O  "O4'" . DT  I 5 129 ? -58.174 -38.364 34.021 1.00 99.67  ? 56   DT  I "O4'" 1 
ATOM   8687  C  "C3'" . DT  I 5 129 ? -58.355 -40.503 35.074 1.00 97.82  ? 56   DT  I "C3'" 1 
ATOM   8688  O  "O3'" . DT  I 5 129 ? -57.460 -40.631 36.167 1.00 94.44  ? 56   DT  I "O3'" 1 
ATOM   8689  C  "C2'" . DT  I 5 129 ? -59.552 -39.627 35.450 1.00 98.19  ? 56   DT  I "C2'" 1 
ATOM   8690  C  "C1'" . DT  I 5 129 ? -59.018 -38.230 35.145 1.00 98.70  ? 56   DT  I "C1'" 1 
ATOM   8691  N  N1    . DT  I 5 129 ? -60.037 -37.194 34.812 1.00 98.68  ? 56   DT  I N1    1 
ATOM   8692  C  C2    . DT  I 5 129 ? -59.865 -35.923 35.324 1.00 99.03  ? 56   DT  I C2    1 
ATOM   8693  O  O2    . DT  I 5 129 ? -58.930 -35.610 36.039 1.00 98.85  ? 56   DT  I O2    1 
ATOM   8694  N  N3    . DT  I 5 129 ? -60.841 -35.020 34.971 1.00 99.14  ? 56   DT  I N3    1 
ATOM   8695  C  C4    . DT  I 5 129 ? -61.945 -35.252 34.170 1.00 98.79  ? 56   DT  I C4    1 
ATOM   8696  O  O4    . DT  I 5 129 ? -62.764 -34.376 33.915 1.00 98.65  ? 56   DT  I O4    1 
ATOM   8697  C  C5    . DT  I 5 129 ? -62.065 -36.596 33.661 1.00 98.82  ? 56   DT  I C5    1 
ATOM   8698  C  C7    . DT  I 5 129 ? -63.226 -36.953 32.785 1.00 98.91  ? 56   DT  I C7    1 
ATOM   8699  C  C6    . DT  I 5 129 ? -61.118 -37.492 33.996 1.00 98.83  ? 56   DT  I C6    1 
ATOM   8700  P  P     . DG  I 5 130 ? -56.167 -41.576 36.164 1.00 91.62  ? 57   DG  I P     1 
ATOM   8701  O  OP1   . DG  I 5 130 ? -55.552 -41.599 34.819 1.00 91.79  ? 57   DG  I OP1   1 
ATOM   8702  O  OP2   . DG  I 5 130 ? -56.529 -42.844 36.819 1.00 91.38  ? 57   DG  I OP2   1 
ATOM   8703  O  "O5'" . DG  I 5 130 ? -55.211 -40.787 37.170 1.00 90.29  ? 57   DG  I "O5'" 1 
ATOM   8704  C  "C5'" . DG  I 5 130 ? -54.854 -39.435 36.893 1.00 88.18  ? 57   DG  I "C5'" 1 
ATOM   8705  C  "C4'" . DG  I 5 130 ? -54.243 -38.715 38.088 1.00 86.19  ? 57   DG  I "C4'" 1 
ATOM   8706  O  "O4'" . DG  I 5 130 ? -55.163 -37.716 38.579 1.00 85.19  ? 57   DG  I "O4'" 1 
ATOM   8707  C  "C3'" . DG  I 5 130 ? -53.854 -39.506 39.326 1.00 85.83  ? 57   DG  I "C3'" 1 
ATOM   8708  O  "O3'" . DG  I 5 130 ? -52.724 -38.818 39.876 1.00 85.25  ? 57   DG  I "O3'" 1 
ATOM   8709  C  "C2'" . DG  I 5 130 ? -55.123 -39.452 40.185 1.00 86.04  ? 57   DG  I "C2'" 1 
ATOM   8710  C  "C1'" . DG  I 5 130 ? -55.862 -38.201 39.705 1.00 85.41  ? 57   DG  I "C1'" 1 
ATOM   8711  N  N9    . DG  I 5 130 ? -57.245 -38.378 39.261 1.00 85.37  ? 57   DG  I N9    1 
ATOM   8712  C  C8    . DG  I 5 130 ? -57.853 -39.532 38.833 1.00 85.47  ? 57   DG  I C8    1 
ATOM   8713  N  N7    . DG  I 5 130 ? -59.098 -39.378 38.484 1.00 85.37  ? 57   DG  I N7    1 
ATOM   8714  C  C5    . DG  I 5 130 ? -59.340 -38.027 38.686 1.00 85.59  ? 57   DG  I C5    1 
ATOM   8715  C  C6    . DG  I 5 130 ? -60.520 -37.262 38.476 1.00 85.72  ? 57   DG  I C6    1 
ATOM   8716  O  O6    . DG  I 5 130 ? -61.621 -37.633 38.051 1.00 85.63  ? 57   DG  I O6    1 
ATOM   8717  N  N1    . DG  I 5 130 ? -60.344 -35.922 38.807 1.00 85.44  ? 57   DG  I N1    1 
ATOM   8718  C  C2    . DG  I 5 130 ? -59.169 -35.389 39.277 1.00 85.29  ? 57   DG  I C2    1 
ATOM   8719  N  N2    . DG  I 5 130 ? -59.189 -34.077 39.540 1.00 85.32  ? 57   DG  I N2    1 
ATOM   8720  N  N3    . DG  I 5 130 ? -58.059 -36.089 39.475 1.00 85.27  ? 57   DG  I N3    1 
ATOM   8721  C  C4    . DG  I 5 130 ? -58.209 -37.399 39.160 1.00 85.39  ? 57   DG  I C4    1 
ATOM   8722  P  P     . DC  I 5 131 ? -52.108 -39.025 41.342 1.00 84.84  ? 58   DC  I P     1 
ATOM   8723  O  OP1   . DC  I 5 131 ? -50.747 -38.447 41.313 1.00 85.15  ? 58   DC  I OP1   1 
ATOM   8724  O  OP2   . DC  I 5 131 ? -52.269 -40.438 41.747 1.00 84.78  ? 58   DC  I OP2   1 
ATOM   8725  O  "O5'" . DC  I 5 131 ? -53.050 -38.115 42.267 1.00 84.29  ? 58   DC  I "O5'" 1 
ATOM   8726  C  "C5'" . DC  I 5 131 ? -53.220 -36.728 42.003 1.00 84.04  ? 58   DC  I "C5'" 1 
ATOM   8727  C  "C4'" . DC  I 5 131 ? -54.336 -36.115 42.835 1.00 84.94  ? 58   DC  I "C4'" 1 
ATOM   8728  O  "O4'" . DC  I 5 131 ? -55.632 -36.481 42.304 1.00 85.53  ? 58   DC  I "O4'" 1 
ATOM   8729  C  "C3'" . DC  I 5 131 ? -54.386 -36.495 44.313 1.00 85.38  ? 58   DC  I "C3'" 1 
ATOM   8730  O  "O3'" . DC  I 5 131 ? -54.677 -35.336 45.062 1.00 85.42  ? 58   DC  I "O3'" 1 
ATOM   8731  C  "C2'" . DC  I 5 131 ? -55.559 -37.463 44.391 1.00 86.06  ? 58   DC  I "C2'" 1 
ATOM   8732  C  "C1'" . DC  I 5 131 ? -56.483 -36.791 43.386 1.00 86.44  ? 58   DC  I "C1'" 1 
ATOM   8733  N  N1    . DC  I 5 131 ? -57.627 -37.600 42.862 1.00 87.03  ? 58   DC  I N1    1 
ATOM   8734  C  C2    . DC  I 5 131 ? -58.771 -36.920 42.425 1.00 87.14  ? 58   DC  I C2    1 
ATOM   8735  O  O2    . DC  I 5 131 ? -58.794 -35.689 42.498 1.00 87.18  ? 58   DC  I O2    1 
ATOM   8736  N  N3    . DC  I 5 131 ? -59.820 -37.631 41.931 1.00 87.46  ? 58   DC  I N3    1 
ATOM   8737  C  C4    . DC  I 5 131 ? -59.757 -38.967 41.869 1.00 87.15  ? 58   DC  I C4    1 
ATOM   8738  N  N4    . DC  I 5 131 ? -60.817 -39.618 41.381 1.00 87.07  ? 58   DC  I N4    1 
ATOM   8739  C  C5    . DC  I 5 131 ? -58.601 -39.686 42.306 1.00 86.98  ? 58   DC  I C5    1 
ATOM   8740  C  C6    . DC  I 5 131 ? -57.571 -38.970 42.788 1.00 87.32  ? 58   DC  I C6    1 
ATOM   8741  P  P     . DA  I 5 132 ? -53.516 -34.549 45.824 1.00 85.24  ? 59   DA  I P     1 
ATOM   8742  O  OP1   . DA  I 5 132 ? -52.359 -34.501 44.910 1.00 84.74  ? 59   DA  I OP1   1 
ATOM   8743  O  OP2   . DA  I 5 132 ? -53.375 -35.135 47.178 1.00 84.14  ? 59   DA  I OP2   1 
ATOM   8744  O  "O5'" . DA  I 5 132 ? -54.095 -33.063 45.998 1.00 86.35  ? 59   DA  I "O5'" 1 
ATOM   8745  C  "C5'" . DA  I 5 132 ? -54.865 -32.416 44.987 1.00 88.59  ? 59   DA  I "C5'" 1 
ATOM   8746  C  "C4'" . DA  I 5 132 ? -56.094 -31.721 45.569 1.00 90.95  ? 59   DA  I "C4'" 1 
ATOM   8747  O  "O4'" . DA  I 5 132 ? -57.244 -32.611 45.581 1.00 92.01  ? 59   DA  I "O4'" 1 
ATOM   8748  C  "C3'" . DA  I 5 132 ? -55.987 -31.182 46.995 1.00 91.97  ? 59   DA  I "C3'" 1 
ATOM   8749  O  "O3'" . DA  I 5 132 ? -56.632 -29.912 47.060 1.00 92.27  ? 59   DA  I "O3'" 1 
ATOM   8750  C  "C2'" . DA  I 5 132 ? -56.707 -32.222 47.859 1.00 92.32  ? 59   DA  I "C2'" 1 
ATOM   8751  C  "C1'" . DA  I 5 132 ? -57.667 -32.921 46.901 1.00 92.66  ? 59   DA  I "C1'" 1 
ATOM   8752  N  N9    . DA  I 5 132 ? -57.637 -34.380 46.979 1.00 93.10  ? 59   DA  I N9    1 
ATOM   8753  C  C8    . DA  I 5 132 ? -56.684 -35.163 47.583 1.00 93.16  ? 59   DA  I C8    1 
ATOM   8754  N  N7    . DA  I 5 132 ? -56.899 -36.452 47.482 1.00 93.10  ? 59   DA  I N7    1 
ATOM   8755  C  C5    . DA  I 5 132 ? -58.072 -36.520 46.744 1.00 93.55  ? 59   DA  I C5    1 
ATOM   8756  C  C6    . DA  I 5 132 ? -58.838 -37.616 46.290 1.00 93.50  ? 59   DA  I C6    1 
ATOM   8757  N  N6    . DA  I 5 132 ? -58.488 -38.891 46.543 1.00 93.19  ? 59   DA  I N6    1 
ATOM   8758  N  N1    . DA  I 5 132 ? -59.963 -37.344 45.581 1.00 92.91  ? 59   DA  I N1    1 
ATOM   8759  C  C2    . DA  I 5 132 ? -60.296 -36.068 45.349 1.00 92.75  ? 59   DA  I C2    1 
ATOM   8760  N  N3    . DA  I 5 132 ? -59.657 -34.962 45.723 1.00 92.89  ? 59   DA  I N3    1 
ATOM   8761  C  C4    . DA  I 5 132 ? -58.544 -35.256 46.423 1.00 93.25  ? 59   DA  I C4    1 
ATOM   8762  P  P     . DG  I 5 133 ? -56.622 -29.022 48.388 1.00 92.86  ? 60   DG  I P     1 
ATOM   8763  O  OP1   . DG  I 5 133 ? -56.600 -27.603 47.955 1.00 92.99  ? 60   DG  I OP1   1 
ATOM   8764  O  OP2   . DG  I 5 133 ? -55.617 -29.535 49.347 1.00 91.78  ? 60   DG  I OP2   1 
ATOM   8765  O  "O5'" . DG  I 5 133 ? -58.043 -29.338 49.027 1.00 93.82  ? 60   DG  I "O5'" 1 
ATOM   8766  C  "C5'" . DG  I 5 133 ? -59.259 -29.033 48.361 1.00 95.33  ? 60   DG  I "C5'" 1 
ATOM   8767  C  "C4'" . DG  I 5 133 ? -60.365 -29.814 49.044 1.00 96.51  ? 60   DG  I "C4'" 1 
ATOM   8768  O  "O4'" . DG  I 5 133 ? -60.145 -31.232 48.817 1.00 96.78  ? 60   DG  I "O4'" 1 
ATOM   8769  C  "C3'" . DG  I 5 133 ? -60.430 -29.633 50.562 1.00 97.42  ? 60   DG  I "C3'" 1 
ATOM   8770  O  "O3'" . DG  I 5 133 ? -61.776 -29.338 50.941 1.00 99.43  ? 60   DG  I "O3'" 1 
ATOM   8771  C  "C2'" . DG  I 5 133 ? -59.936 -30.972 51.114 1.00 96.85  ? 60   DG  I "C2'" 1 
ATOM   8772  C  "C1'" . DG  I 5 133 ? -60.433 -31.912 50.020 1.00 96.61  ? 60   DG  I "C1'" 1 
ATOM   8773  N  N9    . DG  I 5 133 ? -59.861 -33.265 50.007 1.00 96.51  ? 60   DG  I N9    1 
ATOM   8774  C  C8    . DG  I 5 133 ? -58.632 -33.688 50.463 1.00 96.49  ? 60   DG  I C8    1 
ATOM   8775  N  N7    . DG  I 5 133 ? -58.422 -34.968 50.316 1.00 96.31  ? 60   DG  I N7    1 
ATOM   8776  C  C5    . DG  I 5 133 ? -59.590 -35.429 49.728 1.00 96.30  ? 60   DG  I C5    1 
ATOM   8777  C  C6    . DG  I 5 133 ? -59.957 -36.737 49.333 1.00 96.21  ? 60   DG  I C6    1 
ATOM   8778  O  O6    . DG  I 5 133 ? -59.292 -37.777 49.423 1.00 96.26  ? 60   DG  I O6    1 
ATOM   8779  N  N1    . DG  I 5 133 ? -61.234 -36.773 48.774 1.00 96.40  ? 60   DG  I N1    1 
ATOM   8780  C  C2    . DG  I 5 133 ? -62.055 -35.675 48.622 1.00 96.52  ? 60   DG  I C2    1 
ATOM   8781  N  N2    . DG  I 5 133 ? -63.255 -35.891 48.063 1.00 96.60  ? 60   DG  I N2    1 
ATOM   8782  N  N3    . DG  I 5 133 ? -61.725 -34.445 48.993 1.00 96.07  ? 60   DG  I N3    1 
ATOM   8783  C  C4    . DG  I 5 133 ? -60.483 -34.395 49.534 1.00 96.26  ? 60   DG  I C4    1 
ATOM   8784  P  P     . DG  I 5 134 ? -62.193 -28.903 52.430 1.00 100.95 ? 61   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5 134 ? -63.526 -28.277 52.304 1.00 101.39 ? 61   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5 134 ? -61.089 -28.135 53.045 1.00 100.52 ? 61   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5 134 ? -62.315 -30.297 53.222 1.00 102.57 ? 61   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5 134 ? -63.504 -30.691 53.927 1.00 104.97 ? 61   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5 134 ? -64.522 -31.369 53.019 1.00 106.38 ? 61   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5 134 ? -63.838 -32.027 51.925 1.00 106.84 ? 61   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5 134 ? -65.361 -32.446 53.688 1.00 107.59 ? 61   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5 134 ? -66.607 -31.909 54.090 1.00 109.68 ? 61   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5 134 ? -65.563 -33.493 52.600 1.00 107.48 ? 61   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5 134 ? -64.283 -33.364 51.781 1.00 106.83 ? 61   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5 134 ? -63.198 -34.284 52.146 1.00 106.65 ? 61   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5 134 ? -61.970 -33.948 52.669 1.00 106.54 ? 61   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5 134 ? -61.190 -34.969 52.886 1.00 106.46 ? 61   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5 134 ? -61.945 -36.059 52.479 1.00 106.45 ? 61   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5 134 ? -61.623 -37.437 52.477 1.00 106.48 ? 61   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5 134 ? -60.573 -37.975 52.850 1.00 106.62 ? 61   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5 134 ? -62.663 -38.224 51.982 1.00 106.59 ? 61   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5 134 ? -63.871 -37.734 51.543 1.00 106.59 ? 61   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5 134 ? -64.754 -38.641 51.104 1.00 106.50 ? 61   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5 134 ? -64.186 -36.442 51.538 1.00 106.69 ? 61   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5 134 ? -63.181 -35.659 52.017 1.00 106.58 ? 61   DG  I C4    1 
ATOM   8806  P  P     . DT  I 5 135 ? -67.086 -32.079 55.607 1.00 111.53 ? 62   DT  I P     1 
ATOM   8807  O  OP1   . DT  I 5 135 ? -68.311 -31.268 55.794 1.00 111.09 ? 62   DT  I OP1   1 
ATOM   8808  O  OP2   . DT  I 5 135 ? -65.907 -31.843 56.470 1.00 111.69 ? 62   DT  I OP2   1 
ATOM   8809  O  "O5'" . DT  I 5 135 ? -67.470 -33.630 55.709 1.00 112.60 ? 62   DT  I "O5'" 1 
ATOM   8810  C  "C5'" . DT  I 5 135 ? -68.617 -34.139 55.029 1.00 114.35 ? 62   DT  I "C5'" 1 
ATOM   8811  C  "C4'" . DT  I 5 135 ? -68.541 -35.650 54.916 1.00 115.61 ? 62   DT  I "C4'" 1 
ATOM   8812  O  "O4'" . DT  I 5 135 ? -67.355 -36.016 54.165 1.00 115.97 ? 62   DT  I "O4'" 1 
ATOM   8813  C  "C3'" . DT  I 5 135 ? -68.401 -36.378 56.244 1.00 116.20 ? 62   DT  I "C3'" 1 
ATOM   8814  O  "O3'" . DT  I 5 135 ? -69.688 -36.626 56.794 1.00 117.32 ? 62   DT  I "O3'" 1 
ATOM   8815  C  "C2'" . DT  I 5 135 ? -67.685 -37.662 55.835 1.00 116.07 ? 62   DT  I "C2'" 1 
ATOM   8816  C  "C1'" . DT  I 5 135 ? -66.775 -37.189 54.713 1.00 115.87 ? 62   DT  I "C1'" 1 
ATOM   8817  N  N1    . DT  I 5 135 ? -65.357 -36.931 55.151 1.00 115.71 ? 62   DT  I N1    1 
ATOM   8818  C  C2    . DT  I 5 135 ? -64.456 -37.985 55.140 1.00 115.56 ? 62   DT  I C2    1 
ATOM   8819  O  O2    . DT  I 5 135 ? -64.739 -39.120 54.801 1.00 115.47 ? 62   DT  I O2    1 
ATOM   8820  N  N3    . DT  I 5 135 ? -63.186 -37.657 55.547 1.00 115.74 ? 62   DT  I N3    1 
ATOM   8821  C  C4    . DT  I 5 135 ? -62.732 -36.410 55.956 1.00 115.86 ? 62   DT  I C4    1 
ATOM   8822  O  O4    . DT  I 5 135 ? -61.567 -36.233 56.301 1.00 115.79 ? 62   DT  I O4    1 
ATOM   8823  C  C5    . DT  I 5 135 ? -63.720 -35.349 55.948 1.00 115.80 ? 62   DT  I C5    1 
ATOM   8824  C  C7    . DT  I 5 135 ? -63.353 -33.953 56.372 1.00 115.61 ? 62   DT  I C7    1 
ATOM   8825  C  C6    . DT  I 5 135 ? -64.966 -35.659 55.551 1.00 115.67 ? 62   DT  I C6    1 
ATOM   8826  P  P     . DG  I 5 136 ? -69.872 -37.596 58.056 1.00 118.15 ? 63   DG  I P     1 
ATOM   8827  O  OP1   . DG  I 5 136 ? -71.253 -37.418 58.561 1.00 118.41 ? 63   DG  I OP1   1 
ATOM   8828  O  OP2   . DG  I 5 136 ? -68.734 -37.371 58.983 1.00 117.79 ? 63   DG  I OP2   1 
ATOM   8829  O  "O5'" . DG  I 5 136 ? -69.740 -39.046 57.375 1.00 117.61 ? 63   DG  I "O5'" 1 
ATOM   8830  C  "C5'" . DG  I 5 136 ? -70.293 -40.224 57.960 1.00 117.23 ? 63   DG  I "C5'" 1 
ATOM   8831  C  "C4'" . DG  I 5 136 ? -69.331 -40.849 58.954 1.00 116.90 ? 63   DG  I "C4'" 1 
ATOM   8832  O  "O4'" . DG  I 5 136 ? -67.973 -40.683 58.477 1.00 116.75 ? 63   DG  I "O4'" 1 
ATOM   8833  C  "C3'" . DG  I 5 136 ? -69.363 -40.221 60.352 1.00 116.75 ? 63   DG  I "C3'" 1 
ATOM   8834  O  "O3'" . DG  I 5 136 ? -70.159 -41.013 61.272 1.00 116.58 ? 63   DG  I "O3'" 1 
ATOM   8835  C  "C2'" . DG  I 5 136 ? -67.893 -40.015 60.742 1.00 116.58 ? 63   DG  I "C2'" 1 
ATOM   8836  C  "C1'" . DG  I 5 136 ? -67.116 -40.685 59.602 1.00 116.17 ? 63   DG  I "C1'" 1 
ATOM   8837  N  N9    . DG  I 5 136 ? -65.823 -40.074 59.247 1.00 115.94 ? 63   DG  I N9    1 
ATOM   8838  C  C8    . DG  I 5 136 ? -65.477 -38.741 59.267 1.00 115.71 ? 63   DG  I C8    1 
ATOM   8839  N  N7    . DG  I 5 136 ? -64.246 -38.514 58.902 1.00 115.64 ? 63   DG  I N7    1 
ATOM   8840  C  C5    . DG  I 5 136 ? -63.736 -39.776 58.619 1.00 115.67 ? 63   DG  I C5    1 
ATOM   8841  C  C6    . DG  I 5 136 ? -62.448 -40.175 58.174 1.00 115.65 ? 63   DG  I C6    1 
ATOM   8842  O  O6    . DG  I 5 136 ? -61.469 -39.465 57.930 1.00 115.91 ? 63   DG  I O6    1 
ATOM   8843  N  N1    . DG  I 5 136 ? -62.335 -41.552 58.010 1.00 115.56 ? 63   DG  I N1    1 
ATOM   8844  C  C2    . DG  I 5 136 ? -63.349 -42.446 58.245 1.00 115.69 ? 63   DG  I C2    1 
ATOM   8845  N  N2    . DG  I 5 136 ? -63.063 -43.738 58.031 1.00 115.74 ? 63   DG  I N2    1 
ATOM   8846  N  N3    . DG  I 5 136 ? -64.562 -42.090 58.660 1.00 115.86 ? 63   DG  I N3    1 
ATOM   8847  C  C4    . DG  I 5 136 ? -64.691 -40.745 58.827 1.00 115.83 ? 63   DG  I C4    1 
ATOM   8848  P  P     . DG  I 5 137 ? -69.685 -42.318 62.088 1.00 116.26 ? 64   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5 137 ? -70.913 -43.035 62.492 1.00 116.21 ? 64   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5 137 ? -68.744 -41.849 63.130 1.00 115.81 ? 64   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5 137 ? -68.919 -43.263 61.038 1.00 115.43 ? 64   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5 137 ? -68.823 -44.674 61.265 1.00 113.88 ? 64   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5 137 ? -67.570 -45.007 62.055 1.00 112.90 ? 64   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5 137 ? -66.523 -44.082 61.662 1.00 112.74 ? 64   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5 137 ? -67.716 -44.876 63.574 1.00 112.31 ? 64   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5 137 ? -67.688 -46.172 64.215 1.00 111.77 ? 64   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5 137 ? -66.604 -43.914 64.010 1.00 112.39 ? 64   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5 137 ? -65.702 -43.804 62.780 1.00 112.10 ? 64   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5 137 ? -65.060 -42.494 62.612 1.00 111.87 ? 64   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5 137 ? -65.615 -41.261 62.866 1.00 111.83 ? 64   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5 137 ? -64.819 -40.257 62.629 1.00 111.90 ? 64   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5 137 ? -63.646 -40.859 62.191 1.00 111.94 ? 64   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5 137 ? -62.419 -40.272 61.786 1.00 111.88 ? 64   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5 137 ? -62.128 -39.067 61.737 1.00 111.77 ? 64   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5 137 ? -61.479 -41.234 61.412 1.00 111.75 ? 64   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5 137 ? -61.701 -42.593 61.430 1.00 111.71 ? 64   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5 137 ? -60.681 -43.365 61.039 1.00 111.72 ? 64   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5 137 ? -62.845 -43.156 61.808 1.00 111.68 ? 64   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5 137 ? -63.776 -42.236 62.174 1.00 111.81 ? 64   DG  I C4    1 
