data_3L2Q
# 
_entry.id   3L2Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3L2Q         
NDB   NA0396       
RCSB  RCSB056758   
WWPDB D_1000056758 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3DLR 'Catalytic core domain of PFV IN'                                      unspecified 
PDB 3L2R 'the same protein in complex with magnesium'                           unspecified 
PDB 3L2S 'the same protein in complex with manganese'                           unspecified 
PDB 3L2T 'the same protein in complex with magnesium and MK0518 (Raltegravir)'  unspecified 
PDB 3L2U 'the same protein in complex with magnesium and GS9137 (Elvitegravir)' unspecified 
PDB 3L2V 'the same protein in complex with manganese and MK0518 (Raltegravir)'  unspecified 
PDB 3L2W 'the same protein in complex with manganese and GS9137 (Elvitegravir)' unspecified 
# 
_pdbx_database_status.entry_id                        3L2Q 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-12-15 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hare, S.'       1 
'Gupta, S.S.'    2 
'Cherepanov, P.' 3 
# 
_citation.id                        primary 
_citation.title                     'Retroviral intasome assembly and inhibition of DNA strand transfer' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            464 
_citation.page_first                232 
_citation.page_last                 236 
_citation.year                      2010 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20118915 
_citation.pdbx_database_id_DOI      10.1038/nature08784 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hare, S.'       1 
primary 'Gupta, S.S.'    2 
primary 'Valkov, E.'     3 
primary 'Engelman, A.'   4 
primary 'Cherepanov, P.' 5 
# 
_cell.entry_id           3L2Q 
_cell.length_a           158.250 
_cell.length_b           158.250 
_cell.length_c           124.750 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3L2Q 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Integrase                                                           44456.695 2 ? ? ? ? 
2 polymer     syn "5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*TP*GP*TP*A)-3'" 5864.817  1 ? ? ? 
'19 nucleotide preprocessed PFV donor DNA' 
3 polymer     syn "5'-D(*TP*AP*CP*AP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3'"       5163.401  1 ? ? ? 
'17 nucleotide preprocessed PFV donor DNA' 
4 non-polymer syn 'ZINC ION'                                                          65.409    1 ? ? ? ? 
5 non-polymer syn GLYCEROL                                                            92.094    3 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IN, p42In' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DT)(DG)(DT)(DA)' ATTGTCATGGAATTTTGTA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DA)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TACAAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DT  n 
2 17  DG  n 
2 18  DT  n 
2 19  DA  n 
3 1   DT  n 
3 2   DA  n 
3 3   DC  n 
3 4   DA  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HSRV2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PC2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSSH6P-PFV-INFL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POL_FOAMV P14350 1 
;CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLY
WWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKA
PSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPT
KWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVG
QLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
752 ? 
2 PDB 3L2Q      3L2Q   2 ATTGTCATGGAATTTTGTA ?   ? 
3 PDB 3L2Q      3L2Q   3 TACAAAATTCCATGACA ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3L2Q A 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
2 1 3L2Q B 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
3 2 3L2Q C 1 ? 19  ? 3L2Q   1   ? 19   ? 1 19  
4 3 3L2Q D 1 ? 17  ? 3L2Q   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3L2Q GLY A 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  1  
1 3L2Q PRO A 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  2  
1 3L2Q GLY A 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   3  
1 3L2Q SER A 220 ? UNP P14350 GLY 968 VARIANT          217 4  
1 3L2Q GLY A 221 ? UNP P14350 SER 969 VARIANT          218 5  
2 3L2Q GLY B 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  6  
2 3L2Q PRO B 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  7  
2 3L2Q GLY B 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   8  
2 3L2Q SER B 220 ? UNP P14350 GLY 968 VARIANT          217 9  
2 3L2Q GLY B 221 ? UNP P14350 SER 969 VARIANT          218 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                               'Zn 2'            65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3L2Q 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.670 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.91 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   68.52 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;1.35M ammonium sulfate, 25% (v/v) glycerol, 4.8% (v/v) 1,6-hexanediol, 50mM Mes-NaOH, pH 6.5, vapor diffusion, hanging drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   2009-10-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9796 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_wavelength_list        0.9796 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
# 
_reflns.entry_id                     3L2Q 
_reflns.d_resolution_high            3.250 
_reflns.d_resolution_low             38.979 
_reflns.number_all                   25432 
_reflns.number_obs                   25432 
_reflns.pdbx_Rsym_value              0.116 
_reflns.pdbx_redundancy              6.600 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.25 
_reflns_shell.d_res_low              3.43 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3L2Q 
_refine.ls_number_reflns_obs                     24121 
_refine.ls_number_reflns_all                     25488 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.38 
_refine.ls_d_res_high                            3.25 
_refine.ls_percent_reflns_obs                    99.68 
_refine.ls_R_factor_obs                          0.19793 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19673 
_refine.ls_R_factor_R_free                       0.22087 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1288 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.B_iso_mean                               96.738 
_refine.aniso_B[1][1]                            2.05 
_refine.aniso_B[2][2]                            2.05 
_refine.aniso_B[3][3]                            -4.10 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3DLR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.678 
_refine.pdbx_overall_ESU_R_Free                  0.330 
_refine.overall_SU_ML                            0.255 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             33.550 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4149 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4900 
_refine_hist.d_res_high                       3.25 
_refine_hist.d_res_low                        38.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 5104 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.315  2.153  ? 7119 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.920  5.000  ? 526  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.662 23.488 ? 172  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.210 15.000 ? 676  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.047 15.000 ? 23   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.073  0.200  ? 809  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.022  ? 3612 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.419  1.500  ? 2657 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.808  2.000  ? 4339 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.965  3.000  ? 2447 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.719  4.500  ? 2780 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 A 860 0.35 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 860 0.42 2.00 'medium thermal'    1 2 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.250 
_refine_ls_shell.d_res_low                        3.334 
_refine_ls_shell.number_reflns_R_work             1742 
_refine_ls_shell.R_factor_R_work                  0.317 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.324 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             75 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 119 A 200 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 119 B 200 1 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 241 A 257 2 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 241 B 257 2 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 263 A 273 3 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 263 B 273 3 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3L2Q 
_struct.title                     'Crystal structure of the Prototype Foamy Virus (PFV) intasome in apo form' 
_struct.pdbx_descriptor           'Integrase/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3L2Q 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, TETRAMER, DNA INTEGRATION, ENDONUCLEASE, METAL-BINDING, MULTIFUNCTIONAL ENZYME, NUCLEASE, NUCLEOTIDYLTRANSFERASE, NUCLEUS, TRANSFERASE, VIRAL NUCLEOPROTEIN, VIRION, ZINC, DNA-BINDING, ZINC BINDING, HHCC MOTIF, VIRAL PROTEIN, RECOMBINATION, RECOMBINATION-DNA complex
;
_struct_keywords.pdbx_keywords   RECOMBINATION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 15  ? GLN A 20  ? LEU A 12  GLN A 17  1 ? 6  
HELX_P HELX_P2  2  PRO A 53  ? LEU A 67  ? PRO A 50  LEU A 64  1 ? 15 
HELX_P HELX_P3  3  GLY A 71  ? TYR A 83  ? GLY A 68  TYR A 80  1 ? 13 
HELX_P HELX_P4  4  ASN A 87  ? CYS A 99  ? ASN A 84  CYS A 96  1 ? 13 
HELX_P HELX_P5  5  CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P6  6  SER A 165 ? THR A 177 ? SER A 162 THR A 174 1 ? 13 
HELX_P HELX_P7  7  GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P8  8  SER A 195 ? GLY A 206 ? SER A 192 GLY A 203 1 ? 12 
HELX_P HELX_P9  9  HIS A 216 ? SER A 219 ? HIS A 213 SER A 216 5 ? 4  
HELX_P HELX_P10 10 SER A 220 ? VAL A 239 ? SER A 217 VAL A 236 1 ? 20 
HELX_P HELX_P11 11 TRP A 245 ? ASP A 247 ? TRP A 242 ASP A 244 5 ? 3  
HELX_P HELX_P12 12 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P13 13 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P14 14 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P15 15 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P16 16 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P17 17 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P18 18 SER B 220 ? VAL B 239 ? SER B 217 VAL B 236 1 ? 20 
HELX_P HELX_P19 19 LEU B 248 ? ASN B 258 ? LEU B 245 ASN B 255 1 ? 11 
HELX_P HELX_P20 20 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 62 A ZN 393 1_555 ? ? ? ? ? ? ?            2.016 ? 
metalc2  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 66 A ZN 393 1_555 ? ? ? ? ? ? ?            2.039 ? 
metalc3  metalc ? ? A CYS 102 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 99 A ZN 393 1_555 ? ? ? ? ? ? ?            2.232 ? 
metalc4  metalc ? ? A CYS 99  SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 96 A ZN 393 1_555 ? ? ? ? ? ? ?            2.247 ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC 16 N3 ? ? C DG  4  D DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC 16 O2 ? ? C DG  4  D DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC 16 N4 ? ? C DG  4  D DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA 15 N1 ? ? C DT  5  D DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA 15 N6 ? ? C DT  5  D DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG 14 N1 ? ? C DC  6  D DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG 14 O6 ? ? C DC  6  D DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG 14 N2 ? ? C DC  6  D DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT 13 N3 ? ? C DA  7  D DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT 13 O4 ? ? C DA  7  D DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D DA 12 N1 ? ? C DT  8  D DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D DA 12 N6 ? ? C DT  8  D DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC 11 N3 ? ? C DG  9  D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC 11 O2 ? ? C DG  9  D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC 11 N4 ? ? C DG  9  D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC 10 N3 ? ? C DG  10 D DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC 10 O2 ? ? C DG  10 D DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC 10 N4 ? ? C DG  10 D DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D DT 9  N3 ? ? C DA  11 D DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D DT 9  O4 ? ? C DA  11 D DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT 8  N3 ? ? C DA  12 D DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT 8  O4 ? ? C DA  12 D DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D DA 7  N1 ? ? C DT  13 D DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D DA 7  N6 ? ? C DT  13 D DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA 6  N1 ? ? C DT  14 D DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA 6  N6 ? ? C DT  14 D DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA 5  N1 ? ? C DT  15 D DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA 5  N6 ? ? C DT  15 D DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DT  16  N3  ? ? ? 1_555 D DA 4  N1 ? ? C DT  16 D DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DT  16  O4  ? ? ? 1_555 D DA 4  N6 ? ? C DT  16 D DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D DC 3  N3 ? ? C DG  17 D DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D DC 3  O2 ? ? C DG  17 D DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D DC 3  N4 ? ? C DG  17 D DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DT  18  N3  ? ? ? 1_555 D DA 2  N1 ? ? C DT  18 D DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DT  18  O4  ? ? ? 1_555 D DA 2  N6 ? ? C DT  18 D DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D DT 1  N3 ? ? C DA  19 D DT 1   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 10.68 
2 HIS 360 A . ? HIS 357 A LEU 361 A ? LEU 358 A 1 -7.18 
3 LEU 361 A . ? LEU 358 A GLY 362 A ? GLY 359 A 1 2.69  
4 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 6.65  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
A 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
A 3 GLY A 47  ? ILE A 51  ? GLY A 44  ILE A 48  
B 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
B 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
C 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
C 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
C 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
C 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
C 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
D 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
D 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
D 3 SER A 344 ? ASN A 351 ? SER A 341 ASN A 348 
D 4 LEU A 325 ? GLU A 328 ? LEU A 322 GLU A 325 
D 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
E 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
E 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
E 3 LYS B 127 ? ILE B 133 ? LYS B 124 ILE B 130 
E 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
E 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 34  ? N PHE A 31  O LYS A 41  ? O LYS A 38  
A 2 3 N VAL A 40  ? N VAL A 37  O ILE A 51  ? O ILE A 48  
B 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
C 1 2 O TYR A 159 ? O TYR A 156 N LEU A 146 ? N LEU A 143 
C 2 3 O VAL A 149 ? O VAL A 146 N PHE A 129 ? N PHE A 126 
C 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
C 4 5 N SER A 187 ? N SER A 184 O GLU A 210 ? O GLU A 207 
D 1 2 O VAL A 367 ? O VAL A 364 N VAL A 355 ? N VAL A 352 
D 2 3 O VAL A 356 ? O VAL A 353 N LEU A 347 ? N LEU A 344 
D 3 4 O SER A 344 ? O SER A 341 N VAL A 326 ? N VAL A 323 
D 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
E 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
E 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
E 3 4 N PHE B 128 ? N PHE B 125 O VAL B 184 ? O VAL B 181 
E 4 5 N ILE B 185 ? N ILE B 182 O GLU B 210 ? O GLU B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 393'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 801' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 802' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 803' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 65  ? HIS A 62  . ? 1_555 ? 
2  AC1 4 HIS A 69  ? HIS A 66  . ? 1_555 ? 
3  AC1 4 CYS A 99  ? CYS A 96  . ? 1_555 ? 
4  AC1 4 CYS A 102 ? CYS A 99  . ? 1_555 ? 
5  AC2 3 SER A 165 ? SER A 162 . ? 1_555 ? 
6  AC2 3 THR A 166 ? THR A 163 . ? 1_555 ? 
7  AC2 3 SER A 167 ? SER A 164 . ? 1_555 ? 
8  AC3 3 SER A 139 ? SER A 136 . ? 1_555 ? 
9  AC3 3 GLN A 140 ? GLN A 137 . ? 1_555 ? 
10 AC3 3 LYS A 244 ? LYS A 241 . ? 1_555 ? 
11 AC4 3 HIS A 341 ? HIS A 338 . ? 1_555 ? 
12 AC4 3 LYS A 342 ? LYS A 339 . ? 1_555 ? 
13 AC4 3 HIS A 360 ? HIS A 357 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3L2Q 
_atom_sites.fract_transf_matrix[1][1]   0.006319 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006319 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008016 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 13  ? -79.025 16.165 -61.661 1.00 155.92 ? 10  ALA A N     1 
ATOM   2    C  CA    . ALA A 1 13  ? -80.477 15.842 -61.508 1.00 158.22 ? 10  ALA A CA    1 
ATOM   3    C  C     . ALA A 1 13  ? -81.289 17.107 -61.236 1.00 157.93 ? 10  ALA A C     1 
ATOM   4    O  O     . ALA A 1 13  ? -82.284 17.373 -61.917 1.00 158.45 ? 10  ALA A O     1 
ATOM   5    C  CB    . ALA A 1 13  ? -80.685 14.816 -60.393 1.00 160.59 ? 10  ALA A CB    1 
ATOM   6    N  N     . GLU A 1 14  ? -80.841 17.881 -60.244 1.00 157.16 ? 11  GLU A N     1 
ATOM   7    C  CA    . GLU A 1 14  ? -81.473 19.153 -59.849 1.00 157.08 ? 11  GLU A CA    1 
ATOM   8    C  C     . GLU A 1 14  ? -81.235 20.290 -60.854 1.00 154.91 ? 11  GLU A C     1 
ATOM   9    O  O     . GLU A 1 14  ? -81.881 21.339 -60.783 1.00 155.13 ? 11  GLU A O     1 
ATOM   10   C  CB    . GLU A 1 14  ? -80.983 19.595 -58.460 1.00 156.96 ? 11  GLU A CB    1 
ATOM   11   C  CG    . GLU A 1 14  ? -79.460 19.799 -58.368 1.00 155.15 ? 11  GLU A CG    1 
ATOM   12   C  CD    . GLU A 1 14  ? -79.058 21.056 -57.603 1.00 154.53 ? 11  GLU A CD    1 
ATOM   13   O  OE1   . GLU A 1 14  ? -79.899 21.975 -57.457 1.00 155.28 ? 11  GLU A OE1   1 
ATOM   14   O  OE2   . GLU A 1 14  ? -77.887 21.128 -57.163 1.00 153.04 ? 11  GLU A OE2   1 
ATOM   15   N  N     . LEU A 1 15  ? -80.298 20.075 -61.775 1.00 152.98 ? 12  LEU A N     1 
ATOM   16   C  CA    . LEU A 1 15  ? -79.941 21.073 -62.782 1.00 151.00 ? 12  LEU A CA    1 
ATOM   17   C  C     . LEU A 1 15  ? -80.750 20.868 -64.070 1.00 151.40 ? 12  LEU A C     1 
ATOM   18   O  O     . LEU A 1 15  ? -80.587 21.610 -65.047 1.00 150.65 ? 12  LEU A O     1 
ATOM   19   C  CB    . LEU A 1 15  ? -78.433 21.036 -63.073 1.00 149.13 ? 12  LEU A CB    1 
ATOM   20   C  CG    . LEU A 1 15  ? -77.442 21.104 -61.906 1.00 148.22 ? 12  LEU A CG    1 
ATOM   21   C  CD1   . LEU A 1 15  ? -77.110 19.707 -61.363 1.00 149.50 ? 12  LEU A CD1   1 
ATOM   22   C  CD2   . LEU A 1 15  ? -76.178 21.799 -62.357 1.00 146.16 ? 12  LEU A CD2   1 
ATOM   23   N  N     . ASP A 1 16  ? -81.617 19.857 -64.065 1.00 152.55 ? 13  ASP A N     1 
ATOM   24   C  CA    . ASP A 1 16  ? -82.543 19.639 -65.167 1.00 153.01 ? 13  ASP A CA    1 
ATOM   25   C  C     . ASP A 1 16  ? -83.502 20.832 -65.260 1.00 153.13 ? 13  ASP A C     1 
ATOM   26   O  O     . ASP A 1 16  ? -83.557 21.522 -66.284 1.00 152.41 ? 13  ASP A O     1 
ATOM   27   C  CB    . ASP A 1 16  ? -83.315 18.324 -64.957 1.00 155.25 ? 13  ASP A CB    1 
ATOM   28   C  CG    . ASP A 1 16  ? -83.831 17.714 -66.266 1.00 155.94 ? 13  ASP A CG    1 
ATOM   29   O  OD1   . ASP A 1 16  ? -84.481 18.424 -67.067 1.00 156.06 ? 13  ASP A OD1   1 
ATOM   30   O  OD2   . ASP A 1 16  ? -83.597 16.506 -66.484 1.00 156.33 ? 13  ASP A OD2   1 
ATOM   31   N  N     . GLN A 1 17  ? -84.217 21.084 -64.162 1.00 154.03 ? 14  GLN A N     1 
ATOM   32   C  CA    . GLN A 1 17  ? -85.270 22.107 -64.088 1.00 154.80 ? 14  GLN A CA    1 
ATOM   33   C  C     . GLN A 1 17  ? -84.791 23.476 -64.565 1.00 153.00 ? 14  GLN A C     1 
ATOM   34   O  O     . GLN A 1 17  ? -85.553 24.244 -65.163 1.00 153.99 ? 14  GLN A O     1 
ATOM   35   C  CB    . GLN A 1 17  ? -85.813 22.226 -62.651 1.00 156.51 ? 14  GLN A CB    1 
ATOM   36   C  CG    . GLN A 1 17  ? -86.419 20.945 -62.062 1.00 158.32 ? 14  GLN A CG    1 
ATOM   37   C  CD    . GLN A 1 17  ? -85.408 20.078 -61.312 1.00 157.19 ? 14  GLN A CD    1 
ATOM   38   O  OE1   . GLN A 1 17  ? -84.226 20.028 -61.656 1.00 154.59 ? 14  GLN A OE1   1 
ATOM   39   N  NE2   . GLN A 1 17  ? -85.882 19.380 -60.287 1.00 159.23 ? 14  GLN A NE2   1 
ATOM   40   N  N     . LEU A 1 18  ? -83.517 23.752 -64.300 1.00 150.39 ? 15  LEU A N     1 
ATOM   41   C  CA    . LEU A 1 18  ? -82.909 25.059 -64.511 1.00 148.69 ? 15  LEU A CA    1 
ATOM   42   C  C     . LEU A 1 18  ? -82.872 25.466 -65.984 1.00 147.93 ? 15  LEU A C     1 
ATOM   43   O  O     . LEU A 1 18  ? -83.311 26.564 -66.345 1.00 148.55 ? 15  LEU A O     1 
ATOM   44   C  CB    . LEU A 1 18  ? -81.496 25.049 -63.917 1.00 146.79 ? 15  LEU A CB    1 
ATOM   45   C  CG    . LEU A 1 18  ? -80.793 26.360 -63.571 1.00 145.80 ? 15  LEU A CG    1 
ATOM   46   C  CD1   . LEU A 1 18  ? -81.513 27.109 -62.449 1.00 146.98 ? 15  LEU A CD1   1 
ATOM   47   C  CD2   . LEU A 1 18  ? -79.352 26.062 -63.192 1.00 143.87 ? 15  LEU A CD2   1 
ATOM   48   N  N     . LEU A 1 19  ? -82.355 24.564 -66.820 1.00 146.61 ? 16  LEU A N     1 
ATOM   49   C  CA    . LEU A 1 19  ? -82.228 24.777 -68.265 1.00 145.93 ? 16  LEU A CA    1 
ATOM   50   C  C     . LEU A 1 19  ? -83.557 25.133 -68.924 1.00 147.37 ? 16  LEU A C     1 
ATOM   51   O  O     . LEU A 1 19  ? -83.597 25.857 -69.920 1.00 147.57 ? 16  LEU A O     1 
ATOM   52   C  CB    . LEU A 1 19  ? -81.643 23.527 -68.928 1.00 145.24 ? 16  LEU A CB    1 
ATOM   53   C  CG    . LEU A 1 19  ? -80.128 23.329 -68.862 1.00 143.33 ? 16  LEU A CG    1 
ATOM   54   C  CD1   . LEU A 1 19  ? -79.777 21.859 -68.682 1.00 142.81 ? 16  LEU A CD1   1 
ATOM   55   C  CD2   . LEU A 1 19  ? -79.468 23.904 -70.103 1.00 142.70 ? 16  LEU A CD2   1 
ATOM   56   N  N     . GLN A 1 20  ? -84.637 24.622 -68.346 1.00 148.40 ? 17  GLN A N     1 
ATOM   57   C  CA    . GLN A 1 20  ? -85.980 24.836 -68.855 1.00 150.03 ? 17  GLN A CA    1 
ATOM   58   C  C     . GLN A 1 20  ? -86.520 26.224 -68.497 1.00 150.85 ? 17  GLN A C     1 
ATOM   59   O  O     . GLN A 1 20  ? -87.495 26.689 -69.093 1.00 152.61 ? 17  GLN A O     1 
ATOM   60   C  CB    . GLN A 1 20  ? -86.894 23.736 -68.323 1.00 151.63 ? 17  GLN A CB    1 
ATOM   61   C  CG    . GLN A 1 20  ? -86.335 22.336 -68.576 1.00 151.20 ? 17  GLN A CG    1 
ATOM   62   C  CD    . GLN A 1 20  ? -86.893 21.282 -67.638 1.00 153.18 ? 17  GLN A CD    1 
ATOM   63   O  OE1   . GLN A 1 20  ? -87.521 21.596 -66.621 1.00 154.78 ? 17  GLN A OE1   1 
ATOM   64   N  NE2   . GLN A 1 20  ? -86.658 20.016 -67.973 1.00 153.04 ? 17  GLN A NE2   1 
ATOM   65   N  N     . GLY A 1 21  ? -85.874 26.882 -67.536 1.00 149.64 ? 18  GLY A N     1 
ATOM   66   C  CA    . GLY A 1 21  ? -86.276 28.214 -67.097 1.00 150.21 ? 18  GLY A CA    1 
ATOM   67   C  C     . GLY A 1 21  ? -87.192 28.201 -65.888 1.00 151.64 ? 18  GLY A C     1 
ATOM   68   O  O     . GLY A 1 21  ? -87.923 29.163 -65.659 1.00 153.64 ? 18  GLY A O     1 
ATOM   69   N  N     . HIS A 1 22  ? -87.165 27.107 -65.127 1.00 150.88 ? 19  HIS A N     1 
ATOM   70   C  CA    . HIS A 1 22  ? -87.883 27.015 -63.854 1.00 152.42 ? 19  HIS A CA    1 
ATOM   71   C  C     . HIS A 1 22  ? -86.963 27.444 -62.709 1.00 151.00 ? 19  HIS A C     1 
ATOM   72   O  O     . HIS A 1 22  ? -85.783 27.082 -62.687 1.00 148.79 ? 19  HIS A O     1 
ATOM   73   C  CB    . HIS A 1 22  ? -88.412 25.595 -63.631 1.00 153.29 ? 19  HIS A CB    1 
ATOM   74   C  CG    . HIS A 1 22  ? -89.576 25.240 -64.505 1.00 155.57 ? 19  HIS A CG    1 
ATOM   75   N  ND1   . HIS A 1 22  ? -90.869 25.163 -64.030 1.00 159.08 ? 19  HIS A ND1   1 
ATOM   76   C  CD2   . HIS A 1 22  ? -89.645 24.955 -65.827 1.00 155.14 ? 19  HIS A CD2   1 
ATOM   77   C  CE1   . HIS A 1 22  ? -91.683 24.839 -65.020 1.00 159.99 ? 19  HIS A CE1   1 
ATOM   78   N  NE2   . HIS A 1 22  ? -90.966 24.710 -66.122 1.00 157.73 ? 19  HIS A NE2   1 
ATOM   79   N  N     . TYR A 1 23  ? -87.500 28.215 -61.766 1.00 152.38 ? 20  TYR A N     1 
ATOM   80   C  CA    . TYR A 1 23  ? -86.700 28.815 -60.687 1.00 151.08 ? 20  TYR A CA    1 
ATOM   81   C  C     . TYR A 1 23  ? -86.224 27.812 -59.639 1.00 149.95 ? 20  TYR A C     1 
ATOM   82   O  O     . TYR A 1 23  ? -86.955 26.887 -59.284 1.00 151.59 ? 20  TYR A O     1 
ATOM   83   C  CB    . TYR A 1 23  ? -87.493 29.933 -59.997 1.00 153.96 ? 20  TYR A CB    1 
ATOM   84   C  CG    . TYR A 1 23  ? -86.788 30.562 -58.814 1.00 153.67 ? 20  TYR A CG    1 
ATOM   85   C  CD1   . TYR A 1 23  ? -85.709 31.429 -59.002 1.00 152.21 ? 20  TYR A CD1   1 
ATOM   86   C  CD2   . TYR A 1 23  ? -87.196 30.289 -57.508 1.00 155.56 ? 20  TYR A CD2   1 
ATOM   87   C  CE1   . TYR A 1 23  ? -85.049 32.010 -57.918 1.00 152.21 ? 20  TYR A CE1   1 
ATOM   88   C  CE2   . TYR A 1 23  ? -86.542 30.867 -56.412 1.00 155.69 ? 20  TYR A CE2   1 
ATOM   89   C  CZ    . TYR A 1 23  ? -85.471 31.728 -56.627 1.00 153.77 ? 20  TYR A CZ    1 
ATOM   90   O  OH    . TYR A 1 23  ? -84.817 32.306 -55.561 1.00 153.30 ? 20  TYR A OH    1 
ATOM   91   N  N     . ILE A 1 24  ? -85.001 28.013 -59.145 1.00 147.17 ? 21  ILE A N     1 
ATOM   92   C  CA    . ILE A 1 24  ? -84.456 27.231 -58.027 1.00 146.02 ? 21  ILE A CA    1 
ATOM   93   C  C     . ILE A 1 24  ? -83.808 28.143 -56.986 1.00 145.08 ? 21  ILE A C     1 
ATOM   94   O  O     . ILE A 1 24  ? -82.970 28.982 -57.328 1.00 143.19 ? 21  ILE A O     1 
ATOM   95   C  CB    . ILE A 1 24  ? -83.443 26.156 -58.502 1.00 143.72 ? 21  ILE A CB    1 
ATOM   96   C  CG1   . ILE A 1 24  ? -84.136 25.144 -59.422 1.00 144.65 ? 21  ILE A CG1   1 
ATOM   97   C  CG2   . ILE A 1 24  ? -82.796 25.445 -57.307 1.00 143.22 ? 21  ILE A CG2   1 
ATOM   98   C  CD1   . ILE A 1 24  ? -83.222 24.095 -60.003 1.00 143.73 ? 21  ILE A CD1   1 
ATOM   99   N  N     . LYS A 1 25  ? -84.204 27.967 -55.722 1.00 146.34 ? 22  LYS A N     1 
ATOM   100  C  CA    . LYS A 1 25  ? -83.686 28.772 -54.608 1.00 145.85 ? 22  LYS A CA    1 
ATOM   101  C  C     . LYS A 1 25  ? -82.164 28.842 -54.650 1.00 142.25 ? 22  LYS A C     1 
ATOM   102  O  O     . LYS A 1 25  ? -81.477 27.828 -54.495 1.00 140.82 ? 22  LYS A O     1 
ATOM   103  C  CB    . LYS A 1 25  ? -84.164 28.235 -53.252 1.00 148.04 ? 22  LYS A CB    1 
ATOM   104  N  N     . GLY A 1 26  ? -81.656 30.048 -54.894 1.00 140.85 ? 23  GLY A N     1 
ATOM   105  C  CA    . GLY A 1 26  ? -80.224 30.283 -54.977 1.00 137.38 ? 23  GLY A CA    1 
ATOM   106  C  C     . GLY A 1 26  ? -79.704 30.514 -56.383 1.00 135.16 ? 23  GLY A C     1 
ATOM   107  O  O     . GLY A 1 26  ? -78.559 30.927 -56.551 1.00 133.35 ? 23  GLY A O     1 
ATOM   108  N  N     . TYR A 1 27  ? -80.529 30.247 -57.393 1.00 135.43 ? 24  TYR A N     1 
ATOM   109  C  CA    . TYR A 1 27  ? -80.117 30.451 -58.784 1.00 133.74 ? 24  TYR A CA    1 
ATOM   110  C  C     . TYR A 1 27  ? -80.795 31.668 -59.401 1.00 135.45 ? 24  TYR A C     1 
ATOM   111  O  O     . TYR A 1 27  ? -81.927 31.569 -59.875 1.00 137.13 ? 24  TYR A O     1 
ATOM   112  C  CB    . TYR A 1 27  ? -80.372 29.199 -59.629 1.00 133.01 ? 24  TYR A CB    1 
ATOM   113  C  CG    . TYR A 1 27  ? -79.501 28.022 -59.251 1.00 130.47 ? 24  TYR A CG    1 
ATOM   114  C  CD1   . TYR A 1 27  ? -78.268 27.809 -59.866 1.00 127.28 ? 24  TYR A CD1   1 
ATOM   115  C  CD2   . TYR A 1 27  ? -79.908 27.121 -58.273 1.00 130.97 ? 24  TYR A CD2   1 
ATOM   116  C  CE1   . TYR A 1 27  ? -77.464 26.727 -59.512 1.00 125.55 ? 24  TYR A CE1   1 
ATOM   117  C  CE2   . TYR A 1 27  ? -79.112 26.035 -57.916 1.00 129.20 ? 24  TYR A CE2   1 
ATOM   118  C  CZ    . TYR A 1 27  ? -77.894 25.844 -58.537 1.00 126.46 ? 24  TYR A CZ    1 
ATOM   119  O  OH    . TYR A 1 27  ? -77.111 24.770 -58.172 1.00 125.34 ? 24  TYR A OH    1 
ATOM   120  N  N     . PRO A 1 28  ? -80.101 32.822 -59.402 1.00 135.24 ? 25  PRO A N     1 
ATOM   121  C  CA    . PRO A 1 28  ? -80.719 34.059 -59.855 1.00 137.54 ? 25  PRO A CA    1 
ATOM   122  C  C     . PRO A 1 28  ? -81.181 33.952 -61.295 1.00 138.34 ? 25  PRO A C     1 
ATOM   123  O  O     . PRO A 1 28  ? -80.377 33.661 -62.179 1.00 136.85 ? 25  PRO A O     1 
ATOM   124  C  CB    . PRO A 1 28  ? -79.585 35.086 -59.737 1.00 136.62 ? 25  PRO A CB    1 
ATOM   125  C  CG    . PRO A 1 28  ? -78.342 34.292 -59.758 1.00 133.69 ? 25  PRO A CG    1 
ATOM   126  C  CD    . PRO A 1 28  ? -78.683 33.019 -59.059 1.00 133.14 ? 25  PRO A CD    1 
ATOM   127  N  N     . LYS A 1 29  ? -82.476 34.163 -61.517 1.00 141.20 ? 26  LYS A N     1 
ATOM   128  C  CA    . LYS A 1 29  ? -83.019 34.276 -62.867 1.00 142.50 ? 26  LYS A CA    1 
ATOM   129  C  C     . LYS A 1 29  ? -82.614 35.643 -63.426 1.00 143.78 ? 26  LYS A C     1 
ATOM   130  O  O     . LYS A 1 29  ? -82.155 36.504 -62.670 1.00 144.32 ? 26  LYS A O     1 
ATOM   131  C  CB    . LYS A 1 29  ? -84.537 34.127 -62.840 1.00 145.08 ? 26  LYS A CB    1 
ATOM   132  C  CG    . LYS A 1 29  ? -85.125 33.479 -64.080 1.00 145.19 ? 26  LYS A CG    1 
ATOM   133  C  CD    . LYS A 1 29  ? -86.629 33.318 -63.924 1.00 147.74 ? 26  LYS A CD    1 
ATOM   134  C  CE    . LYS A 1 29  ? -87.195 32.427 -65.019 1.00 147.65 ? 26  LYS A CE    1 
ATOM   135  N  NZ    . LYS A 1 29  ? -88.627 32.112 -64.744 1.00 150.80 ? 26  LYS A NZ    1 
ATOM   136  N  N     . GLN A 1 30  ? -82.790 35.829 -64.737 1.00 144.68 ? 27  GLN A N     1 
ATOM   137  C  CA    . GLN A 1 30  ? -82.341 37.023 -65.497 1.00 146.12 ? 27  GLN A CA    1 
ATOM   138  C  C     . GLN A 1 30  ? -81.023 36.723 -66.218 1.00 143.96 ? 27  GLN A C     1 
ATOM   139  O  O     . GLN A 1 30  ? -80.647 37.419 -67.165 1.00 144.91 ? 27  GLN A O     1 
ATOM   140  C  CB    . GLN A 1 30  ? -82.261 38.317 -64.648 1.00 147.93 ? 27  GLN A CB    1 
ATOM   141  C  CG    . GLN A 1 30  ? -80.847 38.728 -64.190 1.00 146.37 ? 27  GLN A CG    1 
ATOM   142  C  CD    . GLN A 1 30  ? -80.835 39.824 -63.130 1.00 148.22 ? 27  GLN A CD    1 
ATOM   143  O  OE1   . GLN A 1 30  ? -81.879 40.253 -62.631 1.00 150.90 ? 27  GLN A OE1   1 
ATOM   144  N  NE2   . GLN A 1 30  ? -79.639 40.277 -62.777 1.00 146.85 ? 27  GLN A NE2   1 
ATOM   145  N  N     . TYR A 1 31  ? -80.326 35.692 -65.750 1.00 141.52 ? 28  TYR A N     1 
ATOM   146  C  CA    . TYR A 1 31  ? -79.199 35.127 -66.476 1.00 139.75 ? 28  TYR A CA    1 
ATOM   147  C  C     . TYR A 1 31  ? -79.699 33.867 -67.146 1.00 138.81 ? 28  TYR A C     1 
ATOM   148  O  O     . TYR A 1 31  ? -80.385 33.061 -66.517 1.00 138.55 ? 28  TYR A O     1 
ATOM   149  C  CB    . TYR A 1 31  ? -78.034 34.802 -65.533 1.00 137.93 ? 28  TYR A CB    1 
ATOM   150  C  CG    . TYR A 1 31  ? -77.468 36.008 -64.817 1.00 139.52 ? 28  TYR A CG    1 
ATOM   151  C  CD1   . TYR A 1 31  ? -77.156 37.175 -65.521 1.00 142.23 ? 28  TYR A CD1   1 
ATOM   152  C  CD2   . TYR A 1 31  ? -77.235 35.982 -63.440 1.00 139.62 ? 28  TYR A CD2   1 
ATOM   153  C  CE1   . TYR A 1 31  ? -76.641 38.290 -64.874 1.00 143.89 ? 28  TYR A CE1   1 
ATOM   154  C  CE2   . TYR A 1 31  ? -76.712 37.096 -62.778 1.00 141.19 ? 28  TYR A CE2   1 
ATOM   155  C  CZ    . TYR A 1 31  ? -76.418 38.247 -63.506 1.00 143.21 ? 28  TYR A CZ    1 
ATOM   156  O  OH    . TYR A 1 31  ? -75.903 39.361 -62.879 1.00 144.41 ? 28  TYR A OH    1 
ATOM   157  N  N     . THR A 1 32  ? -79.386 33.706 -68.426 1.00 138.59 ? 29  THR A N     1 
ATOM   158  C  CA    . THR A 1 32  ? -79.847 32.525 -69.152 1.00 137.99 ? 29  THR A CA    1 
ATOM   159  C  C     . THR A 1 32  ? -78.872 31.362 -68.963 1.00 135.44 ? 29  THR A C     1 
ATOM   160  O  O     . THR A 1 32  ? -77.656 31.515 -69.106 1.00 134.43 ? 29  THR A O     1 
ATOM   161  C  CB    . THR A 1 32  ? -80.177 32.800 -70.662 1.00 139.50 ? 29  THR A CB    1 
ATOM   162  O  OG1   . THR A 1 32  ? -79.301 33.809 -71.184 1.00 140.37 ? 29  THR A OG1   1 
ATOM   163  C  CG2   . THR A 1 32  ? -81.642 33.253 -70.840 1.00 141.28 ? 29  THR A CG2   1 
ATOM   164  N  N     . TYR A 1 33  ? -79.435 30.214 -68.604 1.00 134.58 ? 30  TYR A N     1 
ATOM   165  C  CA    . TYR A 1 33  ? -78.677 29.011 -68.318 1.00 132.61 ? 30  TYR A CA    1 
ATOM   166  C  C     . TYR A 1 33  ? -78.790 28.072 -69.509 1.00 132.40 ? 30  TYR A C     1 
ATOM   167  O  O     . TYR A 1 33  ? -79.877 27.607 -69.843 1.00 133.40 ? 30  TYR A O     1 
ATOM   168  C  CB    . TYR A 1 33  ? -79.227 28.330 -67.062 1.00 132.57 ? 30  TYR A CB    1 
ATOM   169  C  CG    . TYR A 1 33  ? -79.219 29.183 -65.807 1.00 132.92 ? 30  TYR A CG    1 
ATOM   170  C  CD1   . TYR A 1 33  ? -78.137 29.151 -64.927 1.00 131.94 ? 30  TYR A CD1   1 
ATOM   171  C  CD2   . TYR A 1 33  ? -80.302 30.004 -65.486 1.00 134.86 ? 30  TYR A CD2   1 
ATOM   172  C  CE1   . TYR A 1 33  ? -78.126 29.926 -63.762 1.00 132.49 ? 30  TYR A CE1   1 
ATOM   173  C  CE2   . TYR A 1 33  ? -80.303 30.784 -64.323 1.00 135.57 ? 30  TYR A CE2   1 
ATOM   174  C  CZ    . TYR A 1 33  ? -79.212 30.741 -63.468 1.00 134.27 ? 30  TYR A CZ    1 
ATOM   175  O  OH    . TYR A 1 33  ? -79.204 31.505 -62.320 1.00 134.81 ? 30  TYR A OH    1 
ATOM   176  N  N     . PHE A 1 34  ? -77.668 27.795 -70.154 1.00 131.24 ? 31  PHE A N     1 
ATOM   177  C  CA    . PHE A 1 34  ? -77.694 27.003 -71.372 1.00 131.29 ? 31  PHE A CA    1 
ATOM   178  C  C     . PHE A 1 34  ? -76.807 25.766 -71.279 1.00 130.11 ? 31  PHE A C     1 
ATOM   179  O  O     . PHE A 1 34  ? -76.255 25.472 -70.216 1.00 129.10 ? 31  PHE A O     1 
ATOM   180  C  CB    . PHE A 1 34  ? -77.337 27.871 -72.585 1.00 132.22 ? 31  PHE A CB    1 
ATOM   181  C  CG    . PHE A 1 34  ? -75.945 28.423 -72.551 1.00 131.56 ? 31  PHE A CG    1 
ATOM   182  C  CD1   . PHE A 1 34  ? -74.928 27.812 -73.275 1.00 131.58 ? 31  PHE A CD1   1 
ATOM   183  C  CD2   . PHE A 1 34  ? -75.649 29.556 -71.802 1.00 131.58 ? 31  PHE A CD2   1 
ATOM   184  C  CE1   . PHE A 1 34  ? -73.632 28.316 -73.252 1.00 131.68 ? 31  PHE A CE1   1 
ATOM   185  C  CE2   . PHE A 1 34  ? -74.359 30.068 -71.768 1.00 131.44 ? 31  PHE A CE2   1 
ATOM   186  C  CZ    . PHE A 1 34  ? -73.346 29.447 -72.497 1.00 131.51 ? 31  PHE A CZ    1 
ATOM   187  N  N     . LEU A 1 35  ? -76.688 25.049 -72.396 1.00 130.34 ? 32  LEU A N     1 
ATOM   188  C  CA    . LEU A 1 35  ? -75.983 23.773 -72.451 1.00 129.70 ? 32  LEU A CA    1 
ATOM   189  C  C     . LEU A 1 35  ? -74.942 23.735 -73.574 1.00 130.02 ? 32  LEU A C     1 
ATOM   190  O  O     . LEU A 1 35  ? -75.208 24.165 -74.696 1.00 131.08 ? 32  LEU A O     1 
ATOM   191  C  CB    . LEU A 1 35  ? -76.997 22.633 -72.618 1.00 130.33 ? 32  LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 35  ? -76.541 21.171 -72.546 1.00 130.41 ? 32  LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 35  ? -76.215 20.757 -71.119 1.00 129.56 ? 32  LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 35  ? -77.615 20.264 -73.121 1.00 131.69 ? 32  LEU A CD2   1 
ATOM   195  N  N     . GLU A 1 36  ? -73.756 23.228 -73.246 1.00 129.40 ? 33  GLU A N     1 
ATOM   196  C  CA    . GLU A 1 36  ? -72.681 22.965 -74.211 1.00 130.03 ? 33  GLU A CA    1 
ATOM   197  C  C     . GLU A 1 36  ? -71.820 21.849 -73.658 1.00 129.50 ? 33  GLU A C     1 
ATOM   198  O  O     . GLU A 1 36  ? -71.612 21.780 -72.446 1.00 128.48 ? 33  GLU A O     1 
ATOM   199  C  CB    . GLU A 1 36  ? -71.805 24.203 -74.429 1.00 130.20 ? 33  GLU A CB    1 
ATOM   200  C  CG    . GLU A 1 36  ? -72.250 25.119 -75.564 1.00 132.03 ? 33  GLU A CG    1 
ATOM   201  C  CD    . GLU A 1 36  ? -71.501 26.452 -75.597 1.00 133.00 ? 33  GLU A CD    1 
ATOM   202  O  OE1   . GLU A 1 36  ? -70.702 26.742 -74.679 1.00 131.74 ? 33  GLU A OE1   1 
ATOM   203  O  OE2   . GLU A 1 36  ? -71.719 27.223 -76.555 1.00 135.13 ? 33  GLU A OE2   1 
ATOM   204  N  N     . ASP A 1 37  ? -71.330 20.977 -74.539 1.00 130.41 ? 34  ASP A N     1 
ATOM   205  C  CA    . ASP A 1 37  ? -70.406 19.891 -74.164 1.00 130.54 ? 34  ASP A CA    1 
ATOM   206  C  C     . ASP A 1 37  ? -70.955 18.971 -73.070 1.00 129.64 ? 34  ASP A C     1 
ATOM   207  O  O     . ASP A 1 37  ? -70.188 18.268 -72.398 1.00 129.73 ? 34  ASP A O     1 
ATOM   208  C  CB    . ASP A 1 37  ? -69.050 20.459 -73.703 1.00 130.43 ? 34  ASP A CB    1 
ATOM   209  C  CG    . ASP A 1 37  ? -68.412 21.385 -74.727 1.00 131.96 ? 34  ASP A CG    1 
ATOM   210  O  OD1   . ASP A 1 37  ? -68.131 20.919 -75.857 1.00 134.35 ? 34  ASP A OD1   1 
ATOM   211  O  OD2   . ASP A 1 37  ? -68.176 22.573 -74.390 1.00 131.55 ? 34  ASP A OD2   1 
ATOM   212  N  N     . GLY A 1 38  ? -72.274 18.985 -72.884 1.00 128.83 ? 35  GLY A N     1 
ATOM   213  C  CA    . GLY A 1 38  ? -72.905 18.255 -71.785 1.00 127.91 ? 35  GLY A CA    1 
ATOM   214  C  C     . GLY A 1 38  ? -72.487 18.761 -70.410 1.00 126.02 ? 35  GLY A C     1 
ATOM   215  O  O     . GLY A 1 38  ? -72.329 17.970 -69.476 1.00 126.24 ? 35  GLY A O     1 
ATOM   216  N  N     . LYS A 1 39  ? -72.274 20.076 -70.307 1.00 124.25 ? 36  LYS A N     1 
ATOM   217  C  CA    . LYS A 1 39  ? -72.082 20.781 -69.028 1.00 122.15 ? 36  LYS A CA    1 
ATOM   218  C  C     . LYS A 1 39  ? -73.066 21.942 -69.002 1.00 120.90 ? 36  LYS A C     1 
ATOM   219  O  O     . LYS A 1 39  ? -73.336 22.554 -70.037 1.00 121.16 ? 36  LYS A O     1 
ATOM   220  C  CB    . LYS A 1 39  ? -70.663 21.355 -68.876 1.00 121.57 ? 36  LYS A CB    1 
ATOM   221  C  CG    . LYS A 1 39  ? -69.499 20.411 -69.143 1.00 122.73 ? 36  LYS A CG    1 
ATOM   222  C  CD    . LYS A 1 39  ? -68.214 21.212 -69.380 1.00 123.02 ? 36  LYS A CD    1 
ATOM   223  C  CE    . LYS A 1 39  ? -67.156 20.404 -70.132 1.00 124.72 ? 36  LYS A CE    1 
ATOM   224  N  NZ    . LYS A 1 39  ? -66.460 19.410 -69.258 1.00 124.95 ? 36  LYS A NZ    1 
ATOM   225  N  N     . VAL A 1 40  ? -73.595 22.249 -67.825 1.00 119.40 ? 37  VAL A N     1 
ATOM   226  C  CA    . VAL A 1 40  ? -74.508 23.374 -67.686 1.00 118.55 ? 37  VAL A CA    1 
ATOM   227  C  C     . VAL A 1 40  ? -73.689 24.650 -67.599 1.00 117.26 ? 37  VAL A C     1 
ATOM   228  O  O     . VAL A 1 40  ? -72.723 24.710 -66.839 1.00 116.65 ? 37  VAL A O     1 
ATOM   229  C  CB    . VAL A 1 40  ? -75.353 23.251 -66.421 1.00 118.73 ? 37  VAL A CB    1 
ATOM   230  C  CG1   . VAL A 1 40  ? -76.640 24.046 -66.572 1.00 119.32 ? 37  VAL A CG1   1 
ATOM   231  C  CG2   . VAL A 1 40  ? -75.646 21.786 -66.121 1.00 119.62 ? 37  VAL A CG2   1 
ATOM   232  N  N     . LYS A 1 41  ? -74.055 25.666 -68.372 1.00 116.89 ? 38  LYS A N     1 
ATOM   233  C  CA    . LYS A 1 41  ? -73.299 26.918 -68.354 1.00 115.81 ? 38  LYS A CA    1 
ATOM   234  C  C     . LYS A 1 41  ? -74.177 28.129 -68.089 1.00 116.38 ? 38  LYS A C     1 
ATOM   235  O  O     . LYS A 1 41  ? -75.393 28.081 -68.282 1.00 117.23 ? 38  LYS A O     1 
ATOM   236  C  CB    . LYS A 1 41  ? -72.505 27.103 -69.649 1.00 116.08 ? 38  LYS A CB    1 
ATOM   237  C  CG    . LYS A 1 41  ? -71.486 26.016 -69.894 1.00 114.77 ? 38  LYS A CG    1 
ATOM   238  C  CD    . LYS A 1 41  ? -70.456 26.416 -70.914 1.00 114.20 ? 38  LYS A CD    1 
ATOM   239  C  CE    . LYS A 1 41  ? -69.670 25.198 -71.350 1.00 114.33 ? 38  LYS A CE    1 
ATOM   240  N  NZ    . LYS A 1 41  ? -68.405 25.576 -72.020 1.00 115.45 ? 38  LYS A NZ    1 
ATOM   241  N  N     . VAL A 1 42  ? -73.550 29.212 -67.640 1.00 116.00 ? 39  VAL A N     1 
ATOM   242  C  CA    . VAL A 1 42  ? -74.263 30.457 -67.391 1.00 116.87 ? 39  VAL A CA    1 
ATOM   243  C  C     . VAL A 1 42  ? -73.479 31.687 -67.843 1.00 117.50 ? 39  VAL A C     1 
ATOM   244  O  O     . VAL A 1 42  ? -72.270 31.792 -67.633 1.00 116.47 ? 39  VAL A O     1 
ATOM   245  C  CB    . VAL A 1 42  ? -74.678 30.590 -65.910 1.00 116.47 ? 39  VAL A CB    1 
ATOM   246  C  CG1   . VAL A 1 42  ? -73.455 30.664 -65.007 1.00 115.34 ? 39  VAL A CG1   1 
ATOM   247  C  CG2   . VAL A 1 42  ? -75.587 31.796 -65.705 1.00 117.81 ? 39  VAL A CG2   1 
ATOM   248  N  N     . SER A 1 43  ? -74.198 32.605 -68.480 1.00 119.44 ? 40  SER A N     1 
ATOM   249  C  CA    . SER A 1 43  ? -73.661 33.899 -68.858 1.00 121.00 ? 40  SER A CA    1 
ATOM   250  C  C     . SER A 1 43  ? -73.786 34.872 -67.686 1.00 121.50 ? 40  SER A C     1 
ATOM   251  O  O     . SER A 1 43  ? -74.896 35.236 -67.281 1.00 122.70 ? 40  SER A O     1 
ATOM   252  C  CB    . SER A 1 43  ? -74.401 34.443 -70.080 1.00 122.99 ? 40  SER A CB    1 
ATOM   253  O  OG    . SER A 1 43  ? -73.965 35.753 -70.384 1.00 124.51 ? 40  SER A OG    1 
ATOM   254  N  N     . ARG A 1 44  ? -72.642 35.281 -67.146 1.00 120.87 ? 41  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 44  ? -72.600 36.210 -66.022 1.00 121.26 ? 41  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 44  ? -71.781 37.447 -66.379 1.00 122.53 ? 41  ARG A C     1 
ATOM   257  O  O     . ARG A 1 44  ? -70.947 37.388 -67.281 1.00 122.73 ? 41  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 44  ? -72.026 35.514 -64.787 1.00 119.36 ? 41  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 44  ? -73.005 34.532 -64.154 1.00 119.53 ? 41  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 44  ? -72.476 33.886 -62.880 1.00 119.06 ? 41  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 44  ? -72.110 34.857 -61.850 1.00 120.77 ? 41  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 44  ? -72.977 35.559 -61.120 1.00 123.25 ? 41  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 44  ? -74.292 35.427 -61.299 1.00 124.26 ? 41  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 44  ? -72.520 36.411 -60.207 1.00 124.46 ? 41  ARG A NH2   1 
ATOM   265  N  N     . PRO A 1 45  ? -72.030 38.581 -65.691 1.00 123.76 ? 42  PRO A N     1 
ATOM   266  C  CA    . PRO A 1 45  ? -71.237 39.782 -65.953 1.00 125.21 ? 42  PRO A CA    1 
ATOM   267  C  C     . PRO A 1 45  ? -69.749 39.472 -66.123 1.00 123.69 ? 42  PRO A C     1 
ATOM   268  O  O     . PRO A 1 45  ? -69.174 39.823 -67.151 1.00 124.95 ? 42  PRO A O     1 
ATOM   269  C  CB    . PRO A 1 45  ? -71.489 40.633 -64.708 1.00 125.93 ? 42  PRO A CB    1 
ATOM   270  C  CG    . PRO A 1 45  ? -72.905 40.311 -64.350 1.00 126.35 ? 42  PRO A CG    1 
ATOM   271  C  CD    . PRO A 1 45  ? -73.111 38.851 -64.722 1.00 124.33 ? 42  PRO A CD    1 
ATOM   272  N  N     . GLU A 1 46  ? -69.156 38.787 -65.143 1.00 121.20 ? 43  GLU A N     1 
ATOM   273  C  CA    . GLU A 1 46  ? -67.731 38.419 -65.171 1.00 119.83 ? 43  GLU A CA    1 
ATOM   274  C  C     . GLU A 1 46  ? -67.326 37.647 -66.445 1.00 119.65 ? 43  GLU A C     1 
ATOM   275  O  O     . GLU A 1 46  ? -66.190 37.761 -66.925 1.00 120.00 ? 43  GLU A O     1 
ATOM   276  C  CB    . GLU A 1 46  ? -67.358 37.628 -63.906 1.00 117.31 ? 43  GLU A CB    1 
ATOM   277  N  N     . GLY A 1 47  ? -68.272 36.882 -66.989 1.00 119.16 ? 44  GLY A N     1 
ATOM   278  C  CA    . GLY A 1 47  ? -68.042 36.020 -68.155 1.00 118.76 ? 44  GLY A CA    1 
ATOM   279  C  C     . GLY A 1 47  ? -68.956 34.799 -68.146 1.00 117.14 ? 44  GLY A C     1 
ATOM   280  O  O     . GLY A 1 47  ? -69.947 34.755 -67.406 1.00 116.93 ? 44  GLY A O     1 
ATOM   281  N  N     . VAL A 1 48  ? -68.624 33.801 -68.960 1.00 116.18 ? 45  VAL A N     1 
ATOM   282  C  CA    . VAL A 1 48  ? -69.418 32.575 -69.032 1.00 114.45 ? 45  VAL A CA    1 
ATOM   283  C  C     . VAL A 1 48  ? -68.749 31.439 -68.251 1.00 112.22 ? 45  VAL A C     1 
ATOM   284  O  O     . VAL A 1 48  ? -67.610 31.054 -68.538 1.00 112.15 ? 45  VAL A O     1 
ATOM   285  C  CB    . VAL A 1 48  ? -69.703 32.183 -70.489 1.00 115.70 ? 45  VAL A CB    1 
ATOM   286  C  CG1   . VAL A 1 48  ? -70.279 30.777 -70.575 1.00 114.85 ? 45  VAL A CG1   1 
ATOM   287  C  CG2   . VAL A 1 48  ? -70.653 33.201 -71.114 1.00 117.49 ? 45  VAL A CG2   1 
ATOM   288  N  N     . LYS A 1 49  ? -69.467 30.924 -67.254 1.00 110.37 ? 46  LYS A N     1 
ATOM   289  C  CA    . LYS A 1 49  ? -68.907 29.961 -66.305 1.00 108.02 ? 46  LYS A CA    1 
ATOM   290  C  C     . LYS A 1 49  ? -69.693 28.663 -66.274 1.00 107.17 ? 46  LYS A C     1 
ATOM   291  O  O     . LYS A 1 49  ? -70.918 28.664 -66.408 1.00 107.73 ? 46  LYS A O     1 
ATOM   292  C  CB    . LYS A 1 49  ? -68.862 30.558 -64.893 1.00 107.22 ? 46  LYS A CB    1 
ATOM   293  C  CG    . LYS A 1 49  ? -68.136 31.897 -64.767 1.00 107.39 ? 46  LYS A CG    1 
ATOM   294  C  CD    . LYS A 1 49  ? -66.680 31.806 -65.217 1.00 106.76 ? 46  LYS A CD    1 
ATOM   295  C  CE    . LYS A 1 49  ? -65.820 32.866 -64.559 1.00 106.43 ? 46  LYS A CE    1 
ATOM   296  N  NZ    . LYS A 1 49  ? -66.249 34.257 -64.843 1.00 108.48 ? 46  LYS A NZ    1 
ATOM   297  N  N     . ILE A 1 50  ? -68.975 27.563 -66.085 1.00 105.84 ? 47  ILE A N     1 
ATOM   298  C  CA    . ILE A 1 50  ? -69.570 26.239 -65.954 1.00 105.26 ? 47  ILE A CA    1 
ATOM   299  C  C     . ILE A 1 50  ? -70.162 26.080 -64.561 1.00 104.64 ? 47  ILE A C     1 
ATOM   300  O  O     . ILE A 1 50  ? -69.509 26.399 -63.575 1.00 104.10 ? 47  ILE A O     1 
ATOM   301  C  CB    . ILE A 1 50  ? -68.501 25.150 -66.181 1.00 105.20 ? 47  ILE A CB    1 
ATOM   302  C  CG1   . ILE A 1 50  ? -67.982 25.207 -67.627 1.00 105.87 ? 47  ILE A CG1   1 
ATOM   303  C  CG2   . ILE A 1 50  ? -69.050 23.769 -65.830 1.00 105.48 ? 47  ILE A CG2   1 
ATOM   304  C  CD1   . ILE A 1 50  ? -66.506 24.899 -67.800 1.00 105.10 ? 47  ILE A CD1   1 
ATOM   305  N  N     . ILE A 1 51  ? -71.398 25.605 -64.473 1.00 105.06 ? 48  ILE A N     1 
ATOM   306  C  CA    . ILE A 1 51  ? -71.993 25.294 -63.174 1.00 105.03 ? 48  ILE A CA    1 
ATOM   307  C  C     . ILE A 1 51  ? -71.929 23.794 -62.942 1.00 105.66 ? 48  ILE A C     1 
ATOM   308  O  O     . ILE A 1 51  ? -72.680 23.044 -63.561 1.00 106.88 ? 48  ILE A O     1 
ATOM   309  C  CB    . ILE A 1 51  ? -73.466 25.705 -63.075 1.00 105.73 ? 48  ILE A CB    1 
ATOM   310  C  CG1   . ILE A 1 51  ? -73.661 27.152 -63.520 1.00 106.07 ? 48  ILE A CG1   1 
ATOM   311  C  CG2   . ILE A 1 51  ? -73.973 25.486 -61.653 1.00 105.71 ? 48  ILE A CG2   1 
ATOM   312  C  CD1   . ILE A 1 51  ? -75.105 27.504 -63.823 1.00 107.84 ? 48  ILE A CD1   1 
ATOM   313  N  N     . PRO A 1 52  ? -71.045 23.346 -62.044 1.00 105.29 ? 49  PRO A N     1 
ATOM   314  C  CA    . PRO A 1 52  ? -70.959 21.917 -61.790 1.00 106.13 ? 49  PRO A CA    1 
ATOM   315  C  C     . PRO A 1 52  ? -72.134 21.422 -60.958 1.00 107.32 ? 49  PRO A C     1 
ATOM   316  O  O     . PRO A 1 52  ? -72.760 22.214 -60.247 1.00 107.02 ? 49  PRO A O     1 
ATOM   317  C  CB    . PRO A 1 52  ? -69.666 21.788 -60.991 1.00 105.56 ? 49  PRO A CB    1 
ATOM   318  C  CG    . PRO A 1 52  ? -69.551 23.070 -60.276 1.00 104.49 ? 49  PRO A CG    1 
ATOM   319  C  CD    . PRO A 1 52  ? -70.120 24.115 -61.195 1.00 104.32 ? 49  PRO A CD    1 
ATOM   320  N  N     . PRO A 1 53  ? -72.435 20.116 -61.046 1.00 109.00 ? 50  PRO A N     1 
ATOM   321  C  CA    . PRO A 1 53  ? -73.473 19.532 -60.194 1.00 110.77 ? 50  PRO A CA    1 
ATOM   322  C  C     . PRO A 1 53  ? -73.045 19.462 -58.726 1.00 110.97 ? 50  PRO A C     1 
ATOM   323  O  O     . PRO A 1 53  ? -71.852 19.389 -58.424 1.00 110.06 ? 50  PRO A O     1 
ATOM   324  C  CB    . PRO A 1 53  ? -73.657 18.111 -60.765 1.00 112.37 ? 50  PRO A CB    1 
ATOM   325  C  CG    . PRO A 1 53  ? -72.935 18.102 -62.085 1.00 111.52 ? 50  PRO A CG    1 
ATOM   326  C  CD    . PRO A 1 53  ? -71.854 19.124 -61.969 1.00 109.59 ? 50  PRO A CD    1 
ATOM   327  N  N     . GLN A 1 54  ? -74.033 19.480 -57.837 1.00 112.33 ? 51  GLN A N     1 
ATOM   328  C  CA    . GLN A 1 54  ? -73.824 19.377 -56.396 1.00 113.03 ? 51  GLN A CA    1 
ATOM   329  C  C     . GLN A 1 54  ? -72.689 18.437 -55.988 1.00 113.12 ? 51  GLN A C     1 
ATOM   330  O  O     . GLN A 1 54  ? -71.779 18.852 -55.270 1.00 112.30 ? 51  GLN A O     1 
ATOM   331  C  CB    . GLN A 1 54  ? -75.119 18.918 -55.722 1.00 115.71 ? 51  GLN A CB    1 
ATOM   332  C  CG    . GLN A 1 54  ? -75.073 18.908 -54.193 1.00 117.13 ? 51  GLN A CG    1 
ATOM   333  C  CD    . GLN A 1 54  ? -75.421 20.253 -53.584 1.00 116.70 ? 51  GLN A CD    1 
ATOM   334  O  OE1   . GLN A 1 54  ? -75.903 21.158 -54.269 1.00 115.88 ? 51  GLN A OE1   1 
ATOM   335  N  NE2   . GLN A 1 54  ? -75.190 20.384 -52.285 1.00 117.85 ? 51  GLN A NE2   1 
ATOM   336  N  N     . SER A 1 55  ? -72.751 17.179 -56.435 1.00 114.28 ? 52  SER A N     1 
ATOM   337  C  CA    . SER A 1 55  ? -71.814 16.141 -55.976 1.00 114.92 ? 52  SER A CA    1 
ATOM   338  C  C     . SER A 1 55  ? -70.360 16.418 -56.370 1.00 113.01 ? 52  SER A C     1 
ATOM   339  O  O     . SER A 1 55  ? -69.427 16.009 -55.675 1.00 113.35 ? 52  SER A O     1 
ATOM   340  C  CB    . SER A 1 55  ? -72.237 14.771 -56.490 1.00 117.15 ? 52  SER A CB    1 
ATOM   341  O  OG    . SER A 1 55  ? -72.039 14.697 -57.887 1.00 116.42 ? 52  SER A OG    1 
ATOM   342  N  N     . ASP A 1 56  ? -70.180 17.118 -57.485 1.00 111.13 ? 53  ASP A N     1 
ATOM   343  C  CA    . ASP A 1 56  ? -68.852 17.463 -57.979 1.00 109.52 ? 53  ASP A CA    1 
ATOM   344  C  C     . ASP A 1 56  ? -68.180 18.621 -57.239 1.00 107.27 ? 53  ASP A C     1 
ATOM   345  O  O     . ASP A 1 56  ? -66.962 18.772 -57.316 1.00 106.60 ? 53  ASP A O     1 
ATOM   346  C  CB    . ASP A 1 56  ? -68.923 17.794 -59.470 1.00 109.14 ? 53  ASP A CB    1 
ATOM   347  C  CG    . ASP A 1 56  ? -69.007 16.557 -60.336 1.00 111.67 ? 53  ASP A CG    1 
ATOM   348  O  OD1   . ASP A 1 56  ? -68.282 15.573 -60.050 1.00 113.99 ? 53  ASP A OD1   1 
ATOM   349  O  OD2   . ASP A 1 56  ? -69.793 16.577 -61.310 1.00 112.39 ? 53  ASP A OD2   1 
ATOM   350  N  N     . ARG A 1 57  ? -68.966 19.427 -56.527 1.00 106.10 ? 54  ARG A N     1 
ATOM   351  C  CA    . ARG A 1 57  ? -68.480 20.695 -55.983 1.00 103.82 ? 54  ARG A CA    1 
ATOM   352  C  C     . ARG A 1 57  ? -67.460 20.580 -54.860 1.00 103.28 ? 54  ARG A C     1 
ATOM   353  O  O     . ARG A 1 57  ? -66.532 21.380 -54.792 1.00 101.92 ? 54  ARG A O     1 
ATOM   354  C  CB    . ARG A 1 57  ? -69.638 21.590 -55.549 1.00 103.92 ? 54  ARG A CB    1 
ATOM   355  C  CG    . ARG A 1 57  ? -70.306 22.326 -56.694 1.00 103.43 ? 54  ARG A CG    1 
ATOM   356  C  CD    . ARG A 1 57  ? -71.592 22.975 -56.238 1.00 104.19 ? 54  ARG A CD    1 
ATOM   357  N  NE    . ARG A 1 57  ? -72.604 22.936 -57.290 1.00 105.15 ? 54  ARG A NE    1 
ATOM   358  C  CZ    . ARG A 1 57  ? -73.820 23.460 -57.180 1.00 106.19 ? 54  ARG A CZ    1 
ATOM   359  N  NH1   . ARG A 1 57  ? -74.187 24.077 -56.062 1.00 107.07 ? 54  ARG A NH1   1 
ATOM   360  N  NH2   . ARG A 1 57  ? -74.669 23.369 -58.192 1.00 106.33 ? 54  ARG A NH2   1 
ATOM   361  N  N     . GLN A 1 58  ? -67.618 19.600 -53.979 1.00 104.37 ? 55  GLN A N     1 
ATOM   362  C  CA    . GLN A 1 58  ? -66.617 19.396 -52.936 1.00 104.13 ? 55  GLN A CA    1 
ATOM   363  C  C     . GLN A 1 58  ? -65.274 19.004 -53.560 1.00 102.98 ? 55  GLN A C     1 
ATOM   364  O  O     . GLN A 1 58  ? -64.229 19.542 -53.180 1.00 101.93 ? 55  GLN A O     1 
ATOM   365  C  CB    . GLN A 1 58  ? -67.072 18.345 -51.922 1.00 106.79 ? 55  GLN A CB    1 
ATOM   366  C  CG    . GLN A 1 58  ? -66.103 18.157 -50.742 1.00 108.77 ? 55  GLN A CG    1 
ATOM   367  C  CD    . GLN A 1 58  ? -66.084 16.724 -50.204 1.00 113.41 ? 55  GLN A CD    1 
ATOM   368  O  OE1   . GLN A 1 58  ? -67.132 16.143 -49.895 1.00 116.22 ? 55  GLN A OE1   1 
ATOM   369  N  NE2   . GLN A 1 58  ? -64.886 16.152 -50.089 1.00 114.10 ? 55  GLN A NE2   1 
ATOM   370  N  N     . LYS A 1 59  ? -65.327 18.073 -54.519 1.00 103.00 ? 56  LYS A N     1 
ATOM   371  C  CA    . LYS A 1 59  ? -64.160 17.631 -55.291 1.00 102.12 ? 56  LYS A CA    1 
ATOM   372  C  C     . LYS A 1 59  ? -63.417 18.817 -55.902 1.00 99.06  ? 56  LYS A C     1 
ATOM   373  O  O     . LYS A 1 59  ? -62.193 18.846 -55.897 1.00 98.90  ? 56  LYS A O     1 
ATOM   374  C  CB    . LYS A 1 59  ? -64.595 16.661 -56.407 1.00 104.01 ? 56  LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 59  ? -63.453 15.964 -57.193 1.00 105.85 ? 56  LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 59  ? -63.644 16.059 -58.737 1.00 108.01 ? 56  LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 59  ? -64.932 15.378 -59.281 1.00 110.35 ? 56  LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 59  ? -64.749 13.974 -59.788 1.00 113.06 ? 56  LYS A NZ    1 
ATOM   379  N  N     . ILE A 1 60  ? -64.168 19.788 -56.421 1.00 96.47  ? 57  ILE A N     1 
ATOM   380  C  CA    . ILE A 1 60  ? -63.598 20.940 -57.116 1.00 93.65  ? 57  ILE A CA    1 
ATOM   381  C  C     . ILE A 1 60  ? -62.858 21.854 -56.148 1.00 92.01  ? 57  ILE A C     1 
ATOM   382  O  O     . ILE A 1 60  ? -61.674 22.154 -56.351 1.00 91.49  ? 57  ILE A O     1 
ATOM   383  C  CB    . ILE A 1 60  ? -64.677 21.706 -57.913 1.00 92.82  ? 57  ILE A CB    1 
ATOM   384  C  CG1   . ILE A 1 60  ? -65.058 20.895 -59.148 1.00 93.48  ? 57  ILE A CG1   1 
ATOM   385  C  CG2   . ILE A 1 60  ? -64.190 23.089 -58.320 1.00 91.16  ? 57  ILE A CG2   1 
ATOM   386  C  CD1   . ILE A 1 60  ? -66.106 21.528 -60.013 1.00 93.02  ? 57  ILE A CD1   1 
ATOM   387  N  N     . VAL A 1 61  ? -63.561 22.266 -55.092 1.00 90.93  ? 58  VAL A N     1 
ATOM   388  C  CA    . VAL A 1 61  ? -63.025 23.160 -54.063 1.00 89.25  ? 58  VAL A CA    1 
ATOM   389  C  C     . VAL A 1 61  ? -61.693 22.619 -53.534 1.00 89.21  ? 58  VAL A C     1 
ATOM   390  O  O     . VAL A 1 61  ? -60.701 23.349 -53.408 1.00 88.23  ? 58  VAL A O     1 
ATOM   391  C  CB    . VAL A 1 61  ? -64.044 23.348 -52.903 1.00 89.36  ? 58  VAL A CB    1 
ATOM   392  C  CG1   . VAL A 1 61  ? -63.512 24.296 -51.849 1.00 88.23  ? 58  VAL A CG1   1 
ATOM   393  C  CG2   . VAL A 1 61  ? -65.360 23.872 -53.428 1.00 89.14  ? 58  VAL A CG2   1 
ATOM   394  N  N     . LEU A 1 62  ? -61.687 21.322 -53.260 1.00 90.21  ? 59  LEU A N     1 
ATOM   395  C  CA    . LEU A 1 62  ? -60.526 20.648 -52.743 1.00 90.68  ? 59  LEU A CA    1 
ATOM   396  C  C     . LEU A 1 62  ? -59.351 20.726 -53.695 1.00 90.24  ? 59  LEU A C     1 
ATOM   397  O  O     . LEU A 1 62  ? -58.248 21.031 -53.260 1.00 90.24  ? 59  LEU A O     1 
ATOM   398  C  CB    . LEU A 1 62  ? -60.860 19.194 -52.443 1.00 93.01  ? 59  LEU A CB    1 
ATOM   399  C  CG    . LEU A 1 62  ? -59.900 18.504 -51.481 1.00 94.88  ? 59  LEU A CG    1 
ATOM   400  C  CD1   . LEU A 1 62  ? -59.983 19.131 -50.076 1.00 94.30  ? 59  LEU A CD1   1 
ATOM   401  C  CD2   . LEU A 1 62  ? -60.181 16.997 -51.459 1.00 98.10  ? 59  LEU A CD2   1 
ATOM   402  N  N     . GLN A 1 63  ? -59.585 20.461 -54.981 1.00 90.24  ? 60  GLN A N     1 
ATOM   403  C  CA    . GLN A 1 63  ? -58.524 20.531 -56.001 1.00 90.29  ? 60  GLN A CA    1 
ATOM   404  C  C     . GLN A 1 63  ? -57.919 21.922 -56.086 1.00 88.17  ? 60  GLN A C     1 
ATOM   405  O  O     . GLN A 1 63  ? -56.695 22.075 -56.103 1.00 88.37  ? 60  GLN A O     1 
ATOM   406  C  CB    . GLN A 1 63  ? -59.049 20.139 -57.376 1.00 91.37  ? 60  GLN A CB    1 
ATOM   407  C  CG    . GLN A 1 63  ? -59.159 18.638 -57.605 1.00 95.11  ? 60  GLN A CG    1 
ATOM   408  C  CD    . GLN A 1 63  ? -60.054 18.282 -58.798 1.00 97.82  ? 60  GLN A CD    1 
ATOM   409  O  OE1   . GLN A 1 63  ? -60.917 19.066 -59.225 1.00 97.45  ? 60  GLN A OE1   1 
ATOM   410  N  NE2   . GLN A 1 63  ? -59.856 17.086 -59.332 1.00 100.61 ? 60  GLN A NE2   1 
ATOM   411  N  N     . ALA A 1 64  ? -58.793 22.927 -56.131 1.00 86.05  ? 61  ALA A N     1 
ATOM   412  C  CA    . ALA A 1 64  ? -58.386 24.327 -56.161 1.00 83.93  ? 61  ALA A CA    1 
ATOM   413  C  C     . ALA A 1 64  ? -57.549 24.655 -54.946 1.00 82.73  ? 61  ALA A C     1 
ATOM   414  O  O     . ALA A 1 64  ? -56.470 25.234 -55.066 1.00 82.65  ? 61  ALA A O     1 
ATOM   415  C  CB    . ALA A 1 64  ? -59.593 25.218 -56.211 1.00 83.05  ? 61  ALA A CB    1 
ATOM   416  N  N     . HIS A 1 65  ? -58.048 24.275 -53.774 1.00 81.76  ? 62  HIS A N     1 
ATOM   417  C  CA    . HIS A 1 65  ? -57.332 24.545 -52.534 1.00 80.59  ? 62  HIS A CA    1 
ATOM   418  C  C     . HIS A 1 65  ? -55.965 23.876 -52.504 1.00 81.22  ? 62  HIS A C     1 
ATOM   419  O  O     . HIS A 1 65  ? -54.971 24.508 -52.140 1.00 81.01  ? 62  HIS A O     1 
ATOM   420  C  CB    . HIS A 1 65  ? -58.154 24.122 -51.319 1.00 80.38  ? 62  HIS A CB    1 
ATOM   421  C  CG    . HIS A 1 65  ? -57.409 24.214 -50.023 1.00 79.07  ? 62  HIS A CG    1 
ATOM   422  N  ND1   . HIS A 1 65  ? -57.220 25.404 -49.356 1.00 76.97  ? 62  HIS A ND1   1 
ATOM   423  C  CD2   . HIS A 1 65  ? -56.817 23.260 -49.267 1.00 79.35  ? 62  HIS A CD2   1 
ATOM   424  C  CE1   . HIS A 1 65  ? -56.543 25.178 -48.244 1.00 77.06  ? 62  HIS A CE1   1 
ATOM   425  N  NE2   . HIS A 1 65  ? -56.286 23.885 -48.166 1.00 78.15  ? 62  HIS A NE2   1 
ATOM   426  N  N     . ASN A 1 66  ? -55.917 22.614 -52.915 1.00 81.96  ? 63  ASN A N     1 
ATOM   427  C  CA    . ASN A 1 66  ? -54.716 21.812 -52.748 1.00 82.91  ? 63  ASN A CA    1 
ATOM   428  C  C     . ASN A 1 66  ? -53.529 22.207 -53.630 1.00 83.12  ? 63  ASN A C     1 
ATOM   429  O  O     . ASN A 1 66  ? -52.423 21.684 -53.449 1.00 84.63  ? 63  ASN A O     1 
ATOM   430  C  CB    . ASN A 1 66  ? -55.039 20.322 -52.911 1.00 84.84  ? 63  ASN A CB    1 
ATOM   431  C  CG    . ASN A 1 66  ? -55.680 19.720 -51.671 1.00 85.00  ? 63  ASN A CG    1 
ATOM   432  O  OD1   . ASN A 1 66  ? -55.524 20.219 -50.555 1.00 84.61  ? 63  ASN A OD1   1 
ATOM   433  N  ND2   . ASN A 1 66  ? -56.399 18.633 -51.865 1.00 86.36  ? 63  ASN A ND2   1 
ATOM   434  N  N     . LEU A 1 67  ? -53.744 23.124 -54.572 1.00 81.94  ? 64  LEU A N     1 
ATOM   435  C  CA    . LEU A 1 67  ? -52.670 23.563 -55.456 1.00 81.98  ? 64  LEU A CA    1 
ATOM   436  C  C     . LEU A 1 67  ? -51.524 24.110 -54.634 1.00 82.06  ? 64  LEU A C     1 
ATOM   437  O  O     . LEU A 1 67  ? -50.388 23.673 -54.799 1.00 83.23  ? 64  LEU A O     1 
ATOM   438  C  CB    . LEU A 1 67  ? -53.170 24.582 -56.470 1.00 80.93  ? 64  LEU A CB    1 
ATOM   439  C  CG    . LEU A 1 67  ? -54.280 24.032 -57.364 1.00 80.22  ? 64  LEU A CG    1 
ATOM   440  C  CD1   . LEU A 1 67  ? -54.739 25.087 -58.332 1.00 79.53  ? 64  LEU A CD1   1 
ATOM   441  C  CD2   . LEU A 1 67  ? -53.863 22.764 -58.104 1.00 81.11  ? 64  LEU A CD2   1 
ATOM   442  N  N     . ALA A 1 68  ? -51.841 25.038 -53.726 1.00 81.05  ? 65  ALA A N     1 
ATOM   443  C  CA    . ALA A 1 68  ? -50.878 25.556 -52.736 1.00 81.06  ? 65  ALA A CA    1 
ATOM   444  C  C     . ALA A 1 68  ? -51.514 25.820 -51.365 1.00 80.03  ? 65  ALA A C     1 
ATOM   445  O  O     . ALA A 1 68  ? -51.017 26.645 -50.597 1.00 79.55  ? 65  ALA A O     1 
ATOM   446  C  CB    . ALA A 1 68  ? -50.188 26.812 -53.253 1.00 80.88  ? 65  ALA A CB    1 
ATOM   447  N  N     . HIS A 1 69  ? -52.607 25.116 -51.063 1.00 80.28  ? 66  HIS A N     1 
ATOM   448  C  CA    . HIS A 1 69  ? -53.280 25.199 -49.756 1.00 79.68  ? 66  HIS A CA    1 
ATOM   449  C  C     . HIS A 1 69  ? -53.623 26.627 -49.367 1.00 78.55  ? 66  HIS A C     1 
ATOM   450  O  O     . HIS A 1 69  ? -53.307 27.079 -48.266 1.00 78.41  ? 66  HIS A O     1 
ATOM   451  C  CB    . HIS A 1 69  ? -52.434 24.540 -48.666 1.00 80.25  ? 66  HIS A CB    1 
ATOM   452  C  CG    . HIS A 1 69  ? -52.484 23.051 -48.693 1.00 81.57  ? 66  HIS A CG    1 
ATOM   453  N  ND1   . HIS A 1 69  ? -53.312 22.322 -47.870 1.00 82.09  ? 66  HIS A ND1   1 
ATOM   454  C  CD2   . HIS A 1 69  ? -51.823 22.153 -49.457 1.00 83.07  ? 66  HIS A CD2   1 
ATOM   455  C  CE1   . HIS A 1 69  ? -53.154 21.036 -48.123 1.00 84.65  ? 66  HIS A CE1   1 
ATOM   456  N  NE2   . HIS A 1 69  ? -52.256 20.907 -49.084 1.00 85.09  ? 66  HIS A NE2   1 
ATOM   457  N  N     . THR A 1 70  ? -54.279 27.332 -50.276 1.00 78.27  ? 67  THR A N     1 
ATOM   458  C  CA    . THR A 1 70  ? -54.527 28.752 -50.098 1.00 77.55  ? 67  THR A CA    1 
ATOM   459  C  C     . THR A 1 70  ? -55.746 29.021 -49.230 1.00 77.17  ? 67  THR A C     1 
ATOM   460  O  O     . THR A 1 70  ? -56.601 28.155 -49.069 1.00 77.69  ? 67  THR A O     1 
ATOM   461  C  CB    . THR A 1 70  ? -54.699 29.428 -51.452 1.00 77.82  ? 67  THR A CB    1 
ATOM   462  O  OG1   . THR A 1 70  ? -55.593 28.647 -52.263 1.00 78.21  ? 67  THR A OG1   1 
ATOM   463  C  CG2   . THR A 1 70  ? -53.342 29.552 -52.141 1.00 78.61  ? 67  THR A CG2   1 
ATOM   464  N  N     . GLY A 1 71  ? -55.824 30.231 -48.684 1.00 76.82  ? 68  GLY A N     1 
ATOM   465  C  CA    . GLY A 1 71  ? -56.958 30.643 -47.850 1.00 77.09  ? 68  GLY A CA    1 
ATOM   466  C  C     . GLY A 1 71  ? -58.257 30.854 -48.610 1.00 77.39  ? 68  GLY A C     1 
ATOM   467  O  O     . GLY A 1 71  ? -58.393 30.403 -49.749 1.00 77.46  ? 68  GLY A O     1 
ATOM   468  N  N     . ARG A 1 72  ? -59.210 31.543 -47.976 1.00 77.67  ? 69  ARG A N     1 
ATOM   469  C  CA    . ARG A 1 72  ? -60.545 31.761 -48.555 1.00 77.98  ? 69  ARG A CA    1 
ATOM   470  C  C     . ARG A 1 72  ? -60.450 32.431 -49.920 1.00 78.33  ? 69  ARG A C     1 
