data_3KVH
# 
_entry.id   3KVH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KVH         
RCSB  RCSB056498   
WWPDB D_1000056498 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KVH 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tresaugues, L.'                       1  
'Siponen, M.I.'                        2  
'Arrowsmith, C.H.'                     3  
'Berglund, H.'                         4  
'Bountra, C.'                          5  
'Collins, R.'                          6  
'Edwards, A.M.'                        7  
'Flodin, S.'                           8  
'Flores, A.'                           9  
'Graslund, S.'                         10 
'Hammarstrom, M.'                      11 
'Johansson, A.'                        12 
'Johansson, I.'                        13 
'Kallas, A.'                           14 
'Karlberg, T.'                         15 
'Kotenyova, T.'                        16 
'Kotzsch, A.'                          17 
'Kraulis, P.'                          18 
'Moche, M.'                            19 
'Nielsen, T.K.'                        20 
'Nyman, T.'                            21 
'Persson, C.'                          22 
'Roos, A.K.'                           23 
'Schuler, H.'                          24 
'Schutz, P.'                           25 
'Thorsell, A.G.'                       26 
'Van Den Berg, S.'                     27 
'Weigelt, J.'                          28 
'Welin, M.'                            29 
'Wisniewska, M.'                       30 
'Nordlund, P.'                         31 
'Structural Genomics Consortium (SGC)' 32 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human protein syndesmos (NUDT16L1)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tresaugues, L.'   1  
primary 'Siponen, M.I.'    2  
primary 'Arrowsmith, C.H.' 3  
primary 'Berglund, H.'     4  
primary 'Bountra, C.'      5  
primary 'Collins, R.'      6  
primary 'Edwards, A.M.'    7  
primary 'Flodin, S.'       8  
primary 'Flores, A.'       9  
primary 'Graslund, S.'     10 
primary 'Hammarstrom, M.'  11 
primary 'Johansson, A.'    12 
primary 'Johansson, I.'    13 
primary 'Kallas, A.'       14 
primary 'Karlberg, T.'     15 
primary 'Kotenyova, T.'    16 
primary 'Kotzsch, A.'      17 
primary 'Kraulis, P.'      18 
primary 'Moche, M.'        19 
primary 'Nielsen, T.K.'    20 
primary 'Nyman, T.'        21 
primary 'Persson, C.'      22 
primary 'Roos, A.K.'       23 
primary 'Schuler, H.'      24 
primary 'Schutz, P.'       25 
primary 'Thorsell, A.G.'   26 
primary 'Van Den Berg, S.' 27 
primary 'Weigelt, J.'      28 
primary 'Welin, M.'        29 
primary 'Wisniewska, M.'   30 
primary 'Nordlund, P.'     31 
# 
_cell.entry_id           3KVH 
_cell.length_a           68.811 
_cell.length_b           60.278 
_cell.length_c           60.483 
_cell.angle_alpha        90.00 
_cell.angle_beta         118.64 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KVH 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein syndesmos' 23938.902 1   ? ? ? ? 
2 non-polymer syn GLYCEROL            92.094    1   ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION'      35.453    1   ? ? ? ? 
4 water       nat water               18.015    172 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NUDT16-like protein 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGL
GLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNA
FVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASSAHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGL
GLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNA
FVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASSAHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   PRO n 
1 4   GLU n 
1 5   LEU n 
1 6   LYS n 
1 7   GLN n 
1 8   ILE n 
1 9   SER n 
1 10  ARG n 
1 11  VAL n 
1 12  GLU n 
1 13  ALA n 
1 14  MET n 
1 15  ARG n 
1 16  LEU n 
1 17  GLY n 
1 18  PRO n 
1 19  GLY n 
1 20  TRP n 
1 21  SER n 
1 22  HIS n 
1 23  SER n 
1 24  CYS n 
1 25  HIS n 
1 26  ALA n 
1 27  MET n 
1 28  LEU n 
1 29  TYR n 
1 30  ALA n 
1 31  ALA n 
1 32  ASN n 
1 33  PRO n 
1 34  GLY n 
1 35  GLN n 
1 36  LEU n 
1 37  PHE n 
1 38  GLY n 
1 39  ARG n 
1 40  ILE n 
1 41  PRO n 
1 42  MET n 
1 43  ARG n 
1 44  PHE n 
1 45  SER n 
1 46  VAL n 
1 47  LEU n 
1 48  MET n 
1 49  GLN n 
1 50  MET n 
1 51  ARG n 
1 52  PHE n 
1 53  ASP n 
1 54  GLY n 
1 55  LEU n 
1 56  LEU n 
1 57  GLY n 
1 58  PHE n 
1 59  PRO n 
1 60  GLY n 
1 61  GLY n 
1 62  PHE n 
1 63  VAL n 
1 64  ASP n 
1 65  ARG n 
1 66  ARG n 
1 67  PHE n 
1 68  TRP n 
1 69  SER n 
1 70  LEU n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  LEU n 
1 75  ASN n 
1 76  ARG n 
1 77  VAL n 
1 78  LEU n 
1 79  GLY n 
1 80  LEU n 
1 81  GLY n 
1 82  LEU n 
1 83  GLY n 
1 84  CYS n 
1 85  LEU n 
1 86  ARG n 
1 87  LEU n 
1 88  THR n 
1 89  GLU n 
1 90  ALA n 
1 91  ASP n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  SER n 
1 96  HIS n 
1 97  LEU n 
1 98  THR n 
1 99  GLU n 
1 100 GLY n 
1 101 PRO n 
1 102 HIS n 
1 103 ARG n 
1 104 VAL n 
1 105 VAL n 
1 106 ALA n 
1 107 HIS n 
1 108 LEU n 
1 109 TYR n 
1 110 ALA n 
1 111 ARG n 
1 112 GLN n 
1 113 LEU n 
1 114 THR n 
1 115 LEU n 
1 116 GLU n 
1 117 GLN n 
1 118 LEU n 
1 119 HIS n 
1 120 ALA n 
1 121 VAL n 
1 122 GLU n 
1 123 ILE n 
1 124 SER n 
1 125 ALA n 
1 126 VAL n 
1 127 HIS n 
1 128 SER n 
1 129 ARG n 
1 130 ASP n 
1 131 HIS n 
1 132 GLY n 
1 133 LEU n 
1 134 GLU n 
1 135 VAL n 
1 136 LEU n 
1 137 GLY n 
1 138 LEU n 
1 139 VAL n 
1 140 ARG n 
1 141 VAL n 
1 142 PRO n 
1 143 LEU n 
1 144 TYR n 
1 145 THR n 
1 146 GLN n 
1 147 LYS n 
1 148 ASP n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 GLY n 
1 153 PHE n 
1 154 PRO n 
1 155 ASN n 
1 156 PHE n 
1 157 LEU n 
1 158 SER n 
1 159 ASN n 
1 160 ALA n 
1 161 PHE n 
1 162 VAL n 
1 163 SER n 
1 164 THR n 
1 165 ALA n 
1 166 LYS n 
1 167 CYS n 
1 168 GLN n 
1 169 LEU n 
1 170 LEU n 
1 171 PHE n 
1 172 ALA n 
1 173 LEU n 
1 174 LYS n 
1 175 VAL n 
1 176 LEU n 
1 177 ASN n 
1 178 MET n 
1 179 MET n 
1 180 PRO n 
1 181 GLU n 
1 182 GLU n 
1 183 LYS n 
1 184 LEU n 
1 185 VAL n 
1 186 GLU n 
1 187 ALA n 
1 188 LEU n 
1 189 ALA n 
1 190 ALA n 
1 191 ALA n 
1 192 THR n 
1 193 GLU n 
1 194 LYS n 
1 195 GLN n 
1 196 LYS n 
1 197 LYS n 
1 198 ALA n 
1 199 LEU n 
1 200 GLU n 
1 201 LYS n 
1 202 LEU n 
1 203 LEU n 
1 204 PRO n 
1 205 ALA n 
1 206 SER n 
1 207 SER n 
1 208 ALA n 
1 209 HIS n 
1 210 HIS n 
1 211 HIS n 
1 212 HIS n 
1 213 HIS n 
1 214 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NUDT16L1, SDOS' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-CH2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SDOS_HUMAN 
_struct_ref.pdbx_db_accession          Q9BRJ7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLG
LGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAF
VSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS
;
_struct_ref.pdbx_align_begin           6 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3KVH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 207 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9BRJ7 
_struct_ref_seq.db_align_beg                  6 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  211 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       211 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KVH MET A 1   ? UNP Q9BRJ7 ? ? 'INITIATING METHIONINE' 5   1 
1 3KVH ALA A 208 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        212 2 
1 3KVH HIS A 209 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        213 3 
1 3KVH HIS A 210 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        214 4 
1 3KVH HIS A 211 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        215 5 
1 3KVH HIS A 212 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        216 6 
1 3KVH HIS A 213 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        217 7 
1 3KVH HIS A 214 ? UNP Q9BRJ7 ? ? 'EXPRESSION TAG'        218 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3KVH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_percent_sol   46.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M hepes pH 7.5, 20%w/v jeffamine M-600, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-10-01 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3KVH 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             28.829 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   23914 
_reflns.number_all                   23962 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              0.058 
_reflns.pdbx_netI_over_sigmaI        8.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.777 
_reflns_shell.pdbx_Rsym_value        0.649 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3KVH 
_refine.ls_number_reflns_obs                     22718 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.01 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_R_factor_obs                          0.18522 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18359 
_refine.ls_R_factor_R_free                       0.21690 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1193 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               11.166 
_refine.aniso_B[1][1]                            -0.08 
_refine.aniso_B[2][2]                            1.13 
_refine.aniso_B[3][3]                            -0.93 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.12 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      3COU 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.104 
_refine.pdbx_overall_ESU_R_Free                  0.103 
_refine.overall_SU_ML                            0.072 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.875 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1506 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             172 
_refine_hist.number_atoms_total               1685 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        27.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 1575 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1098 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.025  1.975  ? 2133 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.820  3.000  ? 2665 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.996  5.000  ? 202  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       29.877 22.206 ? 68   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       10.960 15.000 ? 279  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.045 15.000 ? 15   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.061  0.200  ? 243  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1738 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 339  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.477  1.500  ? 970  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.101  1.500  ? 398  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.900  2.000  ? 1553 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.421  3.000  ? 605  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.210  4.500  ? 573  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             1643 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.percent_reflns_obs               99.14 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3KVH 
_struct.title                     'Crystal structure of human protein syndesmos (NUDT16-like protein)' 
_struct.pdbx_descriptor           'Protein syndesmos' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KVH 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            
;NUDT16-LIKE, NUDT16L1, SYNDESMOS, NUDIX, RNA REGULATION, RNA-BINDING, STRUCTURAL GENOMICS CONSORTIUM, SGC, RNA DEGRADATION, RNA BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 9   ? MET A 14  ? SER A 13  MET A 18  1 ? 6  
HELX_P HELX_P2 2 PHE A 37  ? ARG A 39  ? PHE A 41  ARG A 43  5 ? 3  
HELX_P HELX_P3 3 SER A 69  ? VAL A 77  ? SER A 73  VAL A 81  1 ? 9  
HELX_P HELX_P4 4 THR A 88  ? ALA A 90  ? THR A 92  ALA A 94  5 ? 3  
HELX_P HELX_P5 5 THR A 114 ? HIS A 127 ? THR A 118 HIS A 131 1 ? 14 
HELX_P HELX_P6 6 GLY A 152 ? SER A 158 ? GLY A 156 SER A 162 1 ? 7  
HELX_P HELX_P7 7 THR A 164 ? LEU A 176 ? THR A 168 LEU A 180 1 ? 13 
HELX_P HELX_P8 8 PRO A 180 ? LEU A 203 ? PRO A 184 LEU A 207 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 7   ? ILE A 8   ? GLN A 11  ILE A 12  
A 2 TYR A 92  ? LEU A 97  ? TYR A 96  LEU A 101 
A 3 VAL A 104 ? GLN A 112 ? VAL A 108 GLN A 116 
A 4 SER A 21  ? LEU A 36  ? SER A 25  LEU A 40  
A 5 ILE A 40  ? ARG A 51  ? ILE A 44  ARG A 55  
A 6 GLY A 60  ? VAL A 63  ? GLY A 64  VAL A 67  
B 1 LEU A 56  ? GLY A 57  ? LEU A 60  GLY A 61  
B 2 ILE A 40  ? ARG A 51  ? ILE A 44  ARG A 55  
B 3 SER A 21  ? LEU A 36  ? SER A 25  LEU A 40  
B 4 VAL A 135 ? VAL A 141 ? VAL A 139 VAL A 145 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 8   ? N ILE A 12  O SER A 95  ? O SER A 99  
A 2 3 N HIS A 96  ? N HIS A 100 O ALA A 106 ? O ALA A 110 
A 3 4 O HIS A 107 ? O HIS A 111 N SER A 23  ? N SER A 27  
A 4 5 N ALA A 30  ? N ALA A 34  O SER A 45  ? O SER A 49  
B 1 2 O GLY A 57  ? O GLY A 61  N GLN A 49  ? N GLN A 53  
B 2 3 O SER A 45  ? O SER A 49  N ALA A 30  ? N ALA A 34  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 1'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 219' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 LEU A 184 ? LEU A 188 . ? 1_555 ? 
2 AC1 4 VAL A 185 ? VAL A 189 . ? 1_555 ? 
3 AC1 4 LEU A 188 ? LEU A 192 . ? 1_555 ? 
4 AC1 4 HOH D .   ? HOH A 327 . ? 1_555 ? 
5 AC2 3 ARG A 39  ? ARG A 43  . ? 1_555 ? 
6 AC2 3 GLN A 146 ? GLN A 150 . ? 1_555 ? 
7 AC2 3 LYS A 147 ? LYS A 151 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KVH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KVH 
_atom_sites.fract_transf_matrix[1][1]   0.014533 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007937 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016590 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018838 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 5   ? -10.799 50.928 17.300  1.00 25.65 ? 9   LEU A N   1 
ATOM   2    C  CA  . LEU A 1 5   ? -11.627 49.759 16.883  1.00 25.33 ? 9   LEU A CA  1 
ATOM   3    C  C   . LEU A 1 5   ? -12.318 49.151 18.108  1.00 24.71 ? 9   LEU A C   1 
ATOM   4    O  O   . LEU A 1 5   ? -11.687 48.451 18.910  1.00 25.19 ? 9   LEU A O   1 
ATOM   5    C  CB  . LEU A 1 5   ? -10.756 48.726 16.165  1.00 25.89 ? 9   LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 5   ? -11.459 47.764 15.202  1.00 26.48 ? 9   LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 5   ? -11.939 48.507 13.958  1.00 27.51 ? 9   LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 5   ? -10.539 46.620 14.814  1.00 27.19 ? 9   LEU A CD2 1 
ATOM   9    N  N   . LYS A 1 6   ? -13.615 49.423 18.238  1.00 23.40 ? 10  LYS A N   1 
ATOM   10   C  CA  . LYS A 1 6   ? -14.393 49.054 19.423  1.00 22.28 ? 10  LYS A CA  1 
ATOM   11   C  C   . LYS A 1 6   ? -14.365 47.558 19.746  1.00 21.27 ? 10  LYS A C   1 
ATOM   12   O  O   . LYS A 1 6   ? -14.598 46.718 18.882  1.00 21.15 ? 10  LYS A O   1 
ATOM   13   C  CB  . LYS A 1 6   ? -15.848 49.497 19.254  1.00 22.31 ? 10  LYS A CB  1 
ATOM   14   N  N   . GLN A 1 7   ? -14.091 47.249 21.007  1.00 19.88 ? 11  GLN A N   1 
ATOM   15   C  CA  . GLN A 1 7   ? -14.085 45.882 21.511  1.00 18.80 ? 11  GLN A CA  1 
ATOM   16   C  C   . GLN A 1 7   ? -15.440 45.620 22.168  1.00 17.15 ? 11  GLN A C   1 
ATOM   17   O  O   . GLN A 1 7   ? -16.045 46.527 22.742  1.00 17.23 ? 11  GLN A O   1 
ATOM   18   C  CB  . GLN A 1 7   ? -12.958 45.736 22.536  1.00 19.18 ? 11  GLN A CB  1 
ATOM   19   C  CG  . GLN A 1 7   ? -12.312 44.371 22.622  1.00 20.82 ? 11  GLN A CG  1 
ATOM   20   C  CD  . GLN A 1 7   ? -10.993 44.396 23.398  1.00 22.43 ? 11  GLN A CD  1 
ATOM   21   O  OE1 . GLN A 1 7   ? -10.498 45.463 23.781  1.00 24.44 ? 11  GLN A OE1 1 
ATOM   22   N  NE2 . GLN A 1 7   ? -10.423 43.223 23.626  1.00 22.35 ? 11  GLN A NE2 1 
ATOM   23   N  N   . ILE A 1 8   ? -15.920 44.383 22.081  1.00 15.17 ? 12  ILE A N   1 
ATOM   24   C  CA  . ILE A 1 8   ? -17.178 44.008 22.719  1.00 13.80 ? 12  ILE A CA  1 
ATOM   25   C  C   . ILE A 1 8   ? -17.031 42.595 23.277  1.00 12.35 ? 12  ILE A C   1 
ATOM   26   O  O   . ILE A 1 8   ? -16.288 41.797 22.726  1.00 12.11 ? 12  ILE A O   1 
ATOM   27   C  CB  . ILE A 1 8   ? -18.359 44.078 21.716  1.00 13.57 ? 12  ILE A CB  1 
ATOM   28   C  CG1 . ILE A 1 8   ? -19.687 43.786 22.423  1.00 14.07 ? 12  ILE A CG1 1 
ATOM   29   C  CG2 . ILE A 1 8   ? -18.133 43.127 20.543  1.00 13.50 ? 12  ILE A CG2 1 
ATOM   30   C  CD1 . ILE A 1 8   ? -20.905 44.030 21.573  1.00 14.52 ? 12  ILE A CD1 1 
ATOM   31   N  N   . SER A 1 9   ? -17.715 42.304 24.378  1.00 11.71 ? 13  SER A N   1 
ATOM   32   C  CA  . SER A 1 9   ? -17.672 40.964 24.950  1.00 10.81 ? 13  SER A CA  1 
ATOM   33   C  C   . SER A 1 9   ? -18.422 39.993 24.055  1.00 10.94 ? 13  SER A C   1 
ATOM   34   O  O   . SER A 1 9   ? -19.373 40.370 23.364  1.00 10.74 ? 13  SER A O   1 
ATOM   35   C  CB  . SER A 1 9   ? -18.261 40.925 26.359  1.00 10.71 ? 13  SER A CB  1 
ATOM   36   O  OG  . SER A 1 9   ? -19.679 41.007 26.352  1.00 9.69  ? 13  SER A OG  1 
ATOM   37   N  N   . ARG A 1 10  ? -17.991 38.737 24.089  1.00 10.61 ? 14  ARG A N   1 
ATOM   38   C  CA  . ARG A 1 10  ? -18.634 37.685 23.330  1.00 10.58 ? 14  ARG A CA  1 
ATOM   39   C  C   . ARG A 1 10  ? -20.135 37.618 23.622  1.00 10.44 ? 14  ARG A C   1 
ATOM   40   O  O   . ARG A 1 10  ? -20.944 37.586 22.693  1.00 10.12 ? 14  ARG A O   1 
ATOM   41   C  CB  . ARG A 1 10  ? -17.974 36.339 23.633  1.00 10.62 ? 14  ARG A CB  1 
ATOM   42   C  CG  . ARG A 1 10  ? -18.501 35.174 22.815  1.00 11.69 ? 14  ARG A CG  1 
ATOM   43   C  CD  . ARG A 1 10  ? -17.774 33.889 23.180  1.00 13.00 ? 14  ARG A CD  1 
ATOM   44   N  NE  . ARG A 1 10  ? -18.556 32.703 22.837  1.00 13.45 ? 14  ARG A NE  1 
ATOM   45   C  CZ  . ARG A 1 10  ? -19.509 32.162 23.596  1.00 14.14 ? 14  ARG A CZ  1 
ATOM   46   N  NH1 . ARG A 1 10  ? -19.833 32.678 24.785  1.00 13.45 ? 14  ARG A NH1 1 
ATOM   47   N  NH2 . ARG A 1 10  ? -20.150 31.081 23.162  1.00 14.91 ? 14  ARG A NH2 1 
ATOM   48   N  N   . VAL A 1 11  ? -20.512 37.604 24.902  1.00 9.82  ? 15  VAL A N   1 
ATOM   49   C  CA  . VAL A 1 11  ? -21.928 37.444 25.264  1.00 10.09 ? 15  VAL A CA  1 
ATOM   50   C  C   . VAL A 1 11  ? -22.784 38.661 24.901  1.00 10.08 ? 15  VAL A C   1 
ATOM   51   O  O   . VAL A 1 11  ? -23.966 38.511 24.588  1.00 10.36 ? 15  VAL A O   1 
ATOM   52   C  CB  . VAL A 1 11  ? -22.137 37.073 26.759  1.00 10.19 ? 15  VAL A CB  1 
ATOM   53   C  CG1 . VAL A 1 11  ? -21.441 35.742 27.076  1.00 11.31 ? 15  VAL A CG1 1 
ATOM   54   C  CG2 . VAL A 1 11  ? -21.671 38.185 27.693  1.00 10.38 ? 15  VAL A CG2 1 
ATOM   55   N  N   . GLU A 1 12  ? -22.204 39.858 24.948  1.00 10.07 ? 16  GLU A N   1 
ATOM   56   C  CA  . GLU A 1 12  ? -22.923 41.051 24.503  1.00 10.24 ? 16  GLU A CA  1 
ATOM   57   C  C   . GLU A 1 12  ? -23.061 41.077 22.980  1.00 10.70 ? 16  GLU A C   1 
ATOM   58   O  O   . GLU A 1 12  ? -24.115 41.462 22.466  1.00 10.75 ? 16  GLU A O   1 
ATOM   59   C  CB  . GLU A 1 12  ? -22.270 42.327 25.036  1.00 10.21 ? 16  GLU A CB  1 
ATOM   60   C  CG  . GLU A 1 12  ? -22.506 42.522 26.547  1.00 9.82  ? 16  GLU A CG  1 
ATOM   61   C  CD  . GLU A 1 12  ? -21.616 43.588 27.158  1.00 10.96 ? 16  GLU A CD  1 
ATOM   62   O  OE1 . GLU A 1 12  ? -20.417 43.308 27.392  1.00 12.63 ? 16  GLU A OE1 1 
ATOM   63   O  OE2 . GLU A 1 12  ? -22.115 44.700 27.415  1.00 11.14 ? 16  GLU A OE2 1 
ATOM   64   N  N   . ALA A 1 13  ? -22.022 40.634 22.275  1.00 11.47 ? 17  ALA A N   1 
ATOM   65   C  CA  . ALA A 1 13  ? -22.070 40.511 20.814  1.00 11.94 ? 17  ALA A CA  1 
ATOM   66   C  C   . ALA A 1 13  ? -23.198 39.572 20.386  1.00 12.89 ? 17  ALA A C   1 
ATOM   67   O  O   . ALA A 1 13  ? -23.872 39.813 19.388  1.00 12.43 ? 17  ALA A O   1 
ATOM   68   C  CB  . ALA A 1 13  ? -20.741 40.019 20.268  1.00 12.18 ? 17  ALA A CB  1 
ATOM   69   N  N   . MET A 1 14  ? -23.409 38.509 21.154  1.00 13.59 ? 18  MET A N   1 
ATOM   70   C  CA  . MET A 1 14  ? -24.443 37.531 20.842  1.00 14.89 ? 18  MET A CA  1 
ATOM   71   C  C   . MET A 1 14  ? -25.865 38.094 20.990  1.00 15.78 ? 18  MET A C   1 
ATOM   72   O  O   . MET A 1 14  ? -26.807 37.507 20.464  1.00 16.47 ? 18  MET A O   1 
ATOM   73   C  CB  . MET A 1 14  ? -24.263 36.269 21.701  1.00 14.81 ? 18  MET A CB  1 
ATOM   74   C  CG  . MET A 1 14  ? -23.074 35.395 21.263  1.00 15.85 ? 18  MET A CG  1 
ATOM   75   S  SD  . MET A 1 14  ? -22.501 34.228 22.530  1.00 17.60 ? 18  MET A SD  1 
ATOM   76   C  CE  . MET A 1 14  ? -24.033 33.355 22.919  1.00 18.68 ? 18  MET A CE  1 
ATOM   77   N  N   . ARG A 1 15  ? -26.016 39.220 21.695  1.00 16.91 ? 19  ARG A N   1 
ATOM   78   C  CA  . ARG A 1 15  ? -27.321 39.861 21.895  1.00 17.91 ? 19  ARG A CA  1 
ATOM   79   C  C   . ARG A 1 15  ? -27.667 40.920 20.856  1.00 18.66 ? 19  ARG A C   1 
ATOM   80   O  O   . ARG A 1 15  ? -28.765 41.487 20.893  1.00 18.84 ? 19  ARG A O   1 
ATOM   81   C  CB  . ARG A 1 15  ? -27.382 40.528 23.269  1.00 17.99 ? 19  ARG A CB  1 
ATOM   82   C  CG  . ARG A 1 15  ? -27.350 39.562 24.403  1.00 18.68 ? 19  ARG A CG  1 
ATOM   83   C  CD  . ARG A 1 15  ? -27.533 40.282 25.704  1.00 19.04 ? 19  ARG A CD  1 
ATOM   84   N  NE  . ARG A 1 15  ? -28.939 40.597 25.967  1.00 18.88 ? 19  ARG A NE  1 
ATOM   85   C  CZ  . ARG A 1 15  ? -29.459 41.816 26.133  1.00 19.12 ? 19  ARG A CZ  1 
ATOM   86   N  NH1 . ARG A 1 15  ? -28.712 42.918 26.087  1.00 19.54 ? 19  ARG A NH1 1 
ATOM   87   N  NH2 . ARG A 1 15  ? -30.760 41.932 26.361  1.00 19.22 ? 19  ARG A NH2 1 
ATOM   88   N  N   . LEU A 1 16  ? -26.736 41.203 19.952  1.00 19.59 ? 20  LEU A N   1 
ATOM   89   C  CA  . LEU A 1 16  ? -26.953 42.217 18.924  1.00 20.23 ? 20  LEU A CA  1 
ATOM   90   C  C   . LEU A 1 16  ? -28.095 41.821 17.988  1.00 20.75 ? 20  LEU A C   1 
ATOM   91   O  O   . LEU A 1 16  ? -28.357 40.633 17.777  1.00 21.11 ? 20  LEU A O   1 
ATOM   92   C  CB  . LEU A 1 16  ? -25.670 42.450 18.127  1.00 20.30 ? 20  LEU A CB  1 
ATOM   93   C  CG  . LEU A 1 16  ? -24.525 43.092 18.917  1.00 20.49 ? 20  LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1 16  ? -23.233 43.084 18.099  1.00 20.60 ? 20  LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1 16  ? -24.893 44.499 19.343  1.00 20.64 ? 20  LEU A CD2 1 
ATOM   96   N  N   . GLY A 1 17  ? -28.768 42.826 17.431  1.00 21.16 ? 21  GLY A N   1 
ATOM   97   C  CA  . GLY A 1 17  ? -29.914 42.599 16.552  1.00 21.36 ? 21  GLY A CA  1 
ATOM   98   C  C   . GLY A 1 17  ? -29.578 41.748 15.333  1.00 21.39 ? 21  GLY A C   1 