ATOM   8870  P  P     . DA  I 5 138 ? -66.402 -46.890 64.875 1.00 111.42 ? 65   DA  I P     1 
ATOM   8871  O  OP1   . DA  I 5 138 ? -66.788 -48.298 65.130 1.00 111.55 ? 65   DA  I OP1   1 
ATOM   8872  O  OP2   . DA  I 5 138 ? -65.930 -46.069 66.015 1.00 111.21 ? 65   DA  I OP2   1 
ATOM   8873  O  "O5'" . DA  I 5 138 ? -65.289 -46.848 63.718 1.00 109.91 ? 65   DA  I "O5'" 1 
ATOM   8874  C  "C5'" . DA  I 5 138 ? -64.631 -48.022 63.249 1.00 107.48 ? 65   DA  I "C5'" 1 
ATOM   8875  C  "C4'" . DA  I 5 138 ? -63.153 -47.977 63.587 1.00 105.74 ? 65   DA  I "C4'" 1 
ATOM   8876  O  "O4'" . DA  I 5 138 ? -62.646 -46.627 63.394 1.00 105.62 ? 65   DA  I "O4'" 1 
ATOM   8877  C  "C3'" . DA  I 5 138 ? -62.820 -48.368 65.021 1.00 104.72 ? 65   DA  I "C3'" 1 
ATOM   8878  O  "O3'" . DA  I 5 138 ? -61.726 -49.290 65.023 1.00 103.81 ? 65   DA  I "O3'" 1 
ATOM   8879  C  "C2'" . DA  I 5 138 ? -62.465 -47.040 65.688 1.00 104.79 ? 65   DA  I "C2'" 1 
ATOM   8880  C  "C1'" . DA  I 5 138 ? -61.898 -46.229 64.527 1.00 104.58 ? 65   DA  I "C1'" 1 
ATOM   8881  N  N9    . DA  I 5 138 ? -62.013 -44.780 64.725 1.00 104.31 ? 65   DA  I N9    1 
ATOM   8882  C  C8    . DA  I 5 138 ? -63.131 -44.090 65.113 1.00 104.16 ? 65   DA  I C8    1 
ATOM   8883  N  N7    . DA  I 5 138 ? -62.962 -42.795 65.226 1.00 104.02 ? 65   DA  I N7    1 
ATOM   8884  C  C5    . DA  I 5 138 ? -61.633 -42.618 64.889 1.00 104.12 ? 65   DA  I C5    1 
ATOM   8885  C  C6    . DA  I 5 138 ? -60.831 -41.461 64.814 1.00 103.99 ? 65   DA  I C6    1 
ATOM   8886  N  N6    . DA  I 5 138 ? -61.295 -40.240 65.088 1.00 103.95 ? 65   DA  I N6    1 
ATOM   8887  N  N1    . DA  I 5 138 ? -59.538 -41.617 64.449 1.00 103.98 ? 65   DA  I N1    1 
ATOM   8888  C  C2    . DA  I 5 138 ? -59.084 -42.852 64.174 1.00 104.07 ? 65   DA  I C2    1 
ATOM   8889  N  N3    . DA  I 5 138 ? -59.743 -44.016 64.210 1.00 104.04 ? 65   DA  I N3    1 
ATOM   8890  C  C4    . DA  I 5 138 ? -61.027 -43.829 64.579 1.00 104.24 ? 65   DA  I C4    1 
ATOM   8891  P  P     . DT  I 5 139 ? -61.055 -49.808 66.388 1.00 103.34 ? 66   DT  I P     1 
ATOM   8892  O  OP1   . DT  I 5 139 ? -60.620 -51.210 66.199 1.00 103.62 ? 66   DT  I OP1   1 
ATOM   8893  O  OP2   . DT  I 5 139 ? -61.922 -49.438 67.532 1.00 102.92 ? 66   DT  I OP2   1 
ATOM   8894  O  "O5'" . DT  I 5 139 ? -59.739 -48.919 66.471 1.00 102.34 ? 66   DT  I "O5'" 1 
ATOM   8895  C  "C5'" . DT  I 5 139 ? -58.650 -49.163 65.590 1.00 99.78  ? 66   DT  I "C5'" 1 
ATOM   8896  C  "C4'" . DT  I 5 139 ? -57.536 -48.203 65.945 1.00 97.86  ? 66   DT  I "C4'" 1 
ATOM   8897  O  "O4'" . DT  I 5 139 ? -58.061 -46.849 65.963 1.00 97.33  ? 66   DT  I "O4'" 1 
ATOM   8898  C  "C3'" . DT  I 5 139 ? -56.892 -48.441 67.309 1.00 96.42  ? 66   DT  I "C3'" 1 
ATOM   8899  O  "O3'" . DT  I 5 139 ? -55.506 -48.523 67.044 1.00 95.08  ? 66   DT  I "O3'" 1 
ATOM   8900  C  "C2'" . DT  I 5 139 ? -57.293 -47.220 68.143 1.00 95.86  ? 66   DT  I "C2'" 1 
ATOM   8901  C  "C1'" . DT  I 5 139 ? -57.488 -46.165 67.060 1.00 95.84  ? 66   DT  I "C1'" 1 
ATOM   8902  N  N1    . DT  I 5 139 ? -58.363 -44.993 67.406 1.00 95.40  ? 66   DT  I N1    1 
ATOM   8903  C  C2    . DT  I 5 139 ? -57.825 -43.719 67.322 1.00 95.10  ? 66   DT  I C2    1 
ATOM   8904  O  O2    . DT  I 5 139 ? -56.670 -43.485 66.991 1.00 94.83  ? 66   DT  I O2    1 
ATOM   8905  N  N3    . DT  I 5 139 ? -58.702 -42.710 67.647 1.00 94.97  ? 66   DT  I N3    1 
ATOM   8906  C  C4    . DT  I 5 139 ? -60.026 -42.835 68.030 1.00 94.97  ? 66   DT  I C4    1 
ATOM   8907  O  O4    . DT  I 5 139 ? -60.710 -41.852 68.297 1.00 94.98  ? 66   DT  I O4    1 
ATOM   8908  C  C5    . DT  I 5 139 ? -60.524 -44.191 68.092 1.00 94.90  ? 66   DT  I C5    1 
ATOM   8909  C  C7    . DT  I 5 139 ? -61.942 -44.472 68.496 1.00 95.24  ? 66   DT  I C7    1 
ATOM   8910  C  C6    . DT  I 5 139 ? -59.683 -45.190 67.779 1.00 95.10  ? 66   DT  I C6    1 
ATOM   8911  P  P     . DA  I 5 140 ? -54.347 -48.745 68.128 1.00 94.62  ? 67   DA  I P     1 
ATOM   8912  O  OP1   . DA  I 5 140 ? -53.821 -50.122 67.962 1.00 94.19  ? 67   DA  I OP1   1 
ATOM   8913  O  OP2   . DA  I 5 140 ? -54.785 -48.271 69.466 1.00 94.54  ? 67   DA  I OP2   1 
ATOM   8914  O  "O5'" . DA  I 5 140 ? -53.268 -47.703 67.562 1.00 93.14  ? 67   DA  I "O5'" 1 
ATOM   8915  C  "C5'" . DA  I 5 140 ? -53.719 -46.565 66.801 1.00 90.17  ? 67   DA  I "C5'" 1 
ATOM   8916  C  "C4'" . DA  I 5 140 ? -52.917 -45.314 67.114 1.00 87.88  ? 67   DA  I "C4'" 1 
ATOM   8917  O  "O4'" . DA  I 5 140 ? -53.773 -44.218 67.541 1.00 86.82  ? 67   DA  I "O4'" 1 
ATOM   8918  C  "C3'" . DA  I 5 140 ? -51.868 -45.456 68.205 1.00 86.61  ? 67   DA  I "C3'" 1 
ATOM   8919  O  "O3'" . DA  I 5 140 ? -50.777 -44.639 67.793 1.00 85.76  ? 67   DA  I "O3'" 1 
ATOM   8920  C  "C2'" . DA  I 5 140 ? -52.612 -44.968 69.450 1.00 86.23  ? 67   DA  I "C2'" 1 
ATOM   8921  C  "C1'" . DA  I 5 140 ? -53.477 -43.850 68.877 1.00 85.55  ? 67   DA  I "C1'" 1 
ATOM   8922  N  N9    . DA  I 5 140 ? -54.756 -43.582 69.541 1.00 85.12  ? 67   DA  I N9    1 
ATOM   8923  C  C8    . DA  I 5 140 ? -55.702 -44.476 69.952 1.00 84.65  ? 67   DA  I C8    1 
ATOM   8924  N  N7    . DA  I 5 140 ? -56.753 -43.906 70.491 1.00 84.66  ? 67   DA  I N7    1 
ATOM   8925  C  C5    . DA  I 5 140 ? -56.488 -42.548 70.430 1.00 84.61  ? 67   DA  I C5    1 
ATOM   8926  C  C6    . DA  I 5 140 ? -57.202 -41.391 70.833 1.00 84.90  ? 67   DA  I C6    1 
ATOM   8927  N  N6    . DA  I 5 140 ? -58.403 -41.401 71.413 1.00 84.99  ? 67   DA  I N6    1 
ATOM   8928  N  N1    . DA  I 5 140 ? -56.640 -40.185 70.621 1.00 85.17  ? 67   DA  I N1    1 
ATOM   8929  C  C2    . DA  I 5 140 ? -55.436 -40.138 70.037 1.00 85.23  ? 67   DA  I C2    1 
ATOM   8930  N  N3    . DA  I 5 140 ? -54.673 -41.147 69.613 1.00 85.07  ? 67   DA  I N3    1 
ATOM   8931  C  C4    . DA  I 5 140 ? -55.258 -42.336 69.842 1.00 84.83  ? 67   DA  I C4    1 
ATOM   8932  P  P     . DT  I 5 141 ? -49.469 -44.407 68.674 1.00 84.38  ? 68   DT  I P     1 
ATOM   8933  O  OP1   . DT  I 5 141 ? -48.396 -43.986 67.747 1.00 84.89  ? 68   DT  I OP1   1 
ATOM   8934  O  OP2   . DT  I 5 141 ? -49.277 -45.584 69.552 1.00 84.13  ? 68   DT  I OP2   1 
ATOM   8935  O  "O5'" . DT  I 5 141 ? -49.885 -43.133 69.543 1.00 83.27  ? 68   DT  I "O5'" 1 
ATOM   8936  C  "C5'" . DT  I 5 141 ? -50.326 -41.958 68.854 1.00 81.36  ? 68   DT  I "C5'" 1 
ATOM   8937  C  "C4'" . DT  I 5 141 ? -49.927 -40.674 69.567 1.00 80.09  ? 68   DT  I "C4'" 1 
ATOM   8938  O  "O4'" . DT  I 5 141 ? -51.076 -40.068 70.217 1.00 79.93  ? 68   DT  I "O4'" 1 
ATOM   8939  C  "C3'" . DT  I 5 141 ? -48.853 -40.743 70.647 1.00 79.21  ? 68   DT  I "C3'" 1 
ATOM   8940  O  "O3'" . DT  I 5 141 ? -48.112 -39.526 70.497 1.00 78.43  ? 68   DT  I "O3'" 1 
ATOM   8941  C  "C2'" . DT  I 5 141 ? -49.665 -40.879 71.941 1.00 78.72  ? 68   DT  I "C2'" 1 
ATOM   8942  C  "C1'" . DT  I 5 141 ? -50.930 -40.078 71.625 1.00 78.71  ? 68   DT  I "C1'" 1 
ATOM   8943  N  N1    . DT  I 5 141 ? -52.229 -40.593 72.184 1.00 78.44  ? 68   DT  I N1    1 
ATOM   8944  C  C2    . DT  I 5 141 ? -53.248 -39.689 72.473 1.00 78.31  ? 68   DT  I C2    1 
ATOM   8945  O  O2    . DT  I 5 141 ? -53.175 -38.479 72.311 1.00 77.63  ? 68   DT  I O2    1 
ATOM   8946  N  N3    . DT  I 5 141 ? -54.393 -40.266 72.972 1.00 78.40  ? 68   DT  I N3    1 
ATOM   8947  C  C4    . DT  I 5 141 ? -54.624 -41.610 73.201 1.00 78.23  ? 68   DT  I C4    1 
ATOM   8948  O  O4    . DT  I 5 141 ? -55.700 -41.991 73.646 1.00 77.93  ? 68   DT  I O4    1 
ATOM   8949  C  C5    . DT  I 5 141 ? -53.522 -42.498 72.880 1.00 77.94  ? 68   DT  I C5    1 
ATOM   8950  C  C7    . DT  I 5 141 ? -53.622 -43.981 73.081 1.00 77.81  ? 68   DT  I C7    1 
ATOM   8951  C  C6    . DT  I 5 141 ? -52.400 -41.953 72.386 1.00 78.00  ? 68   DT  I C6    1 
ATOM   8952  P  P     . DT  I 5 142 ? -47.229 -38.826 71.628 1.00 77.85  ? 69   DT  I P     1 
ATOM   8953  O  OP1   . DT  I 5 142 ? -46.411 -37.788 70.977 1.00 78.13  ? 69   DT  I OP1   1 
ATOM   8954  O  OP2   . DT  I 5 142 ? -46.581 -39.882 72.440 1.00 78.29  ? 69   DT  I OP2   1 
ATOM   8955  O  "O5'" . DT  I 5 142 ? -48.324 -38.083 72.523 1.00 78.08  ? 69   DT  I "O5'" 1 
ATOM   8956  C  "C5'" . DT  I 5 142 ? -48.653 -36.723 72.307 1.00 77.67  ? 69   DT  I "C5'" 1 
ATOM   8957  C  "C4'" . DT  I 5 142 ? -49.528 -36.250 73.448 1.00 77.96  ? 69   DT  I "C4'" 1 
ATOM   8958  O  "O4'" . DT  I 5 142 ? -50.508 -37.275 73.731 1.00 77.89  ? 69   DT  I "O4'" 1 
ATOM   8959  C  "C3'" . DT  I 5 142 ? -48.789 -36.007 74.761 1.00 78.07  ? 69   DT  I "C3'" 1 
ATOM   8960  O  "O3'" . DT  I 5 142 ? -49.135 -34.726 75.244 1.00 78.38  ? 69   DT  I "O3'" 1 
ATOM   8961  C  "C2'" . DT  I 5 142 ? -49.299 -37.102 75.694 1.00 78.03  ? 69   DT  I "C2'" 1 
ATOM   8962  C  "C1'" . DT  I 5 142 ? -50.689 -37.329 75.125 1.00 78.26  ? 69   DT  I "C1'" 1 
ATOM   8963  N  N1    . DT  I 5 142 ? -51.340 -38.628 75.471 1.00 78.32  ? 69   DT  I N1    1 
ATOM   8964  C  C2    . DT  I 5 142 ? -52.636 -38.605 75.951 1.00 78.45  ? 69   DT  I C2    1 
ATOM   8965  O  O2    . DT  I 5 142 ? -53.290 -37.586 76.120 1.00 78.60  ? 69   DT  I O2    1 
ATOM   8966  N  N3    . DT  I 5 142 ? -53.153 -39.840 76.234 1.00 78.33  ? 69   DT  I N3    1 
ATOM   8967  C  C4    . DT  I 5 142 ? -52.530 -41.063 76.092 1.00 78.66  ? 69   DT  I C4    1 
ATOM   8968  O  O4    . DT  I 5 142 ? -53.106 -42.107 76.384 1.00 79.06  ? 69   DT  I O4    1 
ATOM   8969  C  C5    . DT  I 5 142 ? -51.175 -41.020 75.586 1.00 78.70  ? 69   DT  I C5    1 
ATOM   8970  C  C7    . DT  I 5 142 ? -50.385 -42.288 75.392 1.00 78.46  ? 69   DT  I C7    1 
ATOM   8971  C  C6    . DT  I 5 142 ? -50.657 -39.817 75.300 1.00 78.35  ? 69   DT  I C6    1 
ATOM   8972  P  P     . DG  I 5 143 ? -48.220 -33.961 76.303 1.00 78.28  ? 70   DG  I P     1 
ATOM   8973  O  OP1   . DG  I 5 143 ? -47.781 -32.708 75.663 1.00 78.44  ? 70   DG  I OP1   1 
ATOM   8974  O  OP2   . DG  I 5 143 ? -47.254 -34.916 76.885 1.00 78.63  ? 70   DG  I OP2   1 
ATOM   8975  O  "O5'" . DG  I 5 143 ? -49.214 -33.552 77.476 1.00 80.31  ? 70   DG  I "O5'" 1 
ATOM   8976  C  "C5'" . DG  I 5 143 ? -50.629 -33.417 77.293 1.00 82.24  ? 70   DG  I "C5'" 1 
ATOM   8977  C  "C4'" . DG  I 5 143 ? -51.368 -33.903 78.534 1.00 83.78  ? 70   DG  I "C4'" 1 
ATOM   8978  O  "O4'" . DG  I 5 143 ? -51.694 -35.319 78.428 1.00 83.87  ? 70   DG  I "O4'" 1 
ATOM   8979  C  "C3'" . DG  I 5 143 ? -50.600 -33.759 79.845 1.00 84.86  ? 70   DG  I "C3'" 1 
ATOM   8980  O  "O3'" . DG  I 5 143 ? -51.472 -33.259 80.846 1.00 86.90  ? 70   DG  I "O3'" 1 
ATOM   8981  C  "C2'" . DG  I 5 143 ? -50.130 -35.180 80.150 1.00 83.97  ? 70   DG  I "C2'" 1 
ATOM   8982  C  "C1'" . DG  I 5 143 ? -51.356 -35.935 79.656 1.00 83.83  ? 70   DG  I "C1'" 1 
ATOM   8983  N  N9    . DG  I 5 143 ? -51.213 -37.383 79.487 1.00 83.93  ? 70   DG  I N9    1 
ATOM   8984  C  C8    . DG  I 5 143 ? -50.106 -38.126 79.125 1.00 83.87  ? 70   DG  I C8    1 
ATOM   8985  N  N7    . DG  I 5 143 ? -50.334 -39.413 79.074 1.00 83.88  ? 70   DG  I N7    1 
ATOM   8986  C  C5    . DG  I 5 143 ? -51.678 -39.531 79.427 1.00 83.91  ? 70   DG  I C5    1 
ATOM   8987  C  C6    . DG  I 5 143 ? -52.511 -40.676 79.550 1.00 83.55  ? 70   DG  I C6    1 
ATOM   8988  O  O6    . DG  I 5 143 ? -52.205 -41.861 79.363 1.00 83.50  ? 70   DG  I O6    1 
ATOM   8989  N  N1    . DG  I 5 143 ? -53.814 -40.340 79.937 1.00 83.71  ? 70   DG  I N1    1 
ATOM   8990  C  C2    . DG  I 5 143 ? -54.251 -39.049 80.169 1.00 83.90  ? 70   DG  I C2    1 
ATOM   8991  N  N2    . DG  I 5 143 ? -55.528 -38.881 80.529 1.00 83.96  ? 70   DG  I N2    1 
ATOM   8992  N  N3    . DG  I 5 143 ? -53.488 -37.973 80.057 1.00 83.70  ? 70   DG  I N3    1 
ATOM   8993  C  C4    . DG  I 5 143 ? -52.224 -38.289 79.684 1.00 83.83  ? 70   DG  I C4    1 
ATOM   8994  P  P     . DA  I 5 144 ? -50.853 -32.426 82.065 1.00 89.08  ? 71   DA  I P     1 
ATOM   8995  O  OP1   . DA  I 5 144 ? -50.447 -31.113 81.500 1.00 88.83  ? 71   DA  I OP1   1 
ATOM   8996  O  OP2   . DA  I 5 144 ? -49.843 -33.258 82.778 1.00 88.14  ? 71   DA  I OP2   1 
ATOM   8997  O  "O5'" . DA  I 5 144 ? -52.106 -32.245 83.055 1.00 88.49  ? 71   DA  I "O5'" 1 
ATOM   8998  C  "C5'" . DA  I 5 144 ? -53.470 -32.144 82.616 1.00 88.25  ? 71   DA  I "C5'" 1 
ATOM   8999  C  "C4'" . DA  I 5 144 ? -54.339 -33.112 83.404 1.00 87.94  ? 71   DA  I "C4'" 1 
ATOM   9000  O  "O4'" . DA  I 5 144 ? -54.117 -34.444 82.870 1.00 87.20  ? 71   DA  I "O4'" 1 
ATOM   9001  C  "C3'" . DA  I 5 144 ? -54.025 -33.181 84.904 1.00 88.53  ? 71   DA  I "C3'" 1 
ATOM   9002  O  "O3'" . DA  I 5 144 ? -55.180 -32.930 85.746 1.00 89.92  ? 71   DA  I "O3'" 1 
ATOM   9003  C  "C2'" . DA  I 5 144 ? -53.450 -34.584 85.107 1.00 87.17  ? 71   DA  I "C2'" 1 
ATOM   9004  C  "C1'" . DA  I 5 144 ? -54.013 -35.363 83.929 1.00 85.49  ? 71   DA  I "C1'" 1 
ATOM   9005  N  N9    . DA  I 5 144 ? -53.121 -36.439 83.535 1.00 84.93  ? 71   DA  I N9    1 
ATOM   9006  C  C8    . DA  I 5 144 ? -51.806 -36.331 83.192 1.00 84.77  ? 71   DA  I C8    1 
ATOM   9007  N  N7    . DA  I 5 144 ? -51.240 -37.474 82.891 1.00 84.93  ? 71   DA  I N7    1 
ATOM   9008  C  C5    . DA  I 5 144 ? -52.257 -38.396 83.053 1.00 84.77  ? 71   DA  I C5    1 
ATOM   9009  C  C6    . DA  I 5 144 ? -52.309 -39.794 82.890 1.00 84.62  ? 71   DA  I C6    1 
ATOM   9010  N  N6    . DA  I 5 144 ? -51.264 -40.533 82.514 1.00 84.74  ? 71   DA  I N6    1 
ATOM   9011  N  N1    . DA  I 5 144 ? -53.480 -40.408 83.137 1.00 84.69  ? 71   DA  I N1    1 
ATOM   9012  C  C2    . DA  I 5 144 ? -54.529 -39.675 83.524 1.00 84.76  ? 71   DA  I C2    1 
ATOM   9013  N  N3    . DA  I 5 144 ? -54.602 -38.361 83.708 1.00 84.66  ? 71   DA  I N3    1 
ATOM   9014  C  C4    . DA  I 5 144 ? -53.423 -37.775 83.454 1.00 84.84  ? 71   DA  I C4    1 
ATOM   9015  P  P     . DT  I 5 145 ? -55.044 -32.713 87.345 1.00 90.39  ? 72   DT  I P     1 
ATOM   9016  O  OP1   . DT  I 5 145 ? -55.569 -31.357 87.615 1.00 89.91  ? 72   DT  I OP1   1 
ATOM   9017  O  OP2   . DT  I 5 145 ? -53.668 -33.049 87.797 1.00 89.62  ? 72   DT  I OP2   1 
ATOM   9018  O  "O5'" . DT  I 5 145 ? -56.048 -33.806 87.976 1.00 90.92  ? 72   DT  I "O5'" 1 
ATOM   9019  C  "C5'" . DT  I 5 145 ? -56.426 -35.017 87.281 1.00 91.84  ? 72   DT  I "C5'" 1 
ATOM   9020  C  "C4'" . DT  I 5 145 ? -56.263 -36.307 88.087 1.00 92.08  ? 72   DT  I "C4'" 1 
ATOM   9021  O  "O4'" . DT  I 5 145 ? -55.681 -37.344 87.253 1.00 92.09  ? 72   DT  I "O4'" 1 
ATOM   9022  C  "C3'" . DT  I 5 145 ? -55.364 -36.245 89.313 1.00 92.35  ? 72   DT  I "C3'" 1 
ATOM   9023  O  "O3'" . DT  I 5 145 ? -56.155 -35.869 90.441 1.00 92.48  ? 72   DT  I "O3'" 1 
ATOM   9024  C  "C2'" . DT  I 5 145 ? -54.826 -37.672 89.450 1.00 92.32  ? 72   DT  I "C2'" 1 
ATOM   9025  C  "C1'" . DT  I 5 145 ? -54.998 -38.285 88.059 1.00 91.95  ? 72   DT  I "C1'" 1 
ATOM   9026  N  N1    . DT  I 5 145 ? -53.701 -38.713 87.388 1.00 91.88  ? 72   DT  I N1    1 
ATOM   9027  C  C2    . DT  I 5 145 ? -53.544 -40.028 86.988 1.00 91.37  ? 72   DT  I C2    1 
ATOM   9028  O  O2    . DT  I 5 145 ? -54.393 -40.889 87.133 1.00 91.67  ? 72   DT  I O2    1 
ATOM   9029  N  N3    . DT  I 5 145 ? -52.340 -40.311 86.401 1.00 91.12  ? 72   DT  I N3    1 
ATOM   9030  C  C4    . DT  I 5 145 ? -51.289 -39.440 86.169 1.00 91.53  ? 72   DT  I C4    1 
ATOM   9031  O  O4    . DT  I 5 145 ? -50.244 -39.797 85.630 1.00 91.79  ? 72   DT  I O4    1 
ATOM   9032  C  C5    . DT  I 5 145 ? -51.507 -38.085 86.604 1.00 91.57  ? 72   DT  I C5    1 
ATOM   9033  C  C7    . DT  I 5 145 ? -50.435 -37.051 86.411 1.00 91.54  ? 72   DT  I C7    1 
ATOM   9034  C  C6    . DT  I 5 145 ? -52.683 -37.793 87.186 1.00 91.98  ? 72   DT  I C6    1 
ATOM   9035  O  "O5'" . DA  J 6 1   ? -50.622 -50.975 83.464 1.00 110.89 ? -72  DA  J "O5'" 1 
ATOM   9036  C  "C5'" . DA  J 6 1   ? -51.323 -49.743 83.630 1.00 110.55 ? -72  DA  J "C5'" 1 
ATOM   9037  C  "C4'" . DA  J 6 1   ? -52.177 -49.771 84.887 1.00 110.30 ? -72  DA  J "C4'" 1 
ATOM   9038  O  "O4'" . DA  J 6 1   ? -51.439 -49.190 85.994 1.00 110.03 ? -72  DA  J "O4'" 1 
ATOM   9039  C  "C3'" . DA  J 6 1   ? -53.483 -48.996 84.768 1.00 110.29 ? -72  DA  J "C3'" 1 