ATOM   471  O  O     . ARG A 1 72  ? -60.748 31.817 -50.944 1.00 78.64  ? 69  ARG A O     1 
ATOM   472  C  CB    . ARG A 1 72  ? -61.411 32.613 -47.620 1.00 78.26  ? 69  ARG A CB    1 
ATOM   473  C  CG    . ARG A 1 72  ? -62.838 32.836 -48.103 1.00 78.28  ? 69  ARG A CG    1 
ATOM   474  C  CD    . ARG A 1 72  ? -63.294 34.268 -47.890 1.00 77.02  ? 69  ARG A CD    1 
ATOM   475  N  NE    . ARG A 1 72  ? -63.001 34.721 -46.536 1.00 77.56  ? 69  ARG A NE    1 
ATOM   476  C  CZ    . ARG A 1 72  ? -62.752 35.985 -46.198 1.00 78.59  ? 69  ARG A CZ    1 
ATOM   477  N  NH1   . ARG A 1 72  ? -62.756 36.948 -47.114 1.00 79.06  ? 69  ARG A NH1   1 
ATOM   478  N  NH2   . ARG A 1 72  ? -62.490 36.292 -44.937 1.00 78.63  ? 69  ARG A NH2   1 
ATOM   479  N  N     . GLU A 1 73  ? -60.000 33.681 -49.922 1.00 78.60  ? 70  GLU A N     1 
ATOM   480  C  CA    . GLU A 1 73  ? -60.004 34.501 -51.114 1.00 79.32  ? 70  GLU A CA    1 
ATOM   481  C  C     . GLU A 1 73  ? -59.125 33.970 -52.236 1.00 79.25  ? 70  GLU A C     1 
ATOM   482  O  O     . GLU A 1 73  ? -59.545 33.951 -53.397 1.00 79.86  ? 70  GLU A O     1 
ATOM   483  C  CB    . GLU A 1 73  ? -59.618 35.921 -50.747 1.00 80.04  ? 70  GLU A CB    1 
ATOM   484  C  CG    . GLU A 1 73  ? -60.751 36.660 -50.077 1.00 81.94  ? 70  GLU A CG    1 
ATOM   485  C  CD    . GLU A 1 73  ? -61.984 36.750 -50.964 1.00 83.70  ? 70  GLU A CD    1 
ATOM   486  O  OE1   . GLU A 1 73  ? -61.833 37.155 -52.143 1.00 84.52  ? 70  GLU A OE1   1 
ATOM   487  O  OE2   . GLU A 1 73  ? -63.095 36.424 -50.477 1.00 84.18  ? 70  GLU A OE2   1 
ATOM   488  N  N     . ALA A 1 74  ? -57.914 33.537 -51.894 1.00 78.70  ? 71  ALA A N     1 
ATOM   489  C  CA    . ALA A 1 74  ? -57.024 32.961 -52.890 1.00 78.90  ? 71  ALA A CA    1 
ATOM   490  C  C     . ALA A 1 74  ? -57.664 31.716 -53.526 1.00 79.08  ? 71  ALA A C     1 
ATOM   491  O  O     . ALA A 1 74  ? -57.745 31.602 -54.755 1.00 79.85  ? 71  ALA A O     1 
ATOM   492  C  CB    . ALA A 1 74  ? -55.683 32.638 -52.281 1.00 78.59  ? 71  ALA A CB    1 
ATOM   493  N  N     . THR A 1 75  ? -58.151 30.802 -52.692 1.00 78.53  ? 72  THR A N     1 
ATOM   494  C  CA    . THR A 1 75  ? -58.787 29.587 -53.192 1.00 78.63  ? 72  THR A CA    1 
ATOM   495  C  C     . THR A 1 75  ? -60.000 29.881 -54.079 1.00 78.55  ? 72  THR A C     1 
ATOM   496  O  O     . THR A 1 75  ? -60.190 29.207 -55.087 1.00 79.22  ? 72  THR A O     1 
ATOM   497  C  CB    . THR A 1 75  ? -59.187 28.637 -52.047 1.00 78.82  ? 72  THR A CB    1 
ATOM   498  O  OG1   . THR A 1 75  ? -58.043 28.380 -51.222 1.00 78.82  ? 72  THR A OG1   1 
ATOM   499  C  CG2   . THR A 1 75  ? -59.721 27.313 -52.595 1.00 79.83  ? 72  THR A CG2   1 
ATOM   500  N  N     . LEU A 1 76  ? -60.809 30.877 -53.721 1.00 77.87  ? 73  LEU A N     1 
ATOM   501  C  CA    . LEU A 1 76  ? -61.961 31.230 -54.552 1.00 77.85  ? 73  LEU A CA    1 
ATOM   502  C  C     . LEU A 1 76  ? -61.551 31.733 -55.944 1.00 78.21  ? 73  LEU A C     1 
ATOM   503  O  O     . LEU A 1 76  ? -62.040 31.237 -56.961 1.00 78.40  ? 73  LEU A O     1 
ATOM   504  C  CB    . LEU A 1 76  ? -62.885 32.229 -53.854 1.00 77.96  ? 73  LEU A CB    1 
ATOM   505  C  CG    . LEU A 1 76  ? -63.989 32.714 -54.794 1.00 78.48  ? 73  LEU A CG    1 
ATOM   506  C  CD1   . LEU A 1 76  ? -65.362 32.517 -54.203 1.00 79.47  ? 73  LEU A CD1   1 
ATOM   507  C  CD2   . LEU A 1 76  ? -63.759 34.152 -55.203 1.00 78.80  ? 73  LEU A CD2   1 
ATOM   508  N  N     . LEU A 1 77  ? -60.645 32.706 -55.985 1.00 78.24  ? 74  LEU A N     1 
ATOM   509  C  CA    . LEU A 1 77  ? -60.189 33.271 -57.258 1.00 79.03  ? 74  LEU A CA    1 
ATOM   510  C  C     . LEU A 1 77  ? -59.780 32.214 -58.287 1.00 79.39  ? 74  LEU A C     1 
ATOM   511  O  O     . LEU A 1 77  ? -60.079 32.364 -59.475 1.00 80.51  ? 74  LEU A O     1 
ATOM   512  C  CB    . LEU A 1 77  ? -59.065 34.283 -57.042 1.00 79.20  ? 74  LEU A CB    1 
ATOM   513  C  CG    . LEU A 1 77  ? -59.520 35.602 -56.434 1.00 79.00  ? 74  LEU A CG    1 
ATOM   514  C  CD1   . LEU A 1 77  ? -58.336 36.426 -56.056 1.00 78.75  ? 74  LEU A CD1   1 
ATOM   515  C  CD2   . LEU A 1 77  ? -60.385 36.356 -57.419 1.00 81.13  ? 74  LEU A CD2   1 
ATOM   516  N  N     . LYS A 1 78  ? -59.117 31.149 -57.836 1.00 78.60  ? 75  LYS A N     1 
ATOM   517  C  CA    . LYS A 1 78  ? -58.844 30.025 -58.717 1.00 78.95  ? 75  LYS A CA    1 
ATOM   518  C  C     . LYS A 1 78  ? -60.146 29.448 -59.258 1.00 78.95  ? 75  LYS A C     1 
ATOM   519  O  O     . LYS A 1 78  ? -60.373 29.463 -60.468 1.00 79.88  ? 75  LYS A O     1 
ATOM   520  C  CB    . LYS A 1 78  ? -58.020 28.943 -58.022 1.00 78.63  ? 75  LYS A CB    1 
ATOM   521  C  CG    . LYS A 1 78  ? -56.518 29.147 -58.108 1.00 79.71  ? 75  LYS A CG    1 
ATOM   522  C  CD    . LYS A 1 78  ? -56.085 29.525 -59.511 1.00 82.08  ? 75  LYS A CD    1 
ATOM   523  C  CE    . LYS A 1 78  ? -54.650 29.127 -59.781 1.00 83.48  ? 75  LYS A CE    1 
ATOM   524  N  NZ    . LYS A 1 78  ? -54.169 29.756 -61.039 1.00 85.89  ? 75  LYS A NZ    1 
ATOM   525  N  N     . ILE A 1 79  ? -61.009 28.982 -58.358 1.00 78.07  ? 76  ILE A N     1 
ATOM   526  C  CA    . ILE A 1 79  ? -62.265 28.336 -58.740 1.00 78.33  ? 76  ILE A CA    1 
ATOM   527  C  C     . ILE A 1 79  ? -63.109 29.195 -59.682 1.00 79.27  ? 76  ILE A C     1 
ATOM   528  O  O     . ILE A 1 79  ? -63.634 28.694 -60.682 1.00 80.00  ? 76  ILE A O     1 
ATOM   529  C  CB    . ILE A 1 79  ? -63.120 27.968 -57.508 1.00 77.68  ? 76  ILE A CB    1 
ATOM   530  C  CG1   . ILE A 1 79  ? -62.337 27.062 -56.566 1.00 77.15  ? 76  ILE A CG1   1 
ATOM   531  C  CG2   . ILE A 1 79  ? -64.395 27.277 -57.930 1.00 77.91  ? 76  ILE A CG2   1 
ATOM   532  C  CD1   . ILE A 1 79  ? -63.029 26.778 -55.263 1.00 76.27  ? 76  ILE A CD1   1 
ATOM   533  N  N     . ALA A 1 80  ? -63.219 30.485 -59.363 1.00 79.53  ? 77  ALA A N     1 
ATOM   534  C  CA    . ALA A 1 80  ? -64.081 31.403 -60.098 1.00 80.58  ? 77  ALA A CA    1 
ATOM   535  C  C     . ALA A 1 80  ? -63.631 31.631 -61.537 1.00 82.00  ? 77  ALA A C     1 
ATOM   536  O  O     . ALA A 1 80  ? -64.392 32.181 -62.343 1.00 83.08  ? 77  ALA A O     1 
ATOM   537  C  CB    . ALA A 1 80  ? -64.189 32.711 -59.375 1.00 80.81  ? 77  ALA A CB    1 
ATOM   538  N  N     . ASN A 1 81  ? -62.406 31.220 -61.866 1.00 82.28  ? 78  ASN A N     1 
ATOM   539  C  CA    . ASN A 1 81  ? -61.985 31.223 -63.259 1.00 83.85  ? 78  ASN A CA    1 
ATOM   540  C  C     . ASN A 1 81  ? -62.912 30.391 -64.118 1.00 84.48  ? 78  ASN A C     1 
ATOM   541  O  O     . ASN A 1 81  ? -63.496 30.903 -65.060 1.00 85.57  ? 78  ASN A O     1 
ATOM   542  C  CB    . ASN A 1 81  ? -60.552 30.754 -63.399 1.00 83.97  ? 78  ASN A CB    1 
ATOM   543  C  CG    . ASN A 1 81  ? -59.589 31.767 -62.894 1.00 84.42  ? 78  ASN A CG    1 
ATOM   544  O  OD1   . ASN A 1 81  ? -59.980 32.872 -62.525 1.00 84.46  ? 78  ASN A OD1   1 
ATOM   545  N  ND2   . ASN A 1 81  ? -58.314 31.413 -62.872 1.00 86.27  ? 78  ASN A ND2   1 
ATOM   546  N  N     . LEU A 1 82  ? -63.080 29.121 -63.763 1.00 84.25  ? 79  LEU A N     1 
ATOM   547  C  CA    . LEU A 1 82  ? -63.901 28.219 -64.554 1.00 85.25  ? 79  LEU A CA    1 
ATOM   548  C  C     . LEU A 1 82  ? -65.350 28.164 -64.089 1.00 85.42  ? 79  LEU A C     1 
ATOM   549  O  O     . LEU A 1 82  ? -66.258 28.172 -64.921 1.00 86.66  ? 79  LEU A O     1 
ATOM   550  C  CB    . LEU A 1 82  ? -63.305 26.806 -64.596 1.00 85.22  ? 79  LEU A CB    1 
ATOM   551  C  CG    . LEU A 1 82  ? -61.804 26.634 -64.860 1.00 85.64  ? 79  LEU A CG    1 
ATOM   552  C  CD1   . LEU A 1 82  ? -61.395 25.184 -64.653 1.00 85.21  ? 79  LEU A CD1   1 
ATOM   553  C  CD2   . LEU A 1 82  ? -61.382 27.133 -66.241 1.00 86.88  ? 79  LEU A CD2   1 
ATOM   554  N  N     . TYR A 1 83  ? -65.583 28.120 -62.782 1.00 84.99  ? 80  TYR A N     1 
ATOM   555  C  CA    . TYR A 1 83  ? -66.917 27.782 -62.297 1.00 85.56  ? 80  TYR A CA    1 
ATOM   556  C  C     . TYR A 1 83  ? -67.705 28.897 -61.647 1.00 86.29  ? 80  TYR A C     1 
ATOM   557  O  O     . TYR A 1 83  ? -67.151 29.917 -61.240 1.00 86.37  ? 80  TYR A O     1 
ATOM   558  C  CB    . TYR A 1 83  ? -66.851 26.598 -61.341 1.00 84.98  ? 80  TYR A CB    1 
ATOM   559  C  CG    . TYR A 1 83  ? -66.092 25.428 -61.903 1.00 85.48  ? 80  TYR A CG    1 
ATOM   560  C  CD1   . TYR A 1 83  ? -66.722 24.477 -62.711 1.00 85.93  ? 80  TYR A CD1   1 
ATOM   561  C  CD2   . TYR A 1 83  ? -64.737 25.271 -61.629 1.00 85.75  ? 80  TYR A CD2   1 
ATOM   562  C  CE1   . TYR A 1 83  ? -66.017 23.400 -63.232 1.00 86.99  ? 80  TYR A CE1   1 
ATOM   563  C  CE2   . TYR A 1 83  ? -64.024 24.205 -62.138 1.00 87.05  ? 80  TYR A CE2   1 
ATOM   564  C  CZ    . TYR A 1 83  ? -64.665 23.272 -62.939 1.00 87.97  ? 80  TYR A CZ    1 
ATOM   565  O  OH    . TYR A 1 83  ? -63.929 22.220 -63.433 1.00 89.71  ? 80  TYR A OH    1 
ATOM   566  N  N     . TRP A 1 84  ? -69.017 28.684 -61.579 1.00 87.66  ? 81  TRP A N     1 
ATOM   567  C  CA    . TRP A 1 84  ? -69.910 29.461 -60.726 1.00 88.81  ? 81  TRP A CA    1 
ATOM   568  C  C     . TRP A 1 84  ? -70.951 28.554 -60.069 1.00 89.50  ? 81  TRP A C     1 
ATOM   569  O  O     . TRP A 1 84  ? -71.401 27.585 -60.681 1.00 90.19  ? 81  TRP A O     1 
ATOM   570  C  CB    . TRP A 1 84  ? -70.625 30.557 -61.512 1.00 89.93  ? 81  TRP A CB    1 
ATOM   571  C  CG    . TRP A 1 84  ? -71.442 31.406 -60.607 1.00 91.93  ? 81  TRP A CG    1 
ATOM   572  C  CD1   . TRP A 1 84  ? -71.029 32.525 -59.945 1.00 93.47  ? 81  TRP A CD1   1 
ATOM   573  C  CD2   . TRP A 1 84  ? -72.804 31.187 -60.216 1.00 93.97  ? 81  TRP A CD2   1 
ATOM   574  N  NE1   . TRP A 1 84  ? -72.055 33.030 -59.175 1.00 94.66  ? 81  TRP A NE1   1 
ATOM   575  C  CE2   . TRP A 1 84  ? -73.153 32.225 -59.318 1.00 95.10  ? 81  TRP A CE2   1 
ATOM   576  C  CE3   . TRP A 1 84  ? -73.765 30.221 -60.540 1.00 94.89  ? 81  TRP A CE3   1 
ATOM   577  C  CZ2   . TRP A 1 84  ? -74.424 32.322 -58.738 1.00 96.86  ? 81  TRP A CZ2   1 
ATOM   578  C  CZ3   . TRP A 1 84  ? -75.031 30.318 -59.960 1.00 96.89  ? 81  TRP A CZ3   1 
ATOM   579  C  CH2   . TRP A 1 84  ? -75.347 31.363 -59.069 1.00 97.57  ? 81  TRP A CH2   1 
ATOM   580  N  N     . TRP A 1 85  ? -71.311 28.863 -58.824 1.00 89.88  ? 82  TRP A N     1 
ATOM   581  C  CA    . TRP A 1 85  ? -72.503 28.303 -58.179 1.00 91.23  ? 82  TRP A CA    1 
ATOM   582  C  C     . TRP A 1 85  ? -72.934 29.154 -56.972 1.00 92.38  ? 82  TRP A C     1 
ATOM   583  O  O     . TRP A 1 85  ? -72.246 30.119 -56.623 1.00 92.10  ? 82  TRP A O     1 
ATOM   584  C  CB    . TRP A 1 85  ? -72.328 26.821 -57.839 1.00 91.02  ? 82  TRP A CB    1 
ATOM   585  C  CG    . TRP A 1 85  ? -71.307 26.506 -56.799 1.00 90.86  ? 82  TRP A CG    1 
ATOM   586  C  CD1   . TRP A 1 85  ? -71.471 26.573 -55.443 1.00 92.18  ? 82  TRP A CD1   1 
ATOM   587  C  CD2   . TRP A 1 85  ? -69.971 26.026 -57.016 1.00 89.76  ? 82  TRP A CD2   1 
ATOM   588  N  NE1   . TRP A 1 85  ? -70.313 26.184 -54.805 1.00 91.10  ? 82  TRP A NE1   1 
ATOM   589  C  CE2   . TRP A 1 85  ? -69.380 25.842 -55.749 1.00 89.24  ? 82  TRP A CE2   1 
ATOM   590  C  CE3   . TRP A 1 85  ? -69.213 25.743 -58.158 1.00 88.84  ? 82  TRP A CE3   1 
ATOM   591  C  CZ2   . TRP A 1 85  ? -68.070 25.386 -55.595 1.00 87.44  ? 82  TRP A CZ2   1 
ATOM   592  C  CZ3   . TRP A 1 85  ? -67.908 25.288 -57.999 1.00 87.08  ? 82  TRP A CZ3   1 
ATOM   593  C  CH2   . TRP A 1 85  ? -67.354 25.116 -56.731 1.00 86.15  ? 82  TRP A CH2   1 
ATOM   594  N  N     . PRO A 1 86  ? -74.087 28.836 -56.350 1.00 94.18  ? 83  PRO A N     1 
ATOM   595  C  CA    . PRO A 1 86  ? -74.565 29.670 -55.246 1.00 95.55  ? 83  PRO A CA    1 
ATOM   596  C  C     . PRO A 1 86  ? -73.740 29.523 -53.974 1.00 95.16  ? 83  PRO A C     1 
ATOM   597  O  O     . PRO A 1 86  ? -73.391 28.405 -53.586 1.00 94.70  ? 83  PRO A O     1 
ATOM   598  C  CB    . PRO A 1 86  ? -75.990 29.153 -55.004 1.00 97.50  ? 83  PRO A CB    1 
ATOM   599  C  CG    . PRO A 1 86  ? -76.347 28.415 -56.223 1.00 97.27  ? 83  PRO A CG    1 
ATOM   600  C  CD    . PRO A 1 86  ? -75.077 27.806 -56.696 1.00 95.32  ? 83  PRO A CD    1 
ATOM   601  N  N     . ASN A 1 87  ? -73.442 30.657 -53.343 1.00 95.71  ? 84  ASN A N     1 
ATOM   602  C  CA    . ASN A 1 87  ? -72.684 30.706 -52.085 1.00 95.86  ? 84  ASN A CA    1 
ATOM   603  C  C     . ASN A 1 87  ? -71.374 29.920 -52.141 1.00 94.31  ? 84  ASN A C     1 
ATOM   604  O  O     . ASN A 1 87  ? -71.140 29.003 -51.345 1.00 94.64  ? 84  ASN A O     1 
ATOM   605  C  CB    . ASN A 1 87  ? -73.543 30.228 -50.915 1.00 97.63  ? 84  ASN A CB    1 
ATOM   606  C  CG    . ASN A 1 87  ? -74.853 30.965 -50.822 1.00 100.02 ? 84  ASN A CG    1 
ATOM   607  O  OD1   . ASN A 1 87  ? -74.883 32.188 -50.708 1.00 100.83 ? 84  ASN A OD1   1 
ATOM   608  N  ND2   . ASN A 1 87  ? -75.948 30.222 -50.861 1.00 102.01 ? 84  ASN A ND2   1 
ATOM   609  N  N     . MET A 1 88  ? -70.531 30.294 -53.095 1.00 93.04  ? 85  MET A N     1 
ATOM   610  C  CA    . MET A 1 88  ? -69.278 29.610 -53.343 1.00 91.45  ? 85  MET A CA    1 
ATOM   611  C  C     . MET A 1 88  ? -68.374 29.599 -52.117 1.00 90.35  ? 85  MET A C     1 
ATOM   612  O  O     . MET A 1 88  ? -67.891 28.549 -51.694 1.00 90.02  ? 85  MET A O     1 
ATOM   613  C  CB    . MET A 1 88  ? -68.576 30.273 -54.514 1.00 91.06  ? 85  MET A CB    1 
ATOM   614  C  CG    . MET A 1 88  ? -69.475 30.434 -55.719 1.00 93.33  ? 85  MET A CG    1 
ATOM   615  S  SD    . MET A 1 88  ? -68.595 30.320 -57.288 1.00 96.64  ? 85  MET A SD    1 
ATOM   616  C  CE    . MET A 1 88  ? -67.588 28.860 -57.028 1.00 94.83  ? 85  MET A CE    1 
ATOM   617  N  N     . ARG A 1 89  ? -68.159 30.767 -51.534 1.00 89.81  ? 86  ARG A N     1 
ATOM   618  C  CA    . ARG A 1 89  ? -67.288 30.859 -50.377 1.00 88.93  ? 86  ARG A CA    1 
ATOM   619  C  C     . ARG A 1 89  ? -67.716 29.917 -49.253 1.00 89.59  ? 86  ARG A C     1 
ATOM   620  O  O     . ARG A 1 89  ? -66.879 29.211 -48.702 1.00 88.93  ? 86  ARG A O     1 
ATOM   621  C  CB    . ARG A 1 89  ? -67.176 32.306 -49.898 1.00 89.24  ? 86  ARG A CB    1 
ATOM   622  C  CG    . ARG A 1 89  ? -66.368 33.174 -50.842 1.00 87.79  ? 86  ARG A CG    1 
ATOM   623  C  CD    . ARG A 1 89  ? -66.505 34.641 -50.523 1.00 87.52  ? 86  ARG A CD    1 
ATOM   624  N  NE    . ARG A 1 89  ? -65.482 35.441 -51.200 1.00 85.83  ? 86  ARG A NE    1 
ATOM   625  C  CZ    . ARG A 1 89  ? -65.607 35.961 -52.419 1.00 85.35  ? 86  ARG A CZ    1 
ATOM   626  N  NH1   . ARG A 1 89  ? -66.711 35.776 -53.129 1.00 86.30  ? 86  ARG A NH1   1 
ATOM   627  N  NH2   . ARG A 1 89  ? -64.618 36.666 -52.931 1.00 84.23  ? 86  ARG A NH2   1 
ATOM   628  N  N     . LYS A 1 90  ? -69.012 29.873 -48.943 1.00 91.13  ? 87  LYS A N     1 
ATOM   629  C  CA    . LYS A 1 90  ? -69.523 28.963 -47.901 1.00 92.57  ? 87  LYS A CA    1 
ATOM   630  C  C     . LYS A 1 90  ? -68.869 27.580 -48.055 1.00 92.12  ? 87  LYS A C     1 
ATOM   631  O  O     . LYS A 1 90  ? -68.342 27.012 -47.094 1.00 92.27  ? 87  LYS A O     1 
ATOM   632  C  CB    . LYS A 1 90  ? -71.066 28.880 -47.906 1.00 94.14  ? 87  LYS A CB    1 
ATOM   633  N  N     . ASP A 1 91  ? -68.865 27.074 -49.284 1.00 91.68  ? 88  ASP A N     1 
ATOM   634  C  CA    . ASP A 1 91  ? -68.247 25.796 -49.585 1.00 91.71  ? 88  ASP A CA    1 
ATOM   635  C  C     . ASP A 1 91  ? -66.736 25.802 -49.394 1.00 90.30  ? 88  ASP A C     1 
ATOM   636  O  O     . ASP A 1 91  ? -66.180 24.824 -48.897 1.00 91.17  ? 88  ASP A O     1 
ATOM   637  C  CB    . ASP A 1 91  ? -68.596 25.357 -51.005 1.00 91.84  ? 88  ASP A CB    1 
ATOM   638  C  CG    . ASP A 1 91  ? -69.953 24.710 -51.088 1.00 94.14  ? 88  ASP A CG    1 
ATOM   639  O  OD1   . ASP A 1 91  ? -70.307 23.989 -50.131 1.00 96.11  ? 88  ASP A OD1   1 
ATOM   640  O  OD2   . ASP A 1 91  ? -70.656 24.915 -52.104 1.00 95.18  ? 88  ASP A OD2   1 
ATOM   641  N  N     . VAL A 1 92  ? -66.073 26.886 -49.795 1.00 88.62  ? 89  VAL A N     1 
ATOM   642  C  CA    . VAL A 1 92  ? -64.622 27.004 -49.628 1.00 86.95  ? 89  VAL A CA    1 
ATOM   643  C  C     . VAL A 1 92  ? -64.287 26.938 -48.146 1.00 87.33  ? 89  VAL A C     1 
ATOM   644  O  O     . VAL A 1 92  ? -63.513 26.080 -47.723 1.00 87.32  ? 89  VAL A O     1 
ATOM   645  C  CB    . VAL A 1 92  ? -64.083 28.301 -50.255 1.00 85.77  ? 89  VAL A CB    1 
ATOM   646  C  CG1   . VAL A 1 92  ? -62.587 28.421 -50.069 1.00 83.96  ? 89  VAL A CG1   1 
ATOM   647  C  CG2   . VAL A 1 92  ? -64.432 28.340 -51.726 1.00 85.67  ? 89  VAL A CG2   1 
ATOM   648  N  N     . VAL A 1 93  ? -64.915 27.816 -47.362 1.00 87.85  ? 90  VAL A N     1 
ATOM   649  C  CA    . VAL A 1 93  ? -64.716 27.871 -45.910 1.00 88.52  ? 90  VAL A CA    1 
ATOM   650  C  C     . VAL A 1 93  ? -64.893 26.505 -45.252 1.00 90.09  ? 90  VAL A C     1 
ATOM   651  O  O     . VAL A 1 93  ? -64.167 26.169 -44.313 1.00 90.13  ? 90  VAL A O     1 
ATOM   652  C  CB    . VAL A 1 93  ? -65.675 28.862 -45.216 1.00 89.33  ? 90  VAL A CB    1 
ATOM   653  C  CG1   . VAL A 1 93  ? -65.167 29.181 -43.826 1.00 89.54  ? 90  VAL A CG1   1 
ATOM   654  C  CG2   . VAL A 1 93  ? -65.817 30.141 -46.014 1.00 88.64  ? 90  VAL A CG2   1 
ATOM   655  N  N     . LYS A 1 94  ? -65.859 25.731 -45.749 1.00 91.66  ? 91  LYS A N     1 
ATOM   656  C  CA    . LYS A 1 94  ? -66.128 24.389 -45.231 1.00 93.85  ? 91  LYS A CA    1 
ATOM   657  C  C     . LYS A 1 94  ? -64.892 23.495 -45.345 1.00 93.74  ? 91  LYS A C     1 
ATOM   658  O  O     . LYS A 1 94  ? -64.588 22.733 -44.420 1.00 95.17  ? 91  LYS A O     1 
ATOM   659  C  CB    . LYS A 1 94  ? -67.341 23.749 -45.924 1.00 95.05  ? 91  LYS A CB    1 
ATOM   660  N  N     . GLN A 1 95  ? -64.176 23.613 -46.462 1.00 92.47  ? 92  GLN A N     1 
ATOM   661  C  CA    . GLN A 1 95  ? -62.968 22.825 -46.693 1.00 92.99  ? 92  GLN A CA    1 
ATOM   662  C  C     . GLN A 1 95  ? -61.798 23.273 -45.844 1.00 92.01  ? 92  GLN A C     1 
ATOM   663  O  O     . GLN A 1 95  ? -61.138 22.444 -45.212 1.00 93.10  ? 92  GLN A O     1 
ATOM   664  C  CB    . GLN A 1 95  ? -62.564 22.863 -48.157 1.00 92.29  ? 92  GLN A CB    1 
ATOM   665  C  CG    . GLN A 1 95  ? -63.515 22.100 -49.035 1.00 96.08  ? 92  GLN A CG    1 
ATOM   666  C  CD    . GLN A 1 95  ? -63.652 20.658 -48.611 1.00 100.81 ? 92  GLN A CD    1 
ATOM   667  O  OE1   . GLN A 1 95  ? -62.650 19.945 -48.476 1.00 102.58 ? 92  GLN A OE1   1 
ATOM   668  N  NE2   . GLN A 1 95  ? -64.895 20.215 -48.392 1.00 102.27 ? 92  GLN A NE2   1 
ATOM   669  N  N     . LEU A 1 96  ? -61.541 24.580 -45.840 1.00 90.15  ? 93  LEU A N     1 
ATOM   670  C  CA    . LEU A 1 96  ? -60.458 25.154 -45.051 1.00 88.94  ? 93  LEU A CA    1 
ATOM   671  C  C     . LEU A 1 96  ? -60.576 24.781 -43.586 1.00 90.10  ? 93  LEU A C     1 
ATOM   672  O  O     . LEU A 1 96  ? -59.570 24.749 -42.882 1.00 90.40  ? 93  LEU A O     1 
ATOM   673  C  CB    . LEU A 1 96  ? -60.447 26.669 -45.164 1.00 87.49  ? 93  LEU A CB    1 
ATOM   674  C  CG    . LEU A 1 96  ? -60.380 27.264 -46.554 1.00 85.98  ? 93  LEU A CG    1 
ATOM   675  C  CD1   . LEU A 1 96  ? -60.998 28.637 -46.485 1.00 86.31  ? 93  LEU A CD1   1 
ATOM   676  C  CD2   . LEU A 1 96  ? -58.953 27.340 -47.024 1.00 85.05  ? 93  LEU A CD2   1 
ATOM   677  N  N     . GLY A 1 97  ? -61.802 24.523 -43.131 1.00 91.18  ? 94  GLY A N     1 
ATOM   678  C  CA    . GLY A 1 97  ? -62.053 24.098 -41.755 1.00 92.45  ? 94  GLY A CA    1 
ATOM   679  C  C     . GLY A 1 97  ? -61.668 22.651 -41.524 1.00 93.82  ? 94  GLY A C     1 
ATOM   680  O  O     . GLY A 1 97  ? -61.318 22.271 -40.412 1.00 94.85  ? 94  GLY A O     1 
ATOM   681  N  N     . ARG A 1 98  ? -61.734 21.851 -42.584 1.00 94.00  ? 95  ARG A N     1 
ATOM   682  C  CA    . ARG A 1 98  ? -61.399 20.430 -42.520 1.00 95.96  ? 95  ARG A CA    1 
ATOM   683  C  C     . ARG A 1 98  ? -60.023 20.105 -43.096 1.00 94.59  ? 95  ARG A C     1 
ATOM   684  O  O     . ARG A 1 98  ? -59.679 18.928 -43.229 1.00 96.19  ? 95  ARG A O     1 
ATOM   685  C  CB    . ARG A 1 98  ? -62.436 19.588 -43.264 1.00 97.76  ? 95  ARG A CB    1 
ATOM   686  C  CG    . ARG A 1 98  ? -63.867 19.804 -42.853 1.00 101.41 ? 95  ARG A CG    1 
ATOM   687  C  CD    . ARG A 1 98  ? -64.748 18.790 -43.575 1.00 108.29 ? 95  ARG A CD    1 
ATOM   688  N  NE    . ARG A 1 98  ? -66.127 19.255 -43.736 1.00 112.20 ? 95  ARG A NE    1 
ATOM   689  C  CZ    . ARG A 1 98  ? -67.082 19.135 -42.813 1.00 116.61 ? 95  ARG A CZ    1 
ATOM   690  N  NH1   . ARG A 1 98  ? -66.828 18.569 -41.632 1.00 119.56 ? 95  ARG A NH1   1 
ATOM   691  N  NH2   . ARG A 1 98  ? -68.301 19.591 -43.070 1.00 118.11 ? 95  ARG A NH2   1 
ATOM   692  N  N     . CYS A 1 99  ? -59.243 21.123 -43.464 1.00 91.71  ? 96  CYS A N     1 
ATOM   693  C  CA    . CYS A 1 99  ? -57.882 20.856 -43.929 1.00 90.71  ? 96  CYS A CA    1 
ATOM   694  C  C     . CYS A 1 99  ? -56.970 20.644 -42.737 1.00 90.97  ? 96  CYS A C     1 
ATOM   695  O  O     . CYS A 1 99  ? -56.517 21.596 -42.109 1.00 89.46  ? 96  CYS A O     1 
ATOM   696  C  CB    . CYS A 1 99  ? -57.324 21.941 -44.860 1.00 88.41  ? 96  CYS A CB    1 
ATOM   697  S  SG    . CYS A 1 99  ? -55.669 21.511 -45.529 1.00 88.66  ? 96  CYS A SG    1 
ATOM   698  N  N     . GLN A 1 100 ? -56.715 19.379 -42.428 1.00 92.87  ? 97  GLN A N     1 
ATOM   699  C  CA    . GLN A 1 100 ? -55.805 19.033 -41.354 1.00 93.68  ? 97  GLN A CA    1 
ATOM   700  C  C     . GLN A 1 100 ? -54.536 19.893 -41.430 1.00 91.05  ? 97  GLN A C     1 
ATOM   701  O  O     . GLN A 1 100 ? -54.121 20.482 -40.434 1.00 90.33  ? 97  GLN A O     1 
ATOM   702  C  CB    . GLN A 1 100 ? -55.481 17.530 -41.394 1.00 97.02  ? 97  GLN A CB    1 
ATOM   703  C  CG    . GLN A 1 100 ? -54.496 17.029 -40.316 1.00 100.02 ? 97  GLN A CG    1 
ATOM   704  C  CD    . GLN A 1 100 ? -55.087 17.012 -38.908 1.00 103.06 ? 97  GLN A CD    1 
ATOM   705  O  OE1   . GLN A 1 100 ? -55.580 18.028 -38.402 1.00 102.21 ? 97  GLN A OE1   1 
ATOM   706  N  NE2   . GLN A 1 100 ? -55.020 15.855 -38.261 1.00 107.07 ? 97  GLN A NE2   1 
ATOM   707  N  N     . GLN A 1 101 ? -53.973 19.999 -42.632 1.00 89.36  ? 98  GLN A N     1 
ATOM   708  C  CA    . GLN A 1 101 ? -52.673 20.624 -42.849 1.00 87.42  ? 98  GLN A CA    1 
ATOM   709  C  C     . GLN A 1 101 ? -52.629 22.133 -42.637 1.00 84.41  ? 98  GLN A C     1 
ATOM   710  O  O     . GLN A 1 101 ? -51.772 22.628 -41.911 1.00 83.63  ? 98  GLN A O     1 
ATOM   711  C  CB    . GLN A 1 101 ? -52.180 20.270 -44.240 1.00 87.93  ? 98  GLN A CB    1 
ATOM   712  C  CG    . GLN A 1 101 ? -51.646 18.861 -44.323 1.00 90.88  ? 98  GLN A CG    1 
ATOM   713  C  CD    . GLN A 1 101 ? -52.347 18.046 -45.376 1.00 91.72  ? 98  GLN A CD    1 
ATOM   714  O  OE1   . GLN A 1 101 ? -53.542 17.781 -45.267 1.00 91.88  ? 98  GLN A OE1   1 
ATOM   715  N  NE2   . GLN A 1 101 ? -51.607 17.631 -46.401 1.00 92.42  ? 98  GLN A NE2   1 
ATOM   716  N  N     . CYS A 1 102 ? -53.539 22.863 -43.274 1.00 82.51  ? 99  CYS A N     1 
ATOM   717  C  CA    . CYS A 1 102 ? -53.632 24.312 -43.071 1.00 80.19  ? 99  CYS A CA    1 
ATOM   718  C  C     . CYS A 1 102 ? -53.871 24.676 -41.610 1.00 79.85  ? 99  CYS A C     1 
ATOM   719  O  O     . CYS A 1 102 ? -53.239 25.588 -41.084 1.00 79.09  ? 99  CYS A O     1 
ATOM   720  C  CB    . CYS A 1 102 ? -54.718 24.916 -43.952 1.00 79.26  ? 99  CYS A CB    1 
ATOM   721  S  SG    . CYS A 1 102 ? -54.251 24.864 -45.667 1.00 79.21  ? 99  CYS A SG    1 
ATOM   722  N  N     . LEU A 1 103 ? -54.765 23.940 -40.958 1.00 80.59  ? 100 LEU A N     1 
ATOM   723  C  CA    . LEU A 1 103 ? -55.064 24.143 -39.544 1.00 80.51  ? 100 LEU A CA    1 
ATOM   724  C  C     . LEU A 1 103 ? -53.821 24.167 -38.639 1.00 80.46  ? 100 LEU A C     1 
ATOM   725  O  O     . LEU A 1 103 ? -53.623 25.114 -37.869 1.00 79.54  ? 100 LEU A O     1 
ATOM   726  C  CB    . LEU A 1 103 ? -56.066 23.093 -39.051 1.00 82.34  ? 100 LEU A CB    1 
ATOM   727  C  CG    . LEU A 1 103 ? -57.489 23.133 -39.603 1.00 81.50  ? 100 LEU A CG    1 
ATOM   728  C  CD1   . LEU A 1 103 ? -58.389 22.366 -38.670 1.00 83.37  ? 100 LEU A CD1   1 
ATOM   729  C  CD2   . LEU A 1 103 ? -57.997 24.555 -39.787 1.00 79.22  ? 100 LEU A CD2   1 
ATOM   730  N  N     . ILE A 1 104 ? -52.984 23.141 -38.747 1.00 81.39  ? 101 ILE A N     1 
ATOM   731  C  CA    . ILE A 1 104 ? -51.823 23.018 -37.876 1.00 81.78  ? 101 ILE A CA    1 
ATOM   732  C  C     . ILE A 1 104 ? -50.598 23.801 -38.347 1.00 80.74  ? 101 ILE A C     1 
ATOM   733  O  O     . ILE A 1 104 ? -49.593 23.845 -37.624 1.00 81.15  ? 101 ILE A O     1 
ATOM   734  C  CB    . ILE A 1 104 ? -51.424 21.542 -37.634 1.00 84.04  ? 101 ILE A CB    1 
ATOM   735  C  CG1   . ILE A 1 104 ? -51.127 20.839 -38.958 1.00 83.88  ? 101 ILE A CG1   1 
ATOM   736  C  CG2   . ILE A 1 104 ? -52.506 20.824 -36.860 1.00 85.77  ? 101 ILE A CG2   1 
ATOM   737  C  CD1   . ILE A 1 104 ? -50.493 19.498 -38.815 1.00 85.61  ? 101 ILE A CD1   1 
ATOM   738  N  N     . THR A 1 105 ? -50.670 24.420 -39.533 1.00 79.66  ? 102 THR A N     1 
ATOM   739  C  CA    . THR A 1 105 ? -49.498 25.130 -40.081 1.00 79.06  ? 102 THR A CA    1 
ATOM   740  C  C     . THR A 1 105 ? -49.627 26.644 -40.168 1.00 77.39  ? 102 THR A C     1 
ATOM   741  O  O     . THR A 1 105 ? -48.700 27.344 -39.779 1.00 76.86  ? 102 THR A O     1 
ATOM   742  C  CB    . THR A 1 105 ? -49.058 24.599 -41.453 1.00 79.63  ? 102 THR A CB    1 
ATOM   743  O  OG1   . THR A 1 105 ? -49.198 23.180 -41.490 1.00 81.99  ? 102 THR A OG1   1 
ATOM   744  C  CG2   . THR A 1 105 ? -47.607 24.940 -41.701 1.00 79.66  ? 102 THR A CG2   1 
ATOM   745  N  N     . ASN A 1 106 ? -50.749 27.134 -40.694 1.00 77.02  ? 103 ASN A N     1 
ATOM   746  C  CA    . ASN A 1 106 ? -51.026 28.575 -40.786 1.00 76.62  ? 103 ASN A CA    1 
ATOM   747  C  C     . ASN A 1 106 ? -50.869 29.306 -39.453 1.00 76.59  ? 103 ASN A C     1 
ATOM   748  O  O     . ASN A 1 106 ? -51.172 28.749 -38.407 1.00 77.66  ? 103 ASN A O     1 
ATOM   749  C  CB    . ASN A 1 106 ? -52.457 28.812 -41.284 1.00 76.70  ? 103 ASN A CB    1 
ATOM   750  C  CG    . ASN A 1 106 ? -52.650 28.467 -42.756 1.00 78.09  ? 103 ASN A CG    1 
ATOM   751  O  OD1   . ASN A 1 106 ? -51.719 28.043 -43.450 1.00 80.50  ? 103 ASN A OD1   1 
ATOM   752  N  ND2   . ASN A 1 106 ? -53.876 28.657 -43.241 1.00 78.76  ? 103 ASN A ND2   1 
ATOM   753  N  N     . ALA A 1 107 ? -50.425 30.559 -39.478 1.00 76.13  ? 104 ALA A N     1 
ATOM   754  C  CA    . ALA A 1 107 ? -50.301 31.323 -38.231 1.00 76.18  ? 104 ALA A CA    1 
ATOM   755  C  C     . ALA A 1 107 ? -51.629 31.953 -37.839 1.00 76.20  ? 104 ALA A C     1 
ATOM   756  O  O     . ALA A 1 107 ? -52.588 31.901 -38.595 1.00 75.78  ? 104 ALA A O     1 
ATOM   757  C  CB    . ALA A 1 107 ? -49.212 32.386 -38.341 1.00 75.81  ? 104 ALA A CB    1 
ATOM   758  N  N     . SER A 1 108 ? -51.677 32.535 -36.644 1.00 76.75  ? 105 SER A N     1 
ATOM   759  C  CA    . SER A 1 108 ? -52.853 33.269 -36.202 1.00 77.55  ? 105 SER A CA    1 
ATOM   760  C  C     . SER A 1 108 ? -52.902 34.687 -36.771 1.00 77.43  ? 105 SER A C     1 
ATOM   761  O  O     . SER A 1 108 ? -51.875 35.268 -37.139 1.00 77.53  ? 105 SER A O     1 
ATOM   762  C  CB    . SER A 1 108 ? -52.891 33.343 -34.683 1.00 78.23  ? 105 SER A CB    1 
ATOM   763  O  OG    . SER A 1 108 ? -54.154 33.823 -34.255 1.00 79.41  ? 105 SER A OG    1 
ATOM   764  N  N     . ASN A 1 109 ? -54.101 35.247 -36.842 1.00 77.96  ? 106 ASN A N     1 
ATOM   765  C  CA    . ASN A 1 109 ? -54.240 36.659 -37.163 1.00 77.90  ? 106 ASN A CA    1 
ATOM   766  C  C     . ASN A 1 109 ? -55.104 37.376 -36.119 1.00 79.25  ? 106 ASN A C     1 
ATOM   767  O  O     . ASN A 1 109 ? -55.655 38.447 -36.387 1.00 80.20  ? 106 ASN A O     1 
ATOM   768  C  CB    . ASN A 1 109 ? -54.805 36.824 -38.570 1.00 77.46  ? 106 ASN A CB    1 
ATOM   769  C  CG    . ASN A 1 109 ? -56.199 36.258 -38.701 1.00 77.89  ? 106 ASN A CG    1 
ATOM   770  O  OD1   . ASN A 1 109 ? -56.586 35.344 -37.964 1.00 77.80  ? 106 ASN A OD1   1 
ATOM   771  N  ND2   . ASN A 1 109 ? -56.971 36.805 -39.633 1.00 78.14  ? 106 ASN A ND2   1 
ATOM   772  N  N     . LYS A 1 110 ? -55.224 36.755 -34.940 1.00 79.86  ? 107 LYS A N     1 
ATOM   773  C  CA    . LYS A 1 110 ? -55.955 37.293 -33.777 1.00 81.34  ? 107 LYS A CA    1 
ATOM   774  C  C     . LYS A 1 110 ? -54.986 37.296 -32.596 1.00 80.69  ? 107 LYS A C     1 
ATOM   775  O  O     . LYS A 1 110 ? -54.322 36.293 -32.340 1.00 80.21  ? 107 LYS A O     1 
ATOM   776  C  CB    . LYS A 1 110 ? -57.168 36.416 -33.412 1.00 82.98  ? 107 LYS A CB    1 
ATOM   777  C  CG    . LYS A 1 110 ? -57.824 35.656 -34.572 1.00 83.97  ? 107 LYS A CG    1 
ATOM   778  C  CD    . LYS A 1 110 ? -59.232 36.139 -34.842 1.00 87.24  ? 107 LYS A CD    1 
ATOM   779  C  CE    . LYS A 1 110 ? -59.696 35.681 -36.211 1.00 87.79  ? 107 LYS A CE    1 
ATOM   780  N  NZ    . LYS A 1 110 ? -59.323 36.700 -37.243 1.00 89.01  ? 107 LYS A NZ    1 
ATOM   781  N  N     . ALA A 1 111 ? -54.890 38.411 -31.882 1.00 80.69  ? 108 ALA A N     1 
ATOM   782  C  CA    . ALA A 1 111 ? -53.953 38.501 -30.774 1.00 80.05  ? 108 ALA A CA    1 
ATOM   783  C  C     . ALA A 1 111 ? -54.673 38.213 -29.478 1.00 81.50  ? 108 ALA A C     1 
ATOM   784  O  O     . ALA A 1 111 ? -55.873 38.425 -29.383 1.00 82.75  ? 108 ALA A O     1 
ATOM   785  C  CB    . ALA A 1 111 ? -53.319 39.856 -30.734 1.00 79.99  ? 108 ALA A CB    1 
ATOM   786  N  N     . SER A 1 112 ? -53.944 37.714 -28.484 1.00 81.42  ? 109 SER A N     1 
ATOM   787  C  CA    . SER A 1 112 ? -54.541 37.433 -27.173 1.00 83.33  ? 109 SER A CA    1 
ATOM   788  C  C     . SER A 1 112 ? -54.976 38.715 -26.473 1.00 84.63  ? 109 SER A C     1 
ATOM   789  O  O     . SER A 1 112 ? -54.393 39.776 -26.691 1.00 84.22  ? 109 SER A O     1 
ATOM   790  C  CB    . SER A 1 112 ? -53.599 36.618 -26.280 1.00 83.04  ? 109 SER A CB    1 
ATOM   791  O  OG    . SER A 1 112 ? -52.260 36.766 -26.695 1.00 81.79  ? 109 SER A OG    1 
ATOM   792  N  N     . GLY A 1 113 ? -56.014 38.612 -25.649 1.00 86.68  ? 110 GLY A N     1 
ATOM   793  C  CA    . GLY A 1 113 ? -56.545 39.753 -24.923 1.00 88.12  ? 110 GLY A CA    1 
ATOM   794  C  C     . GLY A 1 113 ? -55.505 40.353 -24.007 1.00 87.68  ? 110 GLY A C     1 
ATOM   795  O  O     . GLY A 1 113 ? -54.443 39.760 -23.802 1.00 85.89  ? 110 GLY A O     1 
ATOM   796  N  N     . PRO A 1 114 ? -55.818 41.520 -23.427 1.00 89.45  ? 111 PRO A N     1 
ATOM   797  C  CA    . PRO A 1 114 ? -54.887 42.324 -22.642 1.00 89.69  ? 111 PRO A CA    1 
ATOM   798  C  C     . PRO A 1 114 ? -54.391 41.566 -21.423 1.00 90.40  ? 111 PRO A C     1 
ATOM   799  O  O     . PRO A 1 114 ? -55.161 40.826 -20.821 1.00 92.35  ? 111 PRO A O     1 
ATOM   800  C  CB    . PRO A 1 114 ? -55.741 43.517 -22.212 1.00 92.15  ? 111 PRO A CB    1 
ATOM   801  C  CG    . PRO A 1 114 ? -57.100 43.001 -22.182 1.00 94.26  ? 111 PRO A CG    1 
ATOM   802  C  CD    . PRO A 1 114 ? -57.197 42.014 -23.302 1.00 92.17  ? 111 PRO A CD    1 
ATOM   803  N  N     . ILE A 1 115 ? -53.122 41.749 -21.066 1.00 82.56  ? 112 ILE A N     1 
ATOM   804  C  CA    . ILE A 1 115 ? -52.523 41.006 -19.947 1.00 81.84  ? 112 ILE A CA    1 
ATOM   805  C  C     . ILE A 1 115 ? -53.113 41.389 -18.589 1.00 82.42  ? 112 ILE A C     1 
ATOM   806  O  O     . ILE A 1 115 ? -53.674 42.473 -18.433 1.00 82.91  ? 112 ILE A O     1 
ATOM   807  C  CB    . ILE A 1 115 ? -50.980 41.146 -19.910 1.00 80.00  ? 112 ILE A CB    1 
ATOM   808  C  CG1   . ILE A 1 115 ? -50.568 42.535 -19.440 1.00 78.59  ? 112 ILE A CG1   1 
ATOM   809  C  CG2   . ILE A 1 115 ? -50.375 40.859 -21.281 1.00 80.41  ? 112 ILE A CG2   1 
ATOM   810  C  CD1   . ILE A 1 115 ? -49.182 42.568 -18.914 1.00 76.09  ? 112 ILE A CD1   1 
ATOM   811  N  N     . LEU A 1 116 ? -52.985 40.490 -17.615 1.00 82.79  ? 113 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 116 ? -53.394 40.772 -16.230 1.00 83.55  ? 113 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 116 ? -52.242 41.311 -15.390 1.00 82.58  ? 113 LEU A C     1 
ATOM   814  O  O     . LEU A 1 116 ? -51.089 40.906 -15.562 1.00 81.31  ? 113 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 116 ? -53.935 39.516 -15.541 1.00 84.12  ? 113 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 116 ? -55.116 38.752 -16.119 1.00 85.20  ? 113 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 116 ? -55.141 37.398 -15.451 1.00 85.39  ? 113 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 116 ? -56.441 39.500 -15.948 1.00 85.59  ? 113 LEU A CD2   1 
ATOM   819  N  N     . ARG A 1 117 ? -52.554 42.205 -14.462 1.00 83.57  ? 114 ARG A N     1 
ATOM   820  C  CA    . ARG A 1 117 ? -51.530 42.676 -13.540 1.00 83.23  ? 114 ARG A CA    1 
ATOM   821  C  C     . ARG A 1 117 ? -51.838 42.200 -12.125 1.00 84.44  ? 114 ARG A C     1 
ATOM   822  O  O     . ARG A 1 117 ? -52.475 42.925 -11.364 1.00 85.06  ? 114 ARG A O     1 
ATOM   823  C  CB    . ARG A 1 117 ? -51.390 44.199 -13.607 1.00 82.86  ? 114 ARG A CB    1 
ATOM   824  C  CG    . ARG A 1 117 ? -51.136 44.765 -15.011 1.00 81.85  ? 114 ARG A CG    1 
ATOM   825  C  CD    . ARG A 1 117 ? -49.969 44.089 -15.727 1.00 79.36  ? 114 ARG A CD    1 
ATOM   826  N  NE    . ARG A 1 117 ? -48.678 44.269 -15.064 1.00 77.79  ? 114 ARG A NE    1 
ATOM   827  C  CZ    . ARG A 1 117 ? -47.981 45.403 -15.076 1.00 77.36  ? 114 ARG A CZ    1 
ATOM   828  N  NH1   . ARG A 1 117 ? -48.460 46.471 -15.700 1.00 78.28  ? 114 ARG A NH1   1 
ATOM   829  N  NH2   . ARG A 1 117 ? -46.808 45.477 -14.455 1.00 75.93  ? 114 ARG A NH2   1 
ATOM   830  N  N     . PRO A 1 118 ? -51.388 40.970 -11.774 1.00 85.02  ? 115 PRO A N     1 
ATOM   831  C  CA    . PRO A 1 118 ? -51.738 40.326 -10.508 1.00 86.63  ? 115 PRO A CA    1 
ATOM   832  C  C     . PRO A 1 118 ? -51.315 41.194 -9.336  1.00 87.33  ? 115 PRO A C     1 
ATOM   833  O  O     . PRO A 1 118 ? -50.202 41.745 -9.364  1.00 86.63  ? 115 PRO A O     1 
ATOM   834  C  CB    . PRO A 1 118 ? -50.909 39.033 -10.514 1.00 85.80  ? 115 PRO A CB    1 
ATOM   835  C  CG    . PRO A 1 118 ? -50.403 38.872 -11.862 1.00 84.49  ? 115 PRO A CG    1 
ATOM   836  C  CD    . PRO A 1 118 ? -50.349 40.214 -12.490 1.00 84.11  ? 115 PRO A CD    1 
ATOM   837  N  N     . ASP A 1 119 ? -52.185 41.315 -8.331  1.00 89.36  ? 116 ASP A N     1 
ATOM   838  C  CA    . ASP A 1 119 ? -51.927 42.180 -7.176  1.00 90.32  ? 116 ASP A CA    1 
ATOM   839  C  C     . ASP A 1 119 ? -50.598 41.854 -6.524  1.00 89.23  ? 116 ASP A C     1 
ATOM   840  O  O     . ASP A 1 119 ? -50.254 40.682 -6.359  1.00 89.04  ? 116 ASP A O     1 
ATOM   841  C  CB    . ASP A 1 119 ? -53.040 42.050 -6.142  1.00 92.59  ? 116 ASP A CB    1 
ATOM   842  C  CG    . ASP A 1 119 ? -54.416 42.178 -6.756  1.00 96.31  ? 116 ASP A CG    1 
ATOM   843  O  OD1   . ASP A 1 119 ? -54.841 43.327 -7.025  1.00 99.11  ? 116 ASP A OD1   1 
ATOM   844  O  OD2   . ASP A 1 119 ? -55.066 41.126 -6.977  1.00 99.71  ? 116 ASP A OD2   1 
ATOM   845  N  N     . ARG A 1 120 ? -49.848 42.897 -6.175  1.00 88.81  ? 117 ARG A N     1 
ATOM   846  C  CA    . ARG A 1 120 ? -48.584 42.736 -5.470  1.00 88.25  ? 117 ARG A CA    1 
ATOM   847  C  C     . ARG A 1 120 ? -48.856 41.966 -4.192  1.00 89.23  ? 117 ARG A C     1 
ATOM   848  O  O     . ARG A 1 120 ? -49.832 42.269 -3.505  1.00 90.73  ? 117 ARG A O     1 
ATOM   849  C  CB    . ARG A 1 120 ? -47.981 44.095 -5.124  1.00 87.72  ? 117 ARG A CB    1 
ATOM   850  C  CG    . ARG A 1 120 ? -46.561 44.015 -4.551  1.00 87.52  ? 117 ARG A CG    1 
ATOM   851  C  CD    . ARG A 1 120 ? -46.052 45.379 -4.058  1.00 88.12  ? 117 ARG A CD    1 
ATOM   852  N  NE    . ARG A 1 120 ? -46.081 46.381 -5.120  1.00 87.76  ? 117 ARG A NE    1 
ATOM   853  C  CZ    . ARG A 1 120 ? -45.097 46.580 -5.993  1.00 86.50  ? 117 ARG A CZ    1 
ATOM   854  N  NH1   . ARG A 1 120 ? -43.981 45.861 -5.936  1.00 85.09  ? 117 ARG A NH1   1 
ATOM   855  N  NH2   . ARG A 1 120 ? -45.235 47.505 -6.928  1.00 86.73  ? 117 ARG A NH2   1 
ATOM   856  N  N     . PRO A 1 121 ? -48.019 40.954 -3.882  1.00 88.82  ? 118 PRO A N     1 
ATOM   857  C  CA    . PRO A 1 121 ? -48.101 40.221 -2.625  1.00 89.97  ? 118 PRO A CA    1 
ATOM   858  C  C     . PRO A 1 121 ? -48.114 41.189 -1.455  1.00 90.80  ? 118 PRO A C     1 
ATOM   859  O  O     . PRO A 1 121 ? -47.468 42.243 -1.531  1.00 90.33  ? 118 PRO A O     1 
ATOM   860  C  CB    . PRO A 1 121 ? -46.810 39.419 -2.627  1.00 88.95  ? 118 PRO A CB    1 
ATOM   861  C  CG    . PRO A 1 121 ? -46.613 39.110 -4.046  1.00 88.06  ? 118 PRO A CG    1 
ATOM   862  C  CD    . PRO A 1 121 ? -47.010 40.362 -4.773  1.00 87.65  ? 118 PRO A CD    1 
ATOM   863  N  N     . GLN A 1 122 ? -48.846 40.851 -0.394  1.00 92.30  ? 119 GLN A N     1 
ATOM   864  C  CA    . GLN A 1 122 ? -49.045 41.796 0.705   1.00 93.08  ? 119 GLN A CA    1 
ATOM   865  C  C     . GLN A 1 122 ? -47.821 41.987 1.589   1.00 91.98  ? 119 GLN A C     1 
ATOM   866  O  O     . GLN A 1 122 ? -47.363 43.105 1.787   1.00 91.56  ? 119 GLN A O     1 
ATOM   867  C  CB    . GLN A 1 122 ? -50.256 41.407 1.532   1.00 95.35  ? 119 GLN A CB    1 
ATOM   868  C  CG    . GLN A 1 122 ? -51.529 41.391 0.697   1.00 98.49  ? 119 GLN A CG    1 
ATOM   869  C  CD    . GLN A 1 122 ? -52.761 41.801 1.482   1.00 102.71 ? 119 GLN A CD    1 
ATOM   870  O  OE1   . GLN A 1 122 ? -52.738 41.867 2.719   1.00 104.54 ? 119 GLN A OE1   1 
ATOM   871  N  NE2   . GLN A 1 122 ? -53.847 42.085 0.764   1.00 103.75 ? 119 GLN A NE2   1 
ATOM   872  N  N     . LYS A 1 123 ? -47.279 40.887 2.091   1.00 91.60  ? 120 LYS A N     1 
ATOM   873  C  CA    . LYS A 1 123 ? -46.162 40.937 3.017   1.00 90.83  ? 120 LYS A CA    1 
ATOM   874  C  C     . LYS A 1 123 ? -44.888 40.422 2.366   1.00 88.92  ? 120 LYS A C     1 
ATOM   875  O  O     . LYS A 1 123 ? -44.947 39.625 1.429   1.00 88.73  ? 120 LYS A O     1 
ATOM   876  C  CB    . LYS A 1 123 ? -46.480 40.096 4.257   1.00 92.68  ? 120 LYS A CB    1 
ATOM   877  C  CG    . LYS A 1 123 ? -47.849 40.375 4.874   1.00 95.23  ? 120 LYS A CG    1 
ATOM   878  C  CD    . LYS A 1 123 ? -48.136 39.472 6.053   1.00 97.75  ? 120 LYS A CD    1 
ATOM   879  C  CE    . LYS A 1 123 ? -49.583 39.642 6.487   1.00 100.83 ? 120 LYS A CE    1 
ATOM   880  N  NZ    . LYS A 1 123 ? -49.750 39.526 7.973   1.00 103.72 ? 120 LYS A NZ    1 
ATOM   881  N  N     . PRO A 1 124 ? -43.719 40.874 2.855   1.00 87.70  ? 121 PRO A N     1 
ATOM   882  C  CA    . PRO A 1 124 ? -42.505 40.200 2.425   1.00 86.24  ? 121 PRO A CA    1 
ATOM   883  C  C     . PRO A 1 124 ? -42.580 38.749 2.874   1.00 86.76  ? 121 PRO A C     1 
ATOM   884  O  O     . PRO A 1 124 ? -43.171 38.454 3.924   1.00 87.86  ? 121 PRO A O     1 
ATOM   885  C  CB    . PRO A 1 124 ? -41.402 40.916 3.203   1.00 85.99  ? 121 PRO A CB    1 
ATOM   886  C  CG    . PRO A 1 124 ? -41.999 42.171 3.706   1.00 86.46  ? 121 PRO A CG    1 
ATOM   887  C  CD    . PRO A 1 124 ? -43.455 41.955 3.820   1.00 87.90  ? 121 PRO A CD    1 
ATOM   888  N  N     . PHE A 1 125 ? -41.995 37.856 2.080   1.00 85.69  ? 122 PHE A N     1 
ATOM   889  C  CA    . PHE A 1 125 ? -41.973 36.407 2.369   1.00 85.95  ? 122 PHE A CA    1 
ATOM   890  C  C     . PHE A 1 125 ? -43.292 35.679 2.055   1.00 86.91  ? 122 PHE A C     1 
ATOM   891  O  O     . PHE A 1 125 ? -43.382 34.460 2.247   1.00 87.82  ? 122 PHE A O     1 
ATOM   892  C  CB    . PHE A 1 125 ? -41.519 36.105 3.811   1.00 86.62  ? 122 PHE A CB    1 
ATOM   893  C  CG    . PHE A 1 125 ? -40.179 36.690 4.167   1.00 84.76  ? 122 PHE A CG    1 
ATOM   894  C  CD1   . PHE A 1 125 ? -40.096 37.843 4.934   1.00 83.12  ? 122 PHE A CD1   1 
ATOM   895  C  CD2   . PHE A 1 125 ? -38.999 36.087 3.738   1.00 83.71  ? 122 PHE A CD2   1 
ATOM   896  C  CE1   . PHE A 1 125 ? -38.860 38.387 5.264   1.00 82.09  ? 122 PHE A CE1   1 
ATOM   897  C  CE2   . PHE A 1 125 ? -37.754 36.632 4.062   1.00 81.92  ? 122 PHE A CE2   1 
ATOM   898  C  CZ    . PHE A 1 125 ? -37.688 37.779 4.825   1.00 81.31  ? 122 PHE A CZ    1 
ATOM   899  N  N     . ASP A 1 126 ? -44.300 36.413 1.572   1.00 86.67  ? 123 ASP A N     1 
ATOM   900  C  CA    . ASP A 1 126 ? -45.533 35.798 1.076   1.00 87.19  ? 123 ASP A CA    1 
ATOM   901  C  C     . ASP A 1 126 ? -45.218 34.977 -0.160  1.00 86.10  ? 123 ASP A C     1 
ATOM   902  O  O     . ASP A 1 126 ? -45.693 33.856 -0.294  1.00 87.12  ? 123 ASP A O     1 
ATOM   903  C  CB    . ASP A 1 126 ? -46.594 36.847 0.719   1.00 87.61  ? 123 ASP A CB    1 
ATOM   904  C  CG    . ASP A 1 126 ? -47.429 37.298 1.917   1.00 90.16  ? 123 ASP A CG    1 
ATOM   905  O  OD1   . ASP A 1 126 ? -47.132 36.911 3.074   1.00 91.58  ? 123 ASP A OD1   1 
ATOM   906  O  OD2   . ASP A 1 126 ? -48.401 38.058 1.690   1.00 92.19  ? 123 ASP A OD2   1 
ATOM   907  N  N     . LYS A 1 127 ? -44.412 35.539 -1.061  1.00 84.26  ? 124 LYS A N     1 
ATOM   908  C  CA    . LYS A 1 127 ? -44.092 34.881 -2.321  1.00 83.12  ? 124 LYS A CA    1 
ATOM   909  C  C     . LYS A 1 127 ? -42.688 35.193 -2.797  1.00 81.91  ? 124 LYS A C     1 
ATOM   910  O  O     . LYS A 1 127 ? -42.248 36.344 -2.812  1.00 80.99  ? 124 LYS A O     1 
ATOM   911  C  CB    . LYS A 1 127 ? -45.093 35.264 -3.400  1.00 82.91  ? 124 LYS A CB    1 
ATOM   912  C  CG    . LYS A 1 127 ? -45.036 34.389 -4.620  1.00 82.53  ? 124 LYS A CG    1 
ATOM   913  C  CD    . LYS A 1 127 ? -46.158 34.709 -5.610  1.00 83.44  ? 124 LYS A CD    1 
ATOM   914  C  CE    . LYS A 1 127 ? -47.445 33.946 -5.275  1.00 85.36  ? 124 LYS A CE    1 
ATOM   915  N  NZ    . LYS A 1 127 ? -48.408 33.873 -6.409  1.00 85.22  ? 124 LYS A NZ    1 
ATOM   916  N  N     . PHE A 1 128 ? -41.993 34.133 -3.175  1.00 81.99  ? 125 PHE A N     1 
ATOM   917  C  CA    . PHE A 1 128 ? -40.689 34.227 -3.784  1.00 81.20  ? 125 PHE A CA    1 
ATOM   918  C  C     . PHE A 1 128 ? -40.841 33.826 -5.232  1.00 81.18  ? 125 PHE A C     1 
ATOM   919  O  O     . PHE A 1 128 ? -41.555 32.865 -5.543  1.00 81.80  ? 125 PHE A O     1 
ATOM   920  C  CB    . PHE A 1 128 ? -39.729 33.235 -3.131  1.00 81.62  ? 125 PHE A CB    1 
ATOM   921  C  CG    . PHE A 1 128 ? -39.048 33.747 -1.904  1.00 81.35  ? 125 PHE A CG    1 
ATOM   922  C  CD1   . PHE A 1 128 ? -39.384 34.981 -1.356  1.00 81.70  ? 125 PHE A CD1   1 
ATOM   923  C  CD2   . PHE A 1 128 ? -38.088 32.968 -1.273  1.00 81.34  ? 125 PHE A CD2   1 
ATOM   924  C  CE1   . PHE A 1 128 ? -38.752 35.445 -0.198  1.00 82.16  ? 125 PHE A CE1   1 
ATOM   925  C  CE2   . PHE A 1 128 ? -37.447 33.414 -0.124  1.00 82.51  ? 125 PHE A CE2   1 
ATOM   926  C  CZ    . PHE A 1 128 ? -37.777 34.658 0.418   1.00 82.68  ? 125 PHE A CZ    1 
ATOM   927  N  N     . PHE A 1 129 ? -40.159 34.565 -6.106  1.00 80.51  ? 126 PHE A N     1 
ATOM   928  C  CA    . PHE A 1 129 ? -39.988 34.203 -7.512  1.00 80.23  ? 126 PHE A CA    1 
ATOM   929  C  C     . PHE A 1 129 ? -38.542 33.784 -7.762  1.00 80.11  ? 126 PHE A C     1 
ATOM   930  O  O     . PHE A 1 129 ? -37.614 34.457 -7.316  1.00 79.56  ? 126 PHE A O     1 
ATOM   931  C  CB    . PHE A 1 129 ? -40.359 35.389 -8.384  1.00 79.39  ? 126 PHE A CB    1 
ATOM   932  C  CG    . PHE A 1 129 ? -41.820 35.711 -8.376  1.00 79.81  ? 126 PHE A CG    1 
ATOM   933  C  CD1   . PHE A 1 129 ? -42.699 35.035 -9.216  1.00 80.33  ? 126 PHE A CD1   1 
ATOM   934  C  CD2   . PHE A 1 129 ? -42.322 36.695 -7.539  1.00 80.01  ? 126 PHE A CD2   1 
ATOM   935  C  CE1   . PHE A 1 129 ? -44.047 35.329 -9.217  1.00 80.78  ? 126 PHE A CE1   1 
ATOM   936  C  CE2   . PHE A 1 129 ? -43.682 36.998 -7.535  1.00 80.72  ? 126 PHE A CE2   1 
ATOM   937  C  CZ    . PHE A 1 129 ? -44.543 36.311 -8.374  1.00 81.01  ? 126 PHE A CZ    1 
ATOM   938  N  N     . ILE A 1 130 ? -38.342 32.664 -8.447  1.00 81.00  ? 127 ILE A N     1 
ATOM   939  C  CA    . ILE A 1 130 ? -36.990 32.146 -8.631  1.00 81.93  ? 127 ILE A CA    1 
ATOM   940  C  C     . ILE A 1 130 ? -36.687 31.701 -10.047 1.00 82.79  ? 127 ILE A C     1 
ATOM   941  O  O     . ILE A 1 130 ? -37.553 31.209 -10.758 1.00 83.71  ? 127 ILE A O     1 
ATOM   942  C  CB    . ILE A 1 130 ? -36.641 30.992 -7.662  1.00 82.68  ? 127 ILE A CB    1 
ATOM   943  C  CG1   . ILE A 1 130 ? -37.593 29.810 -7.832  1.00 83.80  ? 127 ILE A CG1   1 
ATOM   944  C  CG2   . ILE A 1 130 ? -36.634 31.469 -6.227  1.00 82.75  ? 127 ILE A CG2   1 
ATOM   945  C  CD1   . ILE A 1 130 ? -37.023 28.496 -7.304  1.00 84.96  ? 127 ILE A CD1   1 
ATOM   946  N  N     . ASP A 1 131 ? -35.435 31.863 -10.444 1.00 83.52  ? 128 ASP A N     1 
ATOM   947  C  CA    . ASP A 1 131 ? -35.022 31.558 -11.799 1.00 84.69  ? 128 ASP A CA    1 
ATOM   948  C  C     . ASP A 1 131 ? -33.512 31.438 -11.866 1.00 84.90  ? 128 ASP A C     1 
ATOM   949  O  O     . ASP A 1 131 ? -32.810 31.972 -11.006 1.00 85.08  ? 128 ASP A O     1 
ATOM   950  C  CB    . ASP A 1 131 ? -35.479 32.666 -12.744 1.00 84.43  ? 128 ASP A CB    1 
ATOM   951  C  CG    . ASP A 1 131 ? -35.434 32.242 -14.197 1.00 87.06  ? 128 ASP A CG    1 
ATOM   952  O  OD1   . ASP A 1 131 ? -35.663 31.033 -14.473 1.00 89.62  ? 128 ASP A OD1   1 
ATOM   953  O  OD2   . ASP A 1 131 ? -35.163 33.115 -15.061 1.00 88.75  ? 128 ASP A OD2   1 
ATOM   954  N  N     . TYR A 1 132 ? -33.018 30.730 -12.878 1.00 85.39  ? 129 TYR A N     1 
ATOM   955  C  CA    . TYR A 1 132 ? -31.596 30.670 -13.142 1.00 85.89  ? 129 TYR A CA    1 
ATOM   956  C  C     . TYR A 1 132 ? -31.231 31.504 -14.355 1.00 86.03  ? 129 TYR A C     1 
ATOM   957  O  O     . TYR A 1 132 ? -31.887 31.416 -15.396 1.00 86.26  ? 129 TYR A O     1 
ATOM   958  C  CB    . TYR A 1 132 ? -31.168 29.246 -13.410 1.00 86.75  ? 129 TYR A CB    1 
ATOM   959  C  CG    . TYR A 1 132 ? -30.848 28.456 -12.188 1.00 87.83  ? 129 TYR A CG    1 
ATOM   960  C  CD1   . TYR A 1 132 ? -31.745 27.508 -11.699 1.00 89.02  ? 129 TYR A CD1   1 
ATOM   961  C  CD2   . TYR A 1 132 ? -29.639 28.634 -11.525 1.00 88.77  ? 129 TYR A CD2   1 
ATOM   962  C  CE1   . TYR A 1 132 ? -31.449 26.760 -10.569 1.00 90.61  ? 129 TYR A CE1   1 
ATOM   963  C  CE2   . TYR A 1 132 ? -29.325 27.891 -10.393 1.00 90.55  ? 129 TYR A CE2   1 
ATOM   964  C  CZ    . TYR A 1 132 ? -30.237 26.956 -9.919  1.00 91.64  ? 129 TYR A CZ    1 
ATOM   965  O  OH    . TYR A 1 132 ? -29.939 26.221 -8.793  1.00 93.68  ? 129 TYR A OH    1 
ATOM   966  N  N     . ILE A 1 133 ? -30.174 32.303 -14.216 1.00 86.16  ? 130 ILE A N     1 
ATOM   967  C  CA    . ILE A 1 133 ? -29.534 32.964 -15.344 1.00 86.45  ? 130 ILE A CA    1 
ATOM   968  C  C     . ILE A 1 133 ? -28.419 32.061 -15.881 1.00 88.03  ? 130 ILE A C     1 
ATOM   969  O  O     . ILE A 1 133 ? -27.707 31.419 -15.098 1.00 88.59  ? 130 ILE A O     1 
ATOM   970  C  CB    . ILE A 1 133 ? -28.966 34.323 -14.916 1.00 85.66  ? 130 ILE A CB    1 
ATOM   971  C  CG1   . ILE A 1 133 ? -30.062 35.379 -14.964 1.00 84.88  ? 130 ILE A CG1   1 
ATOM   972  C  CG2   . ILE A 1 133 ? -27.836 34.760 -15.818 1.00 86.04  ? 130 ILE A CG2   1 
ATOM   973  C  CD1   . ILE A 1 133 ? -29.626 36.727 -14.424 1.00 84.22  ? 130 ILE A CD1   1 
ATOM   974  N  N     . GLY A 1 134 ? -28.282 31.989 -17.206 1.00 89.05  ? 131 GLY A N     1 
ATOM   975  C  CA    . GLY A 1 134 ? -27.128 31.322 -17.805 1.00 90.95  ? 131 GLY A CA    1 
ATOM   976  C  C     . GLY A 1 134 ? -27.386 30.277 -18.880 1.00 92.49  ? 131 GLY A C     1 
ATOM   977  O  O     . GLY A 1 134 ? -28.531 30.022 -19.243 1.00 92.32  ? 131 GLY A O     1 
ATOM   978  N  N     . PRO A 1 135 ? -26.314 29.624 -19.365 1.00 94.09  ? 132 PRO A N     1 
ATOM   979  C  CA    . PRO A 1 135 ? -24.965 29.675 -18.796 1.00 94.97  ? 132 PRO A CA    1 
ATOM   980  C  C     . PRO A 1 135 ? -24.225 30.957 -19.121 1.00 95.12  ? 132 PRO A C     1 
ATOM   981  O  O     . PRO A 1 135 ? -24.504 31.586 -20.141 1.00 94.95  ? 132 PRO A O     1 
ATOM   982  C  CB    . PRO A 1 135 ? -24.253 28.481 -19.447 1.00 96.41  ? 132 PRO A CB    1 
ATOM   983  C  CG    . PRO A 1 135 ? -25.197 27.947 -20.490 1.00 96.62  ? 132 PRO A CG    1 
ATOM   984  C  CD    . PRO A 1 135 ? -26.336 28.895 -20.639 1.00 95.03  ? 132 PRO A CD    1 
ATOM   985  N  N     . LEU A 1 136 ? -23.301 31.330 -18.238 1.00 95.74  ? 133 LEU A N     1 
ATOM   986  C  CA    . LEU A 1 136 ? -22.404 32.468 -18.444 1.00 96.46  ? 133 LEU A CA    1 
ATOM   987  C  C     . LEU A 1 136 ? -20.976 31.988 -18.801 1.00 98.79  ? 133 LEU A C     1 
ATOM   988  O  O     . LEU A 1 136 ? -20.711 30.778 -18.823 1.00 100.04 ? 133 LEU A O     1 
ATOM   989  C  CB    . LEU A 1 136 ? -22.387 33.359 -17.191 1.00 95.28  ? 133 LEU A CB    1 
ATOM   990  C  CG    . LEU A 1 136 ? -23.702 33.857 -16.567 1.00 93.45  ? 133 LEU A CG    1 
ATOM   991  C  CD1   . LEU A 1 136 ? -23.418 34.796 -15.421 1.00 92.17  ? 133 LEU A CD1   1 
ATOM   992  C  CD2   . LEU A 1 136 ? -24.603 34.547 -17.567 1.00 92.93  ? 133 LEU A CD2   1 
ATOM   993  N  N     . PRO A 1 137 ? -20.058 32.922 -19.130 1.00 99.76  ? 134 PRO A N     1 
ATOM   994  C  CA    . PRO A 1 137 ? -18.643 32.550 -19.162 1.00 101.65 ? 134 PRO A CA    1 
ATOM   995  C  C     . PRO A 1 137 ? -18.176 32.013 -17.804 1.00 102.40 ? 134 PRO A C     1 
ATOM   996  O  O     . PRO A 1 137 ? -18.463 32.624 -16.769 1.00 101.48 ? 134 PRO A O     1 
ATOM   997  C  CB    . PRO A 1 137 ? -17.936 33.877 -19.470 1.00 101.77 ? 134 PRO A CB    1 
ATOM   998  C  CG    . PRO A 1 137 ? -18.985 34.941 -19.350 1.00 99.96  ? 134 PRO A CG    1 
ATOM   999  C  CD    . PRO A 1 137 ? -20.264 34.266 -19.690 1.00 99.13  ? 134 PRO A CD    1 
ATOM   1000 N  N     . PRO A 1 138 ? -17.490 30.858 -17.800 1.00 104.20 ? 135 PRO A N     1 
ATOM   1001 C  CA    . PRO A 1 138 ? -16.972 30.310 -16.562 1.00 105.08 ? 135 PRO A CA    1 
ATOM   1002 C  C     . PRO A 1 138 ? -16.192 31.339 -15.765 1.00 105.42 ? 135 PRO A C     1 
ATOM   1003 O  O     . PRO A 1 138 ? -15.197 31.880 -16.250 1.00 106.39 ? 135 PRO A O     1 
ATOM   1004 C  CB    . PRO A 1 138 ? -16.042 29.198 -17.041 1.00 107.04 ? 135 PRO A CB    1 
ATOM   1005 C  CG    . PRO A 1 138 ? -16.679 28.712 -18.278 1.00 106.87 ? 135 PRO A CG    1 
ATOM   1006 C  CD    . PRO A 1 138 ? -17.363 29.897 -18.910 1.00 105.49 ? 135 PRO A CD    1 
ATOM   1007 N  N     . SER A 1 139 ? -16.688 31.624 -14.565 1.00 104.80 ? 136 SER A N     1 
ATOM   1008 C  CA    . SER A 1 139 ? -15.962 32.401 -13.578 1.00 105.31 ? 136 SER A CA    1 
ATOM   1009 C  C     . SER A 1 139 ? -15.785 31.554 -12.326 1.00 106.06 ? 136 SER A C     1 
ATOM   1010 O  O     . SER A 1 139 ? -16.772 31.048 -11.778 1.00 105.30 ? 136 SER A O     1 
ATOM   1011 C  CB    . SER A 1 139 ? -16.720 33.670 -13.243 1.00 103.62 ? 136 SER A CB    1 
ATOM   1012 O  OG    . SER A 1 139 ? -15.940 34.473 -12.387 1.00 104.65 ? 136 SER A OG    1 
ATOM   1013 N  N     . GLN A 1 140 ? -14.529 31.389 -11.894 1.00 107.82 ? 137 GLN A N     1 
ATOM   1014 C  CA    . GLN A 1 140 ? -14.169 30.576 -10.713 1.00 108.92 ? 137 GLN A CA    1 
ATOM   1015 C  C     . GLN A 1 140 ? -14.827 29.184 -10.681 1.00 108.82 ? 137 GLN A C     1 
ATOM   1016 O  O     . GLN A 1 140 ? -15.019 28.592 -9.611  1.00 109.04 ? 137 GLN A O     1 
ATOM   1017 C  CB    . GLN A 1 140 ? -14.483 31.333 -9.413  1.00 108.39 ? 137 GLN A CB    1 
ATOM   1018 C  CG    . GLN A 1 140 ? -13.769 32.667 -9.251  1.00 109.77 ? 137 GLN A CG    1 
ATOM   1019 C  CD    . GLN A 1 140 ? -12.368 32.528 -8.693  1.00 113.44 ? 137 GLN A CD    1 
ATOM   1020 O  OE1   . GLN A 1 140 ? -11.882 31.417 -8.449  1.00 115.35 ? 137 GLN A OE1   1 
ATOM   1021 N  NE2   . GLN A 1 140 ? -11.707 33.664 -8.484  1.00 114.43 ? 137 GLN A NE2   1 
ATOM   1022 N  N     . GLY A 1 141 ? -15.172 28.670 -11.858 1.00 108.55 ? 138 GLY A N     1 
ATOM   1023 C  CA    . GLY A 1 141 ? -15.814 27.367 -11.969 1.00 108.27 ? 138 GLY A CA    1 
ATOM   1024 C  C     . GLY A 1 141 ? -17.329 27.414 -11.936 1.00 106.20 ? 138 GLY A C     1 
ATOM   1025 O  O     . GLY A 1 141 ? -17.980 26.377 -12.047 1.00 106.55 ? 138 GLY A O     1 
ATOM   1026 N  N     . TYR A 1 142 ? -17.896 28.608 -11.792 1.00 104.13 ? 139 TYR A N     1 
ATOM   1027 C  CA    . TYR A 1 142 ? -19.349 28.761 -11.722 1.00 102.07 ? 139 TYR A CA    1 
ATOM   1028 C  C     . TYR A 1 142 ? -19.912 29.256 -13.048 1.00 100.48 ? 139 TYR A C     1 
ATOM   1029 O  O     . TYR A 1 142 ? -19.247 29.999 -13.771 1.00 100.78 ? 139 TYR A O     1 
ATOM   1030 C  CB    . TYR A 1 142 ? -19.741 29.685 -10.566 1.00 101.38 ? 139 TYR A CB    1 
ATOM   1031 C  CG    . TYR A 1 142 ? -19.400 29.109 -9.209  1.00 103.43 ? 139 TYR A CG    1 
ATOM   1032 C  CD1   . TYR A 1 142 ? -20.350 28.407 -8.468  1.00 104.20 ? 139 TYR A CD1   1 
ATOM   1033 C  CD2   . TYR A 1 142 ? -18.117 29.244 -8.675  1.00 105.87 ? 139 TYR A CD2   1 
ATOM   1034 C  CE1   . TYR A 1 142 ? -20.031 27.864 -7.224  1.00 105.61 ? 139 TYR A CE1   1 
ATOM   1035 C  CE2   . TYR A 1 142 ? -17.792 28.702 -7.431  1.00 107.36 ? 139 TYR A CE2   1 
ATOM   1036 C  CZ    . TYR A 1 142 ? -18.754 28.019 -6.716  1.00 106.85 ? 139 TYR A CZ    1 
ATOM   1037 O  OH    . TYR A 1 142 ? -18.434 27.489 -5.496  1.00 108.33 ? 139 TYR A OH    1 
ATOM   1038 N  N     . LEU A 1 143 ? -21.135 28.834 -13.363 1.00 98.53  ? 140 LEU A N     1 
ATOM   1039 C  CA    . LEU A 1 143 ? -21.716 29.066 -14.687 1.00 96.75  ? 140 LEU A CA    1 
ATOM   1040 C  C     . LEU A 1 143 ? -23.082 29.723 -14.643 1.00 94.32  ? 140 LEU A C     1 
ATOM   1041 O  O     . LEU A 1 143 ? -23.491 30.370 -15.605 1.00 94.06  ? 140 LEU A O     1 
ATOM   1042 C  CB    . LEU A 1 143 ? -21.832 27.749 -15.457 1.00 97.77  ? 140 LEU A CB    1 
ATOM   1043 C  CG    . LEU A 1 143 ? -20.527 27.023 -15.756 1.00 99.21  ? 140 LEU A CG    1 
ATOM   1044 C  CD1   . LEU A 1 143 ? -20.746 25.518 -15.765 1.00 100.38 ? 140 LEU A CD1   1 
ATOM   1045 C  CD2   . LEU A 1 143 ? -19.950 27.521 -17.064 1.00 99.34  ? 140 LEU A CD2   1 
ATOM   1046 N  N     . TYR A 1 144 ? -23.795 29.538 -13.541 1.00 92.30  ? 141 TYR A N     1 
ATOM   1047 C  CA    . TYR A 1 144 ? -25.153 30.026 -13.437 1.00 89.68  ? 141 TYR A CA    1 
ATOM   1048 C  C     . TYR A 1 144 ? -25.345 30.828 -12.167 1.00 88.08  ? 141 TYR A C     1 
ATOM   1049 O  O     . TYR A 1 144 ? -24.617 30.662 -11.192 1.00 88.50  ? 141 TYR A O     1 
ATOM   1050 C  CB    . TYR A 1 144 ? -26.122 28.855 -13.450 1.00 90.00  ? 141 TYR A CB    1 
ATOM   1051 C  CG    . TYR A 1 144 ? -26.117 28.045 -14.717 1.00 90.58  ? 141 TYR A CG    1 
ATOM   1052 C  CD1   . TYR A 1 144 ? -27.021 28.320 -15.736 1.00 90.36  ? 141 TYR A CD1   1 
ATOM   1053 C  CD2   . TYR A 1 144 ? -25.229 26.985 -14.890 1.00 92.17  ? 141 TYR A CD2   1 
ATOM   1054 C  CE1   . TYR A 1 144 ? -27.040 27.573 -16.901 1.00 91.80  ? 141 TYR A CE1   1 
ATOM   1055 C  CE2   . TYR A 1 144 ? -25.230 26.232 -16.060 1.00 93.79  ? 141 TYR A CE2   1 
ATOM   1056 C  CZ    . TYR A 1 144 ? -26.141 26.537 -17.062 1.00 93.52  ? 141 TYR A CZ    1 
ATOM   1057 O  OH    . TYR A 1 144 ? -26.162 25.806 -18.224 1.00 94.69  ? 141 TYR A OH    1 
ATOM   1058 N  N     . VAL A 1 145 ? -26.328 31.713 -12.186 1.00 85.97  ? 142 VAL A N     1 
ATOM   1059 C  CA    . VAL A 1 145 ? -26.708 32.437 -10.987 1.00 84.46  ? 142 VAL A CA    1 
ATOM   1060 C  C     . VAL A 1 145 ? -28.153 32.080 -10.677 1.00 83.47  ? 142 VAL A C     1 
ATOM   1061 O  O     . VAL A 1 145 ? -29.024 32.225 -11.545 1.00 83.32  ? 142 VAL A O     1 
ATOM   1062 C  CB    . VAL A 1 145 ? -26.585 33.973 -11.157 1.00 83.68  ? 142 VAL A CB    1 
ATOM   1063 C  CG1   . VAL A 1 145 ? -27.061 34.685 -9.903  1.00 83.33  ? 142 VAL A CG1   1 
ATOM   1064 C  CG2   . VAL A 1 145 ? -25.159 34.367 -11.445 1.00 84.09  ? 142 VAL A CG2   1 
ATOM   1065 N  N     . LEU A 1 146 ? -28.400 31.591 -9.459  1.00 82.43  ? 143 LEU A N     1 
ATOM   1066 C  CA    . LEU A 1 146 ? -29.756 31.455 -8.953  1.00 80.81  ? 143 LEU A CA    1 
ATOM   1067 C  C     . LEU A 1 146 ? -30.217 32.813 -8.452  1.00 79.25  ? 143 LEU A C     1 
ATOM   1068 O  O     . LEU A 1 146 ? -29.503 33.487 -7.709  1.00 78.88  ? 143 LEU A O     1 
ATOM   1069 C  CB    . LEU A 1 146 ? -29.834 30.423 -7.839  1.00 81.50  ? 143 LEU A CB    1 
ATOM   1070 C  CG    . LEU A 1 146 ? -31.215 30.292 -7.193  1.00 81.23  ? 143 LEU A CG    1 
ATOM   1071 C  CD1   . LEU A 1 146 ? -32.194 29.506 -8.050  1.00 80.99  ? 143 LEU A CD1   1 
ATOM   1072 C  CD2   . LEU A 1 146 ? -31.072 29.636 -5.855  1.00 82.18  ? 143 LEU A CD2   1 
ATOM   1073 N  N     . VAL A 1 147 ? -31.408 33.208 -8.883  1.00 77.92  ? 144 VAL A N     1 
ATOM   1074 C  CA    . VAL A 1 147 ? -31.940 34.520 -8.579  1.00 76.64  ? 144 VAL A CA    1 
ATOM   1075 C  C     . VAL A 1 147 ? -33.264 34.336 -7.890  1.00 76.49  ? 144 VAL A C     1 
ATOM   1076 O  O     . VAL A 1 147 ? -34.103 33.580 -8.357  1.00 76.61  ? 144 VAL A O     1 
ATOM   1077 C  CB    . VAL A 1 147 ? -32.126 35.367 -9.846  1.00 76.00  ? 144 VAL A CB    1 
ATOM   1078 C  CG1   . VAL A 1 147 ? -32.776 36.694 -9.517  1.00 75.18  ? 144 VAL A CG1   1 
ATOM   1079 C  CG2   . VAL A 1 147 ? -30.792 35.603 -10.512 1.00 76.09  ? 144 VAL A CG2   1 
ATOM   1080 N  N     . VAL A 1 148 ? -33.424 35.031 -6.771  1.00 76.27  ? 145 VAL A N     1 
ATOM   1081 C  CA    . VAL A 1 148 ? -34.587 34.906 -5.911  1.00 76.47  ? 145 VAL A CA    1 
ATOM   1082 C  C     . VAL A 1 148 ? -35.111 36.301 -5.588  1.00 76.21  ? 145 VAL A C     1 
ATOM   1083 O  O     . VAL A 1 148 ? -34.410 37.106 -4.972  1.00 75.95  ? 145 VAL A O     1 
ATOM   1084 C  CB    . VAL A 1 148 ? -34.222 34.196 -4.579  1.00 77.13  ? 145 VAL A CB    1 
ATOM   1085 C  CG1   . VAL A 1 148 ? -35.470 33.916 -3.768  1.00 77.87  ? 145 VAL A CG1   1 
ATOM   1086 C  CG2   . VAL A 1 148 ? -33.443 32.911 -4.818  1.00 76.95  ? 145 VAL A CG2   1 
ATOM   1087 N  N     . VAL A 1 149 ? -36.342 36.589 -5.992  1.00 76.48  ? 146 VAL A N     1 
ATOM   1088 C  CA    . VAL A 1 149 ? -36.921 37.903 -5.731  1.00 76.82  ? 146 VAL A CA    1 
ATOM   1089 C  C     . VAL A 1 149 ? -38.117 37.794 -4.823  1.00 77.85  ? 146 VAL A C     1 
ATOM   1090 O  O     . VAL A 1 149 ? -39.024 37.010 -5.089  1.00 78.43  ? 146 VAL A O     1 
ATOM   1091 C  CB    . VAL A 1 149 ? -37.408 38.600 -7.017  1.00 76.48  ? 146 VAL A CB    1 
ATOM   1092 C  CG1   . VAL A 1 149 ? -37.959 39.985 -6.690  1.00 76.50  ? 146 VAL A CG1   1 
ATOM   1093 C  CG2   . VAL A 1 149 ? -36.293 38.706 -8.051  1.00 76.20  ? 146 VAL A CG2   1 
ATOM   1094 N  N     . ASP A 1 150 ? -38.137 38.589 -3.759  1.00 78.71  ? 147 ASP A N     1 
ATOM   1095 C  CA    . ASP A 1 150 ? -39.338 38.681 -2.949  1.00 80.33  ? 147 ASP A CA    1 
ATOM   1096 C  C     . ASP A 1 150 ? -40.377 39.483 -3.705  1.00 80.28  ? 147 ASP A C     1 
ATOM   1097 O  O     . ASP A 1 150 ? -40.130 40.615 -4.108  1.00 79.67  ? 147 ASP A O     1 
ATOM   1098 C  CB    . ASP A 1 150 ? -39.076 39.322 -1.596  1.00 81.01  ? 147 ASP A CB    1 
ATOM   1099 C  CG    . ASP A 1 150 ? -40.366 39.534 -0.790  1.00 84.06  ? 147 ASP A CG    1 
ATOM   1100 O  OD1   . ASP A 1 150 ? -41.119 38.551 -0.547  1.00 86.56  ? 147 ASP A OD1   1 
ATOM   1101 O  OD2   . ASP A 1 150 ? -40.632 40.694 -0.400  1.00 86.43  ? 147 ASP A OD2   1 
ATOM   1102 N  N     . GLY A 1 151 ? -41.541 38.876 -3.893  1.00 81.30  ? 148 GLY A N     1 
ATOM   1103 C  CA    . GLY A 1 151 ? -42.618 39.491 -4.654  1.00 81.53  ? 148 GLY A CA    1 
ATOM   1104 C  C     . GLY A 1 151 ? -43.000 40.863 -4.135  1.00 81.74  ? 148 GLY A C     1 
ATOM   1105 O  O     . GLY A 1 151 ? -43.105 41.822 -4.909  1.00 81.40  ? 148 GLY A O     1 
ATOM   1106 N  N     . MET A 1 152 ? -43.199 40.962 -2.825  1.00 82.28  ? 149 MET A N     1 
ATOM   1107 C  CA    . MET A 1 152 ? -43.662 42.206 -2.243  1.00 82.58  ? 149 MET A CA    1 
ATOM   1108 C  C     . MET A 1 152 ? -42.631 43.337 -2.369  1.00 81.41  ? 149 MET A C     1 
ATOM   1109 O  O     . MET A 1 152 ? -42.967 44.449 -2.791  1.00 81.16  ? 149 MET A O     1 
ATOM   1110 C  CB    . MET A 1 152 ? -44.071 41.989 -0.789  1.00 83.88  ? 149 MET A CB    1 
ATOM   1111 C  CG    . MET A 1 152 ? -44.837 43.156 -0.193  1.00 85.73  ? 149 MET A CG    1 
ATOM   1112 S  SD    . MET A 1 152 ? -43.768 44.488 0.384   1.00 88.79  ? 149 MET A SD    1 
ATOM   1113 C  CE    . MET A 1 152 ? -44.653 45.905 -0.273  1.00 88.36  ? 149 MET A CE    1 
ATOM   1114 N  N     . THR A 1 153 ? -41.383 43.049 -2.020  1.00 80.59  ? 150 THR A N     1 
ATOM   1115 C  CA    . THR A 1 153 ? -40.383 44.101 -1.876  1.00 79.99  ? 150 THR A CA    1 
ATOM   1116 C  C     . THR A 1 153 ? -39.504 44.251 -3.109  1.00 79.26  ? 150 THR A C     1 
ATOM   1117 O  O     . THR A 1 153 ? -38.976 45.333 -3.405  1.00 79.00  ? 150 THR A O     1 
ATOM   1118 C  CB    . THR A 1 153 ? -39.460 43.823 -0.694  1.00 80.10  ? 150 THR A CB    1 
ATOM   1119 O  OG1   . THR A 1 153 ? -38.883 42.526 -0.857  1.00 79.48  ? 150 THR A OG1   1 
ATOM   1120 C  CG2   . THR A 1 153 ? -40.225 43.891 0.612   1.00 80.74  ? 150 THR A CG2   1 
ATOM   1121 N  N     . GLY A 1 154 ? -39.331 43.155 -3.827  1.00 79.07  ? 151 GLY A N     1 
ATOM   1122 C  CA    . GLY A 1 154 ? -38.414 43.165 -4.945  1.00 78.11  ? 151 GLY A CA    1 
ATOM   1123 C  C     . GLY A 1 154 ? -36.997 43.004 -4.440  1.00 77.58  ? 151 GLY A C     1 
ATOM   1124 O  O     . GLY A 1 154 ? -36.059 43.195 -5.199  1.00 77.57  ? 151 GLY A O     1 
ATOM   1125 N  N     . PHE A 1 155 ? -36.837 42.663 -3.162  1.00 77.55  ? 152 PHE A N     1 
ATOM   1126 C  CA    . PHE A 1 155 ? -35.528 42.298 -2.629  1.00 77.20  ? 152 PHE A CA    1 
ATOM   1127 C  C     . PHE A 1 155 ? -35.028 41.036 -3.326  1.00 77.02  ? 152 PHE A C     1 
ATOM   1128 O  O     . PHE A 1 155 ? -35.820 40.150 -3.659  1.00 77.15  ? 152 PHE A O     1 
ATOM   1129 C  CB    . PHE A 1 155 ? -35.620 42.052 -1.132  1.00 77.96  ? 152 PHE A CB    1 
ATOM   1130 C  CG    . PHE A 1 155 ? -34.342 42.322 -0.389  1.00 77.35  ? 152 PHE A CG    1 