ATOM   99   O  O   . GLY A 1 17  ? -28.411 41.650 14.945  1.00 21.29 ? 21  GLY A O   1 
ATOM   100  N  N   . PRO A 1 18  ? -30.601 41.115 14.722  1.00 21.32 ? 22  PRO A N   1 
ATOM   101  C  CA  . PRO A 1 18  ? -30.428 40.356 13.474  1.00 21.16 ? 22  PRO A CA  1 
ATOM   102  C  C   . PRO A 1 18  ? -29.789 41.134 12.306  1.00 20.77 ? 22  PRO A C   1 
ATOM   103  O  O   . PRO A 1 18  ? -29.373 40.517 11.322  1.00 21.21 ? 22  PRO A O   1 
ATOM   104  C  CB  . PRO A 1 18  ? -31.865 39.959 13.111  1.00 21.17 ? 22  PRO A CB  1 
ATOM   105  C  CG  . PRO A 1 18  ? -32.569 39.877 14.411  1.00 21.31 ? 22  PRO A CG  1 
ATOM   106  C  CD  . PRO A 1 18  ? -31.962 40.949 15.274  1.00 21.42 ? 22  PRO A CD  1 
ATOM   107  N  N   . GLY A 1 19  ? -29.728 42.464 12.403  1.00 20.11 ? 23  GLY A N   1 
ATOM   108  C  CA  . GLY A 1 19  ? -29.051 43.291 11.403  1.00 19.62 ? 23  GLY A CA  1 
ATOM   109  C  C   . GLY A 1 19  ? -27.529 43.224 11.458  1.00 19.07 ? 23  GLY A C   1 
ATOM   110  O  O   . GLY A 1 19  ? -26.849 43.722 10.558  1.00 19.56 ? 23  GLY A O   1 
ATOM   111  N  N   . TRP A 1 20  ? -26.992 42.627 12.519  1.00 18.20 ? 24  TRP A N   1 
ATOM   112  C  CA  . TRP A 1 20  ? -25.546 42.451 12.666  1.00 17.45 ? 24  TRP A CA  1 
ATOM   113  C  C   . TRP A 1 20  ? -25.097 41.102 12.125  1.00 16.76 ? 24  TRP A C   1 
ATOM   114  O  O   . TRP A 1 20  ? -25.666 40.069 12.473  1.00 17.33 ? 24  TRP A O   1 
ATOM   115  C  CB  . TRP A 1 20  ? -25.151 42.570 14.138  1.00 17.27 ? 24  TRP A CB  1 
ATOM   116  C  CG  . TRP A 1 20  ? -25.225 43.970 14.648  1.00 17.03 ? 24  TRP A CG  1 
ATOM   117  C  CD1 . TRP A 1 20  ? -26.326 44.611 15.147  1.00 17.04 ? 24  TRP A CD1 1 
ATOM   118  C  CD2 . TRP A 1 20  ? -24.151 44.913 14.704  1.00 17.11 ? 24  TRP A CD2 1 
ATOM   119  N  NE1 . TRP A 1 20  ? -25.999 45.892 15.516  1.00 16.30 ? 24  TRP A NE1 1 
ATOM   120  C  CE2 . TRP A 1 20  ? -24.672 46.106 15.249  1.00 17.18 ? 24  TRP A CE2 1 
ATOM   121  C  CE3 . TRP A 1 20  ? -22.800 44.868 14.345  1.00 17.54 ? 24  TRP A CE3 1 
ATOM   122  C  CZ2 . TRP A 1 20  ? -23.886 47.241 15.448  1.00 17.19 ? 24  TRP A CZ2 1 
ATOM   123  C  CZ3 . TRP A 1 20  ? -22.020 45.997 14.545  1.00 17.87 ? 24  TRP A CZ3 1 
ATOM   124  C  CH2 . TRP A 1 20  ? -22.567 47.167 15.088  1.00 17.01 ? 24  TRP A CH2 1 
ATOM   125  N  N   . SER A 1 21  ? -24.071 41.115 11.280  1.00 15.75 ? 25  SER A N   1 
ATOM   126  C  CA  . SER A 1 21  ? -23.444 39.882 10.809  1.00 15.02 ? 25  SER A CA  1 
ATOM   127  C  C   . SER A 1 21  ? -22.271 39.516 11.723  1.00 14.40 ? 25  SER A C   1 
ATOM   128  O  O   . SER A 1 21  ? -21.644 40.400 12.311  1.00 14.45 ? 25  SER A O   1 
ATOM   129  C  CB  . SER A 1 21  ? -22.949 40.053 9.371   1.00 14.91 ? 25  SER A CB  1 
ATOM   130  O  OG  . SER A 1 21  ? -24.021 40.306 8.489   1.00 16.63 ? 25  SER A OG  1 
ATOM   131  N  N   . HIS A 1 22  ? -21.986 38.219 11.840  1.00 13.07 ? 26  HIS A N   1 
ATOM   132  C  CA  . HIS A 1 22  ? -20.877 37.736 12.659  1.00 12.64 ? 26  HIS A CA  1 
ATOM   133  C  C   . HIS A 1 22  ? -19.885 36.945 11.833  1.00 12.49 ? 26  HIS A C   1 
ATOM   134  O  O   . HIS A 1 22  ? -20.273 36.015 11.125  1.00 12.65 ? 26  HIS A O   1 
ATOM   135  C  CB  . HIS A 1 22  ? -21.392 36.849 13.794  1.00 12.20 ? 26  HIS A CB  1 
ATOM   136  C  CG  . HIS A 1 22  ? -22.293 37.566 14.746  1.00 11.64 ? 26  HIS A CG  1 
ATOM   137  N  ND1 . HIS A 1 22  ? -21.880 37.969 15.998  1.00 10.92 ? 26  HIS A ND1 1 
ATOM   138  C  CD2 . HIS A 1 22  ? -23.577 37.976 14.621  1.00 11.08 ? 26  HIS A CD2 1 
ATOM   139  C  CE1 . HIS A 1 22  ? -22.878 38.581 16.609  1.00 10.06 ? 26  HIS A CE1 1 
ATOM   140  N  NE2 . HIS A 1 22  ? -23.918 38.605 15.795  1.00 10.47 ? 26  HIS A NE2 1 
ATOM   141  N  N   . SER A 1 23  ? -18.609 37.322 11.933  1.00 12.63 ? 27  SER A N   1 
ATOM   142  C  CA  A SER A 1 23  ? -17.535 36.570 11.301  0.50 12.90 ? 27  SER A CA  1 
ATOM   143  C  CA  B SER A 1 23  ? -17.525 36.585 11.298  0.50 12.54 ? 27  SER A CA  1 
ATOM   144  C  C   . SER A 1 23  ? -16.646 35.981 12.387  1.00 12.49 ? 27  SER A C   1 
ATOM   145  O  O   . SER A 1 23  ? -16.431 36.604 13.424  1.00 13.28 ? 27  SER A O   1 
ATOM   146  C  CB  A SER A 1 23  ? -16.717 37.462 10.364  0.50 12.93 ? 27  SER A CB  1 
ATOM   147  C  CB  B SER A 1 23  ? -16.703 37.506 10.388  0.50 12.48 ? 27  SER A CB  1 
ATOM   148  O  OG  A SER A 1 23  ? -16.139 36.684 9.327   0.50 14.46 ? 27  SER A OG  1 
ATOM   149  O  OG  B SER A 1 23  ? -15.999 38.492 11.121  0.50 11.79 ? 27  SER A OG  1 
ATOM   150  N  N   . CYS A 1 24  ? -16.165 34.768 12.153  1.00 11.86 ? 28  CYS A N   1 
ATOM   151  C  CA  . CYS A 1 24  ? -15.305 34.077 13.100  1.00 11.61 ? 28  CYS A CA  1 
ATOM   152  C  C   . CYS A 1 24  ? -14.065 33.629 12.359  1.00 11.50 ? 28  CYS A C   1 
ATOM   153  O  O   . CYS A 1 24  ? -14.177 33.027 11.288  1.00 10.73 ? 28  CYS A O   1 
ATOM   154  C  CB  . CYS A 1 24  ? -16.021 32.867 13.690  1.00 11.58 ? 28  CYS A CB  1 
ATOM   155  S  SG  . CYS A 1 24  ? -17.438 33.333 14.707  1.00 10.88 ? 28  CYS A SG  1 
ATOM   156  N  N   . HIS A 1 25  ? -12.903 33.911 12.938  1.00 11.75 ? 29  HIS A N   1 
ATOM   157  C  CA  . HIS A 1 25  ? -11.618 33.586 12.315  1.00 12.41 ? 29  HIS A CA  1 
ATOM   158  C  C   . HIS A 1 25  ? -10.631 33.000 13.325  1.00 12.78 ? 29  HIS A C   1 
ATOM   159  O  O   . HIS A 1 25  ? -10.695 33.310 14.521  1.00 13.94 ? 29  HIS A O   1 
ATOM   160  C  CB  . HIS A 1 25  ? -11.009 34.822 11.658  1.00 12.49 ? 29  HIS A CB  1 
ATOM   161  C  CG  . HIS A 1 25  ? -11.805 35.354 10.507  1.00 13.19 ? 29  HIS A CG  1 
ATOM   162  N  ND1 . HIS A 1 25  ? -12.704 36.393 10.640  1.00 14.46 ? 29  HIS A ND1 1 
ATOM   163  C  CD2 . HIS A 1 25  ? -11.839 34.990 9.203   1.00 13.37 ? 29  HIS A CD2 1 
ATOM   164  C  CE1 . HIS A 1 25  ? -13.260 36.641 9.468   1.00 13.77 ? 29  HIS A CE1 1 
ATOM   165  N  NE2 . HIS A 1 25  ? -12.751 35.805 8.577   1.00 16.14 ? 29  HIS A NE2 1 
ATOM   166  N  N   . ALA A 1 26  ? -9.721  32.163 12.825  1.00 12.60 ? 30  ALA A N   1 
ATOM   167  C  CA  . ALA A 1 26  ? -8.758  31.441 13.649  1.00 11.62 ? 30  ALA A CA  1 
ATOM   168  C  C   . ALA A 1 26  ? -7.335  31.837 13.283  1.00 11.49 ? 30  ALA A C   1 
ATOM   169  O  O   . ALA A 1 26  ? -6.975  31.846 12.096  1.00 11.23 ? 30  ALA A O   1 
ATOM   170  C  CB  . ALA A 1 26  ? -8.930  29.960 13.451  1.00 11.93 ? 30  ALA A CB  1 
ATOM   171  N  N   . MET A 1 27  ? -6.554  32.189 14.299  1.00 11.03 ? 31  MET A N   1 
ATOM   172  C  CA  . MET A 1 27  ? -5.109  32.338 14.182  1.00 11.08 ? 31  MET A CA  1 
ATOM   173  C  C   . MET A 1 27  ? -4.415  31.089 14.721  1.00 11.57 ? 31  MET A C   1 
ATOM   174  O  O   . MET A 1 27  ? -4.296  30.894 15.939  1.00 11.55 ? 31  MET A O   1 
ATOM   175  C  CB  . MET A 1 27  ? -4.638  33.577 14.924  1.00 11.62 ? 31  MET A CB  1 
ATOM   176  C  CG  . MET A 1 27  ? -3.124  33.760 14.924  1.00 12.77 ? 31  MET A CG  1 
ATOM   177  S  SD  . MET A 1 27  ? -2.655  35.351 15.621  1.00 17.23 ? 31  MET A SD  1 
ATOM   178  C  CE  . MET A 1 27  ? -1.108  34.908 16.412  1.00 17.27 ? 31  MET A CE  1 
ATOM   179  N  N   . LEU A 1 28  ? -3.973  30.243 13.794  1.00 11.29 ? 32  LEU A N   1 
ATOM   180  C  CA  . LEU A 1 28  ? -3.222  29.047 14.109  1.00 11.27 ? 32  LEU A CA  1 
ATOM   181  C  C   . LEU A 1 28  ? -1.728  29.383 14.011  1.00 11.29 ? 32  LEU A C   1 
ATOM   182  O  O   . LEU A 1 28  ? -1.282  29.996 13.040  1.00 11.02 ? 32  LEU A O   1 
ATOM   183  C  CB  . LEU A 1 28  ? -3.612  27.916 13.153  1.00 11.69 ? 32  LEU A CB  1 
ATOM   184  C  CG  . LEU A 1 28  ? -5.112  27.591 13.072  1.00 12.83 ? 32  LEU A CG  1 
ATOM   185  C  CD1 . LEU A 1 28  ? -5.408  26.485 12.047  1.00 11.63 ? 32  LEU A CD1 1 
ATOM   186  C  CD2 . LEU A 1 28  ? -5.672  27.194 14.441  1.00 13.20 ? 32  LEU A CD2 1 
ATOM   187  N  N   . TYR A 1 29  ? -0.975  29.028 15.045  1.00 10.52 ? 33  TYR A N   1 
ATOM   188  C  CA  . TYR A 1 29  ? 0.451   29.363 15.112  1.00 10.63 ? 33  TYR A CA  1 
ATOM   189  C  C   . TYR A 1 29  ? 1.250   28.291 15.847  1.00 10.02 ? 33  TYR A C   1 
ATOM   190  O  O   . TYR A 1 29  ? 0.701   27.494 16.605  1.00 10.41 ? 33  TYR A O   1 
ATOM   191  C  CB  . TYR A 1 29  ? 0.640   30.740 15.770  1.00 10.33 ? 33  TYR A CB  1 
ATOM   192  C  CG  . TYR A 1 29  ? 0.314   30.780 17.247  1.00 10.48 ? 33  TYR A CG  1 
ATOM   193  C  CD1 . TYR A 1 29  ? 1.318   30.725 18.203  1.00 10.47 ? 33  TYR A CD1 1 
ATOM   194  C  CD2 . TYR A 1 29  ? -0.997  30.883 17.685  1.00 11.56 ? 33  TYR A CD2 1 
ATOM   195  C  CE1 . TYR A 1 29  ? 1.021   30.770 19.567  1.00 11.68 ? 33  TYR A CE1 1 
ATOM   196  C  CE2 . TYR A 1 29  ? -1.304  30.929 19.040  1.00 11.87 ? 33  TYR A CE2 1 
ATOM   197  C  CZ  . TYR A 1 29  ? -0.295  30.872 19.975  1.00 12.06 ? 33  TYR A CZ  1 
ATOM   198  O  OH  . TYR A 1 29  ? -0.593  30.912 21.324  1.00 13.36 ? 33  TYR A OH  1 
ATOM   199  N  N   . ALA A 1 30  ? 2.560   28.292 15.628  1.00 9.90  ? 34  ALA A N   1 
ATOM   200  C  CA  . ALA A 1 30  ? 3.457   27.355 16.284  1.00 9.50  ? 34  ALA A CA  1 
ATOM   201  C  C   . ALA A 1 30  ? 4.790   28.019 16.577  1.00 9.55  ? 34  ALA A C   1 
ATOM   202  O  O   . ALA A 1 30  ? 5.235   28.875 15.812  1.00 9.77  ? 34  ALA A O   1 
ATOM   203  C  CB  . ALA A 1 30  ? 3.673   26.141 15.398  1.00 9.27  ? 34  ALA A CB  1 
ATOM   204  N  N   . ALA A 1 31  ? 5.418   27.625 17.684  1.00 9.60  ? 35  ALA A N   1 
ATOM   205  C  CA  . ALA A 1 31  ? 6.811   27.985 17.951  1.00 10.05 ? 35  ALA A CA  1 
ATOM   206  C  C   . ALA A 1 31  ? 7.673   27.411 16.836  1.00 10.55 ? 35  ALA A C   1 
ATOM   207  O  O   . ALA A 1 31  ? 7.467   26.271 16.417  1.00 10.73 ? 35  ALA A O   1 
ATOM   208  C  CB  . ALA A 1 31  ? 7.265   27.452 19.309  1.00 9.67  ? 35  ALA A CB  1 
ATOM   209  N  N   . ASN A 1 32  ? 8.612   28.215 16.347  1.00 11.09 ? 36  ASN A N   1 
ATOM   210  C  CA  . ASN A 1 32  ? 9.485   27.838 15.242  1.00 11.21 ? 36  ASN A CA  1 
ATOM   211  C  C   . ASN A 1 32  ? 10.929  28.102 15.660  1.00 11.86 ? 36  ASN A C   1 
ATOM   212  O  O   . ASN A 1 32  ? 11.357  29.256 15.730  1.00 11.46 ? 36  ASN A O   1 
ATOM   213  C  CB  . ASN A 1 32  ? 9.135   28.630 13.976  1.00 11.39 ? 36  ASN A CB  1 
ATOM   214  C  CG  . ASN A 1 32  ? 9.797   28.070 12.720  1.00 11.30 ? 36  ASN A CG  1 
ATOM   215  O  OD1 . ASN A 1 32  ? 10.860  27.436 12.781  1.00 12.28 ? 36  ASN A OD1 1 
ATOM   216  N  ND2 . ASN A 1 32  ? 9.179   28.322 11.572  1.00 12.13 ? 36  ASN A ND2 1 
ATOM   217  N  N   . PRO A 1 33  ? 11.686  27.028 15.933  1.00 12.18 ? 37  PRO A N   1 
ATOM   218  C  CA  . PRO A 1 33  ? 13.073  27.162 16.360  1.00 12.90 ? 37  PRO A CA  1 
ATOM   219  C  C   . PRO A 1 33  ? 14.044  27.377 15.198  1.00 13.43 ? 37  PRO A C   1 
ATOM   220  O  O   . PRO A 1 33  ? 15.260  27.419 15.413  1.00 13.20 ? 37  PRO A O   1 
ATOM   221  C  CB  . PRO A 1 33  ? 13.337  25.824 17.046  1.00 12.92 ? 37  PRO A CB  1 
ATOM   222  C  CG  . PRO A 1 33  ? 12.510  24.858 16.288  1.00 12.63 ? 37  PRO A CG  1 
ATOM   223  C  CD  . PRO A 1 33  ? 11.306  25.610 15.783  1.00 12.33 ? 37  PRO A CD  1 
ATOM   224  N  N   . GLY A 1 34  ? 13.507  27.502 13.984  1.00 14.21 ? 38  GLY A N   1 
ATOM   225  C  CA  . GLY A 1 34  ? 14.304  27.717 12.790  1.00 14.83 ? 38  GLY A CA  1 
ATOM   226  C  C   . GLY A 1 34  ? 15.024  29.053 12.768  1.00 15.49 ? 38  GLY A C   1 
ATOM   227  O  O   . GLY A 1 34  ? 14.620  30.012 13.437  1.00 15.24 ? 38  GLY A O   1 
ATOM   228  N  N   . GLN A 1 35  ? 16.102  29.094 11.991  1.00 16.00 ? 39  GLN A N   1 
ATOM   229  C  CA  . GLN A 1 35  ? 16.933  30.277 11.837  1.00 16.58 ? 39  GLN A CA  1 
ATOM   230  C  C   . GLN A 1 35  ? 17.108  30.550 10.346  1.00 16.57 ? 39  GLN A C   1 
ATOM   231  O  O   . GLN A 1 35  ? 17.814  29.808 9.655   1.00 16.90 ? 39  GLN A O   1 
ATOM   232  C  CB  . GLN A 1 35  ? 18.306  30.048 12.479  1.00 16.80 ? 39  GLN A CB  1 
ATOM   233  C  CG  . GLN A 1 35  ? 18.274  29.654 13.956  1.00 18.56 ? 39  GLN A CG  1 
ATOM   234  C  CD  . GLN A 1 35  ? 18.024  30.832 14.885  1.00 21.28 ? 39  GLN A CD  1 
ATOM   235  O  OE1 . GLN A 1 35  ? 18.538  31.932 14.667  1.00 23.74 ? 39  GLN A OE1 1 
ATOM   236  N  NE2 . GLN A 1 35  ? 17.238  30.602 15.936  1.00 22.99 ? 39  GLN A NE2 1 
ATOM   237  N  N   . LEU A 1 36  ? 16.478  31.608 9.847   1.00 16.16 ? 40  LEU A N   1 
ATOM   238  C  CA  . LEU A 1 36  ? 16.586  31.948 8.432   1.00 16.41 ? 40  LEU A CA  1 
ATOM   239  C  C   . LEU A 1 36  ? 18.036  32.308 8.106   1.00 16.25 ? 40  LEU A C   1 
ATOM   240  O  O   . LEU A 1 36  ? 18.667  33.078 8.831   1.00 15.48 ? 40  LEU A O   1 
ATOM   241  C  CB  . LEU A 1 36  ? 15.649  33.103 8.070   1.00 16.42 ? 40  LEU A CB  1 
ATOM   242  C  CG  . LEU A 1 36  ? 15.538  33.431 6.575   1.00 16.84 ? 40  LEU A CG  1 
ATOM   243  C  CD1 . LEU A 1 36  ? 14.793  32.325 5.839   1.00 17.16 ? 40  LEU A CD1 1 
ATOM   244  C  CD2 . LEU A 1 36  ? 14.871  34.780 6.356   1.00 17.01 ? 40  LEU A CD2 1 
ATOM   245  N  N   . PHE A 1 37  ? 18.549  31.730 7.020   1.00 16.59 ? 41  PHE A N   1 
ATOM   246  C  CA  . PHE A 1 37  ? 19.964  31.845 6.627   1.00 17.04 ? 41  PHE A CA  1 
ATOM   247  C  C   . PHE A 1 37  ? 20.921  31.459 7.761   1.00 16.95 ? 41  PHE A C   1 
ATOM   248  O  O   . PHE A 1 37  ? 22.080  31.878 7.780   1.00 16.88 ? 41  PHE A O   1 
ATOM   249  C  CB  . PHE A 1 37  ? 20.285  33.255 6.105   1.00 17.23 ? 41  PHE A CB  1 
ATOM   250  C  CG  . PHE A 1 37  ? 19.288  33.774 5.100   1.00 18.28 ? 41  PHE A CG  1 
ATOM   251  C  CD1 . PHE A 1 37  ? 18.925  33.005 3.997   1.00 19.01 ? 41  PHE A CD1 1 
ATOM   252  C  CD2 . PHE A 1 37  ? 18.714  35.031 5.255   1.00 19.40 ? 41  PHE A CD2 1 
ATOM   253  C  CE1 . PHE A 1 37  ? 18.001  33.476 3.068   1.00 19.60 ? 41  PHE A CE1 1 
ATOM   254  C  CE2 . PHE A 1 37  ? 17.790  35.514 4.328   1.00 19.50 ? 41  PHE A CE2 1 
ATOM   255  C  CZ  . PHE A 1 37  ? 17.432  34.732 3.235   1.00 19.70 ? 41  PHE A CZ  1 
ATOM   256  N  N   . GLY A 1 38  ? 20.429  30.646 8.694   1.00 16.92 ? 42  GLY A N   1 
ATOM   257  C  CA  . GLY A 1 38  ? 21.201  30.241 9.861   1.00 16.76 ? 42  GLY A CA  1 
ATOM   258  C  C   . GLY A 1 38  ? 21.549  31.337 10.858  1.00 16.66 ? 42  GLY A C   1 
ATOM   259  O  O   . GLY A 1 38  ? 22.424  31.130 11.700  1.00 16.41 ? 42  GLY A O   1 
ATOM   260  N  N   . ARG A 1 39  ? 20.886  32.495 10.783  1.00 16.23 ? 43  ARG A N   1 
ATOM   261  C  CA  . ARG A 1 39  ? 21.200  33.607 11.699  1.00 16.27 ? 43  ARG A CA  1 
ATOM   262  C  C   . ARG A 1 39  ? 20.012  34.431 12.229  1.00 15.77 ? 43  ARG A C   1 
ATOM   263  O  O   . ARG A 1 39  ? 20.163  35.129 13.234  1.00 15.67 ? 43  ARG A O   1 
ATOM   264  C  CB  . ARG A 1 39  ? 22.252  34.538 11.072  1.00 16.59 ? 43  ARG A CB  1 
ATOM   265  C  CG  . ARG A 1 39  ? 21.853  35.156 9.740   1.00 17.68 ? 43  ARG A CG  1 
ATOM   266  C  CD  . ARG A 1 39  ? 22.946  36.079 9.199   1.00 18.98 ? 43  ARG A CD  1 
ATOM   267  N  NE  . ARG A 1 39  ? 22.570  36.680 7.919   1.00 20.27 ? 43  ARG A NE  1 
ATOM   268  C  CZ  . ARG A 1 39  ? 21.717  37.695 7.768   1.00 20.36 ? 43  ARG A CZ  1 
ATOM   269  N  NH1 . ARG A 1 39  ? 21.130  38.262 8.818   1.00 20.03 ? 43  ARG A NH1 1 
ATOM   270  N  NH2 . ARG A 1 39  ? 21.456  38.156 6.549   1.00 21.31 ? 43  ARG A NH2 1 
ATOM   271  N  N   . ILE A 1 40  ? 18.849  34.350 11.578  1.00 15.08 ? 44  ILE A N   1 
ATOM   272  C  CA  . ILE A 1 40  ? 17.672  35.133 11.970  1.00 14.80 ? 44  ILE A CA  1 
ATOM   273  C  C   . ILE A 1 40  ? 16.629  34.235 12.638  1.00 13.99 ? 44  ILE A C   1 
ATOM   274  O  O   . ILE A 1 40  ? 16.041  33.395 11.968  1.00 13.26 ? 44  ILE A O   1 
ATOM   275  C  CB  . ILE A 1 40  ? 17.005  35.787 10.740  1.00 14.73 ? 44  ILE A CB  1 
ATOM   276  C  CG1 . ILE A 1 40  ? 17.969  36.747 10.045  1.00 14.99 ? 44  ILE A CG1 1 
ATOM   277  C  CG2 . ILE A 1 40  ? 15.729  36.521 11.141  1.00 14.97 ? 44  ILE A CG2 1 
ATOM   278  C  CD1 . ILE A 1 40  ? 17.390  37.373 8.793   1.00 15.58 ? 44  ILE A CD1 1 
ATOM   279  N  N   . PRO A 1 41  ? 16.407  34.397 13.959  1.00 13.74 ? 45  PRO A N   1 
ATOM   280  C  CA  . PRO A 1 41  ? 15.418  33.551 14.638  1.00 13.64 ? 45  PRO A CA  1 
ATOM   281  C  C   . PRO A 1 41  ? 13.991  33.806 14.159  1.00 13.36 ? 45  PRO A C   1 
ATOM   282  O  O   . PRO A 1 41  ? 13.522  34.944 14.181  1.00 13.71 ? 45  PRO A O   1 
ATOM   283  C  CB  . PRO A 1 41  ? 15.566  33.943 16.116  1.00 13.51 ? 45  PRO A CB  1 
ATOM   284  C  CG  . PRO A 1 41  ? 16.931  34.548 16.220  1.00 14.10 ? 45  PRO A CG  1 
ATOM   285  C  CD  . PRO A 1 41  ? 17.134  35.251 14.916  1.00 13.98 ? 45  PRO A CD  1 
ATOM   286  N  N   . MET A 1 42  ? 13.307  32.751 13.732  1.00 13.09 ? 46  MET A N   1 
ATOM   287  C  CA  . MET A 1 42  ? 11.937  32.873 13.241  1.00 12.75 ? 46  MET A CA  1 
ATOM   288  C  C   . MET A 1 42  ? 10.924  33.021 14.367  1.00 12.47 ? 46  MET A C   1 
ATOM   289  O  O   . MET A 1 42  ? 9.900   33.696 14.202  1.00 12.24 ? 46  MET A O   1 
ATOM   290  C  CB  . MET A 1 42  ? 11.579  31.671 12.379  1.00 12.71 ? 46  MET A CB  1 
ATOM   291  C  CG  . MET A 1 42  ? 12.372  31.622 11.099  1.00 13.54 ? 46  MET A CG  1 
ATOM   292  S  SD  . MET A 1 42  ? 12.103  30.077 10.254  1.00 14.62 ? 46  MET A SD  1 
ATOM   293  C  CE  . MET A 1 42  ? 12.993  30.384 8.729   1.00 15.72 ? 46  MET A CE  1 
ATOM   294  N  N   . ARG A 1 43  ? 11.205  32.357 15.489  1.00 12.14 ? 47  ARG A N   1 
ATOM   295  C  CA  . ARG A 1 43  ? 10.436  32.465 16.739  1.00 12.52 ? 47  ARG A CA  1 
ATOM   296  C  C   . ARG A 1 43  ? 9.053   31.805 16.701  1.00 12.29 ? 47  ARG A C   1 
ATOM   297  O  O   . ARG A 1 43  ? 8.802   30.855 17.449  1.00 12.30 ? 47  ARG A O   1 
ATOM   298  C  CB  . ARG A 1 43  ? 10.353  33.926 17.209  1.00 12.87 ? 47  ARG A CB  1 
ATOM   299  C  CG  . ARG A 1 43  ? 11.740  34.571 17.370  1.00 13.82 ? 47  ARG A CG  1 
ATOM   300  C  CD  . ARG A 1 43  ? 11.713  35.938 18.047  1.00 15.69 ? 47  ARG A CD  1 
ATOM   301  N  NE  . ARG A 1 43  ? 11.027  35.885 19.338  1.00 16.76 ? 47  ARG A NE  1 
ATOM   302  C  CZ  . ARG A 1 43  ? 9.803   36.361 19.582  1.00 17.53 ? 47  ARG A CZ  1 
ATOM   303  N  NH1 . ARG A 1 43  ? 9.104   36.983 18.635  1.00 18.05 ? 47  ARG A NH1 1 
ATOM   304  N  NH2 . ARG A 1 43  ? 9.285   36.234 20.797  1.00 17.77 ? 47  ARG A NH2 1 
ATOM   305  N  N   . PHE A 1 44  ? 8.167   32.310 15.852  1.00 11.73 ? 48  PHE A N   1 
ATOM   306  C  CA  . PHE A 1 44  ? 6.850   31.705 15.621  1.00 11.18 ? 48  PHE A CA  1 
ATOM   307  C  C   . PHE A 1 44  ? 6.479   31.764 14.144  1.00 11.13 ? 48  PHE A C   1 
ATOM   308  O  O   . PHE A 1 44  ? 6.914   32.661 13.416  1.00 10.07 ? 48  PHE A O   1 
ATOM   309  C  CB  . PHE A 1 44  ? 5.744   32.434 16.393  1.00 11.16 ? 48  PHE A CB  1 
ATOM   310  C  CG  . PHE A 1 44  ? 5.891   32.381 17.879  1.00 10.78 ? 48  PHE A CG  1 
ATOM   311  C  CD1 . PHE A 1 44  ? 5.384   31.310 18.605  1.00 11.12 ? 48  PHE A CD1 1 
ATOM   312  C  CD2 . PHE A 1 44  ? 6.511   33.417 18.558  1.00 10.96 ? 48  PHE A CD2 1 
ATOM   313  C  CE1 . PHE A 1 44  ? 5.516   31.264 19.981  1.00 11.14 ? 48  PHE A CE1 1 
ATOM   314  C  CE2 . PHE A 1 44  ? 6.651   33.377 19.933  1.00 11.89 ? 48  PHE A CE2 1 
ATOM   315  C  CZ  . PHE A 1 44  ? 6.151   32.297 20.649  1.00 11.42 ? 48  PHE A CZ  1 
ATOM   316  N  N   . SER A 1 45  ? 5.625   30.830 13.731  1.00 11.26 ? 49  SER A N   1 
ATOM   317  C  CA  . SER A 1 45  ? 4.986   30.880 12.431  1.00 11.72 ? 49  SER A CA  1 
ATOM   318  C  C   . SER A 1 45  ? 3.478   30.962 12.635  1.00 11.49 ? 49  SER A C   1 
ATOM   319  O  O   . SER A 1 45  ? 2.910   30.193 13.426  1.00 12.21 ? 49  SER A O   1 
ATOM   320  C  CB  . SER A 1 45  ? 5.350   29.649 11.592  1.00 11.76 ? 49  SER A CB  1 
ATOM   321  O  OG  . SER A 1 45  ? 6.708   29.714 11.157  1.00 13.05 ? 49  SER A OG  1 
ATOM   322  N  N   . VAL A 1 46  ? 2.848   31.908 11.952  1.00 11.24 ? 50  VAL A N   1 
ATOM   323  C  CA  . VAL A 1 46  ? 1.394   32.096 11.991  1.00 10.97 ? 50  VAL A CA  1 
ATOM   324  C  C   . VAL A 1 46  ? 0.821   31.880 10.594  1.00 10.85 ? 50  VAL A C   1 
ATOM   325  O  O   . VAL A 1 46  ? 1.423   32.294 9.613   1.00 10.70 ? 50  VAL A O   1 
ATOM   326  C  CB  . VAL A 1 46  ? 1.046   33.530 12.431  1.00 10.68 ? 50  VAL A CB  1 
ATOM   327  C  CG1 . VAL A 1 46  ? -0.479  33.734 12.458  1.00 11.18 ? 50  VAL A CG1 1 
ATOM   328  C  CG2 . VAL A 1 46  ? 1.653   33.855 13.788  1.00 10.99 ? 50  VAL A CG2 1 
ATOM   329  N  N   . LEU A 1 47  ? -0.354  31.259 10.493  1.00 10.81 ? 51  LEU A N   1 
ATOM   330  C  CA  . LEU A 1 47  ? -0.961  31.027 9.186   1.00 10.64 ? 51  LEU A CA  1 
ATOM   331  C  C   . LEU A 1 47  ? -2.000  32.089 8.851   1.00 10.96 ? 51  LEU A C   1 
ATOM   332  O  O   . LEU A 1 47  ? -2.880  32.395 9.654   1.00 10.67 ? 51  LEU A O   1 
ATOM   333  C  CB  . LEU A 1 47  ? -1.617  29.651 9.111   1.00 10.75 ? 51  LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 47  ? -0.727  28.423 9.194   1.00 10.31 ? 51  LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 47  ? -1.587  27.149 9.148   1.00 8.62  ? 51  LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 47  ? 0.305   28.427 8.061   1.00 9.01  ? 51  LEU A CD2 1 
ATOM   337  N  N   . MET A 1 48  ? -1.866  32.666 7.664   1.00 10.93 ? 52  MET A N   1 
ATOM   338  C  CA  . MET A 1 48  ? -2.886  33.525 7.090   1.00 11.04 ? 52  MET A CA  1 
ATOM   339  C  C   . MET A 1 48  ? -3.136  32.987 5.693   1.00 11.56 ? 52  MET A C   1 
ATOM   340  O  O   . MET A 1 48  ? -2.565  31.963 5.306   1.00 11.21 ? 52  MET A O   1 
ATOM   341  C  CB  . MET A 1 48  ? -2.426  34.983 7.090   1.00 11.06 ? 52  MET A CB  1 
ATOM   342  C  CG  . MET A 1 48  ? -2.334  35.545 8.511   1.00 10.13 ? 52  MET A CG  1 
ATOM   343  S  SD  . MET A 1 48  ? -2.088  37.316 8.691   1.00 11.02 ? 52  MET A SD  1 
ATOM   344  C  CE  . MET A 1 48  ? -3.772  37.892 8.400   1.00 10.81 ? 52  MET A CE  1 
ATOM   345  N  N   . GLN A 1 49  ? -4.001  33.644 4.936   1.00 12.46 ? 53  GLN A N   1 
ATOM   346  C  CA  . GLN A 1 49  ? -4.294  33.151 3.603   1.00 12.74 ? 53  GLN A CA  1 
ATOM   347  C  C   . GLN A 1 49  ? -4.684  34.253 2.664   1.00 12.43 ? 53  GLN A C   1 
ATOM   348  O  O   . GLN A 1 49  ? -5.154  35.311 3.096   1.00 12.24 ? 53  GLN A O   1 
ATOM   349  C  CB  . GLN A 1 49  ? -5.409  32.133 3.680   1.00 13.73 ? 53  GLN A CB  1 
ATOM   350  C  CG  . GLN A 1 49  ? -6.748  32.706 4.027   1.00 14.47 ? 53  GLN A CG  1 
ATOM   351  C  CD  . GLN A 1 49  ? -7.758  31.633 4.347   1.00 19.04 ? 53  GLN A CD  1 
ATOM   352  O  OE1 . GLN A 1 49  ? -7.399  30.496 4.646   1.00 23.69 ? 53  GLN A OE1 1 
ATOM   353  N  NE2 . GLN A 1 49  ? -9.025  31.989 4.296   1.00 15.91 ? 53  GLN A NE2 1 
ATOM   354  N  N   . MET A 1 50  ? -4.488  33.982 1.379   1.00 11.36 ? 54  MET A N   1 
ATOM   355  C  CA  . MET A 1 50  ? -4.983  34.835 0.323   1.00 11.26 ? 54  MET A CA  1 
ATOM   356  C  C   . MET A 1 50  ? -6.434  34.456 0.076   1.00 10.58 ? 54  MET A C   1 