ATOM   9040  O  "O3'" . DA  J 6 1   ? -54.570 -49.914 84.706 1.00 110.77 ? -72  DA  J "O3'" 1 
ATOM   9041  C  "C2'" . DA  J 6 1   ? -53.550 -48.109 86.013 1.00 109.75 ? -72  DA  J "C2'" 1 
ATOM   9042  C  "C1'" . DA  J 6 1   ? -52.103 -48.040 86.492 1.00 109.16 ? -72  DA  J "C1'" 1 
ATOM   9043  N  N9    . DA  J 6 1   ? -51.355 -46.837 86.096 1.00 108.85 ? -72  DA  J N9    1 
ATOM   9044  C  C8    . DA  J 6 1   ? -50.168 -46.809 85.414 1.00 108.61 ? -72  DA  J C8    1 
ATOM   9045  N  N7    . DA  J 6 1   ? -49.705 -45.603 85.189 1.00 108.72 ? -72  DA  J N7    1 
ATOM   9046  C  C5    . DA  J 6 1   ? -50.646 -44.768 85.767 1.00 108.70 ? -72  DA  J C5    1 
ATOM   9047  C  C6    . DA  J 6 1   ? -50.735 -43.359 85.871 1.00 108.49 ? -72  DA  J C6    1 
ATOM   9048  N  N6    . DA  J 6 1   ? -49.823 -42.523 85.368 1.00 108.39 ? -72  DA  J N6    1 
ATOM   9049  N  N1    . DA  J 6 1   ? -51.804 -42.841 86.511 1.00 108.42 ? -72  DA  J N1    1 
ATOM   9050  C  C2    . DA  J 6 1   ? -52.723 -43.678 87.012 1.00 108.63 ? -72  DA  J C2    1 
ATOM   9051  N  N3    . DA  J 6 1   ? -52.748 -45.015 86.978 1.00 108.63 ? -72  DA  J N3    1 
ATOM   9052  C  C4    . DA  J 6 1   ? -51.672 -45.511 86.336 1.00 108.74 ? -72  DA  J C4    1 
ATOM   9053  P  P     . DT  J 6 2   ? -56.025 -49.424 84.246 1.00 111.45 ? -71  DT  J P     1 
ATOM   9054  O  OP1   . DT  J 6 2   ? -56.887 -50.621 84.156 1.00 112.22 ? -71  DT  J OP1   1 
ATOM   9055  O  OP2   . DT  J 6 2   ? -55.884 -48.562 83.051 1.00 111.27 ? -71  DT  J OP2   1 
ATOM   9056  O  "O5'" . DT  J 6 2   ? -56.492 -48.538 85.500 1.00 111.07 ? -71  DT  J "O5'" 1 
ATOM   9057  C  "C5'" . DT  J 6 2   ? -57.858 -48.431 85.886 1.00 110.30 ? -71  DT  J "C5'" 1 
ATOM   9058  C  "C4'" . DT  J 6 2   ? -58.396 -47.102 85.405 1.00 109.62 ? -71  DT  J "C4'" 1 
ATOM   9059  O  "O4'" . DT  J 6 2   ? -57.321 -46.130 85.477 1.00 109.39 ? -71  DT  J "O4'" 1 
ATOM   9060  C  "C3'" . DT  J 6 2   ? -58.884 -47.122 83.953 1.00 109.65 ? -71  DT  J "C3'" 1 
ATOM   9061  O  "O3'" . DT  J 6 2   ? -60.291 -46.799 83.784 1.00 109.52 ? -71  DT  J "O3'" 1 
ATOM   9062  C  "C2'" . DT  J 6 2   ? -57.957 -46.161 83.204 1.00 109.50 ? -71  DT  J "C2'" 1 
ATOM   9063  C  "C1'" . DT  J 6 2   ? -57.356 -45.311 84.324 1.00 109.17 ? -71  DT  J "C1'" 1 
ATOM   9064  N  N1    . DT  J 6 2   ? -55.996 -44.715 84.004 1.00 109.21 ? -71  DT  J N1    1 
ATOM   9065  C  C2    . DT  J 6 2   ? -55.820 -43.340 84.105 1.00 108.88 ? -71  DT  J C2    1 
ATOM   9066  O  O2    . DT  J 6 2   ? -56.693 -42.557 84.450 1.00 108.66 ? -71  DT  J O2    1 
ATOM   9067  N  N3    . DT  J 6 2   ? -54.556 -42.901 83.785 1.00 108.61 ? -71  DT  J N3    1 
ATOM   9068  C  C4    . DT  J 6 2   ? -53.473 -43.663 83.381 1.00 108.66 ? -71  DT  J C4    1 
ATOM   9069  O  O4    . DT  J 6 2   ? -52.386 -43.159 83.121 1.00 108.75 ? -71  DT  J O4    1 
ATOM   9070  C  C5    . DT  J 6 2   ? -53.714 -45.084 83.292 1.00 108.70 ? -71  DT  J C5    1 
ATOM   9071  C  C7    . DT  J 6 2   ? -52.611 -46.008 82.863 1.00 108.79 ? -71  DT  J C7    1 
ATOM   9072  C  C6    . DT  J 6 2   ? -54.945 -45.534 83.603 1.00 109.05 ? -71  DT  J C6    1 
ATOM   9073  P  P     . DC  J 6 3   ? -61.118 -45.653 84.561 1.00 109.64 ? -70  DC  J P     1 
ATOM   9074  O  OP1   . DC  J 6 3   ? -61.269 -46.087 85.972 1.00 109.76 ? -70  DC  J OP1   1 
ATOM   9075  O  OP2   . DC  J 6 3   ? -62.320 -45.380 83.737 1.00 109.76 ? -70  DC  J OP2   1 
ATOM   9076  O  "O5'" . DC  J 6 3   ? -60.214 -44.324 84.514 1.00 108.80 ? -70  DC  J "O5'" 1 
ATOM   9077  C  "C5'" . DC  J 6 3   ? -60.696 -43.055 84.993 1.00 106.98 ? -70  DC  J "C5'" 1 
ATOM   9078  C  "C4'" . DC  J 6 3   ? -60.689 -41.974 83.914 1.00 105.74 ? -70  DC  J "C4'" 1 
ATOM   9079  O  "O4'" . DC  J 6 3   ? -59.388 -41.859 83.272 1.00 105.06 ? -70  DC  J "O4'" 1 
ATOM   9080  C  "C3'" . DC  J 6 3   ? -61.677 -42.160 82.765 1.00 104.89 ? -70  DC  J "C3'" 1 
ATOM   9081  O  "O3'" . DC  J 6 3   ? -62.180 -40.888 82.391 1.00 104.03 ? -70  DC  J "O3'" 1 
ATOM   9082  C  "C2'" . DC  J 6 3   ? -60.812 -42.743 81.652 1.00 104.54 ? -70  DC  J "C2'" 1 
ATOM   9083  C  "C1'" . DC  J 6 3   ? -59.563 -41.893 81.865 1.00 104.10 ? -70  DC  J "C1'" 1 
ATOM   9084  N  N1    . DC  J 6 3   ? -58.287 -42.386 81.252 1.00 103.61 ? -70  DC  J N1    1 
ATOM   9085  C  C2    . DC  J 6 3   ? -57.170 -41.538 81.282 1.00 103.25 ? -70  DC  J C2    1 
ATOM   9086  O  O2    . DC  J 6 3   ? -57.281 -40.421 81.804 1.00 102.94 ? -70  DC  J O2    1 
ATOM   9087  N  N3    . DC  J 6 3   ? -55.997 -41.966 80.738 1.00 102.98 ? -70  DC  J N3    1 
ATOM   9088  C  C4    . DC  J 6 3   ? -55.927 -43.183 80.186 1.00 103.34 ? -70  DC  J C4    1 
ATOM   9089  N  N4    . DC  J 6 3   ? -54.759 -43.564 79.665 1.00 103.39 ? -70  DC  J N4    1 
ATOM   9090  C  C5    . DC  J 6 3   ? -57.053 -44.065 80.143 1.00 103.27 ? -70  DC  J C5    1 
ATOM   9091  C  C6    . DC  J 6 3   ? -58.201 -43.630 80.682 1.00 103.37 ? -70  DC  J C6    1 
ATOM   9092  P  P     . DA  J 6 4   ? -63.571 -40.824 81.613 1.00 104.07 ? -69  DA  J P     1 
ATOM   9093  O  OP1   . DA  J 6 4   ? -64.615 -40.969 82.650 1.00 103.78 ? -69  DA  J OP1   1 
ATOM   9094  O  OP2   . DA  J 6 4   ? -63.481 -41.781 80.478 1.00 103.83 ? -69  DA  J OP2   1 
ATOM   9095  O  "O5'" . DA  J 6 4   ? -63.704 -39.348 80.991 1.00 102.81 ? -69  DA  J "O5'" 1 
ATOM   9096  C  "C5'" . DA  J 6 4   ? -62.850 -38.253 81.346 1.00 100.57 ? -69  DA  J "C5'" 1 
ATOM   9097  C  "C4'" . DA  J 6 4   ? -61.995 -37.797 80.167 1.00 98.43  ? -69  DA  J "C4'" 1 
ATOM   9098  O  "O4'" . DA  J 6 4   ? -60.844 -38.666 79.983 1.00 97.15  ? -69  DA  J "O4'" 1 
ATOM   9099  C  "C3'" . DA  J 6 4   ? -62.685 -37.729 78.799 1.00 97.42  ? -69  DA  J "C3'" 1 
ATOM   9100  O  "O3'" . DA  J 6 4   ? -62.362 -36.491 78.188 1.00 97.33  ? -69  DA  J "O3'" 1 
ATOM   9101  C  "C2'" . DA  J 6 4   ? -62.026 -38.872 78.032 1.00 96.66  ? -69  DA  J "C2'" 1 
ATOM   9102  C  "C1'" . DA  J 6 4   ? -60.621 -38.697 78.593 1.00 95.32  ? -69  DA  J "C1'" 1 
ATOM   9103  N  N9    . DA  J 6 4   ? -59.622 -39.704 78.245 1.00 94.92  ? -69  DA  J N9    1 
ATOM   9104  C  C8    . DA  J 6 4   ? -59.767 -41.062 78.165 1.00 94.68  ? -69  DA  J C8    1 
ATOM   9105  N  N7    . DA  J 6 4   ? -58.667 -41.690 77.823 1.00 94.55  ? -69  DA  J N7    1 
ATOM   9106  C  C5    . DA  J 6 4   ? -57.740 -40.673 77.667 1.00 94.54  ? -69  DA  J C5    1 
ATOM   9107  C  C6    . DA  J 6 4   ? -56.378 -40.666 77.309 1.00 94.36  ? -69  DA  J C6    1 
ATOM   9108  N  N6    . DA  J 6 4   ? -55.690 -41.773 77.035 1.00 94.44  ? -69  DA  J N6    1 
ATOM   9109  N  N1    . DA  J 6 4   ? -55.746 -39.476 77.246 1.00 94.43  ? -69  DA  J N1    1 
ATOM   9110  C  C2    . DA  J 6 4   ? -56.428 -38.358 77.524 1.00 94.62  ? -69  DA  J C2    1 
ATOM   9111  N  N3    . DA  J 6 4   ? -57.708 -38.236 77.867 1.00 94.64  ? -69  DA  J N3    1 
ATOM   9112  C  C4    . DA  J 6 4   ? -58.312 -39.441 77.924 1.00 94.79  ? -69  DA  J C4    1 
ATOM   9113  P  P     . DA  J 6 5   ? -63.291 -35.198 78.333 1.00 97.54  ? -68  DA  J P     1 
ATOM   9114  O  OP1   . DA  J 6 5   ? -63.494 -34.928 79.782 1.00 97.35  ? -68  DA  J OP1   1 
ATOM   9115  O  OP2   . DA  J 6 5   ? -64.439 -35.408 77.423 1.00 97.18  ? -68  DA  J OP2   1 
ATOM   9116  O  "O5'" . DA  J 6 5   ? -62.400 -34.021 77.707 1.00 96.87  ? -68  DA  J "O5'" 1 
ATOM   9117  C  "C5'" . DA  J 6 5   ? -61.070 -33.745 78.193 1.00 96.09  ? -68  DA  J "C5'" 1 
ATOM   9118  C  "C4'" . DA  J 6 5   ? -60.047 -33.486 77.082 1.00 95.06  ? -68  DA  J "C4'" 1 
ATOM   9119  O  "O4'" . DA  J 6 5   ? -59.276 -34.673 76.746 1.00 94.84  ? -68  DA  J "O4'" 1 
ATOM   9120  C  "C3'" . DA  J 6 5   ? -60.605 -32.949 75.769 1.00 94.24  ? -68  DA  J "C3'" 1 
ATOM   9121  O  "O3'" . DA  J 6 5   ? -59.846 -31.794 75.426 1.00 93.45  ? -68  DA  J "O3'" 1 
ATOM   9122  C  "C2'" . DA  J 6 5   ? -60.465 -34.113 74.783 1.00 93.99  ? -68  DA  J "C2'" 1 
ATOM   9123  C  "C1'" . DA  J 6 5   ? -59.280 -34.891 75.350 1.00 94.46  ? -68  DA  J "C1'" 1 
ATOM   9124  N  N9    . DA  J 6 5   ? -59.310 -36.342 75.156 1.00 94.58  ? -68  DA  J N9    1 
ATOM   9125  C  C8    . DA  J 6 5   ? -60.375 -37.179 75.334 1.00 94.72  ? -68  DA  J C8    1 
ATOM   9126  N  N7    . DA  J 6 5   ? -60.111 -38.444 75.100 1.00 94.86  ? -68  DA  J N7    1 
ATOM   9127  C  C5    . DA  J 6 5   ? -58.777 -38.441 74.743 1.00 94.42  ? -68  DA  J C5    1 
ATOM   9128  C  C6    . DA  J 6 5   ? -57.896 -39.473 74.373 1.00 94.33  ? -68  DA  J C6    1 
ATOM   9129  N  N6    . DA  J 6 5   ? -58.263 -40.752 74.305 1.00 94.26  ? -68  DA  J N6    1 
ATOM   9130  N  N1    . DA  J 6 5   ? -56.622 -39.141 74.074 1.00 94.50  ? -68  DA  J N1    1 
ATOM   9131  C  C2    . DA  J 6 5   ? -56.259 -37.852 74.142 1.00 94.57  ? -68  DA  J C2    1 
ATOM   9132  N  N3    . DA  J 6 5   ? -56.999 -36.793 74.481 1.00 94.37  ? -68  DA  J N3    1 
ATOM   9133  C  C4    . DA  J 6 5   ? -58.262 -37.156 74.775 1.00 94.55  ? -68  DA  J C4    1 
ATOM   9134  P  P     . DT  J 6 6   ? -60.313 -30.806 74.256 1.00 92.72  ? -67  DT  J P     1 
ATOM   9135  O  OP1   . DT  J 6 6   ? -59.859 -29.442 74.606 1.00 91.82  ? -67  DT  J OP1   1 
ATOM   9136  O  OP2   . DT  J 6 6   ? -61.743 -31.071 73.977 1.00 92.92  ? -67  DT  J OP2   1 
ATOM   9137  O  "O5'" . DT  J 6 6   ? -59.476 -31.349 73.002 1.00 92.62  ? -67  DT  J "O5'" 1 
ATOM   9138  C  "C5'" . DT  J 6 6   ? -58.041 -31.415 73.055 1.00 91.42  ? -67  DT  J "C5'" 1 
ATOM   9139  C  "C4'" . DT  J 6 6   ? -57.480 -32.450 72.093 1.00 89.99  ? -67  DT  J "C4'" 1 
ATOM   9140  O  "O4'" . DT  J 6 6   ? -57.983 -33.772 72.387 1.00 89.65  ? -67  DT  J "O4'" 1 
ATOM   9141  C  "C3'" . DT  J 6 6   ? -57.809 -32.224 70.619 1.00 89.25  ? -67  DT  J "C3'" 1 
ATOM   9142  O  "O3'" . DT  J 6 6   ? -56.728 -31.479 70.041 1.00 88.12  ? -67  DT  J "O3'" 1 
ATOM   9143  C  "C2'" . DT  J 6 6   ? -57.968 -33.640 70.055 1.00 89.38  ? -67  DT  J "C2'" 1 
ATOM   9144  C  "C1'" . DT  J 6 6   ? -57.683 -34.551 71.247 1.00 89.85  ? -67  DT  J "C1'" 1 
ATOM   9145  N  N1    . DT  J 6 6   ? -58.461 -35.840 71.282 1.00 89.80  ? -67  DT  J N1    1 
ATOM   9146  C  C2    . DT  J 6 6   ? -57.812 -37.050 71.077 1.00 89.96  ? -67  DT  J C2    1 
ATOM   9147  O  O2    . DT  J 6 6   ? -56.618 -37.165 70.856 1.00 90.05  ? -67  DT  J O2    1 
ATOM   9148  N  N3    . DT  J 6 6   ? -58.623 -38.156 71.142 1.00 89.85  ? -67  DT  J N3    1 
ATOM   9149  C  C4    . DT  J 6 6   ? -59.984 -38.174 71.386 1.00 90.01  ? -67  DT  J C4    1 
ATOM   9150  O  O4    . DT  J 6 6   ? -60.609 -39.228 71.418 1.00 90.16  ? -67  DT  J O4    1 
ATOM   9151  C  C5    . DT  J 6 6   ? -60.606 -36.882 71.595 1.00 90.07  ? -67  DT  J C5    1 
ATOM   9152  C  C7    . DT  J 6 6   ? -62.080 -36.755 71.868 1.00 89.98  ? -67  DT  J C7    1 
ATOM   9153  C  C6    . DT  J 6 6   ? -59.822 -35.796 71.533 1.00 89.90  ? -67  DT  J C6    1 
ATOM   9154  P  P     . DA  J 6 7   ? -56.523 -31.206 68.473 1.00 87.16  ? -66  DA  J P     1 
ATOM   9155  O  OP1   . DA  J 6 7   ? -55.699 -29.981 68.364 1.00 86.92  ? -66  DA  J OP1   1 
ATOM   9156  O  OP2   . DA  J 6 7   ? -57.810 -31.281 67.748 1.00 86.99  ? -66  DA  J OP2   1 
ATOM   9157  O  "O5'" . DA  J 6 7   ? -55.656 -32.473 68.045 1.00 85.54  ? -66  DA  J "O5'" 1 
ATOM   9158  C  "C5'" . DA  J 6 7   ? -54.362 -32.635 68.602 1.00 83.46  ? -66  DA  J "C5'" 1 
ATOM   9159  C  "C4'" . DA  J 6 7   ? -53.725 -33.912 68.097 1.00 82.20  ? -66  DA  J "C4'" 1 
ATOM   9160  O  "O4'" . DA  J 6 7   ? -54.557 -35.057 68.424 1.00 81.58  ? -66  DA  J "O4'" 1 
ATOM   9161  C  "C3'" . DA  J 6 7   ? -53.492 -33.953 66.590 1.00 81.64  ? -66  DA  J "C3'" 1 
ATOM   9162  O  "O3'" . DA  J 6 7   ? -52.184 -34.494 66.374 1.00 80.95  ? -66  DA  J "O3'" 1 
ATOM   9163  C  "C2'" . DA  J 6 7   ? -54.633 -34.839 66.077 1.00 81.28  ? -66  DA  J "C2'" 1 
ATOM   9164  C  "C1'" . DA  J 6 7   ? -54.855 -35.792 67.251 1.00 81.07  ? -66  DA  J "C1'" 1 
ATOM   9165  N  N9    . DA  J 6 7   ? -56.214 -36.318 67.386 1.00 81.05  ? -66  DA  J N9    1 
ATOM   9166  C  C8    . DA  J 6 7   ? -57.352 -35.588 67.604 1.00 80.98  ? -66  DA  J C8    1 
ATOM   9167  N  N7    . DA  J 6 7   ? -58.444 -36.307 67.697 1.00 80.97  ? -66  DA  J N7    1 
ATOM   9168  C  C5    . DA  J 6 7   ? -57.994 -37.604 67.528 1.00 80.87  ? -66  DA  J C5    1 
ATOM   9169  C  C6    . DA  J 6 7   ? -58.668 -38.841 67.521 1.00 80.86  ? -66  DA  J C6    1 
ATOM   9170  N  N6    . DA  J 6 7   ? -59.990 -38.958 67.689 1.00 80.80  ? -66  DA  J N6    1 
ATOM   9171  N  N1    . DA  J 6 7   ? -57.925 -39.953 67.328 1.00 81.00  ? -66  DA  J N1    1 
ATOM   9172  C  C2    . DA  J 6 7   ? -56.600 -39.838 67.148 1.00 80.53  ? -66  DA  J C2    1 
ATOM   9173  N  N3    . DA  J 6 7   ? -55.860 -38.732 67.137 1.00 80.38  ? -66  DA  J N3    1 
ATOM   9174  C  C4    . DA  J 6 7   ? -56.621 -37.636 67.335 1.00 80.78  ? -66  DA  J C4    1 
ATOM   9175  P  P     . DT  J 6 8   ? -51.508 -34.615 64.934 1.00 80.05  ? -65  DT  J P     1 
ATOM   9176  O  OP1   . DT  J 6 8   ? -50.071 -34.804 65.216 1.00 81.27  ? -65  DT  J OP1   1 
ATOM   9177  O  OP2   . DT  J 6 8   ? -51.987 -33.541 64.040 1.00 79.68  ? -65  DT  J OP2   1 
ATOM   9178  O  "O5'" . DT  J 6 8   ? -52.042 -36.000 64.376 1.00 80.59  ? -65  DT  J "O5'" 1 
ATOM   9179  C  "C5'" . DT  J 6 8   ? -51.557 -37.179 65.009 1.00 81.63  ? -65  DT  J "C5'" 1 
ATOM   9180  C  "C4'" . DT  J 6 8   ? -52.177 -38.404 64.384 1.00 82.20  ? -65  DT  J "C4'" 1 
ATOM   9181  O  "O4'" . DT  J 6 8   ? -53.577 -38.441 64.744 1.00 82.50  ? -65  DT  J "O4'" 1 
ATOM   9182  C  "C3'" . DT  J 6 8   ? -52.130 -38.444 62.859 1.00 82.60  ? -65  DT  J "C3'" 1 
ATOM   9183  O  "O3'" . DT  J 6 8   ? -51.775 -39.762 62.482 1.00 83.45  ? -65  DT  J "O3'" 1 
ATOM   9184  C  "C2'" . DT  J 6 8   ? -53.565 -38.113 62.459 1.00 82.55  ? -65  DT  J "C2'" 1 
ATOM   9185  C  "C1'" . DT  J 6 8   ? -54.293 -38.824 63.593 1.00 82.94  ? -65  DT  J "C1'" 1 
ATOM   9186  N  N1    . DT  J 6 8   ? -55.752 -38.520 63.787 1.00 83.42  ? -65  DT  J N1    1 
ATOM   9187  C  C2    . DT  J 6 8   ? -56.624 -39.585 63.950 1.00 83.45  ? -65  DT  J C2    1 
ATOM   9188  O  O2    . DT  J 6 8   ? -56.277 -40.755 63.942 1.00 83.40  ? -65  DT  J O2    1 
ATOM   9189  N  N3    . DT  J 6 8   ? -57.938 -39.226 64.123 1.00 83.13  ? -65  DT  J N3    1 
ATOM   9190  C  C4    . DT  J 6 8   ? -58.453 -37.944 64.156 1.00 82.93  ? -65  DT  J C4    1 
ATOM   9191  O  O4    . DT  J 6 8   ? -59.648 -37.739 64.325 1.00 83.22  ? -65  DT  J O4    1 
ATOM   9192  C  C5    . DT  J 6 8   ? -57.495 -36.875 63.982 1.00 83.28  ? -65  DT  J C5    1 
ATOM   9193  C  C7    . DT  J 6 8   ? -57.945 -35.439 64.000 1.00 83.35  ? -65  DT  J C7    1 
ATOM   9194  C  C6    . DT  J 6 8   ? -56.205 -37.208 63.808 1.00 83.25  ? -65  DT  J C6    1 
ATOM   9195  P  P     . DC  J 6 9   ? -51.085 -40.117 61.083 1.00 83.74  ? -64  DC  J P     1 
ATOM   9196  O  OP1   . DC  J 6 9   ? -49.640 -40.268 61.367 1.00 82.98  ? -64  DC  J OP1   1 
ATOM   9197  O  OP2   . DC  J 6 9   ? -51.601 -39.197 60.037 1.00 82.73  ? -64  DC  J OP2   1 
ATOM   9198  O  "O5'" . DC  J 6 9   ? -51.661 -41.567 60.737 1.00 84.23  ? -64  DC  J "O5'" 1 
ATOM   9199  C  "C5'" . DC  J 6 9   ? -52.212 -42.411 61.751 1.00 85.26  ? -64  DC  J "C5'" 1 
ATOM   9200  C  "C4'" . DC  J 6 9   ? -53.368 -43.213 61.186 1.00 85.58  ? -64  DC  J "C4'" 1 
ATOM   9201  O  "O4'" . DC  J 6 9   ? -54.638 -42.615 61.569 1.00 85.97  ? -64  DC  J "O4'" 1 
ATOM   9202  C  "C3'" . DC  J 6 9   ? -53.339 -43.296 59.664 1.00 85.44  ? -64  DC  J "C3'" 1 
ATOM   9203  O  "O3'" . DC  J 6 9   ? -53.392 -44.656 59.259 1.00 85.31  ? -64  DC  J "O3'" 1 
ATOM   9204  C  "C2'" . DC  J 6 9   ? -54.555 -42.490 59.220 1.00 85.77  ? -64  DC  J "C2'" 1 
ATOM   9205  C  "C1'" . DC  J 6 9   ? -55.479 -42.526 60.436 1.00 85.81  ? -64  DC  J "C1'" 1 
ATOM   9206  N  N1    . DC  J 6 9   ? -56.376 -41.321 60.558 1.00 85.43  ? -64  DC  J N1    1 
ATOM   9207  C  C2    . DC  J 6 9   ? -57.763 -41.488 60.650 1.00 85.65  ? -64  DC  J C2    1 
ATOM   9208  O  O2    . DC  J 6 9   ? -58.243 -42.628 60.634 1.00 86.29  ? -64  DC  J O2    1 
ATOM   9209  N  N3    . DC  J 6 9   ? -58.556 -40.391 60.755 1.00 85.78  ? -64  DC  J N3    1 
ATOM   9210  C  C4    . DC  J 6 9   ? -58.025 -39.167 60.769 1.00 85.95  ? -64  DC  J C4    1 
ATOM   9211  N  N4    . DC  J 6 9   ? -58.854 -38.119 60.872 1.00 85.85  ? -64  DC  J N4    1 
ATOM   9212  C  C5    . DC  J 6 9   ? -56.616 -38.973 60.668 1.00 85.93  ? -64  DC  J C5    1 
ATOM   9213  C  C6    . DC  J 6 9   ? -55.845 -40.063 60.567 1.00 85.39  ? -64  DC  J C6    1 
ATOM   9214  P  P     . DC  J 6 10  ? -52.894 -45.098 57.803 1.00 85.17  ? -63  DC  J P     1 
ATOM   9215  O  OP1   . DC  J 6 10  ? -51.638 -45.864 57.953 1.00 84.99  ? -63  DC  J OP1   1 
ATOM   9216  O  OP2   . DC  J 6 10  ? -52.944 -43.931 56.888 1.00 84.26  ? -63  DC  J OP2   1 
ATOM   9217  O  "O5'" . DC  J 6 10  ? -54.049 -46.119 57.388 1.00 85.50  ? -63  DC  J "O5'" 1 
ATOM   9218  C  "C5'" . DC  J 6 10  ? -55.001 -46.588 58.348 1.00 85.69  ? -63  DC  J "C5'" 1 