ATOM   1131 C  CD1   . PHE A 1 155 ? -34.088 43.579 0.143   1.00 75.92  ? 152 PHE A CD1   1 
ATOM   1132 C  CD2   . PHE A 1 155 ? -33.405 41.310 -0.202  1.00 77.17  ? 152 PHE A CD2   1 
ATOM   1133 C  CE1   . PHE A 1 155 ? -32.926 43.824 0.836   1.00 75.44  ? 152 PHE A CE1   1 
ATOM   1134 C  CE2   . PHE A 1 155 ? -32.229 41.548 0.492   1.00 76.68  ? 152 PHE A CE2   1 
ATOM   1135 C  CZ    . PHE A 1 155 ? -31.989 42.808 1.009   1.00 76.26  ? 152 PHE A CZ    1 
ATOM   1136 N  N     . THR A 1 156 ? -33.719 40.954 -3.547  1.00 76.65  ? 153 THR A N     1 
ATOM   1137 C  CA    . THR A 1 156 ? -33.178 39.886 -4.375  1.00 76.72  ? 153 THR A CA    1 
ATOM   1138 C  C     . THR A 1 156 ? -31.936 39.211 -3.815  1.00 77.20  ? 153 THR A C     1 
ATOM   1139 O  O     . THR A 1 156 ? -30.948 39.871 -3.482  1.00 77.37  ? 153 THR A O     1 
ATOM   1140 C  CB    . THR A 1 156 ? -32.859 40.391 -5.787  1.00 76.17  ? 153 THR A CB    1 
ATOM   1141 O  OG1   . THR A 1 156 ? -34.017 41.025 -6.335  1.00 76.80  ? 153 THR A OG1   1 
ATOM   1142 C  CG2   . THR A 1 156 ? -32.467 39.241 -6.690  1.00 76.12  ? 153 THR A CG2   1 
ATOM   1143 N  N     . TRP A 1 157 ? -31.989 37.887 -3.743  1.00 77.54  ? 154 TRP A N     1 
ATOM   1144 C  CA    . TRP A 1 157 ? -30.830 37.102 -3.369  1.00 78.27  ? 154 TRP A CA    1 
ATOM   1145 C  C     . TRP A 1 157 ? -30.202 36.428 -4.587  1.00 78.05  ? 154 TRP A C     1 
ATOM   1146 O  O     . TRP A 1 157 ? -30.912 35.883 -5.434  1.00 77.76  ? 154 TRP A O     1 
ATOM   1147 C  CB    . TRP A 1 157 ? -31.210 36.062 -2.317  1.00 79.50  ? 154 TRP A CB    1 
ATOM   1148 C  CG    . TRP A 1 157 ? -31.574 36.658 -0.992  1.00 80.75  ? 154 TRP A CG    1 
ATOM   1149 C  CD1   . TRP A 1 157 ? -30.736 36.892 0.061   1.00 82.03  ? 154 TRP A CD1   1 
ATOM   1150 C  CD2   . TRP A 1 157 ? -32.871 37.102 -0.579  1.00 81.55  ? 154 TRP A CD2   1 
ATOM   1151 N  NE1   . TRP A 1 157 ? -31.430 37.460 1.103   1.00 82.39  ? 154 TRP A NE1   1 
ATOM   1152 C  CE2   . TRP A 1 157 ? -32.742 37.600 0.737   1.00 81.81  ? 154 TRP A CE2   1 
ATOM   1153 C  CE3   . TRP A 1 157 ? -34.132 37.129 -1.194  1.00 81.56  ? 154 TRP A CE3   1 
ATOM   1154 C  CZ2   . TRP A 1 157 ? -33.822 38.114 1.451   1.00 81.88  ? 154 TRP A CZ2   1 
ATOM   1155 C  CZ3   . TRP A 1 157 ? -35.208 37.646 -0.482  1.00 81.77  ? 154 TRP A CZ3   1 
ATOM   1156 C  CH2   . TRP A 1 157 ? -35.042 38.129 0.829   1.00 82.30  ? 154 TRP A CH2   1 
ATOM   1157 N  N     . LEU A 1 158 ? -28.869 36.472 -4.658  1.00 78.30  ? 155 LEU A N     1 
ATOM   1158 C  CA    . LEU A 1 158 ? -28.096 35.865 -5.749  1.00 78.28  ? 155 LEU A CA    1 
ATOM   1159 C  C     . LEU A 1 158 ? -27.183 34.777 -5.230  1.00 79.34  ? 155 LEU A C     1 
ATOM   1160 O  O     . LEU A 1 158 ? -26.489 34.969 -4.245  1.00 79.70  ? 155 LEU A O     1 
ATOM   1161 C  CB    . LEU A 1 158 ? -27.259 36.919 -6.468  1.00 77.60  ? 155 LEU A CB    1 
ATOM   1162 C  CG    . LEU A 1 158 ? -27.958 38.190 -6.950  1.00 76.42  ? 155 LEU A CG    1 
ATOM   1163 C  CD1   . LEU A 1 158 ? -27.024 39.004 -7.810  1.00 76.52  ? 155 LEU A CD1   1 
ATOM   1164 C  CD2   . LEU A 1 158 ? -29.199 37.876 -7.734  1.00 75.99  ? 155 LEU A CD2   1 
ATOM   1165 N  N     . TYR A 1 159 ? -27.193 33.628 -5.888  1.00 80.26  ? 156 TYR A N     1 
ATOM   1166 C  CA    . TYR A 1 159 ? -26.316 32.530 -5.498  1.00 82.21  ? 156 TYR A CA    1 
ATOM   1167 C  C     . TYR A 1 159 ? -25.655 31.947 -6.736  1.00 82.90  ? 156 TYR A C     1 
ATOM   1168 O  O     . TYR A 1 159 ? -26.362 31.505 -7.647  1.00 83.17  ? 156 TYR A O     1 
ATOM   1169 C  CB    . TYR A 1 159 ? -27.095 31.438 -4.754  1.00 82.84  ? 156 TYR A CB    1 
ATOM   1170 C  CG    . TYR A 1 159 ? -27.775 31.947 -3.517  1.00 83.84  ? 156 TYR A CG    1 
ATOM   1171 C  CD1   . TYR A 1 159 ? -27.135 31.919 -2.279  1.00 85.42  ? 156 TYR A CD1   1 
ATOM   1172 C  CD2   . TYR A 1 159 ? -29.054 32.493 -3.590  1.00 84.34  ? 156 TYR A CD2   1 
ATOM   1173 C  CE1   . TYR A 1 159 ? -27.766 32.413 -1.138  1.00 86.54  ? 156 TYR A CE1   1 
ATOM   1174 C  CE2   . TYR A 1 159 ? -29.690 32.988 -2.468  1.00 85.00  ? 156 TYR A CE2   1 
ATOM   1175 C  CZ    . TYR A 1 159 ? -29.047 32.945 -1.248  1.00 86.64  ? 156 TYR A CZ    1 
ATOM   1176 O  OH    . TYR A 1 159 ? -29.700 33.442 -0.149  1.00 88.44  ? 156 TYR A OH    1 
ATOM   1177 N  N     . PRO A 1 160 ? -24.305 31.963 -6.793  1.00 83.59  ? 157 PRO A N     1 
ATOM   1178 C  CA    . PRO A 1 160 ? -23.608 31.348 -7.926  1.00 84.36  ? 157 PRO A CA    1 
ATOM   1179 C  C     . PRO A 1 160 ? -23.680 29.827 -7.854  1.00 85.83  ? 157 PRO A C     1 
ATOM   1180 O  O     . PRO A 1 160 ? -23.541 29.263 -6.770  1.00 86.78  ? 157 PRO A O     1 
ATOM   1181 C  CB    . PRO A 1 160 ? -22.169 31.821 -7.760  1.00 84.83  ? 157 PRO A CB    1 
ATOM   1182 C  CG    . PRO A 1 160 ? -22.054 32.259 -6.362  1.00 84.80  ? 157 PRO A CG    1 
ATOM   1183 C  CD    . PRO A 1 160 ? -23.388 32.665 -5.880  1.00 83.70  ? 157 PRO A CD    1 
ATOM   1184 N  N     . THR A 1 161 ? -23.932 29.173 -8.986  1.00 86.48  ? 158 THR A N     1 
ATOM   1185 C  CA    . THR A 1 161 ? -23.987 27.704 -9.040  1.00 87.95  ? 158 THR A CA    1 
ATOM   1186 C  C     . THR A 1 161 ? -23.263 27.149 -10.268 1.00 89.18  ? 158 THR A C     1 
ATOM   1187 O  O     . THR A 1 161 ? -22.945 27.878 -11.202 1.00 89.01  ? 158 THR A O     1 
ATOM   1188 C  CB    . THR A 1 161 ? -25.445 27.135 -9.009  1.00 87.59  ? 158 THR A CB    1 
ATOM   1189 O  OG1   . THR A 1 161 ? -26.009 27.138 -10.327 1.00 86.82  ? 158 THR A OG1   1 
ATOM   1190 C  CG2   . THR A 1 161 ? -26.351 27.908 -8.044  1.00 86.60  ? 158 THR A CG2   1 
ATOM   1191 N  N     . LYS A 1 162 ? -23.011 25.850 -10.262 1.00 90.94  ? 159 LYS A N     1 
ATOM   1192 C  CA    . LYS A 1 162 ? -22.308 25.216 -11.361 1.00 92.53  ? 159 LYS A CA    1 
ATOM   1193 C  C     . LYS A 1 162 ? -23.286 24.566 -12.337 1.00 92.51  ? 159 LYS A C     1 
ATOM   1194 O  O     . LYS A 1 162 ? -22.915 24.217 -13.457 1.00 93.43  ? 159 LYS A O     1 
ATOM   1195 C  CB    . LYS A 1 162 ? -21.302 24.195 -10.826 1.00 94.37  ? 159 LYS A CB    1 
ATOM   1196 C  CG    . LYS A 1 162 ? -20.190 24.809 -9.982  1.00 96.00  ? 159 LYS A CG    1 
ATOM   1197 C  CD    . LYS A 1 162 ? -19.282 23.738 -9.405  1.00 100.02 ? 159 LYS A CD    1 
ATOM   1198 C  CE    . LYS A 1 162 ? -18.105 24.344 -8.653  1.00 101.93 ? 159 LYS A CE    1 
ATOM   1199 N  NZ    . LYS A 1 162 ? -17.083 23.294 -8.363  1.00 104.98 ? 159 LYS A NZ    1 
ATOM   1200 N  N     . ALA A 1 163 ? -24.535 24.418 -11.908 1.00 91.90  ? 160 ALA A N     1 
ATOM   1201 C  CA    . ALA A 1 163 ? -25.580 23.797 -12.717 1.00 92.06  ? 160 ALA A CA    1 
ATOM   1202 C  C     . ALA A 1 163 ? -26.955 24.353 -12.337 1.00 91.16  ? 160 ALA A C     1 
ATOM   1203 O  O     . ALA A 1 163 ? -27.177 24.715 -11.174 1.00 91.01  ? 160 ALA A O     1 
ATOM   1204 C  CB    . ALA A 1 163 ? -25.556 22.292 -12.521 1.00 93.43  ? 160 ALA A CB    1 
ATOM   1205 N  N     . PRO A 1 164 ? -27.893 24.431 -13.304 1.00 90.76  ? 161 PRO A N     1 
ATOM   1206 C  CA    . PRO A 1 164 ? -29.237 24.764 -12.850 1.00 89.99  ? 161 PRO A CA    1 
ATOM   1207 C  C     . PRO A 1 164 ? -29.884 23.489 -12.336 1.00 91.13  ? 161 PRO A C     1 
ATOM   1208 O  O     . PRO A 1 164 ? -30.817 22.985 -12.955 1.00 91.56  ? 161 PRO A O     1 
ATOM   1209 C  CB    . PRO A 1 164 ? -29.937 25.262 -14.119 1.00 89.34  ? 161 PRO A CB    1 
ATOM   1210 C  CG    . PRO A 1 164 ? -29.086 24.817 -15.274 1.00 90.12  ? 161 PRO A CG    1 
ATOM   1211 C  CD    . PRO A 1 164 ? -27.850 24.139 -14.747 1.00 91.11  ? 161 PRO A CD    1 
ATOM   1212 N  N     . SER A 1 165 ? -29.360 22.971 -11.222 1.00 91.92  ? 162 SER A N     1 
ATOM   1213 C  CA    . SER A 1 165 ? -29.781 21.681 -10.662 1.00 93.22  ? 162 SER A CA    1 
ATOM   1214 C  C     . SER A 1 165 ? -30.600 21.828 -9.385  1.00 93.04  ? 162 SER A C     1 
ATOM   1215 O  O     . SER A 1 165 ? -30.389 22.766 -8.613  1.00 92.45  ? 162 SER A O     1 
ATOM   1216 C  CB    . SER A 1 165 ? -28.561 20.786 -10.391 1.00 94.57  ? 162 SER A CB    1 
ATOM   1217 O  OG    . SER A 1 165 ? -27.674 21.374 -9.454  1.00 94.06  ? 162 SER A OG    1 
ATOM   1218 N  N     . THR A 1 166 ? -31.529 20.897 -9.168  1.00 93.77  ? 163 THR A N     1 
ATOM   1219 C  CA    . THR A 1 166 ? -32.261 20.815 -7.903  1.00 93.98  ? 163 THR A CA    1 
ATOM   1220 C  C     . THR A 1 166 ? -31.255 20.841 -6.761  1.00 94.40  ? 163 THR A C     1 
ATOM   1221 O  O     . THR A 1 166 ? -31.342 21.674 -5.853  1.00 93.79  ? 163 THR A O     1 
ATOM   1222 C  CB    . THR A 1 166 ? -33.099 19.523 -7.799  1.00 95.26  ? 163 THR A CB    1 
ATOM   1223 O  OG1   . THR A 1 166 ? -33.887 19.359 -8.985  1.00 95.74  ? 163 THR A OG1   1 
ATOM   1224 C  CG2   . THR A 1 166 ? -34.014 19.568 -6.582  1.00 95.05  ? 163 THR A CG2   1 
ATOM   1225 N  N     . SER A 1 167 ? -30.286 19.934 -6.836  1.00 95.50  ? 164 SER A N     1 
ATOM   1226 C  CA    . SER A 1 167 ? -29.239 19.837 -5.839  1.00 96.20  ? 164 SER A CA    1 
ATOM   1227 C  C     . SER A 1 167 ? -28.759 21.211 -5.375  1.00 94.72  ? 164 SER A C     1 
ATOM   1228 O  O     . SER A 1 167 ? -28.788 21.517 -4.189  1.00 95.04  ? 164 SER A O     1 
ATOM   1229 C  CB    . SER A 1 167 ? -28.069 19.031 -6.396  1.00 97.42  ? 164 SER A CB    1 
ATOM   1230 O  OG    . SER A 1 167 ? -26.863 19.403 -5.749  1.00 98.59  ? 164 SER A OG    1 
ATOM   1231 N  N     . ALA A 1 168 ? -28.336 22.040 -6.318  1.00 93.38  ? 165 ALA A N     1 
ATOM   1232 C  CA    . ALA A 1 168 ? -27.746 23.332 -5.986  1.00 92.05  ? 165 ALA A CA    1 
ATOM   1233 C  C     . ALA A 1 168 ? -28.783 24.350 -5.540  1.00 90.44  ? 165 ALA A C     1 
ATOM   1234 O  O     . ALA A 1 168 ? -28.470 25.254 -4.765  1.00 90.02  ? 165 ALA A O     1 
ATOM   1235 C  CB    . ALA A 1 168 ? -26.943 23.875 -7.166  1.00 91.85  ? 165 ALA A CB    1 
ATOM   1236 N  N     . THR A 1 169 ? -30.007 24.207 -6.041  1.00 89.36  ? 166 THR A N     1 
ATOM   1237 C  CA    . THR A 1 169 ? -31.093 25.097 -5.659  1.00 87.93  ? 166 THR A CA    1 
ATOM   1238 C  C     . THR A 1 169 ? -31.392 24.906 -4.178  1.00 88.46  ? 166 THR A C     1 
ATOM   1239 O  O     . THR A 1 169 ? -31.603 25.868 -3.438  1.00 87.84  ? 166 THR A O     1 
ATOM   1240 C  CB    . THR A 1 169 ? -32.351 24.820 -6.482  1.00 87.64  ? 166 THR A CB    1 
ATOM   1241 O  OG1   . THR A 1 169 ? -32.001 24.730 -7.864  1.00 87.26  ? 166 THR A OG1   1 
ATOM   1242 C  CG2   . THR A 1 169 ? -33.349 25.935 -6.312  1.00 86.65  ? 166 THR A CG2   1 
ATOM   1243 N  N     . VAL A 1 170 ? -31.379 23.651 -3.750  1.00 89.58  ? 167 VAL A N     1 
ATOM   1244 C  CA    . VAL A 1 170 ? -31.636 23.304 -2.364  1.00 90.20  ? 167 VAL A CA    1 
ATOM   1245 C  C     . VAL A 1 170 ? -30.531 23.834 -1.454  1.00 90.18  ? 167 VAL A C     1 
ATOM   1246 O  O     . VAL A 1 170 ? -30.827 24.484 -0.454  1.00 90.00  ? 167 VAL A O     1 
ATOM   1247 C  CB    . VAL A 1 170 ? -31.836 21.785 -2.206  1.00 91.72  ? 167 VAL A CB    1 
ATOM   1248 C  CG1   . VAL A 1 170 ? -31.883 21.387 -0.739  1.00 92.98  ? 167 VAL A CG1   1 
ATOM   1249 C  CG2   . VAL A 1 170 ? -33.109 21.364 -2.917  1.00 91.43  ? 167 VAL A CG2   1 
ATOM   1250 N  N     . LYS A 1 171 ? -29.271 23.582 -1.811  1.00 90.48  ? 168 LYS A N     1 
ATOM   1251 C  CA    . LYS A 1 171 ? -28.138 24.115 -1.054  1.00 90.85  ? 168 LYS A CA    1 
ATOM   1252 C  C     . LYS A 1 171 ? -28.321 25.614 -0.833  1.00 89.37  ? 168 LYS A C     1 
ATOM   1253 O  O     . LYS A 1 171 ? -28.170 26.103 0.289   1.00 89.70  ? 168 LYS A O     1 
ATOM   1254 C  CB    . LYS A 1 171 ? -26.812 23.889 -1.782  1.00 91.29  ? 168 LYS A CB    1 
ATOM   1255 C  CG    . LYS A 1 171 ? -26.247 22.472 -1.776  1.00 94.36  ? 168 LYS A CG    1 
ATOM   1256 C  CD    . LYS A 1 171 ? -24.928 22.456 -2.585  1.00 97.19  ? 168 LYS A CD    1 
ATOM   1257 C  CE    . LYS A 1 171 ? -24.485 21.059 -3.032  1.00 99.09  ? 168 LYS A CE    1 
ATOM   1258 N  NZ    . LYS A 1 171 ? -23.783 20.316 -1.934  1.00 101.70 ? 168 LYS A NZ    1 
ATOM   1259 N  N     . SER A 1 172 ? -28.668 26.326 -1.906  1.00 87.85  ? 169 SER A N     1 
ATOM   1260 C  CA    . SER A 1 172 ? -28.736 27.788 -1.893  1.00 86.54  ? 169 SER A CA    1 
ATOM   1261 C  C     . SER A 1 172 ? -29.889 28.329 -1.070  1.00 86.00  ? 169 SER A C     1 
ATOM   1262 O  O     . SER A 1 172 ? -29.727 29.308 -0.336  1.00 85.74  ? 169 SER A O     1 
ATOM   1263 C  CB    . SER A 1 172 ? -28.817 28.343 -3.313  1.00 85.57  ? 169 SER A CB    1 
ATOM   1264 O  OG    . SER A 1 172 ? -27.610 28.103 -4.023  1.00 87.05  ? 169 SER A OG    1 
ATOM   1265 N  N     . LEU A 1 173 ? -31.049 27.688 -1.190  1.00 85.88  ? 170 LEU A N     1 
ATOM   1266 C  CA    . LEU A 1 173 ? -32.235 28.110 -0.448  1.00 85.40  ? 170 LEU A CA    1 
ATOM   1267 C  C     . LEU A 1 173 ? -32.210 27.725 1.024   1.00 86.35  ? 170 LEU A C     1 
ATOM   1268 O  O     . LEU A 1 173 ? -32.933 28.309 1.825   1.00 86.60  ? 170 LEU A O     1 
ATOM   1269 C  CB    . LEU A 1 173 ? -33.509 27.585 -1.104  1.00 85.46  ? 170 LEU A CB    1 
ATOM   1270 C  CG    . LEU A 1 173 ? -33.922 28.178 -2.452  1.00 83.97  ? 170 LEU A CG    1 
ATOM   1271 C  CD1   . LEU A 1 173 ? -35.142 27.422 -2.975  1.00 83.96  ? 170 LEU A CD1   1 
ATOM   1272 C  CD2   . LEU A 1 173 ? -34.192 29.687 -2.370  1.00 81.86  ? 170 LEU A CD2   1 
ATOM   1273 N  N     . ASN A 1 174 ? -31.392 26.742 1.380   1.00 87.07  ? 171 ASN A N     1 
ATOM   1274 C  CA    . ASN A 1 174 ? -31.173 26.435 2.780   1.00 88.25  ? 171 ASN A CA    1 
ATOM   1275 C  C     . ASN A 1 174 ? -30.482 27.577 3.504   1.00 87.55  ? 171 ASN A C     1 
ATOM   1276 O  O     . ASN A 1 174 ? -30.852 27.920 4.620   1.00 88.22  ? 171 ASN A O     1 
ATOM   1277 C  CB    . ASN A 1 174 ? -30.398 25.135 2.939   1.00 89.93  ? 171 ASN A CB    1 
ATOM   1278 C  CG    . ASN A 1 174 ? -31.280 23.918 2.768   1.00 92.04  ? 171 ASN A CG    1 
ATOM   1279 O  OD1   . ASN A 1 174 ? -32.482 23.964 3.056   1.00 93.24  ? 171 ASN A OD1   1 
ATOM   1280 N  ND2   . ASN A 1 174 ? -30.694 22.818 2.297   1.00 93.82  ? 171 ASN A ND2   1 
ATOM   1281 N  N     . VAL A 1 175 ? -29.490 28.178 2.858   1.00 86.31  ? 172 VAL A N     1 
ATOM   1282 C  CA    . VAL A 1 175 ? -28.865 29.384 3.383   1.00 85.38  ? 172 VAL A CA    1 
ATOM   1283 C  C     . VAL A 1 175 ? -29.887 30.524 3.430   1.00 84.39  ? 172 VAL A C     1 
ATOM   1284 O  O     . VAL A 1 175 ? -29.950 31.264 4.409   1.00 84.52  ? 172 VAL A O     1 
ATOM   1285 C  CB    . VAL A 1 175 ? -27.618 29.789 2.550   1.00 84.80  ? 172 VAL A CB    1 
ATOM   1286 C  CG1   . VAL A 1 175 ? -27.216 31.262 2.795   1.00 83.69  ? 172 VAL A CG1   1 
ATOM   1287 C  CG2   . VAL A 1 175 ? -26.461 28.840 2.829   1.00 85.08  ? 172 VAL A CG2   1 
ATOM   1288 N  N     . LEU A 1 176 ? -30.695 30.656 2.383   1.00 83.40  ? 173 LEU A N     1 
ATOM   1289 C  CA    . LEU A 1 176 ? -31.667 31.744 2.331   1.00 82.68  ? 173 LEU A CA    1 
ATOM   1290 C  C     . LEU A 1 176 ? -32.704 31.652 3.453   1.00 83.87  ? 173 LEU A C     1 
ATOM   1291 O  O     . LEU A 1 176 ? -32.928 32.635 4.174   1.00 83.98  ? 173 LEU A O     1 
ATOM   1292 C  CB    . LEU A 1 176 ? -32.339 31.836 0.951   1.00 81.53  ? 173 LEU A CB    1 
ATOM   1293 C  CG    . LEU A 1 176 ? -33.330 32.966 0.607   1.00 80.14  ? 173 LEU A CG    1 
ATOM   1294 C  CD1   . LEU A 1 176 ? -33.102 34.261 1.374   1.00 79.50  ? 173 LEU A CD1   1 
ATOM   1295 C  CD2   . LEU A 1 176 ? -33.283 33.241 -0.877  1.00 78.69  ? 173 LEU A CD2   1 
ATOM   1296 N  N     . THR A 1 177 ? -33.312 30.480 3.621   1.00 84.85  ? 174 THR A N     1 
ATOM   1297 C  CA    . THR A 1 177 ? -34.391 30.334 4.585   1.00 86.06  ? 174 THR A CA    1 
ATOM   1298 C  C     . THR A 1 177 ? -33.910 30.242 6.034   1.00 87.88  ? 174 THR A C     1 
ATOM   1299 O  O     . THR A 1 177 ? -34.680 29.909 6.928   1.00 89.16  ? 174 THR A O     1 
ATOM   1300 C  CB    . THR A 1 177 ? -35.266 29.150 4.250   1.00 86.60  ? 174 THR A CB    1 
ATOM   1301 O  OG1   . THR A 1 177 ? -34.473 27.963 4.282   1.00 87.90  ? 174 THR A OG1   1 
ATOM   1302 C  CG2   . THR A 1 177 ? -35.854 29.322 2.875   1.00 85.10  ? 174 THR A CG2   1 
ATOM   1303 N  N     . SER A 1 178 ? -32.635 30.539 6.259   1.00 88.49  ? 175 SER A N     1 
ATOM   1304 C  CA    . SER A 1 178 ? -32.115 30.755 7.606   1.00 90.25  ? 175 SER A CA    1 
ATOM   1305 C  C     . SER A 1 178 ? -32.575 32.119 8.089   1.00 90.07  ? 175 SER A C     1 
ATOM   1306 O  O     . SER A 1 178 ? -32.745 32.325 9.299   1.00 91.52  ? 175 SER A O     1 
ATOM   1307 C  CB    . SER A 1 178 ? -30.595 30.727 7.615   1.00 90.41  ? 175 SER A CB    1 
ATOM   1308 O  OG    . SER A 1 178 ? -30.110 29.804 6.660   1.00 92.05  ? 175 SER A OG    1 
ATOM   1309 N  N     . ILE A 1 179 ? -32.765 33.048 7.144   1.00 88.76  ? 176 ILE A N     1 
ATOM   1310 C  CA    . ILE A 1 179 ? -33.347 34.365 7.438   1.00 88.31  ? 176 ILE A CA    1 
ATOM   1311 C  C     . ILE A 1 179 ? -34.826 34.163 7.744   1.00 88.99  ? 176 ILE A C     1 
ATOM   1312 O  O     . ILE A 1 179 ? -35.252 34.311 8.899   1.00 90.42  ? 176 ILE A O     1 
ATOM   1313 C  CB    . ILE A 1 179 ? -33.162 35.406 6.287   1.00 86.61  ? 176 ILE A CB    1 
ATOM   1314 C  CG1   . ILE A 1 179 ? -31.689 35.527 5.837   1.00 87.52  ? 176 ILE A CG1   1 
ATOM   1315 C  CG2   . ILE A 1 179 ? -33.704 36.766 6.690   1.00 85.23  ? 176 ILE A CG2   1 
ATOM   1316 C  CD1   . ILE A 1 179 ? -30.610 35.539 6.963   1.00 89.92  ? 176 ILE A CD1   1 
ATOM   1317 N  N     . ALA A 1 180 ? -35.605 33.802 6.725   1.00 88.07  ? 177 ALA A N     1 
ATOM   1318 C  CA    . ALA A 1 180 ? -37.024 33.496 6.939   1.00 88.64  ? 177 ALA A CA    1 
ATOM   1319 C  C     . ALA A 1 180 ? -37.543 32.481 5.929   1.00 88.18  ? 177 ALA A C     1 
ATOM   1320 O  O     . ALA A 1 180 ? -36.839 32.138 4.980   1.00 87.46  ? 177 ALA A O     1 
ATOM   1321 C  CB    . ALA A 1 180 ? -37.863 34.765 6.927   1.00 88.07  ? 177 ALA A CB    1 
ATOM   1322 N  N     . ILE A 1 181 ? -38.756 31.981 6.158   1.00 88.60  ? 178 ILE A N     1 
ATOM   1323 C  CA    . ILE A 1 181 ? -39.366 30.996 5.270   1.00 88.17  ? 178 ILE A CA    1 
ATOM   1324 C  C     . ILE A 1 181 ? -40.554 31.621 4.546   1.00 87.56  ? 178 ILE A C     1 
ATOM   1325 O  O     . ILE A 1 181 ? -41.418 32.225 5.198   1.00 88.32  ? 178 ILE A O     1 
ATOM   1326 C  CB    . ILE A 1 181 ? -39.794 29.718 6.038   1.00 89.88  ? 178 ILE A CB    1 
ATOM   1327 C  CG1   . ILE A 1 181 ? -38.578 28.844 6.328   1.00 89.92  ? 178 ILE A CG1   1 
ATOM   1328 C  CG2   . ILE A 1 181 ? -40.819 28.903 5.255   1.00 90.05  ? 178 ILE A CG2   1 
ATOM   1329 C  CD1   . ILE A 1 181 ? -38.920 27.534 7.004   1.00 91.56  ? 178 ILE A CD1   1 
ATOM   1330 N  N     . PRO A 1 182 ? -40.599 31.484 3.197   1.00 86.22  ? 179 PRO A N     1 
ATOM   1331 C  CA    . PRO A 1 182 ? -41.695 32.026 2.401   1.00 85.56  ? 179 PRO A CA    1 
ATOM   1332 C  C     . PRO A 1 182 ? -42.933 31.161 2.518   1.00 86.96  ? 179 PRO A C     1 
ATOM   1333 O  O     . PRO A 1 182 ? -42.836 30.007 2.930   1.00 88.10  ? 179 PRO A O     1 
ATOM   1334 C  CB    . PRO A 1 182 ? -41.152 31.951 0.976   1.00 84.20  ? 179 PRO A CB    1 
ATOM   1335 C  CG    . PRO A 1 182 ? -40.233 30.801 0.988   1.00 84.28  ? 179 PRO A CG    1 
ATOM   1336 C  CD    . PRO A 1 182 ? -39.612 30.780 2.353   1.00 85.42  ? 179 PRO A CD    1 
ATOM   1337 N  N     . LYS A 1 183 ? -44.089 31.705 2.170   1.00 87.18  ? 180 LYS A N     1 
ATOM   1338 C  CA    . LYS A 1 183 ? -45.274 30.873 2.054   1.00 88.94  ? 180 LYS A CA    1 
ATOM   1339 C  C     . LYS A 1 183 ? -45.221 30.140 0.722   1.00 88.62  ? 180 LYS A C     1 
ATOM   1340 O  O     . LYS A 1 183 ? -45.407 28.918 0.666   1.00 89.82  ? 180 LYS A O     1 
ATOM   1341 C  CB    . LYS A 1 183 ? -46.546 31.708 2.105   1.00 89.55  ? 180 LYS A CB    1 
ATOM   1342 C  CG    . LYS A 1 183 ? -46.930 32.219 3.461   1.00 91.53  ? 180 LYS A CG    1 
ATOM   1343 C  CD    . LYS A 1 183 ? -48.089 33.180 3.321   1.00 93.30  ? 180 LYS A CD    1 
ATOM   1344 C  CE    . LYS A 1 183 ? -48.268 34.010 4.567   1.00 95.41  ? 180 LYS A CE    1 
ATOM   1345 N  NZ    . LYS A 1 183 ? -49.012 35.255 4.239   1.00 97.03  ? 180 LYS A NZ    1 
ATOM   1346 N  N     . VAL A 1 184 ? -44.955 30.905 -0.341  1.00 87.25  ? 181 VAL A N     1 
ATOM   1347 C  CA    . VAL A 1 184 ? -45.062 30.441 -1.725  1.00 86.78  ? 181 VAL A CA    1 
ATOM   1348 C  C     . VAL A 1 184 ? -43.787 30.739 -2.520  1.00 85.42  ? 181 VAL A C     1 
ATOM   1349 O  O     . VAL A 1 184 ? -43.280 31.863 -2.500  1.00 84.30  ? 181 VAL A O     1 
ATOM   1350 C  CB    . VAL A 1 184 ? -46.265 31.111 -2.467  1.00 86.76  ? 181 VAL A CB    1 
ATOM   1351 C  CG1   . VAL A 1 184 ? -46.559 30.396 -3.781  1.00 86.56  ? 181 VAL A CG1   1 
ATOM   1352 C  CG2   . VAL A 1 184 ? -47.518 31.150 -1.598  1.00 87.97  ? 181 VAL A CG2   1 
ATOM   1353 N  N     . ILE A 1 185 ? -43.283 29.723 -3.216  1.00 85.68  ? 182 ILE A N     1 
ATOM   1354 C  CA    . ILE A 1 185 ? -42.209 29.892 -4.188  1.00 84.90  ? 182 ILE A CA    1 
ATOM   1355 C  C     . ILE A 1 185 ? -42.748 29.633 -5.599  1.00 85.49  ? 182 ILE A C     1 
ATOM   1356 O  O     . ILE A 1 185 ? -43.239 28.538 -5.904  1.00 86.54  ? 182 ILE A O     1 
ATOM   1357 C  CB    . ILE A 1 185 ? -41.018 28.971 -3.889  1.00 84.83  ? 182 ILE A CB    1 
ATOM   1358 C  CG1   . ILE A 1 185 ? -40.173 29.553 -2.767  1.00 84.42  ? 182 ILE A CG1   1 
ATOM   1359 C  CG2   . ILE A 1 185 ? -40.142 28.811 -5.103  1.00 84.17  ? 182 ILE A CG2   1 
ATOM   1360 C  CD1   . ILE A 1 185 ? -39.220 28.557 -2.154  1.00 84.79  ? 182 ILE A CD1   1 
ATOM   1361 N  N     . HIS A 1 186 ? -42.656 30.656 -6.450  1.00 85.10  ? 183 HIS A N     1 
ATOM   1362 C  CA    . HIS A 1 186 ? -43.130 30.582 -7.824  1.00 85.38  ? 183 HIS A CA    1 
ATOM   1363 C  C     . HIS A 1 186 ? -41.975 30.429 -8.792  1.00 85.14  ? 183 HIS A C     1 
ATOM   1364 O  O     . HIS A 1 186 ? -41.052 31.241 -8.809  1.00 84.29  ? 183 HIS A O     1 
ATOM   1365 C  CB    . HIS A 1 186 ? -43.918 31.831 -8.188  1.00 84.83  ? 183 HIS A CB    1 
ATOM   1366 C  CG    . HIS A 1 186 ? -44.481 31.795 -9.570  1.00 85.03  ? 183 HIS A CG    1 
ATOM   1367 N  ND1   . HIS A 1 186 ? -45.821 31.602 -9.819  1.00 85.90  ? 183 HIS A ND1   1 
ATOM   1368 C  CD2   . HIS A 1 186 ? -43.884 31.899 -10.780 1.00 85.08  ? 183 HIS A CD2   1 
ATOM   1369 C  CE1   . HIS A 1 186 ? -46.029 31.603 -11.122 1.00 86.29  ? 183 HIS A CE1   1 
ATOM   1370 N  NE2   . HIS A 1 186 ? -44.869 31.774 -11.729 1.00 85.99  ? 183 HIS A NE2   1 
ATOM   1371 N  N     . SER A 1 187 ? -42.043 29.395 -9.617  1.00 86.43  ? 184 SER A N     1 
ATOM   1372 C  CA    . SER A 1 187 ? -41.017 29.158 -10.614 1.00 86.63  ? 184 SER A CA    1 
ATOM   1373 C  C     . SER A 1 187 ? -41.629 28.702 -11.922 1.00 87.77  ? 184 SER A C     1 
ATOM   1374 O  O     . SER A 1 187 ? -42.818 28.365 -11.982 1.00 88.43  ? 184 SER A O     1 
ATOM   1375 C  CB    . SER A 1 187 ? -40.050 28.090 -10.116 1.00 87.07  ? 184 SER A CB    1 
ATOM   1376 O  OG    . SER A 1 187 ? -40.706 26.842 -9.968  1.00 88.04  ? 184 SER A OG    1 
ATOM   1377 N  N     . ASP A 1 188 ? -40.798 28.704 -12.964 1.00 88.26  ? 185 ASP A N     1 
ATOM   1378 C  CA    . ASP A 1 188 ? -41.121 28.088 -14.258 1.00 89.76  ? 185 ASP A CA    1 
ATOM   1379 C  C     . ASP A 1 188 ? -40.986 26.568 -14.149 1.00 90.26  ? 185 ASP A C     1 
ATOM   1380 O  O     . ASP A 1 188 ? -40.402 26.062 -13.191 1.00 90.23  ? 185 ASP A O     1 
ATOM   1381 C  CB    . ASP A 1 188 ? -40.195 28.632 -15.364 1.00 89.96  ? 185 ASP A CB    1 
ATOM   1382 C  CG    . ASP A 1 188 ? -38.687 28.428 -15.043 1.00 92.64  ? 185 ASP A CG    1 
ATOM   1383 O  OD1   . ASP A 1 188 ? -37.997 29.454 -14.778 1.00 94.99  ? 185 ASP A OD1   1 
ATOM   1384 O  OD2   . ASP A 1 188 ? -38.199 27.256 -15.047 1.00 94.86  ? 185 ASP A OD2   1 
ATOM   1385 N  N     . GLN A 1 189 ? -41.500 25.845 -15.137 1.00 90.83  ? 186 GLN A N     1 
ATOM   1386 C  CA    . GLN A 1 189 ? -41.507 24.389 -15.070 1.00 91.77  ? 186 GLN A CA    1 
ATOM   1387 C  C     . GLN A 1 189 ? -40.192 23.744 -15.501 1.00 91.94  ? 186 GLN A C     1 
ATOM   1388 O  O     . GLN A 1 189 ? -40.185 22.597 -15.934 1.00 92.75  ? 186 GLN A O     1 
ATOM   1389 C  CB    . GLN A 1 189 ? -42.673 23.813 -15.871 1.00 92.82  ? 186 GLN A CB    1 
ATOM   1390 C  CG    . GLN A 1 189 ? -44.046 24.163 -15.320 1.00 92.49  ? 186 GLN A CG    1 
ATOM   1391 C  CD    . GLN A 1 189 ? -45.168 23.561 -16.139 1.00 93.62  ? 186 GLN A CD    1 
ATOM   1392 O  OE1   . GLN A 1 189 ? -45.083 22.416 -16.578 1.00 94.47  ? 186 GLN A OE1   1 
ATOM   1393 N  NE2   . GLN A 1 189 ? -46.227 24.334 -16.356 1.00 93.94  ? 186 GLN A NE2   1 
ATOM   1394 N  N     . GLY A 1 190 ? -39.087 24.477 -15.362 1.00 91.31  ? 187 GLY A N     1 
ATOM   1395 C  CA    . GLY A 1 190 ? -37.740 23.947 -15.623 1.00 91.98  ? 187 GLY A CA    1 
ATOM   1396 C  C     . GLY A 1 190 ? -37.384 22.769 -14.729 1.00 93.30  ? 187 GLY A C     1 
ATOM   1397 O  O     . GLY A 1 190 ? -37.722 22.753 -13.541 1.00 93.42  ? 187 GLY A O     1 
ATOM   1398 N  N     . ALA A 1 191 ? -36.691 21.785 -15.304 1.00 94.58  ? 188 ALA A N     1 
ATOM   1399 C  CA    . ALA A 1 191 ? -36.405 20.497 -14.637 1.00 96.04  ? 188 ALA A CA    1 
ATOM   1400 C  C     . ALA A 1 191 ? -35.964 20.624 -13.171 1.00 95.95  ? 188 ALA A C     1 
ATOM   1401 O  O     . ALA A 1 191 ? -36.320 19.788 -12.328 1.00 96.91  ? 188 ALA A O     1 
ATOM   1402 C  CB    . ALA A 1 191 ? -35.368 19.686 -15.445 1.00 96.76  ? 188 ALA A CB    1 
ATOM   1403 N  N     . ALA A 1 192 ? -35.206 21.682 -12.883 1.00 94.88  ? 189 ALA A N     1 
ATOM   1404 C  CA    . ALA A 1 192 ? -34.627 21.903 -11.564 1.00 94.74  ? 189 ALA A CA    1 
ATOM   1405 C  C     . ALA A 1 192 ? -35.669 22.060 -10.461 1.00 94.94  ? 189 ALA A C     1 
ATOM   1406 O  O     . ALA A 1 192 ? -35.380 21.786 -9.300  1.00 95.57  ? 189 ALA A O     1 
ATOM   1407 C  CB    . ALA A 1 192 ? -33.725 23.107 -11.594 1.00 93.52  ? 189 ALA A CB    1 
ATOM   1408 N  N     . PHE A 1 193 ? -36.875 22.496 -10.821 1.00 94.64  ? 190 PHE A N     1 
ATOM   1409 C  CA    . PHE A 1 193 ? -37.896 22.809 -9.824  1.00 94.53  ? 190 PHE A CA    1 
ATOM   1410 C  C     . PHE A 1 193 ? -39.065 21.850 -9.878  1.00 95.74  ? 190 PHE A C     1 
ATOM   1411 O  O     . PHE A 1 193 ? -39.859 21.774 -8.943  1.00 96.31  ? 190 PHE A O     1 
ATOM   1412 C  CB    . PHE A 1 193 ? -38.414 24.236 -10.010 1.00 93.38  ? 190 PHE A CB    1 
ATOM   1413 C  CG    . PHE A 1 193 ? -37.340 25.252 -10.234 1.00 91.90  ? 190 PHE A CG    1 
ATOM   1414 C  CD1   . PHE A 1 193 ? -36.288 25.382 -9.339  1.00 91.45  ? 190 PHE A CD1   1 
ATOM   1415 C  CD2   . PHE A 1 193 ? -37.399 26.096 -11.331 1.00 91.74  ? 190 PHE A CD2   1 
ATOM   1416 C  CE1   . PHE A 1 193 ? -35.303 26.325 -9.538  1.00 91.08  ? 190 PHE A CE1   1 
ATOM   1417 C  CE2   . PHE A 1 193 ? -36.417 27.054 -11.541 1.00 91.69  ? 190 PHE A CE2   1 
ATOM   1418 C  CZ    . PHE A 1 193 ? -35.363 27.168 -10.639 1.00 91.03  ? 190 PHE A CZ    1 
ATOM   1419 N  N     . THR A 1 194 ? -39.182 21.135 -10.985 1.00 96.30  ? 191 THR A N     1 
ATOM   1420 C  CA    . THR A 1 194 ? -40.277 20.201 -11.158 1.00 97.99  ? 191 THR A CA    1 
ATOM   1421 C  C     . THR A 1 194 ? -39.894 18.803 -10.687 1.00 99.31  ? 191 THR A C     1 
ATOM   1422 O  O     . THR A 1 194 ? -40.689 17.873 -10.775 1.00 100.68 ? 191 THR A O     1 
ATOM   1423 C  CB    . THR A 1 194 ? -40.740 20.156 -12.621 1.00 98.19  ? 191 THR A CB    1 
ATOM   1424 O  OG1   . THR A 1 194 ? -39.597 20.076 -13.480 1.00 98.62  ? 191 THR A OG1   1 
ATOM   1425 C  CG2   . THR A 1 194 ? -41.512 21.407 -12.958 1.00 97.40  ? 191 THR A CG2   1 
ATOM   1426 N  N     . SER A 1 195 ? -38.671 18.663 -10.187 1.00 99.20  ? 192 SER A N     1 
ATOM   1427 C  CA    . SER A 1 195 ? -38.206 17.395 -9.627  1.00 100.68 ? 192 SER A CA    1 
ATOM   1428 C  C     . SER A 1 195 ? -38.951 17.063 -8.335  1.00 101.34 ? 192 SER A C     1 
ATOM   1429 O  O     . SER A 1 195 ? -39.437 17.954 -7.636  1.00 100.57 ? 192 SER A O     1 
ATOM   1430 C  CB    . SER A 1 195 ? -36.700 17.435 -9.352  1.00 100.51 ? 192 SER A CB    1 
ATOM   1431 O  OG    . SER A 1 195 ? -36.445 17.853 -8.017  1.00 100.70 ? 192 SER A OG    1 
ATOM   1432 N  N     . SER A 1 196 ? -39.022 15.775 -8.022  1.00 102.75 ? 193 SER A N     1 
ATOM   1433 C  CA    . SER A 1 196 ? -39.699 15.314 -6.816  1.00 103.81 ? 193 SER A CA    1 
ATOM   1434 C  C     . SER A 1 196 ? -38.882 15.569 -5.546  1.00 103.33 ? 193 SER A C     1 
ATOM   1435 O  O     . SER A 1 196 ? -39.438 15.610 -4.442  1.00 103.89 ? 193 SER A O     1 
ATOM   1436 C  CB    . SER A 1 196 ? -40.074 13.831 -6.942  1.00 106.00 ? 193 SER A CB    1 
ATOM   1437 O  OG    . SER A 1 196 ? -39.090 13.106 -7.660  1.00 106.94 ? 193 SER A OG    1 
ATOM   1438 N  N     . THR A 1 197 ? -37.569 15.747 -5.709  1.00 102.19 ? 194 THR A N     1 
ATOM   1439 C  CA    . THR A 1 197 ? -36.680 16.059 -4.584  1.00 101.66 ? 194 THR A CA    1 
ATOM   1440 C  C     . THR A 1 197 ? -36.977 17.459 -4.087  1.00 99.90  ? 194 THR A C     1 
ATOM   1441 O  O     . THR A 1 197 ? -36.975 17.711 -2.881  1.00 100.13 ? 194 THR A O     1 
ATOM   1442 C  CB    . THR A 1 197 ? -35.190 16.006 -4.972  1.00 101.26 ? 194 THR A CB    1 
ATOM   1443 O  OG1   . THR A 1 197 ? -34.965 14.950 -5.913  1.00 102.81 ? 194 THR A OG1   1 
ATOM   1444 C  CG2   . THR A 1 197 ? -34.325 15.784 -3.744  1.00 101.60 ? 194 THR A CG2   1 
ATOM   1445 N  N     . PHE A 1 198 ? -37.236 18.365 -5.027  1.00 98.12  ? 195 PHE A N     1 
ATOM   1446 C  CA    . PHE A 1 198 ? -37.546 19.744 -4.689  1.00 96.40  ? 195 PHE A CA    1 
ATOM   1447 C  C     . PHE A 1 198 ? -38.895 19.871 -3.992  1.00 97.08  ? 195 PHE A C     1 
ATOM   1448 O  O     . PHE A 1 198 ? -38.998 20.532 -2.961  1.00 96.97  ? 195 PHE A O     1 
ATOM   1449 C  CB    . PHE A 1 198 ? -37.480 20.642 -5.919  1.00 94.65  ? 195 PHE A CB    1 
ATOM   1450 C  CG    . PHE A 1 198 ? -37.520 22.100 -5.594  1.00 92.49  ? 195 PHE A CG    1 
ATOM   1451 C  CD1   . PHE A 1 198 ? -36.561 22.664 -4.762  1.00 91.42  ? 195 PHE A CD1   1 
ATOM   1452 C  CD2   . PHE A 1 198 ? -38.517 22.911 -6.114  1.00 91.28  ? 195 PHE A CD2   1 
ATOM   1453 C  CE1   . PHE A 1 198 ? -36.601 24.014 -4.449  1.00 90.28  ? 195 PHE A CE1   1 
ATOM   1454 C  CE2   . PHE A 1 198 ? -38.566 24.264 -5.809  1.00 89.68  ? 195 PHE A CE2   1 
ATOM   1455 C  CZ    . PHE A 1 198 ? -37.608 24.819 -4.978  1.00 89.19  ? 195 PHE A CZ    1 
ATOM   1456 N  N     . ALA A 1 199 ? -39.915 19.218 -4.546  1.00 98.15  ? 196 ALA A N     1 
ATOM   1457 C  CA    . ALA A 1 199 ? -41.247 19.166 -3.936  1.00 99.20  ? 196 ALA A CA    1 
ATOM   1458 C  C     . ALA A 1 199 ? -41.196 18.768 -2.460  1.00 100.58 ? 196 ALA A C     1 
ATOM   1459 O  O     . ALA A 1 199 ? -41.921 19.331 -1.638  1.00 100.61 ? 196 ALA A O     1 
ATOM   1460 C  CB    . ALA A 1 199 ? -42.150 18.221 -4.712  1.00 100.30 ? 196 ALA A CB    1 
ATOM   1461 N  N     . GLU A 1 200 ? -40.329 17.807 -2.135  1.00 101.89 ? 197 GLU A N     1 
ATOM   1462 C  CA    . GLU A 1 200 ? -40.182 17.322 -0.758  1.00 103.92 ? 197 GLU A CA    1 
ATOM   1463 C  C     . GLU A 1 200 ? -39.478 18.319 0.128   1.00 102.58 ? 197 GLU A C     1 
ATOM   1464 O  O     . GLU A 1 200 ? -39.984 18.660 1.194   1.00 103.15 ? 197 GLU A O     1 
ATOM   1465 C  CB    . GLU A 1 200 ? -39.425 16.002 -0.708  1.00 105.63 ? 197 GLU A CB    1 
ATOM   1466 C  CG    . GLU A 1 200 ? -40.298 14.779 -0.850  1.00 110.30 ? 197 GLU A CG    1 
ATOM   1467 C  CD    . GLU A 1 200 ? -39.512 13.592 -1.380  1.00 115.25 ? 197 GLU A CD    1 
ATOM   1468 O  OE1   . GLU A 1 200 ? -38.275 13.538 -1.159  1.00 116.22 ? 197 GLU A OE1   1 
ATOM   1469 O  OE2   . GLU A 1 200 ? -40.130 12.716 -2.030  1.00 118.40 ? 197 GLU A OE2   1 
ATOM   1470 N  N     . TRP A 1 201 ? -38.307 18.777 -0.309  1.00 101.06 ? 198 TRP A N     1 
ATOM   1471 C  CA    . TRP A 1 201 ? -37.609 19.841 0.387   1.00 99.83  ? 198 TRP A CA    1 
ATOM   1472 C  C     . TRP A 1 201 ? -38.618 20.919 0.767   1.00 99.31  ? 198 TRP A C     1 
ATOM   1473 O  O     . TRP A 1 201 ? -38.645 21.377 1.913   1.00 99.80  ? 198 TRP A O     1 
ATOM   1474 C  CB    . TRP A 1 201 ? -36.511 20.444 -0.486  1.00 98.06  ? 198 TRP A CB    1 
ATOM   1475 C  CG    . TRP A 1 201 ? -35.880 21.651 0.144   1.00 96.57  ? 198 TRP A CG    1 
ATOM   1476 C  CD1   . TRP A 1 201 ? -34.809 21.665 0.984   1.00 97.16  ? 198 TRP A CD1   1 
ATOM   1477 C  CD2   . TRP A 1 201 ? -36.300 23.014 0.009   1.00 94.31  ? 198 TRP A CD2   1 
ATOM   1478 N  NE1   . TRP A 1 201 ? -34.522 22.950 1.370   1.00 95.56  ? 198 TRP A NE1   1 
ATOM   1479 C  CE2   . TRP A 1 201 ? -35.426 23.798 0.791   1.00 94.06  ? 198 TRP A CE2   1 
ATOM   1480 C  CE3   . TRP A 1 201 ? -37.322 23.649 -0.703  1.00 92.92  ? 198 TRP A CE3   1 
ATOM   1481 C  CZ2   . TRP A 1 201 ? -35.542 25.184 0.882   1.00 92.98  ? 198 TRP A CZ2   1 
ATOM   1482 C  CZ3   . TRP A 1 201 ? -37.440 25.025 -0.614  1.00 91.96  ? 198 TRP A CZ3   1 
ATOM   1483 C  CH2   . TRP A 1 201 ? -36.552 25.780 0.170   1.00 92.11  ? 198 TRP A CH2   1 
ATOM   1484 N  N     . ALA A 1 202 ? -39.453 21.295 -0.202  1.00 98.45  ? 199 ALA A N     1 
ATOM   1485 C  CA    . ALA A 1 202 ? -40.457 22.335 -0.021  1.00 97.86  ? 199 ALA A CA    1 
ATOM   1486 C  C     . ALA A 1 202 ? -41.558 21.910 0.943   1.00 99.64  ? 199 ALA A C     1 
ATOM   1487 O  O     . ALA A 1 202 ? -41.969 22.690 1.807   1.00 99.59  ? 199 ALA A O     1 
ATOM   1488 C  CB    . ALA A 1 202 ? -41.039 22.746 -1.357  1.00 96.66  ? 199 ALA A CB    1 
ATOM   1489 N  N     . LYS A 1 203 ? -42.028 20.673 0.805   1.00 101.37 ? 200 LYS A N     1 
ATOM   1490 C  CA    . LYS A 1 203 ? -43.097 20.186 1.670   1.00 103.43 ? 200 LYS A CA    1 
ATOM   1491 C  C     . LYS A 1 203 ? -42.666 20.218 3.135   1.00 104.10 ? 200 LYS A C     1 
ATOM   1492 O  O     . LYS A 1 203 ? -43.400 20.734 3.978   1.00 104.86 ? 200 LYS A O     1 
ATOM   1493 C  CB    . LYS A 1 203 ? -43.569 18.788 1.265   1.00 105.18 ? 200 LYS A CB    1 
ATOM   1494 C  CG    . LYS A 1 203 ? -44.880 18.403 1.934   1.00 108.32 ? 200 LYS A CG    1 
ATOM   1495 C  CD    . LYS A 1 203 ? -45.532 17.211 1.267   1.00 111.68 ? 200 LYS A CD    1 
ATOM   1496 C  CE    . LYS A 1 203 ? -47.049 17.333 1.345   1.00 113.74 ? 200 LYS A CE    1 
ATOM   1497 N  NZ    . LYS A 1 203 ? -47.729 16.058 0.939   1.00 116.92 ? 200 LYS A NZ    1 
ATOM   1498 N  N     . GLU A 1 204 ? -41.467 19.699 3.413   1.00 103.75 ? 201 GLU A N     1 
ATOM   1499 C  CA    . GLU A 1 204 ? -40.891 19.684 4.757   1.00 104.17 ? 201 GLU A CA    1 
ATOM   1500 C  C     . GLU A 1 204 ? -41.001 21.011 5.459   1.00 102.72 ? 201 GLU A C     1 
ATOM   1501 O  O     . GLU A 1 204 ? -41.324 21.057 6.637   1.00 104.27 ? 201 GLU A O     1 
ATOM   1502 C  CB    . GLU A 1 204 ? -39.424 19.293 4.714   1.00 104.05 ? 201 GLU A CB    1 
ATOM   1503 C  CG    . GLU A 1 204 ? -39.170 17.847 5.056   1.00 107.82 ? 201 GLU A CG    1 
ATOM   1504 C  CD    . GLU A 1 204 ? -37.870 17.322 4.463   1.00 110.25 ? 201 GLU A CD    1 
ATOM   1505 O  OE1   . GLU A 1 204 ? -37.079 18.115 3.882   1.00 109.91 ? 201 GLU A OE1   1 
ATOM   1506 O  OE2   . GLU A 1 204 ? -37.646 16.098 4.575   1.00 112.80 ? 201 GLU A OE2   1 
ATOM   1507 N  N     . ARG A 1 205 ? -40.739 22.091 4.738   1.00 99.92  ? 202 ARG A N     1 
ATOM   1508 C  CA    . ARG A 1 205 ? -40.712 23.408 5.350   1.00 98.33  ? 202 ARG A CA    1 
ATOM   1509 C  C     . ARG A 1 205 ? -42.074 24.108 5.323   1.00 98.32  ? 202 ARG A C     1 
ATOM   1510 O  O     . ARG A 1 205 ? -42.223 25.195 5.875   1.00 97.98  ? 202 ARG A O     1 
ATOM   1511 C  CB    . ARG A 1 205 ? -39.622 24.253 4.700   1.00 96.10  ? 202 ARG A CB    1 
ATOM   1512 C  CG    . ARG A 1 205 ? -38.351 23.462 4.475   1.00 95.31  ? 202 ARG A CG    1 
ATOM   1513 C  CD    . ARG A 1 205 ? -37.122 24.341 4.355   1.00 93.18  ? 202 ARG A CD    1 
ATOM   1514 N  NE    . ARG A 1 205 ? -35.850 23.631 4.547   1.00 92.68  ? 202 ARG A NE    1 
ATOM   1515 C  CZ    . ARG A 1 205 ? -35.625 22.339 4.297   1.00 92.76  ? 202 ARG A CZ    1 
ATOM   1516 N  NH1   . ARG A 1 205 ? -36.575 21.543 3.816   1.00 92.97  ? 202 ARG A NH1   1 
ATOM   1517 N  NH2   . ARG A 1 205 ? -34.419 21.841 4.512   1.00 92.60  ? 202 ARG A NH2   1 
ATOM   1518 N  N     . GLY A 1 206 ? -43.069 23.473 4.706   1.00 98.83  ? 203 GLY A N     1 
ATOM   1519 C  CA    . GLY A 1 206 ? -44.411 24.048 4.618   1.00 98.96  ? 203 GLY A CA    1 
ATOM   1520 C  C     . GLY A 1 206 ? -44.459 25.183 3.618   1.00 97.04  ? 203 GLY A C     1 
ATOM   1521 O  O     . GLY A 1 206 ? -45.072 26.220 3.853   1.00 96.65  ? 203 GLY A O     1 
ATOM   1522 N  N     . ILE A 1 207 ? -43.785 24.982 2.497   1.00 96.02  ? 204 ILE A N     1 
ATOM   1523 C  CA    . ILE A 1 207 ? -43.763 25.958 1.417   1.00 94.35  ? 204 ILE A CA    1 
ATOM   1524 C  C     . ILE A 1 207 ? -44.575 25.390 0.251   1.00 94.96  ? 204 ILE A C     1 
ATOM   1525 O  O     . ILE A 1 207 ? -44.371 24.237 -0.161  1.00 95.54  ? 204 ILE A O     1 
ATOM   1526 C  CB    . ILE A 1 207 ? -42.305 26.292 0.971   1.00 92.57  ? 204 ILE A CB    1 
ATOM   1527 C  CG1   . ILE A 1 207 ? -41.476 26.795 2.161   1.00 91.76  ? 204 ILE A CG1   1 
ATOM   1528 C  CG2   . ILE A 1 207 ? -42.305 27.312 -0.166  1.00 90.68  ? 204 ILE A CG2   1 
ATOM   1529 C  CD1   . ILE A 1 207 ? -40.001 26.960 1.873   1.00 89.20  ? 204 ILE A CD1   1 
ATOM   1530 N  N     . HIS A 1 208 ? -45.512 26.191 -0.256  1.00 94.92  ? 205 HIS A N     1 
ATOM   1531 C  CA    . HIS A 1 208 ? -46.305 25.793 -1.415  1.00 95.46  ? 205 HIS A CA    1 
ATOM   1532 C  C     . HIS A 1 208 ? -45.567 26.141 -2.700  1.00 93.49  ? 205 HIS A C     1 
ATOM   1533 O  O     . HIS A 1 208 ? -45.140 27.281 -2.887  1.00 92.10  ? 205 HIS A O     1 
ATOM   1534 C  CB    . HIS A 1 208 ? -47.679 26.460 -1.397  1.00 96.35  ? 205 HIS A CB    1 
ATOM   1535 C  CG    . HIS A 1 208 ? -48.600 25.964 -2.469  1.00 98.82  ? 205 HIS A CG    1 
ATOM   1536 N  ND1   . HIS A 1 208 ? -48.971 26.738 -3.552  1.00 99.58  ? 205 HIS A ND1   1 
ATOM   1537 C  CD2   . HIS A 1 208 ? -49.219 24.769 -2.630  1.00 101.96 ? 205 HIS A CD2   1 
ATOM   1538 C  CE1   . HIS A 1 208 ? -49.784 26.045 -4.331  1.00 100.87 ? 205 HIS A CE1   1 
ATOM   1539 N  NE2   . HIS A 1 208 ? -49.950 24.847 -3.794  1.00 103.19 ? 205 HIS A NE2   1 
ATOM   1540 N  N     . LEU A 1 209 ? -45.399 25.149 -3.570  1.00 93.52  ? 206 LEU A N     1 
ATOM   1541 C  CA    . LEU A 1 209 ? -44.810 25.385 -4.880  1.00 91.93  ? 206 LEU A CA    1 
ATOM   1542 C  C     . LEU A 1 209 ? -45.896 25.759 -5.878  1.00 92.51  ? 206 LEU A C     1 
ATOM   1543 O  O     . LEU A 1 209 ? -47.020 25.243 -5.821  1.00 94.07  ? 206 LEU A O     1 
ATOM   1544 C  CB    . LEU A 1 209 ? -44.034 24.173 -5.369  1.00 91.71  ? 206 LEU A CB    1 
ATOM   1545 C  CG    . LEU A 1 209 ? -42.784 23.806 -4.587  1.00 90.63  ? 206 LEU A CG    1 
ATOM   1546 C  CD1   . LEU A 1 209 ? -42.045 22.742 -5.340  1.00 90.93  ? 206 LEU A CD1   1 
ATOM   1547 C  CD2   . LEU A 1 209 ? -41.895 25.002 -4.377  1.00 88.58  ? 206 LEU A CD2   1 
ATOM   1548 N  N     . GLU A 1 210 ? -45.549 26.666 -6.785  1.00 91.46  ? 207 GLU A N     1 
ATOM   1549 C  CA    . GLU A 1 210 ? -46.495 27.242 -7.719  1.00 91.76  ? 207 GLU A CA    1 
ATOM   1550 C  C     . GLU A 1 210 ? -45.760 27.443 -9.022  1.00 90.57  ? 207 GLU A C     1 
ATOM   1551 O  O     . GLU A 1 210 ? -44.680 28.044 -9.037  1.00 89.83  ? 207 GLU A O     1 
ATOM   1552 C  CB    . GLU A 1 210 ? -46.988 28.585 -7.186  1.00 91.43  ? 207 GLU A CB    1 
ATOM   1553 C  CG    . GLU A 1 210 ? -47.943 29.314 -8.107  1.00 93.34  ? 207 GLU A CG    1 
ATOM   1554 C  CD    . GLU A 1 210 ? -48.392 30.648 -7.539  1.00 95.69  ? 207 GLU A CD    1 
ATOM   1555 O  OE1   . GLU A 1 210 ? -49.176 30.660 -6.563  1.00 98.47  ? 207 GLU A OE1   1 
ATOM   1556 O  OE2   . GLU A 1 210 ? -47.963 31.693 -8.067  1.00 95.34  ? 207 GLU A OE2   1 
ATOM   1557 N  N     . PHE A 1 211 ? -46.339 26.948 -10.113 1.00 90.75  ? 208 PHE A N     1 
ATOM   1558 C  CA    . PHE A 1 211 ? -45.660 26.967 -11.405 1.00 89.48  ? 208 PHE A CA    1 
ATOM   1559 C  C     . PHE A 1 211 ? -46.364 27.776 -12.491 1.00 89.22  ? 208 PHE A C     1 
ATOM   1560 O  O     . PHE A 1 211 ? -47.586 27.691 -12.644 1.00 90.48  ? 208 PHE A O     1 
ATOM   1561 C  CB    . PHE A 1 211 ? -45.482 25.546 -11.906 1.00 90.30  ? 208 PHE A CB    1 
ATOM   1562 C  CG    . PHE A 1 211 ? -44.723 24.667 -10.974 1.00 90.24  ? 208 PHE A CG    1 
ATOM   1563 C  CD1   . PHE A 1 211 ? -43.331 24.656 -10.988 1.00 89.14  ? 208 PHE A CD1   1 
ATOM   1564 C  CD2   . PHE A 1 211 ? -45.392 23.831 -10.098 1.00 91.22  ? 208 PHE A CD2   1 
ATOM   1565 C  CE1   . PHE A 1 211 ? -42.616 23.830 -10.136 1.00 89.26  ? 208 PHE A CE1   1 
ATOM   1566 C  CE2   . PHE A 1 211 ? -44.687 23.004 -9.245  1.00 92.08  ? 208 PHE A CE2   1 
ATOM   1567 C  CZ    . PHE A 1 211 ? -43.291 23.003 -9.266  1.00 90.95  ? 208 PHE A CZ    1 
ATOM   1568 N  N     . SER A 1 212 ? -45.577 28.536 -13.256 1.00 87.73  ? 209 SER A N     1 
ATOM   1569 C  CA    . SER A 1 212 ? -46.047 29.191 -14.490 1.00 87.15  ? 209 SER A CA    1 
ATOM   1570 C  C     . SER A 1 212 ? -46.564 28.166 -15.494 1.00 87.92  ? 209 SER A C     1 
ATOM   1571 O  O     . SER A 1 212 ? -46.076 27.035 -15.534 1.00 88.51  ? 209 SER A O     1 
ATOM   1572 C  CB    . SER A 1 212 ? -44.907 29.966 -15.151 1.00 85.83  ? 209 SER A CB    1 
ATOM   1573 O  OG    . SER A 1 212 ? -44.132 30.663 -14.196 1.00 85.13  ? 209 SER A OG    1 
ATOM   1574 N  N     . THR A 1 213 ? -47.541 28.555 -16.311 1.00 87.96  ? 210 THR A N     1 
ATOM   1575 C  CA    . THR A 1 213 ? -47.973 27.713 -17.429 1.00 88.58  ? 210 THR A CA    1 
ATOM   1576 C  C     . THR A 1 213 ? -46.737 27.446 -18.283 1.00 87.64  ? 210 THR A C     1 
ATOM   1577 O  O     . THR A 1 213 ? -45.797 28.241 -18.249 1.00 86.56  ? 210 THR A O     1 
ATOM   1578 C  CB    . THR A 1 213 ? -49.062 28.399 -18.273 1.00 89.06  ? 210 THR A CB    1 
ATOM   1579 O  OG1   . THR A 1 213 ? -48.754 29.788 -18.393 1.00 88.69  ? 210 THR A OG1   1 
ATOM   1580 C  CG2   . THR A 1 213 ? -50.405 28.284 -17.611 1.00 90.19  ? 210 THR A CG2   1 
ATOM   1581 N  N     . PRO A 1 214 ? -46.708 26.328 -19.035 1.00 88.23  ? 211 PRO A N     1 
ATOM   1582 C  CA    . PRO A 1 214 ? -45.465 26.041 -19.743 1.00 87.54  ? 211 PRO A CA    1 
ATOM   1583 C  C     . PRO A 1 214 ? -45.143 27.053 -20.849 1.00 86.86  ? 211 PRO A C     1 
ATOM   1584 O  O     . PRO A 1 214 ? -46.043 27.592 -21.499 1.00 87.08  ? 211 PRO A O     1 
ATOM   1585 C  CB    . PRO A 1 214 ? -45.696 24.644 -20.312 1.00 88.75  ? 211 PRO A CB    1 
ATOM   1586 C  CG    . PRO A 1 214 ? -47.142 24.516 -20.441 1.00 89.76  ? 211 PRO A CG    1 
ATOM   1587 C  CD    . PRO A 1 214 ? -47.780 25.384 -19.398 1.00 89.78  ? 211 PRO A CD    1 
ATOM   1588 N  N     . TYR A 1 215 ? -43.851 27.314 -21.010 1.00 86.22  ? 212 TYR A N     1 
ATOM   1589 C  CA    . TYR A 1 215 ? -43.313 28.242 -22.009 1.00 85.98  ? 212 TYR A CA    1 
ATOM   1590 C  C     . TYR A 1 215 ? -43.965 29.628 -22.023 1.00 85.68  ? 212 TYR A C     1 
ATOM   1591 O  O     . TYR A 1 215 ? -44.407 30.114 -23.078 1.00 86.23  ? 212 TYR A O     1 
ATOM   1592 C  CB    . TYR A 1 215 ? -43.349 27.612 -23.396 1.00 86.95  ? 212 TYR A CB    1 
ATOM   1593 C  CG    . TYR A 1 215 ? -42.613 26.308 -23.475 1.00 87.21  ? 212 TYR A CG    1 
ATOM   1594 C  CD1   . TYR A 1 215 ? -41.265 26.265 -23.835 1.00 87.13  ? 212 TYR A CD1   1 
ATOM   1595 C  CD2   . TYR A 1 215 ? -43.262 25.115 -23.196 1.00 87.98  ? 212 TYR A CD2   1 
ATOM   1596 C  CE1   . TYR A 1 215 ? -40.584 25.055 -23.920 1.00 88.45  ? 212 TYR A CE1   1 
ATOM   1597 C  CE2   . TYR A 1 215 ? -42.598 23.904 -23.273 1.00 89.60  ? 212 TYR A CE2   1 
ATOM   1598 C  CZ    . TYR A 1 215 ? -41.262 23.877 -23.635 1.00 89.53  ? 212 TYR A CZ    1 
ATOM   1599 O  OH    . TYR A 1 215 ? -40.615 22.667 -23.707 1.00 90.58  ? 212 TYR A OH    1 
ATOM   1600 N  N     . HIS A 1 216 ? -44.005 30.253 -20.846 1.00 84.76  ? 213 HIS A N     1 
ATOM   1601 C  CA    . HIS A 1 216 ? -44.560 31.585 -20.691 1.00 84.16  ? 213 HIS A CA    1 
ATOM   1602 C  C     . HIS A 1 216 ? -43.777 32.308 -19.605 1.00 83.33  ? 213 HIS A C     1 
ATOM   1603 O  O     . HIS A 1 216 ? -44.201 32.348 -18.458 1.00 83.33  ? 213 HIS A O     1 
ATOM   1604 C  CB    . HIS A 1 216 ? -46.049 31.499 -20.342 1.00 84.78  ? 213 HIS A CB    1 
ATOM   1605 C  CG    . HIS A 1 216 ? -46.795 32.773 -20.565 1.00 83.83  ? 213 HIS A CG    1 
ATOM   1606 N  ND1   . HIS A 1 216 ? -47.315 33.521 -19.532 1.00 83.18  ? 213 HIS A ND1   1 
ATOM   1607 C  CD2   . HIS A 1 216 ? -47.103 33.438 -21.704 1.00 83.45  ? 213 HIS A CD2   1 
ATOM   1608 C  CE1   . HIS A 1 216 ? -47.911 34.593 -20.025 1.00 83.30  ? 213 HIS A CE1   1 
ATOM   1609 N  NE2   . HIS A 1 216 ? -47.797 34.566 -21.340 1.00 83.21  ? 213 HIS A NE2   1 
ATOM   1610 N  N     . PRO A 1 217 ? -42.612 32.870 -19.960 1.00 83.01  ? 214 PRO A N     1 
ATOM   1611 C  CA    . PRO A 1 217 ? -41.770 33.558 -18.983 1.00 82.37  ? 214 PRO A CA    1 
ATOM   1612 C  C     . PRO A 1 217 ? -42.402 34.799 -18.389 1.00 82.49  ? 214 PRO A C     1 
ATOM   1613 O  O     . PRO A 1 217 ? -42.011 35.200 -17.300 1.00 81.99  ? 214 PRO A O     1 
ATOM   1614 C  CB    . PRO A 1 217 ? -40.534 33.940 -19.790 1.00 81.59  ? 214 PRO A CB    1 
ATOM   1615 C  CG    . PRO A 1 217 ? -40.486 32.941 -20.859 1.00 82.62  ? 214 PRO A CG    1 
ATOM   1616 C  CD    . PRO A 1 217 ? -41.919 32.730 -21.247 1.00 83.37  ? 214 PRO A CD    1 
ATOM   1617 N  N     . GLN A 1 218 ? -43.372 35.389 -19.080 1.00 83.61  ? 215 GLN A N     1 
ATOM   1618 C  CA    . GLN A 1 218 ? -44.112 36.534 -18.547 1.00 84.70  ? 215 GLN A CA    1 
ATOM   1619 C  C     . GLN A 1 218 ? -44.702 36.299 -17.135 1.00 85.00  ? 215 GLN A C     1 
ATOM   1620 O  O     . GLN A 1 218 ? -44.838 37.247 -16.357 1.00 84.77  ? 215 GLN A O     1 
ATOM   1621 C  CB    . GLN A 1 218 ? -45.234 36.960 -19.505 1.00 85.97  ? 215 GLN A CB    1 
ATOM   1622 C  CG    . GLN A 1 218 ? -44.770 37.557 -20.839 1.00 89.01  ? 215 GLN A CG    1 
ATOM   1623 C  CD    . GLN A 1 218 ? -44.699 36.523 -21.979 1.00 93.92  ? 215 GLN A CD    1 
ATOM   1624 O  OE1   . GLN A 1 218 ? -44.039 35.476 -21.861 1.00 95.88  ? 215 GLN A OE1   1 
ATOM   1625 N  NE2   . GLN A 1 218 ? -45.379 36.822 -23.090 1.00 95.07  ? 215 GLN A NE2   1 
ATOM   1626 N  N     . SER A 1 219 ? -45.056 35.046 -16.821 1.00 85.78  ? 216 SER A N     1 
ATOM   1627 C  CA    . SER A 1 219 ? -45.622 34.667 -15.517 1.00 85.84  ? 216 SER A CA    1 
ATOM   1628 C  C     . SER A 1 219 ? -44.579 34.734 -14.412 1.00 85.18  ? 216 SER A C     1 
ATOM   1629 O  O     . SER A 1 219 ? -44.910 35.032 -13.274 1.00 85.53  ? 216 SER A O     1 
ATOM   1630 C  CB    . SER A 1 219 ? -46.199 33.257 -15.566 1.00 86.97  ? 216 SER A CB    1 
ATOM   1631 O  OG    . SER A 1 219 ? -46.883 33.003 -16.784 1.00 87.77  ? 216 SER A OG    1 
ATOM   1632 N  N     . SER A 1 220 ? -43.322 34.444 -14.752 1.00 84.67  ? 217 SER A N     1 
ATOM   1633 C  CA    . SER A 1 220 ? -42.183 34.632 -13.842 1.00 84.00  ? 217 SER A CA    1 
ATOM   1634 C  C     . SER A 1 220 ? -41.591 36.043 -13.969 1.00 82.76  ? 217 SER A C     1 
ATOM   1635 O  O     . SER A 1 220 ? -40.439 36.286 -13.589 1.00 81.91  ? 217 SER A O     1 
ATOM   1636 C  CB    . SER A 1 220 ? -41.101 33.593 -14.141 1.00 84.24  ? 217 SER A CB    1 
ATOM   1637 O  OG    . SER A 1 220 ? -41.593 32.278 -13.948 1.00 86.56  ? 217 SER A OG    1 
ATOM   1638 N  N     . GLY A 1 221 ? -42.406 36.961 -14.489 1.00 82.63  ? 218 GLY A N     1 
ATOM   1639 C  CA    . GLY A 1 221 ? -41.987 38.294 -14.921 1.00 81.63  ? 218 GLY A CA    1 
ATOM   1640 C  C     . GLY A 1 221 ? -41.177 39.087 -13.921 1.00 80.86  ? 218 GLY A C     1 
ATOM   1641 O  O     . GLY A 1 221 ? -40.262 39.819 -14.308 1.00 80.32  ? 218 GLY A O     1 
ATOM   1642 N  N     . LYS A 1 222 ? -41.510 38.943 -12.637 1.00 80.81  ? 219 LYS A N     1 
ATOM   1643 C  CA    . LYS A 1 222 ? -40.768 39.625 -11.582 1.00 79.95  ? 219 LYS A CA    1 
ATOM   1644 C  C     . LYS A 1 222 ? -39.307 39.197 -11.553 1.00 79.45  ? 219 LYS A C     1 
ATOM   1645 O  O     . LYS A 1 222 ? -38.435 40.054 -11.609 1.00 79.15  ? 219 LYS A O     1 
ATOM   1646 C  CB    . LYS A 1 222 ? -41.438 39.492 -10.219 1.00 80.16  ? 219 LYS A CB    1 
ATOM   1647 C  CG    . LYS A 1 222 ? -42.402 40.624 -9.937  1.00 80.64  ? 219 LYS A CG    1 
ATOM   1648 C  CD    . LYS A 1 222 ? -42.565 40.849 -8.440  1.00 82.44  ? 219 LYS A CD    1 
ATOM   1649 C  CE    . LYS A 1 222 ? -42.739 42.335 -8.067  1.00 82.98  ? 219 LYS A CE    1 
ATOM   1650 N  NZ    . LYS A 1 222 ? -44.150 42.854 -8.172  1.00 83.55  ? 219 LYS A NZ    1 
ATOM   1651 N  N     . VAL A 1 223 ? -39.026 37.896 -11.516 1.00 79.59  ? 220 VAL A N     1 
ATOM   1652 C  CA    . VAL A 1 223 ? -37.630 37.454 -11.604 1.00 79.39  ? 220 VAL A CA    1 
ATOM   1653 C  C     . VAL A 1 223 ? -37.019 37.853 -12.934 1.00 79.31  ? 220 VAL A C     1 
ATOM   1654 O  O     . VAL A 1 223 ? -35.915 38.398 -12.967 1.00 79.11  ? 220 VAL A O     1 
ATOM   1655 C  CB    . VAL A 1 223 ? -37.437 35.937 -11.573 1.00 79.96  ? 220 VAL A CB    1 
ATOM   1656 C  CG1   . VAL A 1 223 ? -36.074 35.610 -10.973 1.00 79.75  ? 220 VAL A CG1   1 
ATOM   1657 C  CG2   . VAL A 1 223 ? -38.551 35.237 -10.850 1.00 80.81  ? 220 VAL A CG2   1 
ATOM   1658 N  N     . GLU A 1 224 ? -37.726 37.540 -14.026 1.00 79.55  ? 221 GLU A N     1 
ATOM   1659 C  CA    . GLU A 1 224 ? -37.188 37.714 -15.375 1.00 79.32  ? 221 GLU A CA    1 
ATOM   1660 C  C     . GLU A 1 224 ? -36.733 39.146 -15.573 1.00 78.45  ? 221 GLU A C     1 
ATOM   1661 O  O     . GLU A 1 224 ? -35.643 39.388 -16.102 1.00 78.30  ? 221 GLU A O     1 
ATOM   1662 C  CB    . GLU A 1 224 ? -38.206 37.328 -16.452 1.00 79.98  ? 221 GLU A CB    1 
ATOM   1663 C  CG    . GLU A 1 224 ? -38.591 35.852 -16.477 1.00 81.94  ? 221 GLU A CG    1 
ATOM   1664 C  CD    . GLU A 1 224 ? -37.440 34.906 -16.806 1.00 84.08  ? 221 GLU A CD    1 
ATOM   1665 O  OE1   . GLU A 1 224 ? -36.540 35.244 -17.601 1.00 85.01  ? 221 GLU A OE1   1 
ATOM   1666 O  OE2   . GLU A 1 224 ? -37.448 33.788 -16.269 1.00 86.51  ? 221 GLU A OE2   1 
ATOM   1667 N  N     . ARG A 1 225 ? -37.563 40.082 -15.113 1.00 77.60  ? 222 ARG A N     1 
ATOM   1668 C  CA    . ARG A 1 225 ? -37.245 41.495 -15.185 1.00 76.65  ? 222 ARG A CA    1 
ATOM   1669 C  C     . ARG A 1 225 ? -36.015 41.846 -14.356 1.00 76.33  ? 222 ARG A C     1 
ATOM   1670 O  O     . ARG A 1 225 ? -35.230 42.714 -14.726 1.00 75.97  ? 222 ARG A O     1 
ATOM   1671 C  CB    . ARG A 1 225 ? -38.437 42.319 -14.730 1.00 76.47  ? 222 ARG A CB    1 
ATOM   1672 C  CG    . ARG A 1 225 ? -38.237 43.789 -14.888 1.00 74.89  ? 222 ARG A CG    1 
ATOM   1673 C  CD    . ARG A 1 225 ? -37.759 44.110 -16.288 1.00 73.28  ? 222 ARG A CD    1 
ATOM   1674 N  NE    . ARG A 1 225 ? -37.735 45.542 -16.482 1.00 72.53  ? 222 ARG A NE    1 
ATOM   1675 C  CZ    . ARG A 1 225 ? -36.756 46.325 -16.060 1.00 72.09  ? 222 ARG A CZ    1 
ATOM   1676 N  NH1   . ARG A 1 225 ? -35.706 45.802 -15.447 1.00 70.81  ? 222 ARG A NH1   1 
ATOM   1677 N  NH2   . ARG A 1 225 ? -36.833 47.632 -16.254 1.00 73.18  ? 222 ARG A NH2   1 
ATOM   1678 N  N     . LYS A 1 226 ? -35.860 41.165 -13.232 1.00 76.60  ? 223 LYS A N     1 
ATOM   1679 C  CA    . LYS A 1 226 ? -34.717 41.374 -12.359 1.00 76.87  ? 223 LYS A CA    1 
ATOM   1680 C  C     . LYS A 1 226 ? -33.486 40.714 -12.970 1.00 77.05  ? 223 LYS A C     1 
ATOM   1681 O  O     . LYS A 1 226 ? -32.369 41.196 -12.797 1.00 77.08  ? 223 LYS A O     1 
ATOM   1682 C  CB    . LYS A 1 226 ? -35.019 40.830 -10.953 1.00 77.19  ? 223 LYS A CB    1 
ATOM   1683 C  CG    . LYS A 1 226 ? -34.033 41.218 -9.847  1.00 78.05  ? 223 LYS A CG    1 
ATOM   1684 C  CD    . LYS A 1 226 ? -34.035 42.710 -9.523  1.00 80.15  ? 223 LYS A CD    1 
ATOM   1685 C  CE    . LYS A 1 226 ? -35.286 43.155 -8.779  1.00 81.70  ? 223 LYS A CE    1 
ATOM   1686 N  NZ    . LYS A 1 226 ? -35.094 44.525 -8.210  1.00 82.59  ? 223 LYS A NZ    1 
ATOM   1687 N  N     . ASN A 1 227 ? -33.689 39.623 -13.701 1.00 77.51  ? 224 ASN A N     1 
ATOM   1688 C  CA    . ASN A 1 227 ? -32.603 39.024 -14.449 1.00 78.26  ? 224 ASN A CA    1 
ATOM   1689 C  C     . ASN A 1 227 ? -31.932 40.085 -15.308 1.00 78.48  ? 224 ASN A C     1 
ATOM   1690 O  O     . ASN A 1 227 ? -30.717 40.240 -15.286 1.00 78.86  ? 224 ASN A O     1 
ATOM   1691 C  CB    . ASN A 1 227 ? -33.107 37.870 -15.309 1.00 78.74  ? 224 ASN A CB    1 
ATOM   1692 C  CG    . ASN A 1 227 ? -33.372 36.617 -14.501 1.00 79.92  ? 224 ASN A CG    1 
ATOM   1693 O  OD1   . ASN A 1 227 ? -32.845 36.453 -13.398 1.00 80.13  ? 224 ASN A OD1   1 
ATOM   1694 N  ND2   . ASN A 1 227 ? -34.189 35.718 -15.047 1.00 81.48  ? 224 ASN A ND2   1 
ATOM   1695 N  N     . SER A 1 228 ? -32.749 40.841 -16.031 1.00 78.71  ? 225 SER A N     1 
ATOM   1696 C  CA    . SER A 1 228 ? -32.288 41.925 -16.881 1.00 78.83  ? 225 SER A CA    1 
ATOM   1697 C  C     . SER A 1 228 ? -31.341 42.867 -16.149 1.00 78.55  ? 225 SER A C     1 
ATOM   1698 O  O     . SER A 1 228 ? -30.203 43.047 -16.564 1.00 79.13  ? 225 SER A O     1 
ATOM   1699 C  CB    . SER A 1 228 ? -33.494 42.683 -17.430 1.00 78.89  ? 225 SER A CB    1 
ATOM   1700 O  OG    . SER A 1 228 ? -33.104 43.735 -18.281 1.00 80.27  ? 225 SER A OG    1 
ATOM   1701 N  N     . ASP A 1 229 ? -31.790 43.441 -15.043 1.00 78.09  ? 226 ASP A N     1 
ATOM   1702 C  CA    . ASP A 1 229 ? -30.965 44.408 -14.322 1.00 78.23  ? 226 ASP A CA    1 
ATOM   1703 C  C     . ASP A 1 229 ? -29.653 43.876 -13.785 1.00 77.53  ? 226 ASP A C     1 
ATOM   1704 O  O     . ASP A 1 229 ? -28.624 44.547 -13.890 1.00 77.55  ? 226 ASP A O     1 
ATOM   1705 C  CB    . ASP A 1 229 ? -31.754 45.040 -13.197 1.00 78.71  ? 226 ASP A CB    1 
ATOM   1706 C  CG    . ASP A 1 229 ? -32.813 45.969 -13.707 1.00 81.46  ? 226 ASP A CG    1 
ATOM   1707 O  OD1   . ASP A 1 229 ? -32.785 46.304 -14.929 1.00 84.13  ? 226 ASP A OD1   1 
ATOM   1708 O  OD2   . ASP A 1 229 ? -33.668 46.359 -12.882 1.00 84.80  ? 226 ASP A OD2   1 
ATOM   1709 N  N     . ILE A 1 230 ? -29.703 42.680 -13.202 1.00 76.70  ? 227 ILE A N     1 
ATOM   1710 C  CA    . ILE A 1 230 ? -28.494 41.954 -12.804 1.00 76.27  ? 227 ILE A CA    1 
ATOM   1711 C  C     . ILE A 1 230 ? -27.481 41.908 -13.961 1.00 76.41  ? 227 ILE A C     1 
ATOM   1712 O  O     . ILE A 1 230 ? -26.313 42.292 -13.801 1.00 77.17  ? 227 ILE A O     1 
ATOM   1713 C  CB    . ILE A 1 230 ? -28.808 40.515 -12.363 1.00 76.10  ? 227 ILE A CB    1 
ATOM   1714 C  CG1   . ILE A 1 230 ? -29.757 40.516 -11.170 1.00 75.45  ? 227 ILE A CG1   1 
ATOM   1715 C  CG2   . ILE A 1 230 ? -27.528 39.787 -12.024 1.00 76.28  ? 227 ILE A CG2   1 
ATOM   1716 C  CD1   . ILE A 1 230 ? -30.368 39.177 -10.895 1.00 75.58  ? 227 ILE A CD1   1 
ATOM   1717 N  N     . LYS A 1 231 ? -27.939 41.454 -15.124 1.00 75.34  ? 228 LYS A N     1 
ATOM   1718 C  CA    . LYS A 1 231 ? -27.078 41.347 -16.270 1.00 74.93  ? 228 LYS A CA    1 
ATOM   1719 C  C     . LYS A 1 231 ? -26.575 42.712 -16.735 1.00 75.07  ? 228 LYS A C     1 
ATOM   1720 O  O     . LYS A 1 231 ? -25.383 42.883 -17.007 1.00 75.61  ? 228 LYS A O     1 
ATOM   1721 C  CB    . LYS A 1 231 ? -27.794 40.616 -17.380 1.00 74.62  ? 228 LYS A CB    1 
ATOM   1722 C  CG    . LYS A 1 231 ? -27.630 39.135 -17.310 1.00 74.04  ? 228 LYS A CG    1 
ATOM   1723 C  CD    . LYS A 1 231 ? -28.297 38.538 -18.506 1.00 74.78  ? 228 LYS A CD    1 
ATOM   1724 C  CE    . LYS A 1 231 ? -27.798 37.163 -18.818 1.00 75.77  ? 228 LYS A CE    1 
ATOM   1725 N  NZ    . LYS A 1 231 ? -28.204 36.848 -20.204 1.00 77.20  ? 228 LYS A NZ    1 
ATOM   1726 N  N     . ARG A 1 232 ? -27.472 43.689 -16.795 1.00 74.49  ? 229 ARG A N     1 
ATOM   1727 C  CA    . ARG A 1 232 ? -27.108 45.010 -17.299 1.00 74.75  ? 229 ARG A CA    1 
ATOM   1728 C  C     . ARG A 1 232 ? -26.038 45.684 -16.429 1.00 74.74  ? 229 ARG A C     1 
ATOM   1729 O  O     . ARG A 1 232 ? -25.135 46.337 -16.957 1.00 75.42  ? 229 ARG A O     1 
ATOM   1730 C  CB    . ARG A 1 232 ? -28.349 45.893 -17.466 1.00 74.44  ? 229 ARG A CB    1 
ATOM   1731 C  CG    . ARG A 1 232 ? -28.062 47.296 -17.996 1.00 75.74  ? 229 ARG A CG    1 
ATOM   1732 C  CD    . ARG A 1 232 ? -29.340 48.018 -18.371 1.00 78.14  ? 229 ARG A CD    1 
ATOM   1733 N  NE    . ARG A 1 232 ? -30.244 48.168 -17.233 1.00 79.19  ? 229 ARG A NE    1 
ATOM   1734 C  CZ    . ARG A 1 232 ? -30.574 49.331 -16.684 1.00 79.91  ? 229 ARG A CZ    1 
ATOM   1735 N  NH1   . ARG A 1 232 ? -30.085 50.467 -17.176 1.00 80.33  ? 229 ARG A NH1   1 
ATOM   1736 N  NH2   . ARG A 1 232 ? -31.404 49.354 -15.646 1.00 80.19  ? 229 ARG A NH2   1 
ATOM   1737 N  N     . LEU A 1 233 ? -26.128 45.509 -15.110 1.00 74.01  ? 230 LEU A N     1 
ATOM   1738 C  CA    . LEU A 1 233 ? -25.128 46.072 -14.192 1.00 73.96  ? 230 LEU A CA    1 
ATOM   1739 C  C     . LEU A 1 233 ? -23.785 45.334 -14.256 1.00 74.53  ? 230 LEU A C     1 
ATOM   1740 O  O     . LEU A 1 233 ? -22.731 45.975 -14.351 1.00 75.43  ? 230 LEU A O     1 
ATOM   1741 C  CB    . LEU A 1 233 ? -25.648 46.120 -12.751 1.00 73.47  ? 230 LEU A CB    1 
ATOM   1742 C  CG    . LEU A 1 233 ? -24.764 46.719 -11.652 1.00 73.16  ? 230 LEU A CG    1 
ATOM   1743 C  CD1   . LEU A 1 233 ? -24.371 48.139 -11.949 1.00 73.44  ? 230 LEU A CD1   1 
ATOM   1744 C  CD2   . LEU A 1 233 ? -25.536 46.681 -10.374 1.00 73.02  ? 230 LEU A CD2   1 
ATOM   1745 N  N     . LEU A 1 234 ? -23.828 44.001 -14.207 1.00 73.84  ? 231 LEU A N     1 
ATOM   1746 C  CA    . LEU A 1 234 ? -22.635 43.181 -14.409 1.00 74.14  ? 231 LEU A CA    1 
ATOM   1747 C  C     . LEU A 1 234 ? -21.885 43.638 -15.660 1.00 75.04  ? 231 LEU A C     1 
ATOM   1748 O  O     . LEU A 1 234 ? -20.670 43.853 -15.641 1.00 75.99  ? 231 LEU A O     1 
ATOM   1749 C  CB    . LEU A 1 234 ? -23.017 41.706 -14.535 1.00 73.60  ? 231 LEU A CB    1 
ATOM   1750 C  CG    . LEU A 1 234 ? -23.213 40.969 -13.219 1.00 72.52  ? 231 LEU A CG    1 
ATOM   1751 C  CD1   . LEU A 1 234 ? -23.916 39.664 -13.444 1.00 71.22  ? 231 LEU A CD1   1 
ATOM   1752 C  CD2   . LEU A 1 234 ? -21.889 40.748 -12.536 1.00 72.78  ? 231 LEU A CD2   1 
ATOM   1753 N  N     . THR A 1 235 ? -22.638 43.798 -16.742 1.00 74.79  ? 232 THR A N     1 
ATOM   1754 C  CA    . THR A 1 235 ? -22.112 44.288 -17.999 1.00 75.50  ? 232 THR A CA    1 
ATOM   1755 C  C     . THR A 1 235 ? -21.331 45.586 -17.809 1.00 76.26  ? 232 THR A C     1 
ATOM   1756 O  O     . THR A 1 235 ? -20.191 45.693 -18.263 1.00 77.51  ? 232 THR A O     1 
ATOM   1757 C  CB    . THR A 1 235 ? -23.254 44.494 -19.006 1.00 74.84  ? 232 THR A CB    1 
ATOM   1758 O  OG1   . THR A 1 235 ? -23.828 43.228 -19.312 1.00 74.23  ? 232 THR A OG1   1 
ATOM   1759 C  CG2   . THR A 1 235 ? -22.748 45.090 -20.270 1.00 75.79  ? 232 THR A CG2   1 
ATOM   1760 N  N     . LYS A 1 236 ? -21.945 46.553 -17.125 1.00 75.67  ? 233 LYS A N     1 
ATOM   1761 C  CA    . LYS A 1 236 ? -21.375 47.886 -16.981 1.00 76.34  ? 233 LYS A CA    1 
ATOM   1762 C  C     . LYS A 1 236 ? -20.091 47.868 -16.172 1.00 77.66  ? 233 LYS A C     1 
ATOM   1763 O  O     . LYS A 1 236 ? -19.150 48.611 -16.465 1.00 78.86  ? 233 LYS A O     1 
ATOM   1764 C  CB    . LYS A 1 236 ? -22.378 48.831 -16.341 1.00 75.16  ? 233 LYS A CB    1 
ATOM   1765 C  CG    . LYS A 1 236 ? -23.530 49.208 -17.244 1.00 74.47  ? 233 LYS A CG    1 
ATOM   1766 C  CD    . LYS A 1 236 ? -24.281 50.397 -16.661 1.00 74.11  ? 233 LYS A CD    1 
ATOM   1767 C  CE    . LYS A 1 236 ? -25.690 50.534 -17.203 1.00 72.42  ? 233 LYS A CE    1 
ATOM   1768 N  NZ    . LYS A 1 236 ? -26.615 50.937 -16.109 1.00 71.40  ? 233 LYS A NZ    1 
ATOM   1769 N  N     . LEU A 1 237 ? -20.048 47.013 -15.158 1.00 77.82  ? 234 LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 237 ? -18.856 46.884 -14.339 1.00 79.28  ? 234 LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 237 ? -17.757 46.162 -15.089 1.00 81.32  ? 234 LEU A C     1 
ATOM   1772 O  O     . LEU A 1 237 ? -16.581 46.447 -14.890 1.00 82.99  ? 234 LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 237 ? -19.171 46.155 -13.044 1.00 78.32  ? 234 LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 237 ? -20.247 46.844 -12.217 1.00 77.16  ? 234 LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 237 ? -20.635 45.969 -11.048 1.00 77.60  ? 234 LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 237 ? -19.795 48.217 -11.752 1.00 77.07  ? 234 LEU A CD2   1 
ATOM   1777 N  N     . LEU A 1 238 ? -18.144 45.248 -15.969 1.00 82.03  ? 235 LEU A N     1 
ATOM   1778 C  CA    . LEU A 1 238 ? -17.180 44.422 -16.677 1.00 84.06  ? 235 LEU A CA    1 
ATOM   1779 C  C     . LEU A 1 238 ? -16.590 45.019 -17.955 1.00 86.21  ? 235 LEU A C     1 
ATOM   1780 O  O     . LEU A 1 238 ? -15.721 44.393 -18.569 1.00 87.67  ? 235 LEU A O     1 
ATOM   1781 C  CB    . LEU A 1 238 ? -17.777 43.054 -16.962 1.00 83.30  ? 235 LEU A CB    1 
ATOM   1782 C  CG    . LEU A 1 238 ? -17.906 42.211 -15.708 1.00 82.33  ? 235 LEU A CG    1 
ATOM   1783 C  CD1   . LEU A 1 238 ? -18.560 40.926 -16.093 1.00 82.24  ? 235 LEU A CD1   1 
ATOM   1784 C  CD2   . LEU A 1 238 ? -16.556 41.961 -15.068 1.00 83.06  ? 235 LEU A CD2   1 
ATOM   1785 N  N     . VAL A 1 239 ? -17.039 46.215 -18.352 1.00 87.11  ? 236 VAL A N     1 
ATOM   1786 C  CA    . VAL A 1 239 ? -16.502 46.886 -19.553 1.00 89.29  ? 236 VAL A CA    1 
ATOM   1787 C  C     . VAL A 1 239 ? -14.997 47.052 -19.394 1.00 91.89  ? 236 VAL A C     1 
ATOM   1788 O  O     . VAL A 1 239 ? -14.521 47.377 -18.299 1.00 92.25  ? 236 VAL A O     1 
ATOM   1789 C  CB    . VAL A 1 239 ? -17.139 48.272 -19.809 1.00 88.54  ? 236 VAL A CB    1 