ATOM   357  O  O   . MET A 1 50  ? -6.752  33.309 -0.267  1.00 10.70 ? 54  MET A O   1 
ATOM   358  C  CB  . MET A 1 50  ? -4.169  34.652 -0.959  1.00 11.08 ? 54  MET A CB  1 
ATOM   359  C  CG  . MET A 1 50  ? -4.639  35.486 -2.154  1.00 11.26 ? 54  MET A CG  1 
ATOM   360  S  SD  . MET A 1 50  ? -4.522  37.275 -1.885  1.00 12.16 ? 54  MET A SD  1 
ATOM   361  C  CE  . MET A 1 50  ? -2.747  37.522 -1.739  1.00 9.79  ? 54  MET A CE  1 
ATOM   362  N  N   . ARG A 1 51  ? -7.316  35.430 0.244   1.00 10.38 ? 55  ARG A N   1 
ATOM   363  C  CA  . ARG A 1 51  ? -8.743  35.221 0.027   1.00 10.39 ? 55  ARG A CA  1 
ATOM   364  C  C   . ARG A 1 51  ? -9.127  35.415 -1.435  1.00 9.43  ? 55  ARG A C   1 
ATOM   365  O  O   . ARG A 1 51  ? -8.384  36.026 -2.212  1.00 8.82  ? 55  ARG A O   1 
ATOM   366  C  CB  . ARG A 1 51  ? -9.537  36.215 0.874   1.00 11.07 ? 55  ARG A CB  1 
ATOM   367  C  CG  . ARG A 1 51  ? -9.212  36.196 2.338   1.00 12.46 ? 55  ARG A CG  1 
ATOM   368  C  CD  . ARG A 1 51  ? -9.466  37.559 2.960   1.00 15.29 ? 55  ARG A CD  1 
ATOM   369  N  NE  . ARG A 1 51  ? -10.726 38.128 2.491   1.00 16.14 ? 55  ARG A NE  1 
ATOM   370  C  CZ  . ARG A 1 51  ? -11.930 37.777 2.936   1.00 18.21 ? 55  ARG A CZ  1 
ATOM   371  N  NH1 . ARG A 1 51  ? -12.071 36.862 3.904   1.00 18.36 ? 55  ARG A NH1 1 
ATOM   372  N  NH2 . ARG A 1 51  ? -13.004 38.367 2.435   1.00 17.59 ? 55  ARG A NH2 1 
ATOM   373  N  N   . PHE A 1 52  ? -10.316 34.932 -1.807  1.00 8.22  ? 56  PHE A N   1 
ATOM   374  C  CA  . PHE A 1 52  ? -10.852 35.125 -3.163  1.00 7.87  ? 56  PHE A CA  1 
ATOM   375  C  C   . PHE A 1 52  ? -10.876 36.587 -3.613  1.00 6.95  ? 56  PHE A C   1 
ATOM   376  O  O   . PHE A 1 52  ? -10.837 36.855 -4.793  1.00 7.03  ? 56  PHE A O   1 
ATOM   377  C  CB  . PHE A 1 52  ? -12.287 34.565 -3.288  1.00 8.17  ? 56  PHE A CB  1 
ATOM   378  C  CG  . PHE A 1 52  ? -13.293 35.321 -2.468  1.00 8.90  ? 56  PHE A CG  1 
ATOM   379  C  CD1 . PHE A 1 52  ? -13.961 36.403 -3.001  1.00 10.54 ? 56  PHE A CD1 1 
ATOM   380  C  CD2 . PHE A 1 52  ? -13.517 34.982 -1.146  1.00 11.43 ? 56  PHE A CD2 1 
ATOM   381  C  CE1 . PHE A 1 52  ? -14.867 37.131 -2.229  1.00 10.74 ? 56  PHE A CE1 1 
ATOM   382  C  CE2 . PHE A 1 52  ? -14.426 35.702 -0.368  1.00 12.58 ? 56  PHE A CE2 1 
ATOM   383  C  CZ  . PHE A 1 52  ? -15.100 36.775 -0.923  1.00 11.44 ? 56  PHE A CZ  1 
ATOM   384  N  N   . ASP A 1 53  ? -10.955 37.527 -2.669  1.00 7.14  ? 57  ASP A N   1 
ATOM   385  C  CA  . ASP A 1 53  ? -11.048 38.941 -3.036  1.00 7.23  ? 57  ASP A CA  1 
ATOM   386  C  C   . ASP A 1 53  ? -9.682  39.624 -3.120  1.00 6.88  ? 57  ASP A C   1 
ATOM   387  O  O   . ASP A 1 53  ? -9.621  40.846 -3.254  1.00 6.76  ? 57  ASP A O   1 
ATOM   388  C  CB  . ASP A 1 53  ? -12.008 39.709 -2.103  1.00 7.41  ? 57  ASP A CB  1 
ATOM   389  C  CG  . ASP A 1 53  ? -11.601 39.674 -0.646  1.00 8.04  ? 57  ASP A CG  1 
ATOM   390  O  OD1 . ASP A 1 53  ? -10.558 39.098 -0.285  1.00 7.15  ? 57  ASP A OD1 1 
ATOM   391  O  OD2 . ASP A 1 53  ? -12.354 40.239 0.180   1.00 12.25 ? 57  ASP A OD2 1 
ATOM   392  N  N   . GLY A 1 54  ? -8.606  38.840 -3.088  1.00 6.34  ? 58  GLY A N   1 
ATOM   393  C  CA  . GLY A 1 54  ? -7.261  39.366 -3.310  1.00 6.60  ? 58  GLY A CA  1 
ATOM   394  C  C   . GLY A 1 54  ? -6.627  39.997 -2.083  1.00 6.89  ? 58  GLY A C   1 
ATOM   395  O  O   . GLY A 1 54  ? -5.579  40.638 -2.194  1.00 6.62  ? 58  GLY A O   1 
ATOM   396  N  N   . LEU A 1 55  ? -7.238  39.785 -0.914  1.00 7.24  ? 59  LEU A N   1 
ATOM   397  C  CA  . LEU A 1 55  ? -6.722  40.290 0.355   1.00 7.72  ? 59  LEU A CA  1 
ATOM   398  C  C   . LEU A 1 55  ? -6.255  39.185 1.289   1.00 8.56  ? 59  LEU A C   1 
ATOM   399  O  O   . LEU A 1 55  ? -6.795  38.085 1.260   1.00 8.30  ? 59  LEU A O   1 
ATOM   400  C  CB  . LEU A 1 55  ? -7.808  41.101 1.068   1.00 7.81  ? 59  LEU A CB  1 
ATOM   401  C  CG  . LEU A 1 55  ? -8.366  42.273 0.288   1.00 7.39  ? 59  LEU A CG  1 
ATOM   402  C  CD1 . LEU A 1 55  ? -9.584  42.859 1.012   1.00 8.41  ? 59  LEU A CD1 1 
ATOM   403  C  CD2 . LEU A 1 55  ? -7.295  43.371 0.022   1.00 8.44  ? 59  LEU A CD2 1 
ATOM   404  N  N   . LEU A 1 56  ? -5.274  39.497 2.136   1.00 8.69  ? 60  LEU A N   1 
ATOM   405  C  CA  . LEU A 1 56  ? -4.833  38.563 3.180   1.00 9.37  ? 60  LEU A CA  1 
ATOM   406  C  C   . LEU A 1 56  ? -5.790  38.620 4.361   1.00 9.89  ? 60  LEU A C   1 
ATOM   407  O  O   . LEU A 1 56  ? -6.285  39.690 4.739   1.00 10.24 ? 60  LEU A O   1 
ATOM   408  C  CB  . LEU A 1 56  ? -3.411  38.884 3.656   1.00 9.71  ? 60  LEU A CB  1 
ATOM   409  C  CG  . LEU A 1 56  ? -2.313  38.754 2.596   1.00 10.68 ? 60  LEU A CG  1 
ATOM   410  C  CD1 . LEU A 1 56  ? -0.979  39.123 3.193   1.00 10.96 ? 60  LEU A CD1 1 
ATOM   411  C  CD2 . LEU A 1 56  ? -2.278  37.325 2.013   1.00 12.57 ? 60  LEU A CD2 1 
ATOM   412  N  N   . GLY A 1 57  ? -6.067  37.458 4.928   1.00 10.42 ? 61  GLY A N   1 
ATOM   413  C  CA  . GLY A 1 57  ? -6.880  37.374 6.130   1.00 10.20 ? 61  GLY A CA  1 
ATOM   414  C  C   . GLY A 1 57  ? -6.587  36.081 6.860   1.00 10.48 ? 61  GLY A C   1 
ATOM   415  O  O   . GLY A 1 57  ? -5.761  35.272 6.427   1.00 11.28 ? 61  GLY A O   1 
ATOM   416  N  N   . PHE A 1 58  ? -7.268  35.889 7.978   1.00 10.35 ? 62  PHE A N   1 
ATOM   417  C  CA  . PHE A 1 58  ? -7.208  34.624 8.704   1.00 10.17 ? 62  PHE A CA  1 
ATOM   418  C  C   . PHE A 1 58  ? -8.243  33.654 8.149   1.00 10.56 ? 62  PHE A C   1 
ATOM   419  O  O   . PHE A 1 58  ? -9.318  34.073 7.703   1.00 11.01 ? 62  PHE A O   1 
ATOM   420  C  CB  . PHE A 1 58  ? -7.494  34.845 10.191  1.00 10.34 ? 62  PHE A CB  1 
ATOM   421  C  CG  . PHE A 1 58  ? -6.384  35.528 10.928  1.00 9.83  ? 62  PHE A CG  1 
ATOM   422  C  CD1 . PHE A 1 58  ? -5.161  34.899 11.110  1.00 10.24 ? 62  PHE A CD1 1 
ATOM   423  C  CD2 . PHE A 1 58  ? -6.569  36.794 11.466  1.00 11.49 ? 62  PHE A CD2 1 
ATOM   424  C  CE1 . PHE A 1 58  ? -4.141  35.518 11.783  1.00 9.86  ? 62  PHE A CE1 1 
ATOM   425  C  CE2 . PHE A 1 58  ? -5.549  37.419 12.150  1.00 11.12 ? 62  PHE A CE2 1 
ATOM   426  C  CZ  . PHE A 1 58  ? -4.337  36.774 12.326  1.00 10.16 ? 62  PHE A CZ  1 
ATOM   427  N  N   . PRO A 1 59  ? -7.941  32.347 8.193   1.00 11.13 ? 63  PRO A N   1 
ATOM   428  C  CA  . PRO A 1 59  ? -8.963  31.333 7.955   1.00 11.76 ? 63  PRO A CA  1 
ATOM   429  C  C   . PRO A 1 59  ? -10.228 31.609 8.756   1.00 11.94 ? 63  PRO A C   1 
ATOM   430  O  O   . PRO A 1 59  ? -10.148 31.999 9.935   1.00 12.02 ? 63  PRO A O   1 
ATOM   431  C  CB  . PRO A 1 59  ? -8.311  30.043 8.455   1.00 11.95 ? 63  PRO A CB  1 
ATOM   432  C  CG  . PRO A 1 59  ? -6.847  30.304 8.379   1.00 12.46 ? 63  PRO A CG  1 
ATOM   433  C  CD  . PRO A 1 59  ? -6.654  31.762 8.595   1.00 11.02 ? 63  PRO A CD  1 
ATOM   434  N  N   . GLY A 1 60  ? -11.373 31.406 8.119   1.00 12.09 ? 64  GLY A N   1 
ATOM   435  C  CA  . GLY A 1 60  ? -12.667 31.609 8.747   1.00 12.24 ? 64  GLY A CA  1 
ATOM   436  C  C   . GLY A 1 60  ? -13.623 32.307 7.804   1.00 12.90 ? 64  GLY A C   1 
ATOM   437  O  O   . GLY A 1 60  ? -13.409 32.339 6.583   1.00 13.24 ? 64  GLY A O   1 
ATOM   438  N  N   . GLY A 1 61  ? -14.686 32.863 8.366   1.00 12.87 ? 65  GLY A N   1 
ATOM   439  C  CA  . GLY A 1 61  ? -15.708 33.520 7.569   1.00 13.23 ? 65  GLY A CA  1 
ATOM   440  C  C   . GLY A 1 61  ? -16.972 33.793 8.352   1.00 13.50 ? 65  GLY A C   1 
ATOM   441  O  O   . GLY A 1 61  ? -16.994 33.669 9.588   1.00 13.54 ? 65  GLY A O   1 
ATOM   442  N  N   . PHE A 1 62  ? -18.025 34.166 7.633   1.00 13.53 ? 66  PHE A N   1 
ATOM   443  C  CA  . PHE A 1 62  ? -19.294 34.522 8.264   1.00 14.00 ? 66  PHE A CA  1 
ATOM   444  C  C   . PHE A 1 62  ? -20.008 33.283 8.785   1.00 13.58 ? 66  PHE A C   1 
ATOM   445  O  O   . PHE A 1 62  ? -20.019 32.241 8.122   1.00 14.10 ? 66  PHE A O   1 
ATOM   446  C  CB  . PHE A 1 62  ? -20.175 35.316 7.294   1.00 14.26 ? 66  PHE A CB  1 
ATOM   447  C  CG  . PHE A 1 62  ? -19.685 36.719 7.059   1.00 17.20 ? 66  PHE A CG  1 
ATOM   448  C  CD1 . PHE A 1 62  ? -19.884 37.708 8.017   1.00 18.76 ? 66  PHE A CD1 1 
ATOM   449  C  CD2 . PHE A 1 62  ? -19.010 37.052 5.887   1.00 20.54 ? 66  PHE A CD2 1 
ATOM   450  C  CE1 . PHE A 1 62  ? -19.426 39.004 7.814   1.00 20.41 ? 66  PHE A CE1 1 
ATOM   451  C  CE2 . PHE A 1 62  ? -18.547 38.349 5.677   1.00 21.31 ? 66  PHE A CE2 1 
ATOM   452  C  CZ  . PHE A 1 62  ? -18.759 39.326 6.642   1.00 21.78 ? 66  PHE A CZ  1 
ATOM   453  N  N   . VAL A 1 63  ? -20.584 33.407 9.981   1.00 13.05 ? 67  VAL A N   1 
ATOM   454  C  CA  . VAL A 1 63  ? -21.325 32.331 10.632  1.00 12.63 ? 67  VAL A CA  1 
ATOM   455  C  C   . VAL A 1 63  ? -22.817 32.673 10.629  1.00 12.50 ? 67  VAL A C   1 
ATOM   456  O  O   . VAL A 1 63  ? -23.221 33.751 11.075  1.00 12.28 ? 67  VAL A O   1 
ATOM   457  C  CB  . VAL A 1 63  ? -20.819 32.104 12.079  1.00 12.88 ? 67  VAL A CB  1 
ATOM   458  C  CG1 . VAL A 1 63  ? -21.780 31.218 12.875  1.00 13.00 ? 67  VAL A CG1 1 
ATOM   459  C  CG2 . VAL A 1 63  ? -19.405 31.515 12.069  1.00 13.05 ? 67  VAL A CG2 1 
ATOM   460  N  N   . ASP A 1 64  ? -23.630 31.757 10.109  1.00 11.76 ? 68  ASP A N   1 
ATOM   461  C  CA  . ASP A 1 64  ? -25.079 31.931 10.089  1.00 11.59 ? 68  ASP A CA  1 
ATOM   462  C  C   . ASP A 1 64  ? -25.638 31.479 11.438  1.00 11.34 ? 68  ASP A C   1 
ATOM   463  O  O   . ASP A 1 64  ? -25.738 30.284 11.722  1.00 10.36 ? 68  ASP A O   1 
ATOM   464  C  CB  . ASP A 1 64  ? -25.706 31.134 8.935   1.00 11.63 ? 68  ASP A CB  1 
ATOM   465  C  CG  . ASP A 1 64  ? -27.157 31.513 8.668   1.00 11.63 ? 68  ASP A CG  1 
ATOM   466  O  OD1 . ASP A 1 64  ? -27.841 32.046 9.570   1.00 12.24 ? 68  ASP A OD1 1 
ATOM   467  O  OD2 . ASP A 1 64  ? -27.627 31.256 7.540   1.00 13.95 ? 68  ASP A OD2 1 
ATOM   468  N  N   . ARG A 1 65  ? -26.014 32.449 12.268  1.00 11.53 ? 69  ARG A N   1 
ATOM   469  C  CA  . ARG A 1 65  ? -26.466 32.165 13.628  1.00 11.88 ? 69  ARG A CA  1 
ATOM   470  C  C   . ARG A 1 65  ? -27.854 31.516 13.722  1.00 11.76 ? 69  ARG A C   1 
ATOM   471  O  O   . ARG A 1 65  ? -28.260 31.090 14.799  1.00 11.89 ? 69  ARG A O   1 
ATOM   472  C  CB  . ARG A 1 65  ? -26.421 33.438 14.471  1.00 12.14 ? 69  ARG A CB  1 
ATOM   473  C  CG  . ARG A 1 65  ? -25.011 33.980 14.616  1.00 13.33 ? 69  ARG A CG  1 
ATOM   474  C  CD  . ARG A 1 65  ? -24.952 35.090 15.634  1.00 14.67 ? 69  ARG A CD  1 
ATOM   475  N  NE  . ARG A 1 65  ? -25.277 34.593 16.965  1.00 16.43 ? 69  ARG A NE  1 
ATOM   476  C  CZ  . ARG A 1 65  ? -25.916 35.286 17.904  1.00 17.95 ? 69  ARG A CZ  1 
ATOM   477  N  NH1 . ARG A 1 65  ? -26.334 36.530 17.679  1.00 19.36 ? 69  ARG A NH1 1 
ATOM   478  N  NH2 . ARG A 1 65  ? -26.156 34.717 19.077  1.00 18.61 ? 69  ARG A NH2 1 
ATOM   479  N  N   . ARG A 1 66  ? -28.568 31.431 12.600  1.00 11.62 ? 70  ARG A N   1 
ATOM   480  C  CA  . ARG A 1 66  ? -29.792 30.629 12.534  1.00 11.81 ? 70  ARG A CA  1 
ATOM   481  C  C   . ARG A 1 66  ? -29.495 29.135 12.670  1.00 10.98 ? 70  ARG A C   1 
ATOM   482  O  O   . ARG A 1 66  ? -30.384 28.358 13.019  1.00 10.62 ? 70  ARG A O   1 
ATOM   483  C  CB  . ARG A 1 66  ? -30.526 30.867 11.221  1.00 12.38 ? 70  ARG A CB  1 
ATOM   484  C  CG  . ARG A 1 66  ? -31.155 32.244 11.106  1.00 14.15 ? 70  ARG A CG  1 
ATOM   485  C  CD  . ARG A 1 66  ? -31.747 32.446 9.729   1.00 16.22 ? 70  ARG A CD  1 
ATOM   486  N  NE  . ARG A 1 66  ? -30.732 32.351 8.683   1.00 16.99 ? 70  ARG A NE  1 
ATOM   487  C  CZ  . ARG A 1 66  ? -30.981 32.465 7.383   1.00 18.32 ? 70  ARG A CZ  1 
ATOM   488  N  NH1 . ARG A 1 66  ? -32.217 32.682 6.941   1.00 19.79 ? 70  ARG A NH1 1 
ATOM   489  N  NH2 . ARG A 1 66  ? -29.987 32.357 6.516   1.00 19.34 ? 70  ARG A NH2 1 
ATOM   490  N  N   . PHE A 1 67  ? -28.257 28.741 12.370  1.00 9.88  ? 71  PHE A N   1 
ATOM   491  C  CA  . PHE A 1 67  ? -27.849 27.343 12.446  1.00 9.43  ? 71  PHE A CA  1 
ATOM   492  C  C   . PHE A 1 67  ? -26.865 27.040 13.566  1.00 8.92  ? 71  PHE A C   1 
ATOM   493  O  O   . PHE A 1 67  ? -26.986 26.006 14.218  1.00 8.36  ? 71  PHE A O   1 
ATOM   494  C  CB  . PHE A 1 67  ? -27.243 26.901 11.118  1.00 9.34  ? 71  PHE A CB  1 
ATOM   495  C  CG  . PHE A 1 67  ? -28.189 27.003 9.968   1.00 9.61  ? 71  PHE A CG  1 
ATOM   496  C  CD1 . PHE A 1 67  ? -29.330 26.209 9.927   1.00 10.46 ? 71  PHE A CD1 1 
ATOM   497  C  CD2 . PHE A 1 67  ? -27.947 27.886 8.923   1.00 10.64 ? 71  PHE A CD2 1 
ATOM   498  C  CE1 . PHE A 1 67  ? -30.217 26.300 8.876   1.00 9.73  ? 71  PHE A CE1 1 
ATOM   499  C  CE2 . PHE A 1 67  ? -28.836 27.972 7.858   1.00 10.61 ? 71  PHE A CE2 1 
ATOM   500  C  CZ  . PHE A 1 67  ? -29.967 27.179 7.839   1.00 10.55 ? 71  PHE A CZ  1 
ATOM   501  N  N   . TRP A 1 68  ? -25.906 27.935 13.798  1.00 8.68  ? 72  TRP A N   1 
ATOM   502  C  CA  . TRP A 1 68  ? -24.739 27.596 14.602  1.00 8.46  ? 72  TRP A CA  1 
ATOM   503  C  C   . TRP A 1 68  ? -24.411 28.621 15.674  1.00 9.04  ? 72  TRP A C   1 
ATOM   504  O  O   . TRP A 1 68  ? -24.600 29.823 15.478  1.00 8.92  ? 72  TRP A O   1 
ATOM   505  C  CB  . TRP A 1 68  ? -23.514 27.478 13.703  1.00 8.62  ? 72  TRP A CB  1 
ATOM   506  C  CG  . TRP A 1 68  ? -23.716 26.562 12.560  1.00 7.56  ? 72  TRP A CG  1 
ATOM   507  C  CD1 . TRP A 1 68  ? -23.664 26.883 11.240  1.00 7.27  ? 72  TRP A CD1 1 
ATOM   508  C  CD2 . TRP A 1 68  ? -24.011 25.165 12.629  1.00 6.24  ? 72  TRP A CD2 1 
ATOM   509  N  NE1 . TRP A 1 68  ? -23.906 25.771 10.477  1.00 6.04  ? 72  TRP A NE1 1 
ATOM   510  C  CE2 . TRP A 1 68  ? -24.126 24.702 11.304  1.00 5.28  ? 72  TRP A CE2 1 
ATOM   511  C  CE3 . TRP A 1 68  ? -24.184 24.259 13.679  1.00 5.27  ? 72  TRP A CE3 1 
ATOM   512  C  CZ2 . TRP A 1 68  ? -24.399 23.368 10.997  1.00 5.09  ? 72  TRP A CZ2 1 
ATOM   513  C  CZ3 . TRP A 1 68  ? -24.462 22.933 13.374  1.00 6.40  ? 72  TRP A CZ3 1 
ATOM   514  C  CH2 . TRP A 1 68  ? -24.569 22.501 12.040  1.00 6.40  ? 72  TRP A CH2 1 
ATOM   515  N  N   . SER A 1 69  ? -23.898 28.121 16.795  1.00 9.02  ? 73  SER A N   1 
ATOM   516  C  CA  . SER A 1 69  ? -23.151 28.948 17.743  1.00 9.29  ? 73  SER A CA  1 
ATOM   517  C  C   . SER A 1 69  ? -21.906 29.536 17.055  1.00 9.06  ? 73  SER A C   1 
ATOM   518  O  O   . SER A 1 69  ? -21.485 29.084 15.984  1.00 8.80  ? 73  SER A O   1 
ATOM   519  C  CB  . SER A 1 69  ? -22.712 28.112 18.947  1.00 9.57  ? 73  SER A CB  1 
ATOM   520  O  OG  . SER A 1 69  ? -21.701 27.176 18.572  1.00 9.42  ? 73  SER A OG  1 
ATOM   521  N  N   . LEU A 1 70  ? -21.294 30.534 17.681  1.00 8.97  ? 74  LEU A N   1 
ATOM   522  C  CA  . LEU A 1 70  ? -20.083 31.126 17.113  1.00 9.20  ? 74  LEU A CA  1 
ATOM   523  C  C   . LEU A 1 70  ? -18.983 30.081 16.916  1.00 9.66  ? 74  LEU A C   1 
ATOM   524  O  O   . LEU A 1 70  ? -18.293 30.071 15.891  1.00 10.58 ? 74  LEU A O   1 
ATOM   525  C  CB  . LEU A 1 70  ? -19.580 32.258 18.005  1.00 9.07  ? 74  LEU A CB  1 
ATOM   526  C  CG  . LEU A 1 70  ? -20.478 33.479 18.097  1.00 8.95  ? 74  LEU A CG  1 
ATOM   527  C  CD1 . LEU A 1 70  ? -19.843 34.492 19.047  1.00 9.69  ? 74  LEU A CD1 1 
ATOM   528  C  CD2 . LEU A 1 70  ? -20.684 34.100 16.727  1.00 9.78  ? 74  LEU A CD2 1 
ATOM   529  N  N   . GLU A 1 71  ? -18.853 29.177 17.886  1.00 10.46 ? 75  GLU A N   1 
ATOM   530  C  CA  . GLU A 1 71  ? -17.810 28.154 17.866  1.00 11.37 ? 75  GLU A CA  1 
ATOM   531  C  C   . GLU A 1 71  ? -18.107 27.023 16.867  1.00 11.62 ? 75  GLU A C   1 
ATOM   532  O  O   . GLU A 1 71  ? -17.210 26.586 16.144  1.00 12.01 ? 75  GLU A O   1 
ATOM   533  C  CB  . GLU A 1 71  ? -17.624 27.560 19.262  1.00 11.55 ? 75  GLU A CB  1 
ATOM   534  C  CG  . GLU A 1 71  ? -17.011 28.509 20.281  1.00 11.64 ? 75  GLU A CG  1 
ATOM   535  C  CD  . GLU A 1 71  ? -17.912 29.673 20.667  1.00 11.58 ? 75  GLU A CD  1 
ATOM   536  O  OE1 . GLU A 1 71  ? -19.156 29.500 20.722  1.00 10.69 ? 75  GLU A OE1 1 
ATOM   537  O  OE2 . GLU A 1 71  ? -17.366 30.762 20.939  1.00 12.40 ? 75  GLU A OE2 1 
ATOM   538  N  N   . ASP A 1 72  ? -19.354 26.549 16.832  1.00 12.19 ? 76  ASP A N   1 
ATOM   539  C  CA  . ASP A 1 72  ? -19.758 25.514 15.867  1.00 12.53 ? 76  ASP A CA  1 
ATOM   540  C  C   . ASP A 1 72  ? -19.645 26.047 14.432  1.00 12.61 ? 76  ASP A C   1 
ATOM   541  O  O   . ASP A 1 72  ? -19.237 25.320 13.515  1.00 12.97 ? 76  ASP A O   1 
ATOM   542  C  CB  . ASP A 1 72  ? -21.185 25.008 16.154  1.00 12.88 ? 76  ASP A CB  1 
ATOM   543  C  CG  . ASP A 1 72  ? -21.268 24.107 17.399  1.00 14.48 ? 76  ASP A CG  1 
ATOM   544  O  OD1 . ASP A 1 72  ? -20.219 23.714 17.967  1.00 17.78 ? 76  ASP A OD1 1 
ATOM   545  O  OD2 . ASP A 1 72  ? -22.397 23.783 17.817  1.00 16.00 ? 76  ASP A OD2 1 
ATOM   546  N  N   . GLY A 1 73  ? -19.977 27.323 14.246  1.00 12.10 ? 77  GLY A N   1 
ATOM   547  C  CA  . GLY A 1 73  ? -19.881 27.971 12.945  1.00 11.92 ? 77  GLY A CA  1 
ATOM   548  C  C   . GLY A 1 73  ? -18.436 28.121 12.505  1.00 11.82 ? 77  GLY A C   1 
ATOM   549  O  O   . GLY A 1 73  ? -18.085 27.756 11.387  1.00 11.18 ? 77  GLY A O   1 
ATOM   550  N  N   . LEU A 1 74  ? -17.613 28.660 13.400  1.00 12.16 ? 78  LEU A N   1 
ATOM   551  C  CA  . LEU A 1 74  ? -16.164 28.816 13.171  1.00 12.66 ? 78  LEU A CA  1 
ATOM   552  C  C   . LEU A 1 74  ? -15.560 27.558 12.557  1.00 12.95 ? 78  LEU A C   1 
ATOM   553  O  O   . LEU A 1 74  ? -14.951 27.619 11.498  1.00 13.49 ? 78  LEU A O   1 
ATOM   554  C  CB  . LEU A 1 74  ? -15.464 29.109 14.495  1.00 12.53 ? 78  LEU A CB  1 
ATOM   555  C  CG  . LEU A 1 74  ? -13.934 29.053 14.539  1.00 13.89 ? 78  LEU A CG  1 
ATOM   556  C  CD1 . LEU A 1 74  ? -13.364 30.124 13.648  1.00 15.05 ? 78  LEU A CD1 1 
ATOM   557  C  CD2 . LEU A 1 74  ? -13.430 29.203 15.978  1.00 15.46 ? 78  LEU A CD2 1 
ATOM   558  N  N   . ASN A 1 75  ? -15.750 26.416 13.221  1.00 13.32 ? 79  ASN A N   1 
ATOM   559  C  CA  . ASN A 1 75  ? -15.140 25.155 12.770  1.00 13.86 ? 79  ASN A CA  1 
ATOM   560  C  C   . ASN A 1 75  ? -15.628 24.687 11.399  1.00 14.36 ? 79  ASN A C   1 
ATOM   561  O  O   . ASN A 1 75  ? -14.956 23.890 10.752  1.00 14.91 ? 79  ASN A O   1 
ATOM   562  C  CB  . ASN A 1 75  ? -15.361 24.038 13.797  1.00 13.62 ? 79  ASN A CB  1 
ATOM   563  C  CG  . ASN A 1 75  ? -14.541 24.234 15.053  1.00 14.38 ? 79  ASN A CG  1 
ATOM   564  O  OD1 . ASN A 1 75  ? -13.325 24.386 14.989  1.00 14.24 ? 79  ASN A OD1 1 
ATOM   565  N  ND2 . ASN A 1 75  ? -15.206 24.246 16.205  1.00 14.24 ? 79  ASN A ND2 1 
ATOM   566  N  N   . ARG A 1 76  ? -16.790 25.170 10.963  1.00 14.64 ? 80  ARG A N   1 
ATOM   567  C  CA  . ARG A 1 76  ? -17.334 24.812 9.645   1.00 15.01 ? 80  ARG A CA  1 
ATOM   568  C  C   . ARG A 1 76  ? -16.955 25.781 8.519   1.00 15.67 ? 80  ARG A C   1 
ATOM   569  O  O   . ARG A 1 76  ? -17.174 25.467 7.347   1.00 16.17 ? 80  ARG A O   1 
ATOM   570  C  CB  . ARG A 1 76  ? -18.859 24.677 9.731   1.00 14.88 ? 80  ARG A CB  1 
ATOM   571  C  CG  . ARG A 1 76  ? -19.304 23.547 10.632  1.00 14.92 ? 80  ARG A CG  1 
ATOM   572  C  CD  . ARG A 1 76  ? -20.760 23.689 11.059  1.00 15.87 ? 80  ARG A CD  1 
ATOM   573  N  NE  . ARG A 1 76  ? -21.184 22.558 11.886  1.00 16.06 ? 80  ARG A NE  1 
ATOM   574  C  CZ  . ARG A 1 76  ? -21.483 21.353 11.420  1.00 16.92 ? 80  ARG A CZ  1 
ATOM   575  N  NH1 . ARG A 1 76  ? -21.425 21.091 10.115  1.00 18.84 ? 80  ARG A NH1 1 
ATOM   576  N  NH2 . ARG A 1 76  ? -21.849 20.396 12.263  1.00 17.07 ? 80  ARG A NH2 1 
ATOM   577  N  N   . VAL A 1 77  ? -16.378 26.935 8.854   1.00 16.10 ? 81  VAL A N   1 
ATOM   578  C  CA  . VAL A 1 77  ? -16.027 27.948 7.847   1.00 16.53 ? 81  VAL A CA  1 
ATOM   579  C  C   . VAL A 1 77  ? -14.518 28.198 7.689   1.00 17.65 ? 81  VAL A C   1 
ATOM   580  O  O   . VAL A 1 77  ? -14.121 29.150 7.009   1.00 17.40 ? 81  VAL A O   1 
ATOM   581  C  CB  . VAL A 1 77  ? -16.744 29.300 8.121   1.00 16.37 ? 81  VAL A CB  1 
ATOM   582  C  CG1 . VAL A 1 77  ? -18.257 29.114 8.052   1.00 16.49 ? 81  VAL A CG1 1 
ATOM   583  C  CG2 . VAL A 1 77  ? -16.332 29.883 9.466   1.00 15.62 ? 81  VAL A CG2 1 
ATOM   584  N  N   . LEU A 1 78  ? -13.683 27.352 8.290   1.00 18.54 ? 82  LEU A N   1 
ATOM   585  C  CA  . LEU A 1 78  ? -12.224 27.550 8.222   1.00 19.62 ? 82  LEU A CA  1 
ATOM   586  C  C   . LEU A 1 78  ? -11.656 27.328 6.814   1.00 20.34 ? 82  LEU A C   1 
ATOM   587  O  O   . LEU A 1 78  ? -10.684 27.987 6.421   1.00 20.73 ? 82  LEU A O   1 
ATOM   588  C  CB  . LEU A 1 78  ? -11.496 26.633 9.216   1.00 19.72 ? 82  LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 78  ? -11.634 26.936 10.707  1.00 20.20 ? 82  LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 78  ? -10.725 26.033 11.519  1.00 21.48 ? 82  LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 78  ? -11.324 28.402 11.025  1.00 21.40 ? 82  LEU A CD2 1 
ATOM   592  N  N   . GLY A 1 79  ? -12.248 26.397 6.076   1.00 21.33 ? 83  GLY A N   1 
ATOM   593  C  CA  . GLY A 1 79  ? -11.802 26.082 4.714   1.00 22.16 ? 83  GLY A CA  1 
ATOM   594  C  C   . GLY A 1 79  ? -10.497 25.301 4.607   1.00 22.81 ? 83  GLY A C   1 
ATOM   595  O  O   . GLY A 1 79  ? -9.950  25.166 3.507   1.00 23.91 ? 83  GLY A O   1 
ATOM   596  N  N   . LEU A 1 80  ? -10.013 24.760 5.727   1.00 23.04 ? 84  LEU A N   1 
ATOM   597  C  CA  . LEU A 1 80  ? -8.700  24.103 5.778   1.00 23.07 ? 84  LEU A CA  1 
ATOM   598  C  C   . LEU A 1 80  ? -8.760  22.590 5.538   1.00 23.55 ? 84  LEU A C   1 
ATOM   599  O  O   . LEU A 1 80  ? -7.733  21.912 5.612   1.00 23.52 ? 84  LEU A O   1 
ATOM   600  C  CB  . LEU A 1 80  ? -8.019  24.385 7.124   1.00 23.06 ? 84  LEU A CB  1 
ATOM   601  C  CG  . LEU A 1 80  ? -7.749  25.856 7.463   1.00 22.89 ? 84  LEU A CG  1 
ATOM   602  C  CD1 . LEU A 1 80  ? -7.343  26.018 8.924   1.00 23.61 ? 84  LEU A CD1 1 
ATOM   603  C  CD2 . LEU A 1 80  ? -6.674  26.439 6.550   1.00 22.70 ? 84  LEU A CD2 1 
ATOM   604  N  N   . GLY A 1 81  ? -9.956  22.065 5.254   1.00 23.79 ? 85  GLY A N   1 
ATOM   605  C  CA  . GLY A 1 81  ? -10.144 20.641 4.990   1.00 24.18 ? 85  GLY A CA  1 
ATOM   606  C  C   . GLY A 1 81  ? -9.917  19.722 6.180   1.00 24.51 ? 85  GLY A C   1 
ATOM   607  O  O   . GLY A 1 81  ? -9.728  18.519 6.006   1.00 24.41 ? 85  GLY A O   1 
ATOM   608  N  N   . LEU A 1 82  ? -9.961  20.279 7.389   1.00 25.13 ? 86  LEU A N   1 
ATOM   609  C  CA  . LEU A 1 82  ? -9.547  19.551 8.591   1.00 25.63 ? 86  LEU A CA  1 
ATOM   610  C  C   . LEU A 1 82  ? -10.651 18.641 9.137   1.00 25.94 ? 86  LEU A C   1 
ATOM   611  O  O   . LEU A 1 82  ? -11.789 19.067 9.314   1.00 26.39 ? 86  LEU A O   1 
ATOM   612  C  CB  . LEU A 1 82  ? -9.076  20.539 9.666   1.00 25.60 ? 86  LEU A CB  1 
ATOM   613  C  CG  . LEU A 1 82  ? -7.794  21.297 9.296   1.00 25.81 ? 86  LEU A CG  1 
ATOM   614  C  CD1 . LEU A 1 82  ? -7.478  22.364 10.333  1.00 25.76 ? 86  LEU A CD1 1 