ATOM   9219  C  "C4'" . DC  J 6 10  ? -56.384 -46.659 57.724 1.00 86.06  ? -63  DC  J "C4'" 1 
ATOM   9220  O  "O4'" . DC  J 6 10  ? -57.137 -45.472 58.081 1.00 85.49  ? -63  DC  J "O4'" 1 
ATOM   9221  C  "C3'" . DC  J 6 10  ? -56.404 -46.756 56.193 1.00 86.46  ? -63  DC  J "C3'" 1 
ATOM   9222  O  "O3'" . DC  J 6 10  ? -57.273 -47.819 55.796 1.00 87.84  ? -63  DC  J "O3'" 1 
ATOM   9223  C  "C2'" . DC  J 6 10  ? -56.925 -45.396 55.733 1.00 85.44  ? -63  DC  J "C2'" 1 
ATOM   9224  C  "C1'" . DC  J 6 10  ? -57.789 -44.992 56.924 1.00 84.48  ? -63  DC  J "C1'" 1 
ATOM   9225  N  N1    . DC  J 6 10  ? -57.991 -43.529 57.088 1.00 83.62  ? -63  DC  J N1    1 
ATOM   9226  C  C2    . DC  J 6 10  ? -59.233 -43.066 57.532 1.00 83.34  ? -63  DC  J C2    1 
ATOM   9227  O  O2    . DC  J 6 10  ? -60.129 -43.880 57.777 1.00 83.61  ? -63  DC  J O2    1 
ATOM   9228  N  N3    . DC  J 6 10  ? -59.421 -41.731 57.680 1.00 83.50  ? -63  DC  J N3    1 
ATOM   9229  C  C4    . DC  J 6 10  ? -58.430 -40.880 57.405 1.00 83.56  ? -63  DC  J C4    1 
ATOM   9230  N  N4    . DC  J 6 10  ? -58.670 -39.582 57.573 1.00 83.52  ? -63  DC  J N4    1 
ATOM   9231  C  C5    . DC  J 6 10  ? -57.153 -41.325 56.948 1.00 83.68  ? -63  DC  J C5    1 
ATOM   9232  C  C6    . DC  J 6 10  ? -56.984 -42.648 56.805 1.00 83.75  ? -63  DC  J C6    1 
ATOM   9233  P  P     . DA  J 6 11  ? -57.242 -48.485 54.332 1.00 87.99  ? -62  DA  J P     1 
ATOM   9234  O  OP1   . DA  J 6 11  ? -56.970 -49.935 54.505 1.00 86.62  ? -62  DA  J OP1   1 
ATOM   9235  O  OP2   . DA  J 6 11  ? -56.427 -47.645 53.420 1.00 87.68  ? -62  DA  J OP2   1 
ATOM   9236  O  "O5'" . DA  J 6 11  ? -58.752 -48.290 53.863 1.00 87.41  ? -62  DA  J "O5'" 1 
ATOM   9237  C  "C5'" . DA  J 6 11  ? -59.822 -48.614 54.736 1.00 86.87  ? -62  DA  J "C5'" 1 
ATOM   9238  C  "C4'" . DA  J 6 11  ? -61.118 -48.100 54.146 1.00 86.14  ? -62  DA  J "C4'" 1 
ATOM   9239  O  "O4'" . DA  J 6 11  ? -61.313 -46.743 54.603 1.00 85.20  ? -62  DA  J "O4'" 1 
ATOM   9240  C  "C3'" . DA  J 6 11  ? -61.140 -48.095 52.619 1.00 86.23  ? -62  DA  J "C3'" 1 
ATOM   9241  O  "O3'" . DA  J 6 11  ? -62.267 -48.849 52.150 1.00 87.65  ? -62  DA  J "O3'" 1 
ATOM   9242  C  "C2'" . DA  J 6 11  ? -61.192 -46.616 52.240 1.00 85.74  ? -62  DA  J "C2'" 1 
ATOM   9243  C  "C1'" . DA  J 6 11  ? -61.641 -45.910 53.514 1.00 84.95  ? -62  DA  J "C1'" 1 
ATOM   9244  N  N9    . DA  J 6 11  ? -61.000 -44.608 53.712 1.00 84.93  ? -62  DA  J N9    1 
ATOM   9245  C  C8    . DA  J 6 11  ? -59.671 -44.296 53.564 1.00 84.38  ? -62  DA  J C8    1 
ATOM   9246  N  N7    . DA  J 6 11  ? -59.400 -43.035 53.809 1.00 84.38  ? -62  DA  J N7    1 
ATOM   9247  C  C5    . DA  J 6 11  ? -60.629 -42.479 54.142 1.00 84.50  ? -62  DA  J C5    1 
ATOM   9248  C  C6    . DA  J 6 11  ? -61.034 -41.171 54.507 1.00 84.45  ? -62  DA  J C6    1 
ATOM   9249  N  N6    . DA  J 6 11  ? -60.192 -40.138 54.609 1.00 84.53  ? -62  DA  J N6    1 
ATOM   9250  N  N1    . DA  J 6 11  ? -62.344 -40.956 54.771 1.00 84.23  ? -62  DA  J N1    1 
ATOM   9251  C  C2    . DA  J 6 11  ? -63.194 -41.984 54.676 1.00 84.37  ? -62  DA  J C2    1 
ATOM   9252  N  N3    . DA  J 6 11  ? -62.938 -43.252 54.343 1.00 84.59  ? -62  DA  J N3    1 
ATOM   9253  C  C4    . DA  J 6 11  ? -61.627 -43.437 54.085 1.00 84.85  ? -62  DA  J C4    1 
ATOM   9254  P  P     . DC  J 6 12  ? -62.654 -49.003 50.594 1.00 88.42  ? -61  DC  J P     1 
ATOM   9255  O  OP1   . DC  J 6 12  ? -63.247 -50.345 50.419 1.00 88.58  ? -61  DC  J OP1   1 
ATOM   9256  O  OP2   . DC  J 6 12  ? -61.510 -48.618 49.740 1.00 87.66  ? -61  DC  J OP2   1 
ATOM   9257  O  "O5'" . DC  J 6 12  ? -63.802 -47.905 50.407 1.00 88.95  ? -61  DC  J "O5'" 1 
ATOM   9258  C  "C5'" . DC  J 6 12  ? -64.640 -47.511 51.489 1.00 90.86  ? -61  DC  J "C5'" 1 
ATOM   9259  C  "C4'" . DC  J 6 12  ? -65.265 -46.169 51.167 1.00 92.64  ? -61  DC  J "C4'" 1 
ATOM   9260  O  "O4'" . DC  J 6 12  ? -64.382 -45.109 51.626 1.00 93.67  ? -61  DC  J "O4'" 1 
ATOM   9261  C  "C3'" . DC  J 6 12  ? -65.491 -45.936 49.672 1.00 93.31  ? -61  DC  J "C3'" 1 
ATOM   9262  O  "O3'" . DC  J 6 12  ? -66.868 -45.611 49.412 1.00 94.38  ? -61  DC  J "O3'" 1 
ATOM   9263  C  "C2'" . DC  J 6 12  ? -64.532 -44.793 49.335 1.00 93.90  ? -61  DC  J "C2'" 1 
ATOM   9264  C  "C1'" . DC  J 6 12  ? -64.416 -44.065 50.671 1.00 93.87  ? -61  DC  J "C1'" 1 
ATOM   9265  N  N1    . DC  J 6 12  ? -63.210 -43.149 50.781 1.00 93.92  ? -61  DC  J N1    1 
ATOM   9266  C  C2    . DC  J 6 12  ? -63.358 -41.823 51.233 1.00 93.57  ? -61  DC  J C2    1 
ATOM   9267  O  O2    . DC  J 6 12  ? -64.475 -41.404 51.556 1.00 93.50  ? -61  DC  J O2    1 
ATOM   9268  N  N3    . DC  J 6 12  ? -62.257 -41.025 51.312 1.00 93.55  ? -61  DC  J N3    1 
ATOM   9269  C  C4    . DC  J 6 12  ? -61.053 -41.491 50.959 1.00 93.63  ? -61  DC  J C4    1 
ATOM   9270  N  N4    . DC  J 6 12  ? -60.000 -40.673 51.053 1.00 93.48  ? -61  DC  J N4    1 
ATOM   9271  C  C5    . DC  J 6 12  ? -60.877 -42.829 50.487 1.00 94.08  ? -61  DC  J C5    1 
ATOM   9272  C  C6    . DC  J 6 12  ? -61.968 -43.610 50.416 1.00 94.26  ? -61  DC  J C6    1 
ATOM   9273  P  P     . DC  J 6 13  ? -67.416 -45.183 47.959 1.00 94.82  ? -60  DC  J P     1 
ATOM   9274  O  OP1   . DC  J 6 13  ? -68.789 -45.722 47.845 1.00 94.87  ? -60  DC  J OP1   1 
ATOM   9275  O  OP2   . DC  J 6 13  ? -66.416 -45.518 46.919 1.00 94.35  ? -60  DC  J OP2   1 
ATOM   9276  O  "O5'" . DC  J 6 13  ? -67.483 -43.585 48.064 1.00 96.03  ? -60  DC  J "O5'" 1 
ATOM   9277  C  "C5'" . DC  J 6 13  ? -68.505 -42.919 48.811 1.00 97.33  ? -60  DC  J "C5'" 1 
ATOM   9278  C  "C4'" . DC  J 6 13  ? -68.616 -41.467 48.373 1.00 98.76  ? -60  DC  J "C4'" 1 
ATOM   9279  O  "O4'" . DC  J 6 13  ? -67.416 -40.759 48.773 1.00 99.28  ? -60  DC  J "O4'" 1 
ATOM   9280  C  "C3'" . DC  J 6 13  ? -68.773 -41.218 46.872 1.00 99.46  ? -60  DC  J "C3'" 1 
ATOM   9281  O  "O3'" . DC  J 6 13  ? -69.713 -40.160 46.639 1.00 100.70 ? -60  DC  J "O3'" 1 
ATOM   9282  C  "C2'" . DC  J 6 13  ? -67.371 -40.818 46.421 1.00 99.63  ? -60  DC  J "C2'" 1 
ATOM   9283  C  "C1'" . DC  J 6 13  ? -66.844 -40.096 47.659 1.00 99.77  ? -60  DC  J "C1'" 1 
ATOM   9284  N  N1    . DC  J 6 13  ? -65.339 -40.089 47.801 1.00 100.08 ? -60  DC  J N1    1 
ATOM   9285  C  C2    . DC  J 6 13  ? -64.649 -38.889 48.074 1.00 99.88  ? -60  DC  J C2    1 
ATOM   9286  O  O2    . DC  J 6 13  ? -65.275 -37.826 48.203 1.00 99.96  ? -60  DC  J O2    1 
ATOM   9287  N  N3    . DC  J 6 13  ? -63.295 -38.927 48.200 1.00 99.58  ? -60  DC  J N3    1 
ATOM   9288  C  C4    . DC  J 6 13  ? -62.637 -40.081 48.063 1.00 99.55  ? -60  DC  J C4    1 
ATOM   9289  N  N4    . DC  J 6 13  ? -61.309 -40.073 48.188 1.00 99.74  ? -60  DC  J N4    1 
ATOM   9290  C  C5    . DC  J 6 13  ? -63.312 -41.305 47.786 1.00 99.88  ? -60  DC  J C5    1 
ATOM   9291  C  C6    . DC  J 6 13  ? -64.645 -41.264 47.667 1.00 100.11 ? -60  DC  J C6    1 
ATOM   9292  P  P     . DT  J 6 14  ? -70.401 -39.941 45.203 1.00 101.20 ? -59  DT  J P     1 
ATOM   9293  O  OP1   . DT  J 6 14  ? -71.806 -39.553 45.445 1.00 101.05 ? -59  DT  J OP1   1 
ATOM   9294  O  OP2   . DT  J 6 14  ? -70.074 -41.104 44.340 1.00 100.58 ? -59  DT  J OP2   1 
ATOM   9295  O  "O5'" . DT  J 6 14  ? -69.643 -38.670 44.607 1.00 102.07 ? -59  DT  J "O5'" 1 
ATOM   9296  C  "C5'" . DT  J 6 14  ? -69.407 -37.521 45.410 1.00 103.99 ? -59  DT  J "C5'" 1 
ATOM   9297  C  "C4'" . DT  J 6 14  ? -68.269 -36.714 44.820 1.00 105.23 ? -59  DT  J "C4'" 1 
ATOM   9298  O  "O4'" . DT  J 6 14  ? -67.005 -37.352 45.135 1.00 105.57 ? -59  DT  J "O4'" 1 
ATOM   9299  C  "C3'" . DT  J 6 14  ? -68.312 -36.579 43.294 1.00 105.80 ? -59  DT  J "C3'" 1 
ATOM   9300  O  "O3'" . DT  J 6 14  ? -68.416 -35.201 42.921 1.00 106.73 ? -59  DT  J "O3'" 1 
ATOM   9301  C  "C2'" . DT  J 6 14  ? -67.007 -37.207 42.807 1.00 105.76 ? -59  DT  J "C2'" 1 
ATOM   9302  C  "C1'" . DT  J 6 14  ? -66.141 -37.063 44.056 1.00 105.81 ? -59  DT  J "C1'" 1 
ATOM   9303  N  N1    . DT  J 6 14  ? -64.924 -37.936 44.089 1.00 105.75 ? -59  DT  J N1    1 
ATOM   9304  C  C2    . DT  J 6 14  ? -63.694 -37.328 44.241 1.00 105.55 ? -59  DT  J C2    1 
ATOM   9305  O  O2    . DT  J 6 14  ? -63.545 -36.125 44.359 1.00 105.77 ? -59  DT  J O2    1 
ATOM   9306  N  N3    . DT  J 6 14  ? -62.629 -38.188 44.255 1.00 105.32 ? -59  DT  J N3    1 
ATOM   9307  C  C4    . DT  J 6 14  ? -62.671 -39.563 44.134 1.00 105.80 ? -59  DT  J C4    1 
ATOM   9308  O  O4    . DT  J 6 14  ? -61.642 -40.231 44.162 1.00 106.01 ? -59  DT  J O4    1 
ATOM   9309  C  C5    . DT  J 6 14  ? -63.991 -40.143 43.976 1.00 105.84 ? -59  DT  J C5    1 
ATOM   9310  C  C7    . DT  J 6 14  ? -64.175 -41.629 43.835 1.00 105.53 ? -59  DT  J C7    1 
ATOM   9311  C  C6    . DT  J 6 14  ? -65.042 -39.309 43.960 1.00 105.67 ? -59  DT  J C6    1 
ATOM   9312  P  P     . DG  J 6 15  ? -69.610 -34.719 41.964 1.00 106.92 ? -58  DG  J P     1 
ATOM   9313  O  OP1   . DG  J 6 15  ? -70.865 -35.050 42.679 1.00 107.02 ? -58  DG  J OP1   1 
ATOM   9314  O  OP2   . DG  J 6 15  ? -69.346 -35.285 40.615 1.00 106.50 ? -58  DG  J OP2   1 
ATOM   9315  O  "O5'" . DG  J 6 15  ? -69.482 -33.119 41.866 1.00 106.01 ? -58  DG  J "O5'" 1 
ATOM   9316  C  "C5'" . DG  J 6 15  ? -68.807 -32.348 42.865 1.00 105.28 ? -58  DG  J "C5'" 1 
ATOM   9317  C  "C4'" . DG  J 6 15  ? -67.637 -31.576 42.274 1.00 104.41 ? -58  DG  J "C4'" 1 
ATOM   9318  O  "O4'" . DG  J 6 15  ? -66.438 -32.389 42.277 1.00 103.73 ? -58  DG  J "O4'" 1 
ATOM   9319  C  "C3'" . DG  J 6 15  ? -67.863 -31.077 40.846 1.00 104.38 ? -58  DG  J "C3'" 1 
ATOM   9320  O  "O3'" . DG  J 6 15  ? -67.859 -29.625 40.844 1.00 104.59 ? -58  DG  J "O3'" 1 
ATOM   9321  C  "C2'" . DG  J 6 15  ? -66.805 -31.797 39.998 1.00 103.95 ? -58  DG  J "C2'" 1 
ATOM   9322  C  "C1'" . DG  J 6 15  ? -65.815 -32.384 41.005 1.00 103.26 ? -58  DG  J "C1'" 1 
ATOM   9323  N  N9    . DG  J 6 15  ? -65.384 -33.760 40.730 1.00 102.96 ? -58  DG  J N9    1 
ATOM   9324  C  C8    . DG  J 6 15  ? -66.090 -34.746 40.083 1.00 102.81 ? -58  DG  J C8    1 
ATOM   9325  N  N7    . DG  J 6 15  ? -65.455 -35.880 39.999 1.00 102.83 ? -58  DG  J N7    1 
ATOM   9326  C  C5    . DG  J 6 15  ? -64.247 -35.642 40.633 1.00 102.71 ? -58  DG  J C5    1 
ATOM   9327  C  C6    . DG  J 6 15  ? -63.145 -36.506 40.854 1.00 102.69 ? -58  DG  J C6    1 
ATOM   9328  O  O6    . DG  J 6 15  ? -63.025 -37.689 40.522 1.00 102.76 ? -58  DG  J O6    1 
ATOM   9329  N  N1    . DG  J 6 15  ? -62.109 -35.874 41.540 1.00 102.86 ? -58  DG  J N1    1 
ATOM   9330  C  C2    . DG  J 6 15  ? -62.141 -34.561 41.961 1.00 102.93 ? -58  DG  J C2    1 
ATOM   9331  N  N2    . DG  J 6 15  ? -61.058 -34.113 42.610 1.00 102.76 ? -58  DG  J N2    1 
ATOM   9332  N  N3    . DG  J 6 15  ? -63.171 -33.741 41.760 1.00 103.02 ? -58  DG  J N3    1 
ATOM   9333  C  C4    . DG  J 6 15  ? -64.189 -34.343 41.092 1.00 102.87 ? -58  DG  J C4    1 
ATOM   9334  P  P     . DC  J 6 16  ? -66.885 -28.658 40.013 1.00 104.70 ? -57  DC  J P     1 
ATOM   9335  O  OP1   . DC  J 6 16  ? -67.279 -27.282 40.378 1.00 104.41 ? -57  DC  J OP1   1 
ATOM   9336  O  OP2   . DC  J 6 16  ? -66.879 -29.069 38.586 1.00 104.39 ? -57  DC  J OP2   1 
ATOM   9337  O  "O5'" . DC  J 6 16  ? -65.440 -28.950 40.649 1.00 104.87 ? -57  DC  J "O5'" 1 
ATOM   9338  C  "C5'" . DC  J 6 16  ? -64.365 -28.017 40.540 1.00 104.16 ? -57  DC  J "C5'" 1 
ATOM   9339  C  "C4'" . DC  J 6 16  ? -63.262 -28.524 39.622 1.00 104.17 ? -57  DC  J "C4'" 1 
ATOM   9340  O  "O4'" . DC  J 6 16  ? -63.243 -29.971 39.507 1.00 103.95 ? -57  DC  J "O4'" 1 
ATOM   9341  C  "C3'" . DC  J 6 16  ? -63.335 -27.992 38.188 1.00 104.27 ? -57  DC  J "C3'" 1 
ATOM   9342  O  "O3'" . DC  J 6 16  ? -62.110 -27.348 37.874 1.00 104.04 ? -57  DC  J "O3'" 1 
ATOM   9343  C  "C2'" . DC  J 6 16  ? -63.530 -29.240 37.334 1.00 104.09 ? -57  DC  J "C2'" 1 
ATOM   9344  C  "C1'" . DC  J 6 16  ? -62.771 -30.232 38.204 1.00 104.25 ? -57  DC  J "C1'" 1 
ATOM   9345  N  N1    . DC  J 6 16  ? -62.938 -31.677 37.877 1.00 104.45 ? -57  DC  J N1    1 
ATOM   9346  C  C2    . DC  J 6 16  ? -62.044 -32.591 38.447 1.00 104.49 ? -57  DC  J C2    1 
ATOM   9347  O  O2    . DC  J 6 16  ? -61.155 -32.181 39.201 1.00 104.67 ? -57  DC  J O2    1 
ATOM   9348  N  N3    . DC  J 6 16  ? -62.175 -33.908 38.155 1.00 104.63 ? -57  DC  J N3    1 
ATOM   9349  C  C4    . DC  J 6 16  ? -63.145 -34.319 37.335 1.00 104.56 ? -57  DC  J C4    1 
ATOM   9350  N  N4    . DC  J 6 16  ? -63.225 -35.629 37.087 1.00 104.57 ? -57  DC  J N4    1 
ATOM   9351  C  C5    . DC  J 6 16  ? -64.071 -33.407 36.742 1.00 104.54 ? -57  DC  J C5    1 
ATOM   9352  C  C6    . DC  J 6 16  ? -63.930 -32.107 37.036 1.00 104.50 ? -57  DC  J C6    1 
ATOM   9353  P  P     . DA  J 6 17  ? -61.925 -25.779 38.131 1.00 104.27 ? -56  DA  J P     1 
ATOM   9354  O  OP1   . DA  J 6 17  ? -62.716 -25.364 39.313 1.00 104.03 ? -56  DA  J OP1   1 
ATOM   9355  O  OP2   . DA  J 6 17  ? -62.149 -25.121 36.825 1.00 104.43 ? -56  DA  J OP2   1 
ATOM   9356  O  "O5'" . DA  J 6 17  ? -60.375 -25.648 38.508 1.00 104.10 ? -56  DA  J "O5'" 1 
ATOM   9357  C  "C5'" . DA  J 6 17  ? -59.855 -26.214 39.715 1.00 103.63 ? -56  DA  J "C5'" 1 
ATOM   9358  C  "C4'" . DA  J 6 17  ? -58.521 -26.911 39.475 1.00 103.47 ? -56  DA  J "C4'" 1 
ATOM   9359  O  "O4'" . DA  J 6 17  ? -58.715 -28.214 38.865 1.00 103.18 ? -56  DA  J "O4'" 1 
ATOM   9360  C  "C3'" . DA  J 6 17  ? -57.538 -26.187 38.560 1.00 103.58 ? -56  DA  J "C3'" 1 
ATOM   9361  O  "O3'" . DA  J 6 17  ? -56.216 -26.497 38.992 1.00 104.05 ? -56  DA  J "O3'" 1 
ATOM   9362  C  "C2'" . DA  J 6 17  ? -57.829 -26.790 37.191 1.00 103.18 ? -56  DA  J "C2'" 1 
ATOM   9363  C  "C1'" . DA  J 6 17  ? -58.159 -28.229 37.564 1.00 103.11 ? -56  DA  J "C1'" 1 
ATOM   9364  N  N9    . DA  J 6 17  ? -59.147 -28.836 36.690 1.00 103.21 ? -56  DA  J N9    1 
ATOM   9365  C  C8    . DA  J 6 17  ? -60.082 -28.205 35.914 1.00 103.27 ? -56  DA  J C8    1 
ATOM   9366  N  N7    . DA  J 6 17  ? -60.841 -29.026 35.234 1.00 103.42 ? -56  DA  J N7    1 
ATOM   9367  C  C5    . DA  J 6 17  ? -60.372 -30.278 35.594 1.00 103.24 ? -56  DA  J C5    1 
ATOM   9368  C  C6    . DA  J 6 17  ? -60.754 -31.582 35.221 1.00 103.19 ? -56  DA  J C6    1 
ATOM   9369  N  N6    . DA  J 6 17  ? -61.744 -31.836 34.363 1.00 103.15 ? -56  DA  J N6    1 
ATOM   9370  N  N1    . DA  J 6 17  ? -60.073 -32.617 35.760 1.00 103.30 ? -56  DA  J N1    1 
ATOM   9371  C  C2    . DA  J 6 17  ? -59.076 -32.364 36.622 1.00 103.43 ? -56  DA  J C2    1 
ATOM   9372  N  N3    . DA  J 6 17  ? -58.630 -31.184 37.053 1.00 103.30 ? -56  DA  J N3    1 
ATOM   9373  C  C4    . DA  J 6 17  ? -59.326 -30.178 36.493 1.00 103.23 ? -56  DA  J C4    1 
ATOM   9374  P  P     . DG  J 6 18  ? -54.909 -26.060 38.176 1.00 103.70 ? -55  DG  J P     1 
ATOM   9375  O  OP1   . DG  J 6 18  ? -53.889 -25.732 39.199 1.00 103.25 ? -55  DG  J OP1   1 
ATOM   9376  O  OP2   . DG  J 6 18  ? -55.267 -25.081 37.123 1.00 103.40 ? -55  DG  J OP2   1 
ATOM   9377  O  "O5'" . DG  J 6 18  ? -54.494 -27.405 37.434 1.00 103.06 ? -55  DG  J "O5'" 1 
ATOM   9378  C  "C5'" . DG  J 6 18  ? -53.997 -28.495 38.185 1.00 103.28 ? -55  DG  J "C5'" 1 
ATOM   9379  C  "C4'" . DG  J 6 18  ? -53.799 -29.670 37.256 1.00 103.36 ? -55  DG  J "C4'" 1 
ATOM   9380  O  "O4'" . DG  J 6 18  ? -55.059 -29.954 36.596 1.00 103.81 ? -55  DG  J "O4'" 1 
ATOM   9381  C  "C3'" . DG  J 6 18  ? -52.783 -29.428 36.149 1.00 103.39 ? -55  DG  J "C3'" 1 
ATOM   9382  O  "O3'" . DG  J 6 18  ? -52.027 -30.607 35.977 1.00 103.80 ? -55  DG  J "O3'" 1 
ATOM   9383  C  "C2'" . DG  J 6 18  ? -53.653 -29.128 34.929 1.00 103.58 ? -55  DG  J "C2'" 1 
ATOM   9384  C  "C1'" . DG  J 6 18  ? -54.854 -30.027 35.199 1.00 103.70 ? -55  DG  J "C1'" 1 
ATOM   9385  N  N9    . DG  J 6 18  ? -56.083 -29.657 34.486 1.00 103.63 ? -55  DG  J N9    1 
ATOM   9386  C  C8    . DG  J 6 18  ? -56.586 -28.392 34.273 1.00 103.53 ? -55  DG  J C8    1 
ATOM   9387  N  N7    . DG  J 6 18  ? -57.702 -28.375 33.600 1.00 103.54 ? -55  DG  J N7    1 
ATOM   9388  C  C5    . DG  J 6 18  ? -57.958 -29.717 33.347 1.00 103.72 ? -55  DG  J C5    1 
ATOM   9389  C  C6    . DG  J 6 18  ? -59.033 -30.326 32.651 1.00 103.63 ? -55  DG  J C6    1 
ATOM   9390  O  O6    . DG  J 6 18  ? -59.994 -29.764 32.115 1.00 103.59 ? -55  DG  J O6    1 
ATOM   9391  N  N1    . DG  J 6 18  ? -58.923 -31.719 32.618 1.00 103.54 ? -55  DG  J N1    1 
ATOM   9392  C  C2    . DG  J 6 18  ? -57.894 -32.431 33.193 1.00 103.44 ? -55  DG  J C2    1 
ATOM   9393  N  N2    . DG  J 6 18  ? -57.938 -33.761 33.070 1.00 103.46 ? -55  DG  J N2    1 
ATOM   9394  N  N3    . DG  J 6 18  ? -56.880 -31.875 33.845 1.00 103.51 ? -55  DG  J N3    1 
ATOM   9395  C  C4    . DG  J 6 18  ? -56.973 -30.520 33.886 1.00 103.64 ? -55  DG  J C4    1 
ATOM   9396  P  P     . DA  J 6 19  ? -50.829 -30.648 34.924 1.00 104.12 ? -54  DA  J P     1 
ATOM   9397  O  OP1   . DA  J 6 19  ? -49.725 -29.903 35.567 1.00 104.37 ? -54  DA  J OP1   1 