ATOM   1790 C  CG1   . VAL A 1 239 ? -16.752 48.773 -21.174 1.00 89.70  ? 236 VAL A CG1   1 
ATOM   1791 C  CG2   . VAL A 1 239 ? -18.639 48.201 -19.719 1.00 87.05  ? 236 VAL A CG2   1 
ATOM   1792 N  N     . GLY A 1 240 ? -14.250 46.802 -20.466 1.00 94.29  ? 237 GLY A N     1 
ATOM   1793 C  CA    . GLY A 1 240 ? -12.799 46.857 -20.399 1.00 97.64  ? 237 GLY A CA    1 
ATOM   1794 C  C     . GLY A 1 240 ? -12.235 45.564 -19.843 1.00 99.24  ? 237 GLY A C     1 
ATOM   1795 O  O     . GLY A 1 240 ? -11.487 44.876 -20.526 1.00 101.02 ? 237 GLY A O     1 
ATOM   1796 N  N     . ARG A 1 241 ? -12.611 45.228 -18.608 1.00 99.29  ? 238 ARG A N     1 
ATOM   1797 C  CA    . ARG A 1 241 ? -12.138 44.015 -17.903 1.00 100.68 ? 238 ARG A CA    1 
ATOM   1798 C  C     . ARG A 1 241 ? -12.565 42.684 -18.545 1.00 100.68 ? 238 ARG A C     1 
ATOM   1799 O  O     . ARG A 1 241 ? -13.490 42.658 -19.359 1.00 99.72  ? 238 ARG A O     1 
ATOM   1800 C  CB    . ARG A 1 241 ? -12.607 44.045 -16.440 1.00 99.60  ? 238 ARG A CB    1 
ATOM   1801 C  CG    . ARG A 1 241 ? -11.708 44.835 -15.524 1.00 102.14 ? 238 ARG A CG    1 
ATOM   1802 C  CD    . ARG A 1 241 ? -12.523 45.763 -14.655 1.00 104.38 ? 238 ARG A CD    1 
ATOM   1803 N  NE    . ARG A 1 241 ? -11.834 47.044 -14.496 1.00 108.89 ? 238 ARG A NE    1 
ATOM   1804 C  CZ    . ARG A 1 241 ? -12.428 48.210 -14.226 1.00 109.55 ? 238 ARG A CZ    1 
ATOM   1805 N  NH1   . ARG A 1 241 ? -13.752 48.289 -14.072 1.00 108.05 ? 238 ARG A NH1   1 
ATOM   1806 N  NH2   . ARG A 1 241 ? -11.684 49.307 -14.115 1.00 110.86 ? 238 ARG A NH2   1 
ATOM   1807 N  N     . PRO A 1 242 ? -11.875 41.578 -18.189 1.00 102.04 ? 239 PRO A N     1 
ATOM   1808 C  CA    . PRO A 1 242 ? -12.385 40.236 -18.489 1.00 102.12 ? 239 PRO A CA    1 
ATOM   1809 C  C     . PRO A 1 242 ? -13.551 39.915 -17.559 1.00 100.58 ? 239 PRO A C     1 
ATOM   1810 O  O     . PRO A 1 242 ? -13.667 40.525 -16.487 1.00 100.04 ? 239 PRO A O     1 
ATOM   1811 C  CB    . PRO A 1 242 ? -11.195 39.319 -18.183 1.00 103.76 ? 239 PRO A CB    1 
ATOM   1812 C  CG    . PRO A 1 242 ? -10.011 40.219 -18.132 1.00 105.43 ? 239 PRO A CG    1 
ATOM   1813 C  CD    . PRO A 1 242 ? -10.522 41.519 -17.614 1.00 103.87 ? 239 PRO A CD    1 
ATOM   1814 N  N     . THR A 1 243 ? -14.393 38.961 -17.960 1.00 100.20 ? 240 THR A N     1 
ATOM   1815 C  CA    . THR A 1 243 ? -15.703 38.743 -17.325 1.00 98.51  ? 240 THR A CA    1 
ATOM   1816 C  C     . THR A 1 243 ? -15.666 37.989 -15.986 1.00 98.54  ? 240 THR A C     1 
ATOM   1817 O  O     . THR A 1 243 ? -16.250 36.914 -15.852 1.00 98.14  ? 240 THR A O     1 
ATOM   1818 C  CB    . THR A 1 243 ? -16.704 38.054 -18.298 1.00 97.90  ? 240 THR A CB    1 
ATOM   1819 O  OG1   . THR A 1 243 ? -16.157 36.811 -18.756 1.00 98.79  ? 240 THR A OG1   1 
ATOM   1820 C  CG2   . THR A 1 243 ? -17.014 38.951 -19.489 1.00 97.26  ? 240 THR A CG2   1 
ATOM   1821 N  N     . LYS A 1 244 ? -14.995 38.571 -14.996 1.00 99.30  ? 241 LYS A N     1 
ATOM   1822 C  CA    . LYS A 1 244 ? -14.907 37.973 -13.666 1.00 99.74  ? 241 LYS A CA    1 
ATOM   1823 C  C     . LYS A 1 244 ? -16.148 38.346 -12.847 1.00 97.88  ? 241 LYS A C     1 
ATOM   1824 O  O     . LYS A 1 244 ? -16.111 39.273 -12.036 1.00 97.92  ? 241 LYS A O     1 
ATOM   1825 C  CB    . LYS A 1 244 ? -13.612 38.408 -12.951 1.00 101.30 ? 241 LYS A CB    1 
ATOM   1826 C  CG    . LYS A 1 244 ? -12.323 37.865 -13.577 1.00 104.24 ? 241 LYS A CG    1 
ATOM   1827 C  CD    . LYS A 1 244 ? -11.075 38.594 -13.065 1.00 107.54 ? 241 LYS A CD    1 
ATOM   1828 C  CE    . LYS A 1 244 ? -9.805  38.159 -13.810 1.00 110.40 ? 241 LYS A CE    1 
ATOM   1829 N  NZ    . LYS A 1 244 ? -9.301  36.824 -13.356 1.00 112.27 ? 241 LYS A NZ    1 
ATOM   1830 N  N     . TRP A 1 245 ? -17.247 37.627 -13.057 1.00 96.44  ? 242 TRP A N     1 
ATOM   1831 C  CA    . TRP A 1 245 ? -18.498 37.994 -12.407 1.00 94.51  ? 242 TRP A CA    1 
ATOM   1832 C  C     . TRP A 1 245 ? -18.707 37.392 -11.018 1.00 94.41  ? 242 TRP A C     1 
ATOM   1833 O  O     . TRP A 1 245 ? -19.565 37.861 -10.269 1.00 93.54  ? 242 TRP A O     1 
ATOM   1834 C  CB    . TRP A 1 245 ? -19.698 37.712 -13.313 1.00 93.47  ? 242 TRP A CB    1 
ATOM   1835 C  CG    . TRP A 1 245 ? -19.827 36.295 -13.765 1.00 93.29  ? 242 TRP A CG    1 
ATOM   1836 C  CD1   . TRP A 1 245 ? -19.409 35.782 -14.951 1.00 93.88  ? 242 TRP A CD1   1 
ATOM   1837 C  CD2   . TRP A 1 245 ? -20.434 35.208 -13.049 1.00 92.55  ? 242 TRP A CD2   1 
ATOM   1838 N  NE1   . TRP A 1 245 ? -19.705 34.442 -15.022 1.00 93.98  ? 242 TRP A NE1   1 
ATOM   1839 C  CE2   . TRP A 1 245 ? -20.331 34.063 -13.866 1.00 93.00  ? 242 TRP A CE2   1 
ATOM   1840 C  CE3   . TRP A 1 245 ? -21.043 35.087 -11.793 1.00 91.49  ? 242 TRP A CE3   1 
ATOM   1841 C  CZ2   . TRP A 1 245 ? -20.820 32.813 -13.473 1.00 92.63  ? 242 TRP A CZ2   1 
ATOM   1842 C  CZ3   . TRP A 1 245 ? -21.526 33.843 -11.404 1.00 91.00  ? 242 TRP A CZ3   1 
ATOM   1843 C  CH2   . TRP A 1 245 ? -21.413 32.724 -12.245 1.00 91.32  ? 242 TRP A CH2   1 
ATOM   1844 N  N     . TYR A 1 246 ? -17.936 36.368 -10.665 1.00 95.39  ? 243 TYR A N     1 
ATOM   1845 C  CA    . TYR A 1 246 ? -18.115 35.714 -9.372  1.00 95.43  ? 243 TYR A CA    1 
ATOM   1846 C  C     . TYR A 1 246 ? -17.978 36.703 -8.213  1.00 94.96  ? 243 TYR A C     1 
ATOM   1847 O  O     . TYR A 1 246 ? -18.877 36.819 -7.387  1.00 94.27  ? 243 TYR A O     1 
ATOM   1848 C  CB    . TYR A 1 246 ? -17.139 34.556 -9.200  1.00 97.11  ? 243 TYR A CB    1 
ATOM   1849 C  CG    . TYR A 1 246 ? -17.333 33.787 -7.914  1.00 98.55  ? 243 TYR A CG    1 
ATOM   1850 C  CD1   . TYR A 1 246 ? -18.239 32.732 -7.846  1.00 99.38  ? 243 TYR A CD1   1 
ATOM   1851 C  CD2   . TYR A 1 246 ? -16.613 34.113 -6.763  1.00 100.31 ? 243 TYR A CD2   1 
ATOM   1852 C  CE1   . TYR A 1 246 ? -18.426 32.018 -6.667  1.00 100.28 ? 243 TYR A CE1   1 
ATOM   1853 C  CE2   . TYR A 1 246 ? -16.798 33.408 -5.575  1.00 101.24 ? 243 TYR A CE2   1 
ATOM   1854 C  CZ    . TYR A 1 246 ? -17.703 32.360 -5.540  1.00 101.29 ? 243 TYR A CZ    1 
ATOM   1855 O  OH    . TYR A 1 246 ? -17.891 31.650 -4.380  1.00 102.38 ? 243 TYR A OH    1 
ATOM   1856 N  N     . ASP A 1 247 ? -16.860 37.424 -8.168  1.00 95.38  ? 244 ASP A N     1 
ATOM   1857 C  CA    . ASP A 1 247 ? -16.608 38.398 -7.108  1.00 94.79  ? 244 ASP A CA    1 
ATOM   1858 C  C     . ASP A 1 247 ? -17.593 39.549 -7.119  1.00 92.71  ? 244 ASP A C     1 
ATOM   1859 O  O     . ASP A 1 247 ? -17.712 40.271 -6.137  1.00 92.75  ? 244 ASP A O     1 
ATOM   1860 C  CB    . ASP A 1 247 ? -15.200 38.983 -7.222  1.00 96.48  ? 244 ASP A CB    1 
ATOM   1861 C  CG    . ASP A 1 247 ? -14.120 37.932 -7.154  1.00 98.98  ? 244 ASP A CG    1 
ATOM   1862 O  OD1   . ASP A 1 247 ? -14.129 37.106 -6.213  1.00 99.96  ? 244 ASP A OD1   1 
ATOM   1863 O  OD2   . ASP A 1 247 ? -13.251 37.947 -8.049  1.00 101.33 ? 244 ASP A OD2   1 
ATOM   1864 N  N     . LEU A 1 248 ? -18.293 39.741 -8.225  1.00 90.96  ? 245 LEU A N     1 
ATOM   1865 C  CA    . LEU A 1 248 ? -19.149 40.907 -8.330  1.00 89.13  ? 245 LEU A CA    1 
ATOM   1866 C  C     . LEU A 1 248 ? -20.556 40.714 -7.768  1.00 87.55  ? 245 LEU A C     1 
ATOM   1867 O  O     . LEU A 1 248 ? -21.160 41.673 -7.275  1.00 87.00  ? 245 LEU A O     1 
ATOM   1868 C  CB    . LEU A 1 248 ? -19.184 41.433 -9.760  1.00 88.91  ? 245 LEU A CB    1 
ATOM   1869 C  CG    . LEU A 1 248 ? -17.905 42.121 -10.236 1.00 89.83  ? 245 LEU A CG    1 
ATOM   1870 C  CD1   . LEU A 1 248 ? -18.237 42.942 -11.455 1.00 90.12  ? 245 LEU A CD1   1 
ATOM   1871 C  CD2   . LEU A 1 248 ? -17.265 43.007 -9.166  1.00 89.90  ? 245 LEU A CD2   1 
ATOM   1872 N  N     . LEU A 1 249 ? -21.058 39.480 -7.811  1.00 86.61  ? 246 LEU A N     1 
ATOM   1873 C  CA    . LEU A 1 249 ? -22.425 39.188 -7.377  1.00 84.79  ? 246 LEU A CA    1 
ATOM   1874 C  C     . LEU A 1 249 ? -22.842 39.933 -6.113  1.00 84.11  ? 246 LEU A C     1 
ATOM   1875 O  O     . LEU A 1 249 ? -23.838 40.669 -6.161  1.00 83.32  ? 246 LEU A O     1 
ATOM   1876 C  CB    . LEU A 1 249 ? -22.673 37.685 -7.240  1.00 84.94  ? 246 LEU A CB    1 
ATOM   1877 C  CG    . LEU A 1 249 ? -22.809 36.909 -8.548  1.00 84.68  ? 246 LEU A CG    1 
ATOM   1878 C  CD1   . LEU A 1 249 ? -23.140 35.478 -8.231  1.00 85.12  ? 246 LEU A CD1   1 
ATOM   1879 C  CD2   . LEU A 1 249 ? -23.872 37.500 -9.464  1.00 83.32  ? 246 LEU A CD2   1 
ATOM   1880 N  N     . PRO A 1 250 ? -22.078 39.780 -4.996  1.00 84.37  ? 247 PRO A N     1 
ATOM   1881 C  CA    . PRO A 1 250 ? -22.416 40.501 -3.753  1.00 83.84  ? 247 PRO A CA    1 
ATOM   1882 C  C     . PRO A 1 250 ? -22.653 42.003 -3.966  1.00 82.75  ? 247 PRO A C     1 
ATOM   1883 O  O     . PRO A 1 250 ? -23.732 42.503 -3.650  1.00 81.99  ? 247 PRO A O     1 
ATOM   1884 C  CB    . PRO A 1 250 ? -21.190 40.269 -2.875  1.00 85.01  ? 247 PRO A CB    1 
ATOM   1885 C  CG    . PRO A 1 250 ? -20.667 38.973 -3.336  1.00 85.64  ? 247 PRO A CG    1 
ATOM   1886 C  CD    . PRO A 1 250 ? -20.874 38.946 -4.810  1.00 85.18  ? 247 PRO A CD    1 
ATOM   1887 N  N     . VAL A 1 251 ? -21.665 42.698 -4.525  1.00 82.54  ? 248 VAL A N     1 
ATOM   1888 C  CA    . VAL A 1 251 ? -21.788 44.120 -4.839  1.00 81.62  ? 248 VAL A CA    1 
ATOM   1889 C  C     . VAL A 1 251 ? -23.056 44.397 -5.653  1.00 80.41  ? 248 VAL A C     1 
ATOM   1890 O  O     . VAL A 1 251 ? -23.835 45.291 -5.314  1.00 79.87  ? 248 VAL A O     1 
ATOM   1891 C  CB    . VAL A 1 251 ? -20.562 44.635 -5.609  1.00 82.20  ? 248 VAL A CB    1 
ATOM   1892 C  CG1   . VAL A 1 251 ? -20.331 46.106 -5.313  1.00 81.84  ? 248 VAL A CG1   1 
ATOM   1893 C  CG2   . VAL A 1 251 ? -19.345 43.824 -5.242  1.00 83.30  ? 248 VAL A CG2   1 
ATOM   1894 N  N     . VAL A 1 252 ? -23.266 43.624 -6.716  1.00 79.84  ? 249 VAL A N     1 
ATOM   1895 C  CA    . VAL A 1 252 ? -24.474 43.758 -7.520  1.00 78.77  ? 249 VAL A CA    1 
ATOM   1896 C  C     . VAL A 1 252 ? -25.710 43.606 -6.622  1.00 78.42  ? 249 VAL A C     1 
ATOM   1897 O  O     . VAL A 1 252 ? -26.539 44.527 -6.555  1.00 78.03  ? 249 VAL A O     1 
ATOM   1898 C  CB    . VAL A 1 252 ? -24.496 42.753 -8.694  1.00 78.76  ? 249 VAL A CB    1 
ATOM   1899 C  CG1   . VAL A 1 252 ? -25.722 42.969 -9.590  1.00 77.31  ? 249 VAL A CG1   1 
ATOM   1900 C  CG2   . VAL A 1 252 ? -23.215 42.870 -9.504  1.00 79.44  ? 249 VAL A CG2   1 
ATOM   1901 N  N     . GLN A 1 253 ? -25.805 42.470 -5.916  1.00 78.37  ? 250 GLN A N     1 
ATOM   1902 C  CA    . GLN A 1 253 ? -26.913 42.195 -4.993  1.00 77.99  ? 250 GLN A CA    1 
ATOM   1903 C  C     . GLN A 1 253 ? -27.209 43.425 -4.161  1.00 77.75  ? 250 GLN A C     1 
ATOM   1904 O  O     . GLN A 1 253 ? -28.308 43.972 -4.220  1.00 77.37  ? 250 GLN A O     1 
ATOM   1905 C  CB    . GLN A 1 253 ? -26.592 41.003 -4.080  1.00 78.75  ? 250 GLN A CB    1 
ATOM   1906 C  CG    . GLN A 1 253 ? -27.620 40.733 -2.961  1.00 79.66  ? 250 GLN A CG    1 
ATOM   1907 C  CD    . GLN A 1 253 ? -27.472 39.344 -2.335  1.00 81.62  ? 250 GLN A CD    1 
ATOM   1908 O  OE1   . GLN A 1 253 ? -27.773 38.332 -2.963  1.00 82.43  ? 250 GLN A OE1   1 
ATOM   1909 N  NE2   . GLN A 1 253 ? -27.015 39.297 -1.093  1.00 82.67  ? 250 GLN A NE2   1 
ATOM   1910 N  N     . LEU A 1 254 ? -26.200 43.866 -3.413  1.00 78.13  ? 251 LEU A N     1 
ATOM   1911 C  CA    . LEU A 1 254 ? -26.310 45.015 -2.529  1.00 77.91  ? 251 LEU A CA    1 
ATOM   1912 C  C     . LEU A 1 254 ? -26.723 46.259 -3.303  1.00 77.84  ? 251 LEU A C     1 
ATOM   1913 O  O     . LEU A 1 254 ? -27.651 46.956 -2.891  1.00 77.84  ? 251 LEU A O     1 
ATOM   1914 C  CB    . LEU A 1 254 ? -24.996 45.235 -1.768  1.00 78.22  ? 251 LEU A CB    1 
ATOM   1915 C  CG    . LEU A 1 254 ? -24.865 46.366 -0.751  1.00 77.41  ? 251 LEU A CG    1 
ATOM   1916 C  CD1   . LEU A 1 254 ? -25.915 46.261 0.298   1.00 77.24  ? 251 LEU A CD1   1 
ATOM   1917 C  CD2   . LEU A 1 254 ? -23.524 46.317 -0.105  1.00 77.22  ? 251 LEU A CD2   1 
ATOM   1918 N  N     . ALA A 1 255 ? -26.061 46.511 -4.434  1.00 78.16  ? 252 ALA A N     1 
ATOM   1919 C  CA    . ALA A 1 255 ? -26.302 47.711 -5.234  1.00 78.30  ? 252 ALA A CA    1 
ATOM   1920 C  C     . ALA A 1 255 ? -27.747 47.778 -5.686  1.00 78.23  ? 252 ALA A C     1 
ATOM   1921 O  O     . ALA A 1 255 ? -28.383 48.836 -5.637  1.00 78.16  ? 252 ALA A O     1 
ATOM   1922 C  CB    . ALA A 1 255 ? -25.388 47.734 -6.424  1.00 78.17  ? 252 ALA A CB    1 
ATOM   1923 N  N     . LEU A 1 256 ? -28.261 46.627 -6.106  1.00 78.72  ? 253 LEU A N     1 
ATOM   1924 C  CA    . LEU A 1 256 ? -29.599 46.536 -6.647  1.00 79.12  ? 253 LEU A CA    1 
ATOM   1925 C  C     . LEU A 1 256 ? -30.683 46.636 -5.582  1.00 79.88  ? 253 LEU A C     1 
ATOM   1926 O  O     . LEU A 1 256 ? -31.706 47.295 -5.802  1.00 80.06  ? 253 LEU A O     1 
ATOM   1927 C  CB    . LEU A 1 256 ? -29.755 45.256 -7.457  1.00 78.83  ? 253 LEU A CB    1 
ATOM   1928 C  CG    . LEU A 1 256 ? -29.101 45.326 -8.830  1.00 78.88  ? 253 LEU A CG    1 
ATOM   1929 C  CD1   . LEU A 1 256 ? -29.251 43.991 -9.530  1.00 79.42  ? 253 LEU A CD1   1 
ATOM   1930 C  CD2   . LEU A 1 256 ? -29.705 46.460 -9.673  1.00 78.87  ? 253 LEU A CD2   1 
ATOM   1931 N  N     . ASN A 1 257 ? -30.463 45.986 -4.438  1.00 80.84  ? 254 ASN A N     1 
ATOM   1932 C  CA    . ASN A 1 257 ? -31.438 45.996 -3.349  1.00 81.69  ? 254 ASN A CA    1 
ATOM   1933 C  C     . ASN A 1 257 ? -31.597 47.378 -2.749  1.00 82.38  ? 254 ASN A C     1 
ATOM   1934 O  O     . ASN A 1 257 ? -32.605 47.678 -2.102  1.00 82.46  ? 254 ASN A O     1 
ATOM   1935 C  CB    . ASN A 1 257 ? -31.051 44.993 -2.274  1.00 82.13  ? 254 ASN A CB    1 
ATOM   1936 C  CG    . ASN A 1 257 ? -31.208 43.562 -2.735  1.00 82.44  ? 254 ASN A CG    1 
ATOM   1937 O  OD1   . ASN A 1 257 ? -32.125 43.232 -3.512  1.00 81.27  ? 254 ASN A OD1   1 
ATOM   1938 N  ND2   . ASN A 1 257 ? -30.309 42.691 -2.256  1.00 82.80  ? 254 ASN A ND2   1 
ATOM   1939 N  N     . ASN A 1 258 ? -30.605 48.223 -3.006  1.00 83.17  ? 255 ASN A N     1 
ATOM   1940 C  CA    . ASN A 1 258 ? -30.592 49.568 -2.490  1.00 84.35  ? 255 ASN A CA    1 
ATOM   1941 C  C     . ASN A 1 258 ? -30.784 50.634 -3.548  1.00 84.68  ? 255 ASN A C     1 
ATOM   1942 O  O     . ASN A 1 258 ? -30.397 51.772 -3.335  1.00 85.33  ? 255 ASN A O     1 
ATOM   1943 C  CB    . ASN A 1 258 ? -29.306 49.806 -1.717  1.00 84.90  ? 255 ASN A CB    1 
ATOM   1944 C  CG    . ASN A 1 258 ? -29.386 49.288 -0.309  1.00 86.44  ? 255 ASN A CG    1 
ATOM   1945 O  OD1   . ASN A 1 258 ? -30.113 49.840 0.520   1.00 88.62  ? 255 ASN A OD1   1 
ATOM   1946 N  ND2   . ASN A 1 258 ? -28.646 48.220 -0.019  1.00 87.04  ? 255 ASN A ND2   1 
ATOM   1947 N  N     . THR A 1 259 ? -31.404 50.275 -4.669  1.00 84.97  ? 256 THR A N     1 
ATOM   1948 C  CA    . THR A 1 259 ? -31.709 51.230 -5.740  1.00 85.78  ? 256 THR A CA    1 
ATOM   1949 C  C     . THR A 1 259 ? -33.196 51.614 -5.797  1.00 85.96  ? 256 THR A C     1 
ATOM   1950 O  O     . THR A 1 259 ? -34.062 50.750 -5.737  1.00 86.29  ? 256 THR A O     1 
ATOM   1951 C  CB    . THR A 1 259 ? -31.251 50.655 -7.091  1.00 85.67  ? 256 THR A CB    1 
ATOM   1952 O  OG1   . THR A 1 259 ? -29.820 50.719 -7.169  1.00 86.71  ? 256 THR A OG1   1 
ATOM   1953 C  CG2   . THR A 1 259 ? -31.861 51.418 -8.265  1.00 86.25  ? 256 THR A CG2   1 
ATOM   1954 N  N     . TYR A 1 260 ? -33.488 52.905 -5.924  1.00 86.45  ? 257 TYR A N     1 
ATOM   1955 C  CA    . TYR A 1 260 ? -34.875 53.379 -5.984  1.00 86.99  ? 257 TYR A CA    1 
ATOM   1956 C  C     . TYR A 1 260 ? -35.638 52.971 -7.258  1.00 86.09  ? 257 TYR A C     1 
ATOM   1957 O  O     . TYR A 1 260 ? -35.102 53.057 -8.357  1.00 86.31  ? 257 TYR A O     1 
ATOM   1958 C  CB    . TYR A 1 260 ? -34.896 54.900 -5.890  1.00 88.20  ? 257 TYR A CB    1 
ATOM   1959 C  CG    . TYR A 1 260 ? -34.674 55.478 -4.506  1.00 91.19  ? 257 TYR A CG    1 
ATOM   1960 C  CD1   . TYR A 1 260 ? -33.399 55.869 -4.079  1.00 93.01  ? 257 TYR A CD1   1 
ATOM   1961 C  CD2   . TYR A 1 260 ? -35.745 55.663 -3.635  1.00 93.26  ? 257 TYR A CD2   1 
ATOM   1962 C  CE1   . TYR A 1 260 ? -33.204 56.416 -2.819  1.00 94.13  ? 257 TYR A CE1   1 
ATOM   1963 C  CE2   . TYR A 1 260 ? -35.556 56.202 -2.381  1.00 94.65  ? 257 TYR A CE2   1 
ATOM   1964 C  CZ    . TYR A 1 260 ? -34.291 56.576 -1.978  1.00 95.16  ? 257 TYR A CZ    1 
ATOM   1965 O  OH    . TYR A 1 260 ? -34.133 57.109 -0.721  1.00 97.10  ? 257 TYR A OH    1 
ATOM   1966 N  N     . SER A 1 261 ? -36.888 52.534 -7.116  1.00 84.83  ? 258 SER A N     1 
ATOM   1967 C  CA    . SER A 1 261 ? -37.784 52.444 -8.270  1.00 83.39  ? 258 SER A CA    1 
ATOM   1968 C  C     . SER A 1 261 ? -38.507 53.777 -8.385  1.00 82.97  ? 258 SER A C     1 
ATOM   1969 O  O     . SER A 1 261 ? -39.341 54.092 -7.539  1.00 83.22  ? 258 SER A O     1 
ATOM   1970 C  CB    . SER A 1 261 ? -38.806 51.319 -8.117  1.00 83.52  ? 258 SER A CB    1 
ATOM   1971 O  OG    . SER A 1 261 ? -39.854 51.463 -9.075  1.00 83.55  ? 258 SER A OG    1 
ATOM   1972 N  N     . PRO A 1 262 ? -38.193 54.568 -9.426  1.00 82.05  ? 259 PRO A N     1 
ATOM   1973 C  CA    . PRO A 1 262 ? -38.735 55.911 -9.543  1.00 82.16  ? 259 PRO A CA    1 
ATOM   1974 C  C     . PRO A 1 262 ? -40.254 55.996 -9.396  1.00 82.50  ? 259 PRO A C     1 
ATOM   1975 O  O     . PRO A 1 262 ? -40.768 57.057 -9.079  1.00 83.10  ? 259 PRO A O     1 
ATOM   1976 C  CB    . PRO A 1 262 ? -38.292 56.326 -10.939 1.00 82.12  ? 259 PRO A CB    1 
ATOM   1977 C  CG    . PRO A 1 262 ? -37.004 55.649 -11.100 1.00 81.27  ? 259 PRO A CG    1 
ATOM   1978 C  CD    . PRO A 1 262 ? -37.211 54.302 -10.489 1.00 81.55  ? 259 PRO A CD    1 
ATOM   1979 N  N     . VAL A 1 263 ? -40.944 54.878 -9.597  1.00 82.25  ? 260 VAL A N     1 
ATOM   1980 C  CA    . VAL A 1 263 ? -42.403 54.782 -9.483  1.00 82.77  ? 260 VAL A CA    1 
ATOM   1981 C  C     . VAL A 1 263 ? -42.858 54.610 -8.039  1.00 83.26  ? 260 VAL A C     1 
ATOM   1982 O  O     . VAL A 1 263 ? -43.902 55.120 -7.633  1.00 84.36  ? 260 VAL A O     1 
ATOM   1983 C  CB    . VAL A 1 263 ? -42.890 53.546 -10.229 1.00 82.44  ? 260 VAL A CB    1 
ATOM   1984 C  CG1   . VAL A 1 263 ? -44.373 53.657 -10.550 1.00 82.70  ? 260 VAL A CG1   1 
ATOM   1985 C  CG2   . VAL A 1 263 ? -42.047 53.338 -11.487 1.00 83.01  ? 260 VAL A CG2   1 
ATOM   1986 N  N     . LEU A 1 264 ? -42.086 53.849 -7.275  1.00 82.71  ? 261 LEU A N     1 
ATOM   1987 C  CA    . LEU A 1 264 ? -42.435 53.526 -5.908  1.00 82.97  ? 261 LEU A CA    1 
ATOM   1988 C  C     . LEU A 1 264 ? -41.882 54.613 -5.031  1.00 83.48  ? 261 LEU A C     1 
ATOM   1989 O  O     . LEU A 1 264 ? -42.484 54.987 -4.033  1.00 84.48  ? 261 LEU A O     1 
ATOM   1990 C  CB    . LEU A 1 264 ? -41.831 52.176 -5.524  1.00 82.13  ? 261 LEU A CB    1 
ATOM   1991 C  CG    . LEU A 1 264 ? -42.184 51.030 -6.479  1.00 81.54  ? 261 LEU A CG    1 
ATOM   1992 C  CD1   . LEU A 1 264 ? -41.535 49.718 -6.068  1.00 80.28  ? 261 LEU A CD1   1 
ATOM   1993 C  CD2   . LEU A 1 264 ? -43.702 50.887 -6.575  1.00 82.18  ? 261 LEU A CD2   1 
ATOM   1994 N  N     . LYS A 1 265 ? -40.738 55.139 -5.448  1.00 83.31  ? 262 LYS A N     1 
ATOM   1995 C  CA    . LYS A 1 265 ? -39.940 56.079 -4.666  1.00 83.82  ? 262 LYS A CA    1 
ATOM   1996 C  C     . LYS A 1 265 ? -39.402 55.430 -3.383  1.00 83.93  ? 262 LYS A C     1 
ATOM   1997 O  O     . LYS A 1 265 ? -39.340 56.058 -2.334  1.00 84.54  ? 262 LYS A O     1 
ATOM   1998 C  CB    . LYS A 1 265 ? -40.704 57.384 -4.414  1.00 84.74  ? 262 LYS A CB    1 
ATOM   1999 C  CG    . LYS A 1 265 ? -41.168 58.074 -5.697  1.00 85.25  ? 262 LYS A CG    1 
ATOM   2000 C  CD    . LYS A 1 265 ? -40.917 59.580 -5.653  1.00 87.96  ? 262 LYS A CD    1 
ATOM   2001 C  CE    . LYS A 1 265 ? -42.064 60.356 -5.008  1.00 90.55  ? 262 LYS A CE    1 
ATOM   2002 N  NZ    . LYS A 1 265 ? -43.246 60.342 -5.917  1.00 92.19  ? 262 LYS A NZ    1 
ATOM   2003 N  N     . TYR A 1 266 ? -39.009 54.161 -3.512  1.00 83.82  ? 263 TYR A N     1 
ATOM   2004 C  CA    . TYR A 1 266 ? -38.437 53.351 -2.443  1.00 84.04  ? 263 TYR A CA    1 
ATOM   2005 C  C     . TYR A 1 266 ? -37.489 52.290 -2.993  1.00 83.09  ? 263 TYR A C     1 
ATOM   2006 O  O     . TYR A 1 266 ? -37.644 51.845 -4.126  1.00 82.96  ? 263 TYR A O     1 
ATOM   2007 C  CB    . TYR A 1 266 ? -39.542 52.662 -1.659  1.00 84.84  ? 263 TYR A CB    1 
ATOM   2008 C  CG    . TYR A 1 266 ? -40.381 53.618 -0.865  1.00 87.43  ? 263 TYR A CG    1 
ATOM   2009 C  CD1   . TYR A 1 266 ? -39.843 54.320 0.212   1.00 88.96  ? 263 TYR A CD1   1 
ATOM   2010 C  CD2   . TYR A 1 266 ? -41.717 53.833 -1.193  1.00 89.74  ? 263 TYR A CD2   1 
ATOM   2011 C  CE1   . TYR A 1 266 ? -40.614 55.214 0.939   1.00 90.81  ? 263 TYR A CE1   1 
ATOM   2012 C  CE2   . TYR A 1 266 ? -42.501 54.720 -0.468  1.00 91.24  ? 263 TYR A CE2   1 
ATOM   2013 C  CZ    . TYR A 1 266 ? -41.941 55.400 0.594   1.00 91.78  ? 263 TYR A CZ    1 
ATOM   2014 O  OH    . TYR A 1 266 ? -42.712 56.269 1.306   1.00 93.93  ? 263 TYR A OH    1 
ATOM   2015 N  N     . THR A 1 267 ? -36.510 51.882 -2.189  1.00 82.65  ? 264 THR A N     1 
ATOM   2016 C  CA    . THR A 1 267 ? -35.628 50.775 -2.560  1.00 81.47  ? 264 THR A CA    1 
ATOM   2017 C  C     . THR A 1 267 ? -36.190 49.481 -1.996  1.00 80.98  ? 264 THR A C     1 
ATOM   2018 O  O     . THR A 1 267 ? -36.913 49.508 -1.007  1.00 81.60  ? 264 THR A O     1 
ATOM   2019 C  CB    . THR A 1 267 ? -34.198 50.988 -2.052  1.00 81.58  ? 264 THR A CB    1 
ATOM   2020 O  OG1   . THR A 1 267 ? -34.137 50.741 -0.644  1.00 82.64  ? 264 THR A OG1   1 
ATOM   2021 C  CG2   . THR A 1 267 ? -33.750 52.409 -2.329  1.00 82.02  ? 264 THR A CG2   1 
ATOM   2022 N  N     . PRO A 1 268 ? -35.894 48.344 -2.637  1.00 79.97  ? 265 PRO A N     1 
ATOM   2023 C  CA    . PRO A 1 268 ? -36.352 47.070 -2.087  1.00 79.97  ? 265 PRO A CA    1 
ATOM   2024 C  C     . PRO A 1 268 ? -35.983 46.923 -0.614  1.00 80.21  ? 265 PRO A C     1 
ATOM   2025 O  O     . PRO A 1 268 ? -36.824 46.526 0.198   1.00 80.85  ? 265 PRO A O     1 
ATOM   2026 C  CB    . PRO A 1 268 ? -35.601 46.030 -2.920  1.00 79.45  ? 265 PRO A CB    1 
ATOM   2027 C  CG    . PRO A 1 268 ? -35.018 46.776 -4.076  1.00 79.20  ? 265 PRO A CG    1 
ATOM   2028 C  CD    . PRO A 1 268 ? -35.433 48.200 -4.020  1.00 79.26  ? 265 PRO A CD    1 
ATOM   2029 N  N     . HIS A 1 269 ? -34.735 47.262 -0.288  1.00 79.58  ? 266 HIS A N     1 
ATOM   2030 C  CA    . HIS A 1 269 ? -34.224 47.227 1.078   1.00 79.43  ? 266 HIS A CA    1 
ATOM   2031 C  C     . HIS A 1 269 ? -35.145 47.965 2.008   1.00 79.70  ? 266 HIS A C     1 
ATOM   2032 O  O     . HIS A 1 269 ? -35.519 47.421 3.031   1.00 80.88  ? 266 HIS A O     1 
ATOM   2033 C  CB    . HIS A 1 269 ? -32.836 47.858 1.147   1.00 79.49  ? 266 HIS A CB    1 
ATOM   2034 C  CG    . HIS A 1 269 ? -32.220 47.842 2.513   1.00 79.95  ? 266 HIS A CG    1 
ATOM   2035 N  ND1   . HIS A 1 269 ? -32.649 48.660 3.538   1.00 79.89  ? 266 HIS A ND1   1 
ATOM   2036 C  CD2   . HIS A 1 269 ? -31.175 47.135 3.007   1.00 79.69  ? 266 HIS A CD2   1 
ATOM   2037 C  CE1   . HIS A 1 269 ? -31.910 48.442 4.609   1.00 80.35  ? 266 HIS A CE1   1 
ATOM   2038 N  NE2   . HIS A 1 269 ? -31.011 47.521 4.313   1.00 80.92  ? 266 HIS A NE2   1 
ATOM   2039 N  N     . GLN A 1 270 ? -35.501 49.198 1.654   1.00 79.00  ? 267 GLN A N     1 
ATOM   2040 C  CA    . GLN A 1 270 ? -36.422 50.010 2.452   1.00 79.34  ? 267 GLN A CA    1 
ATOM   2041 C  C     . GLN A 1 270 ? -37.750 49.314 2.693   1.00 79.19  ? 267 GLN A C     1 
ATOM   2042 O  O     . GLN A 1 270 ? -38.216 49.234 3.819   1.00 80.12  ? 267 GLN A O     1 
ATOM   2043 C  CB    . GLN A 1 270 ? -36.654 51.371 1.801   1.00 79.35  ? 267 GLN A CB    1 
ATOM   2044 C  CG    . GLN A 1 270 ? -35.623 52.414 2.203   1.00 81.00  ? 267 GLN A CG    1 
ATOM   2045 C  CD    . GLN A 1 270 ? -35.355 53.427 1.109   1.00 81.69  ? 267 GLN A CD    1 
ATOM   2046 O  OE1   . GLN A 1 270 ? -36.273 53.900 0.447   1.00 82.30  ? 267 GLN A OE1   1 
ATOM   2047 N  NE2   . GLN A 1 270 ? -34.087 53.764 0.916   1.00 82.38  ? 267 GLN A NE2   1 
ATOM   2048 N  N     . LEU A 1 271 ? -38.343 48.789 1.635   1.00 78.14  ? 268 LEU A N     1 
ATOM   2049 C  CA    . LEU A 1 271 ? -39.577 48.058 1.764   1.00 78.34  ? 268 LEU A CA    1 
ATOM   2050 C  C     . LEU A 1 271 ? -39.398 46.829 2.659   1.00 78.89  ? 268 LEU A C     1 
ATOM   2051 O  O     . LEU A 1 271 ? -40.294 46.480 3.429   1.00 80.20  ? 268 LEU A O     1 
ATOM   2052 C  CB    . LEU A 1 271 ? -40.103 47.668 0.385   1.00 77.72  ? 268 LEU A CB    1 
ATOM   2053 C  CG    . LEU A 1 271 ? -40.395 48.791 -0.617  1.00 76.92  ? 268 LEU A CG    1 
ATOM   2054 C  CD1   . LEU A 1 271 ? -40.978 48.201 -1.878  1.00 76.45  ? 268 LEU A CD1   1 
ATOM   2055 C  CD2   . LEU A 1 271 ? -41.337 49.841 -0.052  1.00 77.07  ? 268 LEU A CD2   1 
ATOM   2056 N  N     . LEU A 1 272 ? -38.241 46.183 2.588   1.00 78.16  ? 269 LEU A N     1 
ATOM   2057 C  CA    . LEU A 1 272 ? -38.010 45.017 3.430   1.00 78.58  ? 269 LEU A CA    1 
ATOM   2058 C  C     . LEU A 1 272 ? -37.754 45.367 4.888   1.00 79.67  ? 269 LEU A C     1 
ATOM   2059 O  O     . LEU A 1 272 ? -38.333 44.742 5.761   1.00 80.95  ? 269 LEU A O     1 
ATOM   2060 C  CB    . LEU A 1 272 ? -36.903 44.106 2.875   1.00 77.86  ? 269 LEU A CB    1 
ATOM   2061 C  CG    . LEU A 1 272 ? -36.646 42.774 3.596   1.00 77.72  ? 269 LEU A CG    1 
ATOM   2062 C  CD1   . LEU A 1 272 ? -37.950 42.092 3.992   1.00 78.14  ? 269 LEU A CD1   1 
ATOM   2063 C  CD2   . LEU A 1 272 ? -35.793 41.844 2.750   1.00 75.54  ? 269 LEU A CD2   1 
ATOM   2064 N  N     . PHE A 1 273 ? -36.915 46.366 5.149   1.00 79.58  ? 270 PHE A N     1 
ATOM   2065 C  CA    . PHE A 1 273 ? -36.503 46.675 6.516   1.00 80.89  ? 270 PHE A CA    1 
ATOM   2066 C  C     . PHE A 1 273 ? -37.109 47.924 7.129   1.00 82.28  ? 270 PHE A C     1 
ATOM   2067 O  O     . PHE A 1 273 ? -37.175 48.032 8.348   1.00 83.67  ? 270 PHE A O     1 
ATOM   2068 C  CB    . PHE A 1 273 ? -34.988 46.749 6.620   1.00 80.32  ? 270 PHE A CB    1 
ATOM   2069 C  CG    . PHE A 1 273 ? -34.297 45.490 6.227   1.00 79.60  ? 270 PHE A CG    1 
ATOM   2070 C  CD1   . PHE A 1 273 ? -33.458 45.468 5.128   1.00 78.39  ? 270 PHE A CD1   1 
ATOM   2071 C  CD2   . PHE A 1 273 ? -34.476 44.322 6.957   1.00 80.23  ? 270 PHE A CD2   1 
ATOM   2072 C  CE1   . PHE A 1 273 ? -32.801 44.304 4.763   1.00 78.05  ? 270 PHE A CE1   1 
ATOM   2073 C  CE2   . PHE A 1 273 ? -33.827 43.144 6.593   1.00 79.40  ? 270 PHE A CE2   1 
ATOM   2074 C  CZ    . PHE A 1 273 ? -32.993 43.135 5.497   1.00 78.21  ? 270 PHE A CZ    1 
ATOM   2075 N  N     . GLY A 1 274 ? -37.530 48.874 6.305   1.00 82.55  ? 271 GLY A N     1 
ATOM   2076 C  CA    . GLY A 1 274 ? -38.151 50.097 6.815   1.00 84.69  ? 271 GLY A CA    1 
ATOM   2077 C  C     . GLY A 1 274 ? -37.186 51.179 7.275   1.00 86.04  ? 271 GLY A C     1 
ATOM   2078 O  O     . GLY A 1 274 ? -37.626 52.275 7.655   1.00 86.90  ? 271 GLY A O     1 
ATOM   2079 N  N     . ILE A 1 275 ? -35.887 50.856 7.289   1.00 86.47  ? 272 ILE A N     1 
ATOM   2080 C  CA    . ILE A 1 275 ? -34.804 51.844 7.404   1.00 87.51  ? 272 ILE A CA    1 
ATOM   2081 C  C     . ILE A 1 275 ? -33.643 51.423 6.527   1.00 87.31  ? 272 ILE A C     1 
ATOM   2082 O  O     . ILE A 1 275 ? -33.452 50.227 6.271   1.00 87.17  ? 272 ILE A O     1 
ATOM   2083 C  CB    . ILE A 1 275 ? -34.228 51.972 8.819   1.00 88.60  ? 272 ILE A CB    1 
ATOM   2084 C  CG1   . ILE A 1 275 ? -33.724 50.640 9.336   1.00 89.34  ? 272 ILE A CG1   1 
ATOM   2085 C  CG2   . ILE A 1 275 ? -35.202 52.523 9.763   1.00 90.63  ? 272 ILE A CG2   1 
ATOM   2086 C  CD1   . ILE A 1 275 ? -32.234 50.535 9.241   1.00 90.92  ? 272 ILE A CD1   1 
ATOM   2087 N  N     . ASP A 1 276 ? -32.850 52.399 6.090   1.00 87.84  ? 273 ASP A N     1 
ATOM   2088 C  CA    . ASP A 1 276 ? -31.625 52.108 5.352   1.00 87.81  ? 273 ASP A CA    1 
ATOM   2089 C  C     . ASP A 1 276 ? -30.564 51.569 6.315   1.00 88.34  ? 273 ASP A C     1 
ATOM   2090 O  O     . ASP A 1 276 ? -30.473 52.012 7.449   1.00 89.53  ? 273 ASP A O     1 
ATOM   2091 C  CB    . ASP A 1 276 ? -31.121 53.372 4.643   1.00 87.98  ? 273 ASP A CB    1 
ATOM   2092 C  CG    . ASP A 1 276 ? -31.726 53.563 3.240   1.00 89.18  ? 273 ASP A CG    1 
ATOM   2093 O  OD1   . ASP A 1 276 ? -32.269 52.587 2.653   1.00 90.03  ? 273 ASP A OD1   1 
ATOM   2094 O  OD2   . ASP A 1 276 ? -31.627 54.701 2.708   1.00 91.49  ? 273 ASP A OD2   1 
ATOM   2095 N  N     . SER A 1 277 ? -29.772 50.602 5.878   1.00 87.89  ? 274 SER A N     1 
ATOM   2096 C  CA    . SER A 1 277 ? -28.594 50.185 6.646   1.00 88.54  ? 274 SER A CA    1 
ATOM   2097 C  C     . SER A 1 277 ? -27.497 51.261 6.568   1.00 88.64  ? 274 SER A C     1 
ATOM   2098 O  O     . SER A 1 277 ? -27.768 52.425 6.254   1.00 88.51  ? 274 SER A O     1 
ATOM   2099 C  CB    . SER A 1 277 ? -28.053 48.857 6.110   1.00 88.27  ? 274 SER A CB    1 
ATOM   2100 O  OG    . SER A 1 277 ? -27.920 48.902 4.689   1.00 88.02  ? 274 SER A OG    1 
ATOM   2101 N  N     . ASN A 1 278 ? -26.258 50.872 6.854   1.00 88.75  ? 275 ASN A N     1 
ATOM   2102 C  CA    . ASN A 1 278 ? -25.136 51.778 6.700   1.00 88.79  ? 275 ASN A CA    1 
ATOM   2103 C  C     . ASN A 1 278 ? -24.566 51.682 5.290   1.00 87.81  ? 275 ASN A C     1 
ATOM   2104 O  O     . ASN A 1 278 ? -23.456 51.187 5.074   1.00 88.43  ? 275 ASN A O     1 
ATOM   2105 C  CB    . ASN A 1 278 ? -24.059 51.497 7.750   1.00 90.09  ? 275 ASN A CB    1 
ATOM   2106 C  CG    . ASN A 1 278 ? -22.832 52.373 7.580   1.00 90.58  ? 275 ASN A CG    1 
ATOM   2107 O  OD1   . ASN A 1 278 ? -22.910 53.450 6.996   1.00 90.78  ? 275 ASN A OD1   1 
ATOM   2108 N  ND2   . ASN A 1 278 ? -21.692 51.912 8.085   1.00 91.08  ? 275 ASN A ND2   1 
ATOM   2109 N  N     . THR A 1 279 ? -25.337 52.144 4.322   1.00 86.38  ? 276 THR A N     1 
ATOM   2110 C  CA    . THR A 1 279 ? -24.846 52.198 2.963   1.00 85.72  ? 276 THR A CA    1 
ATOM   2111 C  C     . THR A 1 279 ? -24.658 53.661 2.600   1.00 85.64  ? 276 THR A C     1 
ATOM   2112 O  O     . THR A 1 279 ? -25.068 54.534 3.370   1.00 86.24  ? 276 THR A O     1 
ATOM   2113 C  CB    . THR A 1 279 ? -25.820 51.538 2.003   1.00 84.76  ? 276 THR A CB    1 
ATOM   2114 O  OG1   . THR A 1 279 ? -27.138 52.003 2.298   1.00 85.34  ? 276 THR A OG1   1 
ATOM   2115 C  CG2   . THR A 1 279 ? -25.781 50.028 2.168   1.00 84.92  ? 276 THR A CG2   1 
ATOM   2116 N  N     . PRO A 1 280 ? -24.005 53.945 1.454   1.00 85.09  ? 277 PRO A N     1 
ATOM   2117 C  CA    . PRO A 1 280 ? -23.868 55.322 0.985   1.00 85.16  ? 277 PRO A CA    1 
ATOM   2118 C  C     . PRO A 1 280 ? -25.211 55.990 0.729   1.00 84.56  ? 277 PRO A C     1 
ATOM   2119 O  O     . PRO A 1 280 ? -26.175 55.321 0.348   1.00 83.77  ? 277 PRO A O     1 
ATOM   2120 C  CB    . PRO A 1 280 ? -23.116 55.158 -0.325  1.00 84.83  ? 277 PRO A CB    1 
ATOM   2121 C  CG    . PRO A 1 280 ? -22.299 53.952 -0.114  1.00 85.08  ? 277 PRO A CG    1 
ATOM   2122 C  CD    . PRO A 1 280 ? -23.149 53.028 0.682   1.00 84.78  ? 277 PRO A CD    1 
ATOM   2123 N  N     . PHE A 1 281 ? -25.257 57.300 0.955   1.00 85.14  ? 278 PHE A N     1 
ATOM   2124 C  CA    . PHE A 1 281 ? -26.464 58.109 0.780   1.00 84.86  ? 278 PHE A CA    1 
ATOM   2125 C  C     . PHE A 1 281 ? -27.692 57.524 1.462   1.00 85.37  ? 278 PHE A C     1 
ATOM   2126 O  O     . PHE A 1 281 ? -28.789 57.578 0.914   1.00 84.82  ? 278 PHE A O     1 
ATOM   2127 C  CB    . PHE A 1 281 ? -26.753 58.334 -0.698  1.00 83.68  ? 278 PHE A CB    1 
ATOM   2128 C  CG    . PHE A 1 281 ? -25.664 59.042 -1.423  1.00 82.17  ? 278 PHE A CG    1 
ATOM   2129 C  CD1   . PHE A 1 281 ? -25.711 60.415 -1.589  1.00 81.57  ? 278 PHE A CD1   1 
ATOM   2130 C  CD2   . PHE A 1 281 ? -24.599 58.339 -1.948  1.00 80.20  ? 278 PHE A CD2   1 
ATOM   2131 C  CE1   . PHE A 1 281 ? -24.712 61.080 -2.261  1.00 81.63  ? 278 PHE A CE1   1 
ATOM   2132 C  CE2   . PHE A 1 281 ? -23.599 58.989 -2.623  1.00 80.86  ? 278 PHE A CE2   1 
ATOM   2133 C  CZ    . PHE A 1 281 ? -23.653 60.367 -2.782  1.00 81.78  ? 278 PHE A CZ    1 
ATOM   2134 N  N     . ALA A 1 282 ? -27.496 56.982 2.663   1.00 87.06  ? 279 ALA A N     1 
ATOM   2135 C  CA    . ALA A 1 282 ? -28.575 56.380 3.454   1.00 88.03  ? 279 ALA A CA    1 
ATOM   2136 C  C     . ALA A 1 282 ? -29.559 57.419 3.974   1.00 89.39  ? 279 ALA A C     1 
ATOM   2137 O  O     . ALA A 1 282 ? -29.162 58.428 4.576   1.00 90.24  ? 279 ALA A O     1 
ATOM   2138 C  CB    . ALA A 1 282 ? -28.005 55.585 4.604   1.00 88.60  ? 279 ALA A CB    1 
ATOM   2139 N  N     . ASN A 1 283 ? -30.842 57.143 3.742   1.00 90.07  ? 280 ASN A N     1 
ATOM   2140 C  CA    . ASN A 1 283 ? -31.929 58.054 4.071   1.00 91.73  ? 280 ASN A CA    1 
ATOM   2141 C  C     . ASN A 1 283 ? -32.172 58.186 5.558   1.00 93.43  ? 280 ASN A C     1 
ATOM   2142 O  O     . ASN A 1 283 ? -32.234 57.188 6.272   1.00 93.63  ? 280 ASN A O     1 
ATOM   2143 C  CB    . ASN A 1 283 ? -33.218 57.617 3.387   1.00 91.27  ? 280 ASN A CB    1 
ATOM   2144 C  CG    . ASN A 1 283 ? -34.313 58.653 3.513   1.00 92.77  ? 280 ASN A CG    1 
ATOM   2145 O  OD1   . ASN A 1 283 ? -34.987 58.738 4.540   1.00 93.67  ? 280 ASN A OD1   1 
ATOM   2146 N  ND2   . ASN A 1 283 ? -34.492 59.457 2.466   1.00 93.70  ? 280 ASN A ND2   1 
ATOM   2147 N  N     . GLN A 1 284 ? -32.351 59.426 6.002   1.00 95.31  ? 281 GLN A N     1 
ATOM   2148 C  CA    . GLN A 1 284 ? -32.424 59.737 7.426   1.00 97.61  ? 281 GLN A CA    1 
ATOM   2149 C  C     . GLN A 1 284 ? -33.751 60.320 7.902   1.00 98.35  ? 281 GLN A C     1 
ATOM   2150 O  O     . GLN A 1 284 ? -33.846 60.799 9.030   1.00 99.74  ? 281 GLN A O     1 
ATOM   2151 C  CB    . GLN A 1 284 ? -31.289 60.685 7.792   1.00 98.67  ? 281 GLN A CB    1 
ATOM   2152 C  CG    . GLN A 1 284 ? -29.961 59.984 7.925   1.00 101.13 ? 281 GLN A CG    1 
ATOM   2153 C  CD    . GLN A 1 284 ? -28.797 60.940 7.802   1.00 104.92 ? 281 GLN A CD    1 
ATOM   2154 O  OE1   . GLN A 1 284 ? -28.649 61.865 8.608   1.00 107.28 ? 281 GLN A OE1   1 
ATOM   2155 N  NE2   . GLN A 1 284 ? -27.956 60.725 6.788   1.00 105.18 ? 281 GLN A NE2   1 
ATOM   2156 N  N     . ASP A 1 285 ? -34.773 60.262 7.055   1.00 97.89  ? 282 ASP A N     1 
ATOM   2157 C  CA    . ASP A 1 285 ? -36.064 60.892 7.350   1.00 98.78  ? 282 ASP A CA    1 
ATOM   2158 C  C     . ASP A 1 285 ? -36.749 60.392 8.626   1.00 99.55  ? 282 ASP A C     1 
ATOM   2159 O  O     . ASP A 1 285 ? -37.510 61.122 9.250   1.00 100.84 ? 282 ASP A O     1 
ATOM   2160 C  CB    . ASP A 1 285 ? -37.020 60.740 6.161   1.00 98.29  ? 282 ASP A CB    1 
ATOM   2161 C  CG    . ASP A 1 285 ? -36.559 61.510 4.929   1.00 98.25  ? 282 ASP A CG    1 
ATOM   2162 O  OD1   . ASP A 1 285 ? -35.565 62.275 5.028   1.00 98.76  ? 282 ASP A OD1   1 
ATOM   2163 O  OD2   . ASP A 1 285 ? -37.202 61.344 3.862   1.00 97.69  ? 282 ASP A OD2   1 
ATOM   2164 N  N     . THR A 1 286 ? -36.474 59.158 9.018   1.00 98.88  ? 283 THR A N     1 
ATOM   2165 C  CA    . THR A 1 286 ? -37.205 58.555 10.120  1.00 99.59  ? 283 THR A CA    1 
ATOM   2166 C  C     . THR A 1 286 ? -36.295 58.333 11.311  1.00 100.15 ? 283 THR A C     1 
ATOM   2167 O  O     . THR A 1 286 ? -36.454 57.375 12.066  1.00 100.45 ? 283 THR A O     1 
ATOM   2168 C  CB    . THR A 1 286 ? -37.835 57.241 9.677   1.00 98.96  ? 283 THR A CB    1 
ATOM   2169 O  OG1   . THR A 1 286 ? -36.812 56.393 9.136   1.00 98.00  ? 283 THR A OG1   1 
ATOM   2170 C  CG2   . THR A 1 286 ? -38.912 57.500 8.610   1.00 98.19  ? 283 THR A CG2   1 
ATOM   2171 N  N     . LEU A 1 287 ? -35.354 59.254 11.477  1.00 100.33 ? 284 LEU A N     1 
ATOM   2172 C  CA    . LEU A 1 287 ? -34.304 59.141 12.481  1.00 100.92 ? 284 LEU A CA    1 
ATOM   2173 C  C     . LEU A 1 287 ? -34.815 59.427 13.880  1.00 102.39 ? 284 LEU A C     1 
ATOM   2174 O  O     . LEU A 1 287 ? -34.208 58.992 14.858  1.00 103.23 ? 284 LEU A O     1 
ATOM   2175 C  CB    . LEU A 1 287 ? -33.168 60.109 12.161  1.00 100.94 ? 284 LEU A CB    1 
ATOM   2176 C  CG    . LEU A 1 287 ? -31.752 59.597 12.413  1.00 101.32 ? 284 LEU A CG    1 
ATOM   2177 C  CD1   . LEU A 1 287 ? -31.267 58.686 11.263  1.00 99.90  ? 284 LEU A CD1   1 
ATOM   2178 C  CD2   . LEU A 1 287 ? -30.813 60.776 12.619  1.00 102.36 ? 284 LEU A CD2   1 
ATOM   2179 N  N     . ASP A 1 288 ? -35.926 60.158 13.969  1.00 102.78 ? 285 ASP A N     1 
ATOM   2180 C  CA    . ASP A 1 288 ? -36.495 60.570 15.259  1.00 104.21 ? 285 ASP A CA    1 
ATOM   2181 C  C     . ASP A 1 288 ? -37.633 59.700 15.748  1.00 104.05 ? 285 ASP A C     1 
ATOM   2182 O  O     . ASP A 1 288 ? -38.039 59.803 16.898  1.00 105.58 ? 285 ASP A O     1 
ATOM   2183 C  CB    . ASP A 1 288 ? -36.969 62.021 15.202  1.00 105.33 ? 285 ASP A CB    1 
ATOM   2184 C  CG    . ASP A 1 288 ? -35.820 63.008 15.236  1.00 106.79 ? 285 ASP A CG    1 
ATOM   2185 O  OD1   . ASP A 1 288 ? -34.839 62.791 15.997  1.00 108.40 ? 285 ASP A OD1   1 
ATOM   2186 O  OD2   . ASP A 1 288 ? -35.904 64.008 14.492  1.00 107.67 ? 285 ASP A OD2   1 
ATOM   2187 N  N     . LEU A 1 289 ? -38.152 58.854 14.870  1.00 102.07 ? 286 LEU A N     1 
ATOM   2188 C  CA    . LEU A 1 289 ? -39.205 57.935 15.243  1.00 101.90 ? 286 LEU A CA    1 
ATOM   2189 C  C     . LEU A 1 289 ? -38.600 56.775 16.002  1.00 102.02 ? 286 LEU A C     1 
ATOM   2190 O  O     . LEU A 1 289 ? -37.500 56.341 15.694  1.00 100.92 ? 286 LEU A O     1 
ATOM   2191 C  CB    . LEU A 1 289 ? -39.930 57.427 14.000  1.00 100.34 ? 286 LEU A CB    1 
ATOM   2192 C  CG    . LEU A 1 289 ? -40.421 58.494 13.026  1.00 99.09  ? 286 LEU A CG    1 
ATOM   2193 C  CD1   . LEU A 1 289 ? -40.994 57.849 11.791  1.00 97.15  ? 286 LEU A CD1   1 
ATOM   2194 C  CD2   . LEU A 1 289 ? -41.445 59.394 13.688  1.00 100.19 ? 286 LEU A CD2   1 
ATOM   2195 N  N     . THR A 1 290 ? -39.314 56.286 17.008  1.00 103.53 ? 287 THR A N     1 
ATOM   2196 C  CA    . THR A 1 290 ? -38.950 55.038 17.660  1.00 103.99 ? 287 THR A CA    1 
ATOM   2197 C  C     . THR A 1 290 ? -39.072 53.970 16.608  1.00 102.39 ? 287 THR A C     1 
ATOM   2198 O  O     . THR A 1 290 ? -39.806 54.141 15.637  1.00 101.65 ? 287 THR A O     1 
ATOM   2199 C  CB    . THR A 1 290 ? -39.932 54.669 18.780  1.00 106.12 ? 287 THR A CB    1 
ATOM   2200 O  OG1   . THR A 1 290 ? -41.276 54.925 18.344  1.00 106.41 ? 287 THR A OG1   1 
ATOM   2201 C  CG2   . THR A 1 290 ? -39.634 55.457 20.052  1.00 108.11 ? 287 THR A CG2   1 
ATOM   2202 N  N     . ARG A 1 291 ? -38.377 52.860 16.786  1.00 102.16 ? 288 ARG A N     1 
ATOM   2203 C  CA    . ARG A 1 291 ? -38.550 51.763 15.855  1.00 101.10 ? 288 ARG A CA    1 
ATOM   2204 C  C     . ARG A 1 291 ? -40.033 51.512 15.604  1.00 101.93 ? 288 ARG A C     1 
ATOM   2205 O  O     . ARG A 1 291 ? -40.439 51.240 14.482  1.00 100.64 ? 288 ARG A O     1 
ATOM   2206 C  CB    . ARG A 1 291 ? -37.890 50.494 16.380  1.00 101.17 ? 288 ARG A CB    1 
ATOM   2207 C  CG    . ARG A 1 291 ? -38.007 49.298 15.432  1.00 99.01  ? 288 ARG A CG    1 
ATOM   2208 C  CD    . ARG A 1 291 ? -37.426 49.602 14.058  1.00 94.66  ? 288 ARG A CD    1 
ATOM   2209 N  NE    . ARG A 1 291 ? -37.433 48.424 13.204  1.00 91.71  ? 288 ARG A NE    1 
ATOM   2210 C  CZ    . ARG A 1 291 ? -37.368 48.463 11.880  1.00 89.69  ? 288 ARG A CZ    1 
ATOM   2211 N  NH1   . ARG A 1 291 ? -37.297 49.630 11.244  1.00 88.25  ? 288 ARG A NH1   1 
ATOM   2212 N  NH2   . ARG A 1 291 ? -37.385 47.329 11.190  1.00 88.29  ? 288 ARG A NH2   1 
ATOM   2213 N  N     . GLU A 1 292 ? -40.830 51.633 16.660  1.00 104.58 ? 289 GLU A N     1 
ATOM   2214 C  CA    . GLU A 1 292 ? -42.254 51.331 16.611  1.00 106.22 ? 289 GLU A CA    1 
ATOM   2215 C  C     . GLU A 1 292 ? -43.051 52.247 15.711  1.00 105.48 ? 289 GLU A C     1 
ATOM   2216 O  O     . GLU A 1 292 ? -43.865 51.769 14.930  1.00 105.13 ? 289 GLU A O     1 
ATOM   2217 C  CB    . GLU A 1 292 ? -42.857 51.350 18.007  1.00 109.16 ? 289 GLU A CB    1 
ATOM   2218 C  CG    . GLU A 1 292 ? -42.759 50.024 18.725  1.00 112.62 ? 289 GLU A CG    1 
ATOM   2219 C  CD    . GLU A 1 292 ? -44.084 49.621 19.346  1.00 117.92 ? 289 GLU A CD    1 
ATOM   2220 O  OE1   . GLU A 1 292 ? -44.580 50.348 20.250  1.00 120.38 ? 289 GLU A OE1   1 
ATOM   2221 O  OE2   . GLU A 1 292 ? -44.629 48.575 18.914  1.00 119.24 ? 289 GLU A OE2   1 
ATOM   2222 N  N     . GLU A 1 293 ? -42.836 53.555 15.830  1.00 105.65 ? 290 GLU A N     1 
ATOM   2223 C  CA    . GLU A 1 293 ? -43.513 54.515 14.961  1.00 105.46 ? 290 GLU A CA    1 
ATOM   2224 C  C     . GLU A 1 293 ? -43.149 54.212 13.513  1.00 103.44 ? 290 GLU A C     1 
ATOM   2225 O  O     . GLU A 1 293 ? -44.019 54.064 12.649  1.00 103.20 ? 290 GLU A O     1 
ATOM   2226 C  CB    . GLU A 1 293 ? -43.137 55.948 15.334  1.00 106.02 ? 290 GLU A CB    1 
ATOM   2227 C  CG    . GLU A 1 293 ? -43.866 56.466 16.570  1.00 109.01 ? 290 GLU A CG    1 
ATOM   2228 C  CD    . GLU A 1 293 ? -43.072 57.498 17.359  1.00 110.23 ? 290 GLU A CD    1 
ATOM   2229 O  OE1   . GLU A 1 293 ? -42.071 58.031 16.837  1.00 109.37 ? 290 GLU A OE1   1 
ATOM   2230 O  OE2   . GLU A 1 293 ? -43.457 57.778 18.512  1.00 112.25 ? 290 GLU A OE2   1 
ATOM   2231 N  N     . GLU A 1 294 ? -41.849 54.083 13.281  1.00 102.27 ? 291 GLU A N     1 
ATOM   2232 C  CA    . GLU A 1 294 ? -41.283 53.679 12.007  1.00 100.41 ? 291 GLU A CA    1 
ATOM   2233 C  C     . GLU A 1 294 ? -41.941 52.435 11.387  1.00 99.48  ? 291 GLU A C     1 
ATOM   2234 O  O     . GLU A 1 294 ? -42.319 52.456 10.214  1.00 98.36  ? 291 GLU A O     1 
ATOM   2235 C  CB    . GLU A 1 294 ? -39.808 53.419 12.231  1.00 100.02 ? 291 GLU A CB    1 
ATOM   2236 C  CG    . GLU A 1 294 ? -38.947 53.460 11.004  1.00 100.27 ? 291 GLU A CG    1 
ATOM   2237 C  CD    . GLU A 1 294 ? -37.505 53.649 11.390  1.00 102.73 ? 291 GLU A CD    1 
ATOM   2238 O  OE1   . GLU A 1 294 ? -37.037 52.920 12.301  1.00 104.44 ? 291 GLU A OE1   1 
ATOM   2239 O  OE2   . GLU A 1 294 ? -36.846 54.533 10.800  1.00 102.95 ? 291 GLU A OE2   1 
ATOM   2240 N  N     . LEU A 1 295 ? -42.073 51.366 12.181  1.00 99.91  ? 292 LEU A N     1 
ATOM   2241 C  CA    . LEU A 1 295 ? -42.616 50.078 11.715  1.00 99.21  ? 292 LEU A CA    1 
ATOM   2242 C  C     . LEU A 1 295 ? -44.066 50.136 11.249  1.00 99.70  ? 292 LEU A C     1 
ATOM   2243 O  O     . LEU A 1 295 ? -44.495 49.313 10.431  1.00 98.97  ? 292 LEU A O     1 
ATOM   2244 C  CB    . LEU A 1 295 ? -42.460 48.981 12.777  1.00 100.11 ? 292 LEU A CB    1 
ATOM   2245 C  CG    . LEU A 1 295 ? -41.178 48.143 12.719  1.00 99.24  ? 292 LEU A CG    1 
ATOM   2246 C  CD1   . LEU A 1 295 ? -41.207 46.984 13.693  1.00 99.86  ? 292 LEU A CD1   1 
ATOM   2247 C  CD2   . LEU A 1 295 ? -40.918 47.626 11.312  1.00 98.23  ? 292 LEU A CD2   1 
ATOM   2248 N  N     . SER A 1 296 ? -44.817 51.097 11.776  1.00 100.86 ? 293 SER A N     1 
ATOM   2249 C  CA    . SER A 1 296 ? -46.188 51.300 11.341  1.00 101.64 ? 293 SER A CA    1 
ATOM   2250 C  C     . SER A 1 296 ? -46.252 52.294 10.186  1.00 100.44 ? 293 SER A C     1 
ATOM   2251 O  O     . SER A 1 296 ? -47.122 52.180 9.317   1.00 100.64 ? 293 SER A O     1 
ATOM   2252 C  CB    . SER A 1 296 ? -47.062 51.756 12.494  1.00 103.89 ? 293 SER A CB    1 
ATOM   2253 O  OG    . SER A 1 296 ? -46.493 52.903 13.080  1.00 104.64 ? 293 SER A OG    1 
ATOM   2254 N  N     . LEU A 1 297 ? -45.333 53.258 10.161  1.00 99.41  ? 294 LEU A N     1 
ATOM   2255 C  CA    . LEU A 1 297 ? -45.186 54.094 8.973   1.00 97.96  ? 294 LEU A CA    1 
ATOM   2256 C  C     . LEU A 1 297 ? -44.856 53.209 7.774   1.00 96.25  ? 294 LEU A C     1 
ATOM   2257 O  O     . LEU A 1 297 ? -45.262 53.510 6.653   1.00 95.54  ? 294 LEU A O     1 
ATOM   2258 C  CB    . LEU A 1 297 ? -44.100 55.151 9.147   1.00 97.44  ? 294 LEU A CB    1 
ATOM   2259 C  CG    . LEU A 1 297 ? -44.016 56.129 7.969   1.00 96.32  ? 294 LEU A CG    1 
ATOM   2260 C  CD1   . LEU A 1 297 ? -44.821 57.397 8.254   1.00 97.76  ? 294 LEU A CD1   1 
ATOM   2261 C  CD2   . LEU A 1 297 ? -42.571 56.462 7.637   1.00 94.86  ? 294 LEU A CD2   1 
ATOM   2262 N  N     . LEU A 1 298 ? -44.124 52.121 8.024   1.00 95.67  ? 295 LEU A N     1 
ATOM   2263 C  CA    . LEU A 1 298 ? -43.801 51.149 6.986   1.00 94.33  ? 295 LEU A CA    1 
ATOM   2264 C  C     . LEU A 1 298 ? -45.042 50.435 6.486   1.00 95.20  ? 295 LEU A C     1 
ATOM   2265 O  O     . LEU A 1 298 ? -45.260 50.377 5.278   1.00 94.61  ? 295 LEU A O     1 
ATOM   2266 C  CB    . LEU A 1 298 ? -42.752 50.136 7.452   1.00 93.64  ? 295 LEU A CB    1 
ATOM   2267 C  CG    . LEU A 1 298 ? -42.208 49.163 6.393   1.00 91.46  ? 295 LEU A CG    1 
ATOM   2268 C  CD1   . LEU A 1 298 ? -41.480 49.884 5.283   1.00 89.52  ? 295 LEU A CD1   1 
ATOM   2269 C  CD2   . LEU A 1 298 ? -41.293 48.147 7.027   1.00 90.93  ? 295 LEU A CD2   1 
ATOM   2270 N  N     . GLN A 1 299 ? -45.851 49.898 7.400   1.00 97.01  ? 296 GLN A N     1 
ATOM   2271 C  CA    . GLN A 1 299 ? -47.077 49.201 7.010   1.00 98.38  ? 296 GLN A CA    1 
ATOM   2272 C  C     . GLN A 1 299 ? -47.956 50.091 6.158   1.00 98.44  ? 296 GLN A C     1 
ATOM   2273 O  O     . GLN A 1 299 ? -48.597 49.625 5.214   1.00 98.28  ? 296 GLN A O     1 
ATOM   2274 C  CB    . GLN A 1 299 ? -47.858 48.737 8.226   1.00 100.68 ? 296 GLN A CB    1 
ATOM   2275 C  CG    . GLN A 1 299 ? -47.308 47.466 8.868   1.00 102.96 ? 296 GLN A CG    1 
ATOM   2276 C  CD    . GLN A 1 299 ? -47.813 47.289 10.296  1.00 107.33 ? 296 GLN A CD    1 
ATOM   2277 O  OE1   . GLN A 1 299 ? -49.026 47.284 10.546  1.00 109.65 ? 296 GLN A OE1   1 
ATOM   2278 N  NE2   . GLN A 1 299 ? -46.882 47.165 11.244  1.00 107.57 ? 296 GLN A NE2   1 
ATOM   2279 N  N     . GLU A 1 300 ? -47.968 51.373 6.500   1.00 98.94  ? 297 GLU A N     1 
ATOM   2280 C  CA    . GLU A 1 300 ? -48.643 52.395 5.711   1.00 99.32  ? 297 GLU A CA    1 
ATOM   2281 C  C     . GLU A 1 300 ? -48.045 52.519 4.295   1.00 96.76  ? 297 GLU A C     1 
ATOM   2282 O  O     . GLU A 1 300 ? -48.782 52.545 3.314   1.00 96.72  ? 297 GLU A O     1 
ATOM   2283 C  CB    . GLU A 1 300 ? -48.627 53.733 6.478   1.00 100.85 ? 297 GLU A CB    1 
ATOM   2284 C  CG    . GLU A 1 300 ? -48.894 55.006 5.648   1.00 103.74 ? 297 GLU A CG    1 
ATOM   2285 C  CD    . GLU A 1 300 ? -50.286 55.049 5.023   1.00 108.31 ? 297 GLU A CD    1 
ATOM   2286 O  OE1   . GLU A 1 300 ? -51.271 54.713 5.726   1.00 111.02 ? 297 GLU A OE1   1 
ATOM   2287 O  OE2   . GLU A 1 300 ? -50.385 55.423 3.825   1.00 109.18 ? 297 GLU A OE2   1 
ATOM   2288 N  N     . ILE A 1 301 ? -46.720 52.581 4.198   1.00 94.70  ? 298 ILE A N     1 
ATOM   2289 C  CA    . ILE A 1 301 ? -46.033 52.643 2.909   1.00 92.51  ? 298 ILE A CA    1 
ATOM   2290 C  C     . ILE A 1 301 ? -46.326 51.424 2.042   1.00 91.48  ? 298 ILE A C     1 
ATOM   2291 O  O     . ILE A 1 301 ? -46.577 51.561 0.844   1.00 90.98  ? 298 ILE A O     1 
ATOM   2292 C  CB    . ILE A 1 301 ? -44.511 52.771 3.088   1.00 91.47  ? 298 ILE A CB    1 
ATOM   2293 C  CG1   . ILE A 1 301 ? -44.148 54.197 3.491   1.00 92.59  ? 298 ILE A CG1   1 
ATOM   2294 C  CG2   . ILE A 1 301 ? -43.773 52.405 1.814   1.00 89.52  ? 298 ILE A CG2   1 
ATOM   2295 C  CD1   . ILE A 1 301 ? -42.724 54.338 4.065   1.00 93.37  ? 298 ILE A CD1   1 
ATOM   2296 N  N     . ARG A 1 302 ? -46.302 50.242 2.647   1.00 91.11  ? 299 ARG A N     1 
ATOM   2297 C  CA    . ARG A 1 302 ? -46.427 48.994 1.902   1.00 90.27  ? 299 ARG A CA    1 
ATOM   2298 C  C     . ARG A 1 302 ? -47.790 48.783 1.247   1.00 91.21  ? 299 ARG A C     1 
ATOM   2299 O  O     . ARG A 1 302 ? -47.896 48.105 0.222   1.00 90.41  ? 299 ARG A O     1 
ATOM   2300 C  CB    . ARG A 1 302 ? -46.115 47.806 2.799   1.00 90.43  ? 299 ARG A CB    1 
ATOM   2301 C  CG    . ARG A 1 302 ? -44.658 47.578 3.063   1.00 88.66  ? 299 ARG A CG    1 
ATOM   2302 C  CD    . ARG A 1 302 ? -44.527 46.644 4.231   1.00 89.69  ? 299 ARG A CD    1 
ATOM   2303 N  NE    . ARG A 1 302 ? -43.148 46.225 4.452   1.00 89.55  ? 299 ARG A NE    1 
ATOM   2304 C  CZ    . ARG A 1 302 ? -42.765 45.355 5.386   1.00 89.83  ? 299 ARG A CZ    1 
ATOM   2305 N  NH1   . ARG A 1 302 ? -43.663 44.809 6.209   1.00 90.83  ? 299 ARG A NH1   1 
ATOM   2306 N  NH2   . ARG A 1 302 ? -41.480 45.037 5.498   1.00 87.95  ? 299 ARG A NH2   1 
ATOM   2307 N  N     . THR A 1 303 ? -48.838 49.341 1.840   1.00 93.01  ? 300 THR A N     1 
ATOM   2308 C  CA    . THR A 1 303 ? -50.179 49.131 1.301   1.00 94.37  ? 300 THR A CA    1 
ATOM   2309 C  C     . THR A 1 303 ? -50.554 50.223 0.311   1.00 94.58  ? 300 THR A C     1 
ATOM   2310 O  O     . THR A 1 303 ? -51.473 50.056 -0.484  1.00 95.50  ? 300 THR A O     1 
ATOM   2311 C  CB    . THR A 1 303 ? -51.249 49.015 2.405   1.00 96.19  ? 300 THR A CB    1 
ATOM   2312 O  OG1   . THR A 1 303 ? -51.336 50.254 3.113   1.00 96.71  ? 300 THR A OG1   1 
ATOM   2313 C  CG2   . THR A 1 303 ? -50.906 47.885 3.379   1.00 96.25  ? 300 THR A CG2   1 
ATOM   2314 N  N     . SER A 1 304 ? -49.822 51.328 0.347   1.00 94.26  ? 301 SER A N     1 
ATOM   2315 C  CA    . SER A 1 304 ? -50.115 52.469 -0.502  1.00 94.64  ? 301 SER A CA    1 
ATOM   2316 C  C     . SER A 1 304 ? -49.392 52.420 -1.843  1.00 93.35  ? 301 SER A C     1 
ATOM   2317 O  O     . SER A 1 304 ? -49.554 53.336 -2.646  1.00 93.57  ? 301 SER A O     1 
ATOM   2318 C  CB    . SER A 1 304 ? -49.680 53.743 0.195   1.00 94.89  ? 301 SER A CB    1 
ATOM   2319 O  OG    . SER A 1 304 ? -48.310 53.964 -0.101  1.00 93.86  ? 301 SER A OG    1 
ATOM   2320 N  N     . LEU A 1 305 ? -48.583 51.385 -2.076  1.00 92.46  ? 302 LEU A N     1 
ATOM   2321 C  CA    . LEU A 1 305 ? -47.733 51.309 -3.278  1.00 91.20  ? 302 LEU A CA    1 
ATOM   2322 C  C     . LEU A 1 305 ? -48.508 51.328 -4.578  1.00 91.88  ? 302 LEU A C     1 
ATOM   2323 O  O     . LEU A 1 305 ? -49.585 50.749 -4.675  1.00 92.90  ? 302 LEU A O     1 
ATOM   2324 C  CB    . LEU A 1 305 ? -46.835 50.073 -3.259  1.00 89.90  ? 302 LEU A CB    1 
ATOM   2325 C  CG    . LEU A 1 305 ? -45.719 50.030 -2.224  1.00 88.69  ? 302 LEU A CG    1 
ATOM   2326 C  CD1   . LEU A 1 305 ? -44.802 48.863 -2.509  1.00 86.66  ? 302 LEU A CD1   1 
ATOM   2327 C  CD2   . LEU A 1 305 ? -44.953 51.336 -2.205  1.00 88.12  ? 302 LEU A CD2   1 
ATOM   2328 N  N     . TYR A 1 306 ? -47.934 51.994 -5.572  1.00 91.93  ? 303 TYR A N     1 
ATOM   2329 C  CA    . TYR A 1 306 ? -48.501 52.063 -6.906  1.00 92.93  ? 303 TYR A CA    1 
ATOM   2330 C  C     . TYR A 1 306 ? -48.760 50.682 -7.484  1.00 93.02  ? 303 TYR A C     1 
ATOM   2331 O  O     . TYR A 1 306 ? -47.857 49.845 -7.571  1.00 91.86  ? 303 TYR A O     1 
ATOM   2332 C  CB    . TYR A 1 306 ? -47.562 52.820 -7.846  1.00 92.46  ? 303 TYR A CB    1 
ATOM   2333 C  CG    . TYR A 1 306 ? -47.925 52.623 -9.297  1.00 93.78  ? 303 TYR A CG    1 
ATOM   2334 C  CD1   . TYR A 1 306 ? -48.995 53.331 -9.859  1.00 96.39  ? 303 TYR A CD1   1 
ATOM   2335 C  CD2   . TYR A 1 306 ? -47.224 51.713 -10.104 1.00 93.48  ? 303 TYR A CD2   1 
ATOM   2336 C  CE1   . TYR A 1 306 ? -49.358 53.155 -11.189 1.00 97.01  ? 303 TYR A CE1   1 
ATOM   2337 C  CE2   . TYR A 1 306 ? -47.579 51.526 -11.442 1.00 94.42  ? 303 TYR A CE2   1 
ATOM   2338 C  CZ    . TYR A 1 306 ? -48.652 52.252 -11.970 1.00 96.28  ? 303 TYR A CZ    1 
ATOM   2339 O  OH    . TYR A 1 306 ? -49.036 52.094 -13.276 1.00 97.48  ? 303 TYR A OH    1 
ATOM   2340 N  N     . HIS A 1 307 ? -50.001 50.456 -7.891  1.00 94.80  ? 304 HIS A N     1 
ATOM   2341 C  CA    . HIS A 1 307 ? -50.347 49.219 -8.571  1.00 95.54  ? 304 HIS A CA    1 
ATOM   2342 C  C     . HIS A 1 307 ? -50.962 49.462 -9.945  1.00 95.19  ? 304 HIS A C     1 
ATOM   2343 O  O     . HIS A 1 307 ? -52.038 50.052 -10.044 1.00 96.60  ? 304 HIS A O     1 
ATOM   2344 C  CB    . HIS A 1 307 ? -51.260 48.324 -7.720  1.00 97.50  ? 304 HIS A CB    1 
ATOM   2345 C  CG    . HIS A 1 307 ? -51.536 46.994 -8.356  1.00 101.07 ? 304 HIS A CG    1 
ATOM   2346 N  ND1   . HIS A 1 307 ? -50.530 46.095 -8.664  1.00 101.85 ? 304 HIS A ND1   1 
ATOM   2347 C  CD2   . HIS A 1 307 ? -52.695 46.425 -8.775  1.00 104.72 ? 304 HIS A CD2   1 
ATOM   2348 C  CE1   . HIS A 1 307 ? -51.060 45.027 -9.237  1.00 103.50 ? 304 HIS A CE1   1 
ATOM   2349 N  NE2   . HIS A 1 307 ? -52.371 45.199 -9.312  1.00 105.75 ? 304 HIS A NE2   1 
ATOM   2350 N  N     . PRO A 1 308 ? -50.283 48.979 -11.004 1.00 93.65  ? 305 PRO A N     1 
ATOM   2351 C  CA    . PRO A 1 308 ? -50.660 49.151 -12.410 1.00 93.70  ? 305 PRO A CA    1 
ATOM   2352 C  C     . PRO A 1 308 ? -51.957 48.419 -12.760 1.00 94.92  ? 305 PRO A C     1 
ATOM   2353 O  O     . PRO A 1 308 ? -52.245 47.369 -12.179 1.00 95.19  ? 305 PRO A O     1 
ATOM   2354 C  CB    . PRO A 1 308 ? -49.493 48.505 -13.147 1.00 92.36  ? 305 PRO A CB    1 
ATOM   2355 C  CG    . PRO A 1 308 ? -48.950 47.503 -12.185 1.00 91.56  ? 305 PRO A CG    1 
ATOM   2356 C  CD    . PRO A 1 308 ? -49.092 48.121 -10.855 1.00 92.09  ? 305 PRO A CD    1 
ATOM   2357 N  N     . SER A 1 309 ? -52.749 48.958 -13.682 1.00 95.65  ? 306 SER A N     1 
ATOM   2358 C  CA    . SER A 1 309 ? -53.949 48.224 -14.114 1.00 97.07  ? 306 SER A CA    1 
ATOM   2359 C  C     . SER A 1 309 ? -53.763 47.631 -15.516 1.00 96.40  ? 306 SER A C     1 
ATOM   2360 O  O     . SER A 1 309 ? -52.773 47.933 -16.190 1.00 95.68  ? 306 SER A O     1 
ATOM   2361 C  CB    . SER A 1 309 ? -55.230 49.073 -13.996 1.00 99.02  ? 306 SER A CB    1 
ATOM   2362 O  OG    . SER A 1 309 ? -55.113 50.294 -14.706 1.00 100.11 ? 306 SER A OG    1 
ATOM   2363 N  N     . THR A 1 310 ? -54.688 46.777 -15.949 1.00 96.65  ? 307 THR A N     1 
ATOM   2364 C  CA    . THR A 1 310 ? -54.526 46.118 -17.241 1.00 95.78  ? 307 THR A CA    1 
ATOM   2365 C  C     . THR A 1 310 ? -54.793 47.112 -18.362 1.00 95.80  ? 307 THR A C     1 
ATOM   2366 O  O     . THR A 1 310 ? -55.647 47.980 -18.213 1.00 96.89  ? 307 THR A O     1 
ATOM   2367 C  CB    . THR A 1 310 ? -55.412 44.862 -17.390 1.00 96.84  ? 307 THR A CB    1 
ATOM   2368 O  OG1   . THR A 1 310 ? -56.782 45.248 -17.479 1.00 99.15  ? 307 THR A OG1   1 
ATOM   2369 C  CG2   . THR A 1 310 ? -55.227 43.926 -16.204 1.00 96.51  ? 307 THR A CG2   1 
ATOM   2370 N  N     . PRO A 1 311 ? -54.044 47.001 -19.475 1.00 94.69  ? 308 PRO A N     1 
ATOM   2371 C  CA    . PRO A 1 311 ? -54.165 47.900 -20.620 1.00 95.13  ? 308 PRO A CA    1 
ATOM   2372 C  C     . PRO A 1 311 ? -55.378 47.584 -21.510 1.00 96.94  ? 308 PRO A C     1 
ATOM   2373 O  O     . PRO A 1 311 ? -55.957 46.500 -21.397 1.00 97.57  ? 308 PRO A O     1 
ATOM   2374 C  CB    . PRO A 1 311 ? -52.872 47.642 -21.384 1.00 93.66  ? 308 PRO A CB    1 
ATOM   2375 C  CG    . PRO A 1 311 ? -52.565 46.236 -21.098 1.00 93.14  ? 308 PRO A CG    1 
ATOM   2376 C  CD    . PRO A 1 311 ? -52.991 45.992 -19.691 1.00 93.28  ? 308 PRO A CD    1 
ATOM   2377 N  N     . PRO A 1 312 ? -55.765 48.525 -22.391 1.00 101.29 ? 309 PRO A N     1 
ATOM   2378 C  CA    . PRO A 1 312 ? -56.890 48.277 -23.289 1.00 100.96 ? 309 PRO A CA    1 
ATOM   2379 C  C     . PRO A 1 312 ? -56.633 47.092 -24.221 1.00 98.73  ? 309 PRO A C     1 
ATOM   2380 O  O     . PRO A 1 312 ? -55.493 46.858 -24.610 1.00 97.81  ? 309 PRO A O     1 
ATOM   2381 C  CB    . PRO A 1 312 ? -56.978 49.577 -24.095 1.00 102.86 ? 309 PRO A CB    1 
ATOM   2382 C  CG    . PRO A 1 312 ? -55.616 50.180 -23.995 1.00 103.24 ? 309 PRO A CG    1 
ATOM   2383 C  CD    . PRO A 1 312 ? -55.190 49.863 -22.609 1.00 103.21 ? 309 PRO A CD    1 
ATOM   2384 N  N     . ALA A 1 313 ? -57.682 46.351 -24.562 1.00 98.28  ? 310 ALA A N     1 
ATOM   2385 C  CA    . ALA A 1 313 ? -57.568 45.247 -25.519 1.00 96.96  ? 310 ALA A CA    1 
ATOM   2386 C  C     . ALA A 1 313 ? -57.287 45.797 -26.915 1.00 97.18  ? 310 ALA A C     1 
ATOM   2387 O  O     . ALA A 1 313 ? -57.844 46.830 -27.283 1.00 99.16  ? 310 ALA A O     1 
ATOM   2388 C  CB    . ALA A 1 313 ? -58.845 44.416 -25.526 1.00 96.85  ? 310 ALA A CB    1 
ATOM   2389 N  N     . SER A 1 314 ? -56.425 45.128 -27.686 1.00 95.77  ? 311 SER A N     1 
ATOM   2390 C  CA    . SER A 1 314 ? -56.150 45.551 -29.068 1.00 95.72  ? 311 SER A CA    1 
ATOM   2391 C  C     . SER A 1 314 ? -57.376 45.265 -29.928 1.00 95.94  ? 311 SER A C     1 
ATOM   2392 O  O     . SER A 1 314 ? -58.225 44.460 -29.534 1.00 95.57  ? 311 SER A O     1 
ATOM   2393 C  CB    . SER A 1 314 ? -54.922 44.837 -29.633 1.00 94.45  ? 311 SER A CB    1 
ATOM   2394 O  OG    . SER A 1 314 ? -55.239 43.518 -30.031 1.00 92.71  ? 311 SER A OG    1 
ATOM   2395 N  N     . SER A 1 315 ? -57.464 45.922 -31.088 1.00 96.74  ? 312 SER A N     1 
ATOM   2396 C  CA    . SER A 1 315 ? -58.659 45.847 -31.959 1.00 97.77  ? 312 SER A CA    1 
ATOM   2397 C  C     . SER A 1 315 ? -59.125 44.419 -32.213 1.00 96.38  ? 312 SER A C     1 
ATOM   2398 O  O     . SER A 1 315 ? -60.321 44.133 -32.196 1.00 97.43  ? 312 SER A O     1 
ATOM   2399 C  CB    . SER A 1 315 ? -58.417 46.521 -33.318 1.00 98.72  ? 312 SER A CB    1 
ATOM   2400 O  OG    . SER A 1 315 ? -57.608 47.679 -33.195 1.00 101.28 ? 312 SER A OG    1 
ATOM   2401 N  N     . ARG A 1 316 ? -58.168 43.526 -32.444 1.00 94.46  ? 313 ARG A N     1 
ATOM   2402 C  CA    . ARG A 1 316 ? -58.475 42.185 -32.902 1.00 93.10  ? 313 ARG A CA    1 
ATOM   2403 C  C     . ARG A 1 316 ? -57.966 41.134 -31.941 1.00 91.73  ? 313 ARG A C     1 
ATOM   2404 O  O     . ARG A 1 316 ? -57.130 40.291 -32.276 1.00 90.64  ? 313 ARG A O     1 
ATOM   2405 C  CB    . ARG A 1 316 ? -57.920 41.986 -34.301 1.00 92.79  ? 313 ARG A CB    1 
ATOM   2406 C  CG    . ARG A 1 316 ? -58.675 42.802 -35.323 1.00 94.36  ? 313 ARG A CG    1 
ATOM   2407 C  CD    . ARG A 1 316 ? -58.101 42.600 -36.686 1.00 94.13  ? 313 ARG A CD    1 
ATOM   2408 N  NE    . ARG A 1 316 ? -58.699 43.510 -37.650 1.00 95.71  ? 313 ARG A NE    1 
ATOM   2409 C  CZ    . ARG A 1 316 ? -58.584 43.359 -38.961 1.00 96.53  ? 313 ARG A CZ    1 
ATOM   2410 N  NH1   . ARG A 1 316 ? -57.906 42.326 -39.444 1.00 96.44  ? 313 ARG A NH1   1 
ATOM   2411 N  NH2   . ARG A 1 316 ? -59.148 44.229 -39.785 1.00 98.21  ? 313 ARG A NH2   1 
ATOM   2412 N  N     . SER A 1 317 ? -58.499 41.198 -30.732 1.00 91.85  ? 314 SER A N     1 
ATOM   2413 C  CA    . SER A 1 317 ? -58.177 40.233 -29.705 1.00 91.20  ? 314 SER A CA    1 
ATOM   2414 C  C     . SER A 1 317 ? -59.250 39.155 -29.630 1.00 91.26  ? 314 SER A C     1 
ATOM   2415 O  O     . SER A 1 317 ? -60.315 39.281 -30.232 1.00 92.10  ? 314 SER A O     1 
ATOM   2416 C  CB    . SER A 1 317 ? -58.042 40.939 -28.363 1.00 91.75  ? 314 SER A CB    1 
ATOM   2417 O  OG    . SER A 1 317 ? -59.118 41.841 -28.185 1.00 94.35  ? 314 SER A OG    1 
ATOM   2418 N  N     . TRP A 1 318 ? -58.947 38.085 -28.907 1.00 90.57  ? 315 TRP A N     1 
ATOM   2419 C  CA    . TRP A 1 318 ? -59.905 37.029 -28.656 1.00 91.10  ? 315 TRP A CA    1 
ATOM   2420 C  C     . TRP A 1 318 ? -59.826 36.650 -27.204 1.00 91.55  ? 315 TRP A C     1 
ATOM   2421 O  O     . TRP A 1 318 ? -58.821 36.909 -26.532 1.00 91.03  ? 315 TRP A O     1 
ATOM   2422 C  CB    . TRP A 1 318 ? -59.628 35.804 -29.527 1.00 90.98  ? 315 TRP A CB    1 
ATOM   2423 C  CG    . TRP A 1 318 ? -58.385 35.037 -29.169 1.00 89.53  ? 315 TRP A CG    1 
ATOM   2424 C  CD1   . TRP A 1 318 ? -57.100 35.376 -29.469 1.00 88.04  ? 315 TRP A CD1   1 
ATOM   2425 C  CD2   . TRP A 1 318 ? -58.317 33.793 -28.470 1.00 89.97  ? 315 TRP A CD2   1 
ATOM   2426 N  NE1   . TRP A 1 318 ? -56.236 34.427 -28.993 1.00 87.75  ? 315 TRP A NE1   1 
ATOM   2427 C  CE2   . TRP A 1 318 ? -56.957 33.442 -28.376 1.00 89.10  ? 315 TRP A CE2   1 
ATOM   2428 C  CE3   . TRP A 1 318 ? -59.276 32.939 -27.911 1.00 92.39  ? 315 TRP A CE3   1 
ATOM   2429 C  CZ2   . TRP A 1 318 ? -56.526 32.277 -27.739 1.00 90.41  ? 315 TRP A CZ2   1 
ATOM   2430 C  CZ3   . TRP A 1 318 ? -58.847 31.779 -27.274 1.00 93.28  ? 315 TRP A CZ3   1 
ATOM   2431 C  CH2   . TRP A 1 318 ? -57.482 31.461 -27.195 1.00 92.26  ? 315 TRP A CH2   1 
ATOM   2432 N  N     . SER A 1 319 ? -60.896 36.043 -26.712 1.00 92.74  ? 316 SER A N     1 
ATOM   2433 C  CA    . SER A 1 319 ? -60.879 35.517 -25.366 1.00 93.12  ? 316 SER A CA    1 
ATOM   2434 C  C     . SER A 1 319 ? -61.532 34.163 -25.310 1.00 94.36  ? 316 SER A C     1 
ATOM   2435 O  O     . SER A 1 319 ? -62.453 33.877 -26.089 1.00 95.37  ? 316 SER A O     1 
ATOM   2436 C  CB    . SER A 1 319 ? -61.491 36.503 -24.378 1.00 93.88  ? 316 SER A CB    1 
ATOM   2437 O  OG    . SER A 1 319 ? -60.531 37.504 -24.089 1.00 92.90  ? 316 SER A OG    1 
ATOM   2438 N  N     . PRO A 1 320 ? -61.045 33.316 -24.388 1.00 94.59  ? 317 PRO A N     1 
ATOM   2439 C  CA    . PRO A 1 320 ? -61.401 31.913 -24.392 1.00 95.99  ? 317 PRO A CA    1 
ATOM   2440 C  C     . PRO A 1 320 ? -62.781 31.640 -23.782 1.00 97.86  ? 317 PRO A C     1 
ATOM   2441 O  O     . PRO A 1 320 ? -63.076 32.021 -22.643 1.00 98.46  ? 317 PRO A O     1 
ATOM   2442 C  CB    . PRO A 1 320 ? -60.282 31.269 -23.571 1.00 96.06  ? 317 PRO A CB    1 
ATOM   2443 C  CG    . PRO A 1 320 ? -59.677 32.392 -22.747 1.00 94.71  ? 317 PRO A CG    1 
ATOM   2444 C  CD    . PRO A 1 320 ? -60.295 33.682 -23.172 1.00 94.15  ? 317 PRO A CD    1 
ATOM   2445 N  N     . VAL A 1 321 ? -63.615 30.998 -24.584 1.00 98.73  ? 318 VAL A N     1 
ATOM   2446 C  CA    . VAL A 1 321 ? -64.926 30.536 -24.178 1.00 100.95 ? 318 VAL A CA    1 
ATOM   2447 C  C     . VAL A 1 321 ? -64.806 29.040 -23.824 1.00 102.47 ? 318 VAL A C     1 
ATOM   2448 O  O     . VAL A 1 321 ? -64.004 28.322 -24.420 1.00 102.18 ? 318 VAL A O     1 
ATOM   2449 C  CB    . VAL A 1 321 ? -65.937 30.793 -25.340 1.00 101.85 ? 318 VAL A CB    1 
ATOM   2450 C  CG1   . VAL A 1 321 ? -67.203 29.945 -25.213 1.00 105.72 ? 318 VAL A CG1   1 