ATOM   615  C  CD2 . LEU A 1 82  ? -6.625  20.337 9.138   1.00 25.59 ? 86  LEU A CD2 1 
ATOM   616  N  N   . ARG A 1 86  ? -11.028 21.013 16.490  1.00 17.00 ? 90  ARG A N   1 
ATOM   617  C  CA  . ARG A 1 86  ? -12.200 21.558 17.158  1.00 16.80 ? 90  ARG A CA  1 
ATOM   618  C  C   . ARG A 1 86  ? -11.853 22.759 18.035  1.00 15.73 ? 90  ARG A C   1 
ATOM   619  O  O   . ARG A 1 86  ? -11.476 22.595 19.199  1.00 15.94 ? 90  ARG A O   1 
ATOM   620  C  CB  . ARG A 1 86  ? -12.862 20.493 18.031  1.00 17.48 ? 90  ARG A CB  1 
ATOM   621  C  CG  . ARG A 1 86  ? -13.869 19.612 17.312  1.00 19.72 ? 90  ARG A CG  1 
ATOM   622  C  CD  . ARG A 1 86  ? -14.837 18.959 18.294  1.00 23.12 ? 90  ARG A CD  1 
ATOM   623  N  NE  . ARG A 1 86  ? -15.640 19.949 19.031  1.00 26.43 ? 90  ARG A NE  1 
ATOM   624  C  CZ  . ARG A 1 86  ? -15.550 20.226 20.338  1.00 28.29 ? 90  ARG A CZ  1 
ATOM   625  N  NH1 . ARG A 1 86  ? -14.688 19.594 21.138  1.00 29.06 ? 90  ARG A NH1 1 
ATOM   626  N  NH2 . ARG A 1 86  ? -16.347 21.149 20.861  1.00 28.76 ? 90  ARG A NH2 1 
ATOM   627  N  N   . LEU A 1 87  ? -11.996 23.956 17.480  1.00 14.72 ? 91  LEU A N   1 
ATOM   628  C  CA  . LEU A 1 87  ? -11.809 25.186 18.257  1.00 14.02 ? 91  LEU A CA  1 
ATOM   629  C  C   . LEU A 1 87  ? -13.008 25.391 19.183  1.00 12.96 ? 91  LEU A C   1 
ATOM   630  O  O   . LEU A 1 87  ? -14.135 25.030 18.834  1.00 12.34 ? 91  LEU A O   1 
ATOM   631  C  CB  . LEU A 1 87  ? -11.619 26.384 17.330  1.00 14.25 ? 91  LEU A CB  1 
ATOM   632  C  CG  . LEU A 1 87  ? -10.421 26.241 16.385  1.00 14.84 ? 91  LEU A CG  1 
ATOM   633  C  CD1 . LEU A 1 87  ? -10.448 27.338 15.337  1.00 15.00 ? 91  LEU A CD1 1 
ATOM   634  C  CD2 . LEU A 1 87  ? -9.110  26.255 17.157  1.00 13.95 ? 91  LEU A CD2 1 
ATOM   635  N  N   . THR A 1 88  ? -12.758 25.950 20.369  1.00 11.66 ? 92  THR A N   1 
ATOM   636  C  CA  . THR A 1 88  ? -13.805 26.163 21.370  1.00 11.13 ? 92  THR A CA  1 
ATOM   637  C  C   . THR A 1 88  ? -13.673 27.541 22.004  1.00 10.10 ? 92  THR A C   1 
ATOM   638  O  O   . THR A 1 88  ? -12.796 28.323 21.645  1.00 9.80  ? 92  THR A O   1 
ATOM   639  C  CB  . THR A 1 88  ? -13.737 25.114 22.514  1.00 11.06 ? 92  THR A CB  1 
ATOM   640  O  OG1 . THR A 1 88  ? -12.588 25.368 23.338  1.00 10.52 ? 92  THR A OG1 1 
ATOM   641  C  CG2 . THR A 1 88  ? -13.677 23.693 21.949  1.00 11.78 ? 92  THR A CG2 1 
ATOM   642  N  N   . GLU A 1 89  ? -14.534 27.810 22.984  1.00 9.43  ? 93  GLU A N   1 
ATOM   643  C  CA  . GLU A 1 89  ? -14.451 29.039 23.759  1.00 8.75  ? 93  GLU A CA  1 
ATOM   644  C  C   . GLU A 1 89  ? -13.094 29.200 24.446  1.00 8.54  ? 93  GLU A C   1 
ATOM   645  O  O   . GLU A 1 89  ? -12.689 30.324 24.753  1.00 8.52  ? 93  GLU A O   1 
ATOM   646  C  CB  . GLU A 1 89  ? -15.570 29.103 24.805  1.00 8.67  ? 93  GLU A CB  1 
ATOM   647  C  CG  . GLU A 1 89  ? -16.994 29.137 24.215  1.00 9.26  ? 93  GLU A CG  1 
ATOM   648  C  CD  . GLU A 1 89  ? -17.629 27.759 24.064  1.00 11.43 ? 93  GLU A CD  1 
ATOM   649  O  OE1 . GLU A 1 89  ? -16.900 26.780 23.762  1.00 13.74 ? 93  GLU A OE1 1 
ATOM   650  O  OE2 . GLU A 1 89  ? -18.874 27.652 24.228  1.00 12.52 ? 93  GLU A OE2 1 
ATOM   651  N  N   . ALA A 1 90  ? -12.404 28.095 24.711  1.00 8.29  ? 94  ALA A N   1 
ATOM   652  C  CA  . ALA A 1 90  ? -11.082 28.161 25.344  1.00 8.62  ? 94  ALA A CA  1 
ATOM   653  C  C   . ALA A 1 90  ? -10.063 28.864 24.448  1.00 8.63  ? 94  ALA A C   1 
ATOM   654  O  O   . ALA A 1 90  ? -9.079  29.426 24.933  1.00 8.83  ? 94  ALA A O   1 
ATOM   655  C  CB  . ALA A 1 90  ? -10.595 26.774 25.700  1.00 8.83  ? 94  ALA A CB  1 
ATOM   656  N  N   . ASP A 1 91  ? -10.310 28.825 23.143  1.00 8.42  ? 95  ASP A N   1 
ATOM   657  C  CA  . ASP A 1 91  ? -9.432  29.436 22.146  1.00 8.76  ? 95  ASP A CA  1 
ATOM   658  C  C   . ASP A 1 91  ? -9.825  30.882 21.808  1.00 9.38  ? 95  ASP A C   1 
ATOM   659  O  O   . ASP A 1 91  ? -9.114  31.575 21.060  1.00 9.85  ? 95  ASP A O   1 
ATOM   660  C  CB  . ASP A 1 91  ? -9.453  28.578 20.882  1.00 9.18  ? 95  ASP A CB  1 
ATOM   661  C  CG  . ASP A 1 91  ? -9.080  27.149 21.154  1.00 9.43  ? 95  ASP A CG  1 
ATOM   662  O  OD1 . ASP A 1 91  ? -7.964  26.927 21.682  1.00 8.76  ? 95  ASP A OD1 1 
ATOM   663  O  OD2 . ASP A 1 91  ? -9.897  26.248 20.827  1.00 10.18 ? 95  ASP A OD2 1 
ATOM   664  N  N   . TYR A 1 92  ? -10.946 31.349 22.359  1.00 9.51  ? 96  TYR A N   1 
ATOM   665  C  CA  . TYR A 1 92  ? -11.450 32.696 22.049  1.00 9.70  ? 96  TYR A CA  1 
ATOM   666  C  C   . TYR A 1 92  ? -10.513 33.786 22.577  1.00 10.08 ? 96  TYR A C   1 
ATOM   667  O  O   . TYR A 1 92  ? -10.032 33.705 23.714  1.00 10.12 ? 96  TYR A O   1 
ATOM   668  C  CB  . TYR A 1 92  ? -12.860 32.875 22.634  1.00 9.54  ? 96  TYR A CB  1 
ATOM   669  C  CG  . TYR A 1 92  ? -13.424 34.286 22.569  1.00 10.36 ? 96  TYR A CG  1 
ATOM   670  C  CD1 . TYR A 1 92  ? -14.030 34.766 21.415  1.00 9.53  ? 96  TYR A CD1 1 
ATOM   671  C  CD2 . TYR A 1 92  ? -13.368 35.126 23.673  1.00 10.43 ? 96  TYR A CD2 1 
ATOM   672  C  CE1 . TYR A 1 92  ? -14.559 36.057 21.356  1.00 12.16 ? 96  TYR A CE1 1 
ATOM   673  C  CE2 . TYR A 1 92  ? -13.892 36.409 23.628  1.00 11.75 ? 96  TYR A CE2 1 
ATOM   674  C  CZ  . TYR A 1 92  ? -14.481 36.872 22.467  1.00 10.22 ? 96  TYR A CZ  1 
ATOM   675  O  OH  . TYR A 1 92  ? -14.999 38.158 22.445  1.00 11.46 ? 96  TYR A OH  1 
ATOM   676  N  N   . LEU A 1 93  ? -10.271 34.813 21.762  1.00 10.68 ? 97  LEU A N   1 
ATOM   677  C  CA  . LEU A 1 93  ? -9.431  35.938 22.183  1.00 11.39 ? 97  LEU A CA  1 
ATOM   678  C  C   . LEU A 1 93  ? -10.246 37.209 22.411  1.00 11.99 ? 97  LEU A C   1 
ATOM   679  O  O   . LEU A 1 93  ? -10.236 37.765 23.516  1.00 11.67 ? 97  LEU A O   1 
ATOM   680  C  CB  . LEU A 1 93  ? -8.325  36.224 21.163  1.00 11.62 ? 97  LEU A CB  1 
ATOM   681  C  CG  . LEU A 1 93  ? -7.147  35.244 21.070  1.00 12.38 ? 97  LEU A CG  1 
ATOM   682  C  CD1 . LEU A 1 93  ? -6.040  35.878 20.219  1.00 13.31 ? 97  LEU A CD1 1 
ATOM   683  C  CD2 . LEU A 1 93  ? -6.599  34.836 22.433  1.00 13.55 ? 97  LEU A CD2 1 
ATOM   684  N  N   . SER A 1 94  ? -10.922 37.683 21.365  1.00 12.78 ? 98  SER A N   1 
ATOM   685  C  CA  A SER A 1 94  ? -11.757 38.874 21.501  0.50 13.03 ? 98  SER A CA  1 
ATOM   686  C  CA  B SER A 1 94  ? -11.640 38.954 21.411  0.50 13.22 ? 98  SER A CA  1 
ATOM   687  C  C   . SER A 1 94  ? -12.695 39.073 20.320  1.00 13.34 ? 98  SER A C   1 
ATOM   688  O  O   . SER A 1 94  ? -12.684 38.310 19.346  1.00 12.80 ? 98  SER A O   1 
ATOM   689  C  CB  A SER A 1 94  ? -10.908 40.139 21.710  0.50 13.08 ? 98  SER A CB  1 
ATOM   690  C  CB  B SER A 1 94  ? -10.644 40.093 21.202  0.50 13.38 ? 98  SER A CB  1 
ATOM   691  O  OG  A SER A 1 94  ? -11.643 41.118 22.423  0.50 13.18 ? 98  SER A OG  1 
ATOM   692  O  OG  B SER A 1 94  ? -10.065 39.983 19.909  0.50 14.23 ? 98  SER A OG  1 
ATOM   693  N  N   . SER A 1 95  ? -13.555 40.073 20.465  1.00 13.88 ? 99  SER A N   1 
ATOM   694  C  CA  . SER A 1 95  ? -14.497 40.455 19.419  1.00 14.63 ? 99  SER A CA  1 
ATOM   695  C  C   . SER A 1 95  ? -14.398 41.946 19.204  1.00 15.74 ? 99  SER A C   1 
ATOM   696  O  O   . SER A 1 95  ? -14.313 42.713 20.169  1.00 14.46 ? 99  SER A O   1 
ATOM   697  C  CB  . SER A 1 95  ? -15.919 40.108 19.809  1.00 14.61 ? 99  SER A CB  1 
ATOM   698  O  OG  . SER A 1 95  ? -16.019 38.743 20.143  1.00 14.31 ? 99  SER A OG  1 
ATOM   699  N  N   . HIS A 1 96  ? -14.420 42.352 17.939  1.00 16.98 ? 100 HIS A N   1 
ATOM   700  C  CA  . HIS A 1 96  ? -14.364 43.761 17.591  1.00 18.39 ? 100 HIS A CA  1 
ATOM   701  C  C   . HIS A 1 96  ? -15.473 44.127 16.605  1.00 19.41 ? 100 HIS A C   1 
ATOM   702  O  O   . HIS A 1 96  ? -15.750 43.377 15.665  1.00 19.22 ? 100 HIS A O   1 
ATOM   703  C  CB  . HIS A 1 96  ? -13.001 44.090 16.978  1.00 18.39 ? 100 HIS A CB  1 
ATOM   704  C  CG  . HIS A 1 96  ? -11.858 43.975 17.944  1.00 19.74 ? 100 HIS A CG  1 
ATOM   705  N  ND1 . HIS A 1 96  ? -11.085 42.837 18.054  1.00 20.70 ? 100 HIS A ND1 1 
ATOM   706  C  CD2 . HIS A 1 96  ? -11.358 44.859 18.842  1.00 20.83 ? 100 HIS A CD2 1 
ATOM   707  C  CE1 . HIS A 1 96  ? -10.156 43.027 18.976  1.00 21.35 ? 100 HIS A CE1 1 
ATOM   708  N  NE2 . HIS A 1 96  ? -10.299 44.246 19.468  1.00 20.50 ? 100 HIS A NE2 1 
ATOM   709  N  N   . LEU A 1 97  ? -16.092 45.282 16.827  1.00 20.47 ? 101 LEU A N   1 
ATOM   710  C  CA  . LEU A 1 97  ? -17.014 45.859 15.852  1.00 21.45 ? 101 LEU A CA  1 
ATOM   711  C  C   . LEU A 1 97  ? -16.148 46.432 14.731  1.00 22.12 ? 101 LEU A C   1 
ATOM   712  O  O   . LEU A 1 97  ? -15.200 47.169 15.003  1.00 22.41 ? 101 LEU A O   1 
ATOM   713  C  CB  . LEU A 1 97  ? -17.874 46.957 16.494  1.00 21.43 ? 101 LEU A CB  1 
ATOM   714  C  CG  . LEU A 1 97  ? -18.621 46.588 17.786  1.00 21.90 ? 101 LEU A CG  1 
ATOM   715  C  CD1 . LEU A 1 97  ? -19.331 47.803 18.390  1.00 22.19 ? 101 LEU A CD1 1 
ATOM   716  C  CD2 . LEU A 1 97  ? -19.606 45.463 17.525  1.00 22.22 ? 101 LEU A CD2 1 
ATOM   717  N  N   . THR A 1 98  ? -16.445 46.069 13.484  1.00 22.89 ? 102 THR A N   1 
ATOM   718  C  CA  . THR A 1 98  ? -15.620 46.494 12.340  1.00 23.43 ? 102 THR A CA  1 
ATOM   719  C  C   . THR A 1 98  ? -15.889 47.949 11.947  1.00 23.30 ? 102 THR A C   1 
ATOM   720  O  O   . THR A 1 98  ? -16.799 48.588 12.473  1.00 23.57 ? 102 THR A O   1 
ATOM   721  C  CB  . THR A 1 98  ? -15.840 45.602 11.096  1.00 23.44 ? 102 THR A CB  1 
ATOM   722  O  OG1 . THR A 1 98  ? -17.159 45.815 10.573  1.00 24.72 ? 102 THR A OG1 1 
ATOM   723  C  CG2 . THR A 1 98  ? -15.649 44.133 11.444  1.00 24.46 ? 102 THR A CG2 1 
ATOM   724  N  N   . ARG A 1 103 ? -21.576 46.844 9.456   1.00 20.51 ? 107 ARG A N   1 
ATOM   725  C  CA  . ARG A 1 103 ? -22.362 46.271 10.544  1.00 20.26 ? 107 ARG A CA  1 
ATOM   726  C  C   . ARG A 1 103 ? -21.945 44.819 10.804  1.00 19.79 ? 107 ARG A C   1 
ATOM   727  O  O   . ARG A 1 103 ? -22.745 43.885 10.677  1.00 19.88 ? 107 ARG A O   1 
ATOM   728  C  CB  . ARG A 1 103 ? -23.844 46.366 10.204  1.00 20.83 ? 107 ARG A CB  1 
ATOM   729  C  CG  . ARG A 1 103 ? -24.785 46.211 11.388  1.00 21.66 ? 107 ARG A CG  1 
ATOM   730  C  CD  . ARG A 1 103 ? -26.151 46.759 11.036  1.00 23.03 ? 107 ARG A CD  1 
ATOM   731  N  NE  . ARG A 1 103 ? -26.119 48.218 10.905  1.00 24.04 ? 107 ARG A NE  1 
ATOM   732  C  CZ  . ARG A 1 103 ? -26.956 48.947 10.164  1.00 23.93 ? 107 ARG A CZ  1 
ATOM   733  N  NH1 . ARG A 1 103 ? -27.926 48.372 9.457   1.00 24.06 ? 107 ARG A NH1 1 
ATOM   734  N  NH2 . ARG A 1 103 ? -26.819 50.269 10.132  1.00 24.18 ? 107 ARG A NH2 1 
ATOM   735  N  N   . VAL A 1 104 ? -20.680 44.642 11.175  1.00 18.82 ? 108 VAL A N   1 
ATOM   736  C  CA  . VAL A 1 104 ? -20.105 43.313 11.370  1.00 18.13 ? 108 VAL A CA  1 
ATOM   737  C  C   . VAL A 1 104 ? -19.346 43.241 12.697  1.00 17.37 ? 108 VAL A C   1 
ATOM   738  O  O   . VAL A 1 104 ? -18.643 44.184 13.067  1.00 17.38 ? 108 VAL A O   1 
ATOM   739  C  CB  . VAL A 1 104 ? -19.151 42.960 10.209  1.00 18.18 ? 108 VAL A CB  1 
ATOM   740  C  CG1 . VAL A 1 104 ? -18.474 41.610 10.432  1.00 18.48 ? 108 VAL A CG1 1 
ATOM   741  C  CG2 . VAL A 1 104 ? -19.902 42.974 8.877   1.00 18.61 ? 108 VAL A CG2 1 
ATOM   742  N  N   . VAL A 1 105 ? -19.529 42.135 13.418  1.00 16.27 ? 109 VAL A N   1 
ATOM   743  C  CA  . VAL A 1 105 ? -18.701 41.807 14.575  1.00 15.28 ? 109 VAL A CA  1 
ATOM   744  C  C   . VAL A 1 105 ? -17.716 40.733 14.147  1.00 14.52 ? 109 VAL A C   1 
ATOM   745  O  O   . VAL A 1 105 ? -18.119 39.686 13.638  1.00 13.51 ? 109 VAL A O   1 
ATOM   746  C  CB  . VAL A 1 105 ? -19.526 41.287 15.768  1.00 15.57 ? 109 VAL A CB  1 
ATOM   747  C  CG1 . VAL A 1 105 ? -18.606 41.006 16.962  1.00 15.29 ? 109 VAL A CG1 1 
ATOM   748  C  CG2 . VAL A 1 105 ? -20.598 42.282 16.148  1.00 16.25 ? 109 VAL A CG2 1 
ATOM   749  N  N   . ALA A 1 106 ? -16.426 40.997 14.358  1.00 13.29 ? 110 ALA A N   1 
ATOM   750  C  CA  . ALA A 1 106 ? -15.357 40.075 13.985  1.00 13.05 ? 110 ALA A CA  1 
ATOM   751  C  C   . ALA A 1 106 ? -14.827 39.390 15.244  1.00 12.71 ? 110 ALA A C   1 
ATOM   752  O  O   . ALA A 1 106 ? -14.278 40.055 16.129  1.00 12.44 ? 110 ALA A O   1 
ATOM   753  C  CB  . ALA A 1 106 ? -14.224 40.828 13.270  1.00 13.20 ? 110 ALA A CB  1 
ATOM   754  N  N   . HIS A 1 107 ? -15.039 38.075 15.324  1.00 11.84 ? 111 HIS A N   1 
ATOM   755  C  CA  . HIS A 1 107 ? -14.612 37.256 16.460  1.00 11.29 ? 111 HIS A CA  1 
ATOM   756  C  C   . HIS A 1 107 ? -13.306 36.551 16.148  1.00 11.28 ? 111 HIS A C   1 
ATOM   757  O  O   . HIS A 1 107 ? -13.173 35.873 15.120  1.00 12.08 ? 111 HIS A O   1 
ATOM   758  C  CB  . HIS A 1 107 ? -15.671 36.202 16.794  1.00 10.86 ? 111 HIS A CB  1 
ATOM   759  C  CG  . HIS A 1 107 ? -17.027 36.773 17.057  1.00 9.55  ? 111 HIS A CG  1 
ATOM   760  N  ND1 . HIS A 1 107 ? -17.335 37.441 18.224  1.00 9.29  ? 111 HIS A ND1 1 
ATOM   761  C  CD2 . HIS A 1 107 ? -18.158 36.765 16.315  1.00 8.76  ? 111 HIS A CD2 1 
ATOM   762  C  CE1 . HIS A 1 107 ? -18.596 37.834 18.179  1.00 8.82  ? 111 HIS A CE1 1 
ATOM   763  N  NE2 . HIS A 1 107 ? -19.119 37.432 17.035  1.00 9.27  ? 111 HIS A NE2 1 
ATOM   764  N  N   . LEU A 1 108 ? -12.349 36.683 17.056  1.00 11.06 ? 112 LEU A N   1 
ATOM   765  C  CA  . LEU A 1 108 ? -11.026 36.090 16.875  1.00 11.25 ? 112 LEU A CA  1 
ATOM   766  C  C   . LEU A 1 108 ? -10.737 34.979 17.873  1.00 10.61 ? 112 LEU A C   1 
ATOM   767  O  O   . LEU A 1 108 ? -10.861 35.181 19.067  1.00 11.42 ? 112 LEU A O   1 
ATOM   768  C  CB  . LEU A 1 108 ? -9.959  37.160 17.017  1.00 11.76 ? 112 LEU A CB  1 
ATOM   769  C  CG  . LEU A 1 108 ? -8.516  36.694 16.818  1.00 13.48 ? 112 LEU A CG  1 
ATOM   770  C  CD1 . LEU A 1 108 ? -8.300  36.147 15.414  1.00 14.26 ? 112 LEU A CD1 1 
ATOM   771  C  CD2 . LEU A 1 108 ? -7.568  37.859 17.109  1.00 14.83 ? 112 LEU A CD2 1 
ATOM   772  N  N   . TYR A 1 109 ? -10.306 33.840 17.350  1.00 10.34 ? 113 TYR A N   1 
ATOM   773  C  CA  . TYR A 1 109 ? -9.869  32.682 18.103  1.00 10.43 ? 113 TYR A CA  1 
ATOM   774  C  C   . TYR A 1 109 ? -8.417  32.386 17.718  1.00 10.42 ? 113 TYR A C   1 
ATOM   775  O  O   . TYR A 1 109 ? -7.981  32.725 16.622  1.00 10.21 ? 113 TYR A O   1 
ATOM   776  C  CB  . TYR A 1 109 ? -10.744 31.472 17.777  1.00 10.31 ? 113 TYR A CB  1 
ATOM   777  C  CG  . TYR A 1 109 ? -12.218 31.656 18.106  1.00 10.12 ? 113 TYR A CG  1 
ATOM   778  C  CD1 . TYR A 1 109 ? -12.780 31.029 19.212  1.00 10.02 ? 113 TYR A CD1 1 
ATOM   779  C  CD2 . TYR A 1 109 ? -13.047 32.441 17.308  1.00 10.83 ? 113 TYR A CD2 1 
ATOM   780  C  CE1 . TYR A 1 109 ? -14.125 31.199 19.532  1.00 9.89  ? 113 TYR A CE1 1 
ATOM   781  C  CE2 . TYR A 1 109 ? -14.401 32.604 17.612  1.00 9.49  ? 113 TYR A CE2 1 
ATOM   782  C  CZ  . TYR A 1 109 ? -14.924 31.976 18.735  1.00 9.39  ? 113 TYR A CZ  1 
ATOM   783  O  OH  . TYR A 1 109 ? -16.248 32.114 19.060  1.00 10.72 ? 113 TYR A OH  1 
ATOM   784  N  N   . ALA A 1 110 ? -7.679  31.761 18.624  1.00 10.25 ? 114 ALA A N   1 
ATOM   785  C  CA  . ALA A 1 110 ? -6.280  31.410 18.372  1.00 10.60 ? 114 ALA A CA  1 
ATOM   786  C  C   . ALA A 1 110 ? -5.926  30.094 19.052  1.00 10.61 ? 114 ALA A C   1 
ATOM   787  O  O   . ALA A 1 110 ? -6.442  29.788 20.126  1.00 11.36 ? 114 ALA A O   1 
ATOM   788  C  CB  . ALA A 1 110 ? -5.365  32.522 18.846  1.00 10.28 ? 114 ALA A CB  1 
ATOM   789  N  N   . ARG A 1 111 ? -5.050  29.315 18.418  1.00 10.47 ? 115 ARG A N   1 
ATOM   790  C  CA  . ARG A 1 111 ? -4.647  28.015 18.938  1.00 10.79 ? 115 ARG A CA  1 
ATOM   791  C  C   . ARG A 1 111 ? -3.190  27.782 18.574  1.00 10.29 ? 115 ARG A C   1 
ATOM   792  O  O   . ARG A 1 111 ? -2.814  27.907 17.402  1.00 8.90  ? 115 ARG A O   1 
ATOM   793  C  CB  . ARG A 1 111 ? -5.539  26.916 18.354  1.00 11.16 ? 115 ARG A CB  1 
ATOM   794  C  CG  . ARG A 1 111 ? -5.076  25.469 18.564  1.00 12.90 ? 115 ARG A CG  1 
ATOM   795  C  CD  . ARG A 1 111 ? -5.360  24.956 19.953  1.00 13.22 ? 115 ARG A CD  1 
ATOM   796  N  NE  . ARG A 1 111 ? -6.789  24.767 20.240  1.00 13.07 ? 115 ARG A NE  1 
ATOM   797  C  CZ  . ARG A 1 111 ? -7.525  23.720 19.867  1.00 13.20 ? 115 ARG A CZ  1 
ATOM   798  N  NH1 . ARG A 1 111 ? -6.997  22.710 19.179  1.00 15.09 ? 115 ARG A NH1 1 
ATOM   799  N  NH2 . ARG A 1 111 ? -8.814  23.673 20.191  1.00 12.77 ? 115 ARG A NH2 1 
ATOM   800  N  N   . GLN A 1 112 ? -2.385  27.470 19.589  1.00 10.30 ? 116 GLN A N   1 
ATOM   801  C  CA  . GLN A 1 112 ? -0.998  27.080 19.390  1.00 10.68 ? 116 GLN A CA  1 
ATOM   802  C  C   . GLN A 1 112 ? -0.939  25.590 19.066  1.00 10.58 ? 116 GLN A C   1 
ATOM   803  O  O   . GLN A 1 112 ? -1.503  24.757 19.779  1.00 10.59 ? 116 GLN A O   1 
ATOM   804  C  CB  . GLN A 1 112 ? -0.140  27.388 20.622  1.00 11.19 ? 116 GLN A CB  1 
ATOM   805  C  CG  . GLN A 1 112 ? 1.355   27.238 20.355  1.00 12.18 ? 116 GLN A CG  1 
ATOM   806  C  CD  . GLN A 1 112 ? 2.238   27.590 21.539  1.00 14.27 ? 116 GLN A CD  1 
ATOM   807  O  OE1 . GLN A 1 112 ? 1.764   28.019 22.585  1.00 16.79 ? 116 GLN A OE1 1 
ATOM   808  N  NE2 . GLN A 1 112 ? 3.545   27.396 21.374  1.00 16.08 ? 116 GLN A NE2 1 
ATOM   809  N  N   . LEU A 1 113 ? -0.259  25.280 17.968  1.00 10.94 ? 117 LEU A N   1 
ATOM   810  C  CA  . LEU A 1 113 ? -0.027  23.916 17.525  1.00 11.48 ? 117 LEU A CA  1 
ATOM   811  C  C   . LEU A 1 113 ? 1.473   23.666 17.568  1.00 11.48 ? 117 LEU A C   1 
ATOM   812  O  O   . LEU A 1 113 ? 2.255   24.602 17.733  1.00 11.27 ? 117 LEU A O   1 
ATOM   813  C  CB  . LEU A 1 113 ? -0.536  23.751 16.093  1.00 11.93 ? 117 LEU A CB  1 
ATOM   814  C  CG  . LEU A 1 113 ? -2.018  24.086 15.874  1.00 12.47 ? 117 LEU A CG  1 
ATOM   815  C  CD1 . LEU A 1 113 ? -2.364  24.059 14.384  1.00 14.79 ? 117 LEU A CD1 1 
ATOM   816  C  CD2 . LEU A 1 113 ? -2.898  23.136 16.665  1.00 14.18 ? 117 LEU A CD2 1 
ATOM   817  N  N   . THR A 1 114 ? 1.881   22.408 17.425  1.00 11.75 ? 118 THR A N   1 
ATOM   818  C  CA  . THR A 1 114 ? 3.286   22.121 17.172  1.00 11.66 ? 118 THR A CA  1 
ATOM   819  C  C   . THR A 1 114 ? 3.565   22.547 15.735  1.00 11.77 ? 118 THR A C   1 
ATOM   820  O  O   . THR A 1 114 ? 2.634   22.673 14.931  1.00 11.57 ? 118 THR A O   1 
ATOM   821  C  CB  . THR A 1 114 ? 3.621   20.627 17.349  1.00 11.52 ? 118 THR A CB  1 
ATOM   822  O  OG1 . THR A 1 114 ? 2.909   19.856 16.372  1.00 11.01 ? 118 THR A OG1 1 
ATOM   823  C  CG2 . THR A 1 114 ? 3.263   20.139 18.765  1.00 11.38 ? 118 THR A CG2 1 
ATOM   824  N  N   . LEU A 1 115 ? 4.831   22.784 15.406  1.00 11.87 ? 119 LEU A N   1 
ATOM   825  C  CA  . LEU A 1 115 ? 5.182   23.174 14.033  1.00 12.12 ? 119 LEU A CA  1 
ATOM   826  C  C   . LEU A 1 115 ? 4.797   22.067 13.049  1.00 12.12 ? 119 LEU A C   1 
ATOM   827  O  O   . LEU A 1 115 ? 4.389   22.335 11.917  1.00 12.44 ? 119 LEU A O   1 
ATOM   828  C  CB  . LEU A 1 115 ? 6.671   23.511 13.915  1.00 12.41 ? 119 LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 115 ? 7.103   24.215 12.627  1.00 12.44 ? 119 LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 115 ? 6.334   25.514 12.421  1.00 13.16 ? 119 LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 115 ? 8.618   24.463 12.645  1.00 13.08 ? 119 LEU A CD2 1 
ATOM   832  N  N   . GLU A 1 116 ? 4.899   20.829 13.517  1.00 12.89 ? 120 GLU A N   1 
ATOM   833  C  CA  . GLU A 1 116 ? 4.532   19.646 12.753  1.00 13.29 ? 120 GLU A CA  1 
ATOM   834  C  C   . GLU A 1 116 ? 3.033   19.645 12.451  1.00 12.98 ? 120 GLU A C   1 
ATOM   835  O  O   . GLU A 1 116 ? 2.615   19.347 11.331  1.00 12.98 ? 120 GLU A O   1 
ATOM   836  C  CB  . GLU A 1 116 ? 4.930   18.386 13.531  1.00 13.88 ? 120 GLU A CB  1 
ATOM   837  C  CG  . GLU A 1 116 ? 6.448   18.194 13.697  1.00 16.02 ? 120 GLU A CG  1 
ATOM   838  C  CD  . GLU A 1 116 ? 7.154   19.340 14.432  1.00 18.75 ? 120 GLU A CD  1 
ATOM   839  O  OE1 . GLU A 1 116 ? 6.754   19.660 15.578  1.00 18.57 ? 120 GLU A OE1 1 
ATOM   840  O  OE2 . GLU A 1 116 ? 8.107   19.925 13.853  1.00 22.28 ? 120 GLU A OE2 1 
ATOM   841  N  N   . GLN A 1 117 ? 2.231   20.001 13.450  1.00 12.48 ? 121 GLN A N   1 
ATOM   842  C  CA  . GLN A 1 117 ? 0.783   20.142 13.270  1.00 12.23 ? 121 GLN A CA  1 
ATOM   843  C  C   . GLN A 1 117 ? 0.436   21.311 12.344  1.00 11.98 ? 121 GLN A C   1 
ATOM   844  O  O   . GLN A 1 117 ? -0.503  21.221 11.556  1.00 12.07 ? 121 GLN A O   1 
ATOM   845  C  CB  . GLN A 1 117 ? 0.092   20.325 14.619  1.00 12.27 ? 121 GLN A CB  1 
ATOM   846  C  CG  . GLN A 1 117 ? -0.077  19.032 15.408  1.00 12.85 ? 121 GLN A CG  1 
ATOM   847  C  CD  . GLN A 1 117 ? -0.464  19.265 16.864  1.00 13.62 ? 121 GLN A CD  1 
ATOM   848  O  OE1 . GLN A 1 117 ? -0.276  20.351 17.412  1.00 12.17 ? 121 GLN A OE1 1 
ATOM   849  N  NE2 . GLN A 1 117 ? -1.004  18.229 17.499  1.00 14.29 ? 121 GLN A NE2 1 
ATOM   850  N  N   . LEU A 1 118 ? 1.181   22.411 12.458  1.00 11.69 ? 122 LEU A N   1 
ATOM   851  C  CA  . LEU A 1 118 ? 0.975   23.564 11.586  1.00 11.93 ? 122 LEU A CA  1 
ATOM   852  C  C   . LEU A 1 118 ? 1.241   23.195 10.130  1.00 11.87 ? 122 LEU A C   1 
ATOM   853  O  O   . LEU A 1 118 ? 0.485   23.593 9.241   1.00 12.20 ? 122 LEU A O   1 
ATOM   854  C  CB  . LEU A 1 118 ? 1.871   24.741 11.992  1.00 11.77 ? 122 LEU A CB  1 
ATOM   855  C  CG  . LEU A 1 118 ? 1.437   26.113 11.467  1.00 12.26 ? 122 LEU A CG  1 
ATOM   856  C  CD1 . LEU A 1 118 ? 0.240   26.644 12.262  1.00 15.28 ? 122 LEU A CD1 1 
ATOM   857  C  CD2 . LEU A 1 118 ? 2.577   27.098 11.524  1.00 13.72 ? 122 LEU A CD2 1 
ATOM   858  N  N   . HIS A 1 119 ? 2.310   22.440 9.884   1.00 11.35 ? 123 HIS A N   1 
ATOM   859  C  CA  . HIS A 1 119 ? 2.583   21.941 8.540   1.00 11.76 ? 123 HIS A CA  1 
ATOM   860  C  C   . HIS A 1 119 ? 1.473   21.008 8.056   1.00 11.65 ? 123 HIS A C   1 
ATOM   861  O  O   . HIS A 1 119 ? 1.058   21.088 6.899   1.00 11.85 ? 123 HIS A O   1 
ATOM   862  C  CB  . HIS A 1 119 ? 3.950   21.245 8.463   1.00 12.03 ? 123 HIS A CB  1 
ATOM   863  C  CG  . HIS A 1 119 ? 4.435   21.024 7.065   1.00 12.67 ? 123 HIS A CG  1 
ATOM   864  N  ND1 . HIS A 1 119 ? 5.274   19.983 6.724   1.00 15.01 ? 123 HIS A ND1 1 
ATOM   865  C  CD2 . HIS A 1 119 ? 4.193   21.702 5.920   1.00 12.38 ? 123 HIS A CD2 1 
ATOM   866  C  CE1 . HIS A 1 119 ? 5.531   20.036 5.429   1.00 14.77 ? 123 HIS A CE1 1 
ATOM   867  N  NE2 . HIS A 1 119 ? 4.886   21.069 4.917   1.00 14.45 ? 123 HIS A NE2 1 
ATOM   868  N  N   . ALA A 1 120 ? 0.977   20.142 8.941   1.00 10.91 ? 124 ALA A N   1 
ATOM   869  C  CA  . ALA A 1 120 ? -0.146  19.275 8.591   1.00 11.27 ? 124 ALA A CA  1 
ATOM   870  C  C   . ALA A 1 120 ? -1.370  20.068 8.127   1.00 11.03 ? 124 ALA A C   1 
ATOM   871  O  O   . ALA A 1 120 ? -2.078  19.633 7.220   1.00 11.68 ? 124 ALA A O   1 
ATOM   872  C  CB  . ALA A 1 120 ? -0.515  18.341 9.761   1.00 10.87 ? 124 ALA A CB  1 