ATOM   9398  O  OP2   . DA  J 6 19  ? -51.319 -30.279 33.575 1.00 103.81 ? -54  DA  J OP2   1 
ATOM   9399  O  "O5'" . DA  J 6 19  ? -50.450 -32.195 34.840 1.00 104.41 ? -54  DA  J "O5'" 1 
ATOM   9400  C  "C5'" . DA  J 6 19  ? -51.416 -33.176 35.164 1.00 105.14 ? -54  DA  J "C5'" 1 
ATOM   9401  C  "C4'" . DA  J 6 19  ? -52.059 -33.817 33.948 1.00 105.81 ? -54  DA  J "C4'" 1 
ATOM   9402  O  "O4'" . DA  J 6 19  ? -53.230 -33.066 33.549 1.00 105.44 ? -54  DA  J "O4'" 1 
ATOM   9403  C  "C3'" . DA  J 6 19  ? -51.197 -33.950 32.699 1.00 106.65 ? -54  DA  J "C3'" 1 
ATOM   9404  O  "O3'" . DA  J 6 19  ? -51.246 -35.295 32.265 1.00 109.21 ? -54  DA  J "O3'" 1 
ATOM   9405  C  "C2'" . DA  J 6 19  ? -51.880 -33.033 31.691 1.00 105.94 ? -54  DA  J "C2'" 1 
ATOM   9406  C  "C1'" . DA  J 6 19  ? -53.325 -33.171 32.151 1.00 104.83 ? -54  DA  J "C1'" 1 
ATOM   9407  N  N9    . DA  J 6 19  ? -54.237 -32.146 31.650 1.00 104.50 ? -54  DA  J N9    1 
ATOM   9408  C  C8    . DA  J 6 19  ? -54.108 -30.793 31.793 1.00 104.23 ? -54  DA  J C8    1 
ATOM   9409  N  N7    . DA  J 6 19  ? -55.077 -30.111 31.239 1.00 104.15 ? -54  DA  J N7    1 
ATOM   9410  C  C5    . DA  J 6 19  ? -55.898 -31.082 30.695 1.00 104.16 ? -54  DA  J C5    1 
ATOM   9411  C  C6    . DA  J 6 19  ? -57.103 -31.006 29.970 1.00 104.16 ? -54  DA  J C6    1 
ATOM   9412  N  N6    . DA  J 6 19  ? -57.696 -29.851 29.670 1.00 104.20 ? -54  DA  J N6    1 
ATOM   9413  N  N1    . DA  J 6 19  ? -57.675 -32.161 29.570 1.00 104.28 ? -54  DA  J N1    1 
ATOM   9414  C  C2    . DA  J 6 19  ? -57.078 -33.318 29.880 1.00 104.20 ? -54  DA  J C2    1 
ATOM   9415  N  N3    . DA  J 6 19  ? -55.944 -33.512 30.550 1.00 103.97 ? -54  DA  J N3    1 
ATOM   9416  C  C4    . DA  J 6 19  ? -55.398 -32.345 30.937 1.00 104.08 ? -54  DA  J C4    1 
ATOM   9417  P  P     . DT  J 6 20  ? -50.004 -35.935 31.489 1.00 111.62 ? -53  DT  J P     1 
ATOM   9418  O  OP1   . DT  J 6 20  ? -49.476 -37.029 32.337 1.00 111.39 ? -53  DT  J OP1   1 
ATOM   9419  O  OP2   . DT  J 6 20  ? -49.094 -34.845 31.071 1.00 111.36 ? -53  DT  J OP2   1 
ATOM   9420  O  "O5'" . DT  J 6 20  ? -50.682 -36.538 30.169 1.00 113.26 ? -53  DT  J "O5'" 1 
ATOM   9421  C  "C5'" . DT  J 6 20  ? -51.609 -37.607 30.274 1.00 116.84 ? -53  DT  J "C5'" 1 
ATOM   9422  C  "C4'" . DT  J 6 20  ? -52.790 -37.416 29.339 1.00 119.67 ? -53  DT  J "C4'" 1 
ATOM   9423  O  "O4'" . DT  J 6 20  ? -53.272 -36.050 29.364 1.00 120.59 ? -53  DT  J "O4'" 1 
ATOM   9424  C  "C3'" . DT  J 6 20  ? -52.494 -37.715 27.872 1.00 121.40 ? -53  DT  J "C3'" 1 
ATOM   9425  O  "O3'" . DT  J 6 20  ? -53.293 -38.813 27.441 1.00 123.47 ? -53  DT  J "O3'" 1 
ATOM   9426  C  "C2'" . DT  J 6 20  ? -52.877 -36.430 27.139 1.00 121.60 ? -53  DT  J "C2'" 1 
ATOM   9427  C  "C1'" . DT  J 6 20  ? -53.890 -35.847 28.111 1.00 121.77 ? -53  DT  J "C1'" 1 
ATOM   9428  N  N1    . DT  J 6 20  ? -54.239 -34.402 27.873 1.00 122.09 ? -53  DT  J N1    1 
ATOM   9429  C  C2    . DT  J 6 20  ? -55.450 -34.089 27.275 1.00 122.40 ? -53  DT  J C2    1 
ATOM   9430  O  O2    . DT  J 6 20  ? -56.277 -34.917 26.924 1.00 122.59 ? -53  DT  J O2    1 
ATOM   9431  N  N3    . DT  J 6 20  ? -55.676 -32.744 27.104 1.00 122.54 ? -53  DT  J N3    1 
ATOM   9432  C  C4    . DT  J 6 20  ? -54.838 -31.699 27.457 1.00 122.36 ? -53  DT  J C4    1 
ATOM   9433  O  O4    . DT  J 6 20  ? -55.153 -30.529 27.250 1.00 122.28 ? -53  DT  J O4    1 
ATOM   9434  C  C5    . DT  J 6 20  ? -53.587 -32.093 28.074 1.00 122.43 ? -53  DT  J C5    1 
ATOM   9435  C  C7    . DT  J 6 20  ? -52.578 -31.069 28.508 1.00 122.34 ? -53  DT  J C7    1 
ATOM   9436  C  C6    . DT  J 6 20  ? -53.353 -33.404 28.248 1.00 122.28 ? -53  DT  J C6    1 
ATOM   9437  P  P     . DA  J 6 21  ? -52.934 -39.614 26.101 1.00 125.16 ? -52  DA  J P     1 
ATOM   9438  O  OP1   . DA  J 6 21  ? -53.367 -41.018 26.287 1.00 125.08 ? -52  DA  J OP1   1 
ATOM   9439  O  OP2   . DA  J 6 21  ? -51.528 -39.320 25.737 1.00 125.04 ? -52  DA  J OP2   1 
ATOM   9440  O  "O5'" . DA  J 6 21  ? -53.861 -38.900 25.008 1.00 126.94 ? -52  DA  J "O5'" 1 
ATOM   9441  C  "C5'" . DA  J 6 21  ? -55.269 -39.126 24.955 1.00 129.53 ? -52  DA  J "C5'" 1 
ATOM   9442  C  "C4'" . DA  J 6 21  ? -55.892 -38.316 23.831 1.00 131.34 ? -52  DA  J "C4'" 1 
ATOM   9443  O  "O4'" . DA  J 6 21  ? -55.862 -36.910 24.188 1.00 131.73 ? -52  DA  J "O4'" 1 
ATOM   9444  C  "C3'" . DA  J 6 21  ? -55.186 -38.445 22.481 1.00 132.50 ? -52  DA  J "C3'" 1 
ATOM   9445  O  "O3'" . DA  J 6 21  ? -56.116 -38.866 21.479 1.00 134.45 ? -52  DA  J "O3'" 1 
ATOM   9446  C  "C2'" . DA  J 6 21  ? -54.625 -37.046 22.217 1.00 132.35 ? -52  DA  J "C2'" 1 
ATOM   9447  C  "C1'" . DA  J 6 21  ? -55.542 -36.150 23.041 1.00 132.11 ? -52  DA  J "C1'" 1 
ATOM   9448  N  N9    . DA  J 6 21  ? -54.941 -34.873 23.443 1.00 132.16 ? -52  DA  J N9    1 
ATOM   9449  C  C8    . DA  J 6 21  ? -53.788 -34.686 24.161 1.00 132.08 ? -52  DA  J C8    1 
ATOM   9450  N  N7    . DA  J 6 21  ? -53.483 -33.428 24.375 1.00 131.96 ? -52  DA  J N7    1 
ATOM   9451  C  C5    . DA  J 6 21  ? -54.507 -32.732 23.755 1.00 132.14 ? -52  DA  J C5    1 
ATOM   9452  C  C6    . DA  J 6 21  ? -54.774 -31.351 23.617 1.00 132.14 ? -52  DA  J C6    1 
ATOM   9453  N  N6    . DA  J 6 21  ? -53.985 -30.398 24.126 1.00 132.03 ? -52  DA  J N6    1 
ATOM   9454  N  N1    . DA  J 6 21  ? -55.889 -30.987 22.937 1.00 132.20 ? -52  DA  J N1    1 
ATOM   9455  C  C2    . DA  J 6 21  ? -56.679 -31.939 22.419 1.00 132.08 ? -52  DA  J C2    1 
ATOM   9456  N  N3    . DA  J 6 21  ? -56.532 -33.266 22.487 1.00 132.15 ? -52  DA  J N3    1 
ATOM   9457  C  C4    . DA  J 6 21  ? -55.418 -33.604 23.173 1.00 132.24 ? -52  DA  J C4    1 
ATOM   9458  P  P     . DC  J 6 22  ? -55.676 -39.228 19.977 1.00 136.08 ? -51  DC  J P     1 
ATOM   9459  O  OP1   . DC  J 6 22  ? -56.643 -40.220 19.467 1.00 136.16 ? -51  DC  J OP1   1 
ATOM   9460  O  OP2   . DC  J 6 22  ? -54.228 -39.539 19.935 1.00 135.69 ? -51  DC  J OP2   1 
ATOM   9461  O  "O5'" . DC  J 6 22  ? -55.917 -37.850 19.204 1.00 137.68 ? -51  DC  J "O5'" 1 
ATOM   9462  C  "C5'" . DC  J 6 22  ? -57.222 -37.278 19.144 1.00 140.33 ? -51  DC  J "C5'" 1 
ATOM   9463  C  "C4'" . DC  J 6 22  ? -57.210 -36.013 18.303 1.00 142.49 ? -51  DC  J "C4'" 1 
ATOM   9464  O  "O4'" . DC  J 6 22  ? -56.460 -34.982 18.993 1.00 142.87 ? -51  DC  J "O4'" 1 
ATOM   9465  C  "C3'" . DC  J 6 22  ? -56.577 -36.168 16.924 1.00 143.86 ? -51  DC  J "C3'" 1 
ATOM   9466  O  "O3'" . DC  J 6 22  ? -57.437 -35.614 15.936 1.00 145.96 ? -51  DC  J "O3'" 1 
ATOM   9467  C  "C2'" . DC  J 6 22  ? -55.255 -35.406 17.012 1.00 143.59 ? -51  DC  J "C2'" 1 
ATOM   9468  C  "C1'" . DC  J 6 22  ? -55.521 -34.389 18.119 1.00 143.26 ? -51  DC  J "C1'" 1 
ATOM   9469  N  N1    . DC  J 6 22  ? -54.316 -34.012 18.932 1.00 143.34 ? -51  DC  J N1    1 
ATOM   9470  C  C2    . DC  J 6 22  ? -54.182 -32.705 19.445 1.00 143.33 ? -51  DC  J C2    1 
ATOM   9471  O  O2    . DC  J 6 22  ? -55.057 -31.856 19.220 1.00 143.10 ? -51  DC  J O2    1 
ATOM   9472  N  N3    . DC  J 6 22  ? -53.076 -32.402 20.182 1.00 143.37 ? -51  DC  J N3    1 
ATOM   9473  C  C4    . DC  J 6 22  ? -52.139 -33.332 20.415 1.00 143.33 ? -51  DC  J C4    1 
ATOM   9474  N  N4    . DC  J 6 22  ? -51.070 -32.990 21.144 1.00 143.23 ? -51  DC  J N4    1 
ATOM   9475  C  C5    . DC  J 6 22  ? -52.258 -34.663 19.908 1.00 143.28 ? -51  DC  J C5    1 
ATOM   9476  C  C6    . DC  J 6 22  ? -53.349 -34.952 19.184 1.00 143.37 ? -51  DC  J C6    1 
ATOM   9477  P  P     . DT  J 6 23  ? -57.624 -36.344 14.521 1.00 147.57 ? -50  DT  J P     1 
ATOM   9478  O  OP1   . DT  J 6 23  ? -58.721 -37.326 14.669 1.00 147.33 ? -50  DT  J OP1   1 
ATOM   9479  O  OP2   . DT  J 6 23  ? -56.289 -36.798 14.059 1.00 147.54 ? -50  DT  J OP2   1 
ATOM   9480  O  "O5'" . DT  J 6 23  ? -58.121 -35.170 13.547 1.00 148.92 ? -50  DT  J "O5'" 1 
ATOM   9481  C  "C5'" . DT  J 6 23  ? -58.071 -33.791 13.936 1.00 151.32 ? -50  DT  J "C5'" 1 
ATOM   9482  C  "C4'" . DT  J 6 23  ? -56.837 -33.064 13.415 1.00 153.20 ? -50  DT  J "C4'" 1 
ATOM   9483  O  "O4'" . DT  J 6 23  ? -55.953 -32.739 14.518 1.00 153.44 ? -50  DT  J "O4'" 1 
ATOM   9484  C  "C3'" . DT  J 6 23  ? -55.933 -33.820 12.431 1.00 154.37 ? -50  DT  J "C3'" 1 
ATOM   9485  O  "O3'" . DT  J 6 23  ? -56.367 -33.699 11.037 1.00 156.04 ? -50  DT  J "O3'" 1 
ATOM   9486  C  "C2'" . DT  J 6 23  ? -54.518 -33.310 12.740 1.00 154.10 ? -50  DT  J "C2'" 1 
ATOM   9487  C  "C1'" . DT  J 6 23  ? -54.743 -32.344 13.907 1.00 153.85 ? -50  DT  J "C1'" 1 
ATOM   9488  N  N1    . DT  J 6 23  ? -53.616 -32.213 14.918 1.00 153.91 ? -50  DT  J N1    1 
ATOM   9489  C  C2    . DT  J 6 23  ? -53.699 -31.226 15.888 1.00 153.95 ? -50  DT  J C2    1 
ATOM   9490  O  O2    . DT  J 6 23  ? -54.642 -30.458 15.990 1.00 153.90 ? -50  DT  J O2    1 
ATOM   9491  N  N3    . DT  J 6 23  ? -52.628 -31.172 16.752 1.00 153.97 ? -50  DT  J N3    1 
ATOM   9492  C  C4    . DT  J 6 23  ? -51.501 -31.980 16.749 1.00 153.90 ? -50  DT  J C4    1 
ATOM   9493  O  O4    . DT  J 6 23  ? -50.599 -31.845 17.573 1.00 153.82 ? -50  DT  J O4    1 
ATOM   9494  C  C5    . DT  J 6 23  ? -51.469 -32.985 15.710 1.00 153.95 ? -50  DT  J C5    1 
ATOM   9495  C  C7    . DT  J 6 23  ? -50.302 -33.924 15.597 1.00 153.94 ? -50  DT  J C7    1 
ATOM   9496  C  C6    . DT  J 6 23  ? -52.507 -33.048 14.858 1.00 153.97 ? -50  DT  J C6    1 
ATOM   9497  P  P     . DA  J 6 24  ? -56.212 -32.433 10.047 1.00 157.35 ? -49  DA  J P     1 
ATOM   9498  O  OP1   . DA  J 6 24  ? -56.807 -32.850 8.756  1.00 157.29 ? -49  DA  J OP1   1 
ATOM   9499  O  OP2   . DA  J 6 24  ? -54.810 -31.957 10.069 1.00 157.28 ? -49  DA  J OP2   1 
ATOM   9500  O  "O5'" . DA  J 6 24  ? -57.139 -31.296 10.694 1.00 158.16 ? -49  DA  J "O5'" 1 
ATOM   9501  C  "C5'" . DA  J 6 24  ? -57.664 -30.228 9.898  1.00 159.12 ? -49  DA  J "C5'" 1 
ATOM   9502  C  "C4'" . DA  J 6 24  ? -56.952 -28.910 10.165 1.00 159.85 ? -49  DA  J "C4'" 1 
ATOM   9503  O  "O4'" . DA  J 6 24  ? -56.122 -28.995 11.357 1.00 160.28 ? -49  DA  J "O4'" 1 
ATOM   9504  C  "C3'" . DA  J 6 24  ? -56.031 -28.435 9.041  1.00 160.14 ? -49  DA  J "C3'" 1 
ATOM   9505  O  "O3'" . DA  J 6 24  ? -56.352 -27.062 8.733  1.00 160.21 ? -49  DA  J "O3'" 1 
ATOM   9506  C  "C2'" . DA  J 6 24  ? -54.632 -28.649 9.629  1.00 160.35 ? -49  DA  J "C2'" 1 
ATOM   9507  C  "C1'" . DA  J 6 24  ? -54.903 -28.332 11.094 1.00 160.76 ? -49  DA  J "C1'" 1 
ATOM   9508  N  N9    . DA  J 6 24  ? -53.868 -28.766 12.036 1.00 160.97 ? -49  DA  J N9    1 
ATOM   9509  C  C8    . DA  J 6 24  ? -53.307 -30.010 12.128 1.00 160.98 ? -49  DA  J C8    1 
ATOM   9510  N  N7    . DA  J 6 24  ? -52.402 -30.124 13.070 1.00 160.93 ? -49  DA  J N7    1 
ATOM   9511  C  C5    . DA  J 6 24  ? -52.359 -28.866 13.641 1.00 161.05 ? -49  DA  J C5    1 
ATOM   9512  C  C6    . DA  J 6 24  ? -51.590 -28.331 14.697 1.00 161.02 ? -49  DA  J C6    1 
ATOM   9513  N  N6    . DA  J 6 24  ? -50.690 -29.047 15.382 1.00 160.95 ? -49  DA  J N6    1 
ATOM   9514  N  N1    . DA  J 6 24  ? -51.785 -27.029 15.020 1.00 161.05 ? -49  DA  J N1    1 
ATOM   9515  C  C2    . DA  J 6 24  ? -52.692 -26.315 14.331 1.00 160.99 ? -49  DA  J C2    1 
ATOM   9516  N  N3    . DA  J 6 24  ? -53.471 -26.711 13.320 1.00 161.04 ? -49  DA  J N3    1 
ATOM   9517  C  C4    . DA  J 6 24  ? -53.255 -28.010 13.016 1.00 161.07 ? -49  DA  J C4    1 
ATOM   9518  P  P     . DC  J 6 25  ? -55.286 -25.982 8.199  1.00 160.17 ? -48  DC  J P     1 
ATOM   9519  O  OP1   . DC  J 6 25  ? -56.033 -24.767 7.801  1.00 160.20 ? -48  DC  J OP1   1 
ATOM   9520  O  OP2   . DC  J 6 25  ? -54.405 -26.650 7.209  1.00 160.09 ? -48  DC  J OP2   1 
ATOM   9521  O  "O5'" . DC  J 6 25  ? -54.445 -25.638 9.522  1.00 159.50 ? -48  DC  J "O5'" 1 
ATOM   9522  C  "C5'" . DC  J 6 25  ? -53.497 -24.580 9.563  1.00 158.28 ? -48  DC  J "C5'" 1 
ATOM   9523  C  "C4'" . DC  J 6 25  ? -52.081 -25.107 9.390  1.00 157.33 ? -48  DC  J "C4'" 1 
ATOM   9524  O  "O4'" . DC  J 6 25  ? -51.830 -26.237 10.265 1.00 157.39 ? -48  DC  J "O4'" 1 
ATOM   9525  C  "C3'" . DC  J 6 25  ? -51.710 -25.577 7.977  1.00 156.50 ? -48  DC  J "C3'" 1 
ATOM   9526  O  "O3'" . DC  J 6 25  ? -50.765 -24.690 7.364  1.00 155.17 ? -48  DC  J "O3'" 1 
ATOM   9527  C  "C2'" . DC  J 6 25  ? -51.115 -26.972 8.197  1.00 156.76 ? -48  DC  J "C2'" 1 
ATOM   9528  C  "C1'" . DC  J 6 25  ? -50.731 -26.901 9.677  1.00 157.00 ? -48  DC  J "C1'" 1 
ATOM   9529  N  N1    . DC  J 6 25  ? -50.387 -28.190 10.416 1.00 156.88 ? -48  DC  J N1    1 
ATOM   9530  C  C2    . DC  J 6 25  ? -49.750 -28.119 11.674 1.00 156.63 ? -48  DC  J C2    1 
ATOM   9531  O  O2    . DC  J 6 25  ? -49.480 -27.019 12.176 1.00 156.53 ? -48  DC  J O2    1 
ATOM   9532  N  N3    . DC  J 6 25  ? -49.438 -29.271 12.325 1.00 156.52 ? -48  DC  J N3    1 
ATOM   9533  C  C4    . DC  J 6 25  ? -49.731 -30.454 11.780 1.00 156.66 ? -48  DC  J C4    1 
ATOM   9534  N  N4    . DC  J 6 25  ? -49.404 -31.550 12.470 1.00 156.68 ? -48  DC  J N4    1 
ATOM   9535  C  C5    . DC  J 6 25  ? -50.373 -30.558 10.506 1.00 156.67 ? -48  DC  J C5    1 
ATOM   9536  C  C6    . DC  J 6 25  ? -50.679 -29.416 9.870  1.00 156.82 ? -48  DC  J C6    1 
ATOM   9537  P  P     . DC  J 6 26  ? -51.153 -23.264 6.723  1.00 154.08 ? -47  DC  J P     1 
ATOM   9538  O  OP1   . DC  J 6 26  ? -52.572 -22.940 6.992  1.00 153.90 ? -47  DC  J OP1   1 
ATOM   9539  O  OP2   . DC  J 6 26  ? -50.673 -23.274 5.325  1.00 154.08 ? -47  DC  J OP2   1 
ATOM   9540  O  "O5'" . DC  J 6 26  ? -50.228 -22.230 7.527  1.00 152.97 ? -47  DC  J "O5'" 1 
ATOM   9541  C  "C5'" . DC  J 6 26  ? -49.888 -22.412 8.909  1.00 151.19 ? -47  DC  J "C5'" 1 
ATOM   9542  C  "C4'" . DC  J 6 26  ? -48.477 -22.956 9.115  1.00 149.89 ? -47  DC  J "C4'" 1 
ATOM   9543  O  "O4'" . DC  J 6 26  ? -48.494 -24.333 9.577  1.00 149.56 ? -47  DC  J "O4'" 1 
ATOM   9544  C  "C3'" . DC  J 6 26  ? -47.538 -22.934 7.900  1.00 148.98 ? -47  DC  J "C3'" 1 
ATOM   9545  O  "O3'" . DC  J 6 26  ? -46.397 -22.097 8.140  1.00 147.76 ? -47  DC  J "O3'" 1 
ATOM   9546  C  "C2'" . DC  J 6 26  ? -47.124 -24.397 7.750  1.00 148.98 ? -47  DC  J "C2'" 1 
ATOM   9547  C  "C1'" . DC  J 6 26  ? -47.235 -24.849 9.204  1.00 149.22 ? -47  DC  J "C1'" 1 
ATOM   9548  N  N1    . DC  J 6 26  ? -47.138 -26.329 9.498  1.00 149.14 ? -47  DC  J N1    1 
ATOM   9549  C  C2    . DC  J 6 26  ? -46.685 -26.768 10.758 1.00 149.04 ? -47  DC  J C2    1 
ATOM   9550  O  O2    . DC  J 6 26  ? -46.371 -25.947 11.630 1.00 149.05 ? -47  DC  J O2    1 
ATOM   9551  N  N3    . DC  J 6 26  ? -46.604 -28.103 11.001 1.00 148.99 ? -47  DC  J N3    1 
ATOM   9552  C  C4    . DC  J 6 26  ? -46.945 -28.984 10.056 1.00 149.04 ? -47  DC  J C4    1 
ATOM   9553  N  N4    . DC  J 6 26  ? -46.848 -30.285 10.344 1.00 149.08 ? -47  DC  J N4    1 
ATOM   9554  C  C5    . DC  J 6 26  ? -47.405 -28.565 8.773  1.00 149.09 ? -47  DC  J C5    1 
ATOM   9555  C  C6    . DC  J 6 26  ? -47.482 -27.247 8.541  1.00 149.17 ? -47  DC  J C6    1 
ATOM   9556  P  P     . DA  J 6 27  ? -46.512 -20.521 8.448  1.00 146.85 ? -46  DA  J P     1 
ATOM   9557  O  OP1   . DA  J 6 27  ? -46.957 -20.350 9.852  1.00 146.79 ? -46  DA  J OP1   1 
ATOM   9558  O  OP2   . DA  J 6 27  ? -47.291 -19.890 7.359  1.00 146.76 ? -46  DA  J OP2   1 
ATOM   9559  O  "O5'" . DA  J 6 27  ? -44.988 -20.035 8.301  1.00 145.74 ? -46  DA  J "O5'" 1 
ATOM   9560  C  "C5'" . DA  J 6 27  ? -44.332 -19.276 9.331  1.00 143.49 ? -46  DA  J "C5'" 1 
ATOM   9561  C  "C4'" . DA  J 6 27  ? -43.338 -20.120 10.123 1.00 141.65 ? -46  DA  J "C4'" 1 
ATOM   9562  O  "O4'" . DA  J 6 27  ? -43.717 -21.523 10.098 1.00 141.23 ? -46  DA  J "O4'" 1 
ATOM   9563  C  "C3'" . DA  J 6 27  ? -41.892 -20.084 9.638  1.00 140.47 ? -46  DA  J "C3'" 1 
ATOM   9564  O  "O3'" . DA  J 6 27  ? -41.040 -20.226 10.758 1.00 139.29 ? -46  DA  J "O3'" 1 
ATOM   9565  C  "C2'" . DA  J 6 27  ? -41.813 -21.327 8.765  1.00 140.37 ? -46  DA  J "C2'" 1 
ATOM   9566  C  "C1'" . DA  J 6 27  ? -42.624 -22.284 9.631  1.00 140.66 ? -46  DA  J "C1'" 1 
ATOM   9567  N  N9    . DA  J 6 27  ? -43.130 -23.469 8.947  1.00 140.60 ? -46  DA  J N9    1 
ATOM   9568  C  C8    . DA  J 6 27  ? -43.645 -23.559 7.684  1.00 140.70 ? -46  DA  J C8    1 
ATOM   9569  N  N7    . DA  J 6 27  ? -44.016 -24.772 7.348  1.00 140.73 ? -46  DA  J N7    1 
ATOM   9570  C  C5    . DA  J 6 27  ? -43.729 -25.533 8.467  1.00 140.53 ? -46  DA  J C5    1 
ATOM   9571  C  C6    . DA  J 6 27  ? -43.885 -26.905 8.763  1.00 140.46 ? -46  DA  J C6    1 
ATOM   9572  N  N6    . DA  J 6 27  ? -44.391 -27.796 7.913  1.00 140.52 ? -46  DA  J N6    1 
ATOM   9573  N  N1    . DA  J 6 27  ? -43.494 -27.338 9.977  1.00 140.69 ? -46  DA  J N1    1 
ATOM   9574  C  C2    . DA  J 6 27  ? -42.978 -26.450 10.838 1.00 140.82 ? -46  DA  J C2    1 
ATOM   9575  N  N3    . DA  J 6 27  ? -42.781 -25.141 10.677 1.00 140.74 ? -46  DA  J N3    1 
ATOM   9576  C  C4    . DA  J 6 27  ? -43.182 -24.741 9.460  1.00 140.58 ? -46  DA  J C4    1 