ATOM   2451 C  CG2   . VAL A 1 321 ? -66.277 32.283 -25.432 1.00 100.76 ? 318 VAL A CG2   1 
ATOM   2452 N  N     . VAL A 1 322 ? -65.576 28.573 -22.847 1.00 104.07 ? 319 VAL A N     1 
ATOM   2453 C  CA    . VAL A 1 322 ? -65.615 27.142 -22.546 1.00 105.95 ? 319 VAL A CA    1 
ATOM   2454 C  C     . VAL A 1 322 ? -66.232 26.351 -23.710 1.00 107.35 ? 319 VAL A C     1 
ATOM   2455 O  O     . VAL A 1 322 ? -67.341 26.659 -24.154 1.00 108.58 ? 319 VAL A O     1 
ATOM   2456 C  CB    . VAL A 1 322 ? -66.420 26.864 -21.274 1.00 108.67 ? 319 VAL A CB    1 
ATOM   2457 C  CG1   . VAL A 1 322 ? -66.206 25.436 -20.823 1.00 111.14 ? 319 VAL A CG1   1 
ATOM   2458 C  CG2   . VAL A 1 322 ? -66.036 27.850 -20.175 1.00 106.98 ? 319 VAL A CG2   1 
ATOM   2459 N  N     . GLY A 1 323 ? -65.510 25.343 -24.199 1.00 107.16 ? 320 GLY A N     1 
ATOM   2460 C  CA    . GLY A 1 323 ? -65.988 24.504 -25.308 1.00 108.21 ? 320 GLY A CA    1 
ATOM   2461 C  C     . GLY A 1 323 ? -65.488 24.940 -26.676 1.00 105.16 ? 320 GLY A C     1 
ATOM   2462 O  O     . GLY A 1 323 ? -65.797 24.314 -27.691 1.00 106.44 ? 320 GLY A O     1 
ATOM   2463 N  N     . GLN A 1 324 ? -64.714 26.024 -26.689 1.00 101.18 ? 321 GLN A N     1 
ATOM   2464 C  CA    . GLN A 1 324 ? -64.089 26.576 -27.891 1.00 98.11  ? 321 GLN A CA    1 
ATOM   2465 C  C     . GLN A 1 324 ? -63.028 25.618 -28.431 1.00 97.59  ? 321 GLN A C     1 
ATOM   2466 O  O     . GLN A 1 324 ? -62.345 24.948 -27.656 1.00 98.45  ? 321 GLN A O     1 
ATOM   2467 C  CB    . GLN A 1 324 ? -63.441 27.915 -27.535 1.00 94.92  ? 321 GLN A CB    1 
ATOM   2468 C  CG    . GLN A 1 324 ? -63.189 28.874 -28.689 1.00 93.92  ? 321 GLN A CG    1 
ATOM   2469 C  CD    . GLN A 1 324 ? -62.522 30.190 -28.245 1.00 93.50  ? 321 GLN A CD    1 
ATOM   2470 O  OE1   . GLN A 1 324 ? -62.247 30.418 -27.059 1.00 94.05  ? 321 GLN A OE1   1 
ATOM   2471 N  NE2   . GLN A 1 324 ? -62.257 31.058 -29.208 1.00 92.62  ? 321 GLN A NE2   1 
ATOM   2472 N  N     . LEU A 1 325 ? -62.898 25.537 -29.753 1.00 96.34  ? 322 LEU A N     1 
ATOM   2473 C  CA    . LEU A 1 325 ? -61.787 24.798 -30.345 1.00 95.39  ? 322 LEU A CA    1 
ATOM   2474 C  C     . LEU A 1 325 ? -60.537 25.662 -30.417 1.00 91.64  ? 322 LEU A C     1 
ATOM   2475 O  O     . LEU A 1 325 ? -60.588 26.824 -30.822 1.00 89.64  ? 322 LEU A O     1 
ATOM   2476 C  CB    . LEU A 1 325 ? -62.145 24.236 -31.707 1.00 96.67  ? 322 LEU A CB    1 
ATOM   2477 C  CG    . LEU A 1 325 ? -62.615 22.796 -31.570 1.00 100.92 ? 322 LEU A CG    1 
ATOM   2478 C  CD1   . LEU A 1 325 ? -64.147 22.703 -31.377 1.00 104.33 ? 322 LEU A CD1   1 
ATOM   2479 C  CD2   . LEU A 1 325 ? -62.177 22.020 -32.785 1.00 102.38 ? 322 LEU A CD2   1 
ATOM   2480 N  N     . VAL A 1 326 ? -59.412 25.068 -30.038 1.00 90.88  ? 323 VAL A N     1 
ATOM   2481 C  CA    . VAL A 1 326 ? -58.247 25.814 -29.626 1.00 87.69  ? 323 VAL A CA    1 
ATOM   2482 C  C     . VAL A 1 326 ? -56.981 24.995 -29.889 1.00 88.12  ? 323 VAL A C     1 
ATOM   2483 O  O     . VAL A 1 326 ? -56.992 23.775 -29.763 1.00 90.61  ? 323 VAL A O     1 
ATOM   2484 C  CB    . VAL A 1 326 ? -58.418 26.147 -28.132 1.00 87.61  ? 323 VAL A CB    1 
ATOM   2485 C  CG1   . VAL A 1 326 ? -57.109 26.153 -27.399 1.00 87.54  ? 323 VAL A CG1   1 
ATOM   2486 C  CG2   . VAL A 1 326 ? -59.150 27.459 -27.962 1.00 85.67  ? 323 VAL A CG2   1 
ATOM   2487 N  N     . GLN A 1 327 ? -55.885 25.650 -30.258 1.00 85.77  ? 324 GLN A N     1 
ATOM   2488 C  CA    . GLN A 1 327 ? -54.669 24.896 -30.564 1.00 86.65  ? 324 GLN A CA    1 
ATOM   2489 C  C     . GLN A 1 327 ? -53.414 25.433 -29.857 1.00 85.41  ? 324 GLN A C     1 
ATOM   2490 O  O     . GLN A 1 327 ? -53.172 26.639 -29.816 1.00 82.91  ? 324 GLN A O     1 
ATOM   2491 C  CB    . GLN A 1 327 ? -54.483 24.768 -32.095 1.00 86.79  ? 324 GLN A CB    1 
ATOM   2492 C  CG    . GLN A 1 327 ? -55.691 24.093 -32.832 1.00 88.42  ? 324 GLN A CG    1 
ATOM   2493 C  CD    . GLN A 1 327 ? -55.613 24.183 -34.358 1.00 89.71  ? 324 GLN A CD    1 
ATOM   2494 O  OE1   . GLN A 1 327 ? -56.430 24.854 -35.003 1.00 89.76  ? 324 GLN A OE1   1 
ATOM   2495 N  NE2   . GLN A 1 327 ? -54.607 23.531 -34.937 1.00 91.82  ? 324 GLN A NE2   1 
ATOM   2496 N  N     . GLU A 1 328 ? -52.637 24.508 -29.292 1.00 87.57  ? 325 GLU A N     1 
ATOM   2497 C  CA    . GLU A 1 328 ? -51.443 24.823 -28.504 1.00 87.61  ? 325 GLU A CA    1 
ATOM   2498 C  C     . GLU A 1 328 ? -50.209 24.892 -29.395 1.00 87.22  ? 325 GLU A C     1 
ATOM   2499 O  O     . GLU A 1 328 ? -50.038 24.025 -30.249 1.00 89.19  ? 325 GLU A O     1 
ATOM   2500 C  CB    . GLU A 1 328 ? -51.221 23.755 -27.425 1.00 90.92  ? 325 GLU A CB    1 
ATOM   2501 C  CG    . GLU A 1 328 ? -50.147 24.162 -26.396 1.00 92.84  ? 325 GLU A CG    1 
ATOM   2502 C  CD    . GLU A 1 328 ? -49.819 23.113 -25.321 1.00 97.72  ? 325 GLU A CD    1 
ATOM   2503 O  OE1   . GLU A 1 328 ? -50.402 21.997 -25.307 1.00 101.16 ? 325 GLU A OE1   1 
ATOM   2504 O  OE2   . GLU A 1 328 ? -48.951 23.436 -24.478 1.00 98.16  ? 325 GLU A OE2   1 
ATOM   2505 N  N     . ARG A 1 329 ? -49.346 25.895 -29.200 1.00 85.18  ? 326 ARG A N     1 
ATOM   2506 C  CA    . ARG A 1 329 ? -48.159 26.038 -30.047 1.00 84.91  ? 326 ARG A CA    1 
ATOM   2507 C  C     . ARG A 1 329 ? -47.191 24.899 -29.805 1.00 87.15  ? 326 ARG A C     1 
ATOM   2508 O  O     . ARG A 1 329 ? -46.892 24.589 -28.669 1.00 88.68  ? 326 ARG A O     1 
ATOM   2509 C  CB    . ARG A 1 329 ? -47.448 27.391 -29.857 1.00 83.46  ? 326 ARG A CB    1 
ATOM   2510 C  CG    . ARG A 1 329 ? -46.059 27.456 -30.589 1.00 87.37  ? 326 ARG A CG    1 
ATOM   2511 C  CD    . ARG A 1 329 ? -45.622 28.846 -31.109 1.00 89.58  ? 326 ARG A CD    1 
ATOM   2512 N  NE    . ARG A 1 329 ? -46.102 29.917 -30.232 1.00 92.37  ? 326 ARG A NE    1 
ATOM   2513 C  CZ    . ARG A 1 329 ? -46.775 30.995 -30.636 1.00 92.04  ? 326 ARG A CZ    1 
ATOM   2514 N  NH1   . ARG A 1 329 ? -47.033 31.195 -31.929 1.00 91.88  ? 326 ARG A NH1   1 
ATOM   2515 N  NH2   . ARG A 1 329 ? -47.174 31.886 -29.739 1.00 91.37  ? 326 ARG A NH2   1 
ATOM   2516 N  N     . VAL A 1 330 ? -46.719 24.272 -30.879 1.00 87.67  ? 327 VAL A N     1 
ATOM   2517 C  CA    . VAL A 1 330 ? -45.651 23.283 -30.782 1.00 90.29  ? 327 VAL A CA    1 
ATOM   2518 C  C     . VAL A 1 330 ? -44.447 23.949 -30.136 1.00 90.07  ? 327 VAL A C     1 
ATOM   2519 O  O     . VAL A 1 330 ? -43.964 24.976 -30.616 1.00 88.10  ? 327 VAL A O     1 
ATOM   2520 C  CB    . VAL A 1 330 ? -45.258 22.706 -32.157 1.00 91.40  ? 327 VAL A CB    1 
ATOM   2521 C  CG1   . VAL A 1 330 ? -44.061 21.765 -32.036 1.00 94.87  ? 327 VAL A CG1   1 
ATOM   2522 C  CG2   . VAL A 1 330 ? -46.423 21.973 -32.757 1.00 91.86  ? 327 VAL A CG2   1 
ATOM   2523 N  N     . ALA A 1 331 ? -43.986 23.342 -29.045 1.00 92.21  ? 328 ALA A N     1 
ATOM   2524 C  CA    . ALA A 1 331 ? -42.950 23.898 -28.183 1.00 92.15  ? 328 ALA A CA    1 
ATOM   2525 C  C     . ALA A 1 331 ? -41.612 24.077 -28.893 1.00 92.71  ? 328 ALA A C     1 
ATOM   2526 O  O     . ALA A 1 331 ? -41.178 25.208 -29.102 1.00 91.00  ? 328 ALA A O     1 
ATOM   2527 C  CB    . ALA A 1 331 ? -42.786 23.029 -26.931 1.00 95.54  ? 328 ALA A CB    1 
ATOM   2528 N  N     . ARG A 1 332 ? -40.956 22.977 -29.253 1.00 95.08  ? 329 ARG A N     1 
ATOM   2529 C  CA    . ARG A 1 332 ? -39.654 23.065 -29.913 1.00 95.84  ? 329 ARG A CA    1 
ATOM   2530 C  C     . ARG A 1 332 ? -39.752 22.522 -31.343 1.00 95.23  ? 329 ARG A C     1 
ATOM   2531 O  O     . ARG A 1 332 ? -39.284 21.415 -31.628 1.00 98.77  ? 329 ARG A O     1 
ATOM   2532 C  CB    . ARG A 1 332 ? -38.577 22.339 -29.093 1.00 100.49 ? 329 ARG A CB    1 
ATOM   2533 N  N     . PRO A 1 333 ? -40.354 23.314 -32.252 1.00 90.66  ? 330 PRO A N     1 
ATOM   2534 C  CA    . PRO A 1 333 ? -40.788 22.788 -33.536 1.00 89.70  ? 330 PRO A CA    1 
ATOM   2535 C  C     . PRO A 1 333 ? -39.604 22.475 -34.395 1.00 91.42  ? 330 PRO A C     1 
ATOM   2536 O  O     . PRO A 1 333 ? -38.744 23.325 -34.583 1.00 90.98  ? 330 PRO A O     1 
ATOM   2537 C  CB    . PRO A 1 333 ? -41.586 23.945 -34.154 1.00 85.32  ? 330 PRO A CB    1 
ATOM   2538 C  CG    . PRO A 1 333 ? -41.634 25.025 -33.120 1.00 83.86  ? 330 PRO A CG    1 
ATOM   2539 C  CD    . PRO A 1 333 ? -40.475 24.778 -32.212 1.00 87.08  ? 330 PRO A CD    1 
ATOM   2540 N  N     . ALA A 1 334 ? -39.557 21.254 -34.901 1.00 93.70  ? 331 ALA A N     1 
ATOM   2541 C  CA    . ALA A 1 334 ? -38.477 20.839 -35.773 1.00 95.94  ? 331 ALA A CA    1 
ATOM   2542 C  C     . ALA A 1 334 ? -38.537 21.597 -37.097 1.00 93.08  ? 331 ALA A C     1 
ATOM   2543 O  O     . ALA A 1 334 ? -39.599 22.070 -37.509 1.00 89.65  ? 331 ALA A O     1 
ATOM   2544 C  CB    . ALA A 1 334 ? -38.530 19.338 -35.999 1.00 99.97  ? 331 ALA A CB    1 
ATOM   2545 N  N     . SER A 1 335 ? -37.382 21.723 -37.741 1.00 94.63  ? 332 SER A N     1 
ATOM   2546 C  CA    . SER A 1 335 ? -37.267 22.370 -39.045 1.00 92.71  ? 332 SER A CA    1 
ATOM   2547 C  C     . SER A 1 335 ? -38.246 21.792 -40.076 1.00 91.86  ? 332 SER A C     1 
ATOM   2548 O  O     . SER A 1 335 ? -38.193 20.595 -40.390 1.00 95.02  ? 332 SER A O     1 
ATOM   2549 C  CB    . SER A 1 335 ? -35.827 22.251 -39.548 1.00 96.12  ? 332 SER A CB    1 
ATOM   2550 O  OG    . SER A 1 335 ? -35.752 22.451 -40.945 1.00 95.26  ? 332 SER A OG    1 
ATOM   2551 N  N     . LEU A 1 336 ? -39.140 22.650 -40.578 1.00 87.78  ? 333 LEU A N     1 
ATOM   2552 C  CA    . LEU A 1 336 ? -40.080 22.319 -41.672 1.00 86.52  ? 333 LEU A CA    1 
ATOM   2553 C  C     . LEU A 1 336 ? -41.345 21.596 -41.226 1.00 86.33  ? 333 LEU A C     1 
ATOM   2554 O  O     . LEU A 1 336 ? -42.093 21.080 -42.062 1.00 86.80  ? 333 LEU A O     1 
ATOM   2555 C  CB    . LEU A 1 336 ? -39.402 21.526 -42.808 1.00 89.38  ? 333 LEU A CB    1 
ATOM   2556 C  CG    . LEU A 1 336 ? -38.513 22.268 -43.808 1.00 88.37  ? 333 LEU A CG    1 
ATOM   2557 C  CD1   . LEU A 1 336 ? -37.935 21.312 -44.821 1.00 91.02  ? 333 LEU A CD1   1 
ATOM   2558 C  CD2   . LEU A 1 336 ? -39.296 23.352 -44.507 1.00 83.88  ? 333 LEU A CD2   1 
ATOM   2559 N  N     . ARG A 1 337 ? -41.584 21.558 -39.919 1.00 85.91  ? 334 ARG A N     1 
ATOM   2560 C  CA    . ARG A 1 337 ? -42.738 20.846 -39.376 1.00 85.74  ? 334 ARG A CA    1 
ATOM   2561 C  C     . ARG A 1 337 ? -43.712 21.839 -38.737 1.00 82.24  ? 334 ARG A C     1 
ATOM   2562 O  O     . ARG A 1 337 ? -43.310 22.951 -38.412 1.00 80.11  ? 334 ARG A O     1 
ATOM   2563 C  CB    . ARG A 1 337 ? -42.270 19.766 -38.408 1.00 89.01  ? 334 ARG A CB    1 
ATOM   2564 C  CG    . ARG A 1 337 ? -41.400 18.721 -39.075 1.00 92.11  ? 334 ARG A CG    1 
ATOM   2565 C  CD    . ARG A 1 337 ? -41.745 17.325 -38.575 1.00 95.29  ? 334 ARG A CD    1 
ATOM   2566 N  NE    . ARG A 1 337 ? -41.269 16.255 -39.455 1.00 98.10  ? 334 ARG A NE    1 
ATOM   2567 C  CZ    . ARG A 1 337 ? -41.777 15.983 -40.657 1.00 97.09  ? 334 ARG A CZ    1 
ATOM   2568 N  NH1   . ARG A 1 337 ? -42.770 16.720 -41.147 1.00 93.63  ? 334 ARG A NH1   1 
ATOM   2569 N  NH2   . ARG A 1 337 ? -41.279 14.987 -41.377 1.00 99.42  ? 334 ARG A NH2   1 
ATOM   2570 N  N     . PRO A 1 338 ? -44.998 21.462 -38.589 1.00 82.15  ? 335 PRO A N     1 
ATOM   2571 C  CA    . PRO A 1 338 ? -46.026 22.429 -38.197 1.00 79.51  ? 335 PRO A CA    1 
ATOM   2572 C  C     . PRO A 1 338 ? -45.723 23.172 -36.917 1.00 79.10  ? 335 PRO A C     1 
ATOM   2573 O  O     . PRO A 1 338 ? -45.224 22.581 -35.973 1.00 81.09  ? 335 PRO A O     1 
ATOM   2574 C  CB    . PRO A 1 338 ? -47.270 21.561 -38.023 1.00 80.39  ? 335 PRO A CB    1 
ATOM   2575 C  CG    . PRO A 1 338 ? -47.077 20.482 -38.969 1.00 82.92  ? 335 PRO A CG    1 
ATOM   2576 C  CD    . PRO A 1 338 ? -45.604 20.168 -38.939 1.00 85.10  ? 335 PRO A CD    1 
ATOM   2577 N  N     . ARG A 1 339 ? -46.022 24.466 -36.898 1.00 77.49  ? 336 ARG A N     1 
ATOM   2578 C  CA    . ARG A 1 339 ? -45.791 25.279 -35.707 1.00 77.94  ? 336 ARG A CA    1 
ATOM   2579 C  C     . ARG A 1 339 ? -46.929 25.155 -34.651 1.00 78.03  ? 336 ARG A C     1 
ATOM   2580 O  O     . ARG A 1 339 ? -46.870 25.812 -33.616 1.00 77.20  ? 336 ARG A O     1 
ATOM   2581 C  CB    . ARG A 1 339 ? -45.521 26.755 -36.090 1.00 75.58  ? 336 ARG A CB    1 
ATOM   2582 C  CG    . ARG A 1 339 ? -44.302 27.026 -37.039 1.00 78.54  ? 336 ARG A CG    1 
ATOM   2583 C  CD    . ARG A 1 339 ? -42.951 27.157 -36.286 1.00 83.70  ? 336 ARG A CD    1 
ATOM   2584 N  NE    . ARG A 1 339 ? -41.739 27.245 -37.132 1.00 87.35  ? 336 ARG A NE    1 
ATOM   2585 C  CZ    . ARG A 1 339 ? -40.964 26.210 -37.503 1.00 91.73  ? 336 ARG A CZ    1 
ATOM   2586 N  NH1   . ARG A 1 339 ? -41.252 24.963 -37.144 1.00 94.19  ? 336 ARG A NH1   1 
ATOM   2587 N  NH2   . ARG A 1 339 ? -39.885 26.411 -38.255 1.00 94.18  ? 336 ARG A NH2   1 
ATOM   2588 N  N     . TRP A 1 340 ? -47.936 24.304 -34.906 1.00 79.89  ? 337 TRP A N     1 
ATOM   2589 C  CA    . TRP A 1 340 ? -49.110 24.134 -34.015 1.00 80.56  ? 337 TRP A CA    1 
ATOM   2590 C  C     . TRP A 1 340 ? -49.557 22.694 -33.848 1.00 84.04  ? 337 TRP A C     1 
ATOM   2591 O  O     . TRP A 1 340 ? -49.470 21.905 -34.788 1.00 85.99  ? 337 TRP A O     1 
ATOM   2592 C  CB    . TRP A 1 340 ? -50.307 24.910 -34.546 1.00 78.49  ? 337 TRP A CB    1 
ATOM   2593 C  CG    . TRP A 1 340 ? -50.029 26.327 -34.658 1.00 77.41  ? 337 TRP A CG    1 
ATOM   2594 C  CD1   . TRP A 1 340 ? -49.497 26.961 -35.725 1.00 77.13  ? 337 TRP A CD1   1 
ATOM   2595 C  CD2   . TRP A 1 340 ? -50.222 27.318 -33.649 1.00 77.85  ? 337 TRP A CD2   1 
ATOM   2596 N  NE1   . TRP A 1 340 ? -49.352 28.293 -35.458 1.00 76.44  ? 337 TRP A NE1   1 
ATOM   2597 C  CE2   . TRP A 1 340 ? -49.793 28.541 -34.186 1.00 76.31  ? 337 TRP A CE2   1 
ATOM   2598 C  CE3   . TRP A 1 340 ? -50.731 27.294 -32.344 1.00 79.52  ? 337 TRP A CE3   1 
ATOM   2599 C  CZ2   . TRP A 1 340 ? -49.850 29.735 -33.466 1.00 75.68  ? 337 TRP A CZ2   1 
ATOM   2600 C  CZ3   . TRP A 1 340 ? -50.790 28.482 -31.626 1.00 77.77  ? 337 TRP A CZ3   1 
ATOM   2601 C  CH2   . TRP A 1 340 ? -50.350 29.684 -32.190 1.00 76.23  ? 337 TRP A CH2   1 
ATOM   2602 N  N     . HIS A 1 341 ? -50.059 22.366 -32.657 1.00 85.42  ? 338 HIS A N     1 
ATOM   2603 C  CA    . HIS A 1 341 ? -50.657 21.052 -32.387 1.00 89.30  ? 338 HIS A CA    1 
ATOM   2604 C  C     . HIS A 1 341 ? -52.065 20.952 -32.980 1.00 89.33  ? 338 HIS A C     1 
ATOM   2605 O  O     . HIS A 1 341 ? -52.612 21.975 -33.422 1.00 86.58  ? 338 HIS A O     1 
ATOM   2606 C  CB    . HIS A 1 341 ? -50.724 20.790 -30.883 1.00 90.75  ? 338 HIS A CB    1 
ATOM   2607 C  CG    . HIS A 1 341 ? -49.390 20.546 -30.252 1.00 93.09  ? 338 HIS A CG    1 
ATOM   2608 N  ND1   . HIS A 1 341 ? -48.661 19.397 -30.476 1.00 97.62  ? 338 HIS A ND1   1 
ATOM   2609 C  CD2   . HIS A 1 341 ? -48.661 21.292 -29.388 1.00 92.49  ? 338 HIS A CD2   1 
ATOM   2610 C  CE1   . HIS A 1 341 ? -47.536 19.449 -29.783 1.00 98.76  ? 338 HIS A CE1   1 
ATOM   2611 N  NE2   . HIS A 1 341 ? -47.509 20.591 -29.118 1.00 95.89  ? 338 HIS A NE2   1 
ATOM   2612 N  N     . LYS A 1 342 ? -52.642 19.733 -32.978 1.00 92.88  ? 339 LYS A N     1 
ATOM   2613 C  CA    . LYS A 1 342 ? -54.020 19.468 -33.471 1.00 93.73  ? 339 LYS A CA    1 
ATOM   2614 C  C     . LYS A 1 342 ? -55.042 20.150 -32.558 1.00 92.53  ? 339 LYS A C     1 
ATOM   2615 O  O     . LYS A 1 342 ? -54.643 20.679 -31.515 1.00 91.33  ? 339 LYS A O     1 
ATOM   2616 C  CB    . LYS A 1 342 ? -54.306 17.961 -33.598 1.00 97.84  ? 339 LYS A CB    1 
ATOM   2617 N  N     . PRO A 1 343 ? -56.347 20.188 -32.960 1.00 93.32  ? 340 PRO A N     1 
ATOM   2618 C  CA    . PRO A 1 343 ? -57.282 21.002 -32.173 1.00 92.22  ? 340 PRO A CA    1 
ATOM   2619 C  C     . PRO A 1 343 ? -57.579 20.429 -30.790 1.00 94.46  ? 340 PRO A C     1 
ATOM   2620 O  O     . PRO A 1 343 ? -57.476 19.232 -30.601 1.00 97.79  ? 340 PRO A O     1 
ATOM   2621 C  CB    . PRO A 1 343 ? -58.550 21.164 -33.079 1.00 92.45  ? 340 PRO A CB    1 
ATOM   2622 C  CG    . PRO A 1 343 ? -58.034 21.065 -34.453 1.00 92.22  ? 340 PRO A CG    1 
ATOM   2623 C  CD    . PRO A 1 343 ? -56.964 19.855 -34.242 1.00 94.38  ? 340 PRO A CD    1 
ATOM   2624 N  N     . SER A 1 344 ? -57.931 21.301 -29.845 1.00 93.12  ? 341 SER A N     1 
ATOM   2625 C  CA    . SER A 1 344 ? -58.183 20.933 -28.455 1.00 95.50  ? 341 SER A CA    1 
ATOM   2626 C  C     . SER A 1 344 ? -59.405 21.692 -27.963 1.00 94.80  ? 341 SER A C     1 
ATOM   2627 O  O     . SER A 1 344 ? -59.670 22.813 -28.409 1.00 92.44  ? 341 SER A O     1 
ATOM   2628 C  CB    . SER A 1 344 ? -56.992 21.326 -27.570 1.00 94.23  ? 341 SER A CB    1 
ATOM   2629 O  OG    . SER A 1 344 ? -55.795 20.680 -27.960 1.00 96.12  ? 341 SER A OG    1 
ATOM   2630 N  N     . THR A 1 345 ? -60.135 21.094 -27.029 1.00 97.46  ? 342 THR A N     1 
ATOM   2631 C  CA    . THR A 1 345 ? -61.274 21.760 -26.423 1.00 97.03  ? 342 THR A CA    1 
ATOM   2632 C  C     . THR A 1 345 ? -60.844 22.487 -25.153 1.00 95.68  ? 342 THR A C     1 
ATOM   2633 O  O     . THR A 1 345 ? -60.037 21.971 -24.383 1.00 97.01  ? 342 THR A O     1 
ATOM   2634 C  CB    . THR A 1 345 ? -62.360 20.750 -26.079 1.00 101.12 ? 342 THR A CB    1 
ATOM   2635 O  OG1   . THR A 1 345 ? -62.498 19.829 -27.165 1.00 103.08 ? 342 THR A OG1   1 
ATOM   2636 C  CG2   . THR A 1 345 ? -63.690 21.449 -25.831 1.00 100.97 ? 342 THR A CG2   1 
ATOM   2637 N  N     . VAL A 1 346 ? -61.377 23.690 -24.951 1.00 93.54  ? 343 VAL A N     1 
ATOM   2638 C  CA    . VAL A 1 346 ? -61.268 24.408 -23.679 1.00 92.74  ? 343 VAL A CA    1 
ATOM   2639 C  C     . VAL A 1 346 ? -62.176 23.740 -22.637 1.00 96.47  ? 343 VAL A C     1 
ATOM   2640 O  O     . VAL A 1 346 ? -63.369 23.524 -22.887 1.00 98.47  ? 343 VAL A O     1 
ATOM   2641 C  CB    . VAL A 1 346 ? -61.715 25.865 -23.844 1.00 89.82  ? 343 VAL A CB    1 
ATOM   2642 C  CG1   . VAL A 1 346 ? -61.809 26.562 -22.501 1.00 89.31  ? 343 VAL A CG1   1 
ATOM   2643 C  CG2   . VAL A 1 346 ? -60.772 26.603 -24.764 1.00 86.91  ? 343 VAL A CG2   1 
ATOM   2644 N  N     . LEU A 1 347 ? -61.617 23.427 -21.471 1.00 97.83  ? 344 LEU A N     1 
ATOM   2645 C  CA    . LEU A 1 347 ? -62.374 22.757 -20.412 1.00 101.39 ? 344 LEU A CA    1 
ATOM   2646 C  C     . LEU A 1 347 ? -62.857 23.705 -19.325 1.00 100.99 ? 344 LEU A C     1 
ATOM   2647 O  O     . LEU A 1 347 ? -64.048 23.747 -19.042 1.00 103.01 ? 344 LEU A O     1 
ATOM   2648 C  CB    . LEU A 1 347 ? -61.574 21.611 -19.805 1.00 103.85 ? 344 LEU A CB    1 
ATOM   2649 C  CG    . LEU A 1 347 ? -61.477 20.374 -20.687 1.00 106.12 ? 344 LEU A CG    1 
ATOM   2650 C  CD1   . LEU A 1 347 ? -60.525 19.378 -20.055 1.00 108.58 ? 344 LEU A CD1   1 
ATOM   2651 C  CD2   . LEU A 1 347 ? -62.857 19.767 -20.888 1.00 109.40 ? 344 LEU A CD2   1 
ATOM   2652 N  N     . LYS A 1 348 ? -61.938 24.444 -18.707 1.00 99.11  ? 345 LYS A N     1 
ATOM   2653 C  CA    . LYS A 1 348 ? -62.302 25.514 -17.779 1.00 98.32  ? 345 LYS A CA    1 
ATOM   2654 C  C     . LYS A 1 348 ? -61.506 26.760 -18.153 1.00 95.06  ? 345 LYS A C     1 
ATOM   2655 O  O     . LYS A 1 348 ? -60.388 26.661 -18.680 1.00 93.67  ? 345 LYS A O     1 
ATOM   2656 C  CB    . LYS A 1 348 ? -62.051 25.109 -16.319 1.00 100.00 ? 345 LYS A CB    1 
ATOM   2657 N  N     . VAL A 1 349 ? -62.097 27.927 -17.908 1.00 94.38  ? 346 VAL A N     1 
ATOM   2658 C  CA    . VAL A 1 349 ? -61.405 29.206 -18.089 1.00 91.91  ? 346 VAL A CA    1 
ATOM   2659 C  C     . VAL A 1 349 ? -60.999 29.755 -16.707 1.00 92.72  ? 346 VAL A C     1 
ATOM   2660 O  O     . VAL A 1 349 ? -61.778 30.443 -16.040 1.00 93.30  ? 346 VAL A O     1 
ATOM   2661 C  CB    . VAL A 1 349 ? -62.271 30.213 -18.901 1.00 90.36  ? 346 VAL A CB    1 
ATOM   2662 C  CG1   . VAL A 1 349 ? -61.701 31.628 -18.849 1.00 87.83  ? 346 VAL A CG1   1 
ATOM   2663 C  CG2   . VAL A 1 349 ? -62.399 29.755 -20.339 1.00 89.83  ? 346 VAL A CG2   1 
ATOM   2664 N  N     . LEU A 1 350 ? -59.779 29.421 -16.283 1.00 93.32  ? 347 LEU A N     1 
ATOM   2665 C  CA    . LEU A 1 350 ? -59.272 29.784 -14.956 1.00 94.45  ? 347 LEU A CA    1 
ATOM   2666 C  C     . LEU A 1 350 ? -59.211 31.290 -14.734 1.00 93.00  ? 347 LEU A C     1 
ATOM   2667 O  O     . LEU A 1 350 ? -59.282 31.766 -13.601 1.00 94.12  ? 347 LEU A O     1 
ATOM   2668 C  CB    . LEU A 1 350 ? -57.887 29.179 -14.733 1.00 94.95  ? 347 LEU A CB    1 
ATOM   2669 C  CG    . LEU A 1 350 ? -57.829 27.660 -14.561 1.00 98.06  ? 347 LEU A CG    1 
ATOM   2670 C  CD1   . LEU A 1 350 ? -56.414 27.176 -14.769 1.00 98.82  ? 347 LEU A CD1   1 
ATOM   2671 C  CD2   . LEU A 1 350 ? -58.335 27.223 -13.196 1.00 101.21 ? 347 LEU A CD2   1 
ATOM   2672 N  N     . ASN A 1 351 ? -59.056 32.026 -15.826 1.00 91.18  ? 348 ASN A N     1 
ATOM   2673 C  CA    . ASN A 1 351 ? -59.113 33.480 -15.837 1.00 90.03  ? 348 ASN A CA    1 
ATOM   2674 C  C     . ASN A 1 351 ? -59.004 33.885 -17.298 1.00 88.23  ? 348 ASN A C     1 
ATOM   2675 O  O     . ASN A 1 351 ? -58.688 33.029 -18.127 1.00 88.27  ? 348 ASN A O     1 
ATOM   2676 C  CB    . ASN A 1 351 ? -58.006 34.106 -14.955 1.00 89.96  ? 348 ASN A CB    1 
ATOM   2677 C  CG    . ASN A 1 351 ? -56.602 33.945 -15.530 1.00 89.34  ? 348 ASN A CG    1 
ATOM   2678 O  OD1   . ASN A 1 351 ? -56.375 34.096 -16.733 1.00 88.97  ? 348 ASN A OD1   1 
ATOM   2679 N  ND2   . ASN A 1 351 ? -55.643 33.678 -14.653 1.00 90.29  ? 348 ASN A ND2   1 
ATOM   2680 N  N     . PRO A 1 352 ? -59.233 35.174 -17.632 1.00 87.06  ? 349 PRO A N     1 
ATOM   2681 C  CA    . PRO A 1 352 ? -59.304 35.539 -19.055 1.00 85.64  ? 349 PRO A CA    1 
ATOM   2682 C  C     . PRO A 1 352 ? -58.030 35.237 -19.873 1.00 84.23  ? 349 PRO A C     1 
ATOM   2683 O  O     . PRO A 1 352 ? -58.063 35.289 -21.111 1.00 83.28  ? 349 PRO A O     1 
ATOM   2684 C  CB    . PRO A 1 352 ? -59.585 37.045 -19.015 1.00 85.19  ? 349 PRO A CB    1 
ATOM   2685 C  CG    . PRO A 1 352 ? -60.114 37.297 -17.646 1.00 86.75  ? 349 PRO A CG    1 
ATOM   2686 C  CD    . PRO A 1 352 ? -59.360 36.364 -16.776 1.00 87.18  ? 349 PRO A CD    1 
ATOM   2687 N  N     . ARG A 1 353 ? -56.933 34.910 -19.190 1.00 84.17  ? 350 ARG A N     1 
ATOM   2688 C  CA    . ARG A 1 353 ? -55.669 34.631 -19.869 1.00 83.05  ? 350 ARG A CA    1 
ATOM   2689 C  C     . ARG A 1 353 ? -55.098 33.238 -19.638 1.00 84.17  ? 350 ARG A C     1 
ATOM   2690 O  O     . ARG A 1 353 ? -54.041 32.898 -20.171 1.00 84.04  ? 350 ARG A O     1 
ATOM   2691 C  CB    . ARG A 1 353 ? -54.645 35.709 -19.538 1.00 82.27  ? 350 ARG A CB    1 
ATOM   2692 C  CG    . ARG A 1 353 ? -54.857 36.916 -20.391 1.00 80.33  ? 350 ARG A CG    1 
ATOM   2693 C  CD    . ARG A 1 353 ? -53.797 37.945 -20.185 1.00 80.01  ? 350 ARG A CD    1 
ATOM   2694 N  NE    . ARG A 1 353 ? -52.449 37.505 -20.543 1.00 80.03  ? 350 ARG A NE    1 
ATOM   2695 C  CZ    . ARG A 1 353 ? -51.989 37.339 -21.784 1.00 78.96  ? 350 ARG A CZ    1 
ATOM   2696 N  NH1   . ARG A 1 353 ? -52.767 37.535 -22.851 1.00 77.40  ? 350 ARG A NH1   1 
ATOM   2697 N  NH2   . ARG A 1 353 ? -50.730 36.959 -21.954 1.00 78.52  ? 350 ARG A NH2   1 
ATOM   2698 N  N     . THR A 1 354 ? -55.815 32.429 -18.870 1.00 85.58  ? 351 THR A N     1 
ATOM   2699 C  CA    . THR A 1 354 ? -55.357 31.090 -18.543 1.00 87.45  ? 351 THR A CA    1 
ATOM   2700 C  C     . THR A 1 354 ? -56.480 30.078 -18.738 1.00 88.93  ? 351 THR A C     1 
ATOM   2701 O  O     . THR A 1 354 ? -57.643 30.349 -18.414 1.00 89.55  ? 351 THR A O     1 
ATOM   2702 C  CB    . THR A 1 354 ? -54.832 31.020 -17.106 1.00 88.97  ? 351 THR A CB    1 
ATOM   2703 O  OG1   . THR A 1 354 ? -54.164 32.245 -16.784 1.00 88.22  ? 351 THR A OG1   1 
ATOM   2704 C  CG2   . THR A 1 354 ? -53.858 29.865 -16.952 1.00 90.67  ? 351 THR A CG2   1 
ATOM   2705 N  N     . VAL A 1 355 ? -56.124 28.902 -19.249 1.00 89.78  ? 352 VAL A N     1 
ATOM   2706 C  CA    . VAL A 1 355 ? -57.107 27.960 -19.745 1.00 90.79  ? 352 VAL A CA    1 
ATOM   2707 C  C     . VAL A 1 355 ? -56.708 26.514 -19.483 1.00 93.61  ? 352 VAL A C     1 
ATOM   2708 O  O     . VAL A 1 355 ? -55.529 26.179 -19.502 1.00 93.82  ? 352 VAL A O     1 
ATOM   2709 C  CB    . VAL A 1 355 ? -57.325 28.227 -21.244 1.00 88.99  ? 352 VAL A CB    1 
ATOM   2710 C  CG1   . VAL A 1 355 ? -57.602 26.963 -22.019 1.00 91.06  ? 352 VAL A CG1   1 
ATOM   2711 C  CG2   . VAL A 1 355 ? -58.448 29.230 -21.419 1.00 87.65  ? 352 VAL A CG2   1 
ATOM   2712 N  N     . VAL A 1 356 ? -57.700 25.667 -19.206 1.00 96.30  ? 353 VAL A N     1 
ATOM   2713 C  CA    . VAL A 1 356 ? -57.482 24.218 -19.174 1.00 99.57  ? 353 VAL A CA    1 
ATOM   2714 C  C     . VAL A 1 356 ? -58.008 23.606 -20.462 1.00 100.36 ? 353 VAL A C     1 
ATOM   2715 O  O     . VAL A 1 356 ? -59.168 23.803 -20.819 1.00 100.07 ? 353 VAL A O     1 
ATOM   2716 C  CB    . VAL A 1 356 ? -58.151 23.521 -17.974 1.00 102.50 ? 353 VAL A CB    1 
ATOM   2717 C  CG1   . VAL A 1 356 ? -57.728 22.068 -17.932 1.00 105.89 ? 353 VAL A CG1   1 
ATOM   2718 C  CG2   . VAL A 1 356 ? -57.755 24.189 -16.684 1.00 101.87 ? 353 VAL A CG2   1 
ATOM   2719 N  N     . ILE A 1 357 ? -57.140 22.878 -21.157 1.00 101.65 ? 354 ILE A N     1 
ATOM   2720 C  CA    . ILE A 1 357 ? -57.524 22.213 -22.390 1.00 103.14 ? 354 ILE A CA    1 
ATOM   2721 C  C     . ILE A 1 357 ? -57.441 20.705 -22.268 1.00 108.19 ? 354 ILE A C     1 
ATOM   2722 O  O     . ILE A 1 357 ? -56.596 20.177 -21.541 1.00 109.96 ? 354 ILE A O     1 
ATOM   2723 C  CB    . ILE A 1 357 ? -56.661 22.644 -23.601 1.00 100.46 ? 354 ILE A CB    1 
ATOM   2724 C  CG1   . ILE A 1 357 ? -55.174 22.468 -23.307 1.00 100.42 ? 354 ILE A CG1   1 
ATOM   2725 C  CG2   . ILE A 1 357 ? -56.970 24.059 -24.014 1.00 96.55  ? 354 ILE A CG2   1 
ATOM   2726 C  CD1   . ILE A 1 357 ? -54.325 22.458 -24.543 1.00 99.27  ? 354 ILE A CD1   1 
ATOM   2727 N  N     . LEU A 1 358 ? -58.341 20.029 -22.980 1.00 111.23 ? 355 LEU A N     1 
ATOM   2728 C  CA    . LEU A 1 358 ? -58.238 18.599 -23.219 1.00 116.70 ? 355 LEU A CA    1 
ATOM   2729 C  C     . LEU A 1 358 ? -57.387 18.406 -24.464 1.00 116.98 ? 355 LEU A C     1 
ATOM   2730 O  O     . LEU A 1 358 ? -57.791 18.787 -25.566 1.00 115.33 ? 355 LEU A O     1 
ATOM   2731 C  CB    . LEU A 1 358 ? -59.620 17.979 -23.410 1.00 119.34 ? 355 LEU A CB    1 
ATOM   2732 C  CG    . LEU A 1 358 ? -59.678 16.463 -23.593 1.00 123.97 ? 355 LEU A CG    1 
ATOM   2733 C  CD1   . LEU A 1 358 ? -58.884 15.742 -22.520 1.00 126.00 ? 355 LEU A CD1   1 
ATOM   2734 C  CD2   . LEU A 1 358 ? -61.125 16.021 -23.574 1.00 126.59 ? 355 LEU A CD2   1 
ATOM   2735 N  N     . ASP A 1 359 ? -56.214 17.805 -24.275 1.00 120.04 ? 356 ASP A N     1 
ATOM   2736 C  CA    . ASP A 1 359 ? -55.130 17.860 -25.264 1.00 120.04 ? 356 ASP A CA    1 
ATOM   2737 C  C     . ASP A 1 359 ? -55.014 16.635 -26.165 1.00 124.08 ? 356 ASP A C     1 
ATOM   2738 O  O     . ASP A 1 359 ? -56.021 16.035 -26.582 1.00 126.27 ? 356 ASP A O     1 
ATOM   2739 C  CB    . ASP A 1 359 ? -53.774 18.119 -24.562 1.00 119.83 ? 356 ASP A CB    1 
ATOM   2740 C  CG    . ASP A 1 359 ? -53.193 16.859 -23.847 1.00 125.93 ? 356 ASP A CG    1 
ATOM   2741 O  OD1   . ASP A 1 359 ? -51.991 16.871 -23.491 1.00 128.13 ? 356 ASP A OD1   1 
ATOM   2742 O  OD2   . ASP A 1 359 ? -53.913 15.854 -23.645 1.00 130.20 ? 356 ASP A OD2   1 
ATOM   2743 N  N     . HIS A 1 360 ? -53.744 16.289 -26.409 1.00 125.61 ? 357 HIS A N     1 
ATOM   2744 C  CA    . HIS A 1 360 ? -53.265 15.201 -27.278 1.00 129.40 ? 357 HIS A CA    1 
ATOM   2745 C  C     . HIS A 1 360 ? -52.757 13.922 -26.512 1.00 134.40 ? 357 HIS A C     1 
ATOM   2746 O  O     . HIS A 1 360 ? -51.563 13.808 -26.201 1.00 135.42 ? 357 HIS A O     1 
ATOM   2747 C  CB    . HIS A 1 360 ? -52.196 15.760 -28.273 1.00 127.14 ? 357 HIS A CB    1 
ATOM   2748 C  CG    . HIS A 1 360 ? -51.244 16.766 -27.668 1.00 125.50 ? 357 HIS A CG    1 
ATOM   2749 N  ND1   . HIS A 1 360 ? -49.888 16.529 -27.538 1.00 127.72 ? 357 HIS A ND1   1 
ATOM   2750 C  CD2   . HIS A 1 360 ? -51.456 18.010 -27.162 1.00 122.19 ? 357 HIS A CD2   1 
ATOM   2751 C  CE1   . HIS A 1 360 ? -49.311 17.575 -26.969 1.00 125.35 ? 357 HIS A CE1   1 
ATOM   2752 N  NE2   . HIS A 1 360 ? -50.241 18.486 -26.725 1.00 121.94 ? 357 HIS A NE2   1 
ATOM   2753 N  N     . LEU A 1 361 ? -53.644 12.972 -26.188 1.00 137.63 ? 358 LEU A N     1 
ATOM   2754 C  CA    . LEU A 1 361 ? -55.093 13.082 -26.355 1.00 136.46 ? 358 LEU A CA    1 
ATOM   2755 C  C     . LEU A 1 361 ? -55.723 11.942 -25.576 1.00 141.52 ? 358 LEU A C     1 
ATOM   2756 O  O     . LEU A 1 361 ? -55.732 10.810 -26.048 1.00 146.20 ? 358 LEU A O     1 
ATOM   2757 C  CB    . LEU A 1 361 ? -55.503 13.010 -27.836 1.00 135.82 ? 358 LEU A CB    1 
ATOM   2758 C  CG    . LEU A 1 361 ? -56.725 13.838 -28.264 1.00 132.35 ? 358 LEU A CG    1 
ATOM   2759 C  CD1   . LEU A 1 361 ? -56.487 14.514 -29.632 1.00 127.53 ? 358 LEU A CD1   1 
ATOM   2760 C  CD2   . LEU A 1 361 ? -58.018 13.001 -28.231 1.00 136.19 ? 358 LEU A CD2   1 
ATOM   2761 N  N     . GLY A 1 362 ? -56.238 12.225 -24.382 1.00 140.89 ? 359 GLY A N     1 
ATOM   2762 C  CA    . GLY A 1 362 ? -56.267 13.574 -23.838 1.00 135.07 ? 359 GLY A CA    1 
ATOM   2763 C  C     . GLY A 1 362 ? -55.971 13.678 -22.351 1.00 135.39 ? 359 GLY A C     1 
ATOM   2764 O  O     . GLY A 1 362 ? -56.575 12.986 -21.525 1.00 139.04 ? 359 GLY A O     1 
ATOM   2765 N  N     . ASN A 1 363 ? -55.027 14.557 -22.028 1.00 131.47 ? 360 ASN A N     1 
ATOM   2766 C  CA    . ASN A 1 363 ? -54.715 14.938 -20.656 1.00 130.73 ? 360 ASN A CA    1 
ATOM   2767 C  C     . ASN A 1 363 ? -55.138 16.383 -20.444 1.00 124.92 ? 360 ASN A C     1 
ATOM   2768 O  O     . ASN A 1 363 ? -55.401 17.106 -21.406 1.00 121.14 ? 360 ASN A O     1 
ATOM   2769 C  CB    . ASN A 1 363 ? -53.214 14.816 -20.393 1.00 131.68 ? 360 ASN A CB    1 
ATOM   2770 C  CG    . ASN A 1 363 ? -52.608 13.595 -21.046 1.00 136.20 ? 360 ASN A CG    1 
ATOM   2771 O  OD1   . ASN A 1 363 ? -52.472 13.533 -22.275 1.00 135.19 ? 360 ASN A OD1   1 
ATOM   2772 N  ND2   . ASN A 1 363 ? -52.240 12.613 -20.229 1.00 141.13 ? 360 ASN A ND2   1 
ATOM   2773 N  N     . ASN A 1 364 ? -55.218 16.794 -19.184 1.00 124.06 ? 361 ASN A N     1 
ATOM   2774 C  CA    . ASN A 1 364 ? -55.475 18.186 -18.864 1.00 118.83 ? 361 ASN A CA    1 
ATOM   2775 C  C     . ASN A 1 364 ? -54.178 18.976 -18.874 1.00 115.56 ? 361 ASN A C     1 
ATOM   2776 O  O     . ASN A 1 364 ? -53.210 18.622 -18.201 1.00 117.63 ? 361 ASN A O     1 
ATOM   2777 C  CB    . ASN A 1 364 ? -56.177 18.317 -17.513 1.00 120.17 ? 361 ASN A CB    1 
ATOM   2778 C  CG    . ASN A 1 364 ? -57.612 17.828 -17.549 1.00 122.22 ? 361 ASN A CG    1 
ATOM   2779 O  OD1   . ASN A 1 364 ? -58.070 17.277 -18.547 1.00 123.06 ? 361 ASN A OD1   1 
ATOM   2780 N  ND2   . ASN A 1 364 ? -58.332 18.036 -16.455 1.00 123.47 ? 361 ASN A ND2   1 
ATOM   2781 N  N     . ARG A 1 365 ? -54.156 20.035 -19.666 1.00 110.49 ? 362 ARG A N     1 
ATOM   2782 C  CA    . ARG A 1 365 ? -53.029 20.929 -19.673 1.00 107.16 ? 362 ARG A CA    1 
ATOM   2783 C  C     . ARG A 1 365 ? -53.527 22.281 -19.213 1.00 103.41 ? 362 ARG A C     1 
ATOM   2784 O  O     . ARG A 1 365 ? -54.641 22.687 -19.548 1.00 101.88 ? 362 ARG A O     1 
ATOM   2785 C  CB    . ARG A 1 365 ? -52.456 21.033 -21.078 1.00 105.60 ? 362 ARG A CB    1 
ATOM   2786 C  CG    . ARG A 1 365 ? -52.037 19.702 -21.691 1.00 109.36 ? 362 ARG A CG    1 
ATOM   2787 C  CD    . ARG A 1 365 ? -50.536 19.455 -21.609 1.00 110.59 ? 362 ARG A CD    1 
ATOM   2788 N  NE    . ARG A 1 365 ? -49.784 20.377 -22.455 1.00 106.56 ? 362 ARG A NE    1 
ATOM   2789 C  CZ    . ARG A 1 365 ? -48.514 20.703 -22.251 1.00 106.88 ? 362 ARG A CZ    1 
ATOM   2790 N  NH1   . ARG A 1 365 ? -47.838 20.185 -21.234 1.00 109.99 ? 362 ARG A NH1   1 
ATOM   2791 N  NH2   . ARG A 1 365 ? -47.916 21.553 -23.063 1.00 105.03 ? 362 ARG A NH2   1 
ATOM   2792 N  N     . THR A 1 366 ? -52.715 22.968 -18.423 1.00 102.09 ? 363 THR A N     1 
ATOM   2793 C  CA    . THR A 1 366 ? -53.004 24.348 -18.074 1.00 98.51  ? 363 THR A CA    1 
ATOM   2794 C  C     . THR A 1 366 ? -52.031 25.225 -18.852 1.00 95.60  ? 363 THR A C     1 
ATOM   2795 O  O     . THR A 1 366 ? -50.820 25.095 -18.706 1.00 96.59  ? 363 THR A O     1 
ATOM   2796 C  CB    . THR A 1 366 ? -52.867 24.591 -16.573 1.00 99.65  ? 363 THR A CB    1 
ATOM   2797 O  OG1   . THR A 1 366 ? -53.624 23.605 -15.869 1.00 103.07 ? 363 THR A OG1   1 
ATOM   2798 C  CG2   . THR A 1 366 ? -53.401 25.951 -16.214 1.00 96.76  ? 363 THR A CG2   1 
ATOM   2799 N  N     . VAL A 1 367 ? -52.569 26.106 -19.688 1.00 92.25  ? 364 VAL A N     1 
ATOM   2800 C  CA    . VAL A 1 367 ? -51.762 26.868 -20.630 1.00 89.59  ? 364 VAL A CA    1 
ATOM   2801 C  C     . VAL A 1 367 ? -52.158 28.345 -20.678 1.00 86.69  ? 364 VAL A C     1 
ATOM   2802 O  O     . VAL A 1 367 ? -53.299 28.707 -20.399 1.00 85.93  ? 364 VAL A O     1 
ATOM   2803 C  CB    . VAL A 1 367 ? -51.826 26.258 -22.061 1.00 89.41  ? 364 VAL A CB    1 
ATOM   2804 C  CG1   . VAL A 1 367 ? -51.428 24.780 -22.054 1.00 92.27  ? 364 VAL A CG1   1 
ATOM   2805 C  CG2   . VAL A 1 367 ? -53.205 26.425 -22.659 1.00 87.90  ? 364 VAL A CG2   1 
ATOM   2806 N  N     . SER A 1 368 ? -51.193 29.186 -21.025 1.00 85.44  ? 365 SER A N     1 
ATOM   2807 C  CA    . SER A 1 368 ? -51.425 30.608 -21.243 1.00 83.31  ? 365 SER A CA    1 
ATOM   2808 C  C     . SER A 1 368 ? -52.039 30.791 -22.622 1.00 81.65  ? 365 SER A C     1 
ATOM   2809 O  O     . SER A 1 368 ? -51.734 30.017 -23.522 1.00 82.17  ? 365 SER A O     1 
ATOM   2810 C  CB    . SER A 1 368 ? -50.096 31.353 -21.170 1.00 83.02  ? 365 SER A CB    1 
ATOM   2811 O  OG    . SER A 1 368 ? -50.301 32.750 -21.160 1.00 82.32  ? 365 SER A OG    1 
ATOM   2812 N  N     . ILE A 1 369 ? -52.894 31.796 -22.813 1.00 80.10  ? 366 ILE A N     1 
ATOM   2813 C  CA    . ILE A 1 369 ? -53.497 31.968 -24.142 1.00 79.04  ? 366 ILE A CA    1 
ATOM   2814 C  C     . ILE A 1 369 ? -52.492 32.446 -25.171 1.00 78.00  ? 366 ILE A C     1 
ATOM   2815 O  O     . ILE A 1 369 ? -52.759 32.412 -26.374 1.00 77.14  ? 366 ILE A O     1 
ATOM   2816 C  CB    . ILE A 1 369 ? -54.778 32.834 -24.177 1.00 78.19  ? 366 ILE A CB    1 
ATOM   2817 C  CG1   . ILE A 1 369 ? -54.585 34.188 -23.502 1.00 77.92  ? 366 ILE A CG1   1 
ATOM   2818 C  CG2   . ILE A 1 369 ? -55.930 32.087 -23.556 1.00 79.96  ? 366 ILE A CG2   1 
ATOM   2819 C  CD1   . ILE A 1 369 ? -55.805 35.094 -23.684 1.00 78.60  ? 366 ILE A CD1   1 
ATOM   2820 N  N     . ASP A 1 370 ? -51.332 32.887 -24.691 1.00 78.21  ? 367 ASP A N     1 
ATOM   2821 C  CA    . ASP A 1 370 ? -50.280 33.339 -25.587 1.00 77.90  ? 367 ASP A CA    1 
ATOM   2822 C  C     . ASP A 1 370 ? -49.714 32.162 -26.362 1.00 78.71  ? 367 ASP A C     1 
ATOM   2823 O  O     . ASP A 1 370 ? -49.174 32.337 -27.451 1.00 78.37  ? 367 ASP A O     1 
ATOM   2824 C  CB    . ASP A 1 370 ? -49.171 34.082 -24.832 1.00 78.75  ? 367 ASP A CB    1 
ATOM   2825 C  CG    . ASP A 1 370 ? -49.603 35.475 -24.338 1.00 78.52  ? 367 ASP A CG    1 
ATOM   2826 O  OD1   . ASP A 1 370 ? -50.649 36.007 -24.784 1.00 77.01  ? 367 ASP A OD1   1 
ATOM   2827 O  OD2   . ASP A 1 370 ? -48.879 36.041 -23.483 1.00 80.42  ? 367 ASP A OD2   1 
ATOM   2828 N  N     . ASN A 1 371 ? -49.839 30.961 -25.805 1.00 80.09  ? 368 ASN A N     1 
ATOM   2829 C  CA    . ASN A 1 371 ? -49.478 29.759 -26.539 1.00 81.18  ? 368 ASN A CA    1 
ATOM   2830 C  C     . ASN A 1 371 ? -50.703 29.102 -27.159 1.00 81.17  ? 368 ASN A C     1 
ATOM   2831 O  O     . ASN A 1 371 ? -50.685 27.925 -27.485 1.00 82.90  ? 368 ASN A O     1 
ATOM   2832 C  CB    . ASN A 1 371 ? -48.699 28.791 -25.650 1.00 83.69  ? 368 ASN A CB    1 
ATOM   2833 C  CG    . ASN A 1 371 ? -47.383 29.374 -25.172 1.00 84.06  ? 368 ASN A CG    1 
ATOM   2834 O  OD1   . ASN A 1 371 ? -46.854 30.291 -25.775 1.00 83.52  ? 368 ASN A OD1   1 
ATOM   2835 N  ND2   . ASN A 1 371 ? -46.854 28.843 -24.080 1.00 86.79  ? 368 ASN A ND2   1 
ATOM   2836 N  N     . LEU A 1 372 ? -51.762 29.880 -27.343 1.00 79.79  ? 369 LEU A N     1 
ATOM   2837 C  CA    . LEU A 1 372 ? -52.976 29.373 -27.970 1.00 80.46  ? 369 LEU A CA    1 
ATOM   2838 C  C     . LEU A 1 372 ? -53.403 30.132 -29.225 1.00 79.17  ? 369 LEU A C     1 
ATOM   2839 O  O     . LEU A 1 372 ? -53.104 31.315 -29.378 1.00 78.22  ? 369 LEU A O     1 
ATOM   2840 C  CB    . LEU A 1 372 ? -54.131 29.362 -26.962 1.00 80.90  ? 369 LEU A CB    1 
ATOM   2841 C  CG    . LEU A 1 372 ? -54.142 28.273 -25.883 1.00 83.25  ? 369 LEU A CG    1 
ATOM   2842 C  CD1   . LEU A 1 372 ? -55.495 28.225 -25.165 1.00 83.46  ? 369 LEU A CD1   1 
ATOM   2843 C  CD2   . LEU A 1 372 ? -53.786 26.901 -26.455 1.00 84.79  ? 369 LEU A CD2   1 
ATOM   2844 N  N     . LYS A 1 373 ? -54.101 29.443 -30.122 1.00 80.01  ? 370 LYS A N     1 
ATOM   2845 C  CA    . LYS A 1 373 ? -54.820 30.103 -31.206 1.00 78.94  ? 370 LYS A CA    1 
ATOM   2846 C  C     . LYS A 1 373 ? -56.211 29.498 -31.354 1.00 80.27  ? 370 LYS A C     1 
ATOM   2847 O  O     . LYS A 1 373 ? -56.409 28.304 -31.106 1.00 81.85  ? 370 LYS A O     1 
ATOM   2848 C  CB    . LYS A 1 373 ? -54.045 30.010 -32.524 1.00 78.78  ? 370 LYS A CB    1 
ATOM   2849 C  CG    . LYS A 1 373 ? -54.422 28.826 -33.427 1.00 80.00  ? 370 LYS A CG    1 
ATOM   2850 C  CD    . LYS A 1 373 ? -53.374 28.604 -34.493 1.00 80.81  ? 370 LYS A CD    1 
ATOM   2851 C  CE    . LYS A 1 373 ? -53.915 27.803 -35.658 1.00 81.38  ? 370 LYS A CE    1 
ATOM   2852 N  NZ    . LYS A 1 373 ? -52.785 27.347 -36.503 1.00 82.19  ? 370 LYS A NZ    1 
ATOM   2853 N  N     . PRO A 1 374 ? -57.189 30.326 -31.730 1.00 79.87  ? 371 PRO A N     1 
ATOM   2854 C  CA    . PRO A 1 374 ? -58.503 29.781 -32.028 1.00 81.78  ? 371 PRO A CA    1 
ATOM   2855 C  C     . PRO A 1 374 ? -58.472 29.049 -33.358 1.00 82.90  ? 371 PRO A C     1 
ATOM   2856 O  O     . PRO A 1 374 ? -58.077 29.631 -34.367 1.00 82.05  ? 371 PRO A O     1 
ATOM   2857 C  CB    . PRO A 1 374 ? -59.388 31.030 -32.142 1.00 80.92  ? 371 PRO A CB    1 
ATOM   2858 C  CG    . PRO A 1 374 ? -58.644 32.102 -31.450 1.00 79.25  ? 371 PRO A CG    1 
ATOM   2859 C  CD    . PRO A 1 374 ? -57.201 31.796 -31.687 1.00 78.41  ? 371 PRO A CD    1 
ATOM   2860 N  N     . THR A 1 375 ? -58.865 27.780 -33.368 1.00 85.34  ? 372 THR A N     1 
ATOM   2861 C  CA    . THR A 1 375 ? -58.990 27.078 -34.629 1.00 86.80  ? 372 THR A CA    1 
ATOM   2862 C  C     . THR A 1 375 ? -60.004 27.885 -35.396 1.00 86.68  ? 372 THR A C     1 
ATOM   2863 O  O     . THR A 1 375 ? -61.080 28.192 -34.871 1.00 87.79  ? 372 THR A O     1 
ATOM   2864 C  CB    . THR A 1 375 ? -59.522 25.670 -34.447 1.00 89.92  ? 372 THR A CB    1 
ATOM   2865 O  OG1   . THR A 1 375 ? -58.727 24.981 -33.476 1.00 91.33  ? 372 THR A OG1   1 
ATOM   2866 C  CG2   . THR A 1 375 ? -59.472 24.917 -35.759 1.00 91.36  ? 372 THR A CG2   1 
ATOM   2867 N  N     . SER A 1 376 ? -59.643 28.271 -36.613 1.00 85.92  ? 373 SER A N     1 
ATOM   2868 C  CA    . SER A 1 376 ? -60.515 29.092 -37.446 1.00 85.92  ? 373 SER A CA    1 
ATOM   2869 C  C     . SER A 1 376 ? -61.503 28.214 -38.212 1.00 88.40  ? 373 SER A C     1 
ATOM   2870 O  O     . SER A 1 376 ? -61.168 27.085 -38.547 1.00 89.84  ? 373 SER A O     1 
ATOM   2871 C  CB    . SER A 1 376 ? -59.664 29.918 -38.404 1.00 84.12  ? 373 SER A CB    1 
ATOM   2872 O  OG    . SER A 1 376 ? -58.746 29.092 -39.089 1.00 84.79  ? 373 SER A OG    1 
ATOM   2873 N  N     . HIS A 1 377 ? -62.710 28.729 -38.467 1.00 89.49  ? 374 HIS A N     1 
ATOM   2874 C  CA    . HIS A 1 377 ? -63.760 28.061 -39.285 1.00 92.60  ? 374 HIS A CA    1 
ATOM   2875 C  C     . HIS A 1 377 ? -64.625 26.999 -38.553 1.00 95.26  ? 374 HIS A C     1 
ATOM   2876 O  O     . HIS A 1 377 ? -64.762 26.978 -37.321 1.00 95.06  ? 374 HIS A O     1 
ATOM   2877 C  CB    . HIS A 1 377 ? -63.218 27.440 -40.606 1.00 93.49  ? 374 HIS A CB    1 
ATOM   2878 C  CG    . HIS A 1 377 ? -62.108 28.208 -41.289 1.00 91.96  ? 374 HIS A CG    1 
ATOM   2879 N  ND1   . HIS A 1 377 ? -62.288 29.449 -41.870 1.00 91.63  ? 374 HIS A ND1   1 
ATOM   2880 C  CD2   . HIS A 1 377 ? -60.820 27.861 -41.550 1.00 90.95  ? 374 HIS A CD2   1 
ATOM   2881 C  CE1   . HIS A 1 377 ? -61.153 29.845 -42.426 1.00 89.46  ? 374 HIS A CE1   1 
ATOM   2882 N  NE2   . HIS A 1 377 ? -60.247 28.900 -42.247 1.00 88.79  ? 374 HIS A NE2   1 
ATOM   2883 N  N     . ASP B 1 119 ? -28.028 59.457 20.919  1.00 121.52 ? 116 ASP B N     1 
ATOM   2884 C  CA    . ASP B 1 119 ? -28.965 60.606 21.134  1.00 124.13 ? 116 ASP B CA    1 
ATOM   2885 C  C     . ASP B 1 119 ? -30.431 60.272 20.744  1.00 122.58 ? 116 ASP B C     1 
ATOM   2886 O  O     . ASP B 1 119 ? -31.357 60.466 21.551  1.00 124.23 ? 116 ASP B O     1 
ATOM   2887 C  CB    . ASP B 1 119 ? -28.453 61.849 20.382  1.00 125.84 ? 116 ASP B CB    1 
ATOM   2888 C  CG    . ASP B 1 119 ? -28.866 63.163 21.053  1.00 130.92 ? 116 ASP B CG    1 
ATOM   2889 O  OD1   . ASP B 1 119 ? -29.994 63.248 21.601  1.00 133.19 ? 116 ASP B OD1   1 
ATOM   2890 O  OD2   . ASP B 1 119 ? -28.057 64.121 21.025  1.00 134.05 ? 116 ASP B OD2   1 
ATOM   2891 N  N     . ARG B 1 120 ? -30.615 59.772 19.515  1.00 119.03 ? 117 ARG B N     1 
ATOM   2892 C  CA    . ARG B 1 120 ? -31.920 59.363 18.977  1.00 116.88 ? 117 ARG B CA    1 
ATOM   2893 C  C     . ARG B 1 120 ? -32.193 57.869 19.261  1.00 113.91 ? 117 ARG B C     1 
ATOM   2894 O  O     . ARG B 1 120 ? -31.255 57.124 19.530  1.00 112.65 ? 117 ARG B O     1 
ATOM   2895 C  CB    . ARG B 1 120 ? -31.951 59.649 17.473  1.00 115.59 ? 117 ARG B CB    1 
ATOM   2896 N  N     . PRO B 1 121 ? -33.473 57.426 19.200  1.00 112.78 ? 118 PRO B N     1 
ATOM   2897 C  CA    . PRO B 1 121 ? -33.859 56.044 19.555  1.00 110.63 ? 118 PRO B CA    1 
ATOM   2898 C  C     . PRO B 1 121 ? -33.125 54.934 18.793  1.00 107.17 ? 118 PRO B C     1 
ATOM   2899 O  O     . PRO B 1 121 ? -32.907 55.052 17.594  1.00 105.76 ? 118 PRO B O     1 
ATOM   2900 C  CB    . PRO B 1 121 ? -35.359 56.000 19.223  1.00 110.92 ? 118 PRO B CB    1 
ATOM   2901 C  CG    . PRO B 1 121 ? -35.606 57.168 18.342  1.00 111.73 ? 118 PRO B CG    1 
ATOM   2902 C  CD    . PRO B 1 121 ? -34.648 58.215 18.791  1.00 113.99 ? 118 PRO B CD    1 
ATOM   2903 N  N     . GLN B 1 122 ? -32.777 53.865 19.508  1.00 106.03 ? 119 GLN B N     1 
ATOM   2904 C  CA    . GLN B 1 122 ? -32.002 52.712 19.001  1.00 103.37 ? 119 GLN B CA    1 
ATOM   2905 C  C     . GLN B 1 122 ? -32.659 52.075 17.768  1.00 100.82 ? 119 GLN B C     1 
ATOM   2906 O  O     . GLN B 1 122 ? -33.876 51.894 17.742  1.00 101.38 ? 119 GLN B O     1 
ATOM   2907 C  CB    . GLN B 1 122 ? -31.844 51.633 20.105  1.00 103.80 ? 119 GLN B CB    1 
ATOM   2908 C  CG    . GLN B 1 122 ? -31.660 52.124 21.586  1.00 108.08 ? 119 GLN B CG    1 
ATOM   2909 C  CD    . GLN B 1 122 ? -32.973 52.615 22.308  1.00 112.89 ? 119 GLN B CD    1 
ATOM   2910 O  OE1   . GLN B 1 122 ? -34.087 52.555 21.759  1.00 113.39 ? 119 GLN B OE1   1 
ATOM   2911 N  NE2   . GLN B 1 122 ? -32.815 53.107 23.543  1.00 114.98 ? 119 GLN B NE2   1 
ATOM   2912 N  N     . LYS B 1 123 ? -31.865 51.719 16.758  1.00 98.11  ? 120 LYS B N     1 
ATOM   2913 C  CA    . LYS B 1 123 ? -32.418 51.204 15.493  1.00 95.78  ? 120 LYS B CA    1 
ATOM   2914 C  C     . LYS B 1 123 ? -31.686 49.970 14.930  1.00 93.25  ? 120 LYS B C     1 
ATOM   2915 O  O     . LYS B 1 123 ? -30.532 49.712 15.288  1.00 92.96  ? 120 LYS B O     1 
ATOM   2916 C  CB    . LYS B 1 123 ? -32.425 52.312 14.440  1.00 96.06  ? 120 LYS B CB    1 
ATOM   2917 C  CG    . LYS B 1 123 ? -33.290 53.510 14.774  1.00 98.53  ? 120 LYS B CG    1 
ATOM   2918 C  CD    . LYS B 1 123 ? -34.724 53.333 14.312  1.00 98.81  ? 120 LYS B CD    1 
ATOM   2919 C  CE    . LYS B 1 123 ? -35.498 54.630 14.456  1.00 101.08 ? 120 LYS B CE    1 
ATOM   2920 N  NZ    . LYS B 1 123 ? -34.891 55.776 13.712  1.00 102.07 ? 120 LYS B NZ    1 
ATOM   2921 N  N     . PRO B 1 124 ? -32.353 49.198 14.042  1.00 91.48  ? 121 PRO B N     1 
ATOM   2922 C  CA    . PRO B 1 124 ? -31.685 48.074 13.387  1.00 89.29  ? 121 PRO B CA    1 
ATOM   2923 C  C     . PRO B 1 124 ? -30.503 48.543 12.562  1.00 88.29  ? 121 PRO B C     1 
ATOM   2924 O  O     . PRO B 1 124 ? -30.580 49.571 11.897  1.00 88.87  ? 121 PRO B O     1 
ATOM   2925 C  CB    . PRO B 1 124 ? -32.762 47.521 12.466  1.00 88.60  ? 121 PRO B CB    1 
ATOM   2926 C  CG    . PRO B 1 124 ? -34.024 47.888 13.127  1.00 90.31  ? 121 PRO B CG    1 
ATOM   2927 C  CD    . PRO B 1 124 ? -33.786 49.238 13.704  1.00 91.91  ? 121 PRO B CD    1 
ATOM   2928 N  N     . PHE B 1 125 ? -29.407 47.798 12.618  1.00 86.95  ? 122 PHE B N     1 
ATOM   2929 C  CA    . PHE B 1 125 ? -28.207 48.128 11.856  1.00 85.80  ? 122 PHE B CA    1 
ATOM   2930 C  C     . PHE B 1 125 ? -27.345 49.192 12.535  1.00 86.90  ? 122 PHE B C     1 
ATOM   2931 O  O     . PHE B 1 125 ? -26.306 49.586 11.990  1.00 86.97  ? 122 PHE B O     1 
ATOM   2932 C  CB    . PHE B 1 125 ? -28.547 48.547 10.413  1.00 85.15  ? 122 PHE B CB    1 
ATOM   2933 C  CG    . PHE B 1 125 ? -29.444 47.581 9.688   1.00 83.40  ? 122 PHE B CG    1 
ATOM   2934 C  CD1   . PHE B 1 125 ? -30.465 48.040 8.886   1.00 82.61  ? 122 PHE B CD1   1 
ATOM   2935 C  CD2   . PHE B 1 125 ? -29.270 46.209 9.812   1.00 82.46  ? 122 PHE B CD2   1 
ATOM   2936 C  CE1   . PHE B 1 125 ? -31.307 47.148 8.217   1.00 81.77  ? 122 PHE B CE1   1 
ATOM   2937 C  CE2   . PHE B 1 125 ? -30.109 45.312 9.144   1.00 81.09  ? 122 PHE B CE2   1 
ATOM   2938 C  CZ    . PHE B 1 125 ? -31.126 45.784 8.348   1.00 80.50  ? 122 PHE B CZ    1 
ATOM   2939 N  N     . ASP B 1 126 ? -27.756 49.652 13.716  1.00 87.86  ? 123 ASP B N     1 
ATOM   2940 C  CA    . ASP B 1 126 ? -26.925 50.586 14.472  1.00 89.06  ? 123 ASP B CA    1 
ATOM   2941 C  C     . ASP B 1 126 ? -25.684 49.886 14.978  1.00 88.30  ? 123 ASP B C     1 
ATOM   2942 O  O     . ASP B 1 126 ? -24.589 50.434 14.912  1.00 88.69  ? 123 ASP B O     1 
ATOM   2943 C  CB    . ASP B 1 126 ? -27.681 51.213 15.645  1.00 91.00  ? 123 ASP B CB    1 
ATOM   2944 C  CG    . ASP B 1 126 ? -28.584 52.356 15.217  1.00 93.00  ? 123 ASP B CG    1 
ATOM   2945 O  OD1   . ASP B 1 126 ? -28.517 52.768 14.032  1.00 93.34  ? 123 ASP B OD1   1 
ATOM   2946 O  OD2   . ASP B 1 126 ? -29.365 52.841 16.073  1.00 95.49  ? 123 ASP B OD2   1 
ATOM   2947 N  N     . LYS B 1 127 ? -25.861 48.663 15.467  1.00 87.37  ? 124 LYS B N     1 
ATOM   2948 C  CA    . LYS B 1 127 ? -24.768 47.919 16.074  1.00 87.08  ? 124 LYS B CA    1 
ATOM   2949 C  C     . LYS B 1 127 ? -24.930 46.413 15.899  1.00 85.81  ? 124 LYS B C     1 
ATOM   2950 O  O     . LYS B 1 127 ? -26.020 45.870 16.050  1.00 85.74  ? 124 LYS B O     1 
ATOM   2951 C  CB    . LYS B 1 127 ? -24.647 48.275 17.555  1.00 88.64  ? 124 LYS B CB    1 
ATOM   2952 C  CG    . LYS B 1 127 ? -23.320 47.883 18.178  1.00 89.14  ? 124 LYS B CG    1 
ATOM   2953 C  CD    . LYS B 1 127 ? -23.157 48.457 19.577  1.00 91.65  ? 124 LYS B CD    1 
ATOM   2954 C  CE    . LYS B 1 127 ? -23.138 49.977 19.561  1.00 93.54  ? 124 LYS B CE    1 
ATOM   2955 N  NZ    . LYS B 1 127 ? -22.722 50.517 20.871  1.00 96.18  ? 124 LYS B NZ    1 
ATOM   2956 N  N     . PHE B 1 128 ? -23.826 45.751 15.581  1.00 85.22  ? 125 PHE B N     1 
ATOM   2957 C  CA    . PHE B 1 128 ? -23.787 44.306 15.392  1.00 84.63  ? 125 PHE B CA    1 
ATOM   2958 C  C     . PHE B 1 128 ? -22.798 43.703 16.388  1.00 85.59  ? 125 PHE B C     1 
ATOM   2959 O  O     . PHE B 1 128 ? -21.601 44.018 16.360  1.00 85.94  ? 125 PHE B O     1 
ATOM   2960 C  CB    . PHE B 1 128 ? -23.327 43.978 13.966  1.00 83.49  ? 125 PHE B CB    1 
ATOM   2961 C  CG    . PHE B 1 128 ? -24.439 43.899 12.946  1.00 82.61  ? 125 PHE B CG    1 
ATOM   2962 C  CD1   . PHE B 1 128 ? -25.710 44.423 13.203  1.00 83.53  ? 125 PHE B CD1   1 
ATOM   2963 C  CD2   . PHE B 1 128 ? -24.198 43.320 11.709  1.00 80.75  ? 125 PHE B CD2   1 
ATOM   2964 C  CE1   . PHE B 1 128 ? -26.730 44.342 12.253  1.00 82.45  ? 125 PHE B CE1   1 
ATOM   2965 C  CE2   . PHE B 1 128 ? -25.203 43.239 10.762  1.00 81.02  ? 125 PHE B CE2   1 
ATOM   2966 C  CZ    . PHE B 1 128 ? -26.473 43.748 11.035  1.00 81.60  ? 125 PHE B CZ    1 
ATOM   2967 N  N     . PHE B 1 129 ? -23.294 42.847 17.273  1.00 86.21  ? 126 PHE B N     1 
ATOM   2968 C  CA    . PHE B 1 129 ? -22.433 42.193 18.243  1.00 87.17  ? 126 PHE B CA    1 
ATOM   2969 C  C     . PHE B 1 129 ? -21.966 40.856 17.680  1.00 86.93  ? 126 PHE B C     1 
ATOM   2970 O  O     . PHE B 1 129 ? -22.787 40.014 17.304  1.00 86.68  ? 126 PHE B O     1 
ATOM   2971 C  CB    . PHE B 1 129 ? -23.170 42.022 19.566  1.00 88.26  ? 126 PHE B CB    1 
ATOM   2972 C  CG    . PHE B 1 129 ? -23.446 43.320 20.274  1.00 89.17  ? 126 PHE B CG    1 
ATOM   2973 C  CD1   . PHE B 1 129 ? -22.531 43.841 21.183  1.00 90.65  ? 126 PHE B CD1   1 
ATOM   2974 C  CD2   . PHE B 1 129 ? -24.611 44.028 20.031  1.00 88.64  ? 126 PHE B CD2   1 
ATOM   2975 C  CE1   . PHE B 1 129 ? -22.780 45.046 21.841  1.00 91.30  ? 126 PHE B CE1   1 
ATOM   2976 C  CE2   . PHE B 1 129 ? -24.863 45.229 20.686  1.00 89.55  ? 126 PHE B CE2   1 
ATOM   2977 C  CZ    . PHE B 1 129 ? -23.944 45.735 21.588  1.00 90.90  ? 126 PHE B CZ    1 
ATOM   2978 N  N     . ILE B 1 130 ? -20.650 40.673 17.586  1.00 87.49  ? 127 ILE B N     1 
ATOM   2979 C  CA    . ILE B 1 130 ? -20.105 39.446 17.005  1.00 87.55  ? 127 ILE B CA    1 
ATOM   2980 C  C     . ILE B 1 130 ? -19.228 38.659 17.965  1.00 89.53  ? 127 ILE B C     1 
ATOM   2981 O  O     . ILE B 1 130 ? -18.500 39.228 18.788  1.00 90.98  ? 127 ILE B O     1 
ATOM   2982 C  CB    . ILE B 1 130 ? -19.358 39.689 15.674  1.00 86.26  ? 127 ILE B CB    1 
ATOM   2983 C  CG1   . ILE B 1 130 ? -18.082 40.493 15.885  1.00 86.60  ? 127 ILE B CG1   1 
ATOM   2984 C  CG2   . ILE B 1 130 ? -20.252 40.403 14.691  1.00 85.57  ? 127 ILE B CG2   1 
ATOM   2985 C  CD1   . ILE B 1 130 ? -17.148 40.448 14.705  1.00 85.88  ? 127 ILE B CD1   1 
ATOM   2986 N  N     . ASP B 1 131 ? -19.313 37.340 17.862  1.00 90.51  ? 128 ASP B N     1 
ATOM   2987 C  CA    . ASP B 1 131 ? -18.510 36.466 18.694  1.00 92.82  ? 128 ASP B CA    1 
ATOM   2988 C  C     . ASP B 1 131 ? -18.317 35.107 18.057  1.00 92.85  ? 128 ASP B C     1 
ATOM   2989 O  O     . ASP B 1 131 ? -19.131 34.682 17.230  1.00 92.48  ? 128 ASP B O     1 
ATOM   2990 C  CB    . ASP B 1 131 ? -19.155 36.280 20.065  1.00 94.77  ? 128 ASP B CB    1 
ATOM   2991 C  CG    . ASP B 1 131 ? -18.158 35.771 21.100  1.00 98.66  ? 128 ASP B CG    1 
ATOM   2992 O  OD1   . ASP B 1 131 ? -16.930 35.851 20.805  1.00 100.32 ? 128 ASP B OD1   1 
ATOM   2993 O  OD2   . ASP B 1 131 ? -18.595 35.296 22.190  1.00 101.78 ? 128 ASP B OD2   1 
ATOM   2994 N  N     . TYR B 1 132 ? -17.245 34.425 18.452  1.00 93.88  ? 129 TYR B N     1 
ATOM   2995 C  CA    . TYR B 1 132 ? -17.002 33.068 17.991  1.00 94.40  ? 129 TYR B CA    1 
ATOM   2996 C  C     . TYR B 1 132 ? -17.385 32.048 19.033  1.00 96.14  ? 129 TYR B C     1 
ATOM   2997 O  O     . TYR B 1 132 ? -17.041 32.202 20.197  1.00 97.60  ? 129 TYR B O     1 
ATOM   2998 C  CB    . TYR B 1 132 ? -15.541 32.875 17.596  1.00 94.57  ? 129 TYR B CB    1 
ATOM   2999 C  CG    . TYR B 1 132 ? -15.292 33.145 16.142  1.00 93.27  ? 129 TYR B CG    1 
ATOM   3000 C  CD1   . TYR B 1 132 ? -14.465 34.184 15.739  1.00 93.19  ? 129 TYR B CD1   1 
ATOM   3001 C  CD2   . TYR B 1 132 ? -15.903 32.370 15.169  1.00 93.54  ? 129 TYR B CD2   1 
ATOM   3002 C  CE1   . TYR B 1 132 ? -14.239 34.437 14.399  1.00 93.25  ? 129 TYR B CE1   1 
ATOM   3003 C  CE2   . TYR B 1 132 ? -15.690 32.611 13.827  1.00 93.82  ? 129 TYR B CE2   1 
ATOM   3004 C  CZ    . TYR B 1 132 ? -14.857 33.645 13.442  1.00 93.68  ? 129 TYR B CZ    1 
ATOM   3005 O  OH    . TYR B 1 132 ? -14.655 33.881 12.095  1.00 94.18  ? 129 TYR B OH    1 
ATOM   3006 N  N     . ILE B 1 133 ? -18.101 31.012 18.602  1.00 96.58  ? 130 ILE B N     1 
ATOM   3007 C  CA    . ILE B 1 133 ? -18.373 29.844 19.437  1.00 98.65  ? 130 ILE B CA    1 
ATOM   3008 C  C     . ILE B 1 133 ? -17.557 28.656 18.934  1.00 99.97  ? 130 ILE B C     1 
ATOM   3009 O  O     . ILE B 1 133 ? -17.616 28.303 17.749  1.00 99.25  ? 130 ILE B O     1 
ATOM   3010 C  CB    . ILE B 1 133 ? -19.884 29.511 19.478  1.00 98.60  ? 130 ILE B CB    1 
ATOM   3011 C  CG1   . ILE B 1 133 ? -20.593 30.453 20.442  1.00 98.40  ? 130 ILE B CG1   1 
ATOM   3012 C  CG2   . ILE B 1 133 ? -20.127 28.073 19.905  1.00 100.06 ? 130 ILE B CG2   1 
ATOM   3013 C  CD1   . ILE B 1 133 ? -22.078 30.506 20.240  1.00 98.27  ? 130 ILE B CD1   1 
ATOM   3014 N  N     . GLY B 1 134 ? -16.782 28.056 19.835  1.00 102.38 ? 131 GLY B N     1 
ATOM   3015 C  CA    . GLY B 1 134 ? -16.000 26.867 19.500  1.00 104.41 ? 131 GLY B CA    1 
ATOM   3016 C  C     . GLY B 1 134 ? -14.701 26.676 20.266  1.00 106.38 ? 131 GLY B C     1 
ATOM   3017 O  O     . GLY B 1 134 ? -14.334 27.507 21.095  1.00 106.61 ? 131 GLY B O     1 
ATOM   3018 N  N     . PRO B 1 135 ? -13.975 25.588 19.963  1.00 108.10 ? 132 PRO B N     1 
ATOM   3019 C  CA    . PRO B 1 135 ? -14.257 24.652 18.871  1.00 108.52 ? 132 PRO B CA    1 
ATOM   3020 C  C     . PRO B 1 135 ? -15.344 23.618 19.186  1.00 110.27 ? 132 PRO B C     1 
ATOM   3021 O  O     . PRO B 1 135 ? -15.523 23.236 20.335  1.00 111.99 ? 132 PRO B O     1 
ATOM   3022 C  CB    . PRO B 1 135 ? -12.905 23.954 18.645  1.00 109.85 ? 132 PRO B CB    1 
ATOM   3023 C  CG    . PRO B 1 135 ? -11.986 24.422 19.762  1.00 110.54 ? 132 PRO B CG    1 
ATOM   3024 C  CD    . PRO B 1 135 ? -12.809 25.165 20.755  1.00 109.99 ? 132 PRO B CD    1 
ATOM   3025 N  N     . LEU B 1 136 ? -16.053 23.176 18.155  1.00 110.38 ? 133 LEU B N     1 
ATOM   3026 C  CA    . LEU B 1 136 ? -17.075 22.143 18.282  1.00 112.52 ? 133 LEU B CA    1 
ATOM   3027 C  C     . LEU B 1 136 ? -16.623 20.856 17.591  1.00 114.91 ? 133 LEU B C     1 
ATOM   3028 O  O     . LEU B 1 136 ? -15.747 20.902 16.725  1.00 114.54 ? 133 LEU B O     1 
ATOM   3029 C  CB    . LEU B 1 136 ? -18.379 22.626 17.647  1.00 110.85 ? 133 LEU B CB    1 
ATOM   3030 C  CG    . LEU B 1 136 ? -18.860 24.020 18.048  1.00 108.95 ? 133 LEU B CG    1 
ATOM   3031 C  CD1   . LEU B 1 136 ? -20.075 24.430 17.237  1.00 107.12 ? 133 LEU B CD1   1 
ATOM   3032 C  CD2   . LEU B 1 136 ? -19.166 24.068 19.534  1.00 110.57 ? 133 LEU B CD2   1 
ATOM   3033 N  N     . PRO B 1 137 ? -17.208 19.698 17.968  1.00 117.81 ? 134 PRO B N     1 
ATOM   3034 C  CA    . PRO B 1 137 ? -16.971 18.474 17.198  1.00 120.01 ? 134 PRO B CA    1 
ATOM   3035 C  C     . PRO B 1 137 ? -17.243 18.697 15.703  1.00 119.05 ? 134 PRO B C     1 
ATOM   3036 O  O     . PRO B 1 137 ? -18.295 19.232 15.348  1.00 117.72 ? 134 PRO B O     1 
ATOM   3037 C  CB    . PRO B 1 137 ? -17.981 17.477 17.790  1.00 122.30 ? 134 PRO B CB    1 
ATOM   3038 C  CG    . PRO B 1 137 ? -18.862 18.280 18.718  1.00 121.21 ? 134 PRO B CG    1 
ATOM   3039 C  CD    . PRO B 1 137 ? -18.021 19.425 19.163  1.00 119.31 ? 134 PRO B CD    1 
ATOM   3040 N  N     . PRO B 1 138 ? -16.293 18.299 14.835  1.00 119.98 ? 135 PRO B N     1 
ATOM   3041 C  CA    . PRO B 1 138 ? -16.342 18.616 13.401  1.00 119.00 ? 135 PRO B CA    1 
ATOM   3042 C  C     . PRO B 1 138 ? -17.626 18.166 12.714  1.00 119.74 ? 135 PRO B C     1 
ATOM   3043 O  O     . PRO B 1 138 ? -17.945 16.976 12.709  1.00 122.31 ? 135 PRO B O     1 
ATOM   3044 C  CB    . PRO B 1 138 ? -15.146 17.848 12.819  1.00 120.57 ? 135 PRO B CB    1 
ATOM   3045 C  CG    . PRO B 1 138 ? -14.252 17.586 13.971  1.00 121.89 ? 135 PRO B CG    1 
ATOM   3046 C  CD    . PRO B 1 138 ? -15.134 17.454 15.174  1.00 122.27 ? 135 PRO B CD    1 
ATOM   3047 N  N     . SER B 1 139 ? -18.359 19.124 12.157  1.00 117.88 ? 136 SER B N     1 
ATOM   3048 C  CA    . SER B 1 139 ? -19.466 18.818 11.261  1.00 118.50 ? 136 SER B CA    1 
ATOM   3049 C  C     . SER B 1 139 ? -19.148 19.386 9.898   1.00 117.33 ? 136 SER B C     1 
ATOM   3050 O  O     . SER B 1 139 ? -18.827 20.572 9.770   1.00 115.00 ? 136 SER B O     1 
ATOM   3051 C  CB    . SER B 1 139 ? -20.783 19.402 11.768  1.00 117.52 ? 136 SER B CB    1 
ATOM   3052 O  OG    . SER B 1 139 ? -21.868 18.977 10.957  1.00 118.28 ? 136 SER B OG    1 
ATOM   3053 N  N     . GLN B 1 140 ? -19.226 18.527 8.885   1.00 119.25 ? 137 GLN B N     1 
ATOM   3054 C  CA    . GLN B 1 140 ? -18.978 18.917 7.494   1.00 118.87 ? 137 GLN B CA    1 
ATOM   3055 C  C     . GLN B 1 140 ? -17.653 19.675 7.331   1.00 117.32 ? 137 GLN B C     1 
ATOM   3056 O  O     . GLN B 1 140 ? -17.510 20.519 6.442   1.00 115.94 ? 137 GLN B O     1 
ATOM   3057 C  CB    . GLN B 1 140 ? -20.147 19.744 6.936   1.00 117.40 ? 137 GLN B CB    1 
ATOM   3058 C  CG    . GLN B 1 140 ? -21.539 19.150 7.175   1.00 119.98 ? 137 GLN B CG    1 
ATOM   3059 C  CD    . GLN B 1 140 ? -21.968 18.129 6.129   1.00 123.93 ? 137 GLN B CD    1 
ATOM   3060 O  OE1   . GLN B 1 140 ? -21.202 17.765 5.232   1.00 125.51 ? 137 GLN B OE1   1 
ATOM   3061 N  NE2   . GLN B 1 140 ? -23.210 17.664 6.243   1.00 125.52 ? 137 GLN B NE2   1 
ATOM   3062 N  N     . GLY B 1 141 ? -16.688 19.370 8.196   1.00 117.74 ? 138 GLY B N     1 
ATOM   3063 C  CA    . GLY B 1 141 ? -15.375 20.001 8.137   1.00 116.42 ? 138 GLY B CA    1 
ATOM   3064 C  C     . GLY B 1 141 ? -15.315 21.395 8.740   1.00 113.59 ? 138 GLY B C     1 
ATOM   3065 O  O     . GLY B 1 141 ? -14.322 22.105 8.560   1.00 112.91 ? 138 GLY B O     1 
ATOM   3066 N  N     . TYR B 1 142 ? -16.370 21.787 9.457   1.00 112.09 ? 139 TYR B N     1 
ATOM   3067 C  CA    . TYR B 1 142 ? -16.410 23.073 10.157  1.00 109.36 ? 139 TYR B CA    1 
ATOM   3068 C  C     . TYR B 1 142 ? -16.237 22.866 11.646  1.00 109.24 ? 139 TYR B C     1 
ATOM   3069 O  O     . TYR B 1 142 ? -16.561 21.797 12.166  1.00 111.18 ? 139 TYR B O     1 
ATOM   3070 C  CB    . TYR B 1 142 ? -17.724 23.786 9.877   1.00 108.20 ? 139 TYR B CB    1 
ATOM   3071 C  CG    . TYR B 1 142 ? -17.832 24.259 8.454   1.00 108.53 ? 139 TYR B CG    1 
ATOM   3072 C  CD1   . TYR B 1 142 ? -17.541 25.576 8.119   1.00 107.82 ? 139 TYR B CD1   1 
ATOM   3073 C  CD2   . TYR B 1 142 ? -18.203 23.385 7.433   1.00 111.08 ? 139 TYR B CD2   1 
ATOM   3074 C  CE1   . TYR B 1 142 ? -17.630 26.020 6.803   1.00 108.12 ? 139 TYR B CE1   1 
ATOM   3075 C  CE2   . TYR B 1 142 ? -18.287 23.816 6.110   1.00 111.33 ? 139 TYR B CE2   1 
ATOM   3076 C  CZ    . TYR B 1 142 ? -18.002 25.136 5.807   1.00 109.62 ? 139 TYR B CZ    1 
ATOM   3077 O  OH    . TYR B 1 142 ? -18.081 25.579 4.511   1.00 109.80 ? 139 TYR B OH    1 
ATOM   3078 N  N     . LEU B 1 143 ? -15.728 23.885 12.332  1.00 106.92 ? 140 LEU B N     1 
ATOM   3079 C  CA    . LEU B 1 143 ? -15.403 23.756 13.757  1.00 106.62 ? 140 LEU B CA    1 
ATOM   3080 C  C     . LEU B 1 143 ? -15.979 24.874 14.622  1.00 104.39 ? 140 LEU B C     1 
ATOM   3081 O  O     . LEU B 1 143 ? -16.115 24.729 15.843  1.00 105.33 ? 140 LEU B O     1 
ATOM   3082 C  CB    . LEU B 1 143 ? -13.881 23.670 13.957  1.00 107.39 ? 140 LEU B CB    1 
ATOM   3083 C  CG    . LEU B 1 143 ? -13.142 22.468 13.359  1.00 108.97 ? 140 LEU B CG    1 
ATOM   3084 C  CD1   . LEU B 1 143 ? -11.634 22.713 13.325  1.00 109.25 ? 140 LEU B CD1   1 
ATOM   3085 C  CD2   . LEU B 1 143 ? -13.475 21.190 14.117  1.00 110.76 ? 140 LEU B CD2   1 
ATOM   3086 N  N     . TYR B 1 144 ? -16.319 25.985 13.982  1.00 101.14 ? 141 TYR B N     1 
ATOM   3087 C  CA    . TYR B 1 144 ? -16.673 27.194 14.701  1.00 98.69  ? 141 TYR B CA    1 
ATOM   3088 C  C     . TYR B 1 144 ? -17.950 27.785 14.163  1.00 96.39  ? 141 TYR B C     1 
ATOM   3089 O  O     . TYR B 1 144 ? -18.291 27.563 13.002  1.00 96.12  ? 141 TYR B O     1 
ATOM   3090 C  CB    . TYR B 1 144 ? -15.536 28.212 14.581  1.00 97.97  ? 141 TYR B CB    1 
ATOM   3091 C  CG    . TYR B 1 144 ? -14.333 27.830 15.392  1.00 99.22  ? 141 TYR B CG    1 
ATOM   3092 C  CD1   . TYR B 1 144 ? -14.215 28.245 16.712  1.00 99.96  ? 141 TYR B CD1   1 
ATOM   3093 C  CD2   . TYR B 1 144 ? -13.329 27.030 14.853  1.00 100.34 ? 141 TYR B CD2   1 
ATOM   3094 C  CE1   . TYR B 1 144 ? -13.127 27.886 17.483  1.00 102.45 ? 141 TYR B CE1   1 
ATOM   3095 C  CE2   . TYR B 1 144 ? -12.230 26.654 15.617  1.00 103.04 ? 141 TYR B CE2   1 
ATOM   3096 C  CZ    . TYR B 1 144 ? -12.134 27.092 16.937  1.00 103.89 ? 141 TYR B CZ    1 
ATOM   3097 O  OH    . TYR B 1 144 ? -11.057 26.746 17.722  1.00 105.50 ? 141 TYR B OH    1 
ATOM   3098 N  N     . VAL B 1 145 ? -18.660 28.524 15.008  1.00 94.45  ? 142 VAL B N     1 
ATOM   3099 C  CA    . VAL B 1 145 ? -19.794 29.303 14.545  1.00 91.81  ? 142 VAL B CA    1 
ATOM   3100 C  C     . VAL B 1 145 ? -19.538 30.745 14.889  1.00 89.89  ? 142 VAL B C     1 
ATOM   3101 O  O     . VAL B 1 145 ? -19.347 31.079 16.056  1.00 90.41  ? 142 VAL B O     1 
ATOM   3102 C  CB    . VAL B 1 145 ? -21.126 28.868 15.185  1.00 92.55  ? 142 VAL B CB    1 
ATOM   3103 C  CG1   . VAL B 1 145 ? -22.273 29.741 14.681  1.00 91.32  ? 142 VAL B CG1   1 
ATOM   3104 C  CG2   . VAL B 1 145 ? -21.418 27.414 14.887  1.00 93.89  ? 142 VAL B CG2   1 
ATOM   3105 N  N     . LEU B 1 146 ? -19.517 31.592 13.864  1.00 87.58  ? 143 LEU B N     1 
ATOM   3106 C  CA    . LEU B 1 146 ? -19.484 33.033 14.064  1.00 85.61  ? 143 LEU B CA    1 
ATOM   3107 C  C     . LEU B 1 146 ? -20.895 33.471 14.359  1.00 84.78  ? 143 LEU B C     1 
ATOM   3108 O  O     . LEU B 1 146 ? -21.829 33.047 13.681  1.00 84.53  ? 143 LEU B O     1 
ATOM   3109 C  CB    . LEU B 1 146 ? -18.974 33.761 12.825  1.00 84.51  ? 143 LEU B CB    1 
ATOM   3110 C  CG    . LEU B 1 146 ? -18.917 35.282 12.984  1.00 83.51  ? 143 LEU B CG    1 