ATOM   873  N  N   . VAL A 1 121 ? -1.617  21.229 8.729   1.00 11.10 ? 125 VAL A N   1 
ATOM   874  C  CA  . VAL A 1 121 ? -2.742  22.071 8.319   1.00 10.94 ? 125 VAL A CA  1 
ATOM   875  C  C   . VAL A 1 121 ? -2.530  22.616 6.903   1.00 11.11 ? 125 VAL A C   1 
ATOM   876  O  O   . VAL A 1 121 ? -3.453  22.631 6.097   1.00 11.09 ? 125 VAL A O   1 
ATOM   877  C  CB  . VAL A 1 121 ? -2.968  23.242 9.307   1.00 11.16 ? 125 VAL A CB  1 
ATOM   878  C  CG1 . VAL A 1 121 ? -3.942  24.268 8.735   1.00 10.57 ? 125 VAL A CG1 1 
ATOM   879  C  CG2 . VAL A 1 121 ? -3.467  22.721 10.641  1.00 11.95 ? 125 VAL A CG2 1 
ATOM   880  N  N   . GLU A 1 122 ? -1.305  23.046 6.606   1.00 11.28 ? 126 GLU A N   1 
ATOM   881  C  CA  . GLU A 1 122 ? -0.936  23.509 5.264   1.00 11.40 ? 126 GLU A CA  1 
ATOM   882  C  C   . GLU A 1 122 ? -1.130  22.430 4.199   1.00 11.85 ? 126 GLU A C   1 
ATOM   883  O  O   . GLU A 1 122 ? -1.599  22.720 3.098   1.00 11.83 ? 126 GLU A O   1 
ATOM   884  C  CB  . GLU A 1 122 ? 0.517   23.992 5.254   1.00 11.43 ? 126 GLU A CB  1 
ATOM   885  C  CG  . GLU A 1 122 ? 0.757   25.269 6.056   1.00 11.71 ? 126 GLU A CG  1 
ATOM   886  C  CD  . GLU A 1 122 ? 2.241   25.604 6.228   1.00 13.13 ? 126 GLU A CD  1 
ATOM   887  O  OE1 . GLU A 1 122 ? 3.026   24.680 6.503   1.00 14.56 ? 126 GLU A OE1 1 
ATOM   888  O  OE2 . GLU A 1 122 ? 2.620   26.800 6.114   1.00 13.01 ? 126 GLU A OE2 1 
ATOM   889  N  N   . ILE A 1 123 ? -0.773  21.191 4.529   1.00 12.02 ? 127 ILE A N   1 
ATOM   890  C  CA  . ILE A 1 123 ? -0.965  20.061 3.620   1.00 12.40 ? 127 ILE A CA  1 
ATOM   891  C  C   . ILE A 1 123 ? -2.462  19.817 3.418   1.00 12.59 ? 127 ILE A C   1 
ATOM   892  O  O   . ILE A 1 123 ? -2.932  19.725 2.286   1.00 12.58 ? 127 ILE A O   1 
ATOM   893  C  CB  . ILE A 1 123 ? -0.250  18.791 4.140   1.00 12.74 ? 127 ILE A CB  1 
ATOM   894  C  CG1 . ILE A 1 123 ? 1.271   18.979 4.081   1.00 13.44 ? 127 ILE A CG1 1 
ATOM   895  C  CG2 . ILE A 1 123 ? -0.661  17.545 3.332   1.00 12.37 ? 127 ILE A CG2 1 
ATOM   896  C  CD1 . ILE A 1 123 ? 2.062   17.970 4.915   1.00 14.39 ? 127 ILE A CD1 1 
ATOM   897  N  N   . SER A 1 124 ? -3.209  19.730 4.521   1.00 12.80 ? 128 SER A N   1 
ATOM   898  C  CA  . SER A 1 124 ? -4.666  19.546 4.472   1.00 12.84 ? 128 SER A CA  1 
ATOM   899  C  C   . SER A 1 124 ? -5.351  20.629 3.635   1.00 12.92 ? 128 SER A C   1 
ATOM   900  O  O   . SER A 1 124 ? -6.294  20.358 2.890   1.00 12.76 ? 128 SER A O   1 
ATOM   901  C  CB  . SER A 1 124 ? -5.247  19.563 5.891   1.00 13.02 ? 128 SER A CB  1 
ATOM   902  O  OG  . SER A 1 124 ? -6.642  19.315 5.882   1.00 14.36 ? 128 SER A OG  1 
ATOM   903  N  N   . ALA A 1 125 ? -4.859  21.856 3.768   1.00 13.11 ? 129 ALA A N   1 
ATOM   904  C  CA  . ALA A 1 125 ? -5.443  23.022 3.099   1.00 13.21 ? 129 ALA A CA  1 
ATOM   905  C  C   . ALA A 1 125 ? -5.363  22.940 1.579   1.00 13.30 ? 129 ALA A C   1 
ATOM   906  O  O   . ALA A 1 125 ? -6.341  23.239 0.887   1.00 13.25 ? 129 ALA A O   1 
ATOM   907  C  CB  . ALA A 1 125 ? -4.787  24.287 3.596   1.00 13.54 ? 129 ALA A CB  1 
ATOM   908  N  N   . VAL A 1 126 ? -4.217  22.499 1.058   1.00 13.22 ? 130 VAL A N   1 
ATOM   909  C  CA  A VAL A 1 126 ? -4.039  22.414 -0.387  0.50 13.24 ? 130 VAL A CA  1 
ATOM   910  C  CA  B VAL A 1 126 ? -4.019  22.386 -0.389  0.50 13.28 ? 130 VAL A CA  1 
ATOM   911  C  C   . VAL A 1 126 ? -4.973  21.356 -0.997  1.00 13.39 ? 130 VAL A C   1 
ATOM   912  O  O   . VAL A 1 126 ? -5.355  21.466 -2.158  1.00 13.60 ? 130 VAL A O   1 
ATOM   913  C  CB  A VAL A 1 126 ? -2.558  22.155 -0.766  0.50 13.34 ? 130 VAL A CB  1 
ATOM   914  C  CB  B VAL A 1 126 ? -2.552  22.014 -0.732  0.50 13.40 ? 130 VAL A CB  1 
ATOM   915  C  CG1 A VAL A 1 126 ? -2.193  20.693 -0.568  0.50 12.67 ? 130 VAL A CG1 1 
ATOM   916  C  CG1 B VAL A 1 126 ? -2.395  21.684 -2.216  0.50 13.42 ? 130 VAL A CG1 1 
ATOM   917  C  CG2 A VAL A 1 126 ? -2.293  22.593 -2.200  0.50 13.29 ? 130 VAL A CG2 1 
ATOM   918  C  CG2 B VAL A 1 126 ? -1.621  23.144 -0.349  0.50 12.84 ? 130 VAL A CG2 1 
ATOM   919  N  N   . HIS A 1 127 ? -5.364  20.361 -0.197  1.00 13.88 ? 131 HIS A N   1 
ATOM   920  C  CA  . HIS A 1 127 ? -6.306  19.314 -0.622  1.00 14.54 ? 131 HIS A CA  1 
ATOM   921  C  C   . HIS A 1 127 ? -7.782  19.600 -0.285  1.00 15.11 ? 131 HIS A C   1 
ATOM   922  O  O   . HIS A 1 127 ? -8.648  18.753 -0.549  1.00 15.26 ? 131 HIS A O   1 
ATOM   923  C  CB  . HIS A 1 127 ? -5.903  17.967 -0.006  1.00 14.44 ? 131 HIS A CB  1 
ATOM   924  C  CG  . HIS A 1 127 ? -4.595  17.442 -0.508  1.00 14.67 ? 131 HIS A CG  1 
ATOM   925  N  ND1 . HIS A 1 127 ? -4.453  16.870 -1.754  1.00 14.61 ? 131 HIS A ND1 1 
ATOM   926  C  CD2 . HIS A 1 127 ? -3.368  17.407 0.063   1.00 15.09 ? 131 HIS A CD2 1 
ATOM   927  C  CE1 . HIS A 1 127 ? -3.196  16.498 -1.925  1.00 14.88 ? 131 HIS A CE1 1 
ATOM   928  N  NE2 . HIS A 1 127 ? -2.516  16.816 -0.837  1.00 14.29 ? 131 HIS A NE2 1 
ATOM   929  N  N   . SER A 1 128 ? -8.067  20.779 0.268   1.00 15.57 ? 132 SER A N   1 
ATOM   930  C  CA  A SER A 1 128 ? -9.416  21.144 0.719   0.50 15.99 ? 132 SER A CA  1 
ATOM   931  C  CA  B SER A 1 128 ? -9.424  21.112 0.720   0.50 15.98 ? 132 SER A CA  1 
ATOM   932  C  C   . SER A 1 128 ? -10.369 21.442 -0.438  1.00 16.27 ? 132 SER A C   1 
ATOM   933  O  O   . SER A 1 128 ? -9.936  21.796 -1.534  1.00 16.28 ? 132 SER A O   1 
ATOM   934  C  CB  A SER A 1 128 ? -9.346  22.370 1.637   0.50 15.87 ? 132 SER A CB  1 
ATOM   935  C  CB  B SER A 1 128 ? -9.399  22.282 1.710   0.50 15.87 ? 132 SER A CB  1 
ATOM   936  O  OG  A SER A 1 128 ? -10.637 22.823 1.996   0.50 16.11 ? 132 SER A OG  1 
ATOM   937  O  OG  B SER A 1 128 ? -9.254  23.521 1.042   0.50 16.07 ? 132 SER A OG  1 
ATOM   938  N  N   . ARG A 1 129 ? -11.670 21.325 -0.168  1.00 16.92 ? 133 ARG A N   1 
ATOM   939  C  CA  . ARG A 1 129 ? -12.718 21.589 -1.165  1.00 17.50 ? 133 ARG A CA  1 
ATOM   940  C  C   . ARG A 1 129 ? -12.802 23.069 -1.529  1.00 17.39 ? 133 ARG A C   1 
ATOM   941  O  O   . ARG A 1 129 ? -13.250 23.419 -2.622  1.00 18.13 ? 133 ARG A O   1 
ATOM   942  C  CB  . ARG A 1 129 ? -14.080 21.127 -0.640  1.00 18.01 ? 133 ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 129 ? -14.171 19.637 -0.410  1.00 19.91 ? 133 ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 129 ? -15.472 19.253 0.268   1.00 22.18 ? 133 ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 129 ? -15.457 17.848 0.671   1.00 24.80 ? 133 ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 129 ? -15.008 17.383 1.838   1.00 26.12 ? 133 ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 129 ? -14.528 18.202 2.774   1.00 26.79 ? 133 ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 129 ? -15.046 16.074 2.073   1.00 27.18 ? 133 ARG A NH2 1 
ATOM   949  N  N   . ASP A 1 130 ? -12.386 23.925 -0.602  1.00 16.63 ? 134 ASP A N   1 
ATOM   950  C  CA  . ASP A 1 130 ? -12.403 25.370 -0.805  1.00 16.24 ? 134 ASP A CA  1 
ATOM   951  C  C   . ASP A 1 130 ? -11.152 25.886 -1.515  1.00 15.28 ? 134 ASP A C   1 
ATOM   952  O  O   . ASP A 1 130 ? -11.099 27.050 -1.907  1.00 15.15 ? 134 ASP A O   1 
ATOM   953  C  CB  . ASP A 1 130 ? -12.563 26.073 0.545   1.00 16.85 ? 134 ASP A CB  1 
ATOM   954  C  CG  . ASP A 1 130 ? -13.891 25.762 1.194   1.00 18.82 ? 134 ASP A CG  1 
ATOM   955  O  OD1 . ASP A 1 130 ? -14.931 26.189 0.641   1.00 21.33 ? 134 ASP A OD1 1 
ATOM   956  O  OD2 . ASP A 1 130 ? -13.906 25.066 2.232   1.00 22.46 ? 134 ASP A OD2 1 
ATOM   957  N  N   . HIS A 1 131 ? -10.135 25.041 -1.668  1.00 14.41 ? 135 HIS A N   1 
ATOM   958  C  CA  . HIS A 1 131 ? -8.892  25.492 -2.293  1.00 13.78 ? 135 HIS A CA  1 
ATOM   959  C  C   . HIS A 1 131 ? -9.136  25.849 -3.754  1.00 13.31 ? 135 HIS A C   1 
ATOM   960  O  O   . HIS A 1 131 ? -9.663  25.039 -4.515  1.00 13.06 ? 135 HIS A O   1 
ATOM   961  C  CB  . HIS A 1 131 ? -7.797  24.435 -2.205  1.00 13.83 ? 135 HIS A CB  1 
ATOM   962  C  CG  . HIS A 1 131 ? -6.533  24.844 -2.894  1.00 13.44 ? 135 HIS A CG  1 
ATOM   963  N  ND1 . HIS A 1 131 ? -5.676  25.788 -2.372  1.00 13.54 ? 135 HIS A ND1 1 
ATOM   964  C  CD2 . HIS A 1 131 ? -5.996  24.461 -4.076  1.00 13.31 ? 135 HIS A CD2 1 
ATOM   965  C  CE1 . HIS A 1 131 ? -4.661  25.963 -3.200  1.00 14.25 ? 135 HIS A CE1 1 
ATOM   966  N  NE2 . HIS A 1 131 ? -4.831  25.170 -4.240  1.00 14.23 ? 135 HIS A NE2 1 
ATOM   967  N  N   . GLY A 1 132 ? -8.756  27.066 -4.129  1.00 13.16 ? 136 GLY A N   1 
ATOM   968  C  CA  . GLY A 1 132 ? -8.974  27.579 -5.475  1.00 13.15 ? 136 GLY A CA  1 
ATOM   969  C  C   . GLY A 1 132 ? -10.376 28.123 -5.718  1.00 13.42 ? 136 GLY A C   1 
ATOM   970  O  O   . GLY A 1 132 ? -10.737 28.412 -6.861  1.00 13.32 ? 136 GLY A O   1 
ATOM   971  N  N   . LEU A 1 133 ? -11.171 28.243 -4.654  1.00 13.42 ? 137 LEU A N   1 
ATOM   972  C  CA  . LEU A 1 133 ? -12.477 28.892 -4.724  1.00 13.83 ? 137 LEU A CA  1 
ATOM   973  C  C   . LEU A 1 133 ? -12.447 30.094 -3.777  1.00 13.58 ? 137 LEU A C   1 
ATOM   974  O  O   . LEU A 1 133 ? -11.927 31.148 -4.153  1.00 14.27 ? 137 LEU A O   1 
ATOM   975  C  CB  . LEU A 1 133 ? -13.602 27.906 -4.396  1.00 14.16 ? 137 LEU A CB  1 
ATOM   976  C  CG  . LEU A 1 133 ? -13.897 26.846 -5.460  1.00 15.19 ? 137 LEU A CG  1 
ATOM   977  C  CD1 . LEU A 1 133 ? -14.831 25.774 -4.911  1.00 16.95 ? 137 LEU A CD1 1 
ATOM   978  C  CD2 . LEU A 1 133 ? -14.490 27.477 -6.722  1.00 16.81 ? 137 LEU A CD2 1 
ATOM   979  N  N   . GLU A 1 134 ? -12.934 29.948 -2.543  1.00 13.26 ? 138 GLU A N   1 
ATOM   980  C  CA  . GLU A 1 134 ? -12.872 31.063 -1.586  1.00 13.54 ? 138 GLU A CA  1 
ATOM   981  C  C   . GLU A 1 134 ? -11.465 31.306 -0.996  1.00 12.88 ? 138 GLU A C   1 
ATOM   982  O  O   . GLU A 1 134 ? -11.189 32.395 -0.505  1.00 12.39 ? 138 GLU A O   1 
ATOM   983  C  CB  . GLU A 1 134 ? -13.927 30.904 -0.476  1.00 13.90 ? 138 GLU A CB  1 
ATOM   984  C  CG  . GLU A 1 134 ? -15.358 31.031 -0.990  1.00 17.37 ? 138 GLU A CG  1 
ATOM   985  C  CD  . GLU A 1 134 ? -16.415 30.913 0.100   1.00 19.71 ? 138 GLU A CD  1 
ATOM   986  O  OE1 . GLU A 1 134 ? -16.088 31.126 1.284   1.00 23.88 ? 138 GLU A OE1 1 
ATOM   987  O  OE2 . GLU A 1 134 ? -17.581 30.627 -0.235  1.00 23.87 ? 138 GLU A OE2 1 
ATOM   988  N  N   . VAL A 1 135 ? -10.587 30.301 -1.053  1.00 12.38 ? 139 VAL A N   1 
ATOM   989  C  CA  . VAL A 1 135 ? -9.223  30.392 -0.511  1.00 12.57 ? 139 VAL A CA  1 
ATOM   990  C  C   . VAL A 1 135 ? -8.235  30.132 -1.633  1.00 12.57 ? 139 VAL A C   1 
ATOM   991  O  O   . VAL A 1 135 ? -8.339  29.117 -2.320  1.00 12.85 ? 139 VAL A O   1 
ATOM   992  C  CB  . VAL A 1 135 ? -8.990  29.349 0.609   1.00 12.96 ? 139 VAL A CB  1 
ATOM   993  C  CG1 . VAL A 1 135 ? -7.531  29.358 1.099   1.00 14.73 ? 139 VAL A CG1 1 
ATOM   994  C  CG2 . VAL A 1 135 ? -9.964  29.589 1.771   1.00 12.74 ? 139 VAL A CG2 1 
ATOM   995  N  N   . LEU A 1 136 ? -7.292  31.053 -1.812  1.00 12.24 ? 140 LEU A N   1 
ATOM   996  C  CA  . LEU A 1 136 ? -6.344  30.982 -2.917  1.00 12.06 ? 140 LEU A CA  1 
ATOM   997  C  C   . LEU A 1 136 ? -4.936  30.534 -2.518  1.00 12.00 ? 140 LEU A C   1 
ATOM   998  O  O   . LEU A 1 136 ? -4.089  30.362 -3.398  1.00 11.88 ? 140 LEU A O   1 
ATOM   999  C  CB  . LEU A 1 136 ? -6.292  32.323 -3.645  1.00 11.71 ? 140 LEU A CB  1 
ATOM   1000 C  CG  . LEU A 1 136 ? -7.621  32.705 -4.307  1.00 12.23 ? 140 LEU A CG  1 
ATOM   1001 C  CD1 . LEU A 1 136 ? -7.452  34.046 -5.003  1.00 12.35 ? 140 LEU A CD1 1 
ATOM   1002 C  CD2 . LEU A 1 136 ? -8.128  31.631 -5.268  1.00 13.18 ? 140 LEU A CD2 1 
ATOM   1003 N  N   . GLY A 1 137 ? -4.700  30.325 -1.223  1.00 12.06 ? 141 GLY A N   1 
ATOM   1004 C  CA  . GLY A 1 137 ? -3.435  29.783 -0.733  1.00 12.31 ? 141 GLY A CA  1 
ATOM   1005 C  C   . GLY A 1 137 ? -3.068  30.290 0.647   1.00 12.75 ? 141 GLY A C   1 
ATOM   1006 O  O   . GLY A 1 137 ? -3.314  31.455 0.976   1.00 14.34 ? 141 GLY A O   1 
ATOM   1007 N  N   . LEU A 1 138 ? -2.482  29.421 1.465   1.00 12.50 ? 142 LEU A N   1 
ATOM   1008 C  CA  . LEU A 1 138 ? -2.002  29.826 2.776   1.00 12.63 ? 142 LEU A CA  1 
ATOM   1009 C  C   . LEU A 1 138 ? -0.621  30.471 2.659   1.00 12.40 ? 142 LEU A C   1 
ATOM   1010 O  O   . LEU A 1 138 ? 0.154   30.137 1.765   1.00 12.40 ? 142 LEU A O   1 
ATOM   1011 C  CB  . LEU A 1 138 ? -1.919  28.629 3.731   1.00 12.82 ? 142 LEU A CB  1 
ATOM   1012 C  CG  . LEU A 1 138 ? -3.234  27.975 4.143   1.00 13.50 ? 142 LEU A CG  1 
ATOM   1013 C  CD1 . LEU A 1 138 ? -2.978  26.927 5.227   1.00 12.49 ? 142 LEU A CD1 1 
ATOM   1014 C  CD2 . LEU A 1 138 ? -4.224  29.029 4.616   1.00 14.29 ? 142 LEU A CD2 1 
ATOM   1015 N  N   . VAL A 1 139 ? -0.326  31.373 3.590   1.00 12.41 ? 143 VAL A N   1 
ATOM   1016 C  CA  . VAL A 1 139 ? 1.009   31.921 3.754   1.00 13.19 ? 143 VAL A CA  1 
ATOM   1017 C  C   . VAL A 1 139 ? 1.388   31.923 5.223   1.00 13.40 ? 143 VAL A C   1 
ATOM   1018 O  O   . VAL A 1 139 ? 0.525   32.071 6.093   1.00 14.38 ? 143 VAL A O   1 
ATOM   1019 C  CB  . VAL A 1 139 ? 1.119   33.355 3.192   1.00 12.62 ? 143 VAL A CB  1 
ATOM   1020 C  CG1 . VAL A 1 139 ? 0.782   33.381 1.699   1.00 13.73 ? 143 VAL A CG1 1 
ATOM   1021 C  CG2 . VAL A 1 139 ? 0.232   34.353 3.978   1.00 12.94 ? 143 VAL A CG2 1 
ATOM   1022 N  N   . ARG A 1 140 ? 2.679   31.756 5.496   1.00 13.89 ? 144 ARG A N   1 
ATOM   1023 C  CA  . ARG A 1 140 ? 3.204   31.925 6.842   1.00 13.86 ? 144 ARG A CA  1 
ATOM   1024 C  C   . ARG A 1 140 ? 3.602   33.383 7.032   1.00 13.54 ? 144 ARG A C   1 
ATOM   1025 O  O   . ARG A 1 140 ? 4.206   33.987 6.147   1.00 14.42 ? 144 ARG A O   1 
ATOM   1026 C  CB  . ARG A 1 140 ? 4.417   31.016 7.089   1.00 14.12 ? 144 ARG A CB  1 
ATOM   1027 C  CG  . ARG A 1 140 ? 4.073   29.546 7.231   1.00 15.09 ? 144 ARG A CG  1 
ATOM   1028 C  CD  . ARG A 1 140 ? 5.303   28.718 7.573   1.00 15.54 ? 144 ARG A CD  1 
ATOM   1029 N  NE  . ARG A 1 140 ? 4.994   27.294 7.553   1.00 15.08 ? 144 ARG A NE  1 
ATOM   1030 C  CZ  . ARG A 1 140 ? 5.768   26.334 8.050   1.00 15.62 ? 144 ARG A CZ  1 
ATOM   1031 N  NH1 . ARG A 1 140 ? 6.946   26.615 8.611   1.00 14.99 ? 144 ARG A NH1 1 
ATOM   1032 N  NH2 . ARG A 1 140 ? 5.366   25.073 7.966   1.00 15.48 ? 144 ARG A NH2 1 
ATOM   1033 N  N   . VAL A 1 141 ? 3.280   33.942 8.189   1.00 12.55 ? 145 VAL A N   1 
ATOM   1034 C  CA  . VAL A 1 141 ? 3.715   35.297 8.518   1.00 12.30 ? 145 VAL A CA  1 
ATOM   1035 C  C   . VAL A 1 141 ? 5.189   35.254 8.963   1.00 12.35 ? 145 VAL A C   1 
ATOM   1036 O  O   . VAL A 1 141 ? 5.534   34.479 9.869   1.00 12.29 ? 145 VAL A O   1 
ATOM   1037 C  CB  . VAL A 1 141 ? 2.889   35.877 9.662   1.00 11.83 ? 145 VAL A CB  1 
ATOM   1038 C  CG1 . VAL A 1 141 ? 3.421   37.259 10.052  1.00 12.06 ? 145 VAL A CG1 1 
ATOM   1039 C  CG2 . VAL A 1 141 ? 1.403   35.926 9.291   1.00 12.20 ? 145 VAL A CG2 1 
ATOM   1040 N  N   . PRO A 1 142 ? 6.062   36.066 8.329   1.00 12.29 ? 146 PRO A N   1 
ATOM   1041 C  CA  . PRO A 1 142 ? 7.420   36.221 8.859   1.00 12.55 ? 146 PRO A CA  1 
ATOM   1042 C  C   . PRO A 1 142 ? 7.395   37.231 10.009  1.00 12.96 ? 146 PRO A C   1 
ATOM   1043 O  O   . PRO A 1 142 ? 6.996   38.367 9.800   1.00 14.19 ? 146 PRO A O   1 
ATOM   1044 C  CB  . PRO A 1 142 ? 8.207   36.749 7.658   1.00 12.73 ? 146 PRO A CB  1 
ATOM   1045 C  CG  . PRO A 1 142 ? 7.209   37.515 6.851   1.00 12.39 ? 146 PRO A CG  1 
ATOM   1046 C  CD  . PRO A 1 142 ? 5.828   36.965 7.177   1.00 12.55 ? 146 PRO A CD  1 
ATOM   1047 N  N   . LEU A 1 143 ? 7.789   36.823 11.215  1.00 13.12 ? 147 LEU A N   1 
ATOM   1048 C  CA  . LEU A 1 143 ? 7.738   37.724 12.386  1.00 12.97 ? 147 LEU A CA  1 
ATOM   1049 C  C   . LEU A 1 143 ? 9.069   38.433 12.671  1.00 12.99 ? 147 LEU A C   1 
ATOM   1050 O  O   . LEU A 1 143 ? 9.128   39.356 13.488  1.00 13.47 ? 147 LEU A O   1 
ATOM   1051 C  CB  . LEU A 1 143 ? 7.286   36.949 13.629  1.00 13.05 ? 147 LEU A CB  1 
ATOM   1052 C  CG  . LEU A 1 143 ? 5.827   36.502 13.624  1.00 14.90 ? 147 LEU A CG  1 
ATOM   1053 C  CD1 . LEU A 1 143 ? 5.526   35.783 14.938  1.00 14.92 ? 147 LEU A CD1 1 
ATOM   1054 C  CD2 . LEU A 1 143 ? 4.886   37.680 13.422  1.00 17.01 ? 147 LEU A CD2 1 
ATOM   1055 N  N   . TYR A 1 144 ? 10.126  37.986 12.005  1.00 12.54 ? 148 TYR A N   1 
ATOM   1056 C  CA  . TYR A 1 144 ? 11.451  38.601 12.082  1.00 12.06 ? 148 TYR A CA  1 
ATOM   1057 C  C   . TYR A 1 144 ? 11.529  39.844 11.215  1.00 11.83 ? 148 TYR A C   1 
ATOM   1058 O  O   . TYR A 1 144 ? 10.717  40.043 10.308  1.00 11.55 ? 148 TYR A O   1 
ATOM   1059 C  CB  . TYR A 1 144 ? 12.549  37.631 11.609  1.00 12.22 ? 148 TYR A CB  1 
ATOM   1060 C  CG  . TYR A 1 144 ? 12.214  36.952 10.302  1.00 11.85 ? 148 TYR A CG  1 
ATOM   1061 C  CD1 . TYR A 1 144 ? 12.471  37.571 9.082   1.00 10.79 ? 148 TYR A CD1 1 
ATOM   1062 C  CD2 . TYR A 1 144 ? 11.611  35.698 10.289  1.00 12.18 ? 148 TYR A CD2 1 
ATOM   1063 C  CE1 . TYR A 1 144 ? 12.130  36.951 7.884   1.00 11.14 ? 148 TYR A CE1 1 
ATOM   1064 C  CE2 . TYR A 1 144 ? 11.273  35.072 9.100   1.00 11.97 ? 148 TYR A CE2 1 
ATOM   1065 C  CZ  . TYR A 1 144 ? 11.532  35.698 7.901   1.00 11.57 ? 148 TYR A CZ  1 
ATOM   1066 O  OH  . TYR A 1 144 ? 11.187  35.062 6.716   1.00 11.07 ? 148 TYR A OH  1 
ATOM   1067 N  N   . THR A 1 145 ? 12.527  40.675 11.503  1.00 11.44 ? 149 THR A N   1 
ATOM   1068 C  CA  . THR A 1 145 ? 12.856  41.813 10.656  1.00 11.62 ? 149 THR A CA  1 
ATOM   1069 C  C   . THR A 1 145 ? 14.325  41.683 10.271  1.00 11.83 ? 149 THR A C   1 
ATOM   1070 O  O   . THR A 1 145 ? 15.185  41.467 11.131  1.00 12.49 ? 149 THR A O   1 
ATOM   1071 C  CB  . THR A 1 145 ? 12.590  43.166 11.360  1.00 11.61 ? 149 THR A CB  1 
ATOM   1072 O  OG1 . THR A 1 145 ? 11.199  43.282 11.680  1.00 11.07 ? 149 THR A OG1 1 
ATOM   1073 C  CG2 . THR A 1 145 ? 12.982  44.341 10.458  1.00 12.16 ? 149 THR A CG2 1 
ATOM   1074 N  N   . GLN A 1 146 ? 14.604  41.799 8.976   1.00 12.07 ? 150 GLN A N   1 
ATOM   1075 C  CA  . GLN A 1 146 ? 15.968  41.717 8.461   1.00 12.67 ? 150 GLN A CA  1 
ATOM   1076 C  C   . GLN A 1 146 ? 16.767  42.956 8.818   1.00 13.00 ? 150 GLN A C   1 
ATOM   1077 O  O   . GLN A 1 146 ? 16.228  43.926 9.351   1.00 12.87 ? 150 GLN A O   1 
ATOM   1078 C  CB  . GLN A 1 146 ? 15.959  41.541 6.941   1.00 12.92 ? 150 GLN A CB  1 
ATOM   1079 C  CG  . GLN A 1 146 ? 15.347  40.230 6.482   1.00 12.76 ? 150 GLN A CG  1 
ATOM   1080 C  CD  . GLN A 1 146 ? 15.579  40.005 5.008   1.00 14.23 ? 150 GLN A CD  1 
ATOM   1081 O  OE1 . GLN A 1 146 ? 14.669  40.171 4.207   1.00 15.91 ? 150 GLN A OE1 1 
ATOM   1082 N  NE2 . GLN A 1 146 ? 16.819  39.682 4.639   1.00 15.99 ? 150 GLN A NE2 1 
ATOM   1083 N  N   . LYS A 1 147 ? 18.057  42.919 8.495   1.00 13.49 ? 151 LYS A N   1 
ATOM   1084 C  CA  . LYS A 1 147 ? 18.969  44.002 8.832   1.00 14.28 ? 151 LYS A CA  1 
ATOM   1085 C  C   . LYS A 1 147 ? 18.625  45.324 8.151   1.00 14.50 ? 151 LYS A C   1 
ATOM   1086 O  O   . LYS A 1 147 ? 18.923  46.387 8.688   1.00 14.99 ? 151 LYS A O   1 
ATOM   1087 C  CB  . LYS A 1 147 ? 20.410  43.600 8.509   1.00 14.24 ? 151 LYS A CB  1 
ATOM   1088 C  CG  . LYS A 1 147 ? 20.925  42.482 9.396   1.00 15.30 ? 151 LYS A CG  1 
ATOM   1089 N  N   . ASP A 1 148 ? 17.983  45.267 6.988   1.00 14.77 ? 152 ASP A N   1 
ATOM   1090 C  CA  . ASP A 1 148 ? 17.559  46.486 6.295   1.00 15.07 ? 152 ASP A CA  1 
ATOM   1091 C  C   . ASP A 1 148 ? 16.347  47.177 6.939   1.00 15.20 ? 152 ASP A C   1 
ATOM   1092 O  O   . ASP A 1 148 ? 15.896  48.196 6.428   1.00 15.21 ? 152 ASP A O   1 
ATOM   1093 C  CB  . ASP A 1 148 ? 17.296  46.212 4.803   1.00 15.34 ? 152 ASP A CB  1 
ATOM   1094 C  CG  . ASP A 1 148 ? 16.105  45.304 4.557   1.00 15.35 ? 152 ASP A CG  1 
ATOM   1095 O  OD1 . ASP A 1 148 ? 15.386  44.946 5.518   1.00 13.38 ? 152 ASP A OD1 1 
ATOM   1096 O  OD2 . ASP A 1 148 ? 15.881  44.946 3.380   1.00 15.56 ? 152 ASP A OD2 1 
ATOM   1097 N  N   . ARG A 1 149 ? 15.831  46.585 8.026   1.00 15.23 ? 153 ARG A N   1 
ATOM   1098 C  CA  A ARG A 1 149 ? 14.727  47.131 8.831   0.50 15.34 ? 153 ARG A CA  1 
ATOM   1099 C  CA  B ARG A 1 149 ? 14.729  47.147 8.824   0.50 15.25 ? 153 ARG A CA  1 
ATOM   1100 C  C   . ARG A 1 149 ? 13.357  47.117 8.131   1.00 15.00 ? 153 ARG A C   1 
ATOM   1101 O  O   . ARG A 1 149 ? 12.387  47.699 8.637   1.00 14.68 ? 153 ARG A O   1 
ATOM   1102 C  CB  A ARG A 1 149 ? 15.058  48.538 9.360   0.50 15.60 ? 153 ARG A CB  1 
ATOM   1103 C  CB  B ARG A 1 149 ? 15.055  48.573 9.295   0.50 15.44 ? 153 ARG A CB  1 
ATOM   1104 C  CG  A ARG A 1 149 ? 16.204  48.594 10.373  0.50 16.35 ? 153 ARG A CG  1 
ATOM   1105 C  CG  B ARG A 1 149 ? 16.388  48.714 10.022  0.50 15.86 ? 153 ARG A CG  1 
ATOM   1106 C  CD  A ARG A 1 149 ? 16.266  49.973 11.021  0.50 17.55 ? 153 ARG A CD  1 
ATOM   1107 C  CD  B ARG A 1 149 ? 16.551  50.117 10.586  0.50 16.33 ? 153 ARG A CD  1 
ATOM   1108 N  NE  A ARG A 1 149 ? 17.223  50.058 12.118  0.50 18.79 ? 153 ARG A NE  1 
ATOM   1109 N  NE  B ARG A 1 149 ? 17.740  50.252 11.419  0.50 17.10 ? 153 ARG A NE  1 
ATOM   1110 C  CZ  A ARG A 1 149 ? 16.898  49.995 13.406  0.50 19.27 ? 153 ARG A CZ  1 
ATOM   1111 C  CZ  B ARG A 1 149 ? 18.895  50.750 10.995  0.50 16.86 ? 153 ARG A CZ  1 
ATOM   1112 N  NH1 A ARG A 1 149 ? 15.632  49.836 13.772  0.50 19.39 ? 153 ARG A NH1 1 
ATOM   1113 N  NH1 B ARG A 1 149 ? 19.019  51.165 9.742   0.50 17.03 ? 153 ARG A NH1 1 
ATOM   1114 N  NH2 A ARG A 1 149 ? 17.843  50.086 14.329  0.50 19.74 ? 153 ARG A NH2 1 
ATOM   1115 N  NH2 B ARG A 1 149 ? 19.925  50.836 11.823  0.50 17.49 ? 153 ARG A NH2 1 
ATOM   1116 N  N   . VAL A 1 150 ? 13.259  46.438 6.985   1.00 14.67 ? 154 VAL A N   1 
ATOM   1117 C  CA  . VAL A 1 150 ? 11.966  46.273 6.291   1.00 14.59 ? 154 VAL A CA  1 
ATOM   1118 C  C   . VAL A 1 150 ? 11.667  44.820 5.897   1.00 13.82 ? 154 VAL A C   1 
ATOM   1119 O  O   . VAL A 1 150 ? 10.517  44.402 5.936   1.00 13.59 ? 154 VAL A O   1 
ATOM   1120 C  CB  . VAL A 1 150 ? 11.830  47.169 5.023   1.00 14.52 ? 154 VAL A CB  1 
ATOM   1121 C  CG1 . VAL A 1 150 ? 11.798  48.648 5.404   1.00 16.43 ? 154 VAL A CG1 1 
ATOM   1122 C  CG2 . VAL A 1 150 ? 12.943  46.877 4.025   1.00 15.51 ? 154 VAL A CG2 1 
ATOM   1123 N  N   . GLY A 1 151 ? 12.692  44.059 5.515   1.00 13.16 ? 155 GLY A N   1 
ATOM   1124 C  CA  . GLY A 1 151 ? 12.506  42.666 5.125   1.00 12.82 ? 155 GLY A CA  1 
ATOM   1125 C  C   . GLY A 1 151 ? 11.889  41.846 6.242   1.00 12.71 ? 155 GLY A C   1 
ATOM   1126 O  O   . GLY A 1 151 ? 12.325  41.929 7.385   1.00 12.79 ? 155 GLY A O   1 
ATOM   1127 N  N   . GLY A 1 152 ? 10.851  41.083 5.916   1.00 12.12 ? 156 GLY A N   1 
ATOM   1128 C  CA  . GLY A 1 152 ? 10.165  40.237 6.888   1.00 12.01 ? 156 GLY A CA  1 
ATOM   1129 C  C   . GLY A 1 152 ? 8.861   40.891 7.298   1.00 11.58 ? 156 GLY A C   1 
ATOM   1130 O  O   . GLY A 1 152 ? 8.036   41.243 6.442   1.00 11.26 ? 156 GLY A O   1 