ATOM   9577  P  P     . DA  J 6 28  ? -39.750 -19.299 10.970 1.00 138.64 ? -45  DA  J P     1 
ATOM   9578  O  OP1   . DA  J 6 28  ? -40.214 -17.913 11.202 1.00 138.70 ? -45  DA  J OP1   1 
ATOM   9579  O  OP2   . DA  J 6 28  ? -38.792 -19.585 9.877  1.00 138.54 ? -45  DA  J OP2   1 
ATOM   9580  O  "O5'" . DA  J 6 28  ? -39.120 -19.836 12.346 1.00 137.09 ? -45  DA  J "O5'" 1 
ATOM   9581  C  "C5'" . DA  J 6 28  ? -39.577 -21.046 12.966 1.00 134.30 ? -45  DA  J "C5'" 1 
ATOM   9582  C  "C4'" . DA  J 6 28  ? -38.683 -22.231 12.629 1.00 132.21 ? -45  DA  J "C4'" 1 
ATOM   9583  O  "O4'" . DA  J 6 28  ? -39.367 -23.151 11.738 1.00 131.96 ? -45  DA  J "O4'" 1 
ATOM   9584  C  "C3'" . DA  J 6 28  ? -37.343 -21.902 11.956 1.00 130.59 ? -45  DA  J "C3'" 1 
ATOM   9585  O  "O3'" . DA  J 6 28  ? -36.265 -22.565 12.608 1.00 128.15 ? -45  DA  J "O3'" 1 
ATOM   9586  C  "C2'" . DA  J 6 28  ? -37.513 -22.440 10.539 1.00 131.03 ? -45  DA  J "C2'" 1 
ATOM   9587  C  "C1'" . DA  J 6 28  ? -38.401 -23.641 10.834 1.00 131.54 ? -45  DA  J "C1'" 1 
ATOM   9588  N  N9    . DA  J 6 28  ? -39.062 -24.232 9.676  1.00 131.52 ? -45  DA  J N9    1 
ATOM   9589  C  C8    . DA  J 6 28  ? -39.405 -23.619 8.506  1.00 131.51 ? -45  DA  J C8    1 
ATOM   9590  N  N7    . DA  J 6 28  ? -39.994 -24.414 7.649  1.00 131.56 ? -45  DA  J N7    1 
ATOM   9591  C  C5    . DA  J 6 28  ? -40.039 -25.634 8.299  1.00 131.56 ? -45  DA  J C5    1 
ATOM   9592  C  C6    . DA  J 6 28  ? -40.542 -26.901 7.929  1.00 131.66 ? -45  DA  J C6    1 
ATOM   9593  N  N6    . DA  J 6 28  ? -41.121 -27.149 6.751  1.00 131.59 ? -45  DA  J N6    1 
ATOM   9594  N  N1    . DA  J 6 28  ? -40.427 -27.913 8.818  1.00 131.63 ? -45  DA  J N1    1 
ATOM   9595  C  C2    . DA  J 6 28  ? -39.845 -27.670 9.999  1.00 131.55 ? -45  DA  J C2    1 
ATOM   9596  N  N3    . DA  J 6 28  ? -39.338 -26.524 10.456 1.00 131.55 ? -45  DA  J N3    1 
ATOM   9597  C  C4    . DA  J 6 28  ? -39.467 -25.538 9.552  1.00 131.52 ? -45  DA  J C4    1 
ATOM   9598  P  P     . DA  J 6 29  ? -35.972 -22.406 14.174 1.00 125.89 ? -44  DA  J P     1 
ATOM   9599  O  OP1   . DA  J 6 29  ? -36.733 -23.439 14.909 1.00 126.02 ? -44  DA  J OP1   1 
ATOM   9600  O  OP2   . DA  J 6 29  ? -36.156 -20.983 14.528 1.00 126.17 ? -44  DA  J OP2   1 
ATOM   9601  O  "O5'" . DA  J 6 29  ? -34.411 -22.754 14.265 1.00 124.60 ? -44  DA  J "O5'" 1 
ATOM   9602  C  "C5'" . DA  J 6 29  ? -33.846 -23.769 13.445 1.00 122.25 ? -44  DA  J "C5'" 1 
ATOM   9603  C  "C4'" . DA  J 6 29  ? -34.309 -25.147 13.900 1.00 120.59 ? -44  DA  J "C4'" 1 
ATOM   9604  O  "O4'" . DA  J 6 29  ? -35.443 -25.607 13.115 1.00 119.71 ? -44  DA  J "O4'" 1 
ATOM   9605  C  "C3'" . DA  J 6 29  ? -33.266 -26.245 13.789 1.00 119.76 ? -44  DA  J "C3'" 1 
ATOM   9606  O  "O3'" . DA  J 6 29  ? -33.498 -27.191 14.822 1.00 118.85 ? -44  DA  J "O3'" 1 
ATOM   9607  C  "C2'" . DA  J 6 29  ? -33.545 -26.801 12.399 1.00 119.57 ? -44  DA  J "C2'" 1 
ATOM   9608  C  "C1'" . DA  J 6 29  ? -35.054 -26.659 12.250 1.00 119.09 ? -44  DA  J "C1'" 1 
ATOM   9609  N  N9    . DA  J 6 29  ? -35.466 -26.348 10.875 1.00 119.04 ? -44  DA  J N9    1 
ATOM   9610  C  C8    . DA  J 6 29  ? -35.415 -25.130 10.255 1.00 118.73 ? -44  DA  J C8    1 
ATOM   9611  N  N7    . DA  J 6 29  ? -35.852 -25.136 9.020  1.00 118.44 ? -44  DA  J N7    1 
ATOM   9612  C  C5    . DA  J 6 29  ? -36.207 -26.453 8.805  1.00 118.59 ? -44  DA  J C5    1 
ATOM   9613  C  C6    . DA  J 6 29  ? -36.738 -27.123 7.687  1.00 118.74 ? -44  DA  J C6    1 
ATOM   9614  N  N6    . DA  J 6 29  ? -37.010 -26.511 6.535  1.00 118.79 ? -44  DA  J N6    1 
ATOM   9615  N  N1    . DA  J 6 29  ? -36.980 -28.447 7.790  1.00 118.90 ? -44  DA  J N1    1 
ATOM   9616  C  C2    . DA  J 6 29  ? -36.708 -29.064 8.947  1.00 118.83 ? -44  DA  J C2    1 
ATOM   9617  N  N3    . DA  J 6 29  ? -36.209 -28.538 10.066 1.00 118.86 ? -44  DA  J N3    1 
ATOM   9618  C  C4    . DA  J 6 29  ? -35.977 -27.218 9.933  1.00 118.81 ? -44  DA  J C4    1 
ATOM   9619  P  P     . DA  J 6 30  ? -32.684 -28.559 14.950 1.00 118.07 ? -43  DA  J P     1 
ATOM   9620  O  OP1   . DA  J 6 30  ? -32.796 -28.975 16.363 1.00 118.45 ? -43  DA  J OP1   1 
ATOM   9621  O  OP2   . DA  J 6 30  ? -31.349 -28.408 14.328 1.00 117.95 ? -43  DA  J OP2   1 
ATOM   9622  O  "O5'" . DA  J 6 30  ? -33.560 -29.549 14.050 1.00 117.80 ? -43  DA  J "O5'" 1 
ATOM   9623  C  "C5'" . DA  J 6 30  ? -33.711 -30.921 14.387 1.00 117.01 ? -43  DA  J "C5'" 1 
ATOM   9624  C  "C4'" . DA  J 6 30  ? -33.481 -31.769 13.154 1.00 116.36 ? -43  DA  J "C4'" 1 
ATOM   9625  O  "O4'" . DA  J 6 30  ? -33.932 -31.051 11.975 1.00 116.53 ? -43  DA  J "O4'" 1 
ATOM   9626  C  "C3'" . DA  J 6 30  ? -32.022 -32.132 12.914 1.00 115.78 ? -43  DA  J "C3'" 1 
ATOM   9627  O  "O3'" . DA  J 6 30  ? -31.919 -33.546 12.805 1.00 115.17 ? -43  DA  J "O3'" 1 
ATOM   9628  C  "C2'" . DA  J 6 30  ? -31.665 -31.416 11.612 1.00 116.11 ? -43  DA  J "C2'" 1 
ATOM   9629  C  "C1'" . DA  J 6 30  ? -33.015 -31.263 10.925 1.00 116.78 ? -43  DA  J "C1'" 1 
ATOM   9630  N  N9    . DA  J 6 30  ? -33.065 -30.136 9.990  1.00 116.90 ? -43  DA  J N9    1 
ATOM   9631  C  C8    . DA  J 6 30  ? -32.817 -28.827 10.282 1.00 116.93 ? -43  DA  J C8    1 
ATOM   9632  N  N7    . DA  J 6 30  ? -32.923 -28.007 9.266  1.00 116.97 ? -43  DA  J N7    1 
ATOM   9633  C  C5    . DA  J 6 30  ? -33.263 -28.838 8.218  1.00 117.05 ? -43  DA  J C5    1 
ATOM   9634  C  C6    . DA  J 6 30  ? -33.517 -28.582 6.855  1.00 116.91 ? -43  DA  J C6    1 
ATOM   9635  N  N6    . DA  J 6 30  ? -33.465 -27.363 6.313  1.00 116.82 ? -43  DA  J N6    1 
ATOM   9636  N  N1    . DA  J 6 30  ? -33.824 -29.633 6.066  1.00 117.15 ? -43  DA  J N1    1 
ATOM   9637  C  C2    . DA  J 6 30  ? -33.882 -30.859 6.609  1.00 117.16 ? -43  DA  J C2    1 
ATOM   9638  N  N3    . DA  J 6 30  ? -33.663 -31.221 7.875  1.00 117.23 ? -43  DA  J N3    1 
ATOM   9639  C  C4    . DA  J 6 30  ? -33.355 -30.155 8.641  1.00 117.15 ? -43  DA  J C4    1 
ATOM   9640  P  P     . DG  J 6 31  ? -30.552 -34.286 12.414 1.00 114.89 ? -42  DG  J P     1 
ATOM   9641  O  OP1   . DG  J 6 31  ? -30.519 -35.574 13.142 1.00 114.79 ? -42  DG  J OP1   1 
ATOM   9642  O  OP2   . DG  J 6 31  ? -29.423 -33.341 12.565 1.00 114.68 ? -42  DG  J OP2   1 
ATOM   9643  O  "O5'" . DG  J 6 31  ? -30.753 -34.562 10.849 1.00 115.22 ? -42  DG  J "O5'" 1 
ATOM   9644  C  "C5'" . DG  J 6 31  ? -31.903 -35.273 10.365 1.00 115.32 ? -42  DG  J "C5'" 1 
ATOM   9645  C  "C4'" . DG  J 6 31  ? -31.827 -35.597 8.877  1.00 115.02 ? -42  DG  J "C4'" 1 
ATOM   9646  O  "O4'" . DG  J 6 31  ? -32.032 -34.394 8.099  1.00 115.06 ? -42  DG  J "O4'" 1 
ATOM   9647  C  "C3'" . DG  J 6 31  ? -30.526 -36.210 8.368  1.00 115.12 ? -42  DG  J "C3'" 1 
ATOM   9648  O  "O3'" . DG  J 6 31  ? -30.858 -37.234 7.435  1.00 115.45 ? -42  DG  J "O3'" 1 
ATOM   9649  C  "C2'" . DG  J 6 31  ? -29.800 -35.026 7.727  1.00 115.28 ? -42  DG  J "C2'" 1 
ATOM   9650  C  "C1'" . DG  J 6 31  ? -30.962 -34.195 7.197  1.00 115.61 ? -42  DG  J "C1'" 1 
ATOM   9651  N  N9    . DG  J 6 31  ? -30.731 -32.753 7.115  1.00 115.70 ? -42  DG  J N9    1 
ATOM   9652  C  C8    . DG  J 6 31  ? -30.517 -31.894 8.165  1.00 115.81 ? -42  DG  J C8    1 
ATOM   9653  N  N7    . DG  J 6 31  ? -30.356 -30.653 7.805  1.00 115.82 ? -42  DG  J N7    1 
ATOM   9654  C  C5    . DG  J 6 31  ? -30.475 -30.686 6.423  1.00 116.08 ? -42  DG  J C5    1 
ATOM   9655  C  C6    . DG  J 6 31  ? -30.393 -29.635 5.476  1.00 115.97 ? -42  DG  J C6    1 
ATOM   9656  O  O6    . DG  J 6 31  ? -30.191 -28.435 5.691  1.00 115.97 ? -42  DG  J O6    1 
ATOM   9657  N  N1    . DG  J 6 31  ? -30.568 -30.079 4.165  1.00 115.86 ? -42  DG  J N1    1 
ATOM   9658  C  C2    . DG  J 6 31  ? -30.799 -31.388 3.814  1.00 115.93 ? -42  DG  J C2    1 
ATOM   9659  N  N2    . DG  J 6 31  ? -30.945 -31.633 2.502  1.00 116.00 ? -42  DG  J N2    1 
ATOM   9660  N  N3    . DG  J 6 31  ? -30.880 -32.386 4.692  1.00 116.13 ? -42  DG  J N3    1 
ATOM   9661  C  C4    . DG  J 6 31  ? -30.709 -31.970 5.978  1.00 116.08 ? -42  DG  J C4    1 
ATOM   9662  P  P     . DT  J 6 32  ? -29.760 -38.129 6.694  1.00 115.71 ? -41  DT  J P     1 
ATOM   9663  O  OP1   . DT  J 6 32  ? -30.380 -39.445 6.430  1.00 115.79 ? -41  DT  J OP1   1 
ATOM   9664  O  OP2   . DT  J 6 32  ? -28.487 -38.061 7.439  1.00 115.21 ? -41  DT  J OP2   1 
ATOM   9665  O  "O5'" . DT  J 6 32  ? -29.553 -37.354 5.311  1.00 117.41 ? -41  DT  J "O5'" 1 
ATOM   9666  C  "C5'" . DT  J 6 32  ? -30.623 -37.202 4.380  1.00 119.67 ? -41  DT  J "C5'" 1 
ATOM   9667  C  "C4'" . DT  J 6 32  ? -30.167 -36.518 3.100  1.00 121.54 ? -41  DT  J "C4'" 1 
ATOM   9668  O  "O4'" . DT  J 6 32  ? -29.807 -35.139 3.362  1.00 122.27 ? -41  DT  J "O4'" 1 
ATOM   9669  C  "C3'" . DT  J 6 32  ? -28.958 -37.152 2.413  1.00 122.64 ? -41  DT  J "C3'" 1 
ATOM   9670  O  "O3'" . DT  J 6 32  ? -29.277 -37.404 1.051  1.00 123.59 ? -41  DT  J "O3'" 1 
ATOM   9671  C  "C2'" . DT  J 6 32  ? -27.848 -36.111 2.539  1.00 122.96 ? -41  DT  J "C2'" 1 
ATOM   9672  C  "C1'" . DT  J 6 32  ? -28.658 -34.822 2.602  1.00 123.76 ? -41  DT  J "C1'" 1 
ATOM   9673  N  N1    . DT  J 6 32  ? -27.940 -33.674 3.243  1.00 124.25 ? -41  DT  J N1    1 
ATOM   9674  C  C2    . DT  J 6 32  ? -27.846 -32.455 2.586  1.00 124.43 ? -41  DT  J C2    1 
ATOM   9675  O  O2    . DT  J 6 32  ? -28.319 -32.221 1.487  1.00 124.50 ? -41  DT  J O2    1 
ATOM   9676  N  N3    . DT  J 6 32  ? -27.167 -31.484 3.280  1.00 124.67 ? -41  DT  J N3    1 
ATOM   9677  C  C4    . DT  J 6 32  ? -26.578 -31.602 4.530  1.00 124.57 ? -41  DT  J C4    1 
ATOM   9678  O  O4    . DT  J 6 32  ? -25.989 -30.662 5.057  1.00 124.49 ? -41  DT  J O4    1 
ATOM   9679  C  C5    . DT  J 6 32  ? -26.709 -32.899 5.161  1.00 124.65 ? -41  DT  J C5    1 
ATOM   9680  C  C7    . DT  J 6 32  ? -26.118 -33.161 6.517  1.00 124.46 ? -41  DT  J C7    1 
ATOM   9681  C  C6    . DT  J 6 32  ? -27.374 -33.857 4.496  1.00 124.49 ? -41  DT  J C6    1 
ATOM   9682  P  P     . DG  J 6 33  ? -28.358 -38.350 0.150  1.00 124.02 ? -40  DG  J P     1 
ATOM   9683  O  OP1   . DG  J 6 33  ? -29.259 -39.080 -0.768 1.00 124.22 ? -40  DG  J OP1   1 
ATOM   9684  O  OP2   . DG  J 6 33  ? -27.425 -39.104 1.019  1.00 124.15 ? -40  DG  J OP2   1 
ATOM   9685  O  "O5'" . DG  J 6 33  ? -27.491 -37.288 -0.663 1.00 124.75 ? -40  DG  J "O5'" 1 
ATOM   9686  C  "C5'" . DG  J 6 33  ? -28.069 -36.562 -1.732 1.00 126.66 ? -40  DG  J "C5'" 1 
ATOM   9687  C  "C4'" . DG  J 6 33  ? -27.108 -35.483 -2.183 1.00 128.11 ? -40  DG  J "C4'" 1 
ATOM   9688  O  "O4'" . DG  J 6 33  ? -26.890 -34.560 -1.081 1.00 128.77 ? -40  DG  J "O4'" 1 
ATOM   9689  C  "C3'" . DG  J 6 33  ? -25.724 -35.982 -2.613 1.00 128.73 ? -40  DG  J "C3'" 1 
ATOM   9690  O  "O3'" . DG  J 6 33  ? -25.416 -35.452 -3.912 1.00 129.27 ? -40  DG  J "O3'" 1 
ATOM   9691  C  "C2'" . DG  J 6 33  ? -24.813 -35.453 -1.505 1.00 129.01 ? -40  DG  J "C2'" 1 
ATOM   9692  C  "C1'" . DG  J 6 33  ? -25.541 -34.161 -1.161 1.00 129.12 ? -40  DG  J "C1'" 1 
ATOM   9693  N  N9    . DG  J 6 33  ? -25.078 -33.508 0.063  1.00 129.17 ? -40  DG  J N9    1 
ATOM   9694  C  C8    . DG  J 6 33  ? -24.612 -34.109 1.209  1.00 129.19 ? -40  DG  J C8    1 
ATOM   9695  N  N7    . DG  J 6 33  ? -24.252 -33.261 2.130  1.00 129.27 ? -40  DG  J N7    1 
ATOM   9696  C  C5    . DG  J 6 33  ? -24.485 -32.016 1.560  1.00 129.30 ? -40  DG  J C5    1 
ATOM   9697  C  C6    . DG  J 6 33  ? -24.285 -30.712 2.084  1.00 129.19 ? -40  DG  J C6    1 
ATOM   9698  O  O6    . DG  J 6 33  ? -23.847 -30.391 3.194  1.00 129.15 ? -40  DG  J O6    1 
ATOM   9699  N  N1    . DG  J 6 33  ? -24.653 -29.716 1.183  1.00 129.10 ? -40  DG  J N1    1 
ATOM   9700  C  C2    . DG  J 6 33  ? -25.151 -29.952 -0.075 1.00 129.18 ? -40  DG  J C2    1 
ATOM   9701  N  N2    . DG  J 6 33  ? -25.448 -28.864 -0.799 1.00 129.24 ? -40  DG  J N2    1 
ATOM   9702  N  N3    . DG  J 6 33  ? -25.346 -31.166 -0.581 1.00 129.13 ? -40  DG  J N3    1 
ATOM   9703  C  C4    . DG  J 6 33  ? -24.993 -32.150 0.286  1.00 129.17 ? -40  DG  J C4    1 
ATOM   9704  P  P     . DT  J 6 34  ? -23.930 -35.267 -4.494 1.00 129.70 ? -39  DT  J P     1 
ATOM   9705  O  OP1   . DT  J 6 34  ? -24.058 -35.354 -5.965 1.00 129.92 ? -39  DT  J OP1   1 
ATOM   9706  O  OP2   . DT  J 6 34  ? -23.001 -36.188 -3.796 1.00 129.74 ? -39  DT  J OP2   1 
ATOM   9707  O  "O5'" . DT  J 6 34  ? -23.556 -33.760 -4.082 1.00 130.08 ? -39  DT  J "O5'" 1 
ATOM   9708  C  "C5'" . DT  J 6 34  ? -23.442 -32.708 -5.054 1.00 130.46 ? -39  DT  J "C5'" 1 
ATOM   9709  C  "C4'" . DT  J 6 34  ? -22.153 -31.925 -4.873 1.00 130.57 ? -39  DT  J "C4'" 1 
ATOM   9710  O  "O4'" . DT  J 6 34  ? -22.053 -31.516 -3.485 1.00 130.85 ? -39  DT  J "O4'" 1 
ATOM   9711  C  "C3'" . DT  J 6 34  ? -20.876 -32.707 -5.199 1.00 130.64 ? -39  DT  J "C3'" 1 
ATOM   9712  O  "O3'" . DT  J 6 34  ? -20.127 -32.121 -6.299 1.00 130.95 ? -39  DT  J "O3'" 1 
ATOM   9713  C  "C2'" . DT  J 6 34  ? -20.115 -32.789 -3.876 1.00 130.74 ? -39  DT  J "C2'" 1 
ATOM   9714  C  "C1'" . DT  J 6 34  ? -20.710 -31.643 -3.059 1.00 130.97 ? -39  DT  J "C1'" 1 
ATOM   9715  N  N1    . DT  J 6 34  ? -20.607 -31.783 -1.543 1.00 131.02 ? -39  DT  J N1    1 
ATOM   9716  C  C2    . DT  J 6 34  ? -21.153 -30.821 -0.705 1.00 130.89 ? -39  DT  J C2    1 
ATOM   9717  O  O2    . DT  J 6 34  ? -21.747 -29.830 -1.088 1.00 130.87 ? -39  DT  J O2    1 
ATOM   9718  N  N3    . DT  J 6 34  ? -20.984 -31.064 0.636  1.00 130.79 ? -39  DT  J N3    1 
ATOM   9719  C  C4    . DT  J 6 34  ? -20.335 -32.137 1.224  1.00 130.94 ? -39  DT  J C4    1 
ATOM   9720  O  O4    . DT  J 6 34  ? -20.242 -32.251 2.442  1.00 130.92 ? -39  DT  J O4    1 
ATOM   9721  C  C5    . DT  J 6 34  ? -19.781 -33.103 0.304  1.00 131.03 ? -39  DT  J C5    1 
ATOM   9722  C  C7    . DT  J 6 34  ? -19.053 -34.319 0.804  1.00 130.95 ? -39  DT  J C7    1 
ATOM   9723  C  C6    . DT  J 6 34  ? -19.945 -32.879 -1.008 1.00 131.10 ? -39  DT  J C6    1 
ATOM   9724  P  P     . DA  J 6 35  ? -19.115 -30.869 -6.235 1.00 131.23 ? -38  DA  J P     1 
ATOM   9725  O  OP1   . DA  J 6 35  ? -18.857 -30.445 -7.630 1.00 131.06 ? -38  DA  J OP1   1 
ATOM   9726  O  OP2   . DA  J 6 35  ? -17.960 -31.240 -5.386 1.00 131.03 ? -38  DA  J OP2   1 
ATOM   9727  O  "O5'" . DA  J 6 35  ? -19.963 -29.726 -5.497 1.00 131.54 ? -38  DA  J "O5'" 1 
ATOM   9728  C  "C5'" . DA  J 6 35  ? -19.826 -28.345 -5.842 1.00 131.76 ? -38  DA  J "C5'" 1 
ATOM   9729  C  "C4'" . DA  J 6 35  ? -18.939 -27.599 -4.854 1.00 131.80 ? -38  DA  J "C4'" 1 
ATOM   9730  O  "O4'" . DA  J 6 35  ? -18.959 -28.242 -3.550 1.00 131.97 ? -38  DA  J "O4'" 1 
ATOM   9731  C  "C3'" . DA  J 6 35  ? -17.468 -27.499 -5.262 1.00 131.70 ? -38  DA  J "C3'" 1 
ATOM   9732  O  "O3'" . DA  J 6 35  ? -17.047 -26.129 -5.166 1.00 131.16 ? -38  DA  J "O3'" 1 
ATOM   9733  C  "C2'" . DA  J 6 35  ? -16.759 -28.432 -4.280 1.00 131.76 ? -38  DA  J "C2'" 1 
ATOM   9734  C  "C1'" . DA  J 6 35  ? -17.638 -28.265 -3.048 1.00 132.09 ? -38  DA  J "C1'" 1 
ATOM   9735  N  N9    . DA  J 6 35  ? -17.478 -29.323 -2.050 1.00 132.28 ? -38  DA  J N9    1 
ATOM   9736  C  C8    . DA  J 6 35  ? -17.402 -30.670 -2.276 1.00 132.24 ? -38  DA  J C8    1 
ATOM   9737  N  N7    . DA  J 6 35  ? -17.250 -31.389 -1.191 1.00 132.13 ? -38  DA  J N7    1 
ATOM   9738  C  C5    . DA  J 6 35  ? -17.223 -30.450 -0.178 1.00 132.21 ? -38  DA  J C5    1 
ATOM   9739  C  C6    . DA  J 6 35  ? -17.084 -30.573 1.217  1.00 132.20 ? -38  DA  J C6    1 
ATOM   9740  N  N6    . DA  J 6 35  ? -16.944 -31.753 1.831  1.00 132.20 ? -38  DA  J N6    1 
ATOM   9741  N  N1    . DA  J 6 35  ? -17.093 -29.438 1.953  1.00 132.18 ? -38  DA  J N1    1 
ATOM   9742  C  C2    . DA  J 6 35  ? -17.231 -28.259 1.328  1.00 132.09 ? -38  DA  J C2    1 
ATOM   9743  N  N3    . DA  J 6 35  ? -17.370 -28.019 0.023  1.00 132.21 ? -38  DA  J N3    1 
ATOM   9744  C  C4    . DA  J 6 35  ? -17.359 -29.167 -0.685 1.00 132.32 ? -38  DA  J C4    1 
ATOM   9745  P  P     . DT  J 6 36  ? -15.510 -25.674 -5.064 1.00 130.74 ? -37  DT  J P     1 
ATOM   9746  O  OP1   . DT  J 6 36  ? -15.470 -24.232 -5.405 1.00 130.41 ? -37  DT  J OP1   1 
ATOM   9747  O  OP2   . DT  J 6 36  ? -14.648 -26.627 -5.805 1.00 130.49 ? -37  DT  J OP2   1 
ATOM   9748  O  "O5'" . DT  J 6 36  ? -15.199 -25.864 -3.503 1.00 130.21 ? -37  DT  J "O5'" 1 
ATOM   9749  C  "C5'" . DT  J 6 36  ? -15.890 -25.104 -2.496 1.00 129.03 ? -37  DT  J "C5'" 1 
ATOM   9750  C  "C4'" . DT  J 6 36  ? -15.002 -24.855 -1.283 1.00 127.91 ? -37  DT  J "C4'" 1 
ATOM   9751  O  "O4'" . DT  J 6 36  ? -15.123 -25.964 -0.351 1.00 127.38 ? -37  DT  J "O4'" 1 
ATOM   9752  C  "C3'" . DT  J 6 36  ? -13.507 -24.686 -1.596 1.00 127.37 ? -37  DT  J "C3'" 1 
ATOM   9753  O  "O3'" . DT  J 6 36  ? -13.024 -23.428 -1.043 1.00 126.28 ? -37  DT  J "O3'" 1 
ATOM   9754  C  "C2'" . DT  J 6 36  ? -12.870 -25.961 -1.034 1.00 127.14 ? -37  DT  J "C2'" 1 