ATOM   3111 C  CD1   . LEU B 1 146 ? -17.800 35.660 13.926  1.00 83.64  ? 143 LEU B CD1   1 
ATOM   3112 C  CD2   . LEU B 1 146 ? -18.766 35.991 11.647  1.00 82.20  ? 143 LEU B CD2   1 
ATOM   3113 N  N     . VAL B 1 147 ? -21.040 34.322 15.367  1.00 84.25  ? 144 VAL B N     1 
ATOM   3114 C  CA    . VAL B 1 147 ? -22.350 34.733 15.854  1.00 84.02  ? 144 VAL B CA    1 
ATOM   3115 C  C     . VAL B 1 147 ? -22.511 36.245 15.718  1.00 83.19  ? 144 VAL B C     1 
ATOM   3116 O  O     . VAL B 1 147 ? -21.709 37.011 16.253  1.00 83.57  ? 144 VAL B O     1 
ATOM   3117 C  CB    . VAL B 1 147 ? -22.563 34.272 17.327  1.00 85.38  ? 144 VAL B CB    1 
ATOM   3118 C  CG1   . VAL B 1 147 ? -23.749 34.976 17.977  1.00 85.44  ? 144 VAL B CG1   1 
ATOM   3119 C  CG2   . VAL B 1 147 ? -22.739 32.769 17.386  1.00 86.17  ? 144 VAL B CG2   1 
ATOM   3120 N  N     . VAL B 1 148 ? -23.539 36.668 14.988  1.00 82.24  ? 145 VAL B N     1 
ATOM   3121 C  CA    . VAL B 1 148 ? -23.815 38.086 14.821  1.00 81.50  ? 145 VAL B CA    1 
ATOM   3122 C  C     . VAL B 1 148 ? -25.223 38.360 15.291  1.00 82.16  ? 145 VAL B C     1 
ATOM   3123 O  O     . VAL B 1 148 ? -26.181 37.855 14.702  1.00 82.15  ? 145 VAL B O     1 
ATOM   3124 C  CB    . VAL B 1 148 ? -23.705 38.539 13.355  1.00 80.32  ? 145 VAL B CB    1 
ATOM   3125 C  CG1   . VAL B 1 148 ? -23.756 40.047 13.277  1.00 79.87  ? 145 VAL B CG1   1 
ATOM   3126 C  CG2   . VAL B 1 148 ? -22.424 38.021 12.719  1.00 79.78  ? 145 VAL B CG2   1 
ATOM   3127 N  N     . VAL B 1 149 ? -25.344 39.155 16.350  1.00 83.11  ? 146 VAL B N     1 
ATOM   3128 C  CA    . VAL B 1 149 ? -26.645 39.569 16.868  1.00 83.94  ? 146 VAL B CA    1 
ATOM   3129 C  C     . VAL B 1 149 ? -26.818 41.069 16.673  1.00 84.33  ? 146 VAL B C     1 
ATOM   3130 O  O     . VAL B 1 149 ? -25.889 41.847 16.898  1.00 84.49  ? 146 VAL B O     1 
ATOM   3131 C  CB    . VAL B 1 149 ? -26.792 39.245 18.359  1.00 85.27  ? 146 VAL B CB    1 
ATOM   3132 C  CG1   . VAL B 1 149 ? -28.209 39.511 18.821  1.00 85.85  ? 146 VAL B CG1   1 
ATOM   3133 C  CG2   . VAL B 1 149 ? -26.407 37.804 18.637  1.00 85.69  ? 146 VAL B CG2   1 
ATOM   3134 N  N     . ASP B 1 150 ? -28.008 41.470 16.244  1.00 84.94  ? 147 ASP B N     1 
ATOM   3135 C  CA    . ASP B 1 150 ? -28.325 42.884 16.083  1.00 85.90  ? 147 ASP B CA    1 
ATOM   3136 C  C     . ASP B 1 150 ? -28.682 43.558 17.416  1.00 87.67  ? 147 ASP B C     1 
ATOM   3137 O  O     . ASP B 1 150 ? -29.597 43.124 18.132  1.00 88.65  ? 147 ASP B O     1 
ATOM   3138 C  CB    . ASP B 1 150 ? -29.460 43.063 15.082  1.00 85.77  ? 147 ASP B CB    1 
ATOM   3139 C  CG    . ASP B 1 150 ? -29.830 44.520 14.876  1.00 87.62  ? 147 ASP B CG    1 
ATOM   3140 O  OD1   . ASP B 1 150 ? -28.982 45.299 14.376  1.00 88.70  ? 147 ASP B OD1   1 
ATOM   3141 O  OD2   . ASP B 1 150 ? -30.980 44.879 15.212  1.00 90.10  ? 147 ASP B OD2   1 
ATOM   3142 N  N     . GLY B 1 151 ? -27.966 44.638 17.723  1.00 88.37  ? 148 GLY B N     1 
ATOM   3143 C  CA    . GLY B 1 151 ? -28.099 45.345 18.999  1.00 90.25  ? 148 GLY B CA    1 
ATOM   3144 C  C     . GLY B 1 151 ? -29.521 45.664 19.403  1.00 91.30  ? 148 GLY B C     1 
ATOM   3145 O  O     . GLY B 1 151 ? -29.933 45.401 20.537  1.00 92.76  ? 148 GLY B O     1 
ATOM   3146 N  N     . MET B 1 152 ? -30.270 46.211 18.454  1.00 90.71  ? 149 MET B N     1 
ATOM   3147 C  CA    . MET B 1 152 ? -31.612 46.709 18.712  1.00 91.87  ? 149 MET B CA    1 
ATOM   3148 C  C     . MET B 1 152 ? -32.686 45.613 18.715  1.00 91.52  ? 149 MET B C     1 
ATOM   3149 O  O     . MET B 1 152 ? -33.480 45.539 19.641  1.00 93.13  ? 149 MET B O     1 
ATOM   3150 C  CB    . MET B 1 152 ? -31.949 47.828 17.714  1.00 91.80  ? 149 MET B CB    1 
ATOM   3151 C  CG    . MET B 1 152 ? -33.245 48.571 17.977  1.00 93.82  ? 149 MET B CG    1 
ATOM   3152 S  SD    . MET B 1 152 ? -34.680 47.704 17.308  1.00 95.32  ? 149 MET B SD    1 
ATOM   3153 C  CE    . MET B 1 152 ? -35.998 48.342 18.373  1.00 97.18  ? 149 MET B CE    1 
ATOM   3154 N  N     . THR B 1 153 ? -32.708 44.767 17.693  1.00 89.75  ? 150 THR B N     1 
ATOM   3155 C  CA    . THR B 1 153 ? -33.785 43.787 17.527  1.00 89.57  ? 150 THR B CA    1 
ATOM   3156 C  C     . THR B 1 153 ? -33.510 42.416 18.173  1.00 89.89  ? 150 THR B C     1 
ATOM   3157 O  O     . THR B 1 153 ? -34.443 41.697 18.552  1.00 90.72  ? 150 THR B O     1 
ATOM   3158 C  CB    . THR B 1 153 ? -34.047 43.540 16.054  1.00 88.07  ? 150 THR B CB    1 
ATOM   3159 O  OG1   . THR B 1 153 ? -32.864 42.986 15.466  1.00 86.36  ? 150 THR B OG1   1 
ATOM   3160 C  CG2   . THR B 1 153 ? -34.401 44.832 15.360  1.00 87.85  ? 150 THR B CG2   1 
ATOM   3161 N  N     . GLY B 1 154 ? -32.235 42.052 18.277  1.00 89.12  ? 151 GLY B N     1 
ATOM   3162 C  CA    . GLY B 1 154 ? -31.858 40.720 18.731  1.00 89.11  ? 151 GLY B CA    1 
ATOM   3163 C  C     . GLY B 1 154 ? -31.838 39.683 17.615  1.00 88.03  ? 151 GLY B C     1 
ATOM   3164 O  O     . GLY B 1 154 ? -31.693 38.483 17.880  1.00 88.64  ? 151 GLY B O     1 
ATOM   3165 N  N     . PHE B 1 155 ? -31.981 40.123 16.365  1.00 86.60  ? 152 PHE B N     1 
ATOM   3166 C  CA    . PHE B 1 155 ? -31.881 39.197 15.251  1.00 85.39  ? 152 PHE B CA    1 
ATOM   3167 C  C     . PHE B 1 155 ? -30.484 38.588 15.209  1.00 84.86  ? 152 PHE B C     1 
ATOM   3168 O  O     . PHE B 1 155 ? -29.482 39.254 15.510  1.00 84.30  ? 152 PHE B O     1 
ATOM   3169 C  CB    . PHE B 1 155 ? -32.200 39.882 13.928  1.00 84.45  ? 152 PHE B CB    1 
ATOM   3170 C  CG    . PHE B 1 155 ? -32.725 38.941 12.871  1.00 84.01  ? 152 PHE B CG    1 
ATOM   3171 C  CD1   . PHE B 1 155 ? -34.099 38.706 12.746  1.00 84.31  ? 152 PHE B CD1   1 
ATOM   3172 C  CD2   . PHE B 1 155 ? -31.855 38.286 12.001  1.00 82.83  ? 152 PHE B CD2   1 
ATOM   3173 C  CE1   . PHE B 1 155 ? -34.599 37.838 11.769  1.00 83.05  ? 152 PHE B CE1   1 
ATOM   3174 C  CE2   . PHE B 1 155 ? -32.349 37.413 11.025  1.00 82.64  ? 152 PHE B CE2   1 
ATOM   3175 C  CZ    . PHE B 1 155 ? -33.731 37.192 10.914  1.00 82.56  ? 152 PHE B CZ    1 
ATOM   3176 N  N     . THR B 1 156 ? -30.429 37.316 14.831  1.00 84.94  ? 153 THR B N     1 
ATOM   3177 C  CA    . THR B 1 156 ? -29.193 36.552 14.881  1.00 84.65  ? 153 THR B CA    1 
ATOM   3178 C  C     . THR B 1 156 ? -28.831 35.919 13.541  1.00 83.87  ? 153 THR B C     1 
ATOM   3179 O  O     . THR B 1 156 ? -29.647 35.230 12.933  1.00 83.99  ? 153 THR B O     1 
ATOM   3180 C  CB    . THR B 1 156 ? -29.305 35.462 15.952  1.00 85.95  ? 153 THR B CB    1 
ATOM   3181 O  OG1   . THR B 1 156 ? -29.782 36.056 17.164  1.00 87.35  ? 153 THR B OG1   1 
ATOM   3182 C  CG2   . THR B 1 156 ? -27.961 34.779 16.204  1.00 85.65  ? 153 THR B CG2   1 
ATOM   3183 N  N     . TRP B 1 157 ? -27.602 36.171 13.093  1.00 83.10  ? 154 TRP B N     1 
ATOM   3184 C  CA    . TRP B 1 157 ? -27.008 35.408 12.007  1.00 82.91  ? 154 TRP B CA    1 
ATOM   3185 C  C     . TRP B 1 157 ? -25.945 34.476 12.553  1.00 83.01  ? 154 TRP B C     1 
ATOM   3186 O  O     . TRP B 1 157 ? -25.231 34.828 13.493  1.00 82.85  ? 154 TRP B O     1 
ATOM   3187 C  CB    . TRP B 1 157 ? -26.409 36.334 10.958  1.00 82.32  ? 154 TRP B CB    1 
ATOM   3188 C  CG    . TRP B 1 157 ? -27.448 37.161 10.257  1.00 83.93  ? 154 TRP B CG    1 
ATOM   3189 C  CD1   . TRP B 1 157 ? -28.096 36.849 9.086   1.00 84.95  ? 154 TRP B CD1   1 
ATOM   3190 C  CD2   . TRP B 1 157 ? -27.983 38.432 10.688  1.00 84.75  ? 154 TRP B CD2   1 
ATOM   3191 N  NE1   . TRP B 1 157 ? -28.993 37.853 8.758   1.00 85.26  ? 154 TRP B NE1   1 
ATOM   3192 C  CE2   . TRP B 1 157 ? -28.943 38.834 9.718   1.00 84.82  ? 154 TRP B CE2   1 
ATOM   3193 C  CE3   . TRP B 1 157 ? -27.733 39.276 11.784  1.00 84.35  ? 154 TRP B CE3   1 
ATOM   3194 C  CZ2   . TRP B 1 157 ? -29.649 40.046 9.814   1.00 84.28  ? 154 TRP B CZ2   1 
ATOM   3195 C  CZ3   . TRP B 1 157 ? -28.435 40.481 11.875  1.00 84.40  ? 154 TRP B CZ3   1 
ATOM   3196 C  CH2   . TRP B 1 157 ? -29.384 40.850 10.897  1.00 84.43  ? 154 TRP B CH2   1 
ATOM   3197 N  N     . LEU B 1 158 ? -25.864 33.284 11.964  1.00 83.40  ? 155 LEU B N     1 
ATOM   3198 C  CA    . LEU B 1 158 ? -24.870 32.278 12.333  1.00 84.30  ? 155 LEU B CA    1 
ATOM   3199 C  C     . LEU B 1 158 ? -24.112 31.801 11.100  1.00 84.43  ? 155 LEU B C     1 
ATOM   3200 O  O     . LEU B 1 158 ? -24.727 31.407 10.115  1.00 84.85  ? 155 LEU B O     1 
ATOM   3201 C  CB    . LEU B 1 158 ? -25.540 31.082 13.009  1.00 85.46  ? 155 LEU B CB    1 
ATOM   3202 C  CG    . LEU B 1 158 ? -26.480 31.317 14.191  1.00 86.09  ? 155 LEU B CG    1 
ATOM   3203 C  CD1   . LEU B 1 158 ? -27.040 29.997 14.667  1.00 87.88  ? 155 LEU B CD1   1 
ATOM   3204 C  CD2   . LEU B 1 158 ? -25.787 32.029 15.340  1.00 85.95  ? 155 LEU B CD2   1 
ATOM   3205 N  N     . TYR B 1 159 ? -22.785 31.846 11.139  1.00 84.76  ? 156 TYR B N     1 
ATOM   3206 C  CA    . TYR B 1 159 ? -21.991 31.347 10.021  1.00 85.48  ? 156 TYR B CA    1 
ATOM   3207 C  C     . TYR B 1 159 ? -20.967 30.362 10.527  1.00 86.60  ? 156 TYR B C     1 
ATOM   3208 O  O     . TYR B 1 159 ? -20.218 30.671 11.456  1.00 86.74  ? 156 TYR B O     1 
ATOM   3209 C  CB    . TYR B 1 159 ? -21.303 32.482 9.243   1.00 84.87  ? 156 TYR B CB    1 
ATOM   3210 C  CG    . TYR B 1 159 ? -22.271 33.519 8.723   1.00 85.22  ? 156 TYR B CG    1 
ATOM   3211 C  CD1   . TYR B 1 159 ? -23.012 33.289 7.564   1.00 86.48  ? 156 TYR B CD1   1 
ATOM   3212 C  CD2   . TYR B 1 159 ? -22.467 34.719 9.407   1.00 85.46  ? 156 TYR B CD2   1 
ATOM   3213 C  CE1   . TYR B 1 159 ? -23.922 34.228 7.102   1.00 86.84  ? 156 TYR B CE1   1 
ATOM   3214 C  CE2   . TYR B 1 159 ? -23.368 35.665 8.952   1.00 85.74  ? 156 TYR B CE2   1 
ATOM   3215 C  CZ    . TYR B 1 159 ? -24.091 35.413 7.801   1.00 86.90  ? 156 TYR B CZ    1 
ATOM   3216 O  OH    . TYR B 1 159 ? -24.989 36.349 7.348   1.00 88.41  ? 156 TYR B OH    1 
ATOM   3217 N  N     . PRO B 1 160 ? -20.942 29.163 9.930   1.00 87.75  ? 157 PRO B N     1 
ATOM   3218 C  CA    . PRO B 1 160 ? -19.956 28.156 10.298  1.00 89.21  ? 157 PRO B CA    1 
ATOM   3219 C  C     . PRO B 1 160 ? -18.602 28.486 9.689   1.00 89.23  ? 157 PRO B C     1 
ATOM   3220 O  O     . PRO B 1 160 ? -18.517 28.776 8.500   1.00 89.07  ? 157 PRO B O     1 
ATOM   3221 C  CB    . PRO B 1 160 ? -20.528 26.873 9.693   1.00 90.54  ? 157 PRO B CB    1 
ATOM   3222 C  CG    . PRO B 1 160 ? -21.346 27.328 8.544   1.00 89.63  ? 157 PRO B CG    1 
ATOM   3223 C  CD    . PRO B 1 160 ? -21.884 28.680 8.905   1.00 87.99  ? 157 PRO B CD    1 
ATOM   3224 N  N     . THR B 1 161 ? -17.553 28.473 10.499  1.00 90.00  ? 158 THR B N     1 
ATOM   3225 C  CA    . THR B 1 161 ? -16.212 28.717 9.985   1.00 90.56  ? 158 THR B CA    1 
ATOM   3226 C  C     . THR B 1 161 ? -15.297 27.554 10.339  1.00 92.76  ? 158 THR B C     1 
ATOM   3227 O  O     . THR B 1 161 ? -15.674 26.671 11.120  1.00 94.05  ? 158 THR B O     1 
ATOM   3228 C  CB    . THR B 1 161 ? -15.606 30.046 10.504  1.00 89.59  ? 158 THR B CB    1 
ATOM   3229 O  OG1   . THR B 1 161 ? -15.249 29.915 11.883  1.00 90.21  ? 158 THR B OG1   1 
ATOM   3230 C  CG2   . THR B 1 161 ? -16.579 31.211 10.335  1.00 88.03  ? 158 THR B CG2   1 
ATOM   3231 N  N     . LYS B 1 162 ? -14.099 27.555 9.761   1.00 93.68  ? 159 LYS B N     1 
ATOM   3232 C  CA    . LYS B 1 162 ? -13.126 26.489 10.004  1.00 95.95  ? 159 LYS B CA    1 
ATOM   3233 C  C     . LYS B 1 162 ? -12.047 26.906 11.000  1.00 96.12  ? 159 LYS B C     1 
ATOM   3234 O  O     . LYS B 1 162 ? -11.269 26.074 11.465  1.00 97.86  ? 159 LYS B O     1 
ATOM   3235 C  CB    . LYS B 1 162 ? -12.508 26.018 8.685   1.00 96.96  ? 159 LYS B CB    1 
ATOM   3236 C  CG    . LYS B 1 162 ? -13.533 25.398 7.744   1.00 98.76  ? 159 LYS B CG    1 
ATOM   3237 C  CD    . LYS B 1 162 ? -12.912 24.721 6.525   1.00 102.47 ? 159 LYS B CD    1 
ATOM   3238 C  CE    . LYS B 1 162 ? -13.990 23.976 5.723   1.00 104.52 ? 159 LYS B CE    1 
ATOM   3239 N  NZ    . LYS B 1 162 ? -13.434 23.216 4.574   1.00 107.29 ? 159 LYS B NZ    1 
ATOM   3240 N  N     . ALA B 1 163 ? -12.025 28.195 11.327  1.00 94.73  ? 160 ALA B N     1 
ATOM   3241 C  CA    . ALA B 1 163 ? -11.059 28.777 12.248  1.00 94.94  ? 160 ALA B CA    1 
ATOM   3242 C  C     . ALA B 1 163 ? -11.607 30.105 12.766  1.00 93.73  ? 160 ALA B C     1 
ATOM   3243 O  O     . ALA B 1 163 ? -12.367 30.773 12.067  1.00 92.40  ? 160 ALA B O     1 
ATOM   3244 C  CB    . ALA B 1 163 ? -9.728  29.000 11.543  1.00 95.28  ? 160 ALA B CB    1 
ATOM   3245 N  N     . PRO B 1 164 ? -11.235 30.496 14.000  1.00 94.36  ? 161 PRO B N     1 
ATOM   3246 C  CA    . PRO B 1 164 ? -11.577 31.848 14.412  1.00 93.43  ? 161 PRO B CA    1 
ATOM   3247 C  C     . PRO B 1 164 ? -10.544 32.830 13.876  1.00 93.33  ? 161 PRO B C     1 
ATOM   3248 O  O     . PRO B 1 164 ? -9.930  33.557 14.645  1.00 94.17  ? 161 PRO B O     1 
ATOM   3249 C  CB    . PRO B 1 164 ? -11.513 31.771 15.939  1.00 94.53  ? 161 PRO B CB    1 
ATOM   3250 C  CG    . PRO B 1 164 ? -10.529 30.704 16.225  1.00 95.94  ? 161 PRO B CG    1 
ATOM   3251 C  CD    . PRO B 1 164 ? -10.591 29.730 15.085  1.00 96.06  ? 161 PRO B CD    1 
ATOM   3252 N  N     . SER B 1 165 ? -10.350 32.837 12.563  1.00 92.90  ? 162 SER B N     1 
ATOM   3253 C  CA    . SER B 1 165 ? -9.350  33.686 11.938  1.00 93.07  ? 162 SER B CA    1 
ATOM   3254 C  C     . SER B 1 165 ? -9.988  34.939 11.355  1.00 91.84  ? 162 SER B C     1 
ATOM   3255 O  O     . SER B 1 165 ? -11.190 34.961 11.085  1.00 90.79  ? 162 SER B O     1 
ATOM   3256 C  CB    . SER B 1 165 ? -8.608  32.908 10.842  1.00 94.00  ? 162 SER B CB    1 
ATOM   3257 O  OG    . SER B 1 165 ? -9.471  32.525 9.777   1.00 93.17  ? 162 SER B OG    1 
ATOM   3258 N  N     . THR B 1 166 ? -9.178  35.978 11.155  1.00 92.09  ? 163 THR B N     1 
ATOM   3259 C  CA    . THR B 1 166 ? -9.626  37.189 10.461  1.00 91.21  ? 163 THR B CA    1 
ATOM   3260 C  C     . THR B 1 166 ? -10.306 36.820 9.145   1.00 90.63  ? 163 THR B C     1 
ATOM   3261 O  O     . THR B 1 166 ? -11.439 37.247 8.866   1.00 89.43  ? 163 THR B O     1 
ATOM   3262 C  CB    . THR B 1 166 ? -8.447  38.112 10.154  1.00 91.76  ? 163 THR B CB    1 
ATOM   3263 O  OG1   . THR B 1 166 ? -7.707  38.327 11.351  1.00 93.29  ? 163 THR B OG1   1 
ATOM   3264 C  CG2   . THR B 1 166 ? -8.925  39.444 9.627   1.00 90.52  ? 163 THR B CG2   1 
ATOM   3265 N  N     . SER B 1 167 ? -9.595  36.015 8.354   1.00 91.42  ? 164 SER B N     1 
ATOM   3266 C  CA    . SER B 1 167 ? -10.065 35.547 7.058   1.00 91.08  ? 164 SER B CA    1 
ATOM   3267 C  C     . SER B 1 167 ? -11.474 34.949 7.131   1.00 90.09  ? 164 SER B C     1 
ATOM   3268 O  O     . SER B 1 167 ? -12.387 35.416 6.450   1.00 89.43  ? 164 SER B O     1 
ATOM   3269 C  CB    . SER B 1 167 ? -9.089  34.525 6.500   1.00 92.28  ? 164 SER B CB    1 
ATOM   3270 O  OG    . SER B 1 167 ? -9.763  33.653 5.618   1.00 92.87  ? 164 SER B OG    1 
ATOM   3271 N  N     . ALA B 1 168 ? -11.645 33.927 7.966   1.00 90.10  ? 165 ALA B N     1 
ATOM   3272 C  CA    . ALA B 1 168 ? -12.942 33.280 8.131   1.00 89.30  ? 165 ALA B CA    1 
ATOM   3273 C  C     . ALA B 1 168 ? -14.041 34.280 8.508   1.00 88.01  ? 165 ALA B C     1 
ATOM   3274 O  O     . ALA B 1 168 ? -15.181 34.158 8.048   1.00 87.57  ? 165 ALA B O     1 
ATOM   3275 C  CB    . ALA B 1 168 ? -12.851 32.173 9.156   1.00 90.15  ? 165 ALA B CB    1 
ATOM   3276 N  N     . THR B 1 169 ? -13.686 35.266 9.334   1.00 87.42  ? 166 THR B N     1 
ATOM   3277 C  CA    . THR B 1 169 ? -14.598 36.339 9.715   1.00 85.99  ? 166 THR B CA    1 
ATOM   3278 C  C     . THR B 1 169 ? -14.973 37.187 8.501   1.00 85.34  ? 166 THR B C     1 
ATOM   3279 O  O     . THR B 1 169 ? -16.159 37.464 8.278   1.00 84.86  ? 166 THR B O     1 
ATOM   3280 C  CB    . THR B 1 169 ? -13.963 37.245 10.763  1.00 86.28  ? 166 THR B CB    1 
ATOM   3281 O  OG1   . THR B 1 169 ? -13.468 36.443 11.836  1.00 86.89  ? 166 THR B OG1   1 
ATOM   3282 C  CG2   . THR B 1 169 ? -14.968 38.257 11.292  1.00 85.58  ? 166 THR B CG2   1 
ATOM   3283 N  N     . VAL B 1 170 ? -13.969 37.588 7.714   1.00 85.18  ? 167 VAL B N     1 
ATOM   3284 C  CA    . VAL B 1 170 ? -14.214 38.453 6.558   1.00 84.30  ? 167 VAL B CA    1 
ATOM   3285 C  C     . VAL B 1 170 ? -15.060 37.741 5.515   1.00 83.88  ? 167 VAL B C     1 
ATOM   3286 O  O     . VAL B 1 170 ? -16.055 38.290 5.061   1.00 83.21  ? 167 VAL B O     1 
ATOM   3287 C  CB    . VAL B 1 170 ? -12.915 39.030 5.956   1.00 84.97  ? 167 VAL B CB    1 
ATOM   3288 C  CG1   . VAL B 1 170 ? -13.177 39.660 4.609   1.00 84.78  ? 167 VAL B CG1   1 
ATOM   3289 C  CG2   . VAL B 1 170 ? -12.334 40.067 6.884   1.00 85.12  ? 167 VAL B CG2   1 
ATOM   3290 N  N     . LYS B 1 171 ? -14.683 36.510 5.167   1.00 84.54  ? 168 LYS B N     1 
ATOM   3291 C  CA    . LYS B 1 171 ? -15.459 35.710 4.216   1.00 84.83  ? 168 LYS B CA    1 
ATOM   3292 C  C     . LYS B 1 171 ? -16.915 35.634 4.698   1.00 84.11  ? 168 LYS B C     1 
ATOM   3293 O  O     . LYS B 1 171 ? -17.845 35.905 3.930   1.00 84.21  ? 168 LYS B O     1 
ATOM   3294 C  CB    . LYS B 1 171 ? -14.840 34.315 3.988   1.00 85.57  ? 168 LYS B CB    1 
ATOM   3295 N  N     . SER B 1 172 ? -17.105 35.328 5.978   1.00 83.54  ? 169 SER B N     1 
ATOM   3296 C  CA    . SER B 1 172 ? -18.441 35.287 6.555   1.00 83.11  ? 169 SER B CA    1 
ATOM   3297 C  C     . SER B 1 172 ? -19.183 36.626 6.536   1.00 82.08  ? 169 SER B C     1 
ATOM   3298 O  O     . SER B 1 172 ? -20.354 36.690 6.152   1.00 81.92  ? 169 SER B O     1 
ATOM   3299 C  CB    . SER B 1 172 ? -18.385 34.750 7.978   1.00 83.51  ? 169 SER B CB    1 
ATOM   3300 O  OG    . SER B 1 172 ? -18.302 33.341 7.961   1.00 85.39  ? 169 SER B OG    1 
ATOM   3301 N  N     . LEU B 1 173 ? -18.513 37.691 6.955   1.00 81.50  ? 170 LEU B N     1 
ATOM   3302 C  CA    . LEU B 1 173 ? -19.169 38.989 7.027   1.00 80.87  ? 170 LEU B CA    1 
ATOM   3303 C  C     . LEU B 1 173 ? -19.452 39.606 5.638   1.00 80.98  ? 170 LEU B C     1 
ATOM   3304 O  O     . LEU B 1 173 ? -20.333 40.475 5.490   1.00 81.02  ? 170 LEU B O     1 
ATOM   3305 C  CB    . LEU B 1 173 ? -18.399 39.944 7.943   1.00 80.86  ? 170 LEU B CB    1 
ATOM   3306 C  CG    . LEU B 1 173 ? -18.484 39.639 9.439   1.00 80.21  ? 170 LEU B CG    1 
ATOM   3307 C  CD1   . LEU B 1 173 ? -17.770 40.704 10.238  1.00 80.39  ? 170 LEU B CD1   1 
ATOM   3308 C  CD2   . LEU B 1 173 ? -19.918 39.538 9.884   1.00 79.11  ? 170 LEU B CD2   1 
ATOM   3309 N  N     . ASN B 1 174 ? -18.728 39.142 4.620   1.00 81.03  ? 171 ASN B N     1 
ATOM   3310 C  CA    . ASN B 1 174 ? -19.047 39.528 3.260   1.00 80.93  ? 171 ASN B CA    1 
ATOM   3311 C  C     . ASN B 1 174 ? -20.399 38.991 2.871   1.00 80.50  ? 171 ASN B C     1 
ATOM   3312 O  O     . ASN B 1 174 ? -21.147 39.647 2.142   1.00 80.81  ? 171 ASN B O     1 
ATOM   3313 C  CB    . ASN B 1 174 ? -17.980 39.068 2.293   1.00 81.75  ? 171 ASN B CB    1 
ATOM   3314 C  CG    . ASN B 1 174 ? -16.705 39.823 2.479   1.00 83.03  ? 171 ASN B CG    1 
ATOM   3315 O  OD1   . ASN B 1 174 ? -16.717 41.019 2.791   1.00 83.42  ? 171 ASN B OD1   1 
ATOM   3316 N  ND2   . ASN B 1 174 ? -15.585 39.132 2.320   1.00 85.23  ? 171 ASN B ND2   1 
ATOM   3317 N  N     . VAL B 1 175 ? -20.729 37.809 3.373   1.00 79.73  ? 172 VAL B N     1 
ATOM   3318 C  CA    . VAL B 1 175 ? -22.051 37.304 3.137   1.00 79.30  ? 172 VAL B CA    1 
ATOM   3319 C  C     . VAL B 1 175 ? -23.079 38.231 3.799   1.00 78.78  ? 172 VAL B C     1 
ATOM   3320 O  O     . VAL B 1 175 ? -24.035 38.647 3.151   1.00 79.17  ? 172 VAL B O     1 
ATOM   3321 C  CB    . VAL B 1 175 ? -22.194 35.824 3.532   1.00 79.56  ? 172 VAL B CB    1 
ATOM   3322 C  CG1   . VAL B 1 175 ? -23.624 35.511 3.977   1.00 80.18  ? 172 VAL B CG1   1 
ATOM   3323 C  CG2   . VAL B 1 175 ? -21.813 34.943 2.372   1.00 79.53  ? 172 VAL B CG2   1 
ATOM   3324 N  N     . LEU B 1 176 ? -22.874 38.597 5.057   1.00 78.27  ? 173 LEU B N     1 
ATOM   3325 C  CA    . LEU B 1 176 ? -23.891 39.374 5.748   1.00 78.16  ? 173 LEU B CA    1 
ATOM   3326 C  C     . LEU B 1 176 ? -24.050 40.761 5.155   1.00 78.42  ? 173 LEU B C     1 
ATOM   3327 O  O     . LEU B 1 176 ? -25.167 41.289 5.074   1.00 78.54  ? 173 LEU B O     1 
ATOM   3328 C  CB    . LEU B 1 176 ? -23.601 39.479 7.249   1.00 78.21  ? 173 LEU B CB    1 
ATOM   3329 C  CG    . LEU B 1 176 ? -24.699 40.084 8.140   1.00 77.45  ? 173 LEU B CG    1 
ATOM   3330 C  CD1   . LEU B 1 176 ? -26.066 39.520 7.798   1.00 76.66  ? 173 LEU B CD1   1 
ATOM   3331 C  CD2   . LEU B 1 176 ? -24.388 39.835 9.595   1.00 77.30  ? 173 LEU B CD2   1 
ATOM   3332 N  N     . THR B 1 177 ? -22.944 41.348 4.724   1.00 78.63  ? 174 THR B N     1 
ATOM   3333 C  CA    . THR B 1 177 ? -23.000 42.727 4.274   1.00 79.51  ? 174 THR B CA    1 
ATOM   3334 C  C     . THR B 1 177 ? -23.483 42.904 2.834   1.00 80.37  ? 174 THR B C     1 
ATOM   3335 O  O     . THR B 1 177 ? -23.357 43.976 2.260   1.00 81.21  ? 174 THR B O     1 
ATOM   3336 C  CB    . THR B 1 177 ? -21.682 43.444 4.510   1.00 79.61  ? 174 THR B CB    1 
ATOM   3337 O  OG1   . THR B 1 177 ? -20.627 42.717 3.880   1.00 80.14  ? 174 THR B OG1   1 
ATOM   3338 C  CG2   . THR B 1 177 ? -21.413 43.529 6.001   1.00 79.72  ? 174 THR B CG2   1 
ATOM   3339 N  N     . SER B 1 178 ? -24.046 41.848 2.264   1.00 81.06  ? 175 SER B N     1 
ATOM   3340 C  CA    . SER B 1 178 ? -24.716 41.912 0.975   1.00 82.23  ? 175 SER B CA    1 
ATOM   3341 C  C     . SER B 1 178 ? -26.184 42.147 1.242   1.00 82.42  ? 175 SER B C     1 
ATOM   3342 O  O     . SER B 1 178 ? -26.967 42.470 0.336   1.00 83.29  ? 175 SER B O     1 
ATOM   3343 C  CB    . SER B 1 178 ? -24.559 40.584 0.249   1.00 82.89  ? 175 SER B CB    1 
ATOM   3344 O  OG    . SER B 1 178 ? -23.228 40.112 0.352   1.00 84.35  ? 175 SER B OG    1 
ATOM   3345 N  N     . ILE B 1 179 ? -26.557 41.973 2.502   1.00 82.01  ? 176 ILE B N     1 
ATOM   3346 C  CA    . ILE B 1 179 ? -27.907 42.250 2.920   1.00 82.37  ? 176 ILE B CA    1 
ATOM   3347 C  C     . ILE B 1 179 ? -27.956 43.645 3.532   1.00 82.39  ? 176 ILE B C     1 
ATOM   3348 O  O     . ILE B 1 179 ? -28.714 44.508 3.061   1.00 83.21  ? 176 ILE B O     1 
ATOM   3349 C  CB    . ILE B 1 179 ? -28.417 41.189 3.905   1.00 82.35  ? 176 ILE B CB    1 
ATOM   3350 C  CG1   . ILE B 1 179 ? -28.079 39.776 3.400   1.00 83.28  ? 176 ILE B CG1   1 
ATOM   3351 C  CG2   . ILE B 1 179 ? -29.911 41.363 4.154   1.00 82.56  ? 176 ILE B CG2   1 
ATOM   3352 C  CD1   . ILE B 1 179 ? -28.625 39.422 2.022   1.00 84.82  ? 176 ILE B CD1   1 
ATOM   3353 N  N     . ALA B 1 180 ? -27.132 43.871 4.555   1.00 81.68  ? 177 ALA B N     1 
ATOM   3354 C  CA    . ALA B 1 180 ? -27.120 45.150 5.261   1.00 81.79  ? 177 ALA B CA    1 
ATOM   3355 C  C     . ALA B 1 180 ? -25.775 45.390 5.910   1.00 81.53  ? 177 ALA B C     1 
ATOM   3356 O  O     . ALA B 1 180 ? -25.104 44.448 6.317   1.00 81.58  ? 177 ALA B O     1 
ATOM   3357 C  CB    . ALA B 1 180 ? -28.213 45.184 6.308   1.00 81.92  ? 177 ALA B CB    1 
ATOM   3358 N  N     . ILE B 1 181 ? -25.387 46.653 6.016   1.00 81.57  ? 178 ILE B N     1 
ATOM   3359 C  CA    . ILE B 1 181 ? -24.131 47.003 6.651   1.00 81.25  ? 178 ILE B CA    1 
ATOM   3360 C  C     . ILE B 1 181 ? -24.464 47.719 7.953   1.00 81.70  ? 178 ILE B C     1 
ATOM   3361 O  O     . ILE B 1 181 ? -25.279 48.645 7.946   1.00 82.32  ? 178 ILE B O     1 
ATOM   3362 C  CB    . ILE B 1 181 ? -23.281 47.914 5.738   1.00 81.90  ? 178 ILE B CB    1 
ATOM   3363 C  CG1   . ILE B 1 181 ? -22.988 47.231 4.394   1.00 81.13  ? 178 ILE B CG1   1 
ATOM   3364 C  CG2   . ILE B 1 181 ? -21.988 48.321 6.432   1.00 82.48  ? 178 ILE B CG2   1 
ATOM   3365 C  CD1   . ILE B 1 181 ? -22.572 48.189 3.293   1.00 80.90  ? 178 ILE B CD1   1 
ATOM   3366 N  N     . PRO B 1 182 ? -23.858 47.281 9.078   1.00 81.42  ? 179 PRO B N     1 
ATOM   3367 C  CA    . PRO B 1 182 ? -24.070 47.944 10.363  1.00 82.07  ? 179 PRO B CA    1 
ATOM   3368 C  C     . PRO B 1 182 ? -23.281 49.234 10.427  1.00 83.29  ? 179 PRO B C     1 
ATOM   3369 O  O     . PRO B 1 182 ? -22.311 49.388 9.685   1.00 83.31  ? 179 PRO B O     1 
ATOM   3370 C  CB    . PRO B 1 182 ? -23.490 46.950 11.361  1.00 81.74  ? 179 PRO B CB    1 
ATOM   3371 C  CG    . PRO B 1 182 ? -22.444 46.226 10.608  1.00 80.86  ? 179 PRO B CG    1 
ATOM   3372 C  CD    . PRO B 1 182 ? -22.957 46.116 9.205   1.00 80.75  ? 179 PRO B CD    1 
ATOM   3373 N  N     . LYS B 1 183 ? -23.680 50.157 11.295  1.00 84.68  ? 180 LYS B N     1 
ATOM   3374 C  CA    . LYS B 1 183 ? -22.854 51.341 11.533  1.00 86.45  ? 180 LYS B CA    1 
ATOM   3375 C  C     . LYS B 1 183 ? -21.677 50.983 12.422  1.00 86.87  ? 180 LYS B C     1 
ATOM   3376 O  O     . LYS B 1 183 ? -20.557 51.444 12.196  1.00 87.58  ? 180 LYS B O     1 
ATOM   3377 C  CB    . LYS B 1 183 ? -23.663 52.464 12.159  1.00 88.03  ? 180 LYS B CB    1 
ATOM   3378 C  CG    . LYS B 1 183 ? -24.577 53.145 11.176  1.00 89.56  ? 180 LYS B CG    1 
ATOM   3379 C  CD    . LYS B 1 183 ? -25.475 54.146 11.861  1.00 92.84  ? 180 LYS B CD    1 
ATOM   3380 C  CE    . LYS B 1 183 ? -26.250 54.927 10.832  1.00 94.34  ? 180 LYS B CE    1 
ATOM   3381 N  NZ    . LYS B 1 183 ? -27.350 55.643 11.503  1.00 97.66  ? 180 LYS B NZ    1 
ATOM   3382 N  N     . VAL B 1 184 ? -21.939 50.145 13.425  1.00 86.78  ? 181 VAL B N     1 
ATOM   3383 C  CA    . VAL B 1 184 ? -20.920 49.717 14.378  1.00 87.26  ? 181 VAL B CA    1 
ATOM   3384 C  C     . VAL B 1 184 ? -20.917 48.204 14.553  1.00 86.19  ? 181 VAL B C     1 
ATOM   3385 O  O     . VAL B 1 184 ? -21.964 47.574 14.619  1.00 85.25  ? 181 VAL B O     1 
ATOM   3386 C  CB    . VAL B 1 184 ? -21.112 50.388 15.767  1.00 88.95  ? 181 VAL B CB    1 
ATOM   3387 C  CG1   . VAL B 1 184 ? -19.997 49.988 16.723  1.00 89.64  ? 181 VAL B CG1   1 
ATOM   3388 C  CG2   . VAL B 1 184 ? -21.166 51.908 15.640  1.00 90.37  ? 181 VAL B CG2   1 
ATOM   3389 N  N     . ILE B 1 185 ? -19.721 47.635 14.618  1.00 86.71  ? 182 ILE B N     1 
ATOM   3390 C  CA    . ILE B 1 185 ? -19.537 46.264 15.090  1.00 86.77  ? 182 ILE B CA    1 
ATOM   3391 C  C     . ILE B 1 185 ? -18.848 46.282 16.460  1.00 88.75  ? 182 ILE B C     1 
ATOM   3392 O  O     . ILE B 1 185 ? -17.782 46.896 16.628  1.00 89.88  ? 182 ILE B O     1 
ATOM   3393 C  CB    . ILE B 1 185 ? -18.718 45.409 14.091  1.00 85.59  ? 182 ILE B CB    1 
ATOM   3394 C  CG1   . ILE B 1 185 ? -19.542 45.141 12.836  1.00 84.20  ? 182 ILE B CG1   1 
ATOM   3395 C  CG2   . ILE B 1 185 ? -18.272 44.089 14.719  1.00 85.25  ? 182 ILE B CG2   1 
ATOM   3396 C  CD1   . ILE B 1 185 ? -18.738 44.541 11.702  1.00 83.51  ? 182 ILE B CD1   1 
ATOM   3397 N  N     . HIS B 1 186 ? -19.470 45.618 17.433  1.00 89.52  ? 183 HIS B N     1 
ATOM   3398 C  CA    . HIS B 1 186 ? -18.871 45.438 18.751  1.00 91.60  ? 183 HIS B CA    1 
ATOM   3399 C  C     . HIS B 1 186 ? -18.361 44.000 18.923  1.00 91.63  ? 183 HIS B C     1 
ATOM   3400 O  O     . HIS B 1 186 ? -19.039 43.042 18.531  1.00 90.61  ? 183 HIS B O     1 
ATOM   3401 C  CB    . HIS B 1 186 ? -19.883 45.796 19.838  1.00 92.79  ? 183 HIS B CB    1 
ATOM   3402 C  CG    . HIS B 1 186 ? -19.394 45.556 21.233  1.00 94.34  ? 183 HIS B CG    1 
ATOM   3403 N  ND1   . HIS B 1 186 ? -19.131 46.583 22.114  1.00 96.28  ? 183 HIS B ND1   1 
ATOM   3404 C  CD2   . HIS B 1 186 ? -19.140 44.409 21.906  1.00 94.46  ? 183 HIS B CD2   1 
ATOM   3405 C  CE1   . HIS B 1 186 ? -18.726 46.080 23.265  1.00 98.10  ? 183 HIS B CE1   1 
ATOM   3406 N  NE2   . HIS B 1 186 ? -18.718 44.762 23.163  1.00 97.37  ? 183 HIS B NE2   1 
ATOM   3407 N  N     . SER B 1 187 ? -17.168 43.862 19.503  1.00 93.09  ? 184 SER B N     1 
ATOM   3408 C  CA    . SER B 1 187 ? -16.573 42.546 19.757  1.00 93.68  ? 184 SER B CA    1 
ATOM   3409 C  C     . SER B 1 187 ? -15.615 42.614 20.932  1.00 96.08  ? 184 SER B C     1 
ATOM   3410 O  O     . SER B 1 187 ? -15.255 43.711 21.370  1.00 97.41  ? 184 SER B O     1 
ATOM   3411 C  CB    . SER B 1 187 ? -15.824 42.042 18.521  1.00 92.37  ? 184 SER B CB    1 
ATOM   3412 O  OG    . SER B 1 187 ? -14.721 42.879 18.215  1.00 92.69  ? 184 SER B OG    1 
ATOM   3413 N  N     . ASP B 1 188 ? -15.210 41.446 21.439  1.00 97.09  ? 185 ASP B N     1 
ATOM   3414 C  CA    . ASP B 1 188 ? -14.136 41.357 22.438  1.00 99.61  ? 185 ASP B CA    1 
ATOM   3415 C  C     . ASP B 1 188 ? -12.802 41.532 21.731  1.00 99.25  ? 185 ASP B C     1 
ATOM   3416 O  O     . ASP B 1 188 ? -12.758 41.581 20.501  1.00 97.74  ? 185 ASP B O     1 
ATOM   3417 C  CB    . ASP B 1 188 ? -14.173 40.025 23.200  1.00 100.83 ? 185 ASP B CB    1 
ATOM   3418 C  CG    . ASP B 1 188 ? -14.264 38.816 22.274  1.00 101.53 ? 185 ASP B CG    1 
ATOM   3419 O  OD1   . ASP B 1 188 ? -15.289 38.103 22.343  1.00 103.95 ? 185 ASP B OD1   1 
ATOM   3420 O  OD2   . ASP B 1 188 ? -13.329 38.578 21.472  1.00 102.83 ? 185 ASP B OD2   1 
ATOM   3421 N  N     . GLN B 1 189 ? -11.715 41.610 22.494  1.00 100.86 ? 186 GLN B N     1 
ATOM   3422 C  CA    . GLN B 1 189 ? -10.404 41.848 21.900  1.00 100.77 ? 186 GLN B CA    1 
ATOM   3423 C  C     . GLN B 1 189 ? -9.727  40.571 21.388  1.00 100.32 ? 186 GLN B C     1 
ATOM   3424 O  O     . GLN B 1 189 ? -8.512  40.405 21.503  1.00 101.36 ? 186 GLN B O     1 
ATOM   3425 C  CB    . GLN B 1 189 ? -9.515  42.638 22.854  1.00 103.00 ? 186 GLN B CB    1 
ATOM   3426 C  CG    . GLN B 1 189 ? -10.069 44.018 23.158  1.00 103.52 ? 186 GLN B CG    1 
ATOM   3427 C  CD    . GLN B 1 189 ? -8.998  45.086 23.340  1.00 105.74 ? 186 GLN B CD    1 
ATOM   3428 O  OE1   . GLN B 1 189 ? -7.807  44.790 23.451  1.00 106.83 ? 186 GLN B OE1   1 
ATOM   3429 N  NE2   . GLN B 1 189 ? -9.426  46.345 23.369  1.00 106.50 ? 186 GLN B NE2   1 
ATOM   3430 N  N     . GLY B 1 190 ? -10.532 39.688 20.800  1.00 98.93  ? 187 GLY B N     1 
ATOM   3431 C  CA    . GLY B 1 190 ? -10.044 38.466 20.174  1.00 98.81  ? 187 GLY B CA    1 
ATOM   3432 C  C     . GLY B 1 190 ? -9.059  38.798 19.076  1.00 98.76  ? 187 GLY B C     1 
ATOM   3433 O  O     . GLY B 1 190 ? -9.212  39.799 18.381  1.00 98.16  ? 187 GLY B O     1 
ATOM   3434 N  N     . ALA B 1 191 ? -8.040  37.961 18.921  1.00 99.83  ? 188 ALA B N     1 
ATOM   3435 C  CA    . ALA B 1 191 ? -6.966  38.236 17.972  1.00 100.15 ? 188 ALA B CA    1 
ATOM   3436 C  C     . ALA B 1 191 ? -7.524  38.477 16.578  1.00 98.52  ? 188 ALA B C     1 
ATOM   3437 O  O     . ALA B 1 191 ? -6.989  39.294 15.817  1.00 98.42  ? 188 ALA B O     1 
ATOM   3438 C  CB    . ALA B 1 191 ? -5.958  37.103 17.963  1.00 101.20 ? 188 ALA B CB    1 
ATOM   3439 N  N     . ALA B 1 192 ? -8.617  37.777 16.272  1.00 97.49  ? 189 ALA B N     1 
ATOM   3440 C  CA    . ALA B 1 192 ? -9.257  37.842 14.959  1.00 96.15  ? 189 ALA B CA    1 
ATOM   3441 C  C     . ALA B 1 192 ? -9.805  39.225 14.632  1.00 95.50  ? 189 ALA B C     1 
ATOM   3442 O  O     . ALA B 1 192 ? -9.729  39.666 13.487  1.00 94.83  ? 189 ALA B O     1 
ATOM   3443 C  CB    . ALA B 1 192 ? -10.356 36.806 14.859  1.00 95.40  ? 189 ALA B CB    1 
ATOM   3444 N  N     . PHE B 1 193 ? -10.345 39.903 15.641  1.00 95.97  ? 190 PHE B N     1 
ATOM   3445 C  CA    . PHE B 1 193 ? -11.004 41.189 15.441  1.00 95.80  ? 190 PHE B CA    1 
ATOM   3446 C  C     . PHE B 1 193 ? -10.065 42.381 15.681  1.00 97.24  ? 190 PHE B C     1 
ATOM   3447 O  O     . PHE B 1 193 ? -10.281 43.471 15.133  1.00 96.99  ? 190 PHE B O     1 
ATOM   3448 C  CB    . PHE B 1 193 ? -12.255 41.312 16.327  1.00 95.78  ? 190 PHE B CB    1 
ATOM   3449 C  CG    . PHE B 1 193 ? -13.104 40.057 16.398  1.00 95.25  ? 190 PHE B CG    1 
ATOM   3450 C  CD1   . PHE B 1 193 ? -13.648 39.487 15.251  1.00 94.12  ? 190 PHE B CD1   1 
ATOM   3451 C  CD2   . PHE B 1 193 ? -13.390 39.470 17.629  1.00 96.76  ? 190 PHE B CD2   1 
ATOM   3452 C  CE1   . PHE B 1 193 ? -14.438 38.337 15.329  1.00 93.68  ? 190 PHE B CE1   1 
ATOM   3453 C  CE2   . PHE B 1 193 ? -14.178 38.322 17.714  1.00 96.52  ? 190 PHE B CE2   1 
ATOM   3454 C  CZ    . PHE B 1 193 ? -14.701 37.758 16.559  1.00 94.78  ? 190 PHE B CZ    1 
ATOM   3455 N  N     . THR B 1 194 ? -9.034  42.177 16.502  1.00 98.84  ? 191 THR B N     1 
ATOM   3456 C  CA    . THR B 1 194 ? -8.029  43.220 16.736  1.00 100.75 ? 191 THR B CA    1 
ATOM   3457 C  C     . THR B 1 194 ? -7.025  43.368 15.584  1.00 101.03 ? 191 THR B C     1 
ATOM   3458 O  O     . THR B 1 194 ? -6.303  44.366 15.527  1.00 102.66 ? 191 THR B O     1 
ATOM   3459 C  CB    . THR B 1 194 ? -7.232  43.009 18.040  1.00 102.47 ? 191 THR B CB    1 
ATOM   3460 O  OG1   . THR B 1 194 ? -6.788  41.654 18.121  1.00 102.81 ? 191 THR B OG1   1 
ATOM   3461 C  CG2   . THR B 1 194 ? -8.066  43.330 19.237  1.00 103.36 ? 191 THR B CG2   1 
ATOM   3462 N  N     . SER B 1 195 ? -6.967  42.388 14.681  1.00 99.85  ? 192 SER B N     1 
ATOM   3463 C  CA    . SER B 1 195 ? -6.037  42.446 13.555  1.00 99.89  ? 192 SER B CA    1 
ATOM   3464 C  C     . SER B 1 195 ? -6.295  43.685 12.709  1.00 99.46  ? 192 SER B C     1 
ATOM   3465 O  O     . SER B 1 195 ? -7.406  44.246 12.725  1.00 98.45  ? 192 SER B O     1 
ATOM   3466 C  CB    . SER B 1 195 ? -6.143  41.198 12.680  1.00 98.99  ? 192 SER B CB    1 
ATOM   3467 O  OG    . SER B 1 195 ? -7.175  41.330 11.719  1.00 98.17  ? 192 SER B OG    1 
ATOM   3468 N  N     . SER B 1 196 ? -5.263  44.102 11.975  1.00 100.08 ? 193 SER B N     1 
ATOM   3469 C  CA    . SER B 1 196 ? -5.347  45.285 11.123  1.00 99.86  ? 193 SER B CA    1 
ATOM   3470 C  C     . SER B 1 196 ? -5.902  44.974 9.738   1.00 97.98  ? 193 SER B C     1 
ATOM   3471 O  O     . SER B 1 196 ? -6.355  45.878 9.035   1.00 97.82  ? 193 SER B O     1 
ATOM   3472 C  CB    . SER B 1 196 ? -3.996  45.971 11.021  1.00 101.92 ? 193 SER B CB    1 
ATOM   3473 O  OG    . SER B 1 196 ? -3.018  45.021 10.677  1.00 102.98 ? 193 SER B OG    1 
ATOM   3474 N  N     . THR B 1 197 ? -5.880  43.704 9.345   1.00 96.62  ? 194 THR B N     1 
ATOM   3475 C  CA    . THR B 1 197 ? -6.623  43.307 8.160   1.00 95.12  ? 194 THR B CA    1 
ATOM   3476 C  C     . THR B 1 197 ? -8.104  43.560 8.409   1.00 93.53  ? 194 THR B C     1 
ATOM   3477 O  O     . THR B 1 197 ? -8.752  44.247 7.617   1.00 93.27  ? 194 THR B O     1 
ATOM   3478 C  CB    . THR B 1 197 ? -6.388  41.847 7.745   1.00 94.74  ? 194 THR B CB    1 
ATOM   3479 O  OG1   . THR B 1 197 ? -4.992  41.639 7.546   1.00 96.72  ? 194 THR B OG1   1 
ATOM   3480 C  CG2   . THR B 1 197 ? -7.094  41.540 6.436   1.00 93.49  ? 194 THR B CG2   1 
ATOM   3481 N  N     . PHE B 1 198 ? -8.629  43.036 9.517   1.00 92.54  ? 195 PHE B N     1 
ATOM   3482 C  CA    . PHE B 1 198 ? -10.036 43.234 9.836   1.00 91.02  ? 195 PHE B CA    1 
ATOM   3483 C  C     . PHE B 1 198 ? -10.314 44.708 10.007  1.00 91.53  ? 195 PHE B C     1 
ATOM   3484 O  O     . PHE B 1 198 ? -11.356 45.198 9.583   1.00 90.81  ? 195 PHE B O     1 
ATOM   3485 C  CB    . PHE B 1 198 ? -10.457 42.464 11.089  1.00 90.79  ? 195 PHE B CB    1 
ATOM   3486 C  CG    . PHE B 1 198 ? -11.953 42.476 11.345  1.00 89.29  ? 195 PHE B CG    1 
ATOM   3487 C  CD1   . PHE B 1 198 ? -12.827 41.769 10.513  1.00 87.73  ? 195 PHE B CD1   1 
ATOM   3488 C  CD2   . PHE B 1 198 ? -12.484 43.180 12.426  1.00 89.06  ? 195 PHE B CD2   1 
ATOM   3489 C  CE1   . PHE B 1 198 ? -14.198 41.777 10.740  1.00 86.40  ? 195 PHE B CE1   1 
ATOM   3490 C  CE2   . PHE B 1 198 ? -13.850 43.195 12.659  1.00 87.90  ? 195 PHE B CE2   1 
ATOM   3491 C  CZ    . PHE B 1 198 ? -14.709 42.492 11.816  1.00 86.99  ? 195 PHE B CZ    1 
ATOM   3492 N  N     . ALA B 1 199 ? -9.367  45.418 10.610  1.00 93.07  ? 196 ALA B N     1 
ATOM   3493 C  CA    . ALA B 1 199 ? -9.507  46.855 10.787  1.00 94.32  ? 196 ALA B CA    1 
ATOM   3494 C  C     . ALA B 1 199 ? -9.690  47.573 9.443   1.00 94.53  ? 196 ALA B C     1 
ATOM   3495 O  O     . ALA B 1 199 ? -10.571 48.438 9.315   1.00 94.31  ? 196 ALA B O     1 
ATOM   3496 C  CB    . ALA B 1 199 ? -8.320  47.410 11.549  1.00 96.28  ? 196 ALA B CB    1 
ATOM   3497 N  N     . GLU B 1 200 ? -8.870  47.196 8.450   1.00 94.99  ? 197 GLU B N     1 
ATOM   3498 C  CA    . GLU B 1 200 ? -8.945  47.771 7.100   1.00 95.44  ? 197 GLU B CA    1 
ATOM   3499 C  C     . GLU B 1 200 ? -10.260 47.393 6.383   1.00 94.09  ? 197 GLU B C     1 
ATOM   3500 O  O     . GLU B 1 200 ? -10.902 48.239 5.743   1.00 94.33  ? 197 GLU B O     1 
ATOM   3501 C  CB    . GLU B 1 200 ? -7.710  47.399 6.266   1.00 95.98  ? 197 GLU B CB    1 
ATOM   3502 N  N     . TRP B 1 201 ? -10.665 46.131 6.515   1.00 92.89  ? 198 TRP B N     1 
ATOM   3503 C  CA    . TRP B 1 201 ? -11.935 45.653 5.969   1.00 91.47  ? 198 TRP B CA    1 
ATOM   3504 C  C     . TRP B 1 201 ? -13.088 46.564 6.368   1.00 91.31  ? 198 TRP B C     1 
ATOM   3505 O  O     . TRP B 1 201 ? -13.910 46.938 5.526   1.00 91.21  ? 198 TRP B O     1 
ATOM   3506 C  CB    . TRP B 1 201 ? -12.219 44.228 6.452   1.00 90.37  ? 198 TRP B CB    1 
ATOM   3507 C  CG    . TRP B 1 201 ? -13.542 43.679 6.002   1.00 88.69  ? 198 TRP B CG    1 
ATOM   3508 C  CD1   . TRP B 1 201 ? -13.792 43.016 4.841   1.00 88.47  ? 198 TRP B CD1   1 
ATOM   3509 C  CD2   . TRP B 1 201 ? -14.790 43.741 6.706   1.00 87.41  ? 198 TRP B CD2   1 
ATOM   3510 N  NE1   . TRP B 1 201 ? -15.115 42.656 4.772   1.00 87.59  ? 198 TRP B NE1   1 
ATOM   3511 C  CE2   . TRP B 1 201 ? -15.754 43.092 5.902   1.00 87.09  ? 198 TRP B CE2   1 
ATOM   3512 C  CE3   . TRP B 1 201 ? -15.187 44.276 7.937   1.00 86.98  ? 198 TRP B CE3   1 
ATOM   3513 C  CZ2   . TRP B 1 201 ? -17.098 42.962 6.291   1.00 86.33  ? 198 TRP B CZ2   1 
ATOM   3514 C  CZ3   . TRP B 1 201 ? -16.521 44.152 8.323   1.00 86.62  ? 198 TRP B CZ3   1 
ATOM   3515 C  CH2   . TRP B 1 201 ? -17.461 43.496 7.501   1.00 85.94  ? 198 TRP B CH2   1 
ATOM   3516 N  N     . ALA B 1 202 ? -13.139 46.919 7.650   1.00 91.52  ? 199 ALA B N     1 
ATOM   3517 C  CA    . ALA B 1 202 ? -14.256 47.684 8.182   1.00 91.46  ? 199 ALA B CA    1 
ATOM   3518 C  C     . ALA B 1 202 ? -14.149 49.153 7.850   1.00 92.80  ? 199 ALA B C     1 
ATOM   3519 O  O     . ALA B 1 202 ? -15.166 49.823 7.702   1.00 92.58  ? 199 ALA B O     1 
ATOM   3520 C  CB    . ALA B 1 202 ? -14.381 47.486 9.669   1.00 91.70  ? 199 ALA B CB    1 
ATOM   3521 N  N     . LYS B 1 203 ? -12.925 49.659 7.732   1.00 94.51  ? 200 LYS B N     1 
ATOM   3522 C  CA    . LYS B 1 203 ? -12.755 51.045 7.324   1.00 96.61  ? 200 LYS B CA    1 
ATOM   3523 C  C     . LYS B 1 203 ? -13.253 51.240 5.895   1.00 96.62  ? 200 LYS B C     1 
ATOM   3524 O  O     . LYS B 1 203 ? -13.797 52.295 5.580   1.00 97.59  ? 200 LYS B O     1 
ATOM   3525 C  CB    . LYS B 1 203 ? -11.312 51.523 7.454   1.00 98.35  ? 200 LYS B CB    1 
ATOM   3526 C  CG    . LYS B 1 203 ? -11.192 53.038 7.304   1.00 101.24 ? 200 LYS B CG    1 
ATOM   3527 C  CD    . LYS B 1 203 ? -9.747  53.509 7.220   1.00 105.03 ? 200 LYS B CD    1 
ATOM   3528 C  CE    . LYS B 1 203 ? -9.672  55.038 7.180   1.00 107.94 ? 200 LYS B CE    1 
ATOM   3529 N  NZ    . LYS B 1 203 ? -8.268  55.533 7.277   1.00 110.64 ? 200 LYS B NZ    1 
ATOM   3530 N  N     . GLU B 1 204 ? -13.077 50.219 5.051   1.00 96.01  ? 201 GLU B N     1 
ATOM   3531 C  CA    . GLU B 1 204 ? -13.545 50.243 3.662   1.00 96.26  ? 201 GLU B CA    1 
ATOM   3532 C  C     . GLU B 1 204 ? -15.057 50.379 3.552   1.00 95.02  ? 201 GLU B C     1 
ATOM   3533 O  O     . GLU B 1 204 ? -15.562 51.298 2.899   1.00 95.86  ? 201 GLU B O     1 
ATOM   3534 C  CB    . GLU B 1 204 ? -13.126 48.979 2.938   1.00 95.91  ? 201 GLU B CB    1 
ATOM   3535 C  CG    . GLU B 1 204 ? -11.662 48.907 2.578   1.00 100.15 ? 201 GLU B CG    1 
ATOM   3536 C  CD    . GLU B 1 204 ? -11.268 47.519 2.069   1.00 104.07 ? 201 GLU B CD    1 
ATOM   3537 O  OE1   . GLU B 1 204 ? -12.171 46.663 1.877   1.00 105.17 ? 201 GLU B OE1   1 
ATOM   3538 O  OE2   . GLU B 1 204 ? -10.056 47.277 1.860   1.00 106.36 ? 201 GLU B OE2   1 
ATOM   3539 N  N     . ARG B 1 205 ? -15.779 49.465 4.194   1.00 93.22  ? 202 ARG B N     1 
ATOM   3540 C  CA    . ARG B 1 205 ? -17.238 49.484 4.167   1.00 92.12  ? 202 ARG B CA    1 
ATOM   3541 C  C     . ARG B 1 205 ? -17.812 50.612 5.037   1.00 92.89  ? 202 ARG B C     1 
ATOM   3542 O  O     . ARG B 1 205 ? -19.028 50.807 5.088   1.00 92.64  ? 202 ARG B O     1 
ATOM   3543 C  CB    . ARG B 1 205 ? -17.799 48.121 4.577   1.00 90.52  ? 202 ARG B CB    1 
ATOM   3544 C  CG    . ARG B 1 205 ? -16.903 46.963 4.171   1.00 90.19  ? 202 ARG B CG    1 
ATOM   3545 C  CD    . ARG B 1 205 ? -17.663 45.692 3.783   1.00 89.24  ? 202 ARG B CD    1 
ATOM   3546 N  NE    . ARG B 1 205 ? -16.911 44.801 2.885   1.00 89.30  ? 202 ARG B NE    1 
ATOM   3547 C  CZ    . ARG B 1 205 ? -15.617 44.922 2.563   1.00 90.21  ? 202 ARG B CZ    1 
ATOM   3548 N  NH1   . ARG B 1 205 ? -14.861 45.897 3.062   1.00 90.35  ? 202 ARG B NH1   1 
ATOM   3549 N  NH2   . ARG B 1 205 ? -15.062 44.045 1.737   1.00 90.50  ? 202 ARG B NH2   1 
ATOM   3550 N  N     . GLY B 1 206 ? -16.928 51.359 5.701   1.00 94.18  ? 203 GLY B N     1 
ATOM   3551 C  CA    . GLY B 1 206 ? -17.313 52.499 6.535   1.00 95.36  ? 203 GLY B CA    1 
ATOM   3552 C  C     . GLY B 1 206 ? -18.005 52.072 7.813   1.00 94.89  ? 203 GLY B C     1 
ATOM   3553 O  O     . GLY B 1 206 ? -18.951 52.717 8.258   1.00 95.38  ? 203 GLY B O     1 
ATOM   3554 N  N     . ILE B 1 207 ? -17.539 50.965 8.385   1.00 94.15  ? 204 ILE B N     1 
ATOM   3555 C  CA    . ILE B 1 207 ? -18.062 50.423 9.634   1.00 93.78  ? 204 ILE B CA    1 
ATOM   3556 C  C     . ILE B 1 207 ? -17.133 50.862 10.756  1.00 95.65  ? 204 ILE B C     1 
ATOM   3557 O  O     . ILE B 1 207 ? -15.923 50.662 10.662  1.00 96.17  ? 204 ILE B O     1 
ATOM   3558 C  CB    . ILE B 1 207 ? -18.081 48.879 9.597   1.00 91.99  ? 204 ILE B CB    1 
ATOM   3559 C  CG1   . ILE B 1 207 ? -19.030 48.382 8.514   1.00 90.02  ? 204 ILE B CG1   1 
ATOM   3560 C  CG2   . ILE B 1 207 ? -18.466 48.309 10.953  1.00 91.88  ? 204 ILE B CG2   1 
ATOM   3561 C  CD1   . ILE B 1 207 ? -18.892 46.916 8.216   1.00 87.73  ? 204 ILE B CD1   1 
ATOM   3562 N  N     . HIS B 1 208 ? -17.679 51.453 11.814  1.00 97.09  ? 205 HIS B N     1 
ATOM   3563 C  CA    . HIS B 1 208 ? -16.857 51.753 12.979  1.00 99.14  ? 205 HIS B CA    1 
ATOM   3564 C  C     . HIS B 1 208 ? -16.683 50.517 13.863  1.00 98.55  ? 205 HIS B C     1 
ATOM   3565 O  O     . HIS B 1 208 ? -17.659 49.841 14.204  1.00 97.61  ? 205 HIS B O     1 
ATOM   3566 C  CB    . HIS B 1 208 ? -17.414 52.924 13.791  1.00 101.05 ? 205 HIS B CB    1 
ATOM   3567 C  CG    . HIS B 1 208 ? -16.575 53.275 14.985  1.00 104.06 ? 205 HIS B CG    1 
ATOM   3568 N  ND1   . HIS B 1 208 ? -16.989 53.050 16.283  1.00 105.40 ? 205 HIS B ND1   1 
ATOM   3569 C  CD2   . HIS B 1 208 ? -15.334 53.814 15.076  1.00 106.29 ? 205 HIS B CD2   1 
ATOM   3570 C  CE1   . HIS B 1 208 ? -16.050 53.451 17.121  1.00 107.46 ? 205 HIS B CE1   1 
ATOM   3571 N  NE2   . HIS B 1 208 ? -15.034 53.915 16.415  1.00 108.48 ? 205 HIS B NE2   1 
ATOM   3572 N  N     . LEU B 1 209 ? -15.432 50.224 14.217  1.00 99.34  ? 206 LEU B N     1 
ATOM   3573 C  CA    . LEU B 1 209 ? -15.122 49.121 15.121  1.00 99.27  ? 206 LEU B CA    1 
ATOM   3574 C  C     . LEU B 1 209 ? -15.111 49.585 16.570  1.00 101.53 ? 206 LEU B C     1 
ATOM   3575 O  O     . LEU B 1 209 ? -14.626 50.675 16.874  1.00 103.39 ? 206 LEU B O     1 
ATOM   3576 C  CB    . LEU B 1 209 ? -13.787 48.472 14.756  1.00 98.86  ? 206 LEU B CB    1 
ATOM   3577 C  CG    . LEU B 1 209 ? -13.771 47.572 13.520  1.00 96.62  ? 206 LEU B CG    1 
ATOM   3578 C  CD1   . LEU B 1 209 ? -12.453 46.855 13.429  1.00 96.34  ? 206 LEU B CD1   1 
ATOM   3579 C  CD2   . LEU B 1 209 ? -14.898 46.553 13.564  1.00 95.27  ? 206 LEU B CD2   1 
ATOM   3580 N  N     . GLU B 1 210 ? -15.654 48.755 17.457  1.00 101.82 ? 207 GLU B N     1 
ATOM   3581 C  CA    . GLU B 1 210 ? -15.759 49.086 18.875  1.00 104.06 ? 207 GLU B CA    1 
ATOM   3582 C  C     . GLU B 1 210 ? -15.435 47.862 19.713  1.00 104.38 ? 207 GLU B C     1 
ATOM   3583 O  O     . GLU B 1 210 ? -15.985 46.780 19.488  1.00 102.78 ? 207 GLU B O     1 
ATOM   3584 C  CB    . GLU B 1 210 ? -17.158 49.605 19.190  1.00 104.27 ? 207 GLU B CB    1 
ATOM   3585 C  CG    . GLU B 1 210 ? -17.497 49.685 20.666  1.00 106.73 ? 207 GLU B CG    1 
ATOM   3586 C  CD    . GLU B 1 210 ? -18.980 49.895 20.904  1.00 107.79 ? 207 GLU B CD    1 
ATOM   3587 O  OE1   . GLU B 1 210 ? -19.531 50.887 20.377  1.00 108.65 ? 207 GLU B OE1   1 
ATOM   3588 O  OE2   . GLU B 1 210 ? -19.597 49.072 21.617  1.00 107.92 ? 207 GLU B OE2   1 
ATOM   3589 N  N     . PHE B 1 211 ? -14.542 48.047 20.682  1.00 106.86 ? 208 PHE B N     1 
ATOM   3590 C  CA    . PHE B 1 211 ? -14.009 46.935 21.460  1.00 107.90 ? 208 PHE B CA    1 
ATOM   3591 C  C     . PHE B 1 211 ? -14.336 47.029 22.937  1.00 110.45 ? 208 PHE B C     1 
ATOM   3592 O  O     . PHE B 1 211 ? -14.222 48.093 23.535  1.00 112.43 ? 208 PHE B O     1 
ATOM   3593 C  CB    . PHE B 1 211 ? -12.492 46.844 21.277  1.00 108.55 ? 208 PHE B CB    1 
ATOM   3594 C  CG    . PHE B 1 211 ? -12.066 46.547 19.861  1.00 107.10 ? 208 PHE B CG    1 
ATOM   3595 C  CD1   . PHE B 1 211 ? -12.284 45.283 19.301  1.00 105.39 ? 208 PHE B CD1   1 
ATOM   3596 C  CD2   . PHE B 1 211 ? -11.447 47.522 19.088  1.00 107.62 ? 208 PHE B CD2   1 
ATOM   3597 C  CE1   . PHE B 1 211 ? -11.901 44.998 17.993  1.00 103.42 ? 208 PHE B CE1   1 
ATOM   3598 C  CE2   . PHE B 1 211 ? -11.055 47.244 17.780  1.00 106.40 ? 208 PHE B CE2   1 
ATOM   3599 C  CZ    . PHE B 1 211 ? -11.285 45.976 17.233  1.00 104.48 ? 208 PHE B CZ    1 
ATOM   3600 N  N     . SER B 1 212 ? -14.745 45.905 23.517  1.00 111.16 ? 209 SER B N     1 
ATOM   3601 C  CA    . SER B 1 212 ? -14.927 45.798 24.963  1.00 114.42 ? 209 SER B CA    1 
ATOM   3602 C  C     . SER B 1 212 ? -13.560 45.710 25.659  1.00 117.26 ? 209 SER B C     1 
ATOM   3603 O  O     . SER B 1 212 ? -12.566 45.352 25.028  1.00 116.67 ? 209 SER B O     1 
ATOM   3604 C  CB    . SER B 1 212 ? -15.816 44.589 25.312  1.00 113.68 ? 209 SER B CB    1 
ATOM   3605 O  OG    . SER B 1 212 ? -15.252 43.352 24.897  1.00 112.00 ? 209 SER B OG    1 
ATOM   3606 N  N     . THR B 1 213 ? -13.510 46.053 26.946  1.00 120.96 ? 210 THR B N     1 
ATOM   3607 C  CA    . THR B 1 213 ? -12.281 45.941 27.742  1.00 124.33 ? 210 THR B CA    1 
ATOM   3608 C  C     . THR B 1 213 ? -11.806 44.483 27.762  1.00 124.33 ? 210 THR B C     1 
ATOM   3609 O  O     . THR B 1 213 ? -12.633 43.570 27.673  1.00 123.05 ? 210 THR B O     1 
ATOM   3610 C  CB    . THR B 1 213 ? -12.524 46.389 29.200  1.00 127.49 ? 210 THR B CB    1 
ATOM   3611 O  OG1   . THR B 1 213 ? -13.514 47.420 29.227  1.00 128.81 ? 210 THR B OG1   1 
ATOM   3612 C  CG2   . THR B 1 213 ? -11.253 46.911 29.845  1.00 130.26 ? 210 THR B CG2   1 
ATOM   3613 N  N     . PRO B 1 214 ? -10.477 44.255 27.848  1.00 126.18 ? 211 PRO B N     1 
ATOM   3614 C  CA    . PRO B 1 214 ? -10.013 42.882 28.061  1.00 126.75 ? 211 PRO B CA    1 
ATOM   3615 C  C     . PRO B 1 214 ? -10.513 42.339 29.400  1.00 129.48 ? 211 PRO B C     1 
ATOM   3616 O  O     . PRO B 1 214 ? -10.445 43.039 30.422  1.00 132.15 ? 211 PRO B O     1 
ATOM   3617 C  CB    . PRO B 1 214 ? -8.484  43.022 28.088  1.00 128.11 ? 211 PRO B CB    1 
ATOM   3618 C  CG    . PRO B 1 214 ? -8.199  44.242 27.317  1.00 127.41 ? 211 PRO B CG    1 
ATOM   3619 C  CD    . PRO B 1 214 ? -9.355  45.173 27.570  1.00 127.35 ? 211 PRO B CD    1 
ATOM   3620 N  N     . TYR B 1 215 ? -11.024 41.103 29.374  1.00 129.32 ? 212 TYR B N     1 
ATOM   3621 C  CA    . TYR B 1 215 ? -11.506 40.390 30.575  1.00 131.96 ? 212 TYR B CA    1 
ATOM   3622 C  C     . TYR B 1 215 ? -12.927 40.784 31.023  1.00 132.68 ? 212 TYR B C     1 
ATOM   3623 O  O     . TYR B 1 215 ? -13.701 39.915 31.428  1.00 133.05 ? 212 TYR B O     1 
ATOM   3624 C  CB    . TYR B 1 215 ? -10.492 40.427 31.760  1.00 135.11 ? 212 TYR B CB    1 
ATOM   3625 C  CG    . TYR B 1 215 ? -9.126  39.820 31.414  1.00 135.24 ? 212 TYR B CG    1 
ATOM   3626 C  CD1   . TYR B 1 215 ? -8.945  38.434 31.350  1.00 135.04 ? 212 TYR B CD1   1 
ATOM   3627 C  CD2   . TYR B 1 215 ? -8.031  40.640 31.092  1.00 135.87 ? 212 TYR B CD2   1 
ATOM   3628 C  CE1   . TYR B 1 215 ? -7.700  37.876 30.928  1.00 136.03 ? 212 TYR B CE1   1 
ATOM   3629 C  CE2   . TYR B 1 215 ? -6.776  40.097 30.617  1.00 136.68 ? 212 TYR B CE2   1 
ATOM   3630 C  CZ    . TYR B 1 215 ? -6.612  38.713 30.532  1.00 136.85 ? 212 TYR B CZ    1 
ATOM   3631 O  OH    . TYR B 1 215 ? -5.371  38.175 30.095  1.00 137.63 ? 212 TYR B OH    1 
ATOM   3632 N  N     . HIS B 1 216 ? -13.268 42.074 30.938  1.00 133.51 ? 213 HIS B N     1 
ATOM   3633 C  CA    . HIS B 1 216 ? -14.617 42.573 31.284  1.00 134.47 ? 213 HIS B CA    1 
ATOM   3634 C  C     . HIS B 1 216 ? -15.511 42.761 30.034  1.00 131.52 ? 213 HIS B C     1 
ATOM   3635 O  O     . HIS B 1 216 ? -15.771 43.901 29.624  1.00 131.18 ? 213 HIS B O     1 
ATOM   3636 C  CB    . HIS B 1 216 ? -14.526 43.888 32.090  1.00 137.27 ? 213 HIS B CB    1 
ATOM   3637 C  CG    . HIS B 1 216 ? -14.147 43.703 33.533  1.00 141.84 ? 213 HIS B CG    1 
ATOM   3638 N  ND1   . HIS B 1 216 ? -12.840 43.539 33.949  1.00 144.25 ? 213 HIS B ND1   1 
ATOM   3639 C  CD2   . HIS B 1 216 ? -14.904 43.672 34.658  1.00 144.69 ? 213 HIS B CD2   1 
ATOM   3640 C  CE1   . HIS B 1 216 ? -12.809 43.408 35.265  1.00 147.34 ? 213 HIS B CE1   1 
ATOM   3641 N  NE2   . HIS B 1 216 ? -14.048 43.485 35.719  1.00 148.04 ? 213 HIS B NE2   1 
ATOM   3642 N  N     . PRO B 1 217 ? -16.005 41.648 29.438  1.00 129.71 ? 214 PRO B N     1 
ATOM   3643 C  CA    . PRO B 1 217 ? -16.647 41.762 28.129  1.00 127.04 ? 214 PRO B CA    1 
ATOM   3644 C  C     . PRO B 1 217 ? -18.130 42.147 28.246  1.00 127.03 ? 214 PRO B C     1 
ATOM   3645 O  O     . PRO B 1 217 ? -18.952 41.317 28.650  1.00 127.55 ? 214 PRO B O     1 
ATOM   3646 C  CB    . PRO B 1 217 ? -16.483 40.349 27.540  1.00 125.50 ? 214 PRO B CB    1 
ATOM   3647 C  CG    . PRO B 1 217 ? -16.161 39.436 28.743  1.00 127.62 ? 214 PRO B CG    1 
ATOM   3648 C  CD    . PRO B 1 217 ? -16.180 40.290 29.982  1.00 130.24 ? 214 PRO B CD    1 
ATOM   3649 N  N     . GLN B 1 218 ? -18.462 43.395 27.909  1.00 126.73 ? 215 GLN B N     1 
ATOM   3650 C  CA    . GLN B 1 218 ? -19.846 43.878 28.033  1.00 126.74 ? 215 GLN B CA    1 
ATOM   3651 C  C     . GLN B 1 218 ? -20.601 43.980 26.695  1.00 123.46 ? 215 GLN B C     1 
ATOM   3652 O  O     . GLN B 1 218 ? -20.057 44.430 25.684  1.00 122.04 ? 215 GLN B O     1 
ATOM   3653 C  CB    . GLN B 1 218 ? -19.934 45.192 28.853  1.00 129.46 ? 215 GLN B CB    1 
ATOM   3654 C  CG    . GLN B 1 218 ? -19.069 46.378 28.359  1.00 131.40 ? 215 GLN B CG    1 
ATOM   3655 C  CD    . GLN B 1 218 ? -19.684 47.168 27.184  1.00 132.06 ? 215 GLN B CD    1 
ATOM   3656 O  OE1   . GLN B 1 218 ? -20.889 47.081 26.905  1.00 132.36 ? 215 GLN B OE1   1 
ATOM   3657 N  NE2   . GLN B 1 218 ? -18.842 47.942 26.492  1.00 132.19 ? 215 GLN B NE2   1 
ATOM   3658 N  N     . SER B 1 219 ? -21.854 43.532 26.712  1.00 122.25 ? 216 SER B N     1 
ATOM   3659 C  CA    . SER B 1 219 ? -22.778 43.712 25.604  1.00 119.44 ? 216 SER B CA    1 
ATOM   3660 C  C     . SER B 1 219 ? -23.947 44.555 26.091  1.00 120.27 ? 216 SER B C     1 
ATOM   3661 O  O     . SER B 1 219 ? -23.879 45.196 27.143  1.00 122.76 ? 216 SER B O     1 
ATOM   3662 C  CB    . SER B 1 219 ? -23.319 42.361 25.135  1.00 117.99 ? 216 SER B CB    1 
ATOM   3663 O  OG    . SER B 1 219 ? -22.313 41.370 25.099  1.00 117.92 ? 216 SER B OG    1 
ATOM   3664 N  N     . SER B 1 220 ? -25.023 44.545 25.311  1.00 118.25 ? 217 SER B N     1 
ATOM   3665 C  CA    . SER B 1 220 ? -26.322 45.047 25.731  1.00 118.59 ? 217 SER B CA    1 
ATOM   3666 C  C     . SER B 1 220 ? -26.904 44.052 26.750  1.00 119.37 ? 217 SER B C     1 
ATOM   3667 O  O     . SER B 1 220 ? -26.530 42.874 26.762  1.00 118.68 ? 217 SER B O     1 
ATOM   3668 C  CB    . SER B 1 220 ? -27.221 45.147 24.486  1.00 116.83 ? 217 SER B CB    1 
ATOM   3669 O  OG    . SER B 1 220 ? -28.369 45.951 24.677  1.00 118.14 ? 217 SER B OG    1 
ATOM   3670 N  N     . GLY B 1 221 ? -27.799 44.525 27.617  1.00 120.76 ? 218 GLY B N     1 
ATOM   3671 C  CA    . GLY B 1 221 ? -28.543 43.633 28.505  1.00 121.21 ? 218 GLY B CA    1 
ATOM   3672 C  C     . GLY B 1 221 ? -29.211 42.543 27.685  1.00 118.62 ? 218 GLY B C     1 
ATOM   3673 O  O     . GLY B 1 221 ? -29.084 41.358 27.988  1.00 118.89 ? 218 GLY B O     1 
ATOM   3674 N  N     . LYS B 1 222 ? -29.891 42.966 26.620  1.00 116.10 ? 219 LYS B N     1 
ATOM   3675 C  CA    . LYS B 1 222 ? -30.610 42.090 25.692  1.00 113.45 ? 219 LYS B CA    1 
ATOM   3676 C  C     . LYS B 1 222 ? -29.720 41.129 24.898  1.00 110.70 ? 219 LYS B C     1 
ATOM   3677 O  O     . LYS B 1 222 ? -30.118 40.001 24.617  1.00 110.02 ? 219 LYS B O     1 
ATOM   3678 C  CB    . LYS B 1 222 ? -31.439 42.950 24.738  1.00 112.56 ? 219 LYS B CB    1 
ATOM   3679 C  CG    . LYS B 1 222 ? -32.325 42.192 23.778  1.00 111.49 ? 219 LYS B CG    1 
ATOM   3680 C  CD    . LYS B 1 222 ? -33.062 43.174 22.897  1.00 111.83 ? 219 LYS B CD    1 
ATOM   3681 C  CE    . LYS B 1 222 ? -33.765 42.469 21.761  1.00 111.50 ? 219 LYS B CE    1 
ATOM   3682 N  NZ    . LYS B 1 222 ? -34.967 41.713 22.224  1.00 114.03 ? 219 LYS B NZ    1 
ATOM   3683 N  N     . VAL B 1 223 ? -28.530 41.584 24.525  1.00 109.00 ? 220 VAL B N     1 
ATOM   3684 C  CA    . VAL B 1 223 ? -27.589 40.750 23.776  1.00 106.90 ? 220 VAL B CA    1 
ATOM   3685 C  C     . VAL B 1 223 ? -27.017 39.641 24.669  1.00 108.07 ? 220 VAL B C     1 
ATOM   3686 O  O     . VAL B 1 223 ? -26.971 38.476 24.255  1.00 107.44 ? 220 VAL B O     1 
ATOM   3687 C  CB    . VAL B 1 223 ? -26.455 41.591 23.118  1.00 105.64 ? 220 VAL B CB    1 
ATOM   3688 C  CG1   . VAL B 1 223 ? -25.371 40.700 22.505  1.00 103.89 ? 220 VAL B CG1   1 
ATOM   3689 C  CG2   . VAL B 1 223 ? -27.033 42.510 22.068  1.00 104.13 ? 220 VAL B CG2   1 
ATOM   3690 N  N     . GLU B 1 224 ? -26.594 40.005 25.887  1.00 109.74 ? 221 GLU B N     1 
ATOM   3691 C  CA    . GLU B 1 224 ? -26.110 39.030 26.869  1.00 110.71 ? 221 GLU B CA    1 
ATOM   3692 C  C     . GLU B 1 224 ? -27.169 37.936 27.028  1.00 111.15 ? 221 GLU B C     1 
ATOM   3693 O  O     . GLU B 1 224 ? -26.853 36.751 26.866  1.00 110.86 ? 221 GLU B O     1 
ATOM   3694 C  CB    . GLU B 1 224 ? -25.747 39.695 28.205  1.00 112.78 ? 221 GLU B CB    1 
ATOM   3695 N  N     . ARG B 1 225 ? -28.424 38.341 27.284  1.00 111.79 ? 222 ARG B N     1 
ATOM   3696 C  CA    . ARG B 1 225 ? -29.562 37.405 27.355  1.00 112.33 ? 222 ARG B CA    1 
ATOM   3697 C  C     . ARG B 1 225 ? -29.551 36.485 26.121  1.00 110.29 ? 222 ARG B C     1 
ATOM   3698 O  O     . ARG B 1 225 ? -29.493 35.264 26.260  1.00 110.77 ? 222 ARG B O     1 
ATOM   3699 C  CB    . ARG B 1 225 ? -30.933 38.127 27.515  1.00 113.18 ? 222 ARG B CB    1 
ATOM   3700 C  CG    . ARG B 1 225 ? -31.204 38.905 28.865  1.00 115.64 ? 222 ARG B CG    1 
ATOM   3701 C  CD    . ARG B 1 225 ? -32.708 39.345 29.087  1.00 116.55 ? 222 ARG B CD    1 
ATOM   3702 N  NE    . ARG B 1 225 ? -33.275 40.219 28.029  1.00 116.64 ? 222 ARG B NE    1 
ATOM   3703 C  CZ    . ARG B 1 225 ? -34.319 39.927 27.218  1.00 115.46 ? 222 ARG B CZ    1 
ATOM   3704 N  NH1   . ARG B 1 225 ? -34.972 38.777 27.319  1.00 116.58 ? 222 ARG B NH1   1 
ATOM   3705 N  NH2   . ARG B 1 225 ? -34.726 40.797 26.293  1.00 112.46 ? 222 ARG B NH2   1 
ATOM   3706 N  N     . LYS B 1 226 ? -29.546 37.081 24.926  1.00 108.25 ? 223 LYS B N     1 
ATOM   3707 C  CA    . LYS B 1 226 ? -29.639 36.335 23.655  1.00 106.49 ? 223 LYS B CA    1 
ATOM   3708 C  C     . LYS B 1 226 ? -28.465 35.413 23.401  1.00 106.07 ? 223 LYS B C     1 
ATOM   3709 O  O     . LYS B 1 226 ? -28.647 34.267 23.007  1.00 105.86 ? 223 LYS B O     1 
ATOM   3710 C  CB    . LYS B 1 226 ? -29.795 37.281 22.457  1.00 104.39 ? 223 LYS B CB    1 
ATOM   3711 C  CG    . LYS B 1 226 ? -30.279 36.598 21.184  1.00 102.75 ? 223 LYS B CG    1 
ATOM   3712 C  CD    . LYS B 1 226 ? -31.714 36.100 21.363  1.00 105.12 ? 223 LYS B CD    1 
ATOM   3713 C  CE    . LYS B 1 226 ? -32.207 35.295 20.173  1.00 105.29 ? 223 LYS B CE    1 
ATOM   3714 N  NZ    . LYS B 1 226 ? -32.592 36.144 19.002  1.00 104.14 ? 223 LYS B NZ    1 
ATOM   3715 N  N     . ASN B 1 227 ? -27.264 35.934 23.621  1.00 106.29 ? 224 ASN B N     1 
ATOM   3716 C  CA    . ASN B 1 227 ? -26.035 35.200 23.352  1.00 106.35 ? 224 ASN B CA    1 
ATOM   3717 C  C     . ASN B 1 227 ? -25.892 34.000 24.287  1.00 108.43 ? 224 ASN B C     1 
ATOM   3718 O  O     . ASN B 1 227 ? -25.206 33.025 23.966  1.00 108.41 ? 224 ASN B O     1 
ATOM   3719 C  CB    . ASN B 1 227 ? -24.826 36.134 23.457  1.00 106.02 ? 224 ASN B CB    1 
ATOM   3720 C  CG    . ASN B 1 227 ? -23.765 35.829 22.419  1.00 105.38 ? 224 ASN B CG    1 
ATOM   3721 O  OD1   . ASN B 1 227 ? -23.093 34.800 22.491  1.00 106.60 ? 224 ASN B OD1   1 
ATOM   3722 N  ND2   . ASN B 1 227 ? -23.607 36.728 21.443  1.00 104.56 ? 224 ASN B ND2   1 
ATOM   3723 N  N     . SER B 1 228 ? -26.562 34.080 25.436  1.00 110.53 ? 225 SER B N     1 
ATOM   3724 C  CA    . SER B 1 228 ? -26.642 32.969 26.373  1.00 112.69 ? 225 SER B CA    1 
ATOM   3725 C  C     . SER B 1 228 ? -27.593 31.892 25.851  1.00 112.99 ? 225 SER B C     1 
ATOM   3726 O  O     . SER B 1 228 ? -27.268 30.703 25.885  1.00 113.65 ? 225 SER B O     1 
ATOM   3727 C  CB    . SER B 1 228 ? -27.098 33.471 27.735  1.00 114.88 ? 225 SER B CB    1 
ATOM   3728 O  OG    . SER B 1 228 ? -27.030 32.442 28.697  1.00 117.41 ? 225 SER B OG    1 
ATOM   3729 N  N     . ASP B 1 229 ? -28.755 32.324 25.356  1.00 112.66 ? 226 ASP B N     1 
ATOM   3730 C  CA    . ASP B 1 229 ? -29.749 31.427 24.756  1.00 113.20 ? 226 ASP B CA    1 
ATOM   3731 C  C     . ASP B 1 229 ? -29.141 30.551 23.673  1.00 112.01 ? 226 ASP B C     1 
ATOM   3732 O  O     . ASP B 1 229 ? -29.441 29.362 23.589  1.00 113.17 ? 226 ASP B O     1 
ATOM   3733 C  CB    . ASP B 1 229 ? -30.901 32.215 24.133  1.00 112.39 ? 226 ASP B CB    1 
ATOM   3734 C  CG    . ASP B 1 229 ? -31.684 33.030 25.147  1.00 115.28 ? 226 ASP B CG    1 
ATOM   3735 O  OD1   . ASP B 1 229 ? -31.906 32.564 26.291  1.00 118.65 ? 226 ASP B OD1   1 
ATOM   3736 O  OD2   . ASP B 1 229 ? -32.108 34.148 24.780  1.00 116.34 ? 226 ASP B OD2   1 
ATOM   3737 N  N     . ILE B 1 230 ? -28.291 31.151 22.844  1.00 110.08 ? 227 ILE B N     1 
ATOM   3738 C  CA    . ILE B 1 230 ? -27.686 30.455 21.712  1.00 108.93 ? 227 ILE B CA    1 
ATOM   3739 C  C     . ILE B 1 230 ? -26.858 29.260 22.171  1.00 110.47 ? 227 ILE B C     1 
ATOM   3740 O  O     . ILE B 1 230 ? -27.102 28.133 21.725  1.00 111.19 ? 227 ILE B O     1 
ATOM   3741 C  CB    . ILE B 1 230 ? -26.815 31.392 20.856  1.00 106.66 ? 227 ILE B CB    1 
ATOM   3742 C  CG1   . ILE B 1 230 ? -27.660 32.533 20.294  1.00 105.43 ? 227 ILE B CG1   1 
ATOM   3743 C  CG2   . ILE B 1 230 ? -26.161 30.613 19.722  1.00 105.83 ? 227 ILE B CG2   1 
ATOM   3744 C  CD1   . ILE B 1 230 ? -26.849 33.654 19.688  1.00 104.31 ? 227 ILE B CD1   1 
ATOM   3745 N  N     . LYS B 1 231 ? -25.897 29.513 23.066  1.00 111.17 ? 228 LYS B N     1 
ATOM   3746 C  CA    . LYS B 1 231 ? -24.984 28.474 23.559  1.00 112.55 ? 228 LYS B CA    1 
ATOM   3747 C  C     . LYS B 1 231 ? -25.757 27.308 24.199  1.00 114.92 ? 228 LYS B C     1 
ATOM   3748 O  O     . LYS B 1 231 ? -25.463 26.138 23.933  1.00 115.66 ? 228 LYS B O     1 
ATOM   3749 C  CB    . LYS B 1 231 ? -23.934 29.065 24.512  1.00 112.87 ? 228 LYS B CB    1 
ATOM   3750 N  N     . ARG B 1 232 ? -26.766 27.628 25.005  1.00 116.06 ? 229 ARG B N     1 
ATOM   3751 C  CA    . ARG B 1 232 ? -27.597 26.589 25.593  1.00 118.73 ? 229 ARG B CA    1 
ATOM   3752 C  C     . ARG B 1 232 ? -28.397 25.830 24.540  1.00 118.29 ? 229 ARG B C     1 
ATOM   3753 O  O     . ARG B 1 232 ? -28.498 24.603 24.608  1.00 120.23 ? 229 ARG B O     1 
ATOM   3754 C  CB    . ARG B 1 232 ? -28.508 27.144 26.689  1.00 120.47 ? 229 ARG B CB    1 
ATOM   3755 C  CG    . ARG B 1 232 ? -27.899 27.052 28.092  1.00 123.80 ? 229 ARG B CG    1 
ATOM   3756 C  CD    . ARG B 1 232 ? -28.964 27.009 29.181  1.00 127.81 ? 229 ARG B CD    1 
ATOM   3757 N  NE    . ARG B 1 232 ? -29.882 28.146 29.094  1.00 128.09 ? 229 ARG B NE    1 
ATOM   3758 C  CZ    . ARG B 1 232 ? -31.100 28.175 29.630  1.00 130.58 ? 229 ARG B CZ    1 
ATOM   3759 N  NH1   . ARG B 1 232 ? -31.572 27.127 30.295  1.00 134.00 ? 229 ARG B NH1   1 
ATOM   3760 N  NH2   . ARG B 1 232 ? -31.857 29.255 29.496  1.00 129.84 ? 229 ARG B NH2   1 
ATOM   3761 N  N     . LEU B 1 233 ? -28.949 26.549 23.564  1.00 116.06 ? 230 LEU B N     1 
ATOM   3762 C  CA    . LEU B 1 233 ? -29.707 25.908 22.488  1.00 115.65 ? 230 LEU B CA    1 
ATOM   3763 C  C     . LEU B 1 233 ? -28.793 25.028 21.651  1.00 115.57 ? 230 LEU B C     1 
ATOM   3764 O  O     . LEU B 1 233 ? -29.172 23.918 21.278  1.00 116.99 ? 230 LEU B O     1 
ATOM   3765 C  CB    . LEU B 1 233 ? -30.436 26.935 21.610  1.00 113.31 ? 230 LEU B CB    1 
ATOM   3766 C  CG    . LEU B 1 233 ? -31.410 26.450 20.522  1.00 112.44 ? 230 LEU B CG    1 
ATOM   3767 C  CD1   . LEU B 1 233 ? -32.261 25.249 20.930  1.00 114.45 ? 230 LEU B CD1   1 
ATOM   3768 C  CD2   . LEU B 1 233 ? -32.306 27.580 20.093  1.00 110.19 ? 230 LEU B CD2   1 
ATOM   3769 N  N     . LEU B 1 234 ? -27.587 25.525 21.377  1.00 114.27 ? 231 LEU B N     1 
ATOM   3770 C  CA    . LEU B 1 234 ? -26.576 24.752 20.660  1.00 114.38 ? 231 LEU B CA    1 