ATOM   1131 N  N   . PHE A 1 153 ? 8.700   41.109 8.601   1.00 11.50 ? 157 PHE A N   1 
ATOM   1132 C  CA  . PHE A 1 153 ? 7.419   41.535 9.166   1.00 10.89 ? 157 PHE A CA  1 
ATOM   1133 C  C   . PHE A 1 153 ? 6.912   42.904 8.673   1.00 10.54 ? 157 PHE A C   1 
ATOM   1134 O  O   . PHE A 1 153 ? 5.737   43.027 8.346   1.00 10.48 ? 157 PHE A O   1 
ATOM   1135 C  CB  . PHE A 1 153 ? 7.473   41.467 10.708  1.00 10.91 ? 157 PHE A CB  1 
ATOM   1136 C  CG  . PHE A 1 153 ? 6.126   41.490 11.386  1.00 11.59 ? 157 PHE A CG  1 
ATOM   1137 C  CD1 . PHE A 1 153 ? 5.049   40.753 10.897  1.00 12.31 ? 157 PHE A CD1 1 
ATOM   1138 C  CD2 . PHE A 1 153 ? 5.942   42.235 12.542  1.00 12.21 ? 157 PHE A CD2 1 
ATOM   1139 C  CE1 . PHE A 1 153 ? 3.811   40.787 11.545  1.00 13.62 ? 157 PHE A CE1 1 
ATOM   1140 C  CE2 . PHE A 1 153 ? 4.718   42.258 13.189  1.00 13.04 ? 157 PHE A CE2 1 
ATOM   1141 C  CZ  . PHE A 1 153 ? 3.658   41.540 12.694  1.00 12.90 ? 157 PHE A CZ  1 
ATOM   1142 N  N   . PRO A 1 154 ? 7.777   43.942 8.633   1.00 10.75 ? 158 PRO A N   1 
ATOM   1143 C  CA  . PRO A 1 154 ? 7.303   45.227 8.087   1.00 11.14 ? 158 PRO A CA  1 
ATOM   1144 C  C   . PRO A 1 154 ? 6.799   45.131 6.645   1.00 11.36 ? 158 PRO A C   1 
ATOM   1145 O  O   . PRO A 1 154 ? 5.690   45.590 6.351   1.00 10.96 ? 158 PRO A O   1 
ATOM   1146 C  CB  . PRO A 1 154 ? 8.531   46.137 8.197   1.00 11.22 ? 158 PRO A CB  1 
ATOM   1147 C  CG  . PRO A 1 154 ? 9.353   45.521 9.282   1.00 11.14 ? 158 PRO A CG  1 
ATOM   1148 C  CD  . PRO A 1 154 ? 9.162   44.037 9.111   1.00 10.96 ? 158 PRO A CD  1 
ATOM   1149 N  N   . ASN A 1 155 ? 7.575   44.513 5.754   1.00 11.46 ? 159 ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 155 ? 7.091   44.261 4.397   1.00 11.43 ? 159 ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 155 ? 5.760   43.519 4.409   1.00 11.21 ? 159 ASN A C   1 
ATOM   1152 O  O   . ASN A 1 155 ? 4.833   43.878 3.676   1.00 11.58 ? 159 ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 155 ? 8.090   43.439 3.579   1.00 11.23 ? 159 ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 155 ? 9.210   44.280 2.976   1.00 12.17 ? 159 ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 155 ? 9.136   45.510 2.907   1.00 12.00 ? 159 ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 155 ? 10.262  43.604 2.529   1.00 10.92 ? 159 ASN A ND2 1 
ATOM   1157 N  N   . PHE A 1 156 ? 5.674   42.479 5.236   1.00 10.55 ? 160 PHE A N   1 
ATOM   1158 C  CA  . PHE A 1 156 ? 4.450   41.680 5.321   1.00 11.01 ? 160 PHE A CA  1 
ATOM   1159 C  C   . PHE A 1 156 ? 3.241   42.557 5.671   1.00 10.68 ? 160 PHE A C   1 
ATOM   1160 O  O   . PHE A 1 156 ? 2.186   42.450 5.061   1.00 11.13 ? 160 PHE A O   1 
ATOM   1161 C  CB  . PHE A 1 156 ? 4.589   40.550 6.342   1.00 10.64 ? 160 PHE A CB  1 
ATOM   1162 C  CG  . PHE A 1 156 ? 3.356   39.710 6.449   1.00 11.91 ? 160 PHE A CG  1 
ATOM   1163 C  CD1 . PHE A 1 156 ? 3.109   38.705 5.521   1.00 12.12 ? 160 PHE A CD1 1 
ATOM   1164 C  CD2 . PHE A 1 156 ? 2.412   39.957 7.429   1.00 13.30 ? 160 PHE A CD2 1 
ATOM   1165 C  CE1 . PHE A 1 156 ? 1.945   37.951 5.593   1.00 13.60 ? 160 PHE A CE1 1 
ATOM   1166 C  CE2 . PHE A 1 156 ? 1.249   39.216 7.488   1.00 13.23 ? 160 PHE A CE2 1 
ATOM   1167 C  CZ  . PHE A 1 156 ? 1.033   38.205 6.565   1.00 13.40 ? 160 PHE A CZ  1 
ATOM   1168 N  N   . LEU A 1 157 ? 3.413   43.439 6.655   1.00 11.04 ? 161 LEU A N   1 
ATOM   1169 C  CA  . LEU A 1 157 ? 2.339   44.301 7.102   1.00 10.88 ? 161 LEU A CA  1 
ATOM   1170 C  C   . LEU A 1 157 ? 1.975   45.358 6.055   1.00 10.30 ? 161 LEU A C   1 
ATOM   1171 O  O   . LEU A 1 157 ? 0.924   45.985 6.164   1.00 10.53 ? 161 LEU A O   1 
ATOM   1172 C  CB  . LEU A 1 157 ? 2.703   44.960 8.439   1.00 11.36 ? 161 LEU A CB  1 
ATOM   1173 C  CG  . LEU A 1 157 ? 2.773   44.032 9.666   1.00 11.59 ? 161 LEU A CG  1 
ATOM   1174 C  CD1 . LEU A 1 157 ? 3.370   44.776 10.855  1.00 11.25 ? 161 LEU A CD1 1 
ATOM   1175 C  CD2 . LEU A 1 157 ? 1.388   43.451 10.035  1.00 12.01 ? 161 LEU A CD2 1 
ATOM   1176 N  N   . SER A 1 158 ? 2.826   45.539 5.041   1.00 10.47 ? 162 SER A N   1 
ATOM   1177 C  CA  . SER A 1 158 ? 2.528   46.466 3.947   1.00 11.07 ? 162 SER A CA  1 
ATOM   1178 C  C   . SER A 1 158 ? 1.656   45.859 2.833   1.00 11.38 ? 162 SER A C   1 
ATOM   1179 O  O   . SER A 1 158 ? 1.257   46.565 1.904   1.00 12.20 ? 162 SER A O   1 
ATOM   1180 C  CB  . SER A 1 158 ? 3.826   47.056 3.373   1.00 10.71 ? 162 SER A CB  1 
ATOM   1181 O  OG  . SER A 1 158 ? 4.449   46.169 2.464   1.00 10.68 ? 162 SER A OG  1 
ATOM   1182 N  N   . ASN A 1 159 ? 1.337   44.567 2.938   1.00 11.66 ? 163 ASN A N   1 
ATOM   1183 C  CA  . ASN A 1 159 ? 0.355   43.939 2.052   1.00 11.92 ? 163 ASN A CA  1 
ATOM   1184 C  C   . ASN A 1 159 ? -1.071  44.462 2.338   1.00 11.97 ? 163 ASN A C   1 
ATOM   1185 O  O   . ASN A 1 159 ? -1.276  45.319 3.219   1.00 12.33 ? 163 ASN A O   1 
ATOM   1186 C  CB  . ASN A 1 159 ? 0.429   42.397 2.169   1.00 11.60 ? 163 ASN A CB  1 
ATOM   1187 C  CG  . ASN A 1 159 ? 1.699   41.811 1.543   1.00 13.37 ? 163 ASN A CG  1 
ATOM   1188 O  OD1 . ASN A 1 159 ? 1.909   41.896 0.326   1.00 13.76 ? 163 ASN A OD1 1 
ATOM   1189 N  ND2 . ASN A 1 159 ? 2.554   41.213 2.374   1.00 11.97 ? 163 ASN A ND2 1 
ATOM   1190 N  N   . ALA A 1 160 ? -2.043  43.965 1.583   1.00 12.28 ? 164 ALA A N   1 
ATOM   1191 C  CA  . ALA A 1 160 ? -3.430  44.395 1.695   1.00 12.14 ? 164 ALA A CA  1 
ATOM   1192 C  C   . ALA A 1 160 ? -4.208  43.348 2.464   1.00 12.21 ? 164 ALA A C   1 
ATOM   1193 O  O   . ALA A 1 160 ? -4.180  42.174 2.096   1.00 12.20 ? 164 ALA A O   1 
ATOM   1194 C  CB  . ALA A 1 160 ? -4.041  44.572 0.317   1.00 13.09 ? 164 ALA A CB  1 
ATOM   1195 N  N   . PHE A 1 161 ? -4.909  43.783 3.511   1.00 11.88 ? 165 PHE A N   1 
ATOM   1196 C  CA  . PHE A 1 161 ? -5.627  42.882 4.416   1.00 11.92 ? 165 PHE A CA  1 
ATOM   1197 C  C   . PHE A 1 161 ? -7.113  43.144 4.409   1.00 12.40 ? 165 PHE A C   1 
ATOM   1198 O  O   . PHE A 1 161 ? -7.561  44.277 4.206   1.00 12.97 ? 165 PHE A O   1 
ATOM   1199 C  CB  . PHE A 1 161 ? -5.095  43.017 5.854   1.00 11.53 ? 165 PHE A CB  1 
ATOM   1200 C  CG  . PHE A 1 161 ? -3.643  42.610 6.005   1.00 11.96 ? 165 PHE A CG  1 
ATOM   1201 C  CD1 . PHE A 1 161 ? -3.310  41.365 6.498   1.00 11.97 ? 165 PHE A CD1 1 
ATOM   1202 C  CD2 . PHE A 1 161 ? -2.625  43.473 5.647   1.00 11.44 ? 165 PHE A CD2 1 
ATOM   1203 C  CE1 . PHE A 1 161 ? -1.988  40.970 6.644   1.00 13.34 ? 165 PHE A CE1 1 
ATOM   1204 C  CE2 . PHE A 1 161 ? -1.286  43.091 5.772   1.00 11.62 ? 165 PHE A CE2 1 
ATOM   1205 C  CZ  . PHE A 1 161 ? -0.964  41.839 6.265   1.00 13.80 ? 165 PHE A CZ  1 
ATOM   1206 N  N   . VAL A 1 162 ? -7.882  42.088 4.629   1.00 13.27 ? 166 VAL A N   1 
ATOM   1207 C  CA  . VAL A 1 162 ? -9.322  42.225 4.740   1.00 14.33 ? 166 VAL A CA  1 
ATOM   1208 C  C   . VAL A 1 162 ? -9.631  42.951 6.058   1.00 14.93 ? 166 VAL A C   1 
ATOM   1209 O  O   . VAL A 1 162 ? -8.873  42.856 7.028   1.00 14.69 ? 166 VAL A O   1 
ATOM   1210 C  CB  . VAL A 1 162 ? -10.032 40.871 4.645   1.00 14.71 ? 166 VAL A CB  1 
ATOM   1211 C  CG1 . VAL A 1 162 ? -9.795  40.052 5.886   1.00 15.11 ? 166 VAL A CG1 1 
ATOM   1212 C  CG2 . VAL A 1 162 ? -11.524 41.081 4.403   1.00 15.71 ? 166 VAL A CG2 1 
ATOM   1213 N  N   . SER A 1 163 ? -10.714 43.712 6.060   1.00 15.90 ? 167 SER A N   1 
ATOM   1214 C  CA  A SER A 1 163 ? -11.078 44.520 7.219   0.50 16.35 ? 167 SER A CA  1 
ATOM   1215 C  CA  B SER A 1 163 ? -11.100 44.508 7.222   0.50 16.40 ? 167 SER A CA  1 
ATOM   1216 C  C   . SER A 1 163 ? -10.929 43.722 8.522   1.00 16.25 ? 167 SER A C   1 
ATOM   1217 O  O   . SER A 1 163 ? -11.394 42.587 8.619   1.00 17.59 ? 167 SER A O   1 
ATOM   1218 C  CB  A SER A 1 163 ? -12.499 45.067 7.072   0.50 16.52 ? 167 SER A CB  1 
ATOM   1219 C  CB  B SER A 1 163 ? -12.550 44.945 7.086   0.50 16.63 ? 167 SER A CB  1 
ATOM   1220 O  OG  A SER A 1 163 ? -12.763 46.087 8.020   0.50 17.50 ? 167 SER A OG  1 
ATOM   1221 O  OG  B SER A 1 163 ? -13.388 43.809 6.984   0.50 17.86 ? 167 SER A OG  1 
ATOM   1222 N  N   . THR A 1 164 ? -10.249 44.339 9.487   1.00 15.90 ? 168 THR A N   1 
ATOM   1223 C  CA  A THR A 1 164 ? -10.027 43.816 10.839  0.50 15.49 ? 168 THR A CA  1 
ATOM   1224 C  CA  B THR A 1 164 ? -10.030 43.794 10.840  0.50 15.50 ? 168 THR A CA  1 
ATOM   1225 C  C   . THR A 1 164 ? -8.837  42.854 10.965  1.00 14.59 ? 168 THR A C   1 
ATOM   1226 O  O   . THR A 1 164 ? -8.261  42.761 12.028  1.00 14.05 ? 168 THR A O   1 
ATOM   1227 C  CB  A THR A 1 164 ? -11.304 43.177 11.468  0.50 15.48 ? 168 THR A CB  1 
ATOM   1228 C  CB  B THR A 1 164 ? -11.284 43.093 11.478  0.50 15.49 ? 168 THR A CB  1 
ATOM   1229 O  OG1 A THR A 1 164 ? -12.451 43.982 11.168  0.50 16.89 ? 168 THR A OG1 1 
ATOM   1230 O  OG1 B THR A 1 164 ? -11.570 41.847 10.814  0.50 16.33 ? 168 THR A OG1 1 
ATOM   1231 C  CG2 A THR A 1 164 ? -11.166 43.072 12.968  0.50 15.70 ? 168 THR A CG2 1 
ATOM   1232 C  CG2 B THR A 1 164 ? -12.497 44.007 11.430  0.50 16.39 ? 168 THR A CG2 1 
ATOM   1233 N  N   . ALA A 1 165 ? -8.457  42.151 9.892   1.00 13.56 ? 169 ALA A N   1 
ATOM   1234 C  CA  . ALA A 1 165 ? -7.429  41.101 10.022  1.00 13.41 ? 169 ALA A CA  1 
ATOM   1235 C  C   . ALA A 1 165 ? -6.059  41.598 10.496  1.00 13.45 ? 169 ALA A C   1 
ATOM   1236 O  O   . ALA A 1 165 ? -5.384  40.934 11.292  1.00 12.74 ? 169 ALA A O   1 
ATOM   1237 C  CB  . ALA A 1 165 ? -7.274  40.321 8.722   1.00 13.42 ? 169 ALA A CB  1 
ATOM   1238 N  N   . LYS A 1 166 ? -5.624  42.740 9.976   1.00 13.89 ? 170 LYS A N   1 
ATOM   1239 C  CA  . LYS A 1 166 ? -4.312  43.276 10.337  1.00 13.68 ? 170 LYS A CA  1 
ATOM   1240 C  C   . LYS A 1 166 ? -4.327  43.665 11.816  1.00 13.62 ? 170 LYS A C   1 
ATOM   1241 O  O   . LYS A 1 166 ? -3.392  43.347 12.562  1.00 13.39 ? 170 LYS A O   1 
ATOM   1242 C  CB  . LYS A 1 166 ? -4.001  44.490 9.464   1.00 14.12 ? 170 LYS A CB  1 
ATOM   1243 C  CG  . LYS A 1 166 ? -2.584  44.992 9.505   1.00 15.38 ? 170 LYS A CG  1 
ATOM   1244 C  CD  . LYS A 1 166 ? -2.432  46.064 8.409   1.00 16.08 ? 170 LYS A CD  1 
ATOM   1245 C  CE  . LYS A 1 166 ? -1.187  46.865 8.568   1.00 16.96 ? 170 LYS A CE  1 
ATOM   1246 N  NZ  . LYS A 1 166 ? -1.052  47.885 7.477   1.00 14.40 ? 170 LYS A NZ  1 
ATOM   1247 N  N   . CYS A 1 167 ? -5.394  44.348 12.228  1.00 13.64 ? 171 CYS A N   1 
ATOM   1248 C  CA  . CYS A 1 167 ? -5.558  44.744 13.628  1.00 14.64 ? 171 CYS A CA  1 
ATOM   1249 C  C   . CYS A 1 167 ? -5.644  43.521 14.538  1.00 13.57 ? 171 CYS A C   1 
ATOM   1250 O  O   . CYS A 1 167 ? -5.048  43.516 15.621  1.00 13.21 ? 171 CYS A O   1 
ATOM   1251 C  CB  . CYS A 1 167 ? -6.791  45.622 13.814  1.00 15.28 ? 171 CYS A CB  1 
ATOM   1252 S  SG  . CYS A 1 167 ? -6.565  47.295 13.181  1.00 22.17 ? 171 CYS A SG  1 
ATOM   1253 N  N   . GLN A 1 168 ? -6.394  42.501 14.104  1.00 13.17 ? 172 GLN A N   1 
ATOM   1254 C  CA  . GLN A 1 168 ? -6.500  41.240 14.855  1.00 12.66 ? 172 GLN A CA  1 
ATOM   1255 C  C   . GLN A 1 168 ? -5.135  40.560 15.008  1.00 11.87 ? 172 GLN A C   1 
ATOM   1256 O  O   . GLN A 1 168 ? -4.795  40.073 16.090  1.00 11.89 ? 172 GLN A O   1 
ATOM   1257 C  CB  . GLN A 1 168 ? -7.460  40.266 14.164  1.00 13.22 ? 172 GLN A CB  1 
ATOM   1258 C  CG  . GLN A 1 168 ? -8.927  40.615 14.305  1.00 15.23 ? 172 GLN A CG  1 
ATOM   1259 C  CD  . GLN A 1 168 ? -9.821  39.677 13.494  1.00 15.77 ? 172 GLN A CD  1 
ATOM   1260 O  OE1 . GLN A 1 168 ? -9.447  39.217 12.403  1.00 19.09 ? 172 GLN A OE1 1 
ATOM   1261 N  NE2 . GLN A 1 168 ? -10.999 39.402 14.013  1.00 17.87 ? 172 GLN A NE2 1 
ATOM   1262 N  N   . LEU A 1 169 ? -4.352  40.536 13.932  1.00 11.38 ? 173 LEU A N   1 
ATOM   1263 C  CA  . LEU A 1 169 ? -3.021  39.924 13.977  1.00 11.01 ? 173 LEU A CA  1 
ATOM   1264 C  C   . LEU A 1 169 ? -2.160  40.603 15.041  1.00 11.02 ? 173 LEU A C   1 
ATOM   1265 O  O   . LEU A 1 169 ? -1.568  39.945 15.902  1.00 10.67 ? 173 LEU A O   1 
ATOM   1266 C  CB  . LEU A 1 169 ? -2.339  39.994 12.606  1.00 11.22 ? 173 LEU A CB  1 
ATOM   1267 C  CG  . LEU A 1 169 ? -0.860  39.612 12.539  1.00 11.52 ? 173 LEU A CG  1 
ATOM   1268 C  CD1 . LEU A 1 169 ? -0.627  38.138 12.872  1.00 11.34 ? 173 LEU A CD1 1 
ATOM   1269 C  CD2 . LEU A 1 169 ? -0.306  39.954 11.164  1.00 12.44 ? 173 LEU A CD2 1 
ATOM   1270 N  N   . LEU A 1 170 ? -2.108  41.927 14.985  1.00 11.65 ? 174 LEU A N   1 
ATOM   1271 C  CA  . LEU A 1 170 ? -1.272  42.704 15.906  1.00 11.52 ? 174 LEU A CA  1 
ATOM   1272 C  C   . LEU A 1 170 ? -1.784  42.588 17.339  1.00 10.91 ? 174 LEU A C   1 
ATOM   1273 O  O   . LEU A 1 170 ? -0.997  42.493 18.275  1.00 10.52 ? 174 LEU A O   1 
ATOM   1274 C  CB  . LEU A 1 170 ? -1.198  44.166 15.464  1.00 11.72 ? 174 LEU A CB  1 
ATOM   1275 C  CG  . LEU A 1 170 ? -0.524  44.396 14.107  1.00 12.99 ? 174 LEU A CG  1 
ATOM   1276 C  CD1 . LEU A 1 170 ? -0.812  45.796 13.597  1.00 14.83 ? 174 LEU A CD1 1 
ATOM   1277 C  CD2 . LEU A 1 170 ? 0.991   44.133 14.164  1.00 15.02 ? 174 LEU A CD2 1 
ATOM   1278 N  N   . PHE A 1 171 ? -3.106  42.575 17.509  1.00 10.47 ? 175 PHE A N   1 
ATOM   1279 C  CA  . PHE A 1 171 ? -3.693  42.390 18.825  1.00 10.71 ? 175 PHE A CA  1 
ATOM   1280 C  C   . PHE A 1 171 ? -3.309  41.032 19.408  1.00 10.47 ? 175 PHE A C   1 
ATOM   1281 O  O   . PHE A 1 171 ? -2.910  40.946 20.569  1.00 10.50 ? 175 PHE A O   1 
ATOM   1282 C  CB  . PHE A 1 171 ? -5.223  42.537 18.760  1.00 10.89 ? 175 PHE A CB  1 
ATOM   1283 C  CG  . PHE A 1 171 ? -5.921  42.216 20.056  1.00 11.20 ? 175 PHE A CG  1 
ATOM   1284 C  CD1 . PHE A 1 171 ? -5.989  43.147 21.075  1.00 13.18 ? 175 PHE A CD1 1 
ATOM   1285 C  CD2 . PHE A 1 171 ? -6.524  40.973 20.245  1.00 12.96 ? 175 PHE A CD2 1 
ATOM   1286 C  CE1 . PHE A 1 171 ? -6.644  42.846 22.274  1.00 13.01 ? 175 PHE A CE1 1 
ATOM   1287 C  CE2 . PHE A 1 171 ? -7.174  40.667 21.434  1.00 13.05 ? 175 PHE A CE2 1 
ATOM   1288 C  CZ  . PHE A 1 171 ? -7.236  41.600 22.446  1.00 13.10 ? 175 PHE A CZ  1 
ATOM   1289 N  N   . ALA A 1 172 ? -3.448  39.974 18.606  1.00 10.34 ? 176 ALA A N   1 
ATOM   1290 C  CA  . ALA A 1 172 ? -3.143  38.619 19.054  1.00 10.20 ? 176 ALA A CA  1 
ATOM   1291 C  C   . ALA A 1 172 ? -1.650  38.445 19.404  1.00 10.33 ? 176 ALA A C   1 
ATOM   1292 O  O   . ALA A 1 172 ? -1.315  37.887 20.451  1.00 9.98  ? 176 ALA A O   1 
ATOM   1293 C  CB  . ALA A 1 172 ? -3.562  37.618 18.006  1.00 10.51 ? 176 ALA A CB  1 
ATOM   1294 N  N   . LEU A 1 173 ? -0.762  38.960 18.556  1.00 10.30 ? 177 LEU A N   1 
ATOM   1295 C  CA  . LEU A 1 173 ? 0.678   38.865 18.830  1.00 10.72 ? 177 LEU A CA  1 
ATOM   1296 C  C   . LEU A 1 173 ? 1.026   39.486 20.178  1.00 10.90 ? 177 LEU A C   1 
ATOM   1297 O  O   . LEU A 1 173 ? 1.852   38.946 20.919  1.00 12.10 ? 177 LEU A O   1 
ATOM   1298 C  CB  . LEU A 1 173 ? 1.494   39.520 17.717  1.00 10.51 ? 177 LEU A CB  1 
ATOM   1299 C  CG  . LEU A 1 173 ? 1.432   38.760 16.391  1.00 9.98  ? 177 LEU A CG  1 
ATOM   1300 C  CD1 . LEU A 1 173 ? 1.957   39.615 15.230  1.00 9.94  ? 177 LEU A CD1 1 
ATOM   1301 C  CD2 . LEU A 1 173 ? 2.167   37.432 16.453  1.00 10.87 ? 177 LEU A CD2 1 
ATOM   1302 N  N   . LYS A 1 174 ? 0.377   40.600 20.501  1.00 10.91 ? 178 LYS A N   1 
ATOM   1303 C  CA  . LYS A 1 174 ? 0.594   41.278 21.774  1.00 11.30 ? 178 LYS A CA  1 
ATOM   1304 C  C   . LYS A 1 174 ? 0.061   40.449 22.941  1.00 11.43 ? 178 LYS A C   1 
ATOM   1305 O  O   . LYS A 1 174 ? 0.813   40.104 23.860  1.00 11.26 ? 178 LYS A O   1 
ATOM   1306 C  CB  . LYS A 1 174 ? -0.067  42.658 21.758  1.00 11.46 ? 178 LYS A CB  1 
ATOM   1307 C  CG  . LYS A 1 174 ? 0.174   43.497 23.020  1.00 13.32 ? 178 LYS A CG  1 
ATOM   1308 C  CD  . LYS A 1 174 ? -0.514  44.853 22.932  1.00 15.38 ? 178 LYS A CD  1 
ATOM   1309 C  CE  . LYS A 1 174 ? -2.028  44.721 23.054  1.00 17.13 ? 178 LYS A CE  1 
ATOM   1310 N  NZ  . LYS A 1 174 ? -2.701  46.040 23.186  1.00 19.48 ? 178 LYS A NZ  1 
ATOM   1311 N  N   . VAL A 1 175 ? -1.229  40.113 22.896  1.00 11.43 ? 179 VAL A N   1 
ATOM   1312 C  CA  . VAL A 1 175 ? -1.881  39.465 24.043  1.00 11.55 ? 179 VAL A CA  1 
ATOM   1313 C  C   . VAL A 1 175 ? -1.464  38.014 24.298  1.00 11.56 ? 179 VAL A C   1 
ATOM   1314 O  O   . VAL A 1 175 ? -1.585  37.528 25.427  1.00 11.35 ? 179 VAL A O   1 
ATOM   1315 C  CB  . VAL A 1 175 ? -3.443  39.579 24.005  1.00 11.70 ? 179 VAL A CB  1 
ATOM   1316 C  CG1 . VAL A 1 175 ? -3.870  41.044 23.849  1.00 12.82 ? 179 VAL A CG1 1 
ATOM   1317 C  CG2 . VAL A 1 175 ? -4.044  38.705 22.919  1.00 11.81 ? 179 VAL A CG2 1 
ATOM   1318 N  N   . LEU A 1 176 ? -0.967  37.329 23.272  1.00 11.73 ? 180 LEU A N   1 
ATOM   1319 C  CA  . LEU A 1 176 ? -0.417  35.980 23.428  1.00 12.58 ? 180 LEU A CA  1 
ATOM   1320 C  C   . LEU A 1 176 ? 1.079   36.017 23.786  1.00 12.93 ? 180 LEU A C   1 
ATOM   1321 O  O   . LEU A 1 176 ? 1.723   34.969 23.883  1.00 13.05 ? 180 LEU A O   1 
ATOM   1322 C  CB  . LEU A 1 176 ? -0.644  35.161 22.157  1.00 12.63 ? 180 LEU A CB  1 
ATOM   1323 C  CG  . LEU A 1 176 ? -2.114  34.878 21.833  1.00 13.73 ? 180 LEU A CG  1 
ATOM   1324 C  CD1 . LEU A 1 176 ? -2.247  34.322 20.410  1.00 15.20 ? 180 LEU A CD1 1 
ATOM   1325 C  CD2 . LEU A 1 176 ? -2.721  33.941 22.888  1.00 15.02 ? 180 LEU A CD2 1 
ATOM   1326 N  N   . ASN A 1 177 ? 1.610   37.221 23.999  1.00 13.54 ? 181 ASN A N   1 
ATOM   1327 C  CA  . ASN A 1 177 ? 3.025   37.431 24.361  1.00 14.15 ? 181 ASN A CA  1 
ATOM   1328 C  C   . ASN A 1 177 ? 4.006   36.839 23.345  1.00 14.26 ? 181 ASN A C   1 
ATOM   1329 O  O   . ASN A 1 177 ? 5.065   36.311 23.711  1.00 14.12 ? 181 ASN A O   1 
ATOM   1330 C  CB  . ASN A 1 177 ? 3.309   36.902 25.770  1.00 14.55 ? 181 ASN A CB  1 
ATOM   1331 C  CG  . ASN A 1 177 ? 2.476   37.594 26.835  1.00 16.06 ? 181 ASN A CG  1 
ATOM   1332 O  OD1 . ASN A 1 177 ? 2.345   38.820 26.848  1.00 19.26 ? 181 ASN A OD1 1 
ATOM   1333 N  ND2 . ASN A 1 177 ? 1.915   36.810 27.743  1.00 19.18 ? 181 ASN A ND2 1 
ATOM   1334 N  N   . MET A 1 178 ? 3.661   36.958 22.065  1.00 14.01 ? 182 MET A N   1 
ATOM   1335 C  CA  . MET A 1 178 ? 4.502   36.434 20.985  1.00 14.29 ? 182 MET A CA  1 
ATOM   1336 C  C   . MET A 1 178 ? 5.511   37.472 20.509  1.00 14.58 ? 182 MET A C   1 
ATOM   1337 O  O   . MET A 1 178 ? 6.578   37.114 20.007  1.00 15.09 ? 182 MET A O   1 
ATOM   1338 C  CB  . MET A 1 178 ? 3.641   35.969 19.816  1.00 14.19 ? 182 MET A CB  1 
ATOM   1339 C  CG  . MET A 1 178 ? 2.782   34.780 20.187  1.00 14.61 ? 182 MET A CG  1 
ATOM   1340 S  SD  . MET A 1 178 ? 1.495   34.422 18.994  1.00 12.54 ? 182 MET A SD  1 
ATOM   1341 C  CE  . MET A 1 178 ? 2.467   33.873 17.604  1.00 12.51 ? 182 MET A CE  1 
ATOM   1342 N  N   . MET A 1 179 ? 5.156   38.748 20.649  1.00 14.93 ? 183 MET A N   1 
ATOM   1343 C  CA  . MET A 1 179 ? 6.062   39.849 20.334  1.00 15.61 ? 183 MET A CA  1 
ATOM   1344 C  C   . MET A 1 179 ? 5.825   41.010 21.297  1.00 15.08 ? 183 MET A C   1 
ATOM   1345 O  O   . MET A 1 179 ? 4.673   41.328 21.604  1.00 14.63 ? 183 MET A O   1 
ATOM   1346 C  CB  . MET A 1 179 ? 5.855   40.322 18.901  1.00 16.48 ? 183 MET A CB  1 
ATOM   1347 C  CG  . MET A 1 179 ? 6.586   39.477 17.841  1.00 19.74 ? 183 MET A CG  1 
ATOM   1348 S  SD  . MET A 1 179 ? 6.355   40.123 16.187  1.00 27.58 ? 183 MET A SD  1 
ATOM   1349 C  CE  . MET A 1 179 ? 7.030   41.782 16.353  1.00 19.58 ? 183 MET A CE  1 
ATOM   1350 N  N   . PRO A 1 180 ? 6.909   41.661 21.763  1.00 14.48 ? 184 PRO A N   1 
ATOM   1351 C  CA  . PRO A 1 180 ? 6.734   42.855 22.594  1.00 14.22 ? 184 PRO A CA  1 
ATOM   1352 C  C   . PRO A 1 180 ? 5.959   43.953 21.869  1.00 13.96 ? 184 PRO A C   1 
ATOM   1353 O  O   . PRO A 1 180 ? 6.125   44.129 20.659  1.00 13.97 ? 184 PRO A O   1 
ATOM   1354 C  CB  . PRO A 1 180 ? 8.175   43.326 22.864  1.00 14.27 ? 184 PRO A CB  1 
ATOM   1355 C  CG  . PRO A 1 180 ? 9.050   42.184 22.512  1.00 14.53 ? 184 PRO A CG  1 
ATOM   1356 C  CD  . PRO A 1 180 ? 8.328   41.396 21.466  1.00 14.46 ? 184 PRO A CD  1 
ATOM   1357 N  N   . GLU A 1 181 ? 5.135   44.693 22.608  1.00 14.13 ? 185 GLU A N   1 
ATOM   1358 C  CA  . GLU A 1 181 ? 4.329   45.774 22.028  1.00 14.38 ? 185 GLU A CA  1 
ATOM   1359 C  C   . GLU A 1 181 ? 5.183   46.791 21.270  1.00 13.74 ? 185 GLU A C   1 
ATOM   1360 O  O   . GLU A 1 181 ? 4.806   47.233 20.185  1.00 12.95 ? 185 GLU A O   1 
ATOM   1361 C  CB  . GLU A 1 181 ? 3.506   46.494 23.105  1.00 14.52 ? 185 GLU A CB  1 
ATOM   1362 C  CG  . GLU A 1 181 ? 2.609   47.585 22.524  1.00 17.03 ? 185 GLU A CG  1 
ATOM   1363 C  CD  . GLU A 1 181 ? 1.583   48.143 23.500  1.00 20.16 ? 185 GLU A CD  1 
ATOM   1364 O  OE1 . GLU A 1 181 ? 1.477   47.651 24.649  1.00 22.36 ? 185 GLU A OE1 1 
ATOM   1365 O  OE2 . GLU A 1 181 ? 0.874   49.091 23.100  1.00 22.90 ? 185 GLU A OE2 1 
ATOM   1366 N  N   . GLU A 1 182 ? 6.325   47.147 21.853  1.00 13.44 ? 186 GLU A N   1 
ATOM   1367 C  CA  . GLU A 1 182 ? 7.278   48.062 21.231  1.00 13.90 ? 186 GLU A CA  1 
ATOM   1368 C  C   . GLU A 1 182 ? 7.700   47.599 19.838  1.00 13.06 ? 186 GLU A C   1 
ATOM   1369 O  O   . GLU A 1 182 ? 7.851   48.419 18.929  1.00 12.67 ? 186 GLU A O   1 
ATOM   1370 C  CB  . GLU A 1 182 ? 8.528   48.216 22.122  1.00 14.12 ? 186 GLU A CB  1 
ATOM   1371 C  CG  . GLU A 1 182 ? 9.481   49.334 21.696  1.00 17.23 ? 186 GLU A CG  1 
ATOM   1372 C  CD  . GLU A 1 182 ? 10.700  49.469 22.602  1.00 20.16 ? 186 GLU A CD  1 
ATOM   1373 O  OE1 . GLU A 1 182 ? 11.379  48.449 22.859  1.00 23.12 ? 186 GLU A OE1 1 
ATOM   1374 O  OE2 . GLU A 1 182 ? 10.995  50.603 23.047  1.00 21.84 ? 186 GLU A OE2 1 
ATOM   1375 N  N   . LYS A 1 183 ? 7.912   46.296 19.676  1.00 12.61 ? 187 LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 183 ? 8.335   45.754 18.385  1.00 12.36 ? 187 LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 183 ? 7.176   45.747 17.377  1.00 11.43 ? 187 LYS A C   1 
ATOM   1378 O  O   . LYS A 1 183 ? 7.393   45.944 16.178  1.00 11.18 ? 187 LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 183 ? 8.939   44.354 18.541  1.00 12.99 ? 187 LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 183 ? 10.223  44.297 19.378  1.00 14.35 ? 187 LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 183 ? 11.417  44.981 18.703  1.00 17.08 ? 187 LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 183 ? 12.710  44.719 19.479  1.00 18.94 ? 187 LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 183 ? 13.908  45.398 18.899  1.00 21.17 ? 187 LYS A NZ  1 
ATOM   1384 N  N   . LEU A 1 184 ? 5.948   45.542 17.862  1.00 11.04 ? 188 LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 184 ? 4.761   45.602 17.000  1.00 10.86 ? 188 LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 184 ? 4.524   47.021 16.484  1.00 10.49 ? 188 LEU A C   1 