ATOM   9755  C  "C1'" . DT  J 6 36  ? -13.829 -26.325 0.097  1.00 127.07 ? -37  DT  J "C1'" 1 
ATOM   9756  N  N1    . DT  J 6 36  ? -13.809 -27.775 0.492  1.00 126.86 ? -37  DT  J N1    1 
ATOM   9757  C  C2    . DT  J 6 36  ? -13.985 -28.133 1.822  1.00 126.86 ? -37  DT  J C2    1 
ATOM   9758  O  O2    . DT  J 6 36  ? -14.168 -27.342 2.736  1.00 126.76 ? -37  DT  J O2    1 
ATOM   9759  N  N3    . DT  J 6 36  ? -13.949 -29.487 2.056  1.00 126.73 ? -37  DT  J N3    1 
ATOM   9760  C  C4    . DT  J 6 36  ? -13.753 -30.493 1.126  1.00 126.75 ? -37  DT  J C4    1 
ATOM   9761  O  O4    . DT  J 6 36  ? -13.741 -31.672 1.459  1.00 126.65 ? -37  DT  J O4    1 
ATOM   9762  C  C5    . DT  J 6 36  ? -13.572 -30.051 -0.242 1.00 126.75 ? -37  DT  J C5    1 
ATOM   9763  C  C7    . DT  J 6 36  ? -13.349 -31.033 -1.357 1.00 126.84 ? -37  DT  J C7    1 
ATOM   9764  C  C6    . DT  J 6 36  ? -13.609 -28.735 -0.486 1.00 126.71 ? -37  DT  J C6    1 
ATOM   9765  P  P     . DT  J 6 37  ? -11.540 -23.128 -0.483 1.00 125.08 ? -36  DT  J P     1 
ATOM   9766  O  OP1   . DT  J 6 37  ? -11.382 -21.655 -0.434 1.00 124.63 ? -36  DT  J OP1   1 
ATOM   9767  O  OP2   . DT  J 6 37  ? -10.538 -23.952 -1.207 1.00 124.57 ? -36  DT  J OP2   1 
ATOM   9768  O  "O5'" . DT  J 6 37  ? -11.651 -23.672 1.021  1.00 123.98 ? -36  DT  J "O5'" 1 
ATOM   9769  C  "C5'" . DT  J 6 37  ? -12.648 -23.172 1.926  1.00 121.56 ? -36  DT  J "C5'" 1 
ATOM   9770  C  "C4'" . DT  J 6 37  ? -12.300 -23.516 3.367  1.00 119.69 ? -36  DT  J "C4'" 1 
ATOM   9771  O  "O4'" . DT  J 6 37  ? -12.395 -24.949 3.567  1.00 119.63 ? -36  DT  J "O4'" 1 
ATOM   9772  C  "C3'" . DT  J 6 37  ? -10.901 -23.102 3.819  1.00 118.29 ? -36  DT  J "C3'" 1 
ATOM   9773  O  "O3'" . DT  J 6 37  ? -11.000 -22.501 5.100  1.00 115.97 ? -36  DT  J "O3'" 1 
ATOM   9774  C  "C2'" . DT  J 6 37  ? -10.106 -24.407 3.847  1.00 118.81 ? -36  DT  J "C2'" 1 
ATOM   9775  C  "C1'" . DT  J 6 37  ? -11.192 -25.442 4.126  1.00 119.79 ? -36  DT  J "C1'" 1 
ATOM   9776  N  N1    . DT  J 6 37  ? -10.906 -26.797 3.555  1.00 119.87 ? -36  DT  J N1    1 
ATOM   9777  C  C2    . DT  J 6 37  ? -10.917 -27.900 4.388  1.00 120.13 ? -36  DT  J C2    1 
ATOM   9778  O  O2    . DT  J 6 37  ? -11.148 -27.850 5.584  1.00 120.44 ? -36  DT  J O2    1 
ATOM   9779  N  N3    . DT  J 6 37  ? -10.642 -29.090 3.765  1.00 120.10 ? -36  DT  J N3    1 
ATOM   9780  C  C4    . DT  J 6 37  ? -10.362 -29.290 2.425  1.00 120.13 ? -36  DT  J C4    1 
ATOM   9781  O  O4    . DT  J 6 37  ? -10.131 -30.410 1.980  1.00 120.13 ? -36  DT  J O4    1 
ATOM   9782  C  C5    . DT  J 6 37  ? -10.364 -28.098 1.602  1.00 120.39 ? -36  DT  J C5    1 
ATOM   9783  C  C7    . DT  J 6 37  ? -10.074 -28.171 0.127  1.00 120.27 ? -36  DT  J C7    1 
ATOM   9784  C  C6    . DT  J 6 37  ? -10.633 -26.927 2.203  1.00 120.21 ? -36  DT  J C6    1 
ATOM   9785  P  P     . DT  J 6 38  ? -9.734  -21.901 5.872  1.00 114.45 ? -35  DT  J P     1 
ATOM   9786  O  OP1   . DT  J 6 38  ? -10.199 -20.695 6.597  1.00 114.27 ? -35  DT  J OP1   1 
ATOM   9787  O  OP2   . DT  J 6 38  ? -8.566  -21.826 4.963  1.00 114.07 ? -35  DT  J OP2   1 
ATOM   9788  O  "O5'" . DT  J 6 38  ? -9.410  -23.068 6.916  1.00 113.00 ? -35  DT  J "O5'" 1 
ATOM   9789  C  "C5'" . DT  J 6 38  ? -10.216 -23.336 8.074  1.00 109.78 ? -35  DT  J "C5'" 1 
ATOM   9790  C  "C4'" . DT  J 6 38  ? -9.613  -24.496 8.855  1.00 107.34 ? -35  DT  J "C4'" 1 
ATOM   9791  O  "O4'" . DT  J 6 38  ? -9.667  -25.712 8.055  1.00 106.79 ? -35  DT  J "O4'" 1 
ATOM   9792  C  "C3'" . DT  J 6 38  ? -8.142  -24.334 9.260  1.00 105.93 ? -35  DT  J "C3'" 1 
ATOM   9793  O  "O3'" . DT  J 6 38  ? -7.919  -24.876 10.543 1.00 103.42 ? -35  DT  J "O3'" 1 
ATOM   9794  C  "C2'" . DT  J 6 38  ? -7.404  -25.208 8.257  1.00 106.16 ? -35  DT  J "C2'" 1 
ATOM   9795  C  "C1'" . DT  J 6 38  ? -8.412  -26.349 8.178  1.00 106.42 ? -35  DT  J "C1'" 1 
ATOM   9796  N  N1    . DT  J 6 38  ? -8.148  -27.315 7.071  1.00 106.37 ? -35  DT  J N1    1 
ATOM   9797  C  C2    . DT  J 6 38  ? -8.248  -28.668 7.331  1.00 106.34 ? -35  DT  J C2    1 
ATOM   9798  O  O2    . DT  J 6 38  ? -8.562  -29.126 8.416  1.00 106.17 ? -35  DT  J O2    1 
ATOM   9799  N  N3    . DT  J 6 38  ? -7.971  -29.473 6.254  1.00 106.46 ? -35  DT  J N3    1 
ATOM   9800  C  C4    . DT  J 6 38  ? -7.610  -29.069 4.980  1.00 106.28 ? -35  DT  J C4    1 
ATOM   9801  O  O4    . DT  J 6 38  ? -7.388  -29.883 4.091  1.00 106.08 ? -35  DT  J O4    1 
ATOM   9802  C  C5    . DT  J 6 38  ? -7.520  -27.638 4.783  1.00 106.17 ? -35  DT  J C5    1 
ATOM   9803  C  C7    . DT  J 6 38  ? -7.139  -27.051 3.459  1.00 106.49 ? -35  DT  J C7    1 
ATOM   9804  C  C6    . DT  J 6 38  ? -7.787  -26.842 5.822  1.00 106.22 ? -35  DT  J C6    1 
ATOM   9805  P  P     . DG  J 6 39  ? -8.032  -24.015 11.877 1.00 101.23 ? -34  DG  J P     1 
ATOM   9806  O  OP1   . DG  J 6 39  ? -9.218  -23.125 11.808 1.00 100.88 ? -34  DG  J OP1   1 
ATOM   9807  O  OP2   . DG  J 6 39  ? -6.686  -23.467 12.153 1.00 100.86 ? -34  DG  J OP2   1 
ATOM   9808  O  "O5'" . DG  J 6 39  ? -8.324  -25.188 12.923 1.00 100.16 ? -34  DG  J "O5'" 1 
ATOM   9809  C  "C5'" . DG  J 6 39  ? -9.355  -26.140 12.652 1.00 98.51  ? -34  DG  J "C5'" 1 
ATOM   9810  C  "C4'" . DG  J 6 39  ? -9.012  -27.543 13.128 1.00 97.44  ? -34  DG  J "C4'" 1 
ATOM   9811  O  "O4'" . DG  J 6 39  ? -8.497  -28.339 12.034 1.00 97.90  ? -34  DG  J "O4'" 1 
ATOM   9812  C  "C3'" . DG  J 6 39  ? -7.958  -27.649 14.220 1.00 96.57  ? -34  DG  J "C3'" 1 
ATOM   9813  O  "O3'" . DG  J 6 39  ? -8.245  -28.760 15.065 1.00 93.88  ? -34  DG  J "O3'" 1 
ATOM   9814  C  "C2'" . DG  J 6 39  ? -6.675  -27.863 13.430 1.00 97.56  ? -34  DG  J "C2'" 1 
ATOM   9815  C  "C1'" . DG  J 6 39  ? -7.185  -28.775 12.328 1.00 99.13  ? -34  DG  J "C1'" 1 
ATOM   9816  N  N9    . DG  J 6 39  ? -6.444  -28.723 11.073 1.00 99.84  ? -34  DG  J N9    1 
ATOM   9817  C  C8    . DG  J 6 39  ? -5.963  -27.614 10.410 1.00 100.01 ? -34  DG  J C8    1 
ATOM   9818  N  N7    . DG  J 6 39  ? -5.354  -27.903 9.291  1.00 100.19 ? -34  DG  J N7    1 
ATOM   9819  C  C5    . DG  J 6 39  ? -5.441  -29.291 9.208  1.00 100.14 ? -34  DG  J C5    1 
ATOM   9820  C  C6    . DG  J 6 39  ? -4.967  -30.188 8.220  1.00 99.82  ? -34  DG  J C6    1 
ATOM   9821  O  O6    . DG  J 6 39  ? -4.352  -29.921 7.182  1.00 100.01 ? -34  DG  J O6    1 
ATOM   9822  N  N1    . DG  J 6 39  ? -5.263  -31.518 8.523  1.00 99.77  ? -34  DG  J N1    1 
ATOM   9823  C  C2    . DG  J 6 39  ? -5.942  -31.930 9.647  1.00 99.85  ? -34  DG  J C2    1 
ATOM   9824  N  N2    . DG  J 6 39  ? -6.144  -33.248 9.783  1.00 100.01 ? -34  DG  J N2    1 
ATOM   9825  N  N3    . DG  J 6 39  ? -6.394  -31.104 10.580 1.00 99.87  ? -34  DG  J N3    1 
ATOM   9826  C  C4    . DG  J 6 39  ? -6.109  -29.808 10.298 1.00 100.00 ? -34  DG  J C4    1 
ATOM   9827  P  P     . DG  J 6 40  ? -7.983  -28.659 16.635 1.00 91.01  ? -33  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6 40  ? -9.285  -28.847 17.296 1.00 90.30  ? -33  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6 40  ? -7.169  -27.453 16.911 1.00 90.65  ? -33  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6 40  ? -7.058  -29.926 16.910 1.00 91.14  ? -33  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6 40  ? -7.521  -31.222 16.571 1.00 92.01  ? -33  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6 40  ? -6.407  -32.027 15.933 1.00 92.60  ? -33  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6 40  ? -5.936  -31.362 14.732 1.00 92.26  ? -33  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6 40  ? -5.181  -32.219 16.824 1.00 93.18  ? -33  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6 40  ? -4.786  -33.589 16.833 1.00 94.53  ? -33  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6 40  ? -4.117  -31.343 16.175 1.00 92.99  ? -33  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6 40  ? -4.529  -31.473 14.716 1.00 92.39  ? -33  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6 40  ? -3.974  -30.470 13.817 1.00 92.29  ? -33  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6 40  ? -3.834  -29.115 14.010 1.00 92.27  ? -33  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6 40  ? -3.298  -28.492 12.997 1.00 92.01  ? -33  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6 40  ? -3.066  -29.505 12.077 1.00 92.27  ? -33  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6 40  ? -2.501  -29.456 10.782 1.00 92.43  ? -33  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6 40  ? -2.079  -28.460 10.171 1.00 92.41  ? -33  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6 40  ? -2.447  -30.723 10.192 1.00 92.44  ? -33  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6 40  ? -2.888  -31.891 10.776 1.00 92.29  ? -33  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6 40  ? -2.767  -33.022 10.071 1.00 92.14  ? -33  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6 40  ? -3.421  -31.946 11.985 1.00 92.66  ? -33  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6 40  ? -3.475  -30.724 12.570 1.00 92.40  ? -33  DG  J C4    1 
ATOM   9849  P  P     . DA  J 6 41  ? -4.813  -34.367 18.220 1.00 95.17  ? -32  DA  J P     1 
ATOM   9850  O  OP1   . DA  J 6 41  ? -6.216  -34.310 18.686 1.00 95.24  ? -32  DA  J OP1   1 
ATOM   9851  O  OP2   . DA  J 6 41  ? -3.707  -33.828 19.046 1.00 94.68  ? -32  DA  J OP2   1 
ATOM   9852  O  "O5'" . DA  J 6 41  ? -4.432  -35.882 17.874 1.00 97.10  ? -32  DA  J "O5'" 1 
ATOM   9853  C  "C5'" . DA  J 6 41  ? -5.137  -36.677 16.923 1.00 99.77  ? -32  DA  J "C5'" 1 
ATOM   9854  C  "C4'" . DA  J 6 41  ? -4.155  -37.457 16.057 1.00 101.88 ? -32  DA  J "C4'" 1 
ATOM   9855  O  "O4'" . DA  J 6 41  ? -3.616  -36.551 15.062 1.00 102.27 ? -32  DA  J "O4'" 1 
ATOM   9856  C  "C3'" . DA  J 6 41  ? -2.946  -38.070 16.776 1.00 103.54 ? -32  DA  J "C3'" 1 
ATOM   9857  O  "O3'" . DA  J 6 41  ? -2.626  -39.386 16.239 1.00 105.73 ? -32  DA  J "O3'" 1 
ATOM   9858  C  "C2'" . DA  J 6 41  ? -1.866  -37.008 16.566 1.00 103.32 ? -32  DA  J "C2'" 1 
ATOM   9859  C  "C1'" . DA  J 6 41  ? -2.206  -36.523 15.163 1.00 103.33 ? -32  DA  J "C1'" 1 
ATOM   9860  N  N9    . DA  J 6 41  ? -1.728  -35.178 14.858 1.00 103.60 ? -32  DA  J N9    1 
ATOM   9861  C  C8    . DA  J 6 41  ? -1.701  -34.081 15.679 1.00 103.71 ? -32  DA  J C8    1 
ATOM   9862  N  N7    . DA  J 6 41  ? -1.208  -33.002 15.118 1.00 103.40 ? -32  DA  J N7    1 
ATOM   9863  C  C5    . DA  J 6 41  ? -0.890  -33.422 13.840 1.00 103.53 ? -32  DA  J C5    1 
ATOM   9864  C  C6    . DA  J 6 41  ? -0.327  -32.753 12.736 1.00 103.56 ? -32  DA  J C6    1 
ATOM   9865  N  N6    . DA  J 6 41  ? 0.019   -31.465 12.762 1.00 103.48 ? -32  DA  J N6    1 
ATOM   9866  N  N1    . DA  J 6 41  ? -0.140  -33.464 11.601 1.00 103.73 ? -32  DA  J N1    1 
ATOM   9867  C  C2    . DA  J 6 41  ? -0.489  -34.762 11.572 1.00 103.70 ? -32  DA  J C2    1 
ATOM   9868  N  N3    . DA  J 6 41  ? -1.029  -35.498 12.545 1.00 103.70 ? -32  DA  J N3    1 
ATOM   9869  C  C4    . DA  J 6 41  ? -1.203  -34.760 13.660 1.00 103.68 ? -32  DA  J C4    1 
ATOM   9870  P  P     . DA  J 6 42  ? -1.145  -40.022 16.103 1.00 107.46 ? -31  DA  J P     1 
ATOM   9871  O  OP1   . DA  J 6 42  ? -1.291  -41.496 16.060 1.00 107.81 ? -31  DA  J OP1   1 
ATOM   9872  O  OP2   . DA  J 6 42  ? -0.226  -39.429 17.107 1.00 106.44 ? -31  DA  J OP2   1 
ATOM   9873  O  "O5'" . DA  J 6 42  ? -0.727  -39.506 14.642 1.00 108.74 ? -31  DA  J "O5'" 1 
ATOM   9874  C  "C5'" . DA  J 6 42  ? -0.385  -40.417 13.593 1.00 110.75 ? -31  DA  J "C5'" 1 
ATOM   9875  C  "C4'" . DA  J 6 42  ? 1.074   -40.228 13.242 1.00 112.15 ? -31  DA  J "C4'" 1 
ATOM   9876  O  "O4'" . DA  J 6 42  ? 1.254   -38.822 12.948 1.00 112.17 ? -31  DA  J "O4'" 1 
ATOM   9877  C  "C3'" . DA  J 6 42  ? 2.019   -40.582 14.396 1.00 113.05 ? -31  DA  J "C3'" 1 
ATOM   9878  O  "O3'" . DA  J 6 42  ? 2.885   -41.736 14.175 1.00 114.25 ? -31  DA  J "O3'" 1 
ATOM   9879  C  "C2'" . DA  J 6 42  ? 2.792   -39.301 14.700 1.00 112.99 ? -31  DA  J "C2'" 1 
ATOM   9880  C  "C1'" . DA  J 6 42  ? 2.438   -38.351 13.554 1.00 113.05 ? -31  DA  J "C1'" 1 
ATOM   9881  N  N9    . DA  J 6 42  ? 2.273   -36.956 13.982 1.00 113.38 ? -31  DA  J N9    1 
ATOM   9882  C  C8    . DA  J 6 42  ? 1.557   -36.487 15.055 1.00 113.23 ? -31  DA  J C8    1 
ATOM   9883  N  N7    . DA  J 6 42  ? 1.597   -35.183 15.201 1.00 113.10 ? -31  DA  J N7    1 
ATOM   9884  C  C5    . DA  J 6 42  ? 2.396   -34.760 14.152 1.00 113.33 ? -31  DA  J C5    1 
ATOM   9885  C  C6    . DA  J 6 42  ? 2.834   -33.480 13.742 1.00 113.25 ? -31  DA  J C6    1 
ATOM   9886  N  N6    . DA  J 6 42  ? 2.500   -32.356 14.382 1.00 113.20 ? -31  DA  J N6    1 
ATOM   9887  N  N1    . DA  J 6 42  ? 3.629   -33.399 12.651 1.00 113.14 ? -31  DA  J N1    1 
ATOM   9888  C  C2    . DA  J 6 42  ? 3.962   -34.529 12.008 1.00 113.14 ? -31  DA  J C2    1 
ATOM   9889  N  N3    . DA  J 6 42  ? 3.618   -35.786 12.299 1.00 113.26 ? -31  DA  J N3    1 
ATOM   9890  C  C4    . DA  J 6 42  ? 2.826   -35.837 13.391 1.00 113.44 ? -31  DA  J C4    1 
ATOM   9891  P  P     . DA  J 6 43  ? 3.670   -42.152 12.829 1.00 115.32 ? -30  DA  J P     1 
ATOM   9892  O  OP1   . DA  J 6 43  ? 2.725   -42.854 11.928 1.00 114.82 ? -30  DA  J OP1   1 
ATOM   9893  O  OP2   . DA  J 6 43  ? 4.890   -42.857 13.283 1.00 115.46 ? -30  DA  J OP2   1 
ATOM   9894  O  "O5'" . DA  J 6 43  ? 4.149   -40.779 12.146 1.00 115.66 ? -30  DA  J "O5'" 1 
ATOM   9895  C  "C5'" . DA  J 6 43  ? 5.031   -40.777 11.018 1.00 116.15 ? -30  DA  J "C5'" 1 
ATOM   9896  C  "C4'" . DA  J 6 43  ? 6.229   -39.852 11.207 1.00 116.65 ? -30  DA  J "C4'" 1 
ATOM   9897  O  "O4'" . DA  J 6 43  ? 5.843   -38.638 11.915 1.00 116.38 ? -30  DA  J "O4'" 1 
ATOM   9898  C  "C3'" . DA  J 6 43  ? 7.412   -40.444 11.980 1.00 117.18 ? -30  DA  J "C3'" 1 
ATOM   9899  O  "O3'" . DA  J 6 43  ? 8.644   -40.237 11.256 1.00 118.04 ? -30  DA  J "O3'" 1 
ATOM   9900  C  "C2'" . DA  J 6 43  ? 7.377   -39.671 13.296 1.00 116.92 ? -30  DA  J "C2'" 1 
ATOM   9901  C  "C1'" . DA  J 6 43  ? 6.882   -38.315 12.816 1.00 116.34 ? -30  DA  J "C1'" 1 
ATOM   9902  N  N9    . DA  J 6 43  ? 6.388   -37.455 13.890 1.00 116.27 ? -30  DA  J N9    1 
ATOM   9903  C  C8    . DA  J 6 43  ? 5.748   -37.852 15.031 1.00 116.17 ? -30  DA  J C8    1 
ATOM   9904  N  N7    . DA  J 6 43  ? 5.417   -36.868 15.829 1.00 116.19 ? -30  DA  J N7    1 
ATOM   9905  C  C5    . DA  J 6 43  ? 5.878   -35.745 15.170 1.00 116.07 ? -30  DA  J C5    1 
ATOM   9906  C  C6    . DA  J 6 43  ? 5.841   -34.378 15.499 1.00 116.08 ? -30  DA  J C6    1 
ATOM   9907  N  N6    . DA  J 6 43  ? 5.287   -33.921 16.625 1.00 116.32 ? -30  DA  J N6    1 
ATOM   9908  N  N1    . DA  J 6 43  ? 6.393   -33.501 14.632 1.00 116.13 ? -30  DA  J N1    1 
ATOM   9909  C  C2    . DA  J 6 43  ? 6.951   -33.968 13.508 1.00 116.20 ? -30  DA  J C2    1 
ATOM   9910  N  N3    . DA  J 6 43  ? 7.043   -35.234 13.092 1.00 116.27 ? -30  DA  J N3    1 
ATOM   9911  C  C4    . DA  J 6 43  ? 6.485   -36.084 13.975 1.00 116.22 ? -30  DA  J C4    1 
ATOM   9912  P  P     . DC  J 6 44  ? 10.103  -40.499 11.885 1.00 118.57 ? -29  DC  J P     1 
ATOM   9913  O  OP1   . DC  J 6 44  ? 10.962  -40.943 10.767 1.00 118.62 ? -29  DC  J OP1   1 
ATOM   9914  O  OP2   . DC  J 6 44  ? 9.983   -41.366 13.082 1.00 118.31 ? -29  DC  J OP2   1 
ATOM   9915  O  "O5'" . DC  J 6 44  ? 10.579  -39.041 12.364 1.00 118.97 ? -29  DC  J "O5'" 1 
ATOM   9916  C  "C5'" . DC  J 6 44  ? 11.154  -38.115 11.429 1.00 119.70 ? -29  DC  J "C5'" 1 
ATOM   9917  C  "C4'" . DC  J 6 44  ? 11.652  -36.838 12.092 1.00 120.18 ? -29  DC  J "C4'" 1 
ATOM   9918  O  "O4'" . DC  J 6 44  ? 10.605  -36.288 12.931 1.00 120.10 ? -29  DC  J "O4'" 1 
ATOM   9919  C  "C3'" . DC  J 6 44  ? 12.893  -36.985 12.980 1.00 120.62 ? -29  DC  J "C3'" 1 
ATOM   9920  O  "O3'" . DC  J 6 44  ? 13.952  -36.134 12.531 1.00 121.42 ? -29  DC  J "O3'" 1 
ATOM   9921  C  "C2'" . DC  J 6 44  ? 12.432  -36.569 14.375 1.00 120.48 ? -29  DC  J "C2'" 1 
ATOM   9922  C  "C1'" . DC  J 6 44  ? 11.196  -35.726 14.084 1.00 119.89 ? -29  DC  J "C1'" 1 
ATOM   9923  N  N1    . DC  J 6 44  ? 10.209  -35.709 15.215 1.00 119.54 ? -29  DC  J N1    1 
ATOM   9924  C  C2    . DC  J 6 44  ? 9.889   -34.491 15.834 1.00 119.43 ? -29  DC  J C2    1 
ATOM   9925  O  O2    . DC  J 6 44  ? 10.419  -33.445 15.440 1.00 119.21 ? -29  DC  J O2    1 
ATOM   9926  N  N3    . DC  J 6 44  ? 8.997   -34.490 16.859 1.00 119.48 ? -29  DC  J N3    1 
ATOM   9927  C  C4    . DC  J 6 44  ? 8.441   -35.636 17.266 1.00 119.59 ? -29  DC  J C4    1 
ATOM   9928  N  N4    . DC  J 6 44  ? 7.567   -35.580 18.275 1.00 119.60 ? -29  DC  J N4    1 
ATOM   9929  C  C5    . DC  J 6 44  ? 8.751   -36.887 16.652 1.00 119.37 ? -29  DC  J C5    1 
ATOM   9930  C  C6    . DC  J 6 44  ? 9.630   -36.875 15.643 1.00 119.34 ? -29  DC  J C6    1 
ATOM   9931  P  P     . DT  J 6 45  ? 15.464  -36.317 13.052 1.00 121.93 ? -28  DT  J P     1 