ATOM   3771 C  C     . LEU B 1 234 ? -26.213 23.458 21.379  1.00 117.29 ? 231 LEU B C     1 
ATOM   3772 O  O     . LEU B 1 234 ? -26.121 22.414 20.732  1.00 118.30 ? 231 LEU B O     1 
ATOM   3773 C  CB    . LEU B 1 234 ? -25.314 25.580 20.394  1.00 112.36 ? 231 LEU B CB    1 
ATOM   3774 C  CG    . LEU B 1 234 ? -25.284 26.461 19.141  1.00 109.63 ? 231 LEU B CG    1 
ATOM   3775 C  CD1   . LEU B 1 234 ? -23.940 27.150 19.029  1.00 108.10 ? 231 LEU B CD1   1 
ATOM   3776 C  CD2   . LEU B 1 234 ? -25.574 25.667 17.872  1.00 108.97 ? 231 LEU B CD2   1 
ATOM   3777 N  N     . THR B 1 235 ? -26.025 23.528 22.701  1.00 118.98 ? 232 THR B N     1 
ATOM   3778 C  CA    . THR B 1 235 ? -25.660 22.355 23.507  1.00 122.04 ? 232 THR B CA    1 
ATOM   3779 C  C     . THR B 1 235 ? -26.775 21.318 23.533  1.00 124.63 ? 232 THR B C     1 
ATOM   3780 O  O     . THR B 1 235 ? -26.519 20.130 23.333  1.00 126.33 ? 232 THR B O     1 
ATOM   3781 C  CB    . THR B 1 235 ? -25.269 22.731 24.958  1.00 123.26 ? 232 THR B CB    1 
ATOM   3782 O  OG1   . THR B 1 235 ? -24.161 23.631 24.934  1.00 121.62 ? 232 THR B OG1   1 
ATOM   3783 C  CG2   . THR B 1 235 ? -24.863 21.498 25.759  1.00 125.99 ? 232 THR B CG2   1 
ATOM   3784 N  N     . LYS B 1 236 ? -28.004 21.769 23.774  1.00 125.39 ? 233 LYS B N     1 
ATOM   3785 C  CA    . LYS B 1 236 ? -29.151 20.865 23.829  1.00 128.48 ? 233 LYS B CA    1 
ATOM   3786 C  C     . LYS B 1 236 ? -29.258 20.046 22.539  1.00 129.00 ? 233 LYS B C     1 
ATOM   3787 O  O     . LYS B 1 236 ? -29.549 18.849 22.576  1.00 131.62 ? 233 LYS B O     1 
ATOM   3788 C  CB    . LYS B 1 236 ? -30.452 21.629 24.115  1.00 128.07 ? 233 LYS B CB    1 
ATOM   3789 N  N     . LEU B 1 237 ? -28.978 20.687 21.406  1.00 127.14 ? 234 LEU B N     1 
ATOM   3790 C  CA    . LEU B 1 237 ? -29.118 20.030 20.103  1.00 127.75 ? 234 LEU B CA    1 
ATOM   3791 C  C     . LEU B 1 237 ? -27.821 19.413 19.544  1.00 127.98 ? 234 LEU B C     1 
ATOM   3792 O  O     . LEU B 1 237 ? -27.875 18.571 18.649  1.00 129.16 ? 234 LEU B O     1 
ATOM   3793 C  CB    . LEU B 1 237 ? -29.839 20.942 19.088  1.00 125.57 ? 234 LEU B CB    1 
ATOM   3794 C  CG    . LEU B 1 237 ? -31.333 21.230 19.394  1.00 126.61 ? 234 LEU B CG    1 
ATOM   3795 C  CD1   . LEU B 1 237 ? -31.972 22.152 18.342  1.00 124.16 ? 234 LEU B CD1   1 
ATOM   3796 C  CD2   . LEU B 1 237 ? -32.184 19.946 19.585  1.00 129.43 ? 234 LEU B CD2   1 
ATOM   3797 N  N     . LEU B 1 238 ? -26.670 19.826 20.078  1.00 127.46 ? 235 LEU B N     1 
ATOM   3798 C  CA    . LEU B 1 238 ? -25.402 19.115 19.845  1.00 128.26 ? 235 LEU B CA    1 
ATOM   3799 C  C     . LEU B 1 238 ? -25.470 17.682 20.390  1.00 131.78 ? 235 LEU B C     1 
ATOM   3800 O  O     . LEU B 1 238 ? -25.325 16.727 19.631  1.00 133.18 ? 235 LEU B O     1 
ATOM   3801 C  CB    . LEU B 1 238 ? -24.211 19.857 20.469  1.00 127.15 ? 235 LEU B CB    1 
ATOM   3802 C  CG    . LEU B 1 238 ? -23.335 20.745 19.580  1.00 124.41 ? 235 LEU B CG    1 
ATOM   3803 C  CD1   . LEU B 1 238 ? -22.620 21.816 20.406  1.00 122.90 ? 235 LEU B CD1   1 
ATOM   3804 C  CD2   . LEU B 1 238 ? -22.332 19.899 18.806  1.00 125.30 ? 235 LEU B CD2   1 
ATOM   3805 N  N     . VAL B 1 239 ? -25.698 17.539 21.697  1.00 133.48 ? 236 VAL B N     1 
ATOM   3806 C  CA    . VAL B 1 239 ? -25.862 16.220 22.330  1.00 136.95 ? 236 VAL B CA    1 
ATOM   3807 C  C     . VAL B 1 239 ? -26.840 15.330 21.545  1.00 138.44 ? 236 VAL B C     1 
ATOM   3808 O  O     . VAL B 1 239 ? -27.946 15.761 21.194  1.00 137.76 ? 236 VAL B O     1 
ATOM   3809 C  CB    . VAL B 1 239 ? -26.300 16.351 23.814  1.00 138.66 ? 236 VAL B CB    1 
ATOM   3810 C  CG1   . VAL B 1 239 ? -26.941 15.062 24.325  1.00 142.36 ? 236 VAL B CG1   1 
ATOM   3811 C  CG2   . VAL B 1 239 ? -25.113 16.748 24.678  1.00 138.29 ? 236 VAL B CG2   1 
ATOM   3812 N  N     . GLY B 1 240 ? -26.412 14.102 21.257  1.00 140.50 ? 237 GLY B N     1 
ATOM   3813 C  CA    . GLY B 1 240 ? -27.207 13.185 20.450  1.00 141.87 ? 237 GLY B CA    1 
ATOM   3814 C  C     . GLY B 1 240 ? -26.764 13.162 19.000  1.00 140.02 ? 237 GLY B C     1 
ATOM   3815 O  O     . GLY B 1 240 ? -26.652 12.091 18.406  1.00 142.23 ? 237 GLY B O     1 
ATOM   3816 N  N     . ARG B 1 241 ? -26.524 14.342 18.427  1.00 136.20 ? 238 ARG B N     1 
ATOM   3817 C  CA    . ARG B 1 241 ? -26.005 14.463 17.050  1.00 134.41 ? 238 ARG B CA    1 
ATOM   3818 C  C     . ARG B 1 241 ? -24.846 15.484 16.937  1.00 131.16 ? 238 ARG B C     1 
ATOM   3819 O  O     . ARG B 1 241 ? -24.953 16.488 16.209  1.00 128.35 ? 238 ARG B O     1 
ATOM   3820 C  CB    . ARG B 1 241 ? -27.144 14.732 16.034  1.00 133.66 ? 238 ARG B CB    1 
ATOM   3821 C  CG    . ARG B 1 241 ? -27.874 16.082 16.160  1.00 130.84 ? 238 ARG B CG    1 
ATOM   3822 C  CD    . ARG B 1 241 ? -29.314 16.015 15.638  1.00 131.55 ? 238 ARG B CD    1 
ATOM   3823 N  NE    . ARG B 1 241 ? -30.224 15.497 16.661  1.00 134.60 ? 238 ARG B NE    1 
ATOM   3824 C  CZ    . ARG B 1 241 ? -31.065 16.231 17.393  1.00 133.86 ? 238 ARG B CZ    1 
ATOM   3825 N  NH1   . ARG B 1 241 ? -31.159 17.543 17.218  1.00 130.43 ? 238 ARG B NH1   1 
ATOM   3826 N  NH2   . ARG B 1 241 ? -31.830 15.639 18.302  1.00 136.41 ? 238 ARG B NH2   1 
ATOM   3827 N  N     . PRO B 1 242 ? -23.721 15.217 17.647  1.00 131.56 ? 239 PRO B N     1 
ATOM   3828 C  CA    . PRO B 1 242 ? -22.653 16.221 17.781  1.00 128.76 ? 239 PRO B CA    1 
ATOM   3829 C  C     . PRO B 1 242 ? -21.889 16.406 16.476  1.00 126.92 ? 239 PRO B C     1 
ATOM   3830 O  O     . PRO B 1 242 ? -21.284 17.454 16.238  1.00 124.49 ? 239 PRO B O     1 
ATOM   3831 C  CB    . PRO B 1 242 ? -21.733 15.630 18.859  1.00 130.78 ? 239 PRO B CB    1 
ATOM   3832 C  CG    . PRO B 1 242 ? -22.222 14.224 19.118  1.00 134.51 ? 239 PRO B CG    1 
ATOM   3833 C  CD    . PRO B 1 242 ? -23.286 13.893 18.128  1.00 134.88 ? 239 PRO B CD    1 
ATOM   3834 N  N     . THR B 1 243 ? -21.942 15.370 15.648  1.00 128.19 ? 240 THR B N     1 
ATOM   3835 C  CA    . THR B 1 243 ? -21.298 15.333 14.349  1.00 126.68 ? 240 THR B CA    1 
ATOM   3836 C  C     . THR B 1 243 ? -22.135 16.032 13.267  1.00 124.09 ? 240 THR B C     1 
ATOM   3837 O  O     . THR B 1 243 ? -21.613 16.348 12.200  1.00 122.90 ? 240 THR B O     1 
ATOM   3838 C  CB    . THR B 1 243 ? -20.979 13.856 13.947  1.00 130.17 ? 240 THR B CB    1 
ATOM   3839 O  OG1   . THR B 1 243 ? -20.871 13.748 12.524  1.00 130.03 ? 240 THR B OG1   1 
ATOM   3840 C  CG2   . THR B 1 243 ? -22.065 12.877 14.455  1.00 132.95 ? 240 THR B CG2   1 
ATOM   3841 N  N     . LYS B 1 244 ? -23.415 16.289 13.550  1.00 122.97 ? 241 LYS B N     1 
ATOM   3842 C  CA    . LYS B 1 244 ? -24.361 16.750 12.522  1.00 121.06 ? 241 LYS B CA    1 
ATOM   3843 C  C     . LYS B 1 244 ? -25.009 18.120 12.772  1.00 117.78 ? 241 LYS B C     1 
ATOM   3844 O  O     . LYS B 1 244 ? -26.140 18.351 12.348  1.00 117.42 ? 241 LYS B O     1 
ATOM   3845 C  CB    . LYS B 1 244 ? -25.448 15.687 12.296  1.00 123.74 ? 241 LYS B CB    1 
ATOM   3846 N  N     . TRP B 1 245 ? -24.287 19.029 13.430  1.00 115.38 ? 242 TRP B N     1 
ATOM   3847 C  CA    . TRP B 1 245 ? -24.833 20.357 13.779  1.00 112.56 ? 242 TRP B CA    1 
ATOM   3848 C  C     . TRP B 1 245 ? -24.889 21.365 12.628  1.00 110.12 ? 242 TRP B C     1 
ATOM   3849 O  O     . TRP B 1 245 ? -25.555 22.393 12.734  1.00 108.43 ? 242 TRP B O     1 
ATOM   3850 C  CB    . TRP B 1 245 ? -24.095 20.981 14.975  1.00 111.54 ? 242 TRP B CB    1 
ATOM   3851 C  CG    . TRP B 1 245 ? -22.623 21.196 14.766  1.00 110.18 ? 242 TRP B CG    1 
ATOM   3852 C  CD1   . TRP B 1 245 ? -21.616 20.362 15.162  1.00 111.77 ? 242 TRP B CD1   1 
ATOM   3853 C  CD2   . TRP B 1 245 ? -21.983 22.317 14.126  1.00 107.10 ? 242 TRP B CD2   1 
ATOM   3854 N  NE1   . TRP B 1 245 ? -20.393 20.886 14.809  1.00 110.22 ? 242 TRP B NE1   1 
ATOM   3855 C  CE2   . TRP B 1 245 ? -20.587 22.083 14.169  1.00 107.26 ? 242 TRP B CE2   1 
ATOM   3856 C  CE3   . TRP B 1 245 ? -22.451 23.492 13.519  1.00 104.35 ? 242 TRP B CE3   1 
ATOM   3857 C  CZ2   . TRP B 1 245 ? -19.652 22.981 13.629  1.00 104.80 ? 242 TRP B CZ2   1 
ATOM   3858 C  CZ3   . TRP B 1 245 ? -21.515 24.385 12.977  1.00 102.11 ? 242 TRP B CZ3   1 
ATOM   3859 C  CH2   . TRP B 1 245 ? -20.133 24.121 13.041  1.00 102.28 ? 242 TRP B CH2   1 
ATOM   3860 N  N     . TYR B 1 246 ? -24.183 21.079 11.539  1.00 110.09 ? 243 TYR B N     1 
ATOM   3861 C  CA    . TYR B 1 246 ? -24.111 22.006 10.410  1.00 107.92 ? 243 TYR B CA    1 
ATOM   3862 C  C     . TYR B 1 246 ? -25.479 22.189 9.753   1.00 107.45 ? 243 TYR B C     1 
ATOM   3863 O  O     . TYR B 1 246 ? -25.927 23.316 9.557   1.00 105.56 ? 243 TYR B O     1 
ATOM   3864 C  CB    . TYR B 1 246 ? -23.077 21.527 9.389   1.00 108.60 ? 243 TYR B CB    1 
ATOM   3865 C  CG    . TYR B 1 246 ? -22.936 22.419 8.175   1.00 108.04 ? 243 TYR B CG    1 
ATOM   3866 C  CD1   . TYR B 1 246 ? -21.803 23.211 7.997   1.00 107.31 ? 243 TYR B CD1   1 
ATOM   3867 C  CD2   . TYR B 1 246 ? -23.938 22.468 7.194   1.00 109.41 ? 243 TYR B CD2   1 
ATOM   3868 C  CE1   . TYR B 1 246 ? -21.670 24.036 6.875   1.00 106.50 ? 243 TYR B CE1   1 
ATOM   3869 C  CE2   . TYR B 1 246 ? -23.819 23.293 6.075   1.00 108.31 ? 243 TYR B CE2   1 
ATOM   3870 C  CZ    . TYR B 1 246 ? -22.681 24.067 5.922   1.00 106.97 ? 243 TYR B CZ    1 
ATOM   3871 O  OH    . TYR B 1 246 ? -22.557 24.868 4.816   1.00 106.48 ? 243 TYR B OH    1 
ATOM   3872 N  N     . ASP B 1 247 ? -26.128 21.071 9.431   1.00 109.23 ? 244 ASP B N     1 
ATOM   3873 C  CA    . ASP B 1 247 ? -27.439 21.054 8.775   1.00 109.26 ? 244 ASP B CA    1 
ATOM   3874 C  C     . ASP B 1 247 ? -28.520 21.728 9.599   1.00 107.88 ? 244 ASP B C     1 
ATOM   3875 O  O     . ASP B 1 247 ? -29.558 22.130 9.071   1.00 107.65 ? 244 ASP B O     1 
ATOM   3876 C  CB    . ASP B 1 247 ? -27.863 19.615 8.507   1.00 112.63 ? 244 ASP B CB    1 
ATOM   3877 C  CG    . ASP B 1 247 ? -26.885 18.882 7.619   1.00 114.79 ? 244 ASP B CG    1 
ATOM   3878 O  OD1   . ASP B 1 247 ? -26.685 19.334 6.469   1.00 114.66 ? 244 ASP B OD1   1 
ATOM   3879 O  OD2   . ASP B 1 247 ? -26.317 17.861 8.074   1.00 117.68 ? 244 ASP B OD2   1 
ATOM   3880 N  N     . LEU B 1 248 ? -28.268 21.848 10.895  1.00 106.86 ? 245 LEU B N     1 
ATOM   3881 C  CA    . LEU B 1 248 ? -29.252 22.387 11.817  1.00 105.78 ? 245 LEU B CA    1 
ATOM   3882 C  C     . LEU B 1 248 ? -29.183 23.905 11.998  1.00 102.62 ? 245 LEU B C     1 
ATOM   3883 O  O     . LEU B 1 248 ? -30.156 24.517 12.448  1.00 102.50 ? 245 LEU B O     1 
ATOM   3884 C  CB    . LEU B 1 248 ? -29.151 21.674 13.167  1.00 107.41 ? 245 LEU B CB    1 
ATOM   3885 C  CG    . LEU B 1 248 ? -29.484 20.183 13.151  1.00 110.27 ? 245 LEU B CG    1 
ATOM   3886 C  CD1   . LEU B 1 248 ? -29.409 19.645 14.565  1.00 112.17 ? 245 LEU B CD1   1 
ATOM   3887 C  CD2   . LEU B 1 248 ? -30.859 19.910 12.529  1.00 110.79 ? 245 LEU B CD2   1 
ATOM   3888 N  N     . LEU B 1 249 ? -28.052 24.513 11.639  1.00 99.98  ? 246 LEU B N     1 
ATOM   3889 C  CA    . LEU B 1 249 ? -27.869 25.949 11.840  1.00 96.83  ? 246 LEU B CA    1 
ATOM   3890 C  C     . LEU B 1 249 ? -29.049 26.795 11.341  1.00 95.65  ? 246 LEU B C     1 
ATOM   3891 O  O     . LEU B 1 249 ? -29.453 27.725 12.039  1.00 95.04  ? 246 LEU B O     1 
ATOM   3892 C  CB    . LEU B 1 249 ? -26.551 26.445 11.246  1.00 95.29  ? 246 LEU B CB    1 
ATOM   3893 C  CG    . LEU B 1 249 ? -25.235 26.185 11.980  1.00 95.20  ? 246 LEU B CG    1 
ATOM   3894 C  CD1   . LEU B 1 249 ? -24.084 26.662 11.120  1.00 93.97  ? 246 LEU B CD1   1 
ATOM   3895 C  CD2   . LEU B 1 249 ? -25.176 26.876 13.330  1.00 94.68  ? 246 LEU B CD2   1 
ATOM   3896 N  N     . PRO B 1 250 ? -29.621 26.474 10.155  1.00 95.50  ? 247 PRO B N     1 
ATOM   3897 C  CA    . PRO B 1 250 ? -30.811 27.228 9.750   1.00 94.68  ? 247 PRO B CA    1 
ATOM   3898 C  C     . PRO B 1 250 ? -31.985 27.054 10.733  1.00 95.48  ? 247 PRO B C     1 
ATOM   3899 O  O     . PRO B 1 250 ? -32.574 28.044 11.176  1.00 94.59  ? 247 PRO B O     1 
ATOM   3900 C  CB    . PRO B 1 250 ? -31.162 26.632 8.379   1.00 95.42  ? 247 PRO B CB    1 
ATOM   3901 C  CG    . PRO B 1 250 ? -29.934 25.994 7.911   1.00 95.71  ? 247 PRO B CG    1 
ATOM   3902 C  CD    . PRO B 1 250 ? -29.248 25.482 9.131   1.00 96.45  ? 247 PRO B CD    1 
ATOM   3903 N  N     . VAL B 1 251 ? -32.302 25.809 11.083  1.00 97.14  ? 248 VAL B N     1 
ATOM   3904 C  CA    . VAL B 1 251 ? -33.409 25.520 12.008  1.00 98.26  ? 248 VAL B CA    1 
ATOM   3905 C  C     . VAL B 1 251 ? -33.215 26.220 13.349  1.00 97.41  ? 248 VAL B C     1 
ATOM   3906 O  O     . VAL B 1 251 ? -34.188 26.642 13.982  1.00 97.74  ? 248 VAL B O     1 
ATOM   3907 C  CB    . VAL B 1 251 ? -33.578 24.008 12.280  1.00 100.87 ? 248 VAL B CB    1 
ATOM   3908 C  CG1   . VAL B 1 251 ? -34.995 23.731 12.771  1.00 102.00 ? 248 VAL B CG1   1 
ATOM   3909 C  CG2   . VAL B 1 251 ? -33.241 23.167 11.024  1.00 101.71 ? 248 VAL B CG2   1 
ATOM   3910 N  N     . VAL B 1 252 ? -31.954 26.323 13.766  1.00 96.24  ? 249 VAL B N     1 
ATOM   3911 C  CA    . VAL B 1 252 ? -31.574 27.023 14.986  1.00 95.51  ? 249 VAL B CA    1 
ATOM   3912 C  C     . VAL B 1 252 ? -31.802 28.521 14.811  1.00 93.63  ? 249 VAL B C     1 
ATOM   3913 O  O     . VAL B 1 252 ? -32.582 29.127 15.539  1.00 94.10  ? 249 VAL B O     1 
ATOM   3914 C  CB    . VAL B 1 252 ? -30.092 26.760 15.353  1.00 95.22  ? 249 VAL B CB    1 
ATOM   3915 C  CG1   . VAL B 1 252 ? -29.636 27.687 16.492  1.00 94.11  ? 249 VAL B CG1   1 
ATOM   3916 C  CG2   . VAL B 1 252 ? -29.872 25.287 15.706  1.00 96.90  ? 249 VAL B CG2   1 
ATOM   3917 N  N     . GLN B 1 253 ? -31.122 29.096 13.827  1.00 91.76  ? 250 GLN B N     1 
ATOM   3918 C  CA    . GLN B 1 253 ? -31.231 30.507 13.500  1.00 90.17  ? 250 GLN B CA    1 
ATOM   3919 C  C     . GLN B 1 253 ? -32.687 30.961 13.428  1.00 90.49  ? 250 GLN B C     1 
ATOM   3920 O  O     . GLN B 1 253 ? -33.041 32.004 13.974  1.00 90.20  ? 250 GLN B O     1 
ATOM   3921 C  CB    . GLN B 1 253 ? -30.534 30.754 12.168  1.00 88.95  ? 250 GLN B CB    1 
ATOM   3922 C  CG    . GLN B 1 253 ? -30.258 32.192 11.843  1.00 88.25  ? 250 GLN B CG    1 
ATOM   3923 C  CD    . GLN B 1 253 ? -29.131 32.332 10.842  1.00 88.99  ? 250 GLN B CD    1 
ATOM   3924 O  OE1   . GLN B 1 253 ? -28.073 31.707 10.990  1.00 89.83  ? 250 GLN B OE1   1 
ATOM   3925 N  NE2   . GLN B 1 253 ? -29.346 33.154 9.812   1.00 89.03  ? 250 GLN B NE2   1 
ATOM   3926 N  N     . LEU B 1 254 ? -33.520 30.166 12.759  1.00 91.39  ? 251 LEU B N     1 
ATOM   3927 C  CA    . LEU B 1 254 ? -34.952 30.439 12.630  1.00 92.00  ? 251 LEU B CA    1 
ATOM   3928 C  C     . LEU B 1 254 ? -35.672 30.491 13.974  1.00 93.38  ? 251 LEU B C     1 
ATOM   3929 O  O     . LEU B 1 254 ? -36.543 31.340 14.187  1.00 93.37  ? 251 LEU B O     1 
ATOM   3930 C  CB    . LEU B 1 254 ? -35.628 29.372 11.763  1.00 93.28  ? 251 LEU B CB    1 
ATOM   3931 C  CG    . LEU B 1 254 ? -35.866 29.547 10.262  1.00 92.38  ? 251 LEU B CG    1 
ATOM   3932 C  CD1   . LEU B 1 254 ? -36.612 28.334 9.754   1.00 93.34  ? 251 LEU B CD1   1 
ATOM   3933 C  CD2   . LEU B 1 254 ? -36.652 30.822 9.935   1.00 91.42  ? 251 LEU B CD2   1 
ATOM   3934 N  N     . ALA B 1 255 ? -35.315 29.564 14.864  1.00 94.86  ? 252 ALA B N     1 
ATOM   3935 C  CA    . ALA B 1 255 ? -35.995 29.412 16.149  1.00 96.72  ? 252 ALA B CA    1 
ATOM   3936 C  C     . ALA B 1 255 ? -35.699 30.596 17.050  1.00 96.23  ? 252 ALA B C     1 
ATOM   3937 O  O     . ALA B 1 255 ? -36.596 31.142 17.671  1.00 96.88  ? 252 ALA B O     1 
ATOM   3938 C  CB    . ALA B 1 255 ? -35.593 28.121 16.807  1.00 97.96  ? 252 ALA B CB    1 
ATOM   3939 N  N     . LEU B 1 256 ? -34.435 30.999 17.084  1.00 95.62  ? 253 LEU B N     1 
ATOM   3940 C  CA    . LEU B 1 256 ? -33.992 32.152 17.858  1.00 95.76  ? 253 LEU B CA    1 
ATOM   3941 C  C     . LEU B 1 256 ? -34.709 33.419 17.431  1.00 95.58  ? 253 LEU B C     1 
ATOM   3942 O  O     . LEU B 1 256 ? -35.215 34.162 18.266  1.00 96.59  ? 253 LEU B O     1 
ATOM   3943 C  CB    . LEU B 1 256 ? -32.480 32.355 17.710  1.00 94.21  ? 253 LEU B CB    1 
ATOM   3944 C  CG    . LEU B 1 256 ? -31.585 31.184 18.114  1.00 94.88  ? 253 LEU B CG    1 
ATOM   3945 C  CD1   . LEU B 1 256 ? -30.184 31.373 17.594  1.00 93.84  ? 253 LEU B CD1   1 
ATOM   3946 C  CD2   . LEU B 1 256 ? -31.562 31.033 19.611  1.00 96.84  ? 253 LEU B CD2   1 
ATOM   3947 N  N     . ASN B 1 257 ? -34.763 33.661 16.129  1.00 94.99  ? 254 ASN B N     1 
ATOM   3948 C  CA    . ASN B 1 257 ? -35.301 34.918 15.628  1.00 95.03  ? 254 ASN B CA    1 
ATOM   3949 C  C     . ASN B 1 257 ? -36.822 35.035 15.724  1.00 96.87  ? 254 ASN B C     1 
ATOM   3950 O  O     . ASN B 1 257 ? -37.379 36.131 15.703  1.00 96.57  ? 254 ASN B O     1 
ATOM   3951 C  CB    . ASN B 1 257 ? -34.802 35.179 14.207  1.00 93.33  ? 254 ASN B CB    1 
ATOM   3952 C  CG    . ASN B 1 257 ? -33.307 35.392 14.153  1.00 91.89  ? 254 ASN B CG    1 
ATOM   3953 O  OD1   . ASN B 1 257 ? -32.705 35.994 15.063  1.00 91.02  ? 254 ASN B OD1   1 
ATOM   3954 N  ND2   . ASN B 1 257 ? -32.692 34.890 13.090  1.00 90.60  ? 254 ASN B ND2   1 
ATOM   3955 N  N     . ASN B 1 258 ? -37.486 33.897 15.843  1.00 99.31  ? 255 ASN B N     1 
ATOM   3956 C  CA    . ASN B 1 258 ? -38.920 33.891 16.043  1.00 102.09 ? 255 ASN B CA    1 
ATOM   3957 C  C     . ASN B 1 258 ? -39.307 33.525 17.474  1.00 105.04 ? 255 ASN B C     1 
ATOM   3958 O  O     . ASN B 1 258 ? -40.414 33.036 17.741  1.00 106.99 ? 255 ASN B O     1 
ATOM   3959 C  CB    . ASN B 1 258 ? -39.575 32.982 15.020  1.00 102.61 ? 255 ASN B CB    1 
ATOM   3960 C  CG    . ASN B 1 258 ? -39.804 33.681 13.724  1.00 101.48 ? 255 ASN B CG    1 
ATOM   3961 O  OD1   . ASN B 1 258 ? -40.557 34.650 13.677  1.00 102.15 ? 255 ASN B OD1   1 
ATOM   3962 N  ND2   . ASN B 1 258 ? -39.148 33.219 12.662  1.00 100.26 ? 255 ASN B ND2   1 
ATOM   3963 N  N     . THR B 1 259 ? -38.380 33.790 18.393  1.00 106.00 ? 256 THR B N     1 
ATOM   3964 C  CA    . THR B 1 259 ? -38.577 33.515 19.811  1.00 109.20 ? 256 THR B CA    1 
ATOM   3965 C  C     . THR B 1 259 ? -39.020 34.767 20.570  1.00 110.52 ? 256 THR B C     1 
ATOM   3966 O  O     . THR B 1 259 ? -38.385 35.833 20.494  1.00 108.87 ? 256 THR B O     1 
ATOM   3967 C  CB    . THR B 1 259 ? -37.312 32.838 20.446  1.00 109.29 ? 256 THR B CB    1 
ATOM   3968 O  OG1   . THR B 1 259 ? -37.286 31.451 20.074  1.00 110.51 ? 256 THR B OG1   1 
ATOM   3969 C  CG2   . THR B 1 259 ? -37.292 32.944 21.989  1.00 111.12 ? 256 THR B CG2   1 
ATOM   3970 N  N     . TYR B 1 260 ? -40.125 34.613 21.297  1.00 114.05 ? 257 TYR B N     1 
ATOM   3971 C  CA    . TYR B 1 260 ? -40.716 35.698 22.077  1.00 116.55 ? 257 TYR B CA    1 
ATOM   3972 C  C     . TYR B 1 260 ? -39.812 36.295 23.162  1.00 117.64 ? 257 TYR B C     1 
ATOM   3973 O  O     . TYR B 1 260 ? -39.285 35.573 24.020  1.00 118.82 ? 257 TYR B O     1 
ATOM   3974 C  CB    . TYR B 1 260 ? -42.083 35.279 22.629  1.00 119.07 ? 257 TYR B CB    1 
ATOM   3975 C  CG    . TYR B 1 260 ? -43.159 35.599 21.631  1.00 120.46 ? 257 TYR B CG    1 
ATOM   3976 C  CD1   . TYR B 1 260 ? -43.601 34.642 20.702  1.00 121.70 ? 257 TYR B CD1   1 
ATOM   3977 C  CD2   . TYR B 1 260 ? -43.692 36.892 21.561  1.00 121.92 ? 257 TYR B CD2   1 
ATOM   3978 C  CE1   . TYR B 1 260 ? -44.585 34.968 19.741  1.00 122.44 ? 257 TYR B CE1   1 
ATOM   3979 C  CE2   . TYR B 1 260 ? -44.668 37.229 20.614  1.00 122.54 ? 257 TYR B CE2   1 
ATOM   3980 C  CZ    . TYR B 1 260 ? -45.109 36.270 19.712  1.00 122.70 ? 257 TYR B CZ    1 
ATOM   3981 O  OH    . TYR B 1 260 ? -46.070 36.637 18.798  1.00 123.22 ? 257 TYR B OH    1 
ATOM   3982 N  N     . SER B 1 261 ? -39.626 37.617 23.082  1.00 118.21 ? 258 SER B N     1 
ATOM   3983 C  CA    . SER B 1 261 ? -38.875 38.399 24.083  1.00 119.77 ? 258 SER B CA    1 
ATOM   3984 C  C     . SER B 1 261 ? -39.772 38.881 25.253  1.00 123.11 ? 258 SER B C     1 
ATOM   3985 O  O     . SER B 1 261 ? -40.771 39.586 25.032  1.00 123.78 ? 258 SER B O     1 
ATOM   3986 C  CB    . SER B 1 261 ? -38.152 39.588 23.421  1.00 117.77 ? 258 SER B CB    1 
ATOM   3987 O  OG    . SER B 1 261 ? -37.560 40.443 24.389  1.00 118.79 ? 258 SER B OG    1 
ATOM   3988 N  N     . PRO B 1 262 ? -39.426 38.475 26.499  1.00 125.47 ? 259 PRO B N     1 
ATOM   3989 C  CA    . PRO B 1 262 ? -40.080 38.952 27.734  1.00 128.56 ? 259 PRO B CA    1 
ATOM   3990 C  C     . PRO B 1 262 ? -40.352 40.473 27.758  1.00 128.79 ? 259 PRO B C     1 
ATOM   3991 O  O     . PRO B 1 262 ? -41.425 40.899 28.208  1.00 130.84 ? 259 PRO B O     1 
ATOM   3992 C  CB    . PRO B 1 262 ? -39.078 38.562 28.827  1.00 129.88 ? 259 PRO B CB    1 
ATOM   3993 C  CG    . PRO B 1 262 ? -38.321 37.367 28.262  1.00 128.19 ? 259 PRO B CG    1 
ATOM   3994 C  CD    . PRO B 1 262 ? -38.509 37.345 26.764  1.00 125.27 ? 259 PRO B CD    1 
ATOM   3995 N  N     . VAL B 1 263 ? -39.379 41.266 27.290  1.00 126.88 ? 260 VAL B N     1 
ATOM   3996 C  CA    . VAL B 1 263 ? -39.557 42.712 27.046  1.00 126.55 ? 260 VAL B CA    1 
ATOM   3997 C  C     . VAL B 1 263 ? -39.995 42.916 25.590  1.00 123.96 ? 260 VAL B C     1 
ATOM   3998 O  O     . VAL B 1 263 ? -39.453 42.278 24.669  1.00 121.51 ? 260 VAL B O     1 
ATOM   3999 C  CB    . VAL B 1 263 ? -38.257 43.567 27.337  1.00 126.25 ? 260 VAL B CB    1 
ATOM   4000 C  CG1   . VAL B 1 263 ? -38.553 45.076 27.257  1.00 126.50 ? 260 VAL B CG1   1 
ATOM   4001 C  CG2   . VAL B 1 263 ? -37.642 43.221 28.694  1.00 127.99 ? 260 VAL B CG2   1 
ATOM   4002 N  N     . LEU B 1 264 ? -40.980 43.801 25.403  1.00 124.36 ? 261 LEU B N     1 
ATOM   4003 C  CA    . LEU B 1 264 ? -41.547 44.143 24.083  1.00 122.19 ? 261 LEU B CA    1 
ATOM   4004 C  C     . LEU B 1 264 ? -42.559 43.105 23.568  1.00 121.32 ? 261 LEU B C     1 
ATOM   4005 O  O     . LEU B 1 264 ? -43.458 43.443 22.786  1.00 121.07 ? 261 LEU B O     1 
ATOM   4006 C  CB    . LEU B 1 264 ? -40.436 44.371 23.035  1.00 119.81 ? 261 LEU B CB    1 
ATOM   4007 C  CG    . LEU B 1 264 ? -39.370 45.465 23.247  1.00 120.29 ? 261 LEU B CG    1 
ATOM   4008 C  CD1   . LEU B 1 264 ? -37.985 45.054 22.665  1.00 117.33 ? 261 LEU B CD1   1 
ATOM   4009 C  CD2   . LEU B 1 264 ? -39.855 46.835 22.704  1.00 121.15 ? 261 LEU B CD2   1 
ATOM   4010 N  N     . LYS B 1 265 ? -42.410 41.857 24.030  1.00 120.52 ? 262 LYS B N     1 
ATOM   4011 C  CA    . LYS B 1 265 ? -43.098 40.682 23.462  1.00 119.10 ? 262 LYS B CA    1 
ATOM   4012 C  C     . LYS B 1 265 ? -43.203 40.798 21.933  1.00 115.61 ? 262 LYS B C     1 
ATOM   4013 O  O     . LYS B 1 265 ? -44.295 40.804 21.345  1.00 116.01 ? 262 LYS B O     1 
ATOM   4014 C  CB    . LYS B 1 265 ? -44.451 40.411 24.142  1.00 122.23 ? 262 LYS B CB    1 
ATOM   4015 C  CG    . LYS B 1 265 ? -44.369 40.244 25.662  1.00 125.26 ? 262 LYS B CG    1 
ATOM   4016 C  CD    . LYS B 1 265 ? -45.663 40.727 26.318  1.00 128.63 ? 262 LYS B CD    1 
ATOM   4017 C  CE    . LYS B 1 265 ? -45.390 41.512 27.587  1.00 130.29 ? 262 LYS B CE    1 
ATOM   4018 N  NZ    . LYS B 1 265 ? -46.412 42.581 27.739  1.00 132.32 ? 262 LYS B NZ    1 
ATOM   4019 N  N     . TYR B 1 266 ? -42.028 40.939 21.324  1.00 111.39 ? 263 TYR B N     1 
ATOM   4020 C  CA    . TYR B 1 266 ? -41.854 40.904 19.888  1.00 107.71 ? 263 TYR B CA    1 
ATOM   4021 C  C     . TYR B 1 266 ? -40.713 39.972 19.596  1.00 105.03 ? 263 TYR B C     1 
ATOM   4022 O  O     . TYR B 1 266 ? -39.670 40.031 20.247  1.00 104.74 ? 263 TYR B O     1 
ATOM   4023 C  CB    . TYR B 1 266 ? -41.527 42.291 19.341  1.00 106.58 ? 263 TYR B CB    1 
ATOM   4024 C  CG    . TYR B 1 266 ? -42.730 43.194 19.236  1.00 108.58 ? 263 TYR B CG    1 
ATOM   4025 C  CD1   . TYR B 1 266 ? -43.965 42.694 18.814  1.00 109.93 ? 263 TYR B CD1   1 
ATOM   4026 C  CD2   . TYR B 1 266 ? -42.642 44.551 19.540  1.00 109.91 ? 263 TYR B CD2   1 
ATOM   4027 C  CE1   . TYR B 1 266 ? -45.082 43.507 18.711  1.00 111.42 ? 263 TYR B CE1   1 
ATOM   4028 C  CE2   . TYR B 1 266 ? -43.761 45.383 19.432  1.00 111.73 ? 263 TYR B CE2   1 
ATOM   4029 C  CZ    . TYR B 1 266 ? -44.978 44.848 19.018  1.00 112.24 ? 263 TYR B CZ    1 
ATOM   4030 O  OH    . TYR B 1 266 ? -46.095 45.643 18.905  1.00 113.99 ? 263 TYR B OH    1 
ATOM   4031 N  N     . THR B 1 267 ? -40.914 39.090 18.631  1.00 102.87 ? 264 THR B N     1 
ATOM   4032 C  CA    . THR B 1 267 ? -39.824 38.266 18.158  1.00 100.15 ? 264 THR B CA    1 
ATOM   4033 C  C     . THR B 1 267 ? -38.831 39.205 17.451  1.00 97.26  ? 264 THR B C     1 
ATOM   4034 O  O     . THR B 1 267 ? -39.240 40.234 16.917  1.00 97.03  ? 264 THR B O     1 
ATOM   4035 C  CB    . THR B 1 267 ? -40.346 37.143 17.226  1.00 100.26 ? 264 THR B CB    1 
ATOM   4036 O  OG1   . THR B 1 267 ? -40.919 37.707 16.040  1.00 99.36  ? 264 THR B OG1   1 
ATOM   4037 C  CG2   . THR B 1 267 ? -41.415 36.321 17.935  1.00 102.45 ? 264 THR B CG2   1 
ATOM   4038 N  N     . PRO B 1 268 ? -37.523 38.897 17.491  1.00 95.13  ? 265 PRO B N     1 
ATOM   4039 C  CA    . PRO B 1 268 ? -36.578 39.643 16.663  1.00 92.72  ? 265 PRO B CA    1 
ATOM   4040 C  C     . PRO B 1 268 ? -37.055 39.809 15.205  1.00 91.19  ? 265 PRO B C     1 
ATOM   4041 O  O     . PRO B 1 268 ? -36.977 40.904 14.649  1.00 90.65  ? 265 PRO B O     1 
ATOM   4042 C  CB    . PRO B 1 268 ? -35.319 38.784 16.718  1.00 91.84  ? 265 PRO B CB    1 
ATOM   4043 C  CG    . PRO B 1 268 ? -35.422 38.033 17.999  1.00 93.67  ? 265 PRO B CG    1 
ATOM   4044 C  CD    . PRO B 1 268 ? -36.832 38.074 18.495  1.00 95.67  ? 265 PRO B CD    1 
ATOM   4045 N  N     . HIS B 1 269 ? -37.553 38.731 14.607  1.00 90.43  ? 266 HIS B N     1 
ATOM   4046 C  CA    . HIS B 1 269 ? -38.140 38.768 13.274  1.00 89.12  ? 266 HIS B CA    1 
ATOM   4047 C  C     . HIS B 1 269 ? -39.077 39.952 13.101  1.00 89.25  ? 266 HIS B C     1 
ATOM   4048 O  O     . HIS B 1 269 ? -38.932 40.736 12.174  1.00 88.60  ? 266 HIS B O     1 
ATOM   4049 C  CB    . HIS B 1 269 ? -38.905 37.473 13.020  1.00 90.10  ? 266 HIS B CB    1 
ATOM   4050 C  CG    . HIS B 1 269 ? -39.486 37.362 11.644  1.00 89.51  ? 266 HIS B CG    1 
ATOM   4051 N  ND1   . HIS B 1 269 ? -40.647 38.006 11.272  1.00 89.37  ? 266 HIS B ND1   1 
ATOM   4052 C  CD2   . HIS B 1 269 ? -39.084 36.650 10.561  1.00 88.60  ? 266 HIS B CD2   1 
ATOM   4053 C  CE1   . HIS B 1 269 ? -40.923 37.713 10.014  1.00 89.68  ? 266 HIS B CE1   1 
ATOM   4054 N  NE2   . HIS B 1 269 ? -39.992 36.890 9.561   1.00 89.40  ? 266 HIS B NE2   1 
ATOM   4055 N  N     . GLN B 1 270 ? -40.036 40.077 14.005  1.00 90.27  ? 267 GLN B N     1 
ATOM   4056 C  CA    . GLN B 1 270 ? -41.047 41.110 13.909  1.00 90.70  ? 267 GLN B CA    1 
ATOM   4057 C  C     . GLN B 1 270 ? -40.457 42.499 13.947  1.00 89.64  ? 267 GLN B C     1 
ATOM   4058 O  O     . GLN B 1 270 ? -40.923 43.376 13.245  1.00 89.75  ? 267 GLN B O     1 
ATOM   4059 C  CB    . GLN B 1 270 ? -42.053 40.969 15.036  1.00 92.85  ? 267 GLN B CB    1 
ATOM   4060 C  CG    . GLN B 1 270 ? -43.040 39.852 14.844  1.00 95.07  ? 267 GLN B CG    1 
ATOM   4061 C  CD    . GLN B 1 270 ? -43.802 39.553 16.108  1.00 98.62  ? 267 GLN B CD    1 
ATOM   4062 O  OE1   . GLN B 1 270 ? -43.921 40.403 16.984  1.00 99.97  ? 267 GLN B OE1   1 
ATOM   4063 N  NE2   . GLN B 1 270 ? -44.320 38.336 16.217  1.00 100.98 ? 267 GLN B NE2   1 
ATOM   4064 N  N     . LEU B 1 271 ? -39.435 42.705 14.767  1.00 88.96  ? 268 LEU B N     1 
ATOM   4065 C  CA    . LEU B 1 271 ? -38.831 44.027 14.900  1.00 88.72  ? 268 LEU B CA    1 
ATOM   4066 C  C     . LEU B 1 271 ? -37.997 44.415 13.681  1.00 87.28  ? 268 LEU B C     1 
ATOM   4067 O  O     . LEU B 1 271 ? -37.868 45.605 13.355  1.00 87.49  ? 268 LEU B O     1 
ATOM   4068 C  CB    . LEU B 1 271 ? -37.955 44.088 16.141  1.00 88.98  ? 268 LEU B CB    1 
ATOM   4069 C  CG    . LEU B 1 271 ? -38.652 43.996 17.491  1.00 91.32  ? 268 LEU B CG    1 
ATOM   4070 C  CD1   . LEU B 1 271 ? -37.603 43.877 18.588  1.00 92.00  ? 268 LEU B CD1   1 
ATOM   4071 C  CD2   . LEU B 1 271 ? -39.578 45.193 17.726  1.00 92.70  ? 268 LEU B CD2   1 
ATOM   4072 N  N     . LEU B 1 272 ? -37.423 43.406 13.024  1.00 86.00  ? 269 LEU B N     1 
ATOM   4073 C  CA    . LEU B 1 272 ? -36.634 43.610 11.821  1.00 84.33  ? 269 LEU B CA    1 
ATOM   4074 C  C     . LEU B 1 272 ? -37.519 43.844 10.591  1.00 84.58  ? 269 LEU B C     1 
ATOM   4075 O  O     . LEU B 1 272 ? -37.291 44.786 9.839   1.00 84.46  ? 269 LEU B O     1 
ATOM   4076 C  CB    . LEU B 1 272 ? -35.689 42.430 11.599  1.00 83.09  ? 269 LEU B CB    1 
ATOM   4077 C  CG    . LEU B 1 272 ? -34.742 42.554 10.404  1.00 81.93  ? 269 LEU B CG    1 
ATOM   4078 C  CD1   . LEU B 1 272 ? -33.972 43.860 10.472  1.00 81.96  ? 269 LEU B CD1   1 
ATOM   4079 C  CD2   . LEU B 1 272 ? -33.781 41.379 10.321  1.00 80.71  ? 269 LEU B CD2   1 
ATOM   4080 N  N     . PHE B 1 273 ? -38.534 43.007 10.403  1.00 85.20  ? 270 PHE B N     1 
ATOM   4081 C  CA    . PHE B 1 273 ? -39.330 43.052 9.188   1.00 85.72  ? 270 PHE B CA    1 
ATOM   4082 C  C     . PHE B 1 273 ? -40.662 43.769 9.304   1.00 87.91  ? 270 PHE B C     1 
ATOM   4083 O  O     . PHE B 1 273 ? -41.236 44.149 8.293   1.00 88.55  ? 270 PHE B O     1 
ATOM   4084 C  CB    . PHE B 1 273 ? -39.545 41.646 8.648   1.00 85.49  ? 270 PHE B CB    1 
ATOM   4085 C  CG    . PHE B 1 273 ? -38.272 40.911 8.386   1.00 83.75  ? 270 PHE B CG    1 
ATOM   4086 C  CD1   . PHE B 1 273 ? -37.964 39.760 9.087   1.00 83.19  ? 270 PHE B CD1   1 
ATOM   4087 C  CD2   . PHE B 1 273 ? -37.368 41.381 7.452   1.00 82.28  ? 270 PHE B CD2   1 
ATOM   4088 C  CE1   . PHE B 1 273 ? -36.781 39.085 8.854   1.00 81.84  ? 270 PHE B CE1   1 
ATOM   4089 C  CE2   . PHE B 1 273 ? -36.183 40.712 7.218   1.00 80.97  ? 270 PHE B CE2   1 
ATOM   4090 C  CZ    . PHE B 1 273 ? -35.890 39.564 7.919   1.00 80.71  ? 270 PHE B CZ    1 
ATOM   4091 N  N     . GLY B 1 274 ? -41.168 43.937 10.520  1.00 89.80  ? 271 GLY B N     1 
ATOM   4092 C  CA    . GLY B 1 274 ? -42.430 44.651 10.731  1.00 92.45  ? 271 GLY B CA    1 
ATOM   4093 C  C     . GLY B 1 274 ? -43.659 43.917 10.236  1.00 94.46  ? 271 GLY B C     1 
ATOM   4094 O  O     . GLY B 1 274 ? -44.665 44.536 9.877   1.00 95.88  ? 271 GLY B O     1 
ATOM   4095 N  N     . ILE B 1 275 ? -43.557 42.595 10.189  1.00 95.10  ? 272 ILE B N     1 
ATOM   4096 C  CA    . ILE B 1 275 ? -44.693 41.717 9.952   1.00 97.55  ? 272 ILE B CA    1 
ATOM   4097 C  C     . ILE B 1 275 ? -44.479 40.481 10.781  1.00 98.44  ? 272 ILE B C     1 
ATOM   4098 O  O     . ILE B 1 275 ? -43.462 40.347 11.460  1.00 97.78  ? 272 ILE B O     1 
ATOM   4099 C  CB    . ILE B 1 275 ? -44.853 41.288 8.468   1.00 97.39  ? 272 ILE B CB    1 
ATOM   4100 C  CG1   . ILE B 1 275 ? -43.496 41.052 7.798   1.00 95.44  ? 272 ILE B CG1   1 
ATOM   4101 C  CG2   . ILE B 1 275 ? -45.717 42.283 7.698   1.00 99.15  ? 272 ILE B CG2   1 
ATOM   4102 C  CD1   . ILE B 1 275 ? -43.021 39.629 7.867   1.00 95.27  ? 272 ILE B CD1   1 
ATOM   4103 N  N     . ASP B 1 276 ? -45.433 39.569 10.714  1.00 100.71 ? 273 ASP B N     1 
ATOM   4104 C  CA    . ASP B 1 276 ? -45.306 38.320 11.408  1.00 102.09 ? 273 ASP B CA    1 
ATOM   4105 C  C     . ASP B 1 276 ? -44.657 37.274 10.492  1.00 101.31 ? 273 ASP B C     1 
ATOM   4106 O  O     . ASP B 1 276 ? -44.790 37.351 9.266   1.00 101.40 ? 273 ASP B O     1 
ATOM   4107 C  CB    . ASP B 1 276 ? -46.682 37.880 11.874  1.00 104.88 ? 273 ASP B CB    1 
ATOM   4108 C  CG    . ASP B 1 276 ? -46.622 37.093 13.151  1.00 108.37 ? 273 ASP B CG    1 
ATOM   4109 O  OD1   . ASP B 1 276 ? -45.576 36.433 13.396  1.00 109.65 ? 273 ASP B OD1   1 
ATOM   4110 O  OD2   . ASP B 1 276 ? -47.623 37.130 13.909  1.00 112.83 ? 273 ASP B OD2   1 
ATOM   4111 N  N     . SER B 1 277 ? -43.942 36.312 11.076  1.00 100.94 ? 274 SER B N     1 
ATOM   4112 C  CA    . SER B 1 277 ? -43.316 35.247 10.286  1.00 100.32 ? 274 SER B CA    1 
ATOM   4113 C  C     . SER B 1 277 ? -44.299 34.131 9.975   1.00 102.22 ? 274 SER B C     1 
ATOM   4114 O  O     . SER B 1 277 ? -45.377 34.060 10.559  1.00 103.60 ? 274 SER B O     1 
ATOM   4115 C  CB    . SER B 1 277 ? -42.112 34.655 11.012  1.00 99.59  ? 274 SER B CB    1 
ATOM   4116 O  OG    . SER B 1 277 ? -42.462 33.461 11.696  1.00 100.79 ? 274 SER B OG    1 
ATOM   4117 N  N     . ASN B 1 278 ? -43.899 33.253 9.062   1.00 102.32 ? 275 ASN B N     1 
ATOM   4118 C  CA    . ASN B 1 278 ? -44.705 32.100 8.697   1.00 104.61 ? 275 ASN B CA    1 
ATOM   4119 C  C     . ASN B 1 278 ? -44.284 30.858 9.480   1.00 106.00 ? 275 ASN B C     1 
ATOM   4120 O  O     . ASN B 1 278 ? -44.869 29.787 9.320   1.00 108.13 ? 275 ASN B O     1 
ATOM   4121 C  CB    . ASN B 1 278 ? -44.641 31.853 7.185   1.00 104.38 ? 275 ASN B CB    1 
ATOM   4122 C  CG    . ASN B 1 278 ? -44.916 33.110 6.372   1.00 102.56 ? 275 ASN B CG    1 
ATOM   4123 O  OD1   . ASN B 1 278 ? -46.043 33.602 6.316   1.00 101.78 ? 275 ASN B OD1   1 
ATOM   4124 N  ND2   . ASN B 1 278 ? -43.876 33.631 5.733   1.00 99.86  ? 275 ASN B ND2   1 
ATOM   4125 N  N     . THR B 1 279 ? -43.264 31.003 10.321  1.00 105.34 ? 276 THR B N     1 
ATOM   4126 C  CA    . THR B 1 279 ? -42.878 29.933 11.240  1.00 107.14 ? 276 THR B CA    1 
ATOM   4127 C  C     . THR B 1 279 ? -42.735 30.470 12.663  1.00 107.77 ? 276 THR B C     1 
ATOM   4128 O  O     . THR B 1 279 ? -41.646 30.905 13.052  1.00 106.24 ? 276 THR B O     1 
ATOM   4129 C  CB    . THR B 1 279 ? -41.563 29.236 10.833  1.00 106.00 ? 276 THR B CB    1 
ATOM   4130 O  OG1   . THR B 1 279 ? -40.493 30.185 10.861  1.00 103.06 ? 276 THR B OG1   1 
ATOM   4131 C  CG2   . THR B 1 279 ? -41.673 28.588 9.444   1.00 106.61 ? 276 THR B CG2   1 
ATOM   4132 N  N     . PRO B 1 280 ? -43.839 30.461 13.439  1.00 110.37 ? 277 PRO B N     1 
ATOM   4133 C  CA    . PRO B 1 280 ? -43.782 30.904 14.837  1.00 111.16 ? 277 PRO B CA    1 
ATOM   4134 C  C     . PRO B 1 280 ? -43.328 29.774 15.770  1.00 113.08 ? 277 PRO B C     1 
ATOM   4135 O  O     . PRO B 1 280 ? -43.283 28.614 15.350  1.00 114.32 ? 277 PRO B O     1 
ATOM   4136 C  CB    . PRO B 1 280 ? -45.238 31.315 15.137  1.00 112.99 ? 277 PRO B CB    1 
ATOM   4137 C  CG    . PRO B 1 280 ? -45.997 31.189 13.798  1.00 112.98 ? 277 PRO B CG    1 
ATOM   4138 C  CD    . PRO B 1 280 ? -45.225 30.182 13.018  1.00 112.34 ? 277 PRO B CD    1 
ATOM   4139 N  N     . PHE B 1 281 ? -42.974 30.117 17.009  1.00 113.83 ? 278 PHE B N     1 
ATOM   4140 C  CA    . PHE B 1 281 ? -42.603 29.128 18.034  1.00 115.89 ? 278 PHE B CA    1 
ATOM   4141 C  C     . PHE B 1 281 ? -43.290 29.483 19.350  1.00 117.69 ? 278 PHE B C     1 
ATOM   4142 O  O     . PHE B 1 281 ? -43.832 28.614 20.035  1.00 120.26 ? 278 PHE B O     1 
ATOM   4143 C  CB    . PHE B 1 281 ? -41.078 29.074 18.245  1.00 114.45 ? 278 PHE B CB    1 
ATOM   4144 C  CG    . PHE B 1 281 ? -40.307 28.342 17.147  1.00 114.43 ? 278 PHE B CG    1 
ATOM   4145 C  CD1   . PHE B 1 281 ? -39.725 27.094 17.398  1.00 116.38 ? 278 PHE B CD1   1 
ATOM   4146 C  CD2   . PHE B 1 281 ? -40.126 28.916 15.875  1.00 112.61 ? 278 PHE B CD2   1 
ATOM   4147 C  CE1   . PHE B 1 281 ? -38.990 26.420 16.387  1.00 115.58 ? 278 PHE B CE1   1 
ATOM   4148 C  CE2   . PHE B 1 281 ? -39.400 28.248 14.866  1.00 111.45 ? 278 PHE B CE2   1 
ATOM   4149 C  CZ    . PHE B 1 281 ? -38.832 27.002 15.125  1.00 112.70 ? 278 PHE B CZ    1 
ATOM   4150 O  "O5'" . DA  C 2 1   ? -52.236 21.471 -9.090  1.00 140.90 ? 1   DA  C "O5'" 1 
ATOM   4151 C  "C5'" . DA  C 2 1   ? -53.172 22.497 -9.461  1.00 141.61 ? 1   DA  C "C5'" 1 
ATOM   4152 C  "C4'" . DA  C 2 1   ? -52.523 23.643 -10.246 1.00 139.73 ? 1   DA  C "C4'" 1 
ATOM   4153 O  "O4'" . DA  C 2 1   ? -52.516 23.386 -11.682 1.00 140.22 ? 1   DA  C "O4'" 1 
ATOM   4154 C  "C3'" . DA  C 2 1   ? -53.178 25.019 -10.080 1.00 138.28 ? 1   DA  C "C3'" 1 
ATOM   4155 O  "O3'" . DA  C 2 1   ? -52.318 25.950 -9.388  1.00 134.57 ? 1   DA  C "O3'" 1 
ATOM   4156 C  "C2'" . DA  C 2 1   ? -53.521 25.484 -11.499 1.00 138.83 ? 1   DA  C "C2'" 1 
ATOM   4157 C  "C1'" . DA  C 2 1   ? -53.490 24.198 -12.317 1.00 141.27 ? 1   DA  C "C1'" 1 
ATOM   4158 N  N9    . DA  C 2 1   ? -54.787 23.490 -12.475 1.00 145.59 ? 1   DA  C N9    1 
ATOM   4159 C  C8    . DA  C 2 1   ? -55.016 22.429 -13.326 1.00 146.96 ? 1   DA  C C8    1 
ATOM   4160 N  N7    . DA  C 2 1   ? -56.246 21.959 -13.314 1.00 149.22 ? 1   DA  C N7    1 
ATOM   4161 C  C5    . DA  C 2 1   ? -56.893 22.766 -12.386 1.00 150.06 ? 1   DA  C C5    1 
ATOM   4162 C  C6    . DA  C 2 1   ? -58.231 22.785 -11.913 1.00 152.28 ? 1   DA  C C6    1 
ATOM   4163 N  N6    . DA  C 2 1   ? -59.170 21.932 -12.340 1.00 154.00 ? 1   DA  C N6    1 
ATOM   4164 N  N1    . DA  C 2 1   ? -58.566 23.716 -10.984 1.00 152.64 ? 1   DA  C N1    1 
ATOM   4165 C  C2    . DA  C 2 1   ? -57.627 24.574 -10.552 1.00 150.75 ? 1   DA  C C2    1 
ATOM   4166 N  N3    . DA  C 2 1   ? -56.344 24.652 -10.922 1.00 148.62 ? 1   DA  C N3    1 
ATOM   4167 C  C4    . DA  C 2 1   ? -56.020 23.718 -11.853 1.00 148.19 ? 1   DA  C C4    1 
ATOM   4168 P  P     . DT  C 2 2   ? -50.860 26.457 -9.877  1.00 130.44 ? 2   DT  C P     1 
ATOM   4169 O  OP1   . DT  C 2 2   ? -50.112 25.363 -10.556 1.00 129.59 ? 2   DT  C OP1   1 
ATOM   4170 O  OP2   . DT  C 2 2   ? -50.274 27.134 -8.690  1.00 130.11 ? 2   DT  C OP2   1 
ATOM   4171 O  "O5'" . DT  C 2 2   ? -51.194 27.592 -10.975 1.00 125.55 ? 2   DT  C "O5'" 1 
ATOM   4172 C  "C5'" . DT  C 2 2   ? -50.865 27.427 -12.369 1.00 116.90 ? 2   DT  C "C5'" 1 
ATOM   4173 C  "C4'" . DT  C 2 2   ? -51.445 28.546 -13.210 1.00 110.23 ? 2   DT  C "C4'" 1 
ATOM   4174 O  "O4'" . DT  C 2 2   ? -52.873 28.645 -12.995 1.00 110.73 ? 2   DT  C "O4'" 1 
ATOM   4175 C  "C3'" . DT  C 2 2   ? -50.858 29.913 -12.917 1.00 105.57 ? 2   DT  C "C3'" 1 
ATOM   4176 O  "O3'" . DT  C 2 2   ? -50.582 30.542 -14.156 1.00 99.10  ? 2   DT  C "O3'" 1 
ATOM   4177 C  "C2'" . DT  C 2 2   ? -51.982 30.620 -12.166 1.00 108.07 ? 2   DT  C "C2'" 1 
ATOM   4178 C  "C1'" . DT  C 2 2   ? -53.244 29.969 -12.704 1.00 111.47 ? 2   DT  C "C1'" 1 
ATOM   4179 N  N1    . DT  C 2 2   ? -54.400 29.977 -11.730 1.00 116.76 ? 2   DT  C N1    1 
ATOM   4180 C  C2    . DT  C 2 2   ? -55.162 31.127 -11.533 1.00 118.97 ? 2   DT  C C2    1 
ATOM   4181 O  O2    . DT  C 2 2   ? -54.979 32.191 -12.099 1.00 118.94 ? 2   DT  C O2    1 
ATOM   4182 N  N3    . DT  C 2 2   ? -56.185 30.999 -10.617 1.00 121.96 ? 2   DT  C N3    1 
ATOM   4183 C  C4    . DT  C 2 2   ? -56.538 29.876 -9.876  1.00 123.36 ? 2   DT  C C4    1 
ATOM   4184 O  O4    . DT  C 2 2   ? -57.479 29.888 -9.082  1.00 124.77 ? 2   DT  C O4    1 
ATOM   4185 C  C5    . DT  C 2 2   ? -55.712 28.706 -10.115 1.00 122.60 ? 2   DT  C C5    1 
ATOM   4186 C  C7    . DT  C 2 2   ? -55.978 27.420 -9.378  1.00 123.62 ? 2   DT  C C7    1 
ATOM   4187 C  C6    . DT  C 2 2   ? -54.705 28.822 -11.012 1.00 120.03 ? 2   DT  C C6    1 
ATOM   4188 P  P     . DT  C 2 3   ? -49.329 31.498 -14.444 1.00 92.11  ? 3   DT  C P     1 
ATOM   4189 O  OP1   . DT  C 2 3   ? -48.422 30.748 -15.324 1.00 91.15  ? 3   DT  C OP1   1 
ATOM   4190 O  OP2   . DT  C 2 3   ? -48.831 32.159 -13.221 1.00 91.72  ? 3   DT  C OP2   1 
ATOM   4191 O  "O5'" . DT  C 2 3   ? -49.986 32.638 -15.325 1.00 90.12  ? 3   DT  C "O5'" 1 
ATOM   4192 C  "C5'" . DT  C 2 3   ? -51.382 32.784 -15.346 1.00 89.68  ? 3   DT  C "C5'" 1 
ATOM   4193 C  "C4'" . DT  C 2 3   ? -51.787 34.234 -15.557 1.00 89.08  ? 3   DT  C "C4'" 1 
ATOM   4194 O  "O4'" . DT  C 2 3   ? -52.540 34.646 -14.391 1.00 90.24  ? 3   DT  C "O4'" 1 
ATOM   4195 C  "C3'" . DT  C 2 3   ? -50.685 35.293 -15.735 1.00 85.88  ? 3   DT  C "C3'" 1 
ATOM   4196 O  "O3'" . DT  C 2 3   ? -51.202 36.483 -16.367 1.00 83.11  ? 3   DT  C "O3'" 1 
ATOM   4197 C  "C2'" . DT  C 2 3   ? -50.355 35.582 -14.286 1.00 86.41  ? 3   DT  C "C2'" 1 
ATOM   4198 C  "C1'" . DT  C 2 3   ? -51.774 35.617 -13.717 1.00 89.90  ? 3   DT  C "C1'" 1 
ATOM   4199 N  N1    . DT  C 2 3   ? -51.805 35.360 -12.261 1.00 92.81  ? 3   DT  C N1    1 
ATOM   4200 C  C2    . DT  C 2 3   ? -52.607 36.175 -11.489 1.00 94.79  ? 3   DT  C C2    1 
ATOM   4201 O  O2    . DT  C 2 3   ? -53.291 37.074 -11.952 1.00 95.54  ? 3   DT  C O2    1 
ATOM   4202 N  N3    . DT  C 2 3   ? -52.565 35.904 -10.145 1.00 96.35  ? 3   DT  C N3    1 
ATOM   4203 C  C4    . DT  C 2 3   ? -51.814 34.916 -9.531  1.00 96.12  ? 3   DT  C C4    1 
ATOM   4204 O  O4    . DT  C 2 3   ? -51.837 34.747 -8.322  1.00 98.81  ? 3   DT  C O4    1 
ATOM   4205 C  C5    . DT  C 2 3   ? -51.002 34.098 -10.393 1.00 94.15  ? 3   DT  C C5    1 
ATOM   4206 C  C7    . DT  C 2 3   ? -50.162 33.009 -9.807  1.00 93.54  ? 3   DT  C C7    1 
ATOM   4207 C  C6    . DT  C 2 3   ? -51.028 34.353 -11.707 1.00 93.19  ? 3   DT  C C6    1 
ATOM   4208 P  P     . DG  C 2 4   ? -50.663 37.044 -17.767 1.00 79.63  ? 4   DG  C P     1 
ATOM   4209 O  OP1   . DG  C 2 4   ? -51.493 38.203 -18.176 1.00 78.90  ? 4   DG  C OP1   1 
ATOM   4210 O  OP2   . DG  C 2 4   ? -50.467 35.886 -18.679 1.00 79.05  ? 4   DG  C OP2   1 
ATOM   4211 O  "O5'" . DG  C 2 4   ? -49.263 37.653 -17.326 1.00 77.41  ? 4   DG  C "O5'" 1 
ATOM   4212 C  "C5'" . DG  C 2 4   ? -49.291 38.869 -16.617 1.00 76.12  ? 4   DG  C "C5'" 1 
ATOM   4213 C  "C4'" . DG  C 2 4   ? -47.923 39.146 -16.059 1.00 75.22  ? 4   DG  C "C4'" 1 
ATOM   4214 O  "O4'" . DG  C 2 4   ? -47.005 39.133 -17.175 1.00 75.01  ? 4   DG  C "O4'" 1 
ATOM   4215 C  "C3'" . DG  C 2 4   ? -47.779 40.495 -15.363 1.00 75.07  ? 4   DG  C "C3'" 1 
ATOM   4216 O  "O3'" . DG  C 2 4   ? -47.315 40.257 -14.047 1.00 75.24  ? 4   DG  C "O3'" 1 
ATOM   4217 C  "C2'" . DG  C 2 4   ? -46.750 41.245 -16.212 1.00 74.40  ? 4   DG  C "C2'" 1 
ATOM   4218 C  "C1'" . DG  C 2 4   ? -46.022 40.113 -16.938 1.00 74.43  ? 4   DG  C "C1'" 1 
ATOM   4219 N  N9    . DG  C 2 4   ? -45.376 40.528 -18.185 1.00 73.76  ? 4   DG  C N9    1 
ATOM   4220 C  C8    . DG  C 2 4   ? -45.983 40.833 -19.371 1.00 74.06  ? 4   DG  C C8    1 
ATOM   4221 N  N7    . DG  C 2 4   ? -45.153 41.195 -20.306 1.00 74.32  ? 4   DG  C N7    1 
ATOM   4222 C  C5    . DG  C 2 4   ? -43.915 41.123 -19.704 1.00 73.76  ? 4   DG  C C5    1 
ATOM   4223 C  C6    . DG  C 2 4   ? -42.637 41.394 -20.232 1.00 74.22  ? 4   DG  C C6    1 
ATOM   4224 O  O6    . DG  C 2 4   ? -42.346 41.764 -21.370 1.00 75.63  ? 4   DG  C O6    1 
ATOM   4225 N  N1    . DG  C 2 4   ? -41.626 41.205 -19.298 1.00 74.23  ? 4   DG  C N1    1 
ATOM   4226 C  C2    . DG  C 2 4   ? -41.833 40.798 -17.999 1.00 74.69  ? 4   DG  C C2    1 
ATOM   4227 N  N2    . DG  C 2 4   ? -40.736 40.670 -17.233 1.00 75.82  ? 4   DG  C N2    1 
ATOM   4228 N  N3    . DG  C 2 4   ? -43.033 40.531 -17.489 1.00 74.24  ? 4   DG  C N3    1 
ATOM   4229 C  C4    . DG  C 2 4   ? -44.029 40.716 -18.397 1.00 73.75  ? 4   DG  C C4    1 
ATOM   4230 P  P     . DT  C 2 5   ? -47.029 41.406 -12.964 1.00 76.37  ? 5   DT  C P     1 
ATOM   4231 O  OP1   . DT  C 2 5   ? -46.843 40.650 -11.702 1.00 76.32  ? 5   DT  C OP1   1 
ATOM   4232 O  OP2   . DT  C 2 5   ? -48.101 42.436 -13.007 1.00 77.18  ? 5   DT  C OP2   1 
ATOM   4233 O  "O5'" . DT  C 2 5   ? -45.657 42.097 -13.453 1.00 74.40  ? 5   DT  C "O5'" 1 
ATOM   4234 C  "C5'" . DT  C 2 5   ? -44.417 41.481 -13.109 1.00 74.74  ? 5   DT  C "C5'" 1 
ATOM   4235 C  "C4'" . DT  C 2 5   ? -43.193 42.330 -13.401 1.00 74.80  ? 5   DT  C "C4'" 1 
ATOM   4236 O  "O4'" . DT  C 2 5   ? -42.927 42.424 -14.826 1.00 74.51  ? 5   DT  C "O4'" 1 
ATOM   4237 C  "C3'" . DT  C 2 5   ? -43.272 43.761 -12.879 1.00 75.42  ? 5   DT  C "C3'" 1 
ATOM   4238 O  "O3'" . DT  C 2 5   ? -42.159 43.966 -12.035 1.00 75.08  ? 5   DT  C "O3'" 1 
ATOM   4239 C  "C2'" . DT  C 2 5   ? -43.202 44.665 -14.117 1.00 75.39  ? 5   DT  C "C2'" 1 
ATOM   4240 C  "C1'" . DT  C 2 5   ? -42.524 43.750 -15.137 1.00 74.79  ? 5   DT  C "C1'" 1 
ATOM   4241 N  N1    . DT  C 2 5   ? -42.846 44.004 -16.579 1.00 74.47  ? 5   DT  C N1    1 
ATOM   4242 C  C2    . DT  C 2 5   ? -41.814 44.195 -17.470 1.00 74.74  ? 5   DT  C C2    1 
ATOM   4243 O  O2    . DT  C 2 5   ? -40.647 44.189 -17.141 1.00 75.71  ? 5   DT  C O2    1 
ATOM   4244 N  N3    . DT  C 2 5   ? -42.183 44.395 -18.779 1.00 74.61  ? 5   DT  C N3    1 
ATOM   4245 C  C4    . DT  C 2 5   ? -43.464 44.419 -19.276 1.00 74.37  ? 5   DT  C C4    1 
ATOM   4246 O  O4    . DT  C 2 5   ? -43.692 44.604 -20.458 1.00 74.24  ? 5   DT  C O4    1 
ATOM   4247 C  C5    . DT  C 2 5   ? -44.501 44.213 -18.299 1.00 75.05  ? 5   DT  C C5    1 
ATOM   4248 C  C7    . DT  C 2 5   ? -45.934 44.227 -18.722 1.00 76.08  ? 5   DT  C C7    1 
ATOM   4249 C  C6    . DT  C 2 5   ? -44.157 44.012 -17.016 1.00 75.04  ? 5   DT  C C6    1 
ATOM   4250 P  P     . DC  C 2 6   ? -42.189 45.099 -10.920 1.00 74.26  ? 6   DC  C P     1 
ATOM   4251 O  OP1   . DC  C 2 6   ? -41.479 44.572 -9.725  1.00 74.79  ? 6   DC  C OP1   1 
ATOM   4252 O  OP2   . DC  C 2 6   ? -43.560 45.639 -10.831 1.00 74.59  ? 6   DC  C OP2   1 
ATOM   4253 O  "O5'" . DC  C 2 6   ? -41.294 46.218 -11.607 1.00 74.30  ? 6   DC  C "O5'" 1 
ATOM   4254 C  "C5'" . DC  C 2 6   ? -39.905 45.968 -11.772 1.00 73.97  ? 6   DC  C "C5'" 1 
ATOM   4255 C  "C4'" . DC  C 2 6   ? -39.368 46.934 -12.793 1.00 72.31  ? 6   DC  C "C4'" 1 
ATOM   4256 O  "O4'" . DC  C 2 6   ? -40.091 46.762 -14.030 1.00 72.79  ? 6   DC  C "O4'" 1 
ATOM   4257 C  "C3'" . DC  C 2 6   ? -39.563 48.388 -12.436 1.00 70.74  ? 6   DC  C "C3'" 1 
ATOM   4258 O  "O3'" . DC  C 2 6   ? -38.332 48.933 -12.698 1.00 70.71  ? 6   DC  C "O3'" 1 
ATOM   4259 C  "C2'" . DC  C 2 6   ? -40.585 48.904 -13.448 1.00 70.94  ? 6   DC  C "C2'" 1 
ATOM   4260 C  "C1'" . DC  C 2 6   ? -40.215 48.027 -14.631 1.00 71.85  ? 6   DC  C "C1'" 1 
ATOM   4261 N  N1    . DC  C 2 6   ? -41.169 47.892 -15.771 1.00 72.10  ? 6   DC  C N1    1 
ATOM   4262 C  C2    . DC  C 2 6   ? -40.657 47.764 -17.075 1.00 72.04  ? 6   DC  C C2    1 
ATOM   4263 O  O2    . DC  C 2 6   ? -39.427 47.790 -17.263 1.00 70.35  ? 6   DC  C O2    1 
ATOM   4264 N  N3    . DC  C 2 6   ? -41.544 47.626 -18.108 1.00 72.70  ? 6   DC  C N3    1 
ATOM   4265 C  C4    . DC  C 2 6   ? -42.865 47.600 -17.891 1.00 72.03  ? 6   DC  C C4    1 
ATOM   4266 N  N4    . DC  C 2 6   ? -43.681 47.464 -18.941 1.00 70.28  ? 6   DC  C N4    1 
ATOM   4267 C  C5    . DC  C 2 6   ? -43.391 47.716 -16.567 1.00 73.33  ? 6   DC  C C5    1 
ATOM   4268 C  C6    . DC  C 2 6   ? -42.518 47.851 -15.553 1.00 73.01  ? 6   DC  C C6    1 
ATOM   4269 P  P     . DA  C 2 7   ? -37.691 49.914 -11.641 1.00 71.86  ? 7   DA  C P     1 
ATOM   4270 O  OP1   . DA  C 2 7   ? -37.170 49.031 -10.578 1.00 72.84  ? 7   DA  C OP1   1 
ATOM   4271 O  OP2   . DA  C 2 7   ? -38.656 51.024 -11.365 1.00 70.73  ? 7   DA  C OP2   1 
ATOM   4272 O  "O5'" . DA  C 2 7   ? -36.437 50.523 -12.424 1.00 72.23  ? 7   DA  C "O5'" 1 
ATOM   4273 C  "C5'" . DA  C 2 7   ? -35.286 49.737 -12.662 1.00 74.08  ? 7   DA  C "C5'" 1 
ATOM   4274 C  "C4'" . DA  C 2 7   ? -34.523 50.231 -13.884 1.00 75.27  ? 7   DA  C "C4'" 1 
ATOM   4275 O  "O4'" . DA  C 2 7   ? -35.304 50.099 -15.091 1.00 74.57  ? 7   DA  C "O4'" 1 
ATOM   4276 C  "C3'" . DA  C 2 7   ? -34.094 51.688 -13.909 1.00 76.10  ? 7   DA  C "C3'" 1 
ATOM   4277 O  "O3'" . DA  C 2 7   ? -32.933 51.717 -14.718 1.00 78.05  ? 7   DA  C "O3'" 1 
ATOM   4278 C  "C2'" . DA  C 2 7   ? -35.271 52.386 -14.580 1.00 74.62  ? 7   DA  C "C2'" 1 
ATOM   4279 C  "C1'" . DA  C 2 7   ? -35.580 51.364 -15.658 1.00 74.63  ? 7   DA  C "C1'" 1 
ATOM   4280 N  N9    . DA  C 2 7   ? -36.970 51.251 -16.029 1.00 74.42  ? 7   DA  C N9    1 
ATOM   4281 C  C8    . DA  C 2 7   ? -37.992 51.087 -15.154 1.00 75.37  ? 7   DA  C C8    1 
ATOM   4282 N  N7    . DA  C 2 7   ? -39.165 50.976 -15.730 1.00 76.38  ? 7   DA  C N7    1 
ATOM   4283 C  C5    . DA  C 2 7   ? -38.887 51.059 -17.077 1.00 75.05  ? 7   DA  C C5    1 
ATOM   4284 C  C6    . DA  C 2 7   ? -39.735 51.008 -18.199 1.00 74.45  ? 7   DA  C C6    1 
ATOM   4285 N  N6    . DA  C 2 7   ? -41.056 50.849 -18.104 1.00 74.00  ? 7   DA  C N6    1 
ATOM   4286 N  N1    . DA  C 2 7   ? -39.168 51.121 -19.408 1.00 74.38  ? 7   DA  C N1    1 
ATOM   4287 C  C2    . DA  C 2 7   ? -37.833 51.275 -19.453 1.00 75.94  ? 7   DA  C C2    1 
ATOM   4288 N  N3    . DA  C 2 7   ? -36.923 51.339 -18.471 1.00 75.29  ? 7   DA  C N3    1 
ATOM   4289 C  C4    . DA  C 2 7   ? -37.530 51.222 -17.284 1.00 74.80  ? 7   DA  C C4    1 
ATOM   4290 P  P     . DT  C 2 8   ? -31.961 52.979 -14.721 1.00 80.37  ? 8   DT  C P     1 
ATOM   4291 O  OP1   . DT  C 2 8   ? -30.564 52.482 -14.785 1.00 80.80  ? 8   DT  C OP1   1 
ATOM   4292 O  OP2   . DT  C 2 8   ? -32.380 53.877 -13.612 1.00 80.27  ? 8   DT  C OP2   1 
ATOM   4293 O  "O5'" . DT  C 2 8   ? -32.375 53.729 -16.077 1.00 80.37  ? 8   DT  C "O5'" 1 
ATOM   4294 C  "C5'" . DT  C 2 8   ? -32.729 53.032 -17.252 1.00 82.54  ? 8   DT  C "C5'" 1 
ATOM   4295 C  "C4'" . DT  C 2 8   ? -33.267 53.961 -18.328 1.00 83.90  ? 8   DT  C "C4'" 1 
ATOM   4296 O  "O4'" . DT  C 2 8   ? -34.694 53.768 -18.497 1.00 83.32  ? 8   DT  C "O4'" 1 
ATOM   4297 C  "C3'" . DT  C 2 8   ? -33.064 55.450 -18.086 1.00 85.24  ? 8   DT  C "C3'" 1 
ATOM   4298 O  "O3'" . DT  C 2 8   ? -32.429 56.034 -19.217 1.00 87.74  ? 8   DT  C "O3'" 1 
ATOM   4299 C  "C2'" . DT  C 2 8   ? -34.477 55.997 -17.908 1.00 83.97  ? 8   DT  C "C2'" 1 
ATOM   4300 C  "C1'" . DT  C 2 8   ? -35.312 55.015 -18.703 1.00 82.67  ? 8   DT  C "C1'" 1 
ATOM   4301 N  N1    . DT  C 2 8   ? -36.664 54.827 -18.197 1.00 81.76  ? 8   DT  C N1    1 
ATOM   4302 C  C2    . DT  C 2 8   ? -37.671 54.609 -19.098 1.00 81.52  ? 8   DT  C C2    1 
ATOM   4303 O  O2    . DT  C 2 8   ? -37.476 54.596 -20.290 1.00 81.75  ? 8   DT  C O2    1 
ATOM   4304 N  N3    . DT  C 2 8   ? -38.913 54.411 -18.550 1.00 81.74  ? 8   DT  C N3    1 
ATOM   4305 C  C4    . DT  C 2 8   ? -39.233 54.417 -17.198 1.00 82.31  ? 8   DT  C C4    1 
ATOM   4306 O  O4    . DT  C 2 8   ? -40.383 54.242 -16.776 1.00 82.22  ? 8   DT  C O4    1 
ATOM   4307 C  C5    . DT  C 2 8   ? -38.112 54.646 -16.309 1.00 82.49  ? 8   DT  C C5    1 
ATOM   4308 C  C7    . DT  C 2 8   ? -38.322 54.672 -14.824 1.00 83.72  ? 8   DT  C C7    1 
ATOM   4309 C  C6    . DT  C 2 8   ? -36.898 54.831 -16.840 1.00 81.95  ? 8   DT  C C6    1 
ATOM   4310 P  P     . DG  C 2 9   ? -31.465 57.309 -19.052 1.00 90.62  ? 9   DG  C P     1 
ATOM   4311 O  OP1   . DG  C 2 9   ? -30.177 56.797 -19.581 1.00 92.11  ? 9   DG  C OP1   1 
ATOM   4312 O  OP2   . DG  C 2 9   ? -31.608 57.959 -17.706 1.00 88.17  ? 9   DG  C OP2   1 
ATOM   4313 O  "O5'" . DG  C 2 9   ? -32.014 58.378 -20.112 1.00 88.47  ? 9   DG  C "O5'" 1 
ATOM   4314 C  "C5'" . DG  C 2 9   ? -32.379 58.017 -21.436 1.00 84.81  ? 9   DG  C "C5'" 1 
ATOM   4315 C  "C4'" . DG  C 2 9   ? -33.519 58.930 -21.841 1.00 81.78  ? 9   DG  C "C4'" 1 
ATOM   4316 O  "O4'" . DG  C 2 9   ? -34.710 58.632 -21.075 1.00 79.73  ? 9   DG  C "O4'" 1 
ATOM   4317 C  "C3'" . DG  C 2 9   ? -33.270 60.403 -21.581 1.00 81.11  ? 9   DG  C "C3'" 1 
ATOM   4318 O  "O3'" . DG  C 2 9   ? -33.893 61.129 -22.618 1.00 81.68  ? 9   DG  C "O3'" 1 
ATOM   4319 C  "C2'" . DG  C 2 9   ? -33.955 60.637 -20.241 1.00 79.58  ? 9   DG  C "C2'" 1 
ATOM   4320 C  "C1'" . DG  C 2 9   ? -35.203 59.809 -20.476 1.00 78.67  ? 9   DG  C "C1'" 1 
ATOM   4321 N  N9    . DG  C 2 9   ? -35.905 59.351 -19.291 1.00 77.19  ? 9   DG  C N9    1 
ATOM   4322 C  C8    . DG  C 2 9   ? -35.422 59.254 -18.014 1.00 77.09  ? 9   DG  C C8    1 
ATOM   4323 N  N7    . DG  C 2 9   ? -36.288 58.783 -17.163 1.00 76.25  ? 9   DG  C N7    1 
ATOM   4324 C  C5    . DG  C 2 9   ? -37.412 58.541 -17.936 1.00 76.03  ? 9   DG  C C5    1 
ATOM   4325 C  C6    . DG  C 2 9   ? -38.675 58.020 -17.566 1.00 75.50  ? 9   DG  C C6    1 
ATOM   4326 O  O6    . DG  C 2 9   ? -39.026 57.662 -16.443 1.00 75.76  ? 9   DG  C O6    1 
ATOM   4327 N  N1    . DG  C 2 9   ? -39.566 57.936 -18.635 1.00 75.04  ? 9   DG  C N1    1 
ATOM   4328 C  C2    . DG  C 2 9   ? -39.244 58.306 -19.924 1.00 76.21  ? 9   DG  C C2    1 
ATOM   4329 N  N2    . DG  C 2 9   ? -40.196 58.157 -20.857 1.00 76.30  ? 9   DG  C N2    1 
ATOM   4330 N  N3    . DG  C 2 9   ? -38.060 58.800 -20.283 1.00 76.78  ? 9   DG  C N3    1 
ATOM   4331 C  C4    . DG  C 2 9   ? -37.194 58.888 -19.244 1.00 76.39  ? 9   DG  C C4    1 
ATOM   4332 P  P     . DG  C 2 10  ? -33.007 61.668 -23.833 1.00 83.40  ? 10  DG  C P     1 
ATOM   4333 O  OP1   . DG  C 2 10  ? -32.480 60.537 -24.639 1.00 83.97  ? 10  DG  C OP1   1 
ATOM   4334 O  OP2   . DG  C 2 10  ? -32.084 62.682 -23.271 1.00 83.27  ? 10  DG  C OP2   1 
ATOM   4335 O  "O5'" . DG  C 2 10  ? -34.126 62.341 -24.740 1.00 82.99  ? 10  DG  C "O5'" 1 
ATOM   4336 C  "C5'" . DG  C 2 10  ? -34.731 63.520 -24.355 1.00 83.27  ? 10  DG  C "C5'" 1 
ATOM   4337 C  "C4'" . DG  C 2 10  ? -36.132 63.403 -24.872 1.00 83.99  ? 10  DG  C "C4'" 1 
ATOM   4338 O  "O4'" . DG  C 2 10  ? -36.843 62.536 -23.965 1.00 83.19  ? 10  DG  C "O4'" 1 
ATOM   4339 C  "C3'" . DG  C 2 10  ? -36.898 64.709 -24.897 1.00 85.98  ? 10  DG  C "C3'" 1 
ATOM   4340 O  "O3'" . DG  C 2 10  ? -37.851 64.641 -25.926 1.00 88.81  ? 10  DG  C "O3'" 1 
ATOM   4341 C  "C2'" . DG  C 2 10  ? -37.595 64.726 -23.542 1.00 84.61  ? 10  DG  C "C2'" 1 
ATOM   4342 C  "C1'" . DG  C 2 10  ? -37.889 63.250 -23.337 1.00 83.23  ? 10  DG  C "C1'" 1 
ATOM   4343 N  N9    . DG  C 2 10  ? -37.888 62.880 -21.933 1.00 82.31  ? 10  DG  C N9    1 
ATOM   4344 C  C8    . DG  C 2 10  ? -36.859 63.041 -21.045 1.00 81.95  ? 10  DG  C C8    1 
ATOM   4345 N  N7    . DG  C 2 10  ? -37.150 62.612 -19.854 1.00 81.51  ? 10  DG  C N7    1 
ATOM   4346 C  C5    . DG  C 2 10  ? -38.444 62.136 -19.959 1.00 80.76  ? 10  DG  C C5    1 
ATOM   4347 C  C6    . DG  C 2 10  ? -39.274 61.552 -18.983 1.00 79.93  ? 10  DG  C C6    1 
ATOM   4348 O  O6    . DG  C 2 10  ? -38.999 61.345 -17.802 1.00 80.11  ? 10  DG  C O6    1 
ATOM   4349 N  N1    . DG  C 2 10  ? -40.524 61.207 -19.487 1.00 79.37  ? 10  DG  C N1    1 
ATOM   4350 C  C2    . DG  C 2 10  ? -40.897 61.408 -20.795 1.00 80.12  ? 10  DG  C C2    1 
ATOM   4351 N  N2    . DG  C 2 10  ? -42.120 61.016 -21.133 1.00 80.83  ? 10  DG  C N2    1 
ATOM   4352 N  N3    . DG  C 2 10  ? -40.136 61.954 -21.729 1.00 81.53  ? 10  DG  C N3    1 
ATOM   4353 C  C4    . DG  C 2 10  ? -38.919 62.297 -21.236 1.00 81.69  ? 10  DG  C C4    1 
ATOM   4354 P  P     . DA  C 2 11  ? -38.786 65.896 -26.220 1.00 90.82  ? 11  DA  C P     1 
ATOM   4355 O  OP1   . DA  C 2 11  ? -38.441 66.285 -27.610 1.00 91.83  ? 11  DA  C OP1   1 
ATOM   4356 O  OP2   . DA  C 2 11  ? -38.681 66.844 -25.072 1.00 89.78  ? 11  DA  C OP2   1 
ATOM   4357 O  "O5'" . DA  C 2 11  ? -40.267 65.315 -26.237 1.00 89.99  ? 11  DA  C "O5'" 1 
ATOM   4358 C  "C5'" . DA  C 2 11  ? -40.665 64.432 -25.237 1.00 90.26  ? 11  DA  C "C5'" 1 
ATOM   4359 C  "C4'" . DA  C 2 11  ? -42.146 64.584 -24.997 1.00 91.83  ? 11  DA  C "C4'" 1 
ATOM   4360 O  "O4'" . DA  C 2 11  ? -42.421 64.272 -23.614 1.00 91.57  ? 11  DA  C "O4'" 1 
ATOM   4361 C  "C3'" . DA  C 2 11  ? -42.733 65.971 -25.212 1.00 93.42  ? 11  DA  C "C3'" 1 
ATOM   4362 O  "O3'" . DA  C 2 11  ? -44.131 65.755 -25.555 1.00 95.20  ? 11  DA  C "O3'" 1 
ATOM   4363 C  "C2'" . DA  C 2 11  ? -42.423 66.644 -23.869 1.00 92.86  ? 11  DA  C "C2'" 1 
ATOM   4364 C  "C1'" . DA  C 2 11  ? -42.563 65.477 -22.885 1.00 92.27  ? 11  DA  C "C1'" 1 
ATOM   4365 N  N9    . DA  C 2 11  ? -41.604 65.415 -21.781 1.00 91.95  ? 11  DA  C N9    1 
ATOM   4366 C  C8    . DA  C 2 11  ? -40.303 65.838 -21.743 1.00 92.00  ? 11  DA  C C8    1 
ATOM   4367 N  N7    . DA  C 2 11  ? -39.702 65.627 -20.594 1.00 90.66  ? 11  DA  C N7    1 
ATOM   4368 C  C5    . DA  C 2 11  ? -40.675 65.027 -19.835 1.00 90.12  ? 11  DA  C C5    1 
ATOM   4369 C  C6    . DA  C 2 11  ? -40.670 64.556 -18.523 1.00 90.00  ? 11  DA  C C6    1 
ATOM   4370 N  N6    . DA  C 2 11  ? -39.595 64.636 -17.746 1.00 90.58  ? 11  DA  C N6    1 
ATOM   4371 N  N1    . DA  C 2 11  ? -41.798 63.994 -18.043 1.00 90.41  ? 11  DA  C N1    1 
ATOM   4372 C  C2    . DA  C 2 11  ? -42.871 63.914 -18.846 1.00 91.31  ? 11  DA  C C2    1 
ATOM   4373 N  N3    . DA  C 2 11  ? -43.000 64.327 -20.110 1.00 91.49  ? 11  DA  C N3    1 
ATOM   4374 C  C4    . DA  C 2 11  ? -41.850 64.878 -20.543 1.00 91.19  ? 11  DA  C C4    1 
ATOM   4375 P  P     . DA  C 2 12  ? -45.389 66.692 -25.201 1.00 96.50  ? 12  DA  C P     1 
ATOM   4376 O  OP1   . DA  C 2 12  ? -46.510 66.232 -26.050 1.00 97.40  ? 12  DA  C OP1   1 
ATOM   4377 O  OP2   . DA  C 2 12  ? -44.941 68.104 -25.201 1.00 97.43  ? 12  DA  C OP2   1 
ATOM   4378 O  "O5'" . DA  C 2 12  ? -45.751 66.360 -23.682 1.00 95.65  ? 12  DA  C "O5'" 1 
ATOM   4379 C  "C5'" . DA  C 2 12  ? -46.631 65.296 -23.345 1.00 95.02  ? 12  DA  C "C5'" 1 
ATOM   4380 C  "C4'" . DA  C 2 12  ? -47.312 65.563 -22.010 1.00 94.92  ? 12  DA  C "C4'" 1 
ATOM   4381 O  "O4'" . DA  C 2 12  ? -46.380 65.678 -20.894 1.00 94.07  ? 12  DA  C "O4'" 1 
ATOM   4382 C  "C3'" . DA  C 2 12  ? -48.169 66.813 -21.936 1.00 96.24  ? 12  DA  C "C3'" 1 
ATOM   4383 O  "O3'" . DA  C 2 12  ? -49.322 66.363 -21.237 1.00 97.59  ? 12  DA  C "O3'" 1 
ATOM   4384 C  "C2'" . DA  C 2 12  ? -47.286 67.830 -21.196 1.00 95.25  ? 12  DA  C "C2'" 1 
ATOM   4385 C  "C1'" . DA  C 2 12  ? -46.475 66.945 -20.247 1.00 93.43  ? 12  DA  C "C1'" 1 
ATOM   4386 N  N9    . DA  C 2 12  ? -45.082 67.306 -19.937 1.00 90.96  ? 12  DA  C N9    1 
ATOM   4387 C  C8    . DA  C 2 12  ? -44.127 67.803 -20.782 1.00 90.95  ? 12  DA  C C8    1 
ATOM   4388 N  N7    . DA  C 2 12  ? -42.950 67.990 -20.233 1.00 89.76  ? 12  DA  C N7    1 
ATOM   4389 C  C5    . DA  C 2 12  ? -43.142 67.572 -18.935 1.00 88.95  ? 12  DA  C C5    1 
ATOM   4390 C  C6    . DA  C 2 12  ? -42.275 67.506 -17.829 1.00 88.51  ? 12  DA  C C6    1 
ATOM   4391 N  N6    . DA  C 2 12  ? -41.002 67.888 -17.888 1.00 88.87  ? 12  DA  C N6    1 
ATOM   4392 N  N1    . DA  C 2 12  ? -42.759 67.043 -16.659 1.00 88.08  ? 12  DA  C N1    1 
ATOM   4393 C  C2    . DA  C 2 12  ? -44.040 66.662 -16.617 1.00 88.55  ? 12  DA  C C2    1 
ATOM   4394 N  N3    . DA  C 2 12  ? -44.953 66.675 -17.592 1.00 89.09  ? 12  DA  C N3    1 
ATOM   4395 C  C4    . DA  C 2 12  ? -44.438 67.145 -18.736 1.00 89.25  ? 12  DA  C C4    1 
ATOM   4396 P  P     . DT  C 2 13  ? -50.437 67.328 -20.640 1.00 99.54  ? 13  DT  C P     1 
ATOM   4397 O  OP1   . DT  C 2 13  ? -51.729 66.603 -20.591 1.00 100.31 ? 13  DT  C OP1   1 
ATOM   4398 O  OP2   . DT  C 2 13  ? -50.333 68.634 -21.325 1.00 100.70 ? 13  DT  C OP2   1 
ATOM   4399 O  "O5'" . DT  C 2 13  ? -49.881 67.520 -19.160 1.00 98.79  ? 13  DT  C "O5'" 1 
ATOM   4400 C  "C5'" . DT  C 2 13  ? -49.963 66.467 -18.224 1.00 98.15  ? 13  DT  C "C5'" 1 
ATOM   4401 C  "C4'" . DT  C 2 13  ? -49.478 67.000 -16.898 1.00 97.54  ? 13  DT  C "C4'" 1 
ATOM   4402 O  "O4'" . DT  C 2 13  ? -48.138 67.502 -17.062 1.00 96.16  ? 13  DT  C "O4'" 1 
ATOM   4403 C  "C3'" . DT  C 2 13  ? -50.292 68.170 -16.359 1.00 98.84  ? 13  DT  C "C3'" 1 
ATOM   4404 O  "O3'" . DT  C 2 13  ? -50.877 67.706 -15.155 1.00 99.02  ? 13  DT  C "O3'" 1 
ATOM   4405 C  "C2'" . DT  C 2 13  ? -49.279 69.305 -16.175 1.00 98.09  ? 13  DT  C "C2'" 1 
ATOM   4406 C  "C1'" . DT  C 2 13  ? -47.965 68.540 -16.131 1.00 96.46  ? 13  DT  C "C1'" 1 
ATOM   4407 N  N1    . DT  C 2 13  ? -46.719 69.256 -16.541 1.00 96.26  ? 13  DT  C N1    1 
ATOM   4408 C  C2    . DT  C 2 13  ? -45.673 69.352 -15.638 1.00 95.44  ? 13  DT  C C2    1 
ATOM   4409 O  O2    . DT  C 2 13  ? -45.709 68.903 -14.506 1.00 95.34  ? 13  DT  C O2    1 
ATOM   4410 N  N3    . DT  C 2 13  ? -44.565 70.006 -16.110 1.00 95.30  ? 13  DT  C N3    1 
ATOM   4411 C  C4    . DT  C 2 13  ? -44.406 70.554 -17.374 1.00 96.57  ? 13  DT  C C4    1 
ATOM   4412 O  O4    . DT  C 2 13  ? -43.376 71.125 -17.716 1.00 97.02  ? 13  DT  C O4    1 
ATOM   4413 C  C5    . DT  C 2 13  ? -45.527 70.416 -18.273 1.00 97.20  ? 13  DT  C C5    1 
ATOM   4414 C  C7    . DT  C 2 13  ? -45.448 70.982 -19.663 1.00 97.65  ? 13  DT  C C7    1 
ATOM   4415 C  C6    . DT  C 2 13  ? -46.618 69.779 -17.820 1.00 97.22  ? 13  DT  C C6    1 
ATOM   4416 P  P     . DT  C 2 14  ? -51.737 68.618 -14.164 1.00 100.24 ? 14  DT  C P     1 
ATOM   4417 O  OP1   . DT  C 2 14  ? -52.722 67.687 -13.566 1.00 100.08 ? 14  DT  C OP1   1 
ATOM   4418 O  OP2   . DT  C 2 14  ? -52.112 69.912 -14.797 1.00 100.32 ? 14  DT  C OP2   1 
ATOM   4419 O  "O5'" . DT  C 2 14  ? -50.660 68.983 -13.050 1.00 99.43  ? 14  DT  C "O5'" 1 
ATOM   4420 C  "C5'" . DT  C 2 14  ? -50.034 67.954 -12.282 1.00 96.81  ? 14  DT  C "C5'" 1 
ATOM   4421 C  "C4'" . DT  C 2 14  ? -49.036 68.597 -11.344 1.00 94.32  ? 14  DT  C "C4'" 1 
ATOM   4422 O  "O4'" . DT  C 2 14  ? -47.978 69.205 -12.124 1.00 91.54  ? 14  DT  C "O4'" 1 
ATOM   4423 C  "C3'" . DT  C 2 14  ? -49.662 69.695 -10.496 1.00 95.53  ? 14  DT  C "C3'" 1 
ATOM   4424 O  "O3'" . DT  C 2 14  ? -49.424 69.385 -9.125  1.00 97.11  ? 14  DT  C "O3'" 1 
ATOM   4425 C  "C2'" . DT  C 2 14  ? -49.001 70.982 -11.001 1.00 94.17  ? 14  DT  C "C2'" 1 
ATOM   4426 C  "C1'" . DT  C 2 14  ? -47.695 70.480 -11.593 1.00 91.05  ? 14  DT  C "C1'" 1 
ATOM   4427 N  N1    . DT  C 2 14  ? -47.093 71.316 -12.682 1.00 89.51  ? 14  DT  C N1    1 
ATOM   4428 C  C2    . DT  C 2 14  ? -45.751 71.671 -12.599 1.00 88.26  ? 14  DT  C C2    1 
ATOM   4429 O  O2    . DT  C 2 14  ? -45.000 71.368 -11.688 1.00 87.09  ? 14  DT  C O2    1 
ATOM   4430 N  N3    . DT  C 2 14  ? -45.284 72.424 -13.645 1.00 88.31  ? 14  DT  C N3    1 