ATOM   1387 O  O   . LEU A 1 184 ? 4.221   47.219 15.304  1.00 10.02 ? 188 LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 184 ? 3.525   45.093 17.743  1.00 11.16 ? 188 LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 184 ? 3.550   43.609 18.096  1.00 11.33 ? 188 LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 184 ? 2.403   43.275 19.044  1.00 11.81 ? 188 LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 184 ? 3.507   42.734 16.857  1.00 11.17 ? 188 LEU A CD2 1 
ATOM   1392 N  N   . VAL A 1 185 ? 4.672   48.007 17.371  1.00 10.21 ? 189 VAL A N   1 
ATOM   1393 C  CA  . VAL A 1 185 ? 4.538   49.409 16.996  1.00 10.07 ? 189 VAL A CA  1 
ATOM   1394 C  C   . VAL A 1 185 ? 5.572   49.787 15.943  1.00 9.75  ? 189 VAL A C   1 
ATOM   1395 O  O   . VAL A 1 185 ? 5.231   50.422 14.940  1.00 9.34  ? 189 VAL A O   1 
ATOM   1396 C  CB  . VAL A 1 185 ? 4.676   50.341 18.226  1.00 10.11 ? 189 VAL A CB  1 
ATOM   1397 C  CG1 . VAL A 1 185 ? 4.820   51.800 17.800  1.00 11.03 ? 189 VAL A CG1 1 
ATOM   1398 C  CG2 . VAL A 1 185 ? 3.470   50.174 19.146  1.00 11.18 ? 189 VAL A CG2 1 
ATOM   1399 N  N   . GLU A 1 186 ? 6.828   49.393 16.177  1.00 9.78  ? 190 GLU A N   1 
ATOM   1400 C  CA  . GLU A 1 186 ? 7.914   49.621 15.213  1.00 10.01 ? 190 GLU A CA  1 
ATOM   1401 C  C   . GLU A 1 186 ? 7.628   49.003 13.845  1.00 9.64  ? 190 GLU A C   1 
ATOM   1402 O  O   . GLU A 1 186 ? 7.816   49.650 12.813  1.00 9.33  ? 190 GLU A O   1 
ATOM   1403 C  CB  . GLU A 1 186 ? 9.242   49.075 15.756  1.00 10.24 ? 190 GLU A CB  1 
ATOM   1404 C  CG  . GLU A 1 186 ? 10.448  49.323 14.838  1.00 10.90 ? 190 GLU A CG  1 
ATOM   1405 C  CD  . GLU A 1 186 ? 11.751  48.776 15.393  1.00 13.55 ? 190 GLU A CD  1 
ATOM   1406 O  OE1 . GLU A 1 186 ? 11.734  47.704 16.036  1.00 13.52 ? 190 GLU A OE1 1 
ATOM   1407 O  OE2 . GLU A 1 186 ? 12.803  49.420 15.182  1.00 14.05 ? 190 GLU A OE2 1 
ATOM   1408 N  N   . ALA A 1 187 ? 7.180   47.751 13.840  1.00 9.51  ? 191 ALA A N   1 
ATOM   1409 C  CA  . ALA A 1 187 ? 6.931   47.031 12.594  1.00 9.83  ? 191 ALA A CA  1 
ATOM   1410 C  C   . ALA A 1 187 ? 5.824   47.706 11.776  1.00 9.63  ? 191 ALA A C   1 
ATOM   1411 O  O   . ALA A 1 187 ? 5.959   47.899 10.562  1.00 9.01  ? 191 ALA A O   1 
ATOM   1412 C  CB  . ALA A 1 187 ? 6.578   45.587 12.887  1.00 10.26 ? 191 ALA A CB  1 
ATOM   1413 N  N   . LEU A 1 188 ? 4.749   48.102 12.455  1.00 9.51  ? 192 LEU A N   1 
ATOM   1414 C  CA  . LEU A 1 188 ? 3.654   48.815 11.790  1.00 9.73  ? 192 LEU A CA  1 
ATOM   1415 C  C   . LEU A 1 188 ? 4.084   50.196 11.260  1.00 9.06  ? 192 LEU A C   1 
ATOM   1416 O  O   . LEU A 1 188 ? 3.716   50.569 10.143  1.00 8.84  ? 192 LEU A O   1 
ATOM   1417 C  CB  . LEU A 1 188 ? 2.445   48.937 12.715  1.00 10.00 ? 192 LEU A CB  1 
ATOM   1418 C  CG  . LEU A 1 188 ? 1.222   49.638 12.120  1.00 11.46 ? 192 LEU A CG  1 
ATOM   1419 C  CD1 . LEU A 1 188 ? 0.724   48.918 10.862  1.00 11.63 ? 192 LEU A CD1 1 
ATOM   1420 C  CD2 . LEU A 1 188 ? 0.117   49.772 13.171  1.00 11.97 ? 192 LEU A CD2 1 
ATOM   1421 N  N   . ALA A 1 189 ? 4.866   50.941 12.041  1.00 8.72  ? 193 ALA A N   1 
ATOM   1422 C  CA  . ALA A 1 189 ? 5.398   52.230 11.585  1.00 7.97  ? 193 ALA A CA  1 
ATOM   1423 C  C   . ALA A 1 189 ? 6.271   52.066 10.341  1.00 8.00  ? 193 ALA A C   1 
ATOM   1424 O  O   . ALA A 1 189 ? 6.164   52.855 9.396   1.00 6.83  ? 193 ALA A O   1 
ATOM   1425 C  CB  . ALA A 1 189 ? 6.178   52.941 12.705  1.00 7.68  ? 193 ALA A CB  1 
ATOM   1426 N  N   . ALA A 1 190 ? 7.130   51.047 10.346  1.00 7.63  ? 194 ALA A N   1 
ATOM   1427 C  CA  . ALA A 1 190 ? 7.980   50.752 9.190   1.00 8.16  ? 194 ALA A CA  1 
ATOM   1428 C  C   . ALA A 1 190 ? 7.171   50.397 7.944   1.00 8.22  ? 194 ALA A C   1 
ATOM   1429 O  O   . ALA A 1 190 ? 7.459   50.913 6.849   1.00 8.07  ? 194 ALA A O   1 
ATOM   1430 C  CB  . ALA A 1 190 ? 8.974   49.637 9.527   1.00 8.38  ? 194 ALA A CB  1 
ATOM   1431 N  N   . ALA A 1 191 ? 6.154   49.552 8.129   1.00 7.90  ? 195 ALA A N   1 
ATOM   1432 C  CA  . ALA A 1 191 ? 5.213   49.176 7.058   1.00 7.92  ? 195 ALA A CA  1 
ATOM   1433 C  C   . ALA A 1 191 ? 4.546   50.407 6.445   1.00 7.82  ? 195 ALA A C   1 
ATOM   1434 O  O   . ALA A 1 191 ? 4.516   50.570 5.212   1.00 7.42  ? 195 ALA A O   1 
ATOM   1435 C  CB  . ALA A 1 191 ? 4.148   48.166 7.593   1.00 7.48  ? 195 ALA A CB  1 
ATOM   1436 N  N   . THR A 1 192 ? 4.048   51.298 7.303   1.00 7.46  ? 196 THR A N   1 
ATOM   1437 C  CA  . THR A 1 192 ? 3.278   52.439 6.846   1.00 7.61  ? 196 THR A CA  1 
ATOM   1438 C  C   . THR A 1 192 ? 4.176   53.436 6.132   1.00 7.66  ? 196 THR A C   1 
ATOM   1439 O  O   . THR A 1 192 ? 3.799   53.974 5.088   1.00 7.91  ? 196 THR A O   1 
ATOM   1440 C  CB  . THR A 1 192 ? 2.516   53.105 8.010   1.00 7.98  ? 196 THR A CB  1 
ATOM   1441 O  OG1 . THR A 1 192 ? 1.759   52.103 8.699   1.00 8.26  ? 196 THR A OG1 1 
ATOM   1442 C  CG2 . THR A 1 192 ? 1.577   54.203 7.497   1.00 7.29  ? 196 THR A CG2 1 
ATOM   1443 N  N   . GLU A 1 193 ? 5.373   53.669 6.674   1.00 7.66  ? 197 GLU A N   1 
ATOM   1444 C  CA  . GLU A 1 193 ? 6.343   54.525 6.004   1.00 7.86  ? 197 GLU A CA  1 
ATOM   1445 C  C   . GLU A 1 193 ? 6.701   53.963 4.620   1.00 7.50  ? 197 GLU A C   1 
ATOM   1446 O  O   . GLU A 1 193 ? 6.779   54.704 3.651   1.00 7.67  ? 197 GLU A O   1 
ATOM   1447 C  CB  . GLU A 1 193 ? 7.600   54.739 6.863   1.00 8.27  ? 197 GLU A CB  1 
ATOM   1448 C  CG  . GLU A 1 193 ? 8.554   55.744 6.257   1.00 10.02 ? 197 GLU A CG  1 
ATOM   1449 C  CD  . GLU A 1 193 ? 9.745   56.100 7.154   1.00 12.50 ? 197 GLU A CD  1 
ATOM   1450 O  OE1 . GLU A 1 193 ? 10.436  55.182 7.632   1.00 16.76 ? 197 GLU A OE1 1 
ATOM   1451 O  OE2 . GLU A 1 193 ? 9.997   57.296 7.357   1.00 15.13 ? 197 GLU A OE2 1 
ATOM   1452 N  N   . LYS A 1 194 ? 6.875   52.650 4.532   1.00 7.90  ? 198 LYS A N   1 
ATOM   1453 C  CA  . LYS A 1 194 ? 7.160   51.995 3.253   1.00 8.29  ? 198 LYS A CA  1 
ATOM   1454 C  C   . LYS A 1 194 ? 6.030   52.226 2.246   1.00 7.59  ? 198 LYS A C   1 
ATOM   1455 O  O   . LYS A 1 194 ? 6.278   52.578 1.091   1.00 7.42  ? 198 LYS A O   1 
ATOM   1456 C  CB  . LYS A 1 194 ? 7.380   50.490 3.455   1.00 8.33  ? 198 LYS A CB  1 
ATOM   1457 C  CG  . LYS A 1 194 ? 7.608   49.722 2.147   1.00 11.43 ? 198 LYS A CG  1 
ATOM   1458 C  CD  . LYS A 1 194 ? 7.319   48.242 2.260   1.00 14.81 ? 198 LYS A CD  1 
ATOM   1459 C  CE  . LYS A 1 194 ? 7.171   47.582 0.853   1.00 15.77 ? 198 LYS A CE  1 
ATOM   1460 N  NZ  . LYS A 1 194 ? 5.757   47.583 0.310   1.00 16.07 ? 198 LYS A NZ  1 
ATOM   1461 N  N   . GLN A 1 195 ? 4.791   52.024 2.681   1.00 7.76  ? 199 GLN A N   1 
ATOM   1462 C  CA  . GLN A 1 195 ? 3.635   52.273 1.809   1.00 8.03  ? 199 GLN A CA  1 
ATOM   1463 C  C   . GLN A 1 195 ? 3.585   53.724 1.315   1.00 8.21  ? 199 GLN A C   1 
ATOM   1464 O  O   . GLN A 1 195 ? 3.336   53.982 0.127   1.00 8.54  ? 199 GLN A O   1 
ATOM   1465 C  CB  . GLN A 1 195 ? 2.333   51.925 2.533   1.00 7.72  ? 199 GLN A CB  1 
ATOM   1466 C  CG  . GLN A 1 195 ? 2.159   50.449 2.850   1.00 8.26  ? 199 GLN A CG  1 
ATOM   1467 C  CD  . GLN A 1 195 ? 0.917   50.173 3.659   1.00 9.15  ? 199 GLN A CD  1 
ATOM   1468 O  OE1 . GLN A 1 195 ? 0.553   50.944 4.561   1.00 7.95  ? 199 GLN A OE1 1 
ATOM   1469 N  NE2 . GLN A 1 195 ? 0.255   49.066 3.352   1.00 9.00  ? 199 GLN A NE2 1 
ATOM   1470 N  N   . LYS A 1 196 ? 3.846   54.673 2.217   1.00 8.80  ? 200 LYS A N   1 
ATOM   1471 C  CA  . LYS A 1 196 ? 3.862   56.087 1.868   1.00 9.34  ? 200 LYS A CA  1 
ATOM   1472 C  C   . LYS A 1 196 ? 4.923   56.403 0.814   1.00 9.67  ? 200 LYS A C   1 
ATOM   1473 O  O   . LYS A 1 196 ? 4.637   57.071 -0.187  1.00 8.86  ? 200 LYS A O   1 
ATOM   1474 C  CB  . LYS A 1 196 ? 4.106   56.950 3.108   1.00 9.73  ? 200 LYS A CB  1 
ATOM   1475 C  CG  . LYS A 1 196 ? 4.260   58.426 2.788   1.00 11.37 ? 200 LYS A CG  1 
ATOM   1476 C  CD  . LYS A 1 196 ? 4.202   59.285 4.024   1.00 14.77 ? 200 LYS A CD  1 
ATOM   1477 C  CE  . LYS A 1 196 ? 4.076   60.753 3.641   1.00 15.10 ? 200 LYS A CE  1 
ATOM   1478 N  NZ  . LYS A 1 196 ? 5.386   61.393 3.297   1.00 16.95 ? 200 LYS A NZ  1 
ATOM   1479 N  N   . LYS A 1 197 ? 6.145   55.924 1.043   1.00 9.77  ? 201 LYS A N   1 
ATOM   1480 C  CA  . LYS A 1 197 ? 7.248   56.177 0.115   1.00 10.84 ? 201 LYS A CA  1 
ATOM   1481 C  C   . LYS A 1 197 ? 6.978   55.579 -1.271  1.00 11.20 ? 201 LYS A C   1 
ATOM   1482 O  O   . LYS A 1 197 ? 7.286   56.206 -2.287  1.00 11.01 ? 201 LYS A O   1 
ATOM   1483 C  CB  . LYS A 1 197 ? 8.566   55.644 0.687   1.00 10.97 ? 201 LYS A CB  1 
ATOM   1484 C  CG  . LYS A 1 197 ? 9.080   56.467 1.872   1.00 13.04 ? 201 LYS A CG  1 
ATOM   1485 C  CD  . LYS A 1 197 ? 10.345  55.854 2.464   1.00 16.00 ? 201 LYS A CD  1 
ATOM   1486 C  CE  . LYS A 1 197 ? 10.888  56.675 3.640   1.00 17.37 ? 201 LYS A CE  1 
ATOM   1487 N  NZ  . LYS A 1 197 ? 11.642  57.873 3.222   1.00 19.03 ? 201 LYS A NZ  1 
ATOM   1488 N  N   . ALA A 1 198 ? 6.391   54.386 -1.295  1.00 11.68 ? 202 ALA A N   1 
ATOM   1489 C  CA  . ALA A 1 198 ? 6.093   53.688 -2.557  1.00 12.65 ? 202 ALA A CA  1 
ATOM   1490 C  C   . ALA A 1 198 ? 5.022   54.441 -3.350  1.00 13.49 ? 202 ALA A C   1 
ATOM   1491 O  O   . ALA A 1 198 ? 5.139   54.618 -4.565  1.00 12.94 ? 202 ALA A O   1 
ATOM   1492 C  CB  . ALA A 1 198 ? 5.658   52.262 -2.294  1.00 12.84 ? 202 ALA A CB  1 
ATOM   1493 N  N   . LEU A 1 199 ? 4.001   54.916 -2.643  1.00 14.63 ? 203 LEU A N   1 
ATOM   1494 C  CA  . LEU A 1 199 ? 2.908   55.665 -3.266  1.00 15.83 ? 203 LEU A CA  1 
ATOM   1495 C  C   . LEU A 1 199 ? 3.404   57.033 -3.774  1.00 16.57 ? 203 LEU A C   1 
ATOM   1496 O  O   . LEU A 1 199 ? 2.951   57.527 -4.812  1.00 16.54 ? 203 LEU A O   1 
ATOM   1497 C  CB  . LEU A 1 199 ? 1.753   55.806 -2.262  1.00 16.31 ? 203 LEU A CB  1 
ATOM   1498 C  CG  . LEU A 1 199 ? 0.305   55.959 -2.743  1.00 17.79 ? 203 LEU A CG  1 
ATOM   1499 C  CD1 . LEU A 1 199 ? 0.054   57.367 -3.193  1.00 19.37 ? 203 LEU A CD1 1 
ATOM   1500 C  CD2 . LEU A 1 199 ? -0.044  54.949 -3.843  1.00 17.95 ? 203 LEU A CD2 1 
ATOM   1501 N  N   . GLU A 1 200 ? 4.354   57.633 -3.059  1.00 17.30 ? 204 GLU A N   1 
ATOM   1502 C  CA  . GLU A 1 200 ? 4.959   58.896 -3.495  1.00 18.30 ? 204 GLU A CA  1 
ATOM   1503 C  C   . GLU A 1 200 ? 5.757   58.768 -4.801  1.00 18.69 ? 204 GLU A C   1 
ATOM   1504 O  O   . GLU A 1 200 ? 5.815   59.723 -5.578  1.00 18.89 ? 204 GLU A O   1 
ATOM   1505 C  CB  . GLU A 1 200 ? 5.818   59.505 -2.378  1.00 18.54 ? 204 GLU A CB  1 
ATOM   1506 C  CG  . GLU A 1 200 ? 4.965   60.174 -1.299  1.00 20.31 ? 204 GLU A CG  1 
ATOM   1507 C  CD  . GLU A 1 200 ? 5.748   60.642 -0.079  1.00 22.75 ? 204 GLU A CD  1 
ATOM   1508 O  OE1 . GLU A 1 200 ? 6.826   60.075 0.223   1.00 23.98 ? 204 GLU A OE1 1 
ATOM   1509 O  OE2 . GLU A 1 200 ? 5.262   61.579 0.592   1.00 24.06 ? 204 GLU A OE2 1 
ATOM   1510 N  N   . LYS A 1 201 ? 6.362   57.604 -5.038  1.00 19.23 ? 205 LYS A N   1 
ATOM   1511 C  CA  . LYS A 1 201 ? 7.018   57.310 -6.320  1.00 19.91 ? 205 LYS A CA  1 
ATOM   1512 C  C   . LYS A 1 201 ? 6.012   57.258 -7.472  1.00 20.07 ? 205 LYS A C   1 
ATOM   1513 O  O   . LYS A 1 201 ? 6.302   57.713 -8.578  1.00 20.07 ? 205 LYS A O   1 
ATOM   1514 C  CB  . LYS A 1 201 ? 7.759   55.968 -6.272  1.00 20.05 ? 205 LYS A CB  1 
ATOM   1515 C  CG  . LYS A 1 201 ? 9.143   56.014 -5.659  1.00 21.59 ? 205 LYS A CG  1 
ATOM   1516 C  CD  . LYS A 1 201 ? 9.841   54.655 -5.783  1.00 23.74 ? 205 LYS A CD  1 
ATOM   1517 C  CE  . LYS A 1 201 ? 11.358  54.803 -5.823  1.00 25.27 ? 205 LYS A CE  1 
ATOM   1518 N  NZ  . LYS A 1 201 ? 11.907  55.416 -4.578  1.00 26.39 ? 205 LYS A NZ  1 
ATOM   1519 N  N   . LEU A 1 202 ? 4.842   56.682 -7.211  1.00 20.12 ? 206 LEU A N   1 
ATOM   1520 C  CA  . LEU A 1 202 ? 3.785   56.576 -8.222  1.00 20.51 ? 206 LEU A CA  1 
ATOM   1521 C  C   . LEU A 1 202 ? 3.045   57.895 -8.445  1.00 20.72 ? 206 LEU A C   1 
ATOM   1522 O  O   . LEU A 1 202 ? 2.560   58.146 -9.547  1.00 21.09 ? 206 LEU A O   1 
ATOM   1523 C  CB  . LEU A 1 202 ? 2.774   55.484 -7.837  1.00 20.36 ? 206 LEU A CB  1 
ATOM   1524 C  CG  . LEU A 1 202 ? 3.266   54.034 -7.771  1.00 20.23 ? 206 LEU A CG  1 
ATOM   1525 C  CD1 . LEU A 1 202 ? 2.105   53.090 -7.456  1.00 20.19 ? 206 LEU A CD1 1 
ATOM   1526 C  CD2 . LEU A 1 202 ? 3.948   53.609 -9.066  1.00 20.22 ? 206 LEU A CD2 1 
ATOM   1527 N  N   . LEU A 1 203 ? 2.952   58.722 -7.400  1.00 21.01 ? 207 LEU A N   1 
ATOM   1528 C  CA  . LEU A 1 203 ? 2.203   59.985 -7.443  1.00 21.18 ? 207 LEU A CA  1 
ATOM   1529 C  C   . LEU A 1 203 ? 3.006   61.122 -6.818  1.00 21.23 ? 207 LEU A C   1 
ATOM   1530 O  O   . LEU A 1 203 ? 3.623   61.925 -7.522  1.00 21.38 ? 207 LEU A O   1 
ATOM   1531 C  CB  . LEU A 1 203 ? 0.875   59.838 -6.693  1.00 21.27 ? 207 LEU A CB  1 
ATOM   1532 C  CG  . LEU A 1 203 ? -0.091  58.753 -7.182  1.00 21.66 ? 207 LEU A CG  1 
ATOM   1533 C  CD1 . LEU A 1 203 ? -1.172  58.493 -6.145  1.00 21.66 ? 207 LEU A CD1 1 
ATOM   1534 C  CD2 . LEU A 1 203 ? -0.702  59.133 -8.529  1.00 21.87 ? 207 LEU A CD2 1 
HETATM 1535 C  C1  . GOL B 2 .   ? -1.033  48.467 16.252  1.00 47.74 ? 1   GOL A C1  1 
HETATM 1536 O  O1  . GOL B 2 .   ? -1.438  49.812 16.148  1.00 49.02 ? 1   GOL A O1  1 
HETATM 1537 C  C2  . GOL B 2 .   ? 0.218   48.367 17.124  1.00 47.51 ? 1   GOL A C2  1 
HETATM 1538 O  O2  . GOL B 2 .   ? 1.341   48.043 16.329  1.00 46.51 ? 1   GOL A O2  1 
HETATM 1539 C  C3  . GOL B 2 .   ? 0.016   47.285 18.175  1.00 47.16 ? 1   GOL A C3  1 
HETATM 1540 O  O3  . GOL B 2 .   ? 1.044   47.299 19.139  1.00 47.15 ? 1   GOL A O3  1 
HETATM 1541 CL CL  . CL  C 3 .   ? 19.230  40.168 6.936   1.00 35.35 ? 219 CL  A CL  1 
HETATM 1542 O  O   . HOH D 4 .   ? -31.968 23.425 12.527  1.00 17.83 ? 220 HOH A O   1 
HETATM 1543 O  O   . HOH D 4 .   ? -5.631  47.873 9.778   1.00 34.84 ? 221 HOH A O   1 
HETATM 1544 O  O   . HOH D 4 .   ? -21.342 23.762 7.675   1.00 25.52 ? 222 HOH A O   1 
HETATM 1545 O  O   . HOH D 4 .   ? -24.030 35.322 8.001   1.00 33.93 ? 223 HOH A O   1 
HETATM 1546 O  O   . HOH D 4 .   ? 5.187   50.568 22.487  1.00 25.20 ? 224 HOH A O   1 
HETATM 1547 O  O   . HOH D 4 .   ? 3.607   17.435 9.756   1.00 22.77 ? 225 HOH A O   1 
HETATM 1548 O  O   . HOH D 4 .   ? -3.406  19.675 12.190  1.00 33.13 ? 226 HOH A O   1 
HETATM 1549 O  O   . HOH D 4 .   ? 4.098   54.704 15.596  1.00 29.16 ? 227 HOH A O   1 
HETATM 1550 O  O   . HOH D 4 .   ? 8.490   49.945 -1.924  1.00 28.95 ? 229 HOH A O   1 
HETATM 1551 O  O   . HOH D 4 .   ? 12.538  49.511 -1.699  1.00 37.15 ? 230 HOH A O   1 
HETATM 1552 O  O   . HOH D 4 .   ? -12.572 22.758 4.089   1.00 28.19 ? 232 HOH A O   1 
HETATM 1553 O  O   . HOH D 4 .   ? 0.104   28.431 0.029   0.50 12.37 ? 233 HOH A O   1 
HETATM 1554 O  O   . HOH D 4 .   ? -4.546  30.729 11.132  1.00 8.75  ? 234 HOH A O   1 
HETATM 1555 O  O   . HOH D 4 .   ? -4.552  46.617 4.514   1.00 16.85 ? 235 HOH A O   1 
HETATM 1556 O  O   . HOH D 4 .   ? -7.928  31.836 24.336  1.00 9.74  ? 236 HOH A O   1 
HETATM 1557 O  O   . HOH D 4 .   ? -1.157  25.446 2.369   1.00 12.05 ? 237 HOH A O   1 
HETATM 1558 O  O   . HOH D 4 .   ? 10.321  45.811 12.514  1.00 13.97 ? 238 HOH A O   1 
HETATM 1559 O  O   . HOH D 4 .   ? -6.943  44.774 8.191   1.00 18.24 ? 239 HOH A O   1 
HETATM 1560 O  O   . HOH D 4 .   ? -8.685  28.998 -8.562  1.00 13.95 ? 240 HOH A O   1 
HETATM 1561 O  O   . HOH D 4 .   ? 13.425  30.741 16.337  1.00 11.35 ? 241 HOH A O   1 
HETATM 1562 O  O   . HOH D 4 .   ? -0.004  50.583 0.029   0.50 10.33 ? 242 HOH A O   1 
HETATM 1563 O  O   . HOH D 4 .   ? -11.074 30.340 5.398   1.00 13.54 ? 243 HOH A O   1 
HETATM 1564 O  O   . HOH D 4 .   ? -5.945  31.071 22.547  1.00 15.06 ? 244 HOH A O   1 
HETATM 1565 O  O   . HOH D 4 .   ? 2.067   28.238 3.877   1.00 14.09 ? 245 HOH A O   1 
HETATM 1566 O  O   . HOH D 4 .   ? -2.002  52.002 4.034   1.00 15.01 ? 246 HOH A O   1 
HETATM 1567 O  O   . HOH D 4 .   ? -24.331 25.378 17.407  1.00 10.21 ? 247 HOH A O   1 
HETATM 1568 O  O   . HOH D 4 .   ? -22.356 20.589 8.155   1.00 23.54 ? 248 HOH A O   1 
HETATM 1569 O  O   . HOH D 4 .   ? -2.868  26.352 0.582   1.00 14.68 ? 249 HOH A O   1 
HETATM 1570 O  O   . HOH D 4 .   ? 8.518   51.184 19.096  1.00 15.75 ? 250 HOH A O   1 
HETATM 1571 O  O   . HOH D 4 .   ? 10.109  51.727 6.473   1.00 10.71 ? 251 HOH A O   1 
HETATM 1572 O  O   . HOH D 4 .   ? 2.065   51.806 -1.255  1.00 9.87  ? 252 HOH A O   1 
HETATM 1573 O  O   . HOH D 4 .   ? 4.339   25.453 19.284  1.00 11.59 ? 253 HOH A O   1 
HETATM 1574 O  O   . HOH D 4 .   ? -5.922  28.181 22.972  1.00 11.92 ? 254 HOH A O   1 
HETATM 1575 O  O   . HOH D 4 .   ? -9.583  37.577 8.419   1.00 16.88 ? 255 HOH A O   1 
HETATM 1576 O  O   . HOH D 4 .   ? -13.213 38.233 26.740  1.00 16.78 ? 256 HOH A O   1 
HETATM 1577 O  O   . HOH D 4 .   ? -10.029 35.644 5.695   1.00 18.53 ? 257 HOH A O   1 
HETATM 1578 O  O   . HOH D 4 .   ? 9.987   45.597 15.271  1.00 13.58 ? 258 HOH A O   1 
HETATM 1579 O  O   . HOH D 4 .   ? 6.265   52.481 -5.867  1.00 13.99 ? 259 HOH A O   1 
HETATM 1580 O  O   . HOH D 4 .   ? 2.897   52.150 14.789  1.00 13.85 ? 260 HOH A O   1 
HETATM 1581 O  O   . HOH D 4 .   ? 8.837   52.156 -0.159  1.00 10.53 ? 261 HOH A O   1 
HETATM 1582 O  O   . HOH D 4 .   ? -14.805 27.852 -1.437  1.00 14.43 ? 262 HOH A O   1 
HETATM 1583 O  O   . HOH D 4 .   ? 3.395   49.403 -1.049  1.00 20.03 ? 263 HOH A O   1 
HETATM 1584 O  O   . HOH D 4 .   ? -10.659 37.036 26.037  1.00 14.45 ? 264 HOH A O   1 
HETATM 1585 O  O   . HOH D 4 .   ? 13.969  40.000 14.012  1.00 15.70 ? 265 HOH A O   1 
HETATM 1586 O  O   . HOH D 4 .   ? 3.484   41.006 23.986  1.00 12.32 ? 266 HOH A O   1 
HETATM 1587 O  O   . HOH D 4 .   ? 9.977   41.878 13.487  1.00 22.10 ? 267 HOH A O   1 
HETATM 1588 O  O   . HOH D 4 .   ? 10.536  47.030 1.022   1.00 16.93 ? 268 HOH A O   1 
HETATM 1589 O  O   . HOH D 4 .   ? -13.135 32.269 26.473  1.00 22.25 ? 269 HOH A O   1 
HETATM 1590 O  O   . HOH D 4 .   ? -10.733 34.185 26.246  1.00 13.42 ? 270 HOH A O   1 
HETATM 1591 O  O   . HOH D 4 .   ? -26.140 35.428 11.642  1.00 23.14 ? 271 HOH A O   1 
HETATM 1592 O  O   . HOH D 4 .   ? 7.792   23.259 8.725   1.00 20.53 ? 272 HOH A O   1 
HETATM 1593 O  O   . HOH D 4 .   ? -8.104  24.890 23.552  1.00 16.72 ? 273 HOH A O   1 
HETATM 1594 O  O   . HOH D 4 .   ? 11.828  47.804 11.375  1.00 12.92 ? 274 HOH A O   1 
HETATM 1595 O  O   . HOH D 4 .   ? -1.763  47.438 4.806   1.00 11.51 ? 275 HOH A O   1 
HETATM 1596 O  O   . HOH D 4 .   ? -5.520  26.785 0.288   1.00 18.77 ? 276 HOH A O   1 
HETATM 1597 O  O   . HOH D 4 .   ? -25.475 43.741 23.067  1.00 14.55 ? 277 HOH A O   1 
HETATM 1598 O  O   . HOH D 4 .   ? -17.828 33.619 4.820   1.00 20.75 ? 278 HOH A O   1 
HETATM 1599 O  O   . HOH D 4 .   ? -16.375 23.708 19.647  1.00 25.48 ? 279 HOH A O   1 
HETATM 1600 O  O   . HOH D 4 .   ? 1.344   47.659 -0.577  1.00 21.09 ? 280 HOH A O   1 
HETATM 1601 O  O   . HOH D 4 .   ? -11.655 40.299 16.671  1.00 26.72 ? 281 HOH A O   1 
HETATM 1602 O  O   . HOH D 4 .   ? -3.247  36.708 27.610  1.00 18.27 ? 282 HOH A O   1 
HETATM 1603 O  O   . HOH D 4 .   ? 0.607   50.031 7.111   1.00 15.37 ? 283 HOH A O   1 
HETATM 1604 O  O   . HOH D 4 .   ? -5.917  46.949 6.890   1.00 20.31 ? 284 HOH A O   1 
HETATM 1605 O  O   . HOH D 4 .   ? 4.077   50.720 -5.269  1.00 14.56 ? 285 HOH A O   1 
HETATM 1606 O  O   . HOH D 4 .   ? -22.475 31.550 20.266  1.00 12.88 ? 286 HOH A O   1 
HETATM 1607 O  O   . HOH D 4 .   ? 7.221   46.213 -2.154  1.00 25.57 ? 287 HOH A O   1 
HETATM 1608 O  O   . HOH D 4 .   ? -22.688 29.468 8.792   1.00 20.13 ? 288 HOH A O   1 
HETATM 1609 O  O   . HOH D 4 .   ? 1.134   26.805 1.664   1.00 16.81 ? 289 HOH A O   1 
HETATM 1610 O  O   . HOH D 4 .   ? -20.199 25.218 24.595  1.00 17.41 ? 290 HOH A O   1 
HETATM 1611 O  O   . HOH D 4 .   ? -3.447  27.377 22.312  1.00 11.21 ? 291 HOH A O   1 
HETATM 1612 O  O   . HOH D 4 .   ? -8.282  29.189 27.601  1.00 17.46 ? 292 HOH A O   1 
HETATM 1613 O  O   . HOH D 4 .   ? -4.753  45.844 17.055  1.00 22.36 ? 293 HOH A O   1 
HETATM 1614 O  O   . HOH D 4 .   ? -8.104  18.344 3.078   1.00 20.41 ? 294 HOH A O   1 
HETATM 1615 O  O   . HOH D 4 .   ? 18.728  43.025 5.071   1.00 22.18 ? 295 HOH A O   1 
HETATM 1616 O  O   . HOH D 4 .   ? 4.721   48.907 -3.388  1.00 19.97 ? 296 HOH A O   1 
HETATM 1617 O  O   . HOH D 4 .   ? -23.747 36.350 10.648  1.00 17.35 ? 297 HOH A O   1 
HETATM 1618 O  O   . HOH D 4 .   ? 6.909   52.296 21.104  1.00 18.56 ? 298 HOH A O   1 
HETATM 1619 O  O   . HOH D 4 .   ? -4.106  33.644 26.553  1.00 26.09 ? 299 HOH A O   1 
HETATM 1620 O  O   . HOH D 4 .   ? -3.443  49.590 7.802   1.00 25.23 ? 300 HOH A O   1 
HETATM 1621 O  O   . HOH D 4 .   ? 9.251   57.933 -2.471  1.00 21.22 ? 301 HOH A O   1 
HETATM 1622 O  O   . HOH D 4 .   ? -0.074  52.787 10.572  1.00 32.32 ? 302 HOH A O   1 
HETATM 1623 O  O   . HOH D 4 .   ? 14.933  42.275 2.442   1.00 23.50 ? 303 HOH A O   1 
HETATM 1624 O  O   . HOH D 4 .   ? -14.642 41.969 26.741  0.50 27.57 ? 304 HOH A O   1 
HETATM 1625 O  O   . HOH D 4 .   ? -20.491 27.425 21.710  1.00 18.13 ? 305 HOH A O   1 
HETATM 1626 O  O   . HOH D 4 .   ? -6.650  32.269 26.863  1.00 16.69 ? 306 HOH A O   1 
HETATM 1627 O  O   . HOH D 4 .   ? -8.683  46.563 5.386   1.00 28.62 ? 307 HOH A O   1 
HETATM 1628 O  O   . HOH D 4 .   ? -13.675 30.441 4.846   1.00 31.96 ? 308 HOH A O   1 
HETATM 1629 O  O   . HOH D 4 .   ? -12.504 20.153 2.527   1.00 24.13 ? 309 HOH A O   1 
HETATM 1630 O  O   . HOH D 4 .   ? -17.694 23.017 17.508  1.00 25.42 ? 310 HOH A O   1 
HETATM 1631 O  O   . HOH D 4 .   ? 9.490   53.310 -2.524  1.00 26.11 ? 311 HOH A O   1 
HETATM 1632 O  O   . HOH D 4 .   ? -23.291 29.565 22.288  1.00 22.99 ? 312 HOH A O   1 
HETATM 1633 O  O   . HOH D 4 .   ? -18.797 44.703 25.814  1.00 11.67 ? 313 HOH A O   1 
HETATM 1634 O  O   . HOH D 4 .   ? -17.937 24.654 21.842  1.00 19.08 ? 314 HOH A O   1 
HETATM 1635 O  O   . HOH D 4 .   ? 6.987   23.608 17.512  1.00 27.34 ? 315 HOH A O   1 
HETATM 1636 O  O   . HOH D 4 .   ? -26.914 24.195 16.058  1.00 22.19 ? 316 HOH A O   1 
HETATM 1637 O  O   . HOH D 4 .   ? -13.326 37.712 12.909  1.00 26.70 ? 317 HOH A O   1 
HETATM 1638 O  O   . HOH D 4 .   ? 7.491   52.294 -8.361  1.00 26.36 ? 318 HOH A O   1 
HETATM 1639 O  O   . HOH D 4 .   ? 14.169  47.202 12.828  1.00 19.51 ? 319 HOH A O   1 
HETATM 1640 O  O   . HOH D 4 .   ? -12.032 44.454 3.468   1.00 21.44 ? 320 HOH A O   1 
HETATM 1641 O  O   . HOH D 4 .   ? -4.192  21.525 19.626  1.00 21.00 ? 321 HOH A O   1 
HETATM 1642 O  O   . HOH D 4 .   ? -25.679 25.847 19.943  1.00 19.10 ? 322 HOH A O   1 
HETATM 1643 O  O   . HOH D 4 .   ? -10.205 23.217 26.660  1.00 24.92 ? 323 HOH A O   1 
HETATM 1644 O  O   . HOH D 4 .   ? 9.849   30.140 19.829  1.00 15.18 ? 324 HOH A O   1 
HETATM 1645 O  O   . HOH D 4 .   ? -0.184  15.585 -0.101  0.50 19.07 ? 325 HOH A O   1 