ATOM   9932  O  OP1   . DT  J 6 45  ? 16.359  -35.961 11.929 1.00 121.66 ? -28  DT  J OP1   1 
ATOM   9933  O  OP2   . DT  J 6 45  ? 15.576  -37.633 13.721 1.00 121.89 ? -28  DT  J OP2   1 
ATOM   9934  O  "O5'" . DT  J 6 45  ? 15.639  -35.222 14.201 1.00 122.01 ? -28  DT  J "O5'" 1 
ATOM   9935  C  "C5'" . DT  J 6 45  ? 15.144  -33.896 14.061 1.00 121.96 ? -28  DT  J "C5'" 1 
ATOM   9936  C  "C4'" . DT  J 6 45  ? 14.960  -33.301 15.442 1.00 121.84 ? -28  DT  J "C4'" 1 
ATOM   9937  O  "O4'" . DT  J 6 45  ? 13.850  -33.951 16.122 1.00 121.69 ? -28  DT  J "O4'" 1 
ATOM   9938  C  "C3'" . DT  J 6 45  ? 16.175  -33.472 16.356 1.00 121.75 ? -28  DT  J "C3'" 1 
ATOM   9939  O  "O3'" . DT  J 6 45  ? 16.598  -32.206 16.852 1.00 121.47 ? -28  DT  J "O3'" 1 
ATOM   9940  C  "C2'" . DT  J 6 45  ? 15.655  -34.364 17.481 1.00 121.91 ? -28  DT  J "C2'" 1 
ATOM   9941  C  "C1'" . DT  J 6 45  ? 14.188  -33.947 17.491 1.00 122.01 ? -28  DT  J "C1'" 1 
ATOM   9942  N  N1    . DT  J 6 45  ? 13.257  -34.810 18.296 1.00 122.09 ? -28  DT  J N1    1 
ATOM   9943  C  C2    . DT  J 6 45  ? 11.998  -34.335 18.631 1.00 121.99 ? -28  DT  J C2    1 
ATOM   9944  O  O2    . DT  J 6 45  ? 11.570  -33.243 18.308 1.00 122.07 ? -28  DT  J O2    1 
ATOM   9945  N  N3    . DT  J 6 45  ? 11.235  -35.202 19.371 1.00 121.88 ? -28  DT  J N3    1 
ATOM   9946  C  C4    . DT  J 6 45  ? 11.597  -36.466 19.807 1.00 122.12 ? -28  DT  J C4    1 
ATOM   9947  O  O4    . DT  J 6 45  ? 10.827  -37.156 20.467 1.00 122.23 ? -28  DT  J O4    1 
ATOM   9948  C  C5    . DT  J 6 45  ? 12.928  -36.906 19.434 1.00 122.22 ? -28  DT  J C5    1 
ATOM   9949  C  C7    . DT  J 6 45  ? 13.455  -38.256 19.836 1.00 122.15 ? -28  DT  J C7    1 
ATOM   9950  C  C6    . DT  J 6 45  ? 13.678  -36.064 18.709 1.00 122.26 ? -28  DT  J C6    1 
ATOM   9951  P  P     . DG  J 6 46  ? 18.134  -31.908 17.192 1.00 120.93 ? -27  DG  J P     1 
ATOM   9952  O  OP1   . DG  J 6 46  ? 18.946  -32.409 16.060 1.00 120.87 ? -27  DG  J OP1   1 
ATOM   9953  O  OP2   . DG  J 6 46  ? 18.406  -32.380 18.571 1.00 120.56 ? -27  DG  J OP2   1 
ATOM   9954  O  "O5'" . DG  J 6 46  ? 18.199  -30.307 17.179 1.00 120.46 ? -27  DG  J "O5'" 1 
ATOM   9955  C  "C5'" . DG  J 6 46  ? 17.033  -29.521 16.896 1.00 119.48 ? -27  DG  J "C5'" 1 
ATOM   9956  C  "C4'" . DG  J 6 46  ? 16.595  -28.669 18.084 1.00 118.76 ? -27  DG  J "C4'" 1 
ATOM   9957  O  "O4'" . DG  J 6 46  ? 15.554  -29.315 18.863 1.00 118.90 ? -27  DG  J "O4'" 1 
ATOM   9958  C  "C3'" . DG  J 6 46  ? 17.662  -28.292 19.105 1.00 118.28 ? -27  DG  J "C3'" 1 
ATOM   9959  O  "O3'" . DG  J 6 46  ? 17.338  -26.983 19.537 1.00 117.40 ? -27  DG  J "O3'" 1 
ATOM   9960  C  "C2'" . DG  J 6 46  ? 17.491  -29.340 20.204 1.00 118.30 ? -27  DG  J "C2'" 1 
ATOM   9961  C  "C1'" . DG  J 6 46  ? 15.974  -29.505 20.204 1.00 118.85 ? -27  DG  J "C1'" 1 
ATOM   9962  N  N9    . DG  J 6 46  ? 15.486  -30.821 20.607 1.00 118.88 ? -27  DG  J N9    1 
ATOM   9963  C  C8    . DG  J 6 46  ? 15.874  -32.033 20.091 1.00 118.96 ? -27  DG  J C8    1 
ATOM   9964  N  N7    . DG  J 6 46  ? 15.267  -33.053 20.624 1.00 118.99 ? -27  DG  J N7    1 
ATOM   9965  C  C5    . DG  J 6 46  ? 14.410  -32.482 21.551 1.00 118.93 ? -27  DG  J C5    1 
ATOM   9966  C  C6    . DG  J 6 46  ? 13.491  -33.100 22.435 1.00 118.99 ? -27  DG  J C6    1 
ATOM   9967  O  O6    . DG  J 6 46  ? 13.251  -34.308 22.563 1.00 119.00 ? -27  DG  J O6    1 
ATOM   9968  N  N1    . DG  J 6 46  ? 12.811  -32.167 23.219 1.00 118.98 ? -27  DG  J N1    1 
ATOM   9969  C  C2    . DG  J 6 46  ? 13.001  -30.803 23.150 1.00 118.92 ? -27  DG  J C2    1 
ATOM   9970  N  N2    . DG  J 6 46  ? 12.257  -30.059 23.980 1.00 118.93 ? -27  DG  J N2    1 
ATOM   9971  N  N3    . DG  J 6 46  ? 13.860  -30.213 22.322 1.00 118.86 ? -27  DG  J N3    1 
ATOM   9972  C  C4    . DG  J 6 46  ? 14.529  -31.108 21.553 1.00 118.74 ? -27  DG  J C4    1 
ATOM   9973  P  P     . DC  J 6 47  ? 18.225  -26.162 20.585 1.00 116.66 ? -26  DC  J P     1 
ATOM   9974  O  OP1   . DC  J 6 47  ? 17.960  -24.725 20.329 1.00 116.50 ? -26  DC  J OP1   1 
ATOM   9975  O  OP2   . DC  J 6 47  ? 19.616  -26.678 20.560 1.00 116.72 ? -26  DC  J OP2   1 
ATOM   9976  O  "O5'" . DC  J 6 47  ? 17.577  -26.586 21.990 1.00 115.41 ? -26  DC  J "O5'" 1 
ATOM   9977  C  "C5'" . DC  J 6 47  ? 16.202  -26.310 22.321 1.00 112.87 ? -26  DC  J "C5'" 1 
ATOM   9978  C  "C4'" . DC  J 6 47  ? 15.875  -26.722 23.753 1.00 110.58 ? -26  DC  J "C4'" 1 
ATOM   9979  O  "O4'" . DC  J 6 47  ? 15.646  -28.155 23.817 1.00 110.76 ? -26  DC  J "O4'" 1 
ATOM   9980  C  "C3'" . DC  J 6 47  ? 16.957  -26.438 24.793 1.00 108.98 ? -26  DC  J "C3'" 1 
ATOM   9981  O  "O3'" . DC  J 6 47  ? 16.349  -25.992 26.000 1.00 106.83 ? -26  DC  J "O3'" 1 
ATOM   9982  C  "C2'" . DC  J 6 47  ? 17.635  -27.795 24.977 1.00 109.26 ? -26  DC  J "C2'" 1 
ATOM   9983  C  "C1'" . DC  J 6 47  ? 16.424  -28.712 24.862 1.00 110.07 ? -26  DC  J "C1'" 1 
ATOM   9984  N  N1    . DC  J 6 47  ? 16.697  -30.160 24.564 1.00 110.02 ? -26  DC  J N1    1 
ATOM   9985  C  C2    . DC  J 6 47  ? 15.963  -31.151 25.240 1.00 110.20 ? -26  DC  J C2    1 
ATOM   9986  O  O2    . DC  J 6 47  ? 15.111  -30.821 26.070 1.00 110.17 ? -26  DC  J O2    1 
ATOM   9987  N  N3    . DC  J 6 47  ? 16.205  -32.462 24.966 1.00 110.59 ? -26  DC  J N3    1 
ATOM   9988  C  C4    . DC  J 6 47  ? 17.134  -32.798 24.062 1.00 110.58 ? -26  DC  J C4    1 
ATOM   9989  N  N4    . DC  J 6 47  ? 17.339  -34.100 23.827 1.00 110.21 ? -26  DC  J N4    1 
ATOM   9990  C  C5    . DC  J 6 47  ? 17.893  -31.804 23.360 1.00 110.59 ? -26  DC  J C5    1 
ATOM   9991  C  C6    . DC  J 6 47  ? 17.642  -30.515 23.638 1.00 110.31 ? -26  DC  J C6    1 
ATOM   9992  P  P     . DT  J 6 48  ? 16.916  -24.723 26.801 1.00 105.10 ? -25  DT  J P     1 
ATOM   9993  O  OP1   . DT  J 6 48  ? 16.601  -23.519 25.991 1.00 104.83 ? -25  DT  J OP1   1 
ATOM   9994  O  OP2   . DT  J 6 48  ? 18.310  -25.019 27.210 1.00 104.53 ? -25  DT  J OP2   1 
ATOM   9995  O  "O5'" . DT  J 6 48  ? 16.029  -24.702 28.140 1.00 103.27 ? -25  DT  J "O5'" 1 
ATOM   9996  C  "C5'" . DT  J 6 48  ? 14.651  -24.327 28.105 1.00 99.63  ? -25  DT  J "C5'" 1 
ATOM   9997  C  "C4'" . DT  J 6 48  ? 13.769  -25.367 28.775 1.00 96.87  ? -25  DT  J "C4'" 1 
ATOM   9998  O  "O4'" . DT  J 6 48  ? 14.148  -26.715 28.390 1.00 96.43  ? -25  DT  J "O4'" 1 
ATOM   9999  C  "C3'" . DT  J 6 48  ? 13.812  -25.354 30.296 1.00 95.12  ? -25  DT  J "C3'" 1 
ATOM   10000 O  "O3'" . DT  J 6 48  ? 12.480  -25.548 30.750 1.00 92.34  ? -25  DT  J "O3'" 1 
ATOM   10001 C  "C2'" . DT  J 6 48  ? 14.703  -26.543 30.640 1.00 95.63  ? -25  DT  J "C2'" 1 
ATOM   10002 C  "C1'" . DT  J 6 48  ? 14.228  -27.506 29.559 1.00 96.87  ? -25  DT  J "C1'" 1 
ATOM   10003 N  N1    . DT  J 6 48  ? 15.073  -28.723 29.289 1.00 97.19  ? -25  DT  J N1    1 
ATOM   10004 C  C2    . DT  J 6 48  ? 14.525  -29.983 29.498 1.00 97.68  ? -25  DT  J C2    1 
ATOM   10005 O  O2    . DT  J 6 48  ? 13.391  -30.188 29.908 1.00 97.84  ? -25  DT  J O2    1 
ATOM   10006 N  N3    . DT  J 6 48  ? 15.367  -31.031 29.214 1.00 97.72  ? -25  DT  J N3    1 
ATOM   10007 C  C4    . DT  J 6 48  ? 16.664  -30.956 28.744 1.00 97.42  ? -25  DT  J C4    1 
ATOM   10008 O  O4    . DT  J 6 48  ? 17.323  -31.962 28.520 1.00 97.56  ? -25  DT  J O4    1 
ATOM   10009 C  C5    . DT  J 6 48  ? 17.180  -29.621 28.539 1.00 97.81  ? -25  DT  J C5    1 
ATOM   10010 C  C7    . DT  J 6 48  ? 18.586  -29.429 28.036 1.00 97.68  ? -25  DT  J C7    1 
ATOM   10011 C  C6    . DT  J 6 48  ? 16.369  -28.581 28.816 1.00 97.38  ? -25  DT  J C6    1 
ATOM   10012 P  P     . DC  J 6 49  ? 11.970  -24.921 32.135 1.00 89.42  ? -24  DC  J P     1 
ATOM   10013 O  OP1   . DC  J 6 49  ? 10.997  -23.859 31.787 1.00 88.60  ? -24  DC  J OP1   1 
ATOM   10014 O  OP2   . DC  J 6 49  ? 13.151  -24.590 32.971 1.00 88.73  ? -24  DC  J OP2   1 
ATOM   10015 O  "O5'" . DC  J 6 49  ? 11.190  -26.145 32.831 1.00 87.05  ? -24  DC  J "O5'" 1 
ATOM   10016 C  "C5'" . DC  J 6 49  ? 11.143  -27.479 32.290 1.00 82.67  ? -24  DC  J "C5'" 1 
ATOM   10017 C  "C4'" . DC  J 6 49  ? 11.395  -28.544 33.353 1.00 79.65  ? -24  DC  J "C4'" 1 
ATOM   10018 O  "O4'" . DC  J 6 49  ? 12.455  -29.414 32.884 1.00 80.12  ? -24  DC  J "O4'" 1 
ATOM   10019 C  "C3'" . DC  J 6 49  ? 11.823  -28.075 34.754 1.00 76.89  ? -24  DC  J "C3'" 1 
ATOM   10020 O  "O3'" . DC  J 6 49  ? 11.381  -28.961 35.803 1.00 71.99  ? -24  DC  J "O3'" 1 
ATOM   10021 C  "C2'" . DC  J 6 49  ? 13.338  -28.119 34.646 1.00 78.37  ? -24  DC  J "C2'" 1 
ATOM   10022 C  "C1'" . DC  J 6 49  ? 13.490  -29.419 33.854 1.00 81.09  ? -24  DC  J "C1'" 1 
ATOM   10023 N  N1    . DC  J 6 49  ? 14.834  -29.662 33.198 1.00 82.10  ? -24  DC  J N1    1 
ATOM   10024 C  C2    . DC  J 6 49  ? 15.101  -30.923 32.629 1.00 82.45  ? -24  DC  J C2    1 
ATOM   10025 O  O2    . DC  J 6 49  ? 14.239  -31.814 32.657 1.00 82.68  ? -24  DC  J O2    1 
ATOM   10026 N  N3    . DC  J 6 49  ? 16.310  -31.137 32.042 1.00 82.69  ? -24  DC  J N3    1 
ATOM   10027 C  C4    . DC  J 6 49  ? 17.229  -30.161 32.016 1.00 82.47  ? -24  DC  J C4    1 
ATOM   10028 N  N4    . DC  J 6 49  ? 18.400  -30.433 31.428 1.00 82.32  ? -24  DC  J N4    1 
ATOM   10029 C  C5    . DC  J 6 49  ? 16.985  -28.869 32.588 1.00 82.47  ? -24  DC  J C5    1 
ATOM   10030 C  C6    . DC  J 6 49  ? 15.789  -28.669 33.165 1.00 82.43  ? -24  DC  J C6    1 
ATOM   10031 P  P     . DC  J 6 50  ? 9.852   -29.057 36.282 1.00 67.30  ? -23  DC  J P     1 
ATOM   10032 O  OP1   . DC  J 6 50  ? 8.959   -28.904 35.107 1.00 66.70  ? -23  DC  J OP1   1 
ATOM   10033 O  OP2   . DC  J 6 50  ? 9.708   -28.159 37.442 1.00 67.77  ? -23  DC  J OP2   1 
ATOM   10034 O  "O5'" . DC  J 6 50  ? 9.737   -30.540 36.856 1.00 66.29  ? -23  DC  J "O5'" 1 
ATOM   10035 C  "C5'" . DC  J 6 50  ? 9.251   -31.588 36.029 1.00 65.91  ? -23  DC  J "C5'" 1 
ATOM   10036 C  "C4'" . DC  J 6 50  ? 10.093  -32.836 36.185 1.00 65.99  ? -23  DC  J "C4'" 1 
ATOM   10037 O  "O4'" . DC  J 6 50  ? 11.398  -32.597 35.604 1.00 66.52  ? -23  DC  J "O4'" 1 
ATOM   10038 C  "C3'" . DC  J 6 50  ? 10.300  -33.271 37.633 1.00 65.25  ? -23  DC  J "C3'" 1 
ATOM   10039 O  "O3'" . DC  J 6 50  ? 9.673   -34.508 37.843 1.00 64.28  ? -23  DC  J "O3'" 1 
ATOM   10040 C  "C2'" . DC  J 6 50  ? 11.808  -33.390 37.817 1.00 66.55  ? -23  DC  J "C2'" 1 
ATOM   10041 C  "C1'" . DC  J 6 50  ? 12.383  -33.213 36.414 1.00 69.11  ? -23  DC  J "C1'" 1 
ATOM   10042 N  N1    . DC  J 6 50  ? 13.633  -32.375 36.379 1.00 70.92  ? -23  DC  J N1    1 
ATOM   10043 C  C2    . DC  J 6 50  ? 14.760  -32.785 35.624 1.00 71.57  ? -23  DC  J C2    1 
ATOM   10044 O  O2    . DC  J 6 50  ? 14.726  -33.853 34.980 1.00 71.43  ? -23  DC  J O2    1 
ATOM   10045 N  N3    . DC  J 6 50  ? 15.868  -31.984 35.619 1.00 70.54  ? -23  DC  J N3    1 
ATOM   10046 C  C4    . DC  J 6 50  ? 15.880  -30.847 36.319 1.00 70.19  ? -23  DC  J C4    1 
ATOM   10047 N  N4    . DC  J 6 50  ? 16.978  -30.098 36.293 1.00 70.65  ? -23  DC  J N4    1 
ATOM   10048 C  C5    . DC  J 6 50  ? 14.761  -30.417 37.090 1.00 71.42  ? -23  DC  J C5    1 
ATOM   10049 C  C6    . DC  J 6 50  ? 13.668  -31.200 37.089 1.00 71.56  ? -23  DC  J C6    1 
ATOM   10050 P  P     . DA  J 6 51  ? 9.526   -35.101 39.317 1.00 65.57  ? -22  DA  J P     1 
ATOM   10051 O  OP1   . DA  J 6 51  ? 8.217   -35.775 39.420 1.00 64.17  ? -22  DA  J OP1   1 
ATOM   10052 O  OP2   . DA  J 6 51  ? 9.908   -34.095 40.328 1.00 65.64  ? -22  DA  J OP2   1 
ATOM   10053 O  "O5'" . DA  J 6 51  ? 10.698  -36.173 39.352 1.00 68.87  ? -22  DA  J "O5'" 1 
ATOM   10054 C  "C5'" . DA  J 6 51  ? 10.729  -37.284 38.477 1.00 73.28  ? -22  DA  J "C5'" 1 
ATOM   10055 C  "C4'" . DA  J 6 51  ? 12.099  -37.926 38.564 1.00 76.50  ? -22  DA  J "C4'" 1 
ATOM   10056 O  "O4'" . DA  J 6 51  ? 13.136  -36.953 38.305 1.00 77.50  ? -22  DA  J "O4'" 1 
ATOM   10057 C  "C3'" . DA  J 6 51  ? 12.439  -38.536 39.913 1.00 78.53  ? -22  DA  J "C3'" 1 
ATOM   10058 O  "O3'" . DA  J 6 51  ? 13.034  -39.766 39.643 1.00 81.39  ? -22  DA  J "O3'" 1 
ATOM   10059 C  "C2'" . DA  J 6 51  ? 13.465  -37.595 40.526 1.00 78.50  ? -22  DA  J "C2'" 1 
ATOM   10060 C  "C1'" . DA  J 6 51  ? 14.144  -37.067 39.280 1.00 79.48  ? -22  DA  J "C1'" 1 
ATOM   10061 N  N9    . DA  J 6 51  ? 14.686  -35.733 39.426 1.00 80.19  ? -22  DA  J N9    1 
ATOM   10062 C  C8    . DA  J 6 51  ? 14.096  -34.663 40.040 1.00 80.98  ? -22  DA  J C8    1 
ATOM   10063 N  N7    . DA  J 6 51  ? 14.814  -33.567 40.006 1.00 81.21  ? -22  DA  J N7    1 
ATOM   10064 C  C5    . DA  J 6 51  ? 15.952  -33.950 39.315 1.00 80.83  ? -22  DA  J C5    1 
ATOM   10065 C  C6    . DA  J 6 51  ? 17.116  -33.243 38.948 1.00 80.48  ? -22  DA  J C6    1 
ATOM   10066 N  N6    . DA  J 6 51  ? 17.312  -31.950 39.240 1.00 80.41  ? -22  DA  J N6    1 
ATOM   10067 N  N1    . DA  J 6 51  ? 18.068  -33.924 38.270 1.00 80.67  ? -22  DA  J N1    1 
ATOM   10068 C  C2    . DA  J 6 51  ? 17.862  -35.222 37.989 1.00 81.06  ? -22  DA  J C2    1 
ATOM   10069 N  N3    . DA  J 6 51  ? 16.812  -35.996 38.273 1.00 80.70  ? -22  DA  J N3    1 
ATOM   10070 C  C4    . DA  J 6 51  ? 15.889  -35.287 38.948 1.00 80.71  ? -22  DA  J C4    1 
ATOM   10071 P  P     . DT  J 6 52  ? 13.009  -40.952 40.701 1.00 83.56  ? -21  DT  J P     1 
ATOM   10072 O  OP1   . DT  J 6 52  ? 12.343  -42.074 40.003 1.00 83.57  ? -21  DT  J OP1   1 
ATOM   10073 O  OP2   . DT  J 6 52  ? 12.468  -40.481 41.996 1.00 83.20  ? -21  DT  J OP2   1 
ATOM   10074 O  "O5'" . DT  J 6 52  ? 14.581  -41.227 40.880 1.00 85.58  ? -21  DT  J "O5'" 1 
ATOM   10075 C  "C5'" . DT  J 6 52  ? 15.517  -40.724 39.904 1.00 88.72  ? -21  DT  J "C5'" 1 
ATOM   10076 C  "C4'" . DT  J 6 52  ? 16.881  -40.393 40.490 1.00 91.19  ? -21  DT  J "C4'" 1 
ATOM   10077 O  "O4'" . DT  J 6 52  ? 17.167  -38.977 40.331 1.00 90.97  ? -21  DT  J "O4'" 1 
ATOM   10078 C  "C3'" . DT  J 6 52  ? 17.038  -40.699 41.980 1.00 93.64  ? -21  DT  J "C3'" 1 
ATOM   10079 O  "O3'" . DT  J 6 52  ? 18.196  -41.512 42.216 1.00 98.02  ? -21  DT  J "O3'" 1 
ATOM   10080 C  "C2'" . DT  J 6 52  ? 17.185  -39.322 42.614 1.00 92.77  ? -21  DT  J "C2'" 1 
ATOM   10081 C  "C1'" . DT  J 6 52  ? 17.856  -38.548 41.488 1.00 91.17  ? -21  DT  J "C1'" 1 
ATOM   10082 N  N1    . DT  J 6 52  ? 17.819  -37.054 41.694 1.00 90.64  ? -21  DT  J N1    1 
ATOM   10083 C  C2    . DT  J 6 52  ? 18.855  -36.252 41.229 1.00 90.44  ? -21  DT  J C2    1 
ATOM   10084 O  O2    . DT  J 6 52  ? 19.832  -36.651 40.621 1.00 90.56  ? -21  DT  J O2    1 
ATOM   10085 N  N3    . DT  J 6 52  ? 18.711  -34.916 41.493 1.00 90.43  ? -21  DT  J N3    1 
ATOM   10086 C  C4    . DT  J 6 52  ? 17.668  -34.309 42.167 1.00 90.88  ? -21  DT  J C4    1 
ATOM   10087 O  O4    . DT  J 6 52  ? 17.632  -33.099 42.347 1.00 90.88  ? -21  DT  J O4    1 
ATOM   10088 C  C5    . DT  J 6 52  ? 16.620  -35.187 42.636 1.00 90.99  ? -21  DT  J C5    1 
ATOM   10089 C  C7    . DT  J 6 52  ? 15.442  -34.623 43.381 1.00 90.58  ? -21  DT  J C7    1 
ATOM   10090 C  C6    . DT  J 6 52  ? 16.749  -36.502 42.381 1.00 90.69  ? -21  DT  J C6    1 
ATOM   10091 P  P     . DC  J 6 53  ? 18.386  -42.323 43.591 1.00 101.12 ? -20  DC  J P     1 
ATOM   10092 O  OP1   . DC  J 6 53  ? 18.556  -43.749 43.241 1.00 100.83 ? -20  DC  J OP1   1 
ATOM   10093 O  OP2   . DC  J 6 53  ? 17.317  -41.940 44.545 1.00 100.95 ? -20  DC  J OP2   1 
ATOM   10094 O  "O5'" . DC  J 6 53  ? 19.776  -41.748 44.140 1.00 102.89 ? -20  DC  J "O5'" 1 
ATOM   10095 C  "C5'" . DC  J 6 53  ? 20.915  -41.743 43.295 1.00 106.49 ? -20  DC  J "C5'" 1 
ATOM   10096 C  "C4'" . DC  J 6 53  ? 21.773  -40.524 43.555 1.00 109.46 ? -20  DC  J "C4'" 1 
ATOM   10097 O  "O4'" . DC  J 6 53  ? 21.038  -39.320 43.233 1.00 110.21 ? -20  DC  J "O4'" 1 
ATOM   10098 C  "C3'" . DC  J 6 53  ? 22.188  -40.297 45.000 1.00 111.54 ? -20  DC  J "C3'" 1 
ATOM   10099 O  "O3'" . DC  J 6 53  ? 23.253  -41.192 45.363 1.00 114.49 ? -20  DC  J "O3'" 1 
ATOM   10100 C  "C2'" . DC  J 6 53  ? 22.627  -38.834 44.922 1.00 111.45 ? -20  DC  J "C2'" 1 
ATOM   10101 C  "C1'" . DC  J 6 53  ? 21.646  -38.233 43.914 1.00 111.00 ? -20  DC  J "C1'" 1 
ATOM   10102 N  N1    . DC  J 6 53  ? 20.602  -37.322 44.529 1.00 111.09 ? -20  DC  J N1    1 
ATOM   10103 C  C2    . DC  J 6 53  ? 20.657  -35.932 44.294 1.00 111.32 ? -20  DC  J C2    1 
ATOM   10104 O  O2    . DC  J 6 53  ? 21.550  -35.453 43.586 1.00 111.72 ? -20  DC  J O2    1 
ATOM   10105 N  N3    . DC  J 6 53  ? 19.716  -35.126 44.852 1.00 111.30 ? -20  DC  J N3    1 
ATOM   10106 C  C4    . DC  J 6 53  ? 18.749  -35.646 45.615 1.00 111.35 ? -20  DC  J C4    1 
ATOM   10107 N  N4    . DC  J 6 53  ? 17.851  -34.800 46.133 1.00 111.08 ? -20  DC  J N4    1 
ATOM   10108 C  C5    . DC  J 6 53  ? 18.670  -37.053 45.874 1.00 111.47 ? -20  DC  J C5    1 
ATOM   10109 C  C6    . DC  J 6 53  ? 19.604  -37.841 45.318 1.00 111.26 ? -20  DC  J C6    1 
ATOM   10110 P  P     . DA  J 6 54  ? 24.018  -41.133 46.780 1.00 116.43 ? -19  DA  J P     1 
ATOM   10111 O