HETATM 1646 O  O   . HOH D 4 .   ? -11.338 23.079 8.014   1.00 19.42 ? 326 HOH A O   1 
HETATM 1647 O  O   . HOH D 4 .   ? -0.997  44.968 19.480  1.00 30.58 ? 327 HOH A O   1 
HETATM 1648 O  O   . HOH D 4 .   ? 12.603  44.752 0.651   1.00 32.56 ? 328 HOH A O   1 
HETATM 1649 O  O   . HOH D 4 .   ? -25.876 43.302 25.760  1.00 17.10 ? 329 HOH A O   1 
HETATM 1650 O  O   . HOH D 4 .   ? -13.911 40.384 24.190  1.00 25.26 ? 330 HOH A O   1 
HETATM 1651 O  O   . HOH D 4 .   ? -11.779 33.522 1.975   1.00 32.62 ? 331 HOH A O   1 
HETATM 1652 O  O   . HOH D 4 .   ? -2.419  16.768 6.748   1.00 16.18 ? 332 HOH A O   1 
HETATM 1653 O  O   . HOH D 4 .   ? 10.133  38.613 16.112  1.00 14.98 ? 333 HOH A O   1 
HETATM 1654 O  O   . HOH D 4 .   ? 10.841  42.862 15.858  1.00 26.31 ? 334 HOH A O   1 
HETATM 1655 O  O   . HOH D 4 .   ? 10.219  41.028 17.805  1.00 24.83 ? 335 HOH A O   1 
HETATM 1656 O  O   . HOH D 4 .   ? 11.606  49.378 1.290   1.00 23.85 ? 336 HOH A O   1 
HETATM 1657 O  O   . HOH D 4 .   ? -5.452  30.287 28.109  1.00 25.17 ? 337 HOH A O   1 
HETATM 1658 O  O   . HOH D 4 .   ? 16.058  44.732 12.249  1.00 27.17 ? 338 HOH A O   1 
HETATM 1659 O  O   . HOH D 4 .   ? 8.538   51.700 -4.472  1.00 24.56 ? 339 HOH A O   1 
HETATM 1660 O  O   . HOH D 4 .   ? 1.601   32.024 22.986  1.00 30.66 ? 340 HOH A O   1 
HETATM 1661 O  O   . HOH D 4 .   ? -6.238  22.491 22.957  1.00 26.53 ? 341 HOH A O   1 
HETATM 1662 O  O   . HOH D 4 .   ? -14.925 40.540 9.527   1.00 23.37 ? 342 HOH A O   1 
HETATM 1663 O  O   . HOH D 4 .   ? -3.336  46.010 19.501  1.00 24.29 ? 343 HOH A O   1 
HETATM 1664 O  O   . HOH D 4 .   ? -10.680 23.589 23.469  1.00 21.63 ? 344 HOH A O   1 
HETATM 1665 O  O   . HOH D 4 .   ? -6.138  27.969 25.620  1.00 35.85 ? 345 HOH A O   1 
HETATM 1666 O  O   . HOH D 4 .   ? 12.928  56.890 7.647   1.00 22.37 ? 346 HOH A O   1 
HETATM 1667 O  O   . HOH D 4 .   ? -8.654  34.099 -11.572 1.00 9.23  ? 347 HOH A O   1 
HETATM 1668 O  O   . HOH D 4 .   ? -9.559  31.655 -8.680  1.00 9.73  ? 348 HOH A O   1 
HETATM 1669 O  O   . HOH D 4 .   ? -11.306 32.279 -6.646  1.00 10.24 ? 349 HOH A O   1 
HETATM 1670 O  O   . HOH D 4 .   ? -7.128  32.078 -9.770  1.00 9.46  ? 350 HOH A O   1 
HETATM 1671 O  O   . HOH D 4 .   ? -3.194  30.795 24.840  1.00 22.78 ? 351 HOH A O   1 
HETATM 1672 O  O   . HOH D 4 .   ? -3.255  30.525 22.173  1.00 29.97 ? 352 HOH A O   1 
HETATM 1673 O  O   . HOH D 4 .   ? -7.336  25.608 26.239  1.00 28.88 ? 353 HOH A O   1 
HETATM 1674 O  O   . HOH D 4 .   ? -30.378 45.348 13.671  1.00 22.93 ? 354 HOH A O   1 
HETATM 1675 O  O   . HOH D 4 .   ? 13.420  37.541 15.314  1.00 23.72 ? 355 HOH A O   1 
HETATM 1676 O  O   . HOH D 4 .   ? 7.404   38.748 23.324  1.00 22.15 ? 356 HOH A O   1 
HETATM 1677 O  O   . HOH D 4 .   ? 17.601  39.891 1.773   1.00 28.56 ? 357 HOH A O   1 
HETATM 1678 O  O   . HOH D 4 .   ? 11.376  27.580 19.266  1.00 20.40 ? 358 HOH A O   1 
HETATM 1679 O  O   . HOH D 4 .   ? -3.315  48.124 11.699  1.00 27.83 ? 359 HOH A O   1 
HETATM 1680 O  O   . HOH D 4 .   ? -26.263 29.600 6.062   1.00 25.83 ? 360 HOH A O   1 
HETATM 1681 O  O   . HOH D 4 .   ? -7.981  20.955 -3.216  1.00 18.70 ? 361 HOH A O   1 
HETATM 1682 O  O   . HOH D 4 .   ? -11.056 21.134 21.423  1.00 23.86 ? 362 HOH A O   1 
HETATM 1683 O  O   . HOH D 4 .   ? -25.406 22.264 16.757  1.00 14.63 ? 363 HOH A O   1 
HETATM 1684 O  O   . HOH D 4 .   ? -21.478 21.822 15.076  1.00 27.99 ? 364 HOH A O   1 
HETATM 1685 O  O   . HOH D 4 .   ? 10.873  52.094 1.512   1.00 24.41 ? 365 HOH A O   1 
HETATM 1686 O  O   . HOH D 4 .   ? 7.545   35.816 23.054  1.00 24.60 ? 366 HOH A O   1 
HETATM 1687 O  O   . HOH D 4 .   ? 17.867  42.542 2.522   1.00 34.57 ? 367 HOH A O   1 
HETATM 1688 O  O   . HOH D 4 .   ? 16.809  38.558 13.731  1.00 21.76 ? 368 HOH A O   1 
HETATM 1689 O  O   . HOH D 4 .   ? 6.027   23.576 20.315  1.00 19.80 ? 369 HOH A O   1 
HETATM 1690 O  O   . HOH D 4 .   ? 2.763   17.213 16.756  1.00 18.93 ? 370 HOH A O   1 
HETATM 1691 O  O   . HOH D 4 .   ? 10.961  52.272 3.975   1.00 24.99 ? 371 HOH A O   1 
HETATM 1692 O  O   . HOH D 4 .   ? 4.008   31.171 23.612  1.00 33.14 ? 372 HOH A O   1 
HETATM 1693 O  O   . HOH D 4 .   ? 7.225   46.495 24.586  1.00 16.67 ? 373 HOH A O   1 
HETATM 1694 O  O   . HOH D 4 .   ? -28.083 34.811 9.804   1.00 22.95 ? 374 HOH A O   1 
HETATM 1695 O  O   . HOH D 4 .   ? -10.874 38.973 10.140  1.00 29.91 ? 375 HOH A O   1 
HETATM 1696 O  O   . HOH D 4 .   ? -13.995 24.101 8.185   1.00 29.21 ? 376 HOH A O   1 
HETATM 1697 O  O   . HOH D 4 .   ? 5.907   28.923 22.958  1.00 20.85 ? 377 HOH A O   1 
HETATM 1698 O  O   . HOH D 4 .   ? -7.747  25.762 1.586   1.00 26.64 ? 378 HOH A O   1 
HETATM 1699 O  O   . HOH D 4 .   ? 10.176  46.663 -1.627  1.00 30.39 ? 379 HOH A O   1 
HETATM 1700 O  O   . HOH D 4 .   ? -25.350 31.725 17.292  1.00 26.91 ? 381 HOH A O   1 
HETATM 1701 O  O   . HOH D 4 .   ? -24.617 43.266 8.635   1.00 22.56 ? 382 HOH A O   1 
HETATM 1702 O  O   . HOH D 4 .   ? -14.135 39.463 7.274   1.00 43.00 ? 383 HOH A O   1 
HETATM 1703 O  O   . HOH D 4 .   ? -0.164  15.464 7.049   1.00 26.20 ? 384 HOH A O   1 
HETATM 1704 O  O   . HOH D 4 .   ? -14.636 25.362 26.349  0.50 28.85 ? 385 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? -13.039 42.700 1.087   1.00 29.50 ? 386 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? 13.079  53.396 0.566   1.00 27.00 ? 387 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? -7.553  16.922 6.604   1.00 43.67 ? 388 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? -7.371  45.938 10.523  1.00 27.44 ? 389 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? -15.900 31.184 4.435   1.00 36.57 ? 390 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? -15.710 34.385 25.693  1.00 33.32 ? 391 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? -23.846 24.834 21.587  1.00 23.09 ? 392 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? -15.905 37.274 2.944   1.00 32.85 ? 393 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? -31.612 25.993 13.049  1.00 25.83 ? 394 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   5   ?   ?   ?   A . n 
A 1 2   VAL 2   6   ?   ?   ?   A . n 
A 1 3   PRO 3   7   ?   ?   ?   A . n 
A 1 4   GLU 4   8   ?   ?   ?   A . n 
A 1 5   LEU 5   9   9   LEU LEU A . n 
A 1 6   LYS 6   10  10  LYS LYS A . n 
A 1 7   GLN 7   11  11  GLN GLN A . n 
A 1 8   ILE 8   12  12  ILE ILE A . n 
A 1 9   SER 9   13  13  SER SER A . n 
A 1 10  ARG 10  14  14  ARG ARG A . n 
A 1 11  VAL 11  15  15  VAL VAL A . n 
A 1 12  GLU 12  16  16  GLU GLU A . n 
A 1 13  ALA 13  17  17  ALA ALA A . n 
A 1 14  MET 14  18  18  MET MET A . n 
A 1 15  ARG 15  19  19  ARG ARG A . n 
A 1 16  LEU 16  20  20  LEU LEU A . n 
A 1 17  GLY 17  21  21  GLY GLY A . n 
A 1 18  PRO 18  22  22  PRO PRO A . n 
A 1 19  GLY 19  23  23  GLY GLY A . n 
A 1 20  TRP 20  24  24  TRP TRP A . n 
A 1 21  SER 21  25  25  SER SER A . n 
A 1 22  HIS 22  26  26  HIS HIS A . n 
A 1 23  SER 23  27  27  SER SER A . n 
A 1 24  CYS 24  28  28  CYS CYS A . n 
A 1 25  HIS 25  29  29  HIS HIS A . n 
A 1 26  ALA 26  30  30  ALA ALA A . n 
A 1 27  MET 27  31  31  MET MET A . n 
A 1 28  LEU 28  32  32  LEU LEU A . n 
A 1 29  TYR 29  33  33  TYR TYR A . n 
A 1 30  ALA 30  34  34  ALA ALA A . n 
A 1 31  ALA 31  35  35  ALA ALA A . n 
A 1 32  ASN 32  36  36  ASN ASN A . n 
A 1 33  PRO 33  37  37  PRO PRO A . n 
A 1 34  GLY 34  38  38  GLY GLY A . n 
A 1 35  GLN 35  39  39  GLN GLN A . n 
A 1 36  LEU 36  40  40  LEU LEU A . n 
A 1 37  PHE 37  41  41  PHE PHE A . n 
A 1 38  GLY 38  42  42  GLY GLY A . n 
A 1 39  ARG 39  43  43  ARG ARG A . n 
A 1 40  ILE 40  44  44  ILE ILE A . n 
A 1 41  PRO 41  45  45  PRO PRO A . n 
A 1 42  MET 42  46  46  MET MET A . n 
A 1 43  ARG 43  47  47  ARG ARG A . n 
A 1 44  PHE 44  48  48  PHE PHE A . n 
A 1 45  SER 45  49  49  SER SER A . n 
A 1 46  VAL 46  50  50  VAL VAL A . n 
A 1 47  LEU 47  51  51  LEU LEU A . n 
A 1 48  MET 48  52  52  MET MET A . n 
A 1 49  GLN 49  53  53  GLN GLN A . n 
A 1 50  MET 50  54  54  MET MET A . n 
A 1 51  ARG 51  55  55  ARG ARG A . n 
A 1 52  PHE 52  56  56  PHE PHE A . n 
A 1 53  ASP 53  57  57  ASP ASP A . n 
A 1 54  GLY 54  58  58  GLY GLY A . n 
A 1 55  LEU 55  59  59  LEU LEU A . n 
A 1 56  LEU 56  60  60  LEU LEU A . n 
A 1 57  GLY 57  61  61  GLY GLY A . n 
A 1 58  PHE 58  62  62  PHE PHE A . n 
A 1 59  PRO 59  63  63  PRO PRO A . n 
A 1 60  GLY 60  64  64  GLY GLY A . n 
A 1 61  GLY 61  65  65  GLY GLY A . n 
A 1 62  PHE 62  66  66  PHE PHE A . n 
A 1 63  VAL 63  67  67  VAL VAL A . n 
A 1 64  ASP 64  68  68  ASP ASP A . n 
A 1 65  ARG 65  69  69  ARG ARG A . n 
A 1 66  ARG 66  70  70  ARG ARG A . n 
A 1 67  PHE 67  71  71  PHE PHE A . n 
A 1 68  TRP 68  72  72  TRP TRP A . n 
A 1 69  SER 69  73  73  SER SER A . n 
A 1 70  LEU 70  74  74  LEU LEU A . n 
A 1 71  GLU 71  75  75  GLU GLU A . n 
A 1 72  ASP 72  76  76  ASP ASP A . n 
A 1 73  GLY 73  77  77  GLY GLY A . n 
A 1 74  LEU 74  78  78  LEU LEU A . n 
A 1 75  ASN 75  79  79  ASN ASN A . n 
A 1 76  ARG 76  80  80  ARG ARG A . n 
A 1 77  VAL 77  81  81  VAL VAL A . n 
A 1 78  LEU 78  82  82  LEU LEU A . n 
A 1 79  GLY 79  83  83  GLY GLY A . n 
A 1 80  LEU 80  84  84  LEU LEU A . n 
A 1 81  GLY 81  85  85  GLY GLY A . n 
A 1 82  LEU 82  86  86  LEU LEU A . n 
A 1 83  GLY 83  87  ?   ?   ?   A . n 
A 1 84  CYS 84  88  ?   ?   ?   A . n 
A 1 85  LEU 85  89  ?   ?   ?   A . n 
A 1 86  ARG 86  90  90  ARG ARG A . n 
A 1 87  LEU 87  91  91  LEU LEU A . n 
A 1 88  THR 88  92  92  THR THR A . n 
A 1 89  GLU 89  93  93  GLU GLU A . n 
A 1 90  ALA 90  94  94  ALA ALA A . n 
A 1 91  ASP 91  95  95  ASP ASP A . n 
A 1 92  TYR 92  96  96  TYR TYR A . n 
A 1 93  LEU 93  97  97  LEU LEU A . n 
A 1 94  SER 94  98  98  SER SER A . n 
A 1 95  SER 95  99  99  SER SER A . n 
A 1 96  HIS 96  100 100 HIS HIS A . n 
A 1 97  LEU 97  101 101 LEU LEU A . n 
A 1 98  THR 98  102 102 THR THR A . n 
A 1 99  GLU 99  103 ?   ?   ?   A . n 
A 1 100 GLY 100 104 ?   ?   ?   A . n 
A 1 101 PRO 101 105 ?   ?   ?   A . n 
A 1 102 HIS 102 106 ?   ?   ?   A . n 
A 1 103 ARG 103 107 107 ARG ARG A . n 
A 1 104 VAL 104 108 108 VAL VAL A . n 
A 1 105 VAL 105 109 109 VAL VAL A . n 
A 1 106 ALA 106 110 110 ALA ALA A . n 
A 1 107 HIS 107 111 111 HIS HIS A . n 
A 1 108 LEU 108 112 112 LEU LEU A . n 
A 1 109 TYR 109 113 113 TYR TYR A . n 
A 1 110 ALA 110 114 114 ALA ALA A . n 
A 1 111 ARG 111 115 115 ARG ARG A . n 
A 1 112 GLN 112 116 116 GLN GLN A . n 
A 1 113 LEU 113 117 117 LEU LEU A . n 
A 1 114 THR 114 118 118 THR THR A . n 
A 1 115 LEU 115 119 119 LEU LEU A . n 
A 1 116 GLU 116 120 120 GLU GLU A . n 
A 1 117 GLN 117 121 121 GLN GLN A . n 
A 1 118 LEU 118 122 122 LEU LEU A . n 
A 1 119 HIS 119 123 123 HIS HIS A . n 
A 1 120 ALA 120 124 124 ALA ALA A . n 
A 1 121 VAL 121 125 125 VAL VAL A . n 
A 1 122 GLU 122 126 126 GLU GLU A . n 
A 1 123 ILE 123 127 127 ILE ILE A . n 
A 1 124 SER 124 128 128 SER SER A . n 
A 1 125 ALA 125 129 129 ALA ALA A . n 
A 1 126 VAL 126 130 130 VAL VAL A . n 
A 1 127 HIS 127 131 131 HIS HIS A . n 
A 1 128 SER 128 132 132 SER SER A . n 
A 1 129 ARG 129 133 133 ARG ARG A . n 
A 1 130 ASP 130 134 134 ASP ASP A . n 
A 1 131 HIS 131 135 135 HIS HIS A . n 
A 1 132 GLY 132 136 136 GLY GLY A . n 
A 1 133 LEU 133 137 137 LEU LEU A . n 
A 1 134 GLU 134 138 138 GLU GLU A . n 
A 1 135 VAL 135 139 139 VAL VAL A . n 
A 1 136 LEU 136 140 140 LEU LEU A . n 
A 1 137 GLY 137 141 141 GLY GLY A . n 
A 1 138 LEU 138 142 142 LEU LEU A . n 
A 1 139 VAL 139 143 143 VAL VAL A . n 
A 1 140 ARG 140 144 144 ARG ARG A . n 
A 1 141 VAL 141 145 145 VAL VAL A . n 
A 1 142 PRO 142 146 146 PRO PRO A . n 
A 1 143 LEU 143 147 147 LEU LEU A . n 
A 1 144 TYR 144 148 148 TYR TYR A . n 
A 1 145 THR 145 149 149 THR THR A . n 
A 1 146 GLN 146 150 150 GLN GLN A . n 
A 1 147 LYS 147 151 151 LYS LYS A . n 
A 1 148 ASP 148 152 152 ASP ASP A . n 
A 1 149 ARG 149 153 153 ARG ARG A . n 
A 1 150 VAL 150 154 154 VAL VAL A . n 
A 1 151 GLY 151 155 155 GLY GLY A . n 
A 1 152 GLY 152 156 156 GLY GLY A . n 
A 1 153 PHE 153 157 157 PHE PHE A . n 
A 1 154 PRO 154 158 158 PRO PRO A . n 
A 1 155 ASN 155 159 159 ASN ASN A . n 
A 1 156 PHE 156 160 160 PHE PHE A . n 
A 1 157 LEU 157 161 161 LEU LEU A . n 
A 1 158 SER 158 162 162 SER SER A . n 
A 1 159 ASN 159 163 163 ASN ASN A . n 
A 1 160 ALA 160 164 164 ALA ALA A . n 
A 1 161 PHE 161 165 165 PHE PHE A . n 
A 1 162 VAL 162 166 166 VAL VAL A . n 
A 1 163 SER 163 167 167 SER SER A . n 
A 1 164 THR 164 168 168 THR THR A . n 
A 1 165 ALA 165 169 169 ALA ALA A . n 
A 1 166 LYS 166 170 170 LYS LYS A . n 
A 1 167 CYS 167 171 171 CYS CYS A . n 
A 1 168 GLN 168 172 172 GLN GLN A . n 
A 1 169 LEU 169 173 173 LEU LEU A . n 
A 1 170 LEU 170 174 174 LEU LEU A . n 
A 1 171 PHE 171 175 175 PHE PHE A . n 
A 1 172 ALA 172 176 176 ALA ALA A . n 
A 1 173 LEU 173 177 177 LEU LEU A . n 
A 1 174 LYS 174 178 178 LYS LYS A . n 
A 1 175 VAL 175 179 179 VAL VAL A . n 
A 1 176 LEU 176 180 180 LEU LEU A . n 
A 1 177 ASN 177 181 181 ASN ASN A . n 
A 1 178 MET 178 182 182 MET MET A . n 
A 1 179 MET 179 183 183 MET MET A . n 
A 1 180 PRO 180 184 184 PRO PRO A . n 
A 1 181 GLU 181 185 185 GLU GLU A . n 
A 1 182 GLU 182 186 186 GLU GLU A . n 
A 1 183 LYS 183 187 187 LYS LYS A . n 
A 1 184 LEU 184 188 188 LEU LEU A . n 
A 1 185 VAL 185 189 189 VAL VAL A . n 
A 1 186 GLU 186 190 190 GLU GLU A . n 
A 1 187 ALA 187 191 191 ALA ALA A . n 
A 1 188 LEU 188 192 192 LEU LEU A . n 
A 1 189 ALA 189 193 193 ALA ALA A . n 
A 1 190 ALA 190 194 194 ALA ALA A . n 
A 1 191 ALA 191 195 195 ALA ALA A . n 
A 1 192 THR 192 196 196 THR THR A . n 
A 1 193 GLU 193 197 197 GLU GLU A . n 
A 1 194 LYS 194 198 198 LYS LYS A . n 
A 1 195 GLN 195 199 199 GLN GLN A . n 
A 1 196 LYS 196 200 200 LYS LYS A . n 
A 1 197 LYS 197 201 201 LYS LYS A . n 
A 1 198 ALA 198 202 202 ALA ALA A . n 
A 1 199 LEU 199 203 203 LEU LEU A . n 
A 1 200 GLU 200 204 204 GLU GLU A . n 
A 1 201 LYS 201 205 205 LYS LYS A . n 
A 1 202 LEU 202 206 206 LEU LEU A . n 
A 1 203 LEU 203 207 207 LEU LEU A . n 
A 1 204 PRO 204 208 ?   ?   ?   A . n 
A 1 205 ALA 205 209 ?   ?   ?   A . n 
A 1 206 SER 206 210 ?   ?   ?   A . n 
A 1 207 SER 207 211 ?   ?   ?   A . n 
A 1 208 ALA 208 212 ?   ?   ?   A . n 
A 1 209 HIS 209 213 ?   ?   ?   A . n 
A 1 210 HIS 210 214 ?   ?   ?   A . n 
A 1 211 HIS 211 215 ?   ?   ?   A . n 
A 1 212 HIS 212 216 ?   ?   ?   A . n 
A 1 213 HIS 213 217 ?   ?   ?   A . n 
A 1 214 HIS 214 218 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   1   1   GOL GOL A . 
C 3 CL  1   219 219 CL  CL  A . 
D 4 HOH 1   220 220 HOH HOH A . 
D 4 HOH 2   221 221 HOH HOH A . 
D 4 HOH 3   222 222 HOH HOH A . 
D 4 HOH 4   223 223 HOH HOH A . 
D 4 HOH 5   224 224 HOH HOH A . 
D 4 HOH 6   225 225 HOH HOH A . 
D 4 HOH 7   226 226 HOH HOH A . 
D 4 HOH 8   227 227 HOH HOH A . 
D 4 HOH 9   229 229 HOH HOH A . 
D 4 HOH 10  230 230 HOH HOH A . 
D 4 HOH 11  232 232 HOH HOH A . 
D 4 HOH 12  233 233 HOH HOH A . 
D 4 HOH 13  234 234 HOH HOH A . 
D 4 HOH 14  235 235 HOH HOH A . 
D 4 HOH 15  236 236 HOH HOH A . 
D 4 HOH 16  237 237 HOH HOH A . 
D 4 HOH 17  238 238 HOH HOH A . 
D 4 HOH 18  239 239 HOH HOH A . 
D 4 HOH 19  240 240 HOH HOH A . 
D 4 HOH 20  241 241 HOH HOH A . 
D 4 HOH 21  242 242 HOH HOH A . 
D 4 HOH 22  243 243 HOH HOH A . 
D 4 HOH 23  244 244 HOH HOH A . 
D 4 HOH 24  245 245 HOH HOH A . 
D 4 HOH 25  246 246 HOH HOH A . 
D 4 HOH 26  247 247 HOH HOH A . 
D 4 HOH 27  248 248 HOH HOH A . 
D 4 HOH 28  249 249 HOH HOH A . 
D 4 HOH 29  250 250 HOH HOH A . 
D 4 HOH 30  251 251 HOH HOH A . 
D 4 HOH 31  252 252 HOH HOH A . 
D 4 HOH 32  253 253 HOH HOH A . 
D 4 HOH 33  254 254 HOH HOH A . 
D 4 HOH 34  255 255 HOH HOH A . 
D 4 HOH 35  256 256 HOH HOH A . 
D 4 HOH 36  257 257 HOH HOH A . 
D 4 HOH 37  258 258 HOH HOH A . 
D 4 HOH 38  259 259 HOH HOH A . 
D 4 HOH 39  260 260 HOH HOH A . 
D 4 HOH 40  261 261 HOH HOH A . 
D 4 HOH 41  262 262 HOH HOH A . 
D 4 HOH 42  263 263 HOH HOH A . 
D 4 HOH 43  264 264 HOH HOH A . 
D 4 HOH 44  265 265 HOH HOH A . 
D 4 HOH 45  266 266 HOH HOH A . 
D 4 HOH 46  267 267 HOH HOH A . 
D 4 HOH 47  268 268 HOH HOH A . 
D 4 HOH 48  269 269 HOH HOH A . 
D 4 HOH 49  270 270 HOH HOH A . 
D 4 HOH 50  271 271 HOH HOH A . 
D 4 HOH 51  272 272 HOH HOH A . 
D 4 HOH 52  273 273 HOH HOH A . 
D 4 HOH 53  274 274 HOH HOH A . 
D 4 HOH 54  275 275 HOH HOH A . 
D 4 HOH 55  276 276 HOH HOH A . 
D 4 HOH 56  277 277 HOH HOH A . 
D 4 HOH 57  278 278 HOH HOH A . 
D 4 HOH 58  279 279 HOH HOH A . 
D 4 HOH 59  280 280 HOH HOH A . 
D 4 HOH 60  281 281 HOH HOH A . 
D 4 HOH 61  282 282 HOH HOH A . 
D 4 HOH 62  283 283 HOH HOH A . 
D 4 HOH 63  284 284 HOH HOH A . 
D 4 HOH 64  285 285 HOH HOH A . 
D 4 HOH 65  286 286 HOH HOH A . 
D 4 HOH 66  287 287 HOH HOH A . 
D 4 HOH 67  288 288 HOH HOH A . 
D 4 HOH 68  289 289 HOH HOH A . 
D 4 HOH 69  290 290 HOH HOH A . 
D 4 HOH 70  291 291 HOH HOH A . 
D 4 HOH 71  292 292 HOH HOH A . 
D 4 HOH 72  293 293 HOH HOH A . 
D 4 HOH 73  294 294 HOH HOH A . 
D 4 HOH 74  295 295 HOH HOH A . 
D 4 HOH 75  296 296 HOH HOH A . 
D 4 HOH 76  297 297 HOH HOH A . 
D 4 HOH 77  298 298 HOH HOH A . 
D 4 HOH 78  299 299 HOH HOH A . 
D 4 HOH 79  300 300 HOH HOH A . 
D 4 HOH 80  301 301 HOH HOH A . 
D 4 HOH 81  302 302 HOH HOH A . 
D 4 HOH 82  303 303 HOH HOH A . 
D 4 HOH 83  304 304 HOH HOH A . 
D 4 HOH 84  305 305 HOH HOH A . 
D 4 HOH 85  306 306 HOH HOH A . 
D 4 HOH 86  307 307 HOH HOH A . 
D 4 HOH 87  308 308 HOH HOH A . 
D 4 HOH 88  309 309 HOH HOH A . 
D 4 HOH 89  310 310 HOH HOH A . 
D 4 HOH 90  311 311 HOH HOH A . 
D 4 HOH 91  312 312 HOH HOH A . 
D 4 HOH 92  313 313 HOH HOH A . 
D 4 HOH 93  314 314 HOH HOH A . 
D 4 HOH 94  315 315 HOH HOH A . 
D 4 HOH 95  316 316 HOH HOH A . 
D 4 HOH 96  317 317 HOH HOH A . 
D 4 HOH 97  318 318 HOH HOH A . 
D 4 HOH 98  319 319 HOH HOH A . 
D 4 HOH 99  320 320 HOH HOH A . 
D 4 HOH 100 321 321 HOH HOH A . 
D 4 HOH 101 322 322 HOH HOH A . 
D 4 HOH 102 323 323 HOH HOH A . 
D 4 HOH 103 324 324 HOH HOH A . 
D 4 HOH 104 325 325 HOH HOH A . 
D 4 HOH 105 326 326 HOH HOH A . 
D 4 HOH 106 327 327 HOH HOH A . 
D 4 HOH 107 328 328 HOH HOH A . 
D 4 HOH 108 329 329 HOH HOH A . 
D 4 HOH 109 330 330 HOH HOH A . 
D 4 HOH 110 331 331 HOH HOH A . 
D 4 HOH 111 332 332 HOH HOH A . 
D 4 HOH 112 333 333 HOH HOH A . 
D 4 HOH 113 334 334 HOH HOH A . 
D 4 HOH 114 335 335 HOH HOH A . 
D 4 HOH 115 336 336 HOH HOH A . 
D 4 HOH 116 337 337 HOH HOH A . 
D 4 HOH 117 338 338 HOH HOH A . 
D 4 HOH 118 339 339 HOH HOH A . 
D 4 HOH 119 340 340 HOH HOH A . 
D 4 HOH 120 341 341 HOH HOH A . 
D 4 HOH 121 342 342 HOH HOH A . 
D 4 HOH 122 343 343 HOH HOH A . 
D 4 HOH 123 344 344 HOH HOH A . 
D 4 HOH 124 345 345 HOH HOH A . 
D 4 HOH 125 346 346 HOH HOH A . 
D 4 HOH 126 347 347 HOH HOH A . 
D 4 HOH 127 348 348 HOH HOH A . 
D 4 HOH 128 349 349 HOH HOH A . 
D 4 HOH 129 350 350 HOH HOH A . 
D 4 HOH 130 351 351 HOH HOH A . 
D 4 HOH 131 352 352 HOH HOH A . 
D 4 HOH 132 353 353 HOH HOH A . 
D 4 HOH 133 354 354 HOH HOH A . 
D 4 HOH 134 355 355 HOH HOH A . 
D 4 HOH 135 356 356 HOH HOH A . 
D 4 HOH 136 357 357 HOH HOH A . 
D 4 HOH 137 358 358 HOH HOH A . 
D 4 HOH 138 359 359 HOH HOH A . 
D 4 HOH 139 360 360 HOH HOH A . 
D 4 HOH 140 361 361 HOH HOH A . 
D 4 HOH 141 362 362 HOH HOH A . 
D 4 HOH 142 363 363 HOH HOH A . 
D 4 HOH 143 364 364 HOH HOH A . 
D 4 HOH 144 365 365 HOH HOH A . 
D 4 HOH 145 366 366 HOH HOH A . 
D 4 HOH 146 367 367 HOH HOH A . 
D 4 HOH 147 368 368 HOH HOH A . 
D 4 HOH 148 369 369 HOH HOH A . 
D 4 HOH 149 370 370 HOH HOH A . 
D 4 HOH 150 371 371 HOH HOH A . 
D 4 HOH 151 372 372 HOH HOH A . 
D 4 HOH 152 373 373 HOH HOH A . 
D 4 HOH 153 374 374 HOH HOH A . 
D 4 HOH 154 375 375 HOH HOH A . 
D 4 HOH 155 376 376 HOH HOH A . 
D 4 HOH 156 377 377 HOH HOH A . 
D 4 HOH 157 378 378 HOH HOH A . 
D 4 HOH 158 379 379 HOH HOH A . 
D 4 HOH 159 381 381 HOH HOH A . 
D 4 HOH 160 382 382 HOH HOH A . 
D 4 HOH 161 383 383 HOH HOH A . 
D 4 HOH 162 384 384 HOH HOH A . 
D 4 HOH 163 385 385 HOH HOH A . 
D 4 HOH 164 386 386 HOH HOH A . 
D 4 HOH 165 387 387 HOH HOH A . 
D 4 HOH 166 388 388 HOH HOH A . 
D 4 HOH 167 389 389 HOH HOH A . 
D 4 HOH 168 390 390 HOH HOH A . 
D 4 HOH 169 391 391 HOH HOH A . 
D 4 HOH 170 392 392 HOH HOH A . 
D 4 HOH 171 393 393 HOH HOH A . 
D 4 HOH 172 394 394 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4020  ? 
1 MORE         -50   ? 
1 'SSA (A^2)'  18210 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 233 ? D HOH . 
2 1 A HOH 242 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-01-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.pdbx_synchrotron_site' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -11.0453 34.1842 13.5679 0.0807 0.0501 0.0714 -0.0238 -0.0089 -0.0096 2.5836 0.9709 3.1939 0.1861 
-1.6029 -0.1438 -0.0495 0.0137  -0.0019 0.0949 -0.0784 0.0696  0.0113 -0.1798 0.1279 
'X-RAY DIFFRACTION' 2 ? refined 1.5380   38.6978 8.6912  0.0109 0.0557 0.0311 0.0015  0.0078  -0.0021 1.7812 2.3645 2.6422 0.2976 
-0.3571 0.0369  -0.0400 -0.1644 0.0228  0.1110 -0.0428 -0.0343 0.0058 0.1239  0.0827 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 9   ? ? A 114 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 115 ? ? A 207 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER phasing          .        ? 1 
REFMAC refinement       5.5.0102 ? 2 
XDS    'data reduction' .        ? 3 
SCALA  'data scaling'   .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 43  ? ? -140.99 -17.95 
2 1 ARG A 47  ? ? 71.72   -63.82 
3 1 LEU A 97  ? ? -109.00 -60.14 
4 1 LEU A 137 ? ? -119.05 -96.09 
5 1 VAL A 154 ? ? -130.51 -35.80 
6 1 THR A 168 ? ? 84.06   -26.80 
7 1 THR A 168 ? ? 84.98   -28.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 10  ? CG ? A LYS 6   CG 
2 1 Y 1 A LYS 10  ? CD ? A LYS 6   CD 
3 1 Y 1 A LYS 10  ? CE ? A LYS 6   CE 
4 1 Y 1 A LYS 10  ? NZ ? A LYS 6   NZ 
5 1 Y 1 A LYS 151 ? CD ? A LYS 147 CD 
6 1 Y 1 A LYS 151 ? CE ? A LYS 147 CE 
7 1 Y 1 A LYS 151 ? NZ ? A LYS 147 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 5   ? A MET 1   
2  1 Y 1 A VAL 6   ? A VAL 2   
3  1 Y 1 A PRO 7   ? A PRO 3   
4  1 Y 1 A GLU 8   ? A GLU 4   
5  1 Y 1 A GLY 87  ? A GLY 83  
6  1 Y 1 A CYS 88  ? A CYS 84  
7  1 Y 1 A LEU 89  ? A LEU 85  
8  1 Y 1 A GLU 103 ? A GLU 99  
9  1 Y 1 A GLY 104 ? A GLY 100 
10 1 Y 1 A PRO 105 ? A PRO 101 
11 1 Y 1 A HIS 106 ? A HIS 102 
12 1 Y 1 A PRO 208 ? A PRO 204 
13 1 Y 1 A ALA 209 ? A ALA 205 
14 1 Y 1 A SER 210 ? A SER 206 
15 1 Y 1 A SER 211 ? A SER 207 
16 1 Y 1 A ALA 212 ? A ALA 208 
17 1 Y 1 A HIS 213 ? A HIS 209 
18 1 Y 1 A HIS 214 ? A HIS 210 
19 1 Y 1 A HIS 215 ? A HIS 211 
20 1 Y 1 A HIS 216 ? A HIS 212 
21 1 Y 1 A HIS 217 ? A HIS 213 
22 1 Y 1 A HIS 218 ? A HIS 214 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL       GOL 
3 'CHLORIDE ION' CL  
4 water          HOH 
#