ATOM   4431 C  C4    . DT  C 2 14  ? -45.997 72.850 -14.746 1.00 88.71  ? 14  DT  C C4    1 
ATOM   4432 O  O4    . DT  C 2 14  ? -45.489 73.521 -15.631 1.00 88.94  ? 14  DT  C O4    1 
ATOM   4433 C  C5    . DT  C 2 14  ? -47.378 72.454 -14.782 1.00 89.71  ? 14  DT  C C5    1 
ATOM   4434 C  C7    . DT  C 2 14  ? -48.211 72.883 -15.952 1.00 90.94  ? 14  DT  C C7    1 
ATOM   4435 C  C6    . DT  C 2 14  ? -47.863 71.714 -13.764 1.00 90.00  ? 14  DT  C C6    1 
ATOM   4436 P  P     . DT  C 2 15  ? -49.739 70.382 -7.902  1.00 99.85  ? 15  DT  C P     1 
ATOM   4437 O  OP1   . DT  C 2 15  ? -50.204 69.562 -6.757  1.00 100.10 ? 15  DT  C OP1   1 
ATOM   4438 O  OP2   . DT  C 2 15  ? -50.541 71.544 -8.362  1.00 100.40 ? 15  DT  C OP2   1 
ATOM   4439 O  "O5'" . DT  C 2 15  ? -48.282 70.948 -7.581  1.00 98.91  ? 15  DT  C "O5'" 1 
ATOM   4440 C  "C5'" . DT  C 2 15  ? -47.155 70.104 -7.345  1.00 97.46  ? 15  DT  C "C5'" 1 
ATOM   4441 C  "C4'" . DT  C 2 15  ? -45.920 70.980 -7.175  1.00 97.02  ? 15  DT  C "C4'" 1 
ATOM   4442 O  "O4'" . DT  C 2 15  ? -45.621 71.689 -8.404  1.00 96.25  ? 15  DT  C "O4'" 1 
ATOM   4443 C  "C3'" . DT  C 2 15  ? -46.027 72.067 -6.107  1.00 98.28  ? 15  DT  C "C3'" 1 
ATOM   4444 O  "O3'" . DT  C 2 15  ? -44.815 72.068 -5.372  1.00 97.59  ? 15  DT  C "O3'" 1 
ATOM   4445 C  "C2'" . DT  C 2 15  ? -46.248 73.372 -6.888  1.00 98.49  ? 15  DT  C "C2'" 1 
ATOM   4446 C  "C1'" . DT  C 2 15  ? -45.436 73.071 -8.136  1.00 96.50  ? 15  DT  C "C1'" 1 
ATOM   4447 N  N1    . DT  C 2 15  ? -45.762 73.833 -9.389  1.00 95.92  ? 15  DT  C N1    1 
ATOM   4448 C  C2    . DT  C 2 15  ? -44.701 74.426 -10.046 1.00 94.99  ? 15  DT  C C2    1 
ATOM   4449 O  O2    . DT  C 2 15  ? -43.545 74.388 -9.654  1.00 94.03  ? 15  DT  C O2    1 
ATOM   4450 N  N3    . DT  C 2 15  ? -45.047 75.086 -11.195 1.00 95.69  ? 15  DT  C N3    1 
ATOM   4451 C  C4    . DT  C 2 15  ? -46.310 75.212 -11.747 1.00 96.70  ? 15  DT  C C4    1 
ATOM   4452 O  O4    . DT  C 2 15  ? -46.503 75.828 -12.788 1.00 97.50  ? 15  DT  C O4    1 
ATOM   4453 C  C5    . DT  C 2 15  ? -47.379 74.572 -11.025 1.00 97.40  ? 15  DT  C C5    1 
ATOM   4454 C  C7    . DT  C 2 15  ? -48.778 74.667 -11.573 1.00 98.24  ? 15  DT  C C7    1 
ATOM   4455 C  C6    . DT  C 2 15  ? -47.059 73.911 -9.890  1.00 96.94  ? 15  DT  C C6    1 
ATOM   4456 P  P     . DT  C 2 16  ? -44.671 72.871 -3.997  1.00 98.73  ? 16  DT  C P     1 
ATOM   4457 O  OP1   . DT  C 2 16  ? -43.985 71.966 -3.054  1.00 99.06  ? 16  DT  C OP1   1 
ATOM   4458 O  OP2   . DT  C 2 16  ? -45.962 73.493 -3.622  1.00 99.91  ? 16  DT  C OP2   1 
ATOM   4459 O  "O5'" . DT  C 2 16  ? -43.663 74.031 -4.410  1.00 97.97  ? 16  DT  C "O5'" 1 
ATOM   4460 C  "C5'" . DT  C 2 16  ? -42.389 73.685 -4.916  1.00 97.26  ? 16  DT  C "C5'" 1 
ATOM   4461 C  "C4'" . DT  C 2 16  ? -41.744 74.925 -5.480  1.00 97.84  ? 16  DT  C "C4'" 1 
ATOM   4462 O  "O4'" . DT  C 2 16  ? -42.447 75.336 -6.676  1.00 97.84  ? 16  DT  C "O4'" 1 
ATOM   4463 C  "C3'" . DT  C 2 16  ? -41.793 76.106 -4.525  1.00 99.71  ? 16  DT  C "C3'" 1 
ATOM   4464 O  "O3'" . DT  C 2 16  ? -40.470 76.543 -4.383  1.00 100.79 ? 16  DT  C "O3'" 1 
ATOM   4465 C  "C2'" . DT  C 2 16  ? -42.687 77.148 -5.204  1.00 100.17 ? 16  DT  C "C2'" 1 
ATOM   4466 C  "C1'" . DT  C 2 16  ? -42.551 76.751 -6.674  1.00 98.52  ? 16  DT  C "C1'" 1 
ATOM   4467 N  N1    . DT  C 2 16  ? -43.650 77.169 -7.640  1.00 97.73  ? 16  DT  C N1    1 
ATOM   4468 C  C2    . DT  C 2 16  ? -43.285 77.800 -8.815  1.00 96.16  ? 16  DT  C C2    1 
ATOM   4469 O  O2    . DT  C 2 16  ? -42.137 78.057 -9.115  1.00 94.87  ? 16  DT  C O2    1 
ATOM   4470 N  N3    . DT  C 2 16  ? -44.321 78.137 -9.647  1.00 96.55  ? 16  DT  C N3    1 
ATOM   4471 C  C4    . DT  C 2 16  ? -45.669 77.905 -9.439  1.00 97.93  ? 16  DT  C C4    1 
ATOM   4472 O  O4    . DT  C 2 16  ? -46.513 78.255 -10.266 1.00 97.76  ? 16  DT  C O4    1 
ATOM   4473 C  C5    . DT  C 2 16  ? -45.993 77.235 -8.191  1.00 98.81  ? 16  DT  C C5    1 
ATOM   4474 C  C7    . DT  C 2 16  ? -47.421 76.927 -7.839  1.00 100.14 ? 16  DT  C C7    1 
ATOM   4475 C  C6    . DT  C 2 16  ? -44.984 76.901 -7.363  1.00 98.47  ? 16  DT  C C6    1 
ATOM   4476 P  P     . DG  C 2 17  ? -39.943 77.139 -2.999  1.00 103.48 ? 17  DG  C P     1 
ATOM   4477 O  OP1   . DG  C 2 17  ? -38.701 76.409 -2.611  1.00 102.86 ? 17  DG  C OP1   1 
ATOM   4478 O  OP2   . DG  C 2 17  ? -41.094 77.283 -2.072  1.00 103.88 ? 17  DG  C OP2   1 
ATOM   4479 O  "O5'" . DG  C 2 17  ? -39.512 78.605 -3.467  1.00 104.04 ? 17  DG  C "O5'" 1 
ATOM   4480 C  "C5'" . DG  C 2 17  ? -38.421 78.774 -4.365  1.00 102.29 ? 17  DG  C "C5'" 1 
ATOM   4481 C  "C4'" . DG  C 2 17  ? -38.521 80.141 -5.004  1.00 102.44 ? 17  DG  C "C4'" 1 
ATOM   4482 O  "O4'" . DG  C 2 17  ? -39.707 80.214 -5.830  1.00 101.64 ? 17  DG  C "O4'" 1 
ATOM   4483 C  "C3'" . DG  C 2 17  ? -38.607 81.300 -4.020  1.00 104.19 ? 17  DG  C "C3'" 1 
ATOM   4484 O  "O3'" . DG  C 2 17  ? -37.582 82.199 -4.395  1.00 105.09 ? 17  DG  C "O3'" 1 
ATOM   4485 C  "C2'" . DG  C 2 17  ? -40.014 81.876 -4.204  1.00 104.34 ? 17  DG  C "C2'" 1 
ATOM   4486 C  "C1'" . DG  C 2 17  ? -40.367 81.442 -5.626  1.00 102.31 ? 17  DG  C "C1'" 1 
ATOM   4487 N  N9    . DG  C 2 17  ? -41.776 81.158 -5.885  1.00 101.56 ? 17  DG  C N9    1 
ATOM   4488 C  C8    . DG  C 2 17  ? -42.675 80.535 -5.047  1.00 102.04 ? 17  DG  C C8    1 
ATOM   4489 N  N7    . DG  C 2 17  ? -43.866 80.400 -5.557  1.00 101.70 ? 17  DG  C N7    1 
ATOM   4490 C  C5    . DG  C 2 17  ? -43.743 80.966 -6.815  1.00 100.84 ? 17  DG  C C5    1 
ATOM   4491 C  C6    . DG  C 2 17  ? -44.709 81.113 -7.830  1.00 100.66 ? 17  DG  C C6    1 
ATOM   4492 O  O6    . DG  C 2 17  ? -45.884 80.752 -7.781  1.00 102.09 ? 17  DG  C O6    1 
ATOM   4493 N  N1    . DG  C 2 17  ? -44.206 81.737 -8.972  1.00 99.67  ? 17  DG  C N1    1 
ATOM   4494 C  C2    . DG  C 2 17  ? -42.905 82.174 -9.100  1.00 99.30  ? 17  DG  C C2    1 
ATOM   4495 N  N2    . DG  C 2 17  ? -42.576 82.758 -10.261 1.00 98.77  ? 17  DG  C N2    1 
ATOM   4496 N  N3    . DG  C 2 17  ? -41.982 82.046 -8.149  1.00 99.56  ? 17  DG  C N3    1 
ATOM   4497 C  C4    . DG  C 2 17  ? -42.469 81.434 -7.039  1.00 100.53 ? 17  DG  C C4    1 
ATOM   4498 P  P     . DT  C 2 18  ? -37.192 83.460 -3.502  1.00 107.23 ? 18  DT  C P     1 
ATOM   4499 O  OP1   . DT  C 2 18  ? -35.782 83.795 -3.824  1.00 107.18 ? 18  DT  C OP1   1 
ATOM   4500 O  OP2   . DT  C 2 18  ? -37.598 83.204 -2.096  1.00 108.12 ? 18  DT  C OP2   1 
ATOM   4501 O  "O5'" . DT  C 2 18  ? -38.180 84.565 -4.118  1.00 107.06 ? 18  DT  C "O5'" 1 
ATOM   4502 C  "C5'" . DT  C 2 18  ? -38.067 84.938 -5.481  1.00 105.23 ? 18  DT  C "C5'" 1 
ATOM   4503 C  "C4'" . DT  C 2 18  ? -39.280 85.705 -5.973  1.00 105.20 ? 18  DT  C "C4'" 1 
ATOM   4504 O  "O4'" . DT  C 2 18  ? -40.455 84.874 -5.970  1.00 104.64 ? 18  DT  C "O4'" 1 
ATOM   4505 C  "C3'" . DT  C 2 18  ? -39.691 86.921 -5.158  1.00 107.03 ? 18  DT  C "C3'" 1 
ATOM   4506 O  "O3'" . DT  C 2 18  ? -39.204 88.086 -5.809  1.00 107.69 ? 18  DT  C "O3'" 1 
ATOM   4507 C  "C2'" . DT  C 2 18  ? -41.219 86.873 -5.167  1.00 107.62 ? 18  DT  C "C2'" 1 
ATOM   4508 C  "C1'" . DT  C 2 18  ? -41.519 85.772 -6.161  1.00 106.21 ? 18  DT  C "C1'" 1 
ATOM   4509 N  N1    . DT  C 2 18  ? -42.791 85.064 -5.896  1.00 107.81 ? 18  DT  C N1    1 
ATOM   4510 C  C2    . DT  C 2 18  ? -43.765 84.986 -6.884  1.00 108.19 ? 18  DT  C C2    1 
ATOM   4511 O  O2    . DT  C 2 18  ? -43.649 85.475 -7.996  1.00 108.11 ? 18  DT  C O2    1 
ATOM   4512 N  N3    . DT  C 2 18  ? -44.899 84.293 -6.519  1.00 108.76 ? 18  DT  C N3    1 
ATOM   4513 C  C4    . DT  C 2 18  ? -45.134 83.686 -5.293  1.00 109.28 ? 18  DT  C C4    1 
ATOM   4514 O  O4    . DT  C 2 18  ? -46.181 83.093 -5.073  1.00 110.09 ? 18  DT  C O4    1 
ATOM   4515 C  C5    . DT  C 2 18  ? -44.078 83.807 -4.305  1.00 109.17 ? 18  DT  C C5    1 
ATOM   4516 C  C7    . DT  C 2 18  ? -44.208 83.201 -2.940  1.00 109.69 ? 18  DT  C C7    1 
ATOM   4517 C  C6    . DT  C 2 18  ? -42.972 84.480 -4.650  1.00 108.79 ? 18  DT  C C6    1 
ATOM   4518 P  P     . DA  C 2 19  ? -39.629 89.554 -5.346  1.00 109.25 ? 19  DA  C P     1 
ATOM   4519 O  OP1   . DA  C 2 19  ? -38.682 90.475 -6.022  1.00 109.69 ? 19  DA  C OP1   1 
ATOM   4520 O  OP2   . DA  C 2 19  ? -39.764 89.564 -3.872  1.00 108.54 ? 19  DA  C OP2   1 
ATOM   4521 O  "O5'" . DA  C 2 19  ? -41.096 89.746 -5.977  1.00 110.52 ? 19  DA  C "O5'" 1 
ATOM   4522 C  "C5'" . DA  C 2 19  ? -41.230 90.309 -7.275  1.00 112.35 ? 19  DA  C "C5'" 1 
ATOM   4523 C  "C4'" . DA  C 2 19  ? -42.674 90.540 -7.670  1.00 114.88 ? 19  DA  C "C4'" 1 
ATOM   4524 O  "O4'" . DA  C 2 19  ? -43.372 89.281 -7.611  1.00 114.93 ? 19  DA  C "O4'" 1 
ATOM   4525 C  "C3'" . DA  C 2 19  ? -43.468 91.471 -6.769  1.00 117.94 ? 19  DA  C "C3'" 1 
ATOM   4526 O  "O3'" . DA  C 2 19  ? -43.297 92.818 -7.204  1.00 119.29 ? 19  DA  C "O3'" 1 
ATOM   4527 C  "C2'" . DA  C 2 19  ? -44.899 90.988 -6.987  1.00 119.40 ? 19  DA  C "C2'" 1 
ATOM   4528 C  "C1'" . DA  C 2 19  ? -44.720 89.496 -7.260  1.00 118.31 ? 19  DA  C "C1'" 1 
ATOM   4529 N  N9    . DA  C 2 19  ? -44.990 88.643 -6.106  1.00 120.76 ? 19  DA  C N9    1 
ATOM   4530 C  C8    . DA  C 2 19  ? -44.267 88.594 -4.933  1.00 122.58 ? 19  DA  C C8    1 
ATOM   4531 N  N7    . DA  C 2 19  ? -44.723 87.730 -4.046  1.00 123.31 ? 19  DA  C N7    1 
ATOM   4532 C  C5    . DA  C 2 19  ? -45.826 87.175 -4.690  1.00 123.05 ? 19  DA  C C5    1 
ATOM   4533 C  C6    . DA  C 2 19  ? -46.756 86.192 -4.281  1.00 123.32 ? 19  DA  C C6    1 
ATOM   4534 N  N6    . DA  C 2 19  ? -46.673 85.600 -3.081  1.00 123.07 ? 19  DA  C N6    1 
ATOM   4535 N  N1    . DA  C 2 19  ? -47.747 85.852 -5.160  1.00 123.11 ? 19  DA  C N1    1 
ATOM   4536 C  C2    . DA  C 2 19  ? -47.805 86.462 -6.360  1.00 122.40 ? 19  DA  C C2    1 
ATOM   4537 N  N3    . DA  C 2 19  ? -46.992 87.408 -6.848  1.00 121.78 ? 19  DA  C N3    1 
ATOM   4538 C  C4    . DA  C 2 19  ? -46.011 87.720 -5.963  1.00 121.94 ? 19  DA  C C4    1 
ATOM   4539 O  "O5'" . DT  D 3 1   ? -56.428 89.646 -7.916  1.00 156.91 ? 1   DT  D "O5'" 1 
ATOM   4540 C  "C5'" . DT  D 3 1   ? -56.592 88.261 -8.198  1.00 156.02 ? 1   DT  D "C5'" 1 
ATOM   4541 C  "C4'" . DT  D 3 1   ? -55.495 87.719 -9.108  1.00 153.15 ? 1   DT  D "C4'" 1 
ATOM   4542 O  "O4'" . DT  D 3 1   ? -54.232 87.619 -8.377  1.00 151.97 ? 1   DT  D "O4'" 1 
ATOM   4543 C  "C3'" . DT  D 3 1   ? -55.802 86.322 -9.672  1.00 151.21 ? 1   DT  D "C3'" 1 
ATOM   4544 O  "O3'" . DT  D 3 1   ? -55.729 86.268 -11.133 1.00 147.26 ? 1   DT  D "O3'" 1 
ATOM   4545 C  "C2'" . DT  D 3 1   ? -54.817 85.417 -8.922  1.00 150.17 ? 1   DT  D "C2'" 1 
ATOM   4546 C  "C1'" . DT  D 3 1   ? -53.640 86.360 -8.662  1.00 150.37 ? 1   DT  D "C1'" 1 
ATOM   4547 N  N1    . DT  D 3 1   ? -52.685 85.897 -7.569  1.00 150.17 ? 1   DT  D N1    1 
ATOM   4548 C  C2    . DT  D 3 1   ? -51.590 86.678 -7.213  1.00 149.58 ? 1   DT  D C2    1 
ATOM   4549 O  O2    . DT  D 3 1   ? -51.322 87.760 -7.708  1.00 149.33 ? 1   DT  D O2    1 
ATOM   4550 N  N3    . DT  D 3 1   ? -50.805 86.134 -6.221  1.00 148.95 ? 1   DT  D N3    1 
ATOM   4551 C  C4    . DT  D 3 1   ? -50.986 84.920 -5.569  1.00 148.97 ? 1   DT  D C4    1 
ATOM   4552 O  O4    . DT  D 3 1   ? -50.213 84.539 -4.694  1.00 148.53 ? 1   DT  D O4    1 
ATOM   4553 C  C5    . DT  D 3 1   ? -52.138 84.141 -5.985  1.00 149.57 ? 1   DT  D C5    1 
ATOM   4554 C  C7    . DT  D 3 1   ? -52.448 82.805 -5.359  1.00 148.60 ? 1   DT  D C7    1 
ATOM   4555 C  C6    . DT  D 3 1   ? -52.913 84.665 -6.953  1.00 150.31 ? 1   DT  D C6    1 
ATOM   4556 P  P     . DA  D 3 2   ? -54.676 85.405 -12.006 1.00 141.82 ? 2   DA  D P     1 
ATOM   4557 O  OP1   . DA  D 3 2   ? -55.133 85.411 -13.415 1.00 142.43 ? 2   DA  D OP1   1 
ATOM   4558 O  OP2   . DA  D 3 2   ? -54.342 84.110 -11.364 1.00 139.57 ? 2   DA  D OP2   1 
ATOM   4559 O  "O5'" . DA  D 3 2   ? -53.397 86.339 -11.881 1.00 137.51 ? 2   DA  D "O5'" 1 
ATOM   4560 C  "C5'" . DA  D 3 2   ? -53.111 87.233 -12.928 1.00 132.98 ? 2   DA  D "C5'" 1 
ATOM   4561 C  "C4'" . DA  D 3 2   ? -51.701 86.964 -13.392 1.00 126.09 ? 2   DA  D "C4'" 1 
ATOM   4562 O  "O4'" . DA  D 3 2   ? -50.894 86.676 -12.222 1.00 124.01 ? 2   DA  D "O4'" 1 
ATOM   4563 C  "C3'" . DA  D 3 2   ? -51.578 85.791 -14.345 1.00 121.81 ? 2   DA  D "C3'" 1 
ATOM   4564 O  "O3'" . DA  D 3 2   ? -50.790 86.243 -15.437 1.00 117.49 ? 2   DA  D "O3'" 1 
ATOM   4565 C  "C2'" . DA  D 3 2   ? -50.903 84.716 -13.491 1.00 120.64 ? 2   DA  D "C2'" 1 
ATOM   4566 C  "C1'" . DA  D 3 2   ? -50.136 85.519 -12.444 1.00 121.24 ? 2   DA  D "C1'" 1 
ATOM   4567 N  N9    . DA  D 3 2   ? -49.941 84.874 -11.142 1.00 121.31 ? 2   DA  D N9    1 
ATOM   4568 C  C8    . DA  D 3 2   ? -50.798 84.075 -10.426 1.00 122.19 ? 2   DA  D C8    1 
ATOM   4569 N  N7    . DA  D 3 2   ? -50.304 83.649 -9.281  1.00 121.61 ? 2   DA  D N7    1 
ATOM   4570 C  C5    . DA  D 3 2   ? -49.035 84.211 -9.240  1.00 120.90 ? 2   DA  D C5    1 
ATOM   4571 C  C6    . DA  D 3 2   ? -47.977 84.163 -8.296  1.00 120.34 ? 2   DA  D C6    1 
ATOM   4572 N  N6    . DA  D 3 2   ? -48.030 83.485 -7.152  1.00 121.00 ? 2   DA  D N6    1 
ATOM   4573 N  N1    . DA  D 3 2   ? -46.838 84.838 -8.566  1.00 119.72 ? 2   DA  D N1    1 
ATOM   4574 C  C2    . DA  D 3 2   ? -46.756 85.527 -9.718  1.00 119.92 ? 2   DA  D C2    1 
ATOM   4575 N  N3    . DA  D 3 2   ? -47.680 85.659 -10.678 1.00 120.34 ? 2   DA  D N3    1 
ATOM   4576 C  C4    . DA  D 3 2   ? -48.801 84.969 -10.378 1.00 120.77 ? 2   DA  D C4    1 
ATOM   4577 P  P     . DC  D 3 3   ? -50.394 85.349 -16.705 1.00 113.28 ? 3   DC  D P     1 
ATOM   4578 O  OP1   . DC  D 3 3   ? -50.582 86.204 -17.893 1.00 114.50 ? 3   DC  D OP1   1 
ATOM   4579 O  OP2   . DC  D 3 3   ? -51.053 84.031 -16.657 1.00 113.28 ? 3   DC  D OP2   1 
ATOM   4580 O  "O5'" . DC  D 3 3   ? -48.853 85.049 -16.443 1.00 109.49 ? 3   DC  D "O5'" 1 
ATOM   4581 C  "C5'" . DC  D 3 3   ? -47.880 86.055 -16.658 1.00 107.61 ? 3   DC  D "C5'" 1 
ATOM   4582 C  "C4'" . DC  D 3 3   ? -46.562 85.674 -16.016 1.00 104.25 ? 3   DC  D "C4'" 1 
ATOM   4583 O  "O4'" . DC  D 3 3   ? -46.798 85.190 -14.682 1.00 103.72 ? 3   DC  D "O4'" 1 
ATOM   4584 C  "C3'" . DC  D 3 3   ? -45.807 84.558 -16.720 1.00 101.73 ? 3   DC  D "C3'" 1 
ATOM   4585 O  "O3'" . DC  D 3 3   ? -44.822 85.166 -17.529 1.00 100.42 ? 3   DC  D "O3'" 1 
ATOM   4586 C  "C2'" . DC  D 3 3   ? -45.191 83.709 -15.605 1.00 100.24 ? 3   DC  D "C2'" 1 
ATOM   4587 C  "C1'" . DC  D 3 3   ? -45.756 84.299 -14.317 1.00 101.55 ? 3   DC  D "C1'" 1 
ATOM   4588 N  N1    . DC  D 3 3   ? -46.315 83.355 -13.264 1.00 100.93 ? 3   DC  D N1    1 
ATOM   4589 C  C2    . DC  D 3 3   ? -45.558 83.034 -12.113 1.00 99.92  ? 3   DC  D C2    1 
ATOM   4590 O  O2    . DC  D 3 3   ? -44.416 83.490 -11.967 1.00 100.08 ? 3   DC  D O2    1 
ATOM   4591 N  N3    . DC  D 3 3   ? -46.099 82.218 -11.171 1.00 99.31  ? 3   DC  D N3    1 
ATOM   4592 C  C4    . DC  D 3 3   ? -47.336 81.748 -11.336 1.00 100.07 ? 3   DC  D C4    1 
ATOM   4593 N  N4    . DC  D 3 3   ? -47.823 80.949 -10.388 1.00 100.44 ? 3   DC  D N4    1 
ATOM   4594 C  C5    . DC  D 3 3   ? -48.129 82.066 -12.483 1.00 101.21 ? 3   DC  D C5    1 
ATOM   4595 C  C6    . DC  D 3 3   ? -47.590 82.868 -13.410 1.00 101.27 ? 3   DC  D C6    1 
ATOM   4596 P  P     . DA  D 3 4   ? -44.206 84.440 -18.800 1.00 98.35  ? 4   DA  D P     1 
ATOM   4597 O  OP1   . DA  D 3 4   ? -43.668 85.507 -19.686 1.00 99.01  ? 4   DA  D OP1   1 
ATOM   4598 O  OP2   . DA  D 3 4   ? -45.216 83.491 -19.318 1.00 98.49  ? 4   DA  D OP2   1 
ATOM   4599 O  "O5'" . DA  D 3 4   ? -43.010 83.602 -18.148 1.00 96.13  ? 4   DA  D "O5'" 1 
ATOM   4600 C  "C5'" . DA  D 3 4   ? -41.813 84.285 -17.858 1.00 96.96  ? 4   DA  D "C5'" 1 
ATOM   4601 C  "C4'" . DA  D 3 4   ? -40.769 83.390 -17.216 1.00 97.02  ? 4   DA  D "C4'" 1 
ATOM   4602 O  "O4'" . DA  D 3 4   ? -41.297 82.734 -16.045 1.00 96.73  ? 4   DA  D "O4'" 1 
ATOM   4603 C  "C3'" . DA  D 3 4   ? -40.176 82.282 -18.072 1.00 96.91  ? 4   DA  D "C3'" 1 
ATOM   4604 O  "O3'" . DA  D 3 4   ? -38.805 82.253 -17.741 1.00 98.48  ? 4   DA  D "O3'" 1 
ATOM   4605 C  "C2'" . DA  D 3 4   ? -40.902 81.017 -17.626 1.00 94.98  ? 4   DA  D "C2'" 1 
ATOM   4606 C  "C1'" . DA  D 3 4   ? -41.227 81.332 -16.174 1.00 95.04  ? 4   DA  D "C1'" 1 
ATOM   4607 N  N9    . DA  D 3 4   ? -42.531 80.851 -15.738 1.00 94.98  ? 4   DA  D N9    1 
ATOM   4608 C  C8    . DA  D 3 4   ? -43.681 80.760 -16.479 1.00 95.46  ? 4   DA  D C8    1 
ATOM   4609 N  N7    . DA  D 3 4   ? -44.711 80.294 -15.806 1.00 95.47  ? 4   DA  D N7    1 
ATOM   4610 C  C5    . DA  D 3 4   ? -44.205 80.067 -14.537 1.00 94.44  ? 4   DA  D C5    1 
ATOM   4611 C  C6    . DA  D 3 4   ? -44.792 79.575 -13.353 1.00 93.77  ? 4   DA  D C6    1 
ATOM   4612 N  N6    . DA  D 3 4   ? -46.067 79.210 -13.264 1.00 93.65  ? 4   DA  D N6    1 
ATOM   4613 N  N1    . DA  D 3 4   ? -44.009 79.473 -12.261 1.00 93.49  ? 4   DA  D N1    1 
ATOM   4614 C  C2    . DA  D 3 4   ? -42.721 79.846 -12.357 1.00 93.26  ? 4   DA  D C2    1 
ATOM   4615 N  N3    . DA  D 3 4   ? -42.048 80.321 -13.408 1.00 92.94  ? 4   DA  D N3    1 
ATOM   4616 C  C4    . DA  D 3 4   ? -42.859 80.409 -14.476 1.00 94.19  ? 4   DA  D C4    1 
ATOM   4617 P  P     . DA  D 3 5   ? -37.801 81.167 -18.327 1.00 98.99  ? 5   DA  D P     1 
ATOM   4618 O  OP1   . DA  D 3 5   ? -36.509 81.848 -18.608 1.00 98.96  ? 5   DA  D OP1   1 
ATOM   4619 O  OP2   . DA  D 3 5   ? -38.524 80.351 -19.326 1.00 99.14  ? 5   DA  D OP2   1 
ATOM   4620 O  "O5'" . DA  D 3 5   ? -37.622 80.171 -17.113 1.00 99.52  ? 5   DA  D "O5'" 1 
ATOM   4621 C  "C5'" . DA  D 3 5   ? -36.914 80.568 -15.964 1.00 102.19 ? 5   DA  D "C5'" 1 
ATOM   4622 C  "C4'" . DA  D 3 5   ? -37.064 79.445 -14.960 1.00 102.81 ? 5   DA  D "C4'" 1 
ATOM   4623 O  "O4'" . DA  D 3 5   ? -38.471 79.196 -14.676 1.00 101.84 ? 5   DA  D "O4'" 1 
ATOM   4624 C  "C3'" . DA  D 3 5   ? -36.481 78.129 -15.453 1.00 102.73 ? 5   DA  D "C3'" 1 
ATOM   4625 O  "O3'" . DA  D 3 5   ? -35.720 77.602 -14.379 1.00 105.45 ? 5   DA  D "O3'" 1 
ATOM   4626 C  "C2'" . DA  D 3 5   ? -37.716 77.294 -15.784 1.00 100.35 ? 5   DA  D "C2'" 1 
ATOM   4627 C  "C1'" . DA  D 3 5   ? -38.689 77.814 -14.730 1.00 99.49  ? 5   DA  D "C1'" 1 
ATOM   4628 N  N9    . DA  D 3 5   ? -40.085 77.589 -15.046 1.00 98.24  ? 5   DA  D N9    1 
ATOM   4629 C  C8    . DA  D 3 5   ? -40.689 77.686 -16.272 1.00 98.33  ? 5   DA  D C8    1 
ATOM   4630 N  N7    . DA  D 3 5   ? -41.974 77.409 -16.260 1.00 97.81  ? 5   DA  D N7    1 
ATOM   4631 C  C5    . DA  D 3 5   ? -42.223 77.110 -14.930 1.00 97.27  ? 5   DA  D C5    1 
ATOM   4632 C  C6    . DA  D 3 5   ? -43.394 76.729 -14.254 1.00 96.42  ? 5   DA  D C6    1 
ATOM   4633 N  N6    . DA  D 3 5   ? -44.565 76.592 -14.864 1.00 96.05  ? 5   DA  D N6    1 
ATOM   4634 N  N1    . DA  D 3 5   ? -43.308 76.501 -12.929 1.00 96.65  ? 5   DA  D N1    1 
ATOM   4635 C  C2    . DA  D 3 5   ? -42.121 76.641 -12.313 1.00 96.71  ? 5   DA  D C2    1 
ATOM   4636 N  N3    . DA  D 3 5   ? -40.946 76.993 -12.838 1.00 96.81  ? 5   DA  D N3    1 
ATOM   4637 C  C4    . DA  D 3 5   ? -41.069 77.215 -14.163 1.00 97.59  ? 5   DA  D C4    1 
ATOM   4638 P  P     . DA  D 3 6   ? -34.552 76.529 -14.618 1.00 106.76 ? 6   DA  D P     1 
ATOM   4639 O  OP1   . DA  D 3 6   ? -33.313 77.336 -14.766 1.00 107.60 ? 6   DA  D OP1   1 
ATOM   4640 O  OP2   . DA  D 3 6   ? -34.982 75.539 -15.653 1.00 104.24 ? 6   DA  D OP2   1 
ATOM   4641 O  "O5'" . DA  D 3 6   ? -34.471 75.762 -13.202 1.00 104.57 ? 6   DA  D "O5'" 1 
ATOM   4642 C  "C5'" . DA  D 3 6   ? -34.956 76.340 -11.980 1.00 100.89 ? 6   DA  D "C5'" 1 
ATOM   4643 C  "C4'" . DA  D 3 6   ? -35.935 75.383 -11.316 1.00 97.48  ? 6   DA  D "C4'" 1 
ATOM   4644 O  "O4'" . DA  D 3 6   ? -37.202 75.414 -12.012 1.00 96.87  ? 6   DA  D "O4'" 1 
ATOM   4645 C  "C3'" . DA  D 3 6   ? -35.528 73.915 -11.278 1.00 94.97  ? 6   DA  D "C3'" 1 
ATOM   4646 O  "O3'" . DA  D 3 6   ? -35.486 73.563 -9.926  1.00 93.51  ? 6   DA  D "O3'" 1 
ATOM   4647 C  "C2'" . DA  D 3 6   ? -36.646 73.159 -11.993 1.00 94.08  ? 6   DA  D "C2'" 1 
ATOM   4648 C  "C1'" . DA  D 3 6   ? -37.801 74.141 -11.950 1.00 94.79  ? 6   DA  D "C1'" 1 
ATOM   4649 N  N9    . DA  D 3 6   ? -38.748 74.022 -13.063 1.00 93.88  ? 6   DA  D N9    1 
ATOM   4650 C  C8    . DA  D 3 6   ? -38.521 74.208 -14.403 1.00 93.02  ? 6   DA  D C8    1 
ATOM   4651 N  N7    . DA  D 3 6   ? -39.587 74.036 -15.155 1.00 92.38  ? 6   DA  D N7    1 
ATOM   4652 C  C5    . DA  D 3 6   ? -40.582 73.714 -14.244 1.00 92.67  ? 6   DA  D C5    1 
ATOM   4653 C  C6    . DA  D 3 6   ? -41.954 73.404 -14.376 1.00 92.61  ? 6   DA  D C6    1 
ATOM   4654 N  N6    . DA  D 3 6   ? -42.597 73.363 -15.536 1.00 93.05  ? 6   DA  D N6    1 
ATOM   4655 N  N1    . DA  D 3 6   ? -42.663 73.127 -13.268 1.00 93.05  ? 6   DA  D N1    1 
ATOM   4656 C  C2    . DA  D 3 6   ? -42.040 73.159 -12.088 1.00 93.50  ? 6   DA  D C2    1 
ATOM   4657 N  N3    . DA  D 3 6   ? -40.763 73.436 -11.827 1.00 93.47  ? 6   DA  D N3    1 
ATOM   4658 C  C4    . DA  D 3 6   ? -40.082 73.704 -12.955 1.00 93.22  ? 6   DA  D C4    1 
ATOM   4659 P  P     . DA  D 3 7   ? -34.861 72.203 -9.380  1.00 91.96  ? 7   DA  D P     1 
ATOM   4660 O  OP1   . DA  D 3 7   ? -33.722 72.545 -8.478  1.00 91.84  ? 7   DA  D OP1   1 
ATOM   4661 O  OP2   . DA  D 3 7   ? -34.667 71.265 -10.515 1.00 91.06  ? 7   DA  D OP2   1 
ATOM   4662 O  "O5'" . DA  D 3 7   ? -36.077 71.650 -8.502  1.00 90.52  ? 7   DA  D "O5'" 1 
ATOM   4663 C  "C5'" . DA  D 3 7   ? -37.360 72.241 -8.544  1.00 90.22  ? 7   DA  D "C5'" 1 
ATOM   4664 C  "C4'" . DA  D 3 7   ? -38.427 71.187 -8.328  1.00 89.68  ? 7   DA  D "C4'" 1 
ATOM   4665 O  "O4'" . DA  D 3 7   ? -39.336 71.189 -9.454  1.00 89.40  ? 7   DA  D "O4'" 1 
ATOM   4666 C  "C3'" . DA  D 3 7   ? -37.936 69.745 -8.164  1.00 88.58  ? 7   DA  D "C3'" 1 
ATOM   4667 O  "O3'" . DA  D 3 7   ? -38.688 69.093 -7.109  1.00 87.72  ? 7   DA  D "O3'" 1 
ATOM   4668 C  "C2'" . DA  D 3 7   ? -38.155 69.151 -9.551  1.00 88.28  ? 7   DA  D "C2'" 1 
ATOM   4669 C  "C1'" . DA  D 3 7   ? -39.406 69.887 -10.008 1.00 88.78  ? 7   DA  D "C1'" 1 
ATOM   4670 N  N9    . DA  D 3 7   ? -39.527 70.011 -11.463 1.00 89.09  ? 7   DA  D N9    1 
ATOM   4671 C  C8    . DA  D 3 7   ? -38.534 70.244 -12.388 1.00 88.55  ? 7   DA  D C8    1 
ATOM   4672 N  N7    . DA  D 3 7   ? -38.966 70.309 -13.628 1.00 88.01  ? 7   DA  D N7    1 
ATOM   4673 C  C5    . DA  D 3 7   ? -40.333 70.114 -13.501 1.00 88.16  ? 7   DA  D C5    1 
ATOM   4674 C  C6    . DA  D 3 7   ? -41.378 70.070 -14.439 1.00 88.23  ? 7   DA  D C6    1 
ATOM   4675 N  N6    . DA  D 3 7   ? -41.180 70.224 -15.743 1.00 87.78  ? 7   DA  D N6    1 
ATOM   4676 N  N1    . DA  D 3 7   ? -42.636 69.861 -13.989 1.00 89.17  ? 7   DA  D N1    1 
ATOM   4677 C  C2    . DA  D 3 7   ? -42.839 69.698 -12.675 1.00 88.82  ? 7   DA  D C2    1 
ATOM   4678 N  N3    . DA  D 3 7   ? -41.942 69.713 -11.693 1.00 88.76  ? 7   DA  D N3    1 
ATOM   4679 C  C4    . DA  D 3 7   ? -40.700 69.927 -12.179 1.00 88.71  ? 7   DA  D C4    1 
ATOM   4680 P  P     . DT  D 3 8   ? -38.794 67.508 -6.885  1.00 84.69  ? 8   DT  D P     1 
ATOM   4681 O  OP1   . DT  D 3 8   ? -39.306 67.259 -5.523  1.00 84.51  ? 8   DT  D OP1   1 
ATOM   4682 O  OP2   . DT  D 3 8   ? -37.547 66.866 -7.367  1.00 82.99  ? 8   DT  D OP2   1 
ATOM   4683 O  "O5'" . DT  D 3 8   ? -39.980 67.162 -7.884  1.00 84.18  ? 8   DT  D "O5'" 1 
ATOM   4684 C  "C5'" . DT  D 3 8   ? -41.294 67.478 -7.494  1.00 84.40  ? 8   DT  D "C5'" 1 
ATOM   4685 C  "C4'" . DT  D 3 8   ? -42.268 66.796 -8.427  1.00 84.14  ? 8   DT  D "C4'" 1 
ATOM   4686 O  "O4'" . DT  D 3 8   ? -42.002 67.151 -9.800  1.00 84.22  ? 8   DT  D "O4'" 1 
ATOM   4687 C  "C3'" . DT  D 3 8   ? -42.239 65.281 -8.392  1.00 83.27  ? 8   DT  D "C3'" 1 
ATOM   4688 O  "O3'" . DT  D 3 8   ? -43.560 64.971 -8.123  1.00 84.47  ? 8   DT  D "O3'" 1 
ATOM   4689 C  "C2'" . DT  D 3 8   ? -41.824 64.830 -9.792  1.00 81.70  ? 8   DT  D "C2'" 1 
ATOM   4690 C  "C1'" . DT  D 3 8   ? -42.243 66.027 -10.625 1.00 82.26  ? 8   DT  D "C1'" 1 
ATOM   4691 N  N1    . DT  D 3 8   ? -41.483 66.282 -11.892 1.00 81.29  ? 8   DT  D N1    1 
ATOM   4692 C  C2    . DT  D 3 8   ? -42.187 66.382 -13.075 1.00 80.38  ? 8   DT  D C2    1 
ATOM   4693 O  O2    . DT  D 3 8   ? -43.394 66.247 -13.137 1.00 80.74  ? 8   DT  D O2    1 
ATOM   4694 N  N3    . DT  D 3 8   ? -41.423 66.640 -14.188 1.00 79.46  ? 8   DT  D N3    1 
ATOM   4695 C  C4    . DT  D 3 8   ? -40.052 66.807 -14.221 1.00 79.03  ? 8   DT  D C4    1 
ATOM   4696 O  O4    . DT  D 3 8   ? -39.444 67.036 -15.252 1.00 78.80  ? 8   DT  D O4    1 
ATOM   4697 C  C5    . DT  D 3 8   ? -39.379 66.701 -12.956 1.00 79.71  ? 8   DT  D C5    1 
ATOM   4698 C  C7    . DT  D 3 8   ? -37.897 66.867 -12.896 1.00 80.05  ? 8   DT  D C7    1 
ATOM   4699 C  C6    . DT  D 3 8   ? -40.107 66.455 -11.860 1.00 80.76  ? 8   DT  D C6    1 
ATOM   4700 P  P     . DT  D 3 9   ? -44.006 63.487 -7.794  1.00 85.03  ? 9   DT  D P     1 
ATOM   4701 O  OP1   . DT  D 3 9   ? -45.174 63.624 -6.896  1.00 85.92  ? 9   DT  D OP1   1 
ATOM   4702 O  OP2   . DT  D 3 9   ? -42.835 62.661 -7.404  1.00 84.09  ? 9   DT  D OP2   1 
ATOM   4703 O  "O5'" . DT  D 3 9   ? -44.542 63.060 -9.234  1.00 85.59  ? 9   DT  D "O5'" 1 
ATOM   4704 C  "C5'" . DT  D 3 9   ? -45.678 63.812 -9.666  1.00 87.62  ? 9   DT  D "C5'" 1 
ATOM   4705 C  "C4'" . DT  D 3 9   ? -46.160 63.416 -11.042 1.00 87.89  ? 9   DT  D "C4'" 1 
ATOM   4706 O  "O4'" . DT  D 3 9   ? -45.228 63.852 -12.062 1.00 87.11  ? 9   DT  D "O4'" 1 
ATOM   4707 C  "C3'" . DT  D 3 9   ? -46.374 61.925 -11.238 1.00 87.82  ? 9   DT  D "C3'" 1 
ATOM   4708 O  "O3'" . DT  D 3 9   ? -47.684 61.841 -11.764 1.00 89.98  ? 9   DT  D "O3'" 1 
ATOM   4709 C  "C2'" . DT  D 3 9   ? -45.274 61.520 -12.217 1.00 86.28  ? 9   DT  D "C2'" 1 
ATOM   4710 C  "C1'" . DT  D 3 9   ? -45.044 62.812 -12.999 1.00 85.82  ? 9   DT  D "C1'" 1 
ATOM   4711 N  N1    . DT  D 3 9   ? -43.678 63.012 -13.590 1.00 84.40  ? 9   DT  D N1    1 
ATOM   4712 C  C2    . DT  D 3 9   ? -43.559 63.381 -14.916 1.00 83.46  ? 9   DT  D C2    1 
ATOM   4713 O  O2    . DT  D 3 9   ? -44.507 63.539 -15.654 1.00 83.43  ? 9   DT  D O2    1 
ATOM   4714 N  N3    . DT  D 3 9   ? -42.271 63.551 -15.355 1.00 83.22  ? 9   DT  D N3    1 
ATOM   4715 C  C4    . DT  D 3 9   ? -41.109 63.401 -14.611 1.00 83.37  ? 9   DT  D C4    1 
ATOM   4716 O  O4    . DT  D 3 9   ? -39.991 63.580 -15.093 1.00 83.41  ? 9   DT  D O4    1 
ATOM   4717 C  C5    . DT  D 3 9   ? -41.302 63.020 -13.231 1.00 83.29  ? 9   DT  D C5    1 
ATOM   4718 C  C7    . DT  D 3 9   ? -40.128 62.822 -12.326 1.00 83.17  ? 9   DT  D C7    1 
ATOM   4719 C  C6    . DT  D 3 9   ? -42.555 62.854 -12.790 1.00 84.04  ? 9   DT  D C6    1 
ATOM   4720 P  P     . DC  D 3 10  ? -48.315 60.499 -12.350 1.00 90.58  ? 10  DC  D P     1 
ATOM   4721 O  OP1   . DC  D 3 10  ? -49.782 60.633 -12.174 1.00 91.40  ? 10  DC  D OP1   1 
ATOM   4722 O  OP2   . DC  D 3 10  ? -47.555 59.355 -11.780 1.00 89.45  ? 10  DC  D OP2   1 
ATOM   4723 O  "O5'" . DC  D 3 10  ? -47.968 60.583 -13.915 1.00 88.89  ? 10  DC  D "O5'" 1 
ATOM   4724 C  "C5'" . DC  D 3 10  ? -48.324 61.726 -14.684 1.00 87.73  ? 10  DC  D "C5'" 1 
ATOM   4725 C  "C4'" . DC  D 3 10  ? -48.187 61.443 -16.172 1.00 85.81  ? 10  DC  D "C4'" 1 
ATOM   4726 O  "O4'" . DC  D 3 10  ? -46.819 61.619 -16.612 1.00 84.50  ? 10  DC  D "O4'" 1 
ATOM   4727 C  "C3'" . DC  D 3 10  ? -48.581 60.055 -16.630 1.00 84.84  ? 10  DC  D "C3'" 1 
ATOM   4728 O  "O3'" . DC  D 3 10  ? -49.285 60.233 -17.840 1.00 85.38  ? 10  DC  D "O3'" 1 
ATOM   4729 C  "C2'" . DC  D 3 10  ? -47.244 59.330 -16.808 1.00 83.60  ? 10  DC  D "C2'" 1 
ATOM   4730 C  "C1'" . DC  D 3 10  ? -46.293 60.447 -17.205 1.00 82.87  ? 10  DC  D "C1'" 1 
ATOM   4731 N  N1    . DC  D 3 10  ? -44.867 60.341 -16.716 1.00 81.98  ? 10  DC  D N1    1 
ATOM   4732 C  C2    . DC  D 3 10  ? -43.777 60.550 -17.597 1.00 81.25  ? 10  DC  D C2    1 
ATOM   4733 O  O2    . DC  D 3 10  ? -44.010 60.792 -18.788 1.00 81.56  ? 10  DC  D O2    1 
ATOM   4734 N  N3    . DC  D 3 10  ? -42.490 60.477 -17.129 1.00 79.59  ? 10  DC  D N3    1 
ATOM   4735 C  C4    . DC  D 3 10  ? -42.284 60.211 -15.836 1.00 78.64  ? 10  DC  D C4    1 
ATOM   4736 N  N4    . DC  D 3 10  ? -41.038 60.134 -15.385 1.00 76.51  ? 10  DC  D N4    1 
ATOM   4737 C  C5    . DC  D 3 10  ? -43.369 60.002 -14.930 1.00 80.17  ? 10  DC  D C5    1 
ATOM   4738 C  C6    . DC  D 3 10  ? -44.627 60.082 -15.393 1.00 81.22  ? 10  DC  D C6    1 
ATOM   4739 P  P     . DC  D 3 11  ? -49.919 59.001 -18.650 1.00 86.25  ? 11  DC  D P     1 
ATOM   4740 O  OP1   . DC  D 3 11  ? -50.901 59.600 -19.600 1.00 85.95  ? 11  DC  D OP1   1 
ATOM   4741 O  OP2   . DC  D 3 11  ? -50.262 57.908 -17.691 1.00 85.13  ? 11  DC  D OP2   1 
ATOM   4742 O  "O5'" . DC  D 3 11  ? -48.676 58.414 -19.456 1.00 83.56  ? 11  DC  D "O5'" 1 
ATOM   4743 C  "C5'" . DC  D 3 11  ? -48.384 58.797 -20.775 1.00 82.56  ? 11  DC  D "C5'" 1 
ATOM   4744 C  "C4'" . DC  D 3 11  ? -47.213 57.940 -21.176 1.00 80.91  ? 11  DC  D "C4'" 1 
ATOM   4745 O  "O4'" . DC  D 3 11  ? -46.106 58.146 -20.262 1.00 79.62  ? 11  DC  D "O4'" 1 
ATOM   4746 C  "C3'" . DC  D 3 11  ? -47.521 56.455 -21.117 1.00 80.68  ? 11  DC  D "C3'" 1 
ATOM   4747 O  "O3'" . DC  D 3 11  ? -47.098 55.902 -22.340 1.00 81.66  ? 11  DC  D "O3'" 1 
ATOM   4748 C  "C2'" . DC  D 3 11  ? -46.686 55.951 -19.949 1.00 79.42  ? 11  DC  D "C2'" 1 
ATOM   4749 C  "C1'" . DC  D 3 11  ? -45.497 56.888 -20.094 1.00 79.12  ? 11  DC  D "C1'" 1 
ATOM   4750 N  N1    . DC  D 3 11  ? -44.527 56.933 -18.951 1.00 78.92  ? 11  DC  D N1    1 
ATOM   4751 C  C2    . DC  D 3 11  ? -43.179 57.213 -19.209 1.00 78.44  ? 11  DC  D C2    1 
ATOM   4752 O  O2    . DC  D 3 11  ? -42.814 57.422 -20.368 1.00 78.92  ? 11  DC  D O2    1 
ATOM   4753 N  N3    . DC  D 3 11  ? -42.301 57.254 -18.177 1.00 77.64  ? 11  DC  D N3    1 
ATOM   4754 C  C4    . DC  D 3 11  ? -42.732 57.028 -16.943 1.00 77.10  ? 11  DC  D C4    1 
ATOM   4755 N  N4    . DC  D 3 11  ? -41.840 57.077 -15.966 1.00 77.56  ? 11  DC  D N4    1 
ATOM   4756 C  C5    . DC  D 3 11  ? -44.093 56.745 -16.647 1.00 77.95  ? 11  DC  D C5    1 
ATOM   4757 C  C6    . DC  D 3 11  ? -44.947 56.703 -17.670 1.00 79.00  ? 11  DC  D C6    1 
ATOM   4758 P  P     . DA  D 3 12  ? -48.191 55.298 -23.322 1.00 82.59  ? 12  DA  D P     1 
ATOM   4759 O  OP1   . DA  D 3 12  ? -49.286 56.283 -23.411 1.00 83.45  ? 12  DA  D OP1   1 
ATOM   4760 O  OP2   . DA  D 3 12  ? -48.410 53.909 -22.882 1.00 83.21  ? 12  DA  D OP2   1 
ATOM   4761 O  "O5'" . DA  D 3 12  ? -47.485 55.145 -24.737 1.00 83.38  ? 12  DA  D "O5'" 1 
ATOM   4762 C  "C5'" . DA  D 3 12  ? -46.879 56.229 -25.403 1.00 83.84  ? 12  DA  D "C5'" 1 
ATOM   4763 C  "C4'" . DA  D 3 12  ? -45.459 55.815 -25.750 1.00 83.78  ? 12  DA  D "C4'" 1 
ATOM   4764 O  "O4'" . DA  D 3 12  ? -44.658 55.667 -24.550 1.00 82.31  ? 12  DA  D "O4'" 1 
ATOM   4765 C  "C3'" . DA  D 3 12  ? -45.265 54.510 -26.504 1.00 84.65  ? 12  DA  D "C3'" 1 
ATOM   4766 O  "O3'" . DA  D 3 12  ? -44.280 54.856 -27.436 1.00 86.41  ? 12  DA  D "O3'" 1 
ATOM   4767 C  "C2'" . DA  D 3 12  ? -44.761 53.524 -25.444 1.00 83.05  ? 12  DA  D "C2'" 1 
ATOM   4768 C  "C1'" . DA  D 3 12  ? -43.935 54.453 -24.558 1.00 81.82  ? 12  DA  D "C1'" 1 
ATOM   4769 N  N9    . DA  D 3 12  ? -43.818 54.171 -23.134 1.00 80.50  ? 12  DA  D N9    1 
ATOM   4770 C  C8    . DA  D 3 12  ? -44.832 53.786 -22.305 1.00 81.43  ? 12  DA  D C8    1 
ATOM   4771 N  N7    . DA  D 3 12  ? -44.470 53.636 -21.052 1.00 81.09  ? 12  DA  D N7    1 
ATOM   4772 C  C5    . DA  D 3 12  ? -43.131 53.976 -21.052 1.00 78.63  ? 12  DA  D C5    1 
ATOM   4773 C  C6    . DA  D 3 12  ? -42.183 54.021 -20.019 1.00 76.54  ? 12  DA  D C6    1 
ATOM   4774 N  N6    . DA  D 3 12  ? -42.488 53.719 -18.761 1.00 74.86  ? 12  DA  D N6    1 
ATOM   4775 N  N1    . DA  D 3 12  ? -40.925 54.385 -20.331 1.00 76.36  ? 12  DA  D N1    1 
ATOM   4776 C  C2    . DA  D 3 12  ? -40.648 54.693 -21.604 1.00 78.14  ? 12  DA  D C2    1 
ATOM   4777 N  N3    . DA  D 3 12  ? -41.459 54.688 -22.671 1.00 79.78  ? 12  DA  D N3    1 
ATOM   4778 C  C4    . DA  D 3 12  ? -42.707 54.312 -22.326 1.00 79.50  ? 12  DA  D C4    1 
ATOM   4779 P  P     . DT  D 3 13  ? -43.841 53.929 -28.652 1.00 89.52  ? 13  DT  D P     1 
ATOM   4780 O  OP1   . DT  D 3 13  ? -43.493 54.900 -29.729 1.00 89.77  ? 13  DT  D OP1   1 
ATOM   4781 O  OP2   . DT  D 3 13  ? -44.791 52.800 -28.868 1.00 89.33  ? 13  DT  D OP2   1 
ATOM   4782 O  "O5'" . DT  D 3 13  ? -42.529 53.240 -28.052 1.00 87.61  ? 13  DT  D "O5'" 1 
ATOM   4783 C  "C5'" . DT  D 3 13  ? -41.297 53.941 -28.002 1.00 85.49  ? 13  DT  D "C5'" 1 
ATOM   4784 C  "C4'" . DT  D 3 13  ? -40.273 53.082 -27.294 1.00 83.43  ? 13  DT  D "C4'" 1 
ATOM   4785 O  "O4'" . DT  D 3 13  ? -40.629 52.972 -25.896 1.00 82.29  ? 13  DT  D "O4'" 1 
ATOM   4786 C  "C3'" . DT  D 3 13  ? -40.170 51.658 -27.822 1.00 83.00  ? 13  DT  D "C3'" 1 
ATOM   4787 O  "O3'" . DT  D 3 13  ? -38.837 51.418 -28.179 1.00 82.48  ? 13  DT  D "O3'" 1 
ATOM   4788 C  "C2'" . DT  D 3 13  ? -40.579 50.784 -26.643 1.00 82.46  ? 13  DT  D "C2'" 1 
ATOM   4789 C  "C1'" . DT  D 3 13  ? -40.215 51.700 -25.484 1.00 81.60  ? 13  DT  D "C1'" 1 
ATOM   4790 N  N1    . DT  D 3 13  ? -40.864 51.421 -24.188 1.00 80.63  ? 13  DT  D N1    1 
ATOM   4791 C  C2    . DT  D 3 13  ? -40.060 51.453 -23.075 1.00 80.51  ? 13  DT  D C2    1 
ATOM   4792 O  O2    . DT  D 3 13  ? -38.868 51.694 -23.128 1.00 81.09  ? 13  DT  D O2    1 
ATOM   4793 N  N3    . DT  D 3 13  ? -40.705 51.184 -21.896 1.00 80.68  ? 13  DT  D N3    1 
ATOM   4794 C  C4    . DT  D 3 13  ? -42.055 50.900 -21.740 1.00 80.37  ? 13  DT  D C4    1 
ATOM   4795 O  O4    . DT  D 3 13  ? -42.569 50.672 -20.651 1.00 80.78  ? 13  DT  D O4    1 
ATOM   4796 C  C5    . DT  D 3 13  ? -42.829 50.884 -22.943 1.00 80.07  ? 13  DT  D C5    1 
ATOM   4797 C  C7    . DT  D 3 13  ? -44.289 50.578 -22.849 1.00 81.18  ? 13  DT  D C7    1 
ATOM   4798 C  C6    . DT  D 3 13  ? -42.214 51.146 -24.102 1.00 80.53  ? 13  DT  D C6    1 
ATOM   4799 P  P     . DG  D 3 14  ? -38.474 50.349 -29.306 1.00 82.15  ? 14  DG  D P     1 
ATOM   4800 O  OP1   . DG  D 3 14  ? -37.660 51.045 -30.330 1.00 83.20  ? 14  DG  D OP1   1 
ATOM   4801 O  OP2   . DG  D 3 14  ? -39.708 49.638 -29.699 1.00 81.75  ? 14  DG  D OP2   1 
ATOM   4802 O  "O5'" . DG  D 3 14  ? -37.545 49.334 -28.484 1.00 81.98  ? 14  DG  D "O5'" 1 
ATOM   4803 C  "C5'" . DG  D 3 14  ? -36.568 49.825 -27.570 1.00 81.89  ? 14  DG  D "C5'" 1 
ATOM   4804 C  "C4'" . DG  D 3 14  ? -36.266 48.855 -26.440 1.00 81.77  ? 14  DG  D "C4'" 1 
ATOM   4805 O  "O4'" . DG  D 3 14  ? -37.283 48.945 -25.413 1.00 81.22  ? 14  DG  D "O4'" 1 
ATOM   4806 C  "C3'" . DG  D 3 14  ? -36.175 47.378 -26.801 1.00 82.62  ? 14  DG  D "C3'" 1 
ATOM   4807 O  "O3'" . DG  D 3 14  ? -35.109 46.799 -26.085 1.00 84.36  ? 14  DG  D "O3'" 1 
ATOM   4808 C  "C2'" . DG  D 3 14  ? -37.467 46.791 -26.265 1.00 82.35  ? 14  DG  D "C2'" 1 
ATOM   4809 C  "C1'" . DG  D 3 14  ? -37.618 47.629 -25.003 1.00 81.82  ? 14  DG  D "C1'" 1 
ATOM   4810 N  N9    . DG  D 3 14  ? -38.970 47.632 -24.449 1.00 81.66  ? 14  DG  D N9    1 
ATOM   4811 C  C8    . DG  D 3 14  ? -40.145 47.618 -25.156 1.00 81.77  ? 14  DG  D C8    1 
ATOM   4812 N  N7    . DG  D 3 14  ? -41.210 47.639 -24.412 1.00 81.57  ? 14  DG  D N7    1 
ATOM   4813 C  C5    . DG  D 3 14  ? -40.710 47.670 -23.126 1.00 81.33  ? 14  DG  D C5    1 
ATOM   4814 C  C6    . DG  D 3 14  ? -41.403 47.702 -21.898 1.00 81.25  ? 14  DG  D C6    1 
ATOM   4815 O  O6    . DG  D 3 14  ? -42.621 47.709 -21.707 1.00 81.19  ? 14  DG  D O6    1 
ATOM   4816 N  N1    . DG  D 3 14  ? -40.539 47.729 -20.812 1.00 81.61  ? 14  DG  D N1    1 
ATOM   4817 C  C2    . DG  D 3 14  ? -39.170 47.732 -20.905 1.00 81.79  ? 14  DG  D C2    1 
ATOM   4818 N  N2    . DG  D 3 14  ? -38.526 47.768 -19.731 1.00 82.46  ? 14  DG  D N2    1 
ATOM   4819 N  N3    . DG  D 3 14  ? -38.497 47.696 -22.053 1.00 81.97  ? 14  DG  D N3    1 
ATOM   4820 C  C4    . DG  D 3 14  ? -39.332 47.664 -23.124 1.00 81.48  ? 14  DG  D C4    1 
ATOM   4821 P  P     . DA  D 3 15  ? -34.136 45.748 -26.795 1.00 86.31  ? 15  DA  D P     1 
ATOM   4822 O  OP1   . DA  D 3 15  ? -32.974 46.556 -27.268 1.00 87.46  ? 15  DA  D OP1   1 
ATOM   4823 O  OP2   . DA  D 3 15  ? -34.968 44.887 -27.677 1.00 85.77  ? 15  DA  D OP2   1 
ATOM   4824 O  "O5'" . DA  D 3 15  ? -33.652 44.756 -25.641 1.00 85.58  ? 15  DA  D "O5'" 1 
ATOM   4825 C  "C5'" . DA  D 3 15  ? -32.924 45.180 -24.509 1.00 84.92  ? 15  DA  D "C5'" 1 
ATOM   4826 C  "C4'" . DA  D 3 15  ? -33.373 44.328 -23.346 1.00 83.43  ? 15  DA  D "C4'" 1 
ATOM   4827 O  "O4'" . DA  D 3 15  ? -34.751 44.672 -23.078 1.00 82.83  ? 15  DA  D "O4'" 1 
ATOM   4828 C  "C3'" . DA  D 3 15  ? -33.346 42.837 -23.651 1.00 83.44  ? 15  DA  D "C3'" 1 
ATOM   4829 O  "O3'" . DA  D 3 15  ? -32.661 42.134 -22.622 1.00 84.07  ? 15  DA  D "O3'" 1 
ATOM   4830 C  "C2'" . DA  D 3 15  ? -34.824 42.462 -23.760 1.00 83.18  ? 15  DA  D "C2'" 1 
ATOM   4831 C  "C1'" . DA  D 3 15  ? -35.451 43.475 -22.815 1.00 82.89  ? 15  DA  D "C1'" 1 
ATOM   4832 N  N9    . DA  D 3 15  ? -36.891 43.711 -22.958 1.00 82.78  ? 15  DA  D N9    1 
ATOM   4833 C  C8    . DA  D 3 15  ? -37.659 43.725 -24.095 1.00 83.68  ? 15  DA  D C8    1 
ATOM   4834 N  N7    . DA  D 3 15  ? -38.941 43.973 -23.890 1.00 82.92  ? 15  DA  D N7    1 
ATOM   4835 C  C5    . DA  D 3 15  ? -39.016 44.143 -22.520 1.00 81.83  ? 15  DA  D C5    1 
ATOM   4836 C  C6    . DA  D 3 15  ? -40.088 44.428 -21.656 1.00 80.34  ? 15  DA  D C6    1 
ATOM   4837 N  N6    . DA  D 3 15  ? -41.330 44.598 -22.068 1.00 80.25  ? 15  DA  D N6    1 
ATOM   4838 N  N1    . DA  D 3 15  ? -39.843 44.534 -20.341 1.00 79.87  ? 15  DA  D N1    1 
ATOM   4839 C  C2    . DA  D 3 15  ? -38.585 44.354 -19.913 1.00 80.97  ? 15  DA  D C2    1 
ATOM   4840 N  N3    . DA  D 3 15  ? -37.483 44.072 -20.620 1.00 81.76  ? 15  DA  D N3    1 
ATOM   4841 C  C4    . DA  D 3 15  ? -37.769 43.981 -21.932 1.00 82.22  ? 15  DA  D C4    1 
ATOM   4842 P  P     . DC  D 3 16  ? -32.029 40.676 -22.911 1.00 86.75  ? 16  DC  D P     1 
ATOM   4843 O  OP1   . DC  D 3 16  ? -30.554 40.760 -22.817 1.00 88.07  ? 16  DC  D OP1   1 
ATOM   4844 O  OP2   . DC  D 3 16  ? -32.670 40.095 -24.124 1.00 85.88  ? 16  DC  D OP2   1 
ATOM   4845 O  "O5'" . DC  D 3 16  ? -32.507 39.794 -21.654 1.00 86.06  ? 16  DC  D "O5'" 1 
ATOM   4846 C  "C5'" . DC  D 3 16  ? -32.331 40.190 -20.298 1.00 83.98  ? 16  DC  D "C5'" 1 
ATOM   4847 C  "C4'" . DC  D 3 16  ? -33.451 39.591 -19.484 1.00 82.16  ? 16  DC  D "C4'" 1 
ATOM   4848 O  "O4'" . DC  D 3 16  ? -34.619 40.392 -19.728 1.00 80.78  ? 16  DC  D "O4'" 1 
ATOM   4849 C  "C3'" . DC  D 3 16  ? -33.875 38.190 -19.882 1.00 82.10  ? 16  DC  D "C3'" 1 
ATOM   4850 O  "O3'" . DC  D 3 16  ? -33.188 37.255 -19.094 1.00 83.23  ? 16  DC  D "O3'" 1 
ATOM   4851 C  "C2'" . DC  D 3 16  ? -35.353 38.142 -19.531 1.00 81.12  ? 16  DC  D "C2'" 1 
ATOM   4852 C  "C1'" . DC  D 3 16  ? -35.755 39.607 -19.444 1.00 80.47  ? 16  DC  D "C1'" 1 
ATOM   4853 N  N1    . DC  D 3 16  ? -36.841 40.021 -20.390 1.00 80.50  ? 16  DC  D N1    1 
ATOM   4854 C  C2    . DC  D 3 16  ? -37.978 40.696 -19.881 1.00 79.55  ? 16  DC  D C2    1 
ATOM   4855 O  O2    . DC  D 3 16  ? -38.082 40.928 -18.662 1.00 79.18  ? 16  DC  D O2    1 
ATOM   4856 N  N3    . DC  D 3 16  ? -38.957 41.070 -20.749 1.00 78.15  ? 16  DC  D N3    1 
ATOM   4857 C  C4    . DC  D 3 16  ? -38.827 40.797 -22.045 1.00 78.00  ? 16  DC  D C4    1 
ATOM   4858 N  N4    . DC  D 3 16  ? -39.816 41.194 -22.836 1.00 77.72  ? 16  DC  D N4    1 
ATOM   4859 C  C5    . DC  D 3 16  ? -37.693 40.117 -22.586 1.00 79.26  ? 16  DC  D C5    1 
ATOM   4860 C  C6    . DC  D 3 16  ? -36.726 39.751 -21.734 1.00 80.14  ? 16  DC  D C6    1 
ATOM   4861 P  P     . DA  D 3 17  ? -32.091 36.301 -19.747 1.00 84.91  ? 17  DA  D P     1 
ATOM   4862 O  OP1   . DA  D 3 17  ? -31.868 35.181 -18.801 1.00 85.72  ? 17  DA  D OP1   1 
ATOM   4863 O  OP2   . DA  D 3 17  ? -30.962 37.148 -20.189 1.00 84.39  ? 17  DA  D OP2   1 
ATOM   4864 O  "O5'" . DA  D 3 17  ? -32.819 35.727 -21.045 1.00 85.42  ? 17  DA  D "O5'" 1 
ATOM   4865 C  "C5'" . DA  D 3 17  ? -33.362 34.414 -21.036 1.00 87.48  ? 17  DA  D "C5'" 1 
ATOM   4866 C  "C4'" . DA  D 3 17  ? -34.753 34.468 -20.447 1.00 87.38  ? 17  DA  D "C4'" 1 
ATOM   4867 O  "O4'" . DA  D 3 17  ? -35.566 35.373 -21.228 1.00 86.16  ? 17  DA  D "O4'" 1 
ATOM   4868 C  "C3'" . DA  D 3 17  ? -35.517 33.147 -20.430 1.00 88.86  ? 17  DA  D "C3'" 1 
ATOM   4869 O  "O3'" . DA  D 3 17  ? -35.647 32.668 -19.084 1.00 90.68  ? 17  DA  D "O3'" 1 
ATOM   4870 C  "C2'" . DA  D 3 17  ? -36.878 33.531 -21.003 1.00 87.66  ? 17  DA  D "C2'" 1 
ATOM   4871 C  "C1'" . DA  D 3 17  ? -36.863 35.047 -20.846 1.00 86.24  ? 17  DA  D "C1'" 1 
ATOM   4872 N  N9    . DA  D 3 17  ? -37.856 35.723 -21.665 1.00 86.50  ? 17  DA  D N9    1 
ATOM   4873 C  C8    . DA  D 3 17  ? -38.058 35.571 -23.005 1.00 87.53  ? 17  DA  D C8    1 
ATOM   4874 N  N7    . DA  D 3 17  ? -39.057 36.289 -23.476 1.00 87.71  ? 17  DA  D N7    1 
ATOM   4875 C  C5    . DA  D 3 17  ? -39.548 36.956 -22.369 1.00 86.51  ? 17  DA  D C5    1 
ATOM   4876 C  C6    . DA  D 3 17  ? -40.610 37.873 -22.205 1.00 85.95  ? 17  DA  D C6    1 
ATOM   4877 N  N6    . DA  D 3 17  ? -41.398 38.287 -23.199 1.00 86.08  ? 17  DA  D N6    1 
ATOM   4878 N  N1    . DA  D 3 17  ? -40.838 38.349 -20.964 1.00 85.67  ? 17  DA  D N1    1 
ATOM   4879 C  C2    . DA  D 3 17  ? -40.051 37.930 -19.957 1.00 85.75  ? 17  DA  D C2    1 
ATOM   4880 N  N3    . DA  D 3 17  ? -39.024 37.074 -19.985 1.00 86.10  ? 17  DA  D N3    1 
ATOM   4881 C  C4    . DA  D 3 17  ? -38.819 36.616 -21.237 1.00 86.41  ? 17  DA  D C4    1 
HETATM 4882 ZN ZN    . ZN  E 4 .   ? -54.915 23.125 -46.899 1.00 76.20  ? 393 ZN  A ZN    1 
HETATM 4883 C  C1    . GOL F 5 .   ? -29.975 16.909 -8.856  1.00 120.14 ? 801 GOL A C1    1 
HETATM 4884 O  O1    . GOL F 5 .   ? -28.643 17.316 -9.104  1.00 118.36 ? 801 GOL A O1    1 
HETATM 4885 C  C2    . GOL F 5 .   ? -30.798 16.938 -10.154 1.00 120.86 ? 801 GOL A C2    1 
HETATM 4886 O  O2    . GOL F 5 .   ? -30.775 18.229 -10.742 1.00 120.86 ? 801 GOL A O2    1 
HETATM 4887 C  C3    . GOL F 5 .   ? -32.244 16.482 -9.892  1.00 120.54 ? 801 GOL A C3    1 
HETATM 4888 O  O3    . GOL F 5 .   ? -33.093 16.745 -10.994 1.00 119.14 ? 801 GOL A O3    1 
HETATM 4889 C  C1    . GOL G 5 .   ? -11.650 34.343 -12.025 1.00 108.78 ? 802 GOL A C1    1 
HETATM 4890 O  O1    . GOL G 5 .   ? -12.322 35.353 -11.321 1.00 108.70 ? 802 GOL A O1    1 
HETATM 4891 C  C2    . GOL G 5 .   ? -12.550 33.966 -13.185 1.00 109.02 ? 802 GOL A C2    1 
HETATM 4892 O  O2    . GOL G 5 .   ? -12.531 32.566 -13.340 1.00 109.75 ? 802 GOL A O2    1 
HETATM 4893 C  C3    . GOL G 5 .   ? -12.005 34.615 -14.446 1.00 109.28 ? 802 GOL A C3    1 
HETATM 4894 O  O3    . GOL G 5 .   ? -13.076 34.991 -15.284 1.00 109.17 ? 802 GOL A O3    1 
HETATM 4895 C  C1    . GOL H 5 .   ? -50.155 15.946 -31.045 1.00 84.28  ? 803 GOL A C1    1 
HETATM 4896 O  O1    . GOL H 5 .   ? -49.635 17.248 -30.909 1.00 83.14  ? 803 GOL A O1    1 
HETATM 4897 C  C2    . GOL H 5 .   ? -50.376 15.653 -32.526 1.00 84.23  ? 803 GOL A C2    1 
HETATM 4898 O  O2    . GOL H 5 .   ? -49.216 16.039 -33.220 1.00 84.35  ? 803 GOL A O2    1 
HETATM 4899 C  C3    . GOL H 5 .   ? -51.514 16.506 -33.060 1.00 83.78  ? 803 GOL A C3    1 
HETATM 4900 O  O3    . GOL H 5 .   ? -51.289 17.822 -32.610 1.00 82.80  ? 803 GOL A O3    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ALA A 13  ? 1.9288 2.1212 1.8741 0.0000 0.0000 0.0000 10  ALA A N     
2    C CA    . ALA A 13  ? 1.9402 2.1838 1.8877 0.0000 0.0000 0.0000 10  ALA A CA    
3    C C     . ALA A 13  ? 1.9036 2.2252 1.8718 0.0000 0.0000 0.0000 10  ALA A C     
4    O O     . ALA A 13  ? 1.8908 2.2567 1.8728 0.0000 0.0000 0.0000 10  ALA A O     
5    C CB    . ALA A 13  ? 1.9819 2.2123 1.9075 0.0000 0.0000 0.0000 10  ALA A CB    
6    N N     . GLU A 14  ? 1.8879 2.2247 1.8588 0.0000 0.0000 0.0000 11  GLU A N     
7    C CA    . GLU A 14  ? 1.8566 2.2635 1.8483 0.0000 0.0000 0.0000 11  GLU A CA    
8    C C     . GLU A 14  ? 1.8254 2.2281 1.8326 0.0000 0.0000 0.0000 11  GLU A C     
9    O O     . GLU A 14  ? 1.8047 2.2593 1.8302 0.0000 0.0000 0.0000 11  GLU A O     
10   C CB    . GLU A 14  ? 1.8517 2.2715 1.8404 0.0000 0.0000 0.0000 11  GLU A CB    
11   C CG    . GLU A 14  ? 1.8545 2.2065 1.8340 0.0000 0.0000 0.0000 11  GLU A CG    
12   C CD    . GLU A 14  ? 1.8350 2.2106 1.8258 0.0000 0.0000 0.0000 11  GLU A CD    
13   O OE1   . GLU A 14  ? 1.8172 2.2554 1.8272 0.0000 0.0000 0.0000 11  GLU A OE1   
14   O OE2   . GLU A 14  ? 1.8341 2.1652 1.8155 0.0000 0.0000 0.0000 11  GLU A OE2   
15   N N     . LEU A 15  ? 1.8241 2.1660 1.8225 0.0000 0.0000 0.0000 12  LEU A N     
16   C CA    . LEU A 15  ? 1.8000 2.1315 1.8056 0.0000 0.0000 0.0000 12  LEU A CA    
17   C C     . LEU A 15  ? 1.7995 2.1432 1.8098 0.0000 0.0000 0.0000 12  LEU A C     
18   O O     . LEU A 15  ? 1.7918 2.1277 1.8044 0.0000 0.0000 0.0000 12  LEU A O     
19   C CB    . LEU A 15  ? 1.8004 2.0722 1.7935 0.0000 0.0000 0.0000 12  LEU A CB    
20   C CG    . LEU A 15  ? 1.7986 2.0482 1.7850 0.0000 0.0000 0.0000 12  LEU A CG    
21   C CD1   . LEU A 15  ? 1.8307 2.0470 1.8025 0.0000 0.0000 0.0000 12  LEU A CD1   
22   C CD2   . LEU A 15  ? 1.7849 2.0012 1.7673 0.0000 0.0000 0.0000 12  LEU A CD2   
23   N N     . ASP A 16  ? 1.8083 2.1702 1.8177 0.0000 0.0000 0.0000 13  ASP A N     
24   C CA    . ASP A 16  ? 1.8052 2.1874 1.8211 0.0000 0.0000 0.0000 13  ASP A CA    
25   C C     . ASP A 16  ? 1.7807 2.2216 1.8161 0.0000 0.0000 0.0000 13  ASP A C     
26   O O     . ASP A 16  ? 1.7720 2.2077 1.8110 0.0000 0.0000 0.0000 13  ASP A O     
27   C CB    . ASP A 16  ? 1.8319 2.2248 1.8421 0.0000 0.0000 0.0000 13  ASP A CB    
28   C CG    . ASP A 16  ? 1.8429 2.2287 1.8534 0.0000 0.0000 0.0000 13  ASP A CG    
29   O OD1   . ASP A 16  ? 1.8292 2.2476 1.8526 0.0000 0.0000 0.0000 13  ASP A OD1   
30   O OD2   . ASP A 16  ? 1.8657 2.2113 1.8629 0.0000 0.0000 0.0000 13  ASP A OD2   
31   N N     . GLN A 17  ? 1.7694 2.2667 1.8162 0.0000 0.0000 0.0000 14  GLN A N     
32   C CA    . GLN A 17  ? 1.7491 2.3140 1.8185 0.0000 0.0000 0.0000 14  GLN A CA    
33   C C     . GLN A 17  ? 1.7320 2.2750 1.8063 0.0000 0.0000 0.0000 14  GLN A C     
34   O O     . GLN A 17  ? 1.7303 2.3020 1.8185 0.0000 0.0000 0.0000 14  GLN A O     
35   C CB    . GLN A 17  ? 1.7453 2.3760 1.8254 0.0000 0.0000 0.0000 14  GLN A CB    
36   C CG    . GLN A 17  ? 1.7606 2.4225 1.8323 0.0000 0.0000 0.0000 14  GLN A CG    
37   C CD    . GLN A 17  ? 1.7731 2.3796 1.8200 0.0000 0.0000 0.0000 14  GLN A CD    
38   O OE1   . GLN A 17  ? 1.7694 2.3010 1.8034 0.0000 0.0000 0.0000 14  GLN A OE1   
39   N NE2   . GLN A 17  ? 1.7885 2.4343 1.8274 0.0000 0.0000 0.0000 14  GLN A NE2   
40   N N     . LEU A 18  ? 1.7210 2.2108 1.7823 0.0000 0.0000 0.0000 15  LEU A N     
41   C CA    . LEU A 18  ? 1.7078 2.1723 1.7692 0.0000 0.0000 0.0000 15  LEU A CA    
42   C C     . LEU A 18  ? 1.7107 2.1454 1.7647 0.0000 0.0000 0.0000 15  LEU A C     
43   O O     . LEU A 18  ? 1.7129 2.1573 1.7742 0.0000 0.0000 0.0000 15  LEU A O     
44   C CB    . LEU A 18  ? 1.7049 2.1206 1.7518 0.0000 0.0000 0.0000 15  LEU A CB    
45   C CG    . LEU A 18  ? 1.6988 2.0950 1.7458 0.0000 0.0000 0.0000 15  LEU A CG    
46   C CD1   . LEU A 18  ? 1.6888 2.1393 1.7564 0.0000 0.0000 0.0000 15  LEU A CD1   
47   C CD2   . LEU A 18  ? 1.6962 2.0432 1.7269 0.0000 0.0000 0.0000 15  LEU A CD2   
48   N N     . LEU A 19  ? 1.7111 2.1100 1.7495 0.0000 0.0000 0.0000 16  LEU A N     
49   C CA    . LEU A 19  ? 1.7146 2.0882 1.7420 0.0000 0.0000 0.0000 16  LEU A CA    
50   C C     . LEU A 19  ? 1.7160 2.1276 1.7559 0.0000 0.0000 0.0000 16  LEU A C     
51   O O     . LEU A 19  ? 1.7263 2.1221 1.7585 0.0000 0.0000 0.0000 16  LEU A O     
52   C CB    . LEU A 19  ? 1.7199 2.0649 1.7338 0.0000 0.0000 0.0000 16  LEU A CB    
53   C CG    . LEU A 19  ? 1.7160 2.0157 1.7139 0.0000 0.0000 0.0000 16  LEU A CG    
54   C CD1   . LEU A 19  ? 1.7163 1.9995 1.7103 0.0000 0.0000 0.0000 16  LEU A CD1   
55   C CD2   . LEU A 19  ? 1.7208 1.9979 1.7031 0.0000 0.0000 0.0000 16  LEU A CD2   
56   N N     . GLN A 20  ? 1.7056 2.1696 1.7634 0.0000 0.0000 0.0000 17  GLN A N     
57   C CA    . GLN A 20  ? 1.7050 2.2166 1.7787 0.0000 0.0000 0.0000 17  GLN A CA    
58   C C     . GLN A 20  ? 1.7006 2.2406 1.7904 0.0000 0.0000 0.0000 17  GLN A C     
59   O O     . GLN A 20  ? 1.7093 2.2784 1.8109 0.0000 0.0000 0.0000 17  GLN A O     
60   C CB    . GLN A 20  ? 1.7039 2.2675 1.7898 0.0000 0.0000 0.0000 17  GLN A CB    
61   C CG    . GLN A 20  ? 1.7166 2.2428 1.7855 0.0000 0.0000 0.0000 17  GLN A CG    
62   C CD    . GLN A 20  ? 1.7284 2.2902 1.8014 0.0000 0.0000 0.0000 17  GLN A CD    
63   O OE1   . GLN A 20  ? 1.7249 2.3437 1.8122 0.0000 0.0000 0.0000 17  GLN A OE1   
64   N NE2   . GLN A 20  ? 1.7421 2.2714 1.8012 0.0000 0.0000 0.0000 17  GLN A NE2   
65   N N     . GLY A 21  ? 1.6885 2.2181 1.7792 0.0000 0.0000 0.0000 18  GLY A N     
66   C CA    . GLY A 21  ? 1.6835 2.2341 1.7898 0.0000 0.0000 0.0000 18  GLY A CA    
67   C C     . GLY A 21  ? 1.6651 2.2970 1.7994 0.0000 0.0000 0.0000 18  GLY A C     
68   O O     . GLY A 21  ? 1.6705 2.3416 1.8256 0.0000 0.0000 0.0000 18  GLY A O     
69   N N     . HIS A 22  ? 1.6465 2.3058 1.7805 0.0000 0.0000 0.0000 19  HIS A N     
70   C CA    . HIS A 22  ? 1.6317 2.3728 1.7869 0.0000 0.0000 0.0000 19  HIS A CA    
71   C C     . HIS A 22  ? 1.6205 2.3451 1.7718 0.0000 0.0000 0.0000 19  HIS A C     
72   O O     . HIS A 22  ? 1.6222 2.2803 1.7510 0.0000 0.0000 0.0000 19  HIS A O     
73   C CB    . HIS A 22  ? 1.6308 2.4106 1.7829 0.0000 0.0000 0.0000 19  HIS A CB    
74   C CG    . HIS A 22  ? 1.6420 2.4634 1.8053 0.0000 0.0000 0.0000 19  HIS A CG    
75   N ND1   . HIS A 22  ? 1.6448 2.5669 1.8326 0.0000 0.0000 0.0000 19  HIS A ND1   
76   C CD2   . HIS A 22  ? 1.6532 2.4345 1.8071 0.0000 0.0000 0.0000 19  HIS A CD2   
77   C CE1   . HIS A 22  ? 1.6489 2.5878 1.8421 0.0000 0.0000 0.0000 19  HIS A CE1   
78   N NE2   . HIS A 22  ? 1.6559 2.5085 1.8285 0.0000 0.0000 0.0000 19  HIS A NE2   
79   N N     . TYR A 23  ? 1.6086 2.3978 1.7833 0.0000 0.0000 0.0000 20  TYR A N     
80   C CA    . TYR A 23  ? 1.5961 2.3742 1.7703 0.0000 0.0000 0.0000 20  TYR A CA    
81   C C     . TYR A 23  ? 1.5823 2.3712 1.7439 0.0000 0.0000 0.0000 20  TYR A C     
82   O O     . TYR A 23  ? 1.5826 2.4303 1.7468 0.0000 0.0000 0.0000 20  TYR A O     
83   C CB    . TYR A 23  ? 1.5976 2.4490 1.8032 0.0000 0.0000 0.0000 20  TYR A CB    
84   C CG    . TYR A 23  ? 1.5930 2.4442 1.8014 0.0000 0.0000 0.0000 20  TYR A CG    
85   C CD1   . TYR A 23  ? 1.6069 2.3741 1.8023 0.0000 0.0000 0.0000 20  TYR A CD1   
86   C CD2   . TYR A 23  ? 1.5835 2.5213 1.8059 0.0000 0.0000 0.0000 20  TYR A CD2   
87   C CE1   . TYR A 23  ? 1.6065 2.3720 1.8047 0.0000 0.0000 0.0000 20  TYR A CE1   
88   C CE2   . TYR A 23  ? 1.5837 2.5233 1.8086 0.0000 0.0000 0.0000 20  TYR A CE2   
89   C CZ    . TYR A 23  ? 1.5925 2.4438 1.8063 0.0000 0.0000 0.0000 20  TYR A CZ    
90   O OH    . TYR A 23  ? 1.5856 2.4369 1.8022 0.0000 0.0000 0.0000 20  TYR A OH    
91   N N     . ILE A 24  ? 1.5712 2.3028 1.7177 0.0000 0.0000 0.0000 21  ILE A N     
92   C CA    . ILE A 24  ? 1.5593 2.2958 1.6930 0.0000 0.0000 0.0000 21  ILE A CA    
93   C C     . ILE A 24  ? 1.5451 2.2826 1.6845 0.0000 0.0000 0.0000 21  ILE A C     
94   O O     . ILE A 24  ? 1.5434 2.2190 1.6781 0.0000 0.0000 0.0000 21  ILE A O     
95   C CB    . ILE A 24  ? 1.5674 2.2219 1.6714 0.0000 0.0000 0.0000 21  ILE A CB    
96   C CG1   . ILE A 24  ? 1.5797 2.2379 1.6785 0.0000 0.0000 0.0000 21  ILE A CG1   
97   C CG2   . ILE A 24  ? 1.5680 2.2171 1.6568 0.0000 0.0000 0.0000 21  ILE A CG2   
98   C CD1   . ILE A 24  ? 1.6025 2.1830 1.6757 0.0000 0.0000 0.0000 21  ILE A CD1   
99   N N     . LYS A 25  ? 1.5340 2.3443 1.6818 0.0000 0.0000 0.0000 22  LYS A N     
100  C CA    . LYS A 25  ? 1.5208 2.3450 1.6759 0.0000 0.0000 0.0000 22  LYS A CA    
101  C C     . LYS A 25  ? 1.5157 2.2410 1.6481 0.0000 0.0000 0.0000 22  LYS A C     
102  O O     . LYS A 25  ? 1.5190 2.2034 1.6280 0.0000 0.0000 0.0000 22  LYS A O     
103  C CB    . LYS A 25  ? 1.5185 2.4298 1.6763 0.0000 0.0000 0.0000 22  LYS A CB    
104  N N     . GLY A 26  ? 1.5086 2.1954 1.6478 0.0000 0.0000 0.0000 23  GLY A N     
105  C CA    . GLY A 26  ? 1.4997 2.1004 1.6195 0.0000 0.0000 0.0000 23  GLY A CA    
106  C C     . GLY A 26  ? 1.5014 2.0263 1.6077 0.0000 0.0000 0.0000 23  GLY A C     
107  O O     . GLY A 26  ? 1.5046 1.9655 1.5968 0.0000 0.0000 0.0000 23  GLY A O     
108  N N     . TYR A 27  ? 1.5000 2.0360 1.6095 0.0000 0.0000 0.0000 24  TYR A N     
109  C CA    . TYR A 27  ? 1.5049 1.9767 1.5999 0.0000 0.0000 0.0000 24  TYR A CA    
110  C C     . TYR A 27  ? 1.5207 1.9972 1.6285 0.0000 0.0000 0.0000 24  TYR A C     
111  O O     . TYR A 27  ? 1.5235 2.0421 1.6446 0.0000 0.0000 0.0000 24  TYR A O     
112  C CB    . TYR A 27  ? 1.5015 1.9670 1.5854 0.0000 0.0000 0.0000 24  TYR A CB    
113  C CG    . TYR A 27  ? 1.4848 1.9216 1.5509 0.0000 0.0000 0.0000 24  TYR A CG    
114  C CD1   . TYR A 27  ? 1.4735 1.8430 1.5195 0.0000 0.0000 0.0000 24  TYR A CD1   
115  C CD2   . TYR A 27  ? 1.4764 1.9552 1.5448 0.0000 0.0000 0.0000 24  TYR A CD2   
116  C CE1   . TYR A 27  ? 1.4654 1.8077 1.4972 0.0000 0.0000 0.0000 24  TYR A CE1   
117  C CE2   . TYR A 27  ? 1.4719 1.9155 1.5215 0.0000 0.0000 0.0000 24  TYR A CE2   
118  C CZ    . TYR A 27  ? 1.4659 1.8400 1.4989 0.0000 0.0000 0.0000 24  TYR A CZ    
119  O OH    . TYR A 27  ? 1.4689 1.8079 1.4854 0.0000 0.0000 0.0000 24  TYR A OH    
120  N N     . PRO A 28  ? 1.5352 1.9656 1.6376 0.0000 0.0000 0.0000 25  PRO A N     
121  C CA    . PRO A 28  ? 1.5622 1.9888 1.6750 0.0000 0.0000 0.0000 25  PRO A CA    
122  C C     . PRO A 28  ? 1.5834 1.9871 1.6858 0.0000 0.0000 0.0000 25  PRO A C     
123  O O     . PRO A 28  ? 1.5920 1.9394 1.6682 0.0000 0.0000 0.0000 25  PRO A O     
124  C CB    . PRO A 28  ? 1.5780 1.9376 1.6755 0.0000 0.0000 0.0000 25  PRO A CB    
125  C CG    . PRO A 28  ? 1.5616 1.8820 1.6360 0.0000 0.0000 0.0000 25  PRO A CG    
126  C CD    . PRO A 28  ? 1.5335 1.9077 1.6177 0.0000 0.0000 0.0000 25  PRO A CD    
127  N N     . LYS A 29  ? 1.5958 2.0498 1.7195 0.0000 0.0000 0.0000 26  LYS A N     
128  C CA    . LYS A 29  ? 1.6220 2.0548 1.7376 0.0000 0.0000 0.0000 26  LYS A CA    
129  C C     . LYS A 29  ? 1.6661 2.0303 1.7665 0.0000 0.0000 0.0000 26  LYS A C     
130  O O     . LYS A 29  ? 1.6779 2.0241 1.7815 0.0000 0.0000 0.0000 26  LYS A O     
131  C CB    . LYS A 29  ? 1.6182 2.1307 1.7634 0.0000 0.0000 0.0000 26  LYS A CB    
132  C CG    . LYS A 29  ? 1.6223 2.1343 1.7599 0.0000 0.0000 0.0000 26  LYS A CG    
133  C CD    . LYS A 29  ? 1.6142 2.2154 1.7840 0.0000 0.0000 0.0000 26  LYS A CD    
134  C CE    . LYS A 29  ? 1.6129 2.2213 1.7760 0.0000 0.0000 0.0000 26  LYS A CE    
135  N NZ    . LYS A 29  ? 1.6094 2.3157 1.8047 0.0000 0.0000 0.0000 26  LYS A NZ    
136  N N     . GLN A 30  ? 1.6968 2.0217 1.7787 0.0000 0.0000 0.0000 27  GLN A N     
137  C CA    . GLN A 30  ? 1.7492 1.9970 1.8057 0.0000 0.0000 0.0000 27  GLN A CA    
138  C C     . GLN A 30  ? 1.7553 1.9415 1.7730 0.0000 0.0000 0.0000 27  GLN A C     
139  O O     . GLN A 30  ? 1.7973 1.9235 1.7851 0.0000 0.0000 0.0000 27  GLN A O     
140  C CB    . GLN A 30  ? 1.7747 2.0044 1.8417 0.0000 0.0000 0.0000 27  GLN A CB    
141  C CG    . GLN A 30  ? 1.7811 1.9542 1.8260 0.0000 0.0000 0.0000 27  GLN A CG    
142  C CD    . GLN A 30  ? 1.8004 1.9691 1.8622 0.0000 0.0000 0.0000 27  GLN A CD    
143  O OE1   . GLN A 30  ? 1.8079 2.0239 1.9015 0.0000 0.0000 0.0000 27  GLN A OE1   
144  N NE2   . GLN A 30  ? 1.8071 1.9233 1.8491 0.0000 0.0000 0.0000 27  GLN A NE2   
145  N N     . TYR A 31  ? 1.7186 1.9226 1.7360 0.0000 0.0000 0.0000 28  TYR A N     
146  C CA    . TYR A 31  ? 1.7188 1.8852 1.7060 0.0000 0.0000 0.0000 28  TYR A CA    
147  C C     . TYR A 31  ? 1.6945 1.8945 1.6851 0.0000 0.0000 0.0000 28  TYR A C     
148  O O     . TYR A 31  ? 1.6655 1.9182 1.6807 0.0000 0.0000 0.0000 28  TYR A O     
149  C CB    . TYR A 31  ? 1.6986 1.8584 1.6837 0.0000 0.0000 0.0000 28  TYR A CB    
150  C CG    . TYR A 31  ? 1.7309 1.8574 1.7128 0.0000 0.0000 0.0000 28  TYR A CG    
151  C CD1   . TYR A 31  ? 1.7927 1.8617 1.7496 0.0000 0.0000 0.0000 28  TYR A CD1   
152  C CD2   . TYR A 31  ? 1.7178 1.8680 1.7192 0.0000 0.0000 0.0000 28  TYR A CD2   
153  C CE1   . TYR A 31  ? 1.8274 1.8600 1.7799 0.0000 0.0000 0.0000 28  TYR A CE1   
154  C CE2   . TYR A 31  ? 1.7486 1.8679 1.7481 0.0000 0.0000 0.0000 28  TYR A CE2   
155  C CZ    . TYR A 31  ? 1.8025 1.8611 1.7778 0.0000 0.0000 0.0000 28  TYR A CZ    
156  O OH    . TYR A 31  ? 1.8312 1.8529 1.8028 0.0000 0.0000 0.0000 28  TYR A OH    
157  N N     . THR A 32  ? 1.7098 1.8815 1.6745 0.0000 0.0000 0.0000 29  THR A N     
158  C CA    . THR A 32  ? 1.6918 1.8921 1.6590 0.0000 0.0000 0.0000 29  THR A CA    
159  C C     . THR A 32  ? 1.6606 1.8631 1.6224 0.0000 0.0000 0.0000 29  THR A C     
160  O O     . THR A 32  ? 1.6652 1.8360 1.6065 0.0000 0.0000 0.0000 29  THR A O     
161  C CB    . THR A 32  ? 1.7251 1.9049 1.6703 0.0000 0.0000 0.0000 29  THR A CB    
162  O OG1   . THR A 32  ? 1.7649 1.8910 1.6777 0.0000 0.0000 0.0000 29  THR A OG1   
163  C CG2   . THR A 32  ? 1.7336 1.9373 1.6972 0.0000 0.0000 0.0000 29  THR A CG2   
164  N N     . TYR A 33  ? 1.6306 1.8717 1.6111 0.0000 0.0000 0.0000 30  TYR A N     
165  C CA    . TYR A 33  ? 1.6062 1.8478 1.5845 0.0000 0.0000 0.0000 30  TYR A CA    
166  C C     . TYR A 33  ? 1.6059 1.8496 1.5750 0.0000 0.0000 0.0000 30  TYR A C     
167  O O     . TYR A 33  ? 1.6055 1.8770 1.5861 0.0000 0.0000 0.0000 30  TYR A O     
168  C CB    . TYR A 33  ? 1.5859 1.8641 1.5871 0.0000 0.0000 0.0000 30  TYR A CB    
169  C CG    . TYR A 33  ? 1.5829 1.8708 1.5965 0.0000 0.0000 0.0000 30  TYR A CG    
170  C CD1   . TYR A 33  ? 1.5787 1.8471 1.5874 0.0000 0.0000 0.0000 30  TYR A CD1   
171  C CD2   . TYR A 33  ? 1.5904 1.9111 1.6225 0.0000 0.0000 0.0000 30  TYR A CD2   
172  C CE1   . TYR A 33  ? 1.5780 1.8577 1.5984 0.0000 0.0000 0.0000 30  TYR A CE1   
173  C CE2   . TYR A 33  ? 1.5900 1.9252 1.6358 0.0000 0.0000 0.0000 30  TYR A CE2   
174  C CZ    . TYR A 33  ? 1.5829 1.8967 1.6220 0.0000 0.0000 0.0000 30  TYR A CZ    
175  O OH    . TYR A 33  ? 1.5799 1.9097 1.6326 0.0000 0.0000 0.0000 30  TYR A OH    
176  N N     . PHE A 34  ? 1.6059 1.8254 1.5552 0.0000 0.0000 0.0000 31  PHE A N     
177  C CA    . PHE A 34  ? 1.6083 1.8322 1.5480 0.0000 0.0000 0.0000 31  PHE A CA    
178  C C     . PHE A 34  ? 1.5948 1.8152 1.5335 0.0000 0.0000 0.0000 31  PHE A C     
179  O O     . PHE A 34  ? 1.5821 1.7953 1.5277 0.0000 0.0000 0.0000 31  PHE A O     
180  C CB    . PHE A 34  ? 1.6340 1.8415 1.5483 0.0000 0.0000 0.0000 31  PHE A CB    
181  C CG    . PHE A 34  ? 1.6399 1.8247 1.5343 0.0000 0.0000 0.0000 31  PHE A CG    
182  C CD1   . PHE A 34  ? 1.6435 1.8329 1.5232 0.0000 0.0000 0.0000 31  PHE A CD1   
183  C CD2   . PHE A 34  ? 1.6484 1.8116 1.5395 0.0000 0.0000 0.0000 31  PHE A CD2   
184  C CE1   . PHE A 34  ? 1.6543 1.8325 1.5163 0.0000 0.0000 0.0000 31  PHE A CE1   
185  C CE2   . PHE A 34  ? 1.6594 1.8035 1.5313 0.0000 0.0000 0.0000 31  PHE A CE2   
186  C CZ    . PHE A 34  ? 1.6618 1.8160 1.5189 0.0000 0.0000 0.0000 31  PHE A CZ    
187  N N     . LEU A 35  ? 1.5987 1.8244 1.5292 0.0000 0.0000 0.0000 32  LEU A N     
188  C CA    . LEU A 35  ? 1.5909 1.8142 1.5229 0.0000 0.0000 0.0000 32  LEU A CA    
189  C C     . LEU A 35  ? 1.6000 1.8260 1.5140 0.0000 0.0000 0.0000 32  LEU A C     
190  O O     . LEU A 35  ? 1.6142 1.8514 1.5150 0.0000 0.0000 0.0000 32  LEU A O     
191  C CB    . LEU A 35  ? 1.5907 1.8259 1.5355 0.0000 0.0000 0.0000 32  LEU A CB    
192  C CG    . LEU A 35  ? 1.5937 1.8187 1.5426 0.0000 0.0000 0.0000 32  LEU A CG    
193  C CD1   . LEU A 35  ? 1.5864 1.7938 1.5427 0.0000 0.0000 0.0000 32  LEU A CD1   
194  C CD2   . LEU A 35  ? 1.6038 1.8401 1.5597 0.0000 0.0000 0.0000 32  LEU A CD2   
195  N N     . GLU A 36  ? 1.5944 1.8145 1.5076 0.0000 0.0000 0.0000 33  GLU A N     
196  C CA    . GLU A 36  ? 1.6014 1.8371 1.5021 0.0000 0.0000 0.0000 33  GLU A CA    
197  C C     . GLU A 36  ? 1.5932 1.8223 1.5050 0.0000 0.0000 0.0000 33  GLU A C     
198  O O     . GLU A 36  ? 1.5845 1.7923 1.5048 0.0000 0.0000 0.0000 33  GLU A O     
199  C CB    . GLU A 36  ? 1.6089 1.8486 1.4896 0.0000 0.0000 0.0000 33  GLU A CB    
200  C CG    . GLU A 36  ? 1.6358 1.8857 1.4951 0.0000 0.0000 0.0000 33  GLU A CG    
201  C CD    . GLU A 36  ? 1.6584 1.9009 1.4941 0.0000 0.0000 0.0000 33  GLU A CD    
202  O OE1   . GLU A 36  ? 1.6453 1.8761 1.4841 0.0000 0.0000 0.0000 33  GLU A OE1   
203  O OE2   . GLU A 36  ? 1.6920 1.9381 1.5040 0.0000 0.0000 0.0000 33  GLU A OE2   
204  N N     . ASP A 37  ? 1.5986 1.8461 1.5101 0.0000 0.0000 0.0000 34  ASP A N     
205  C CA    . ASP A 37  ? 1.5989 1.8401 1.5208 0.0000 0.0000 0.0000 34  ASP A CA    
206  C C     . ASP A 37  ? 1.5957 1.7985 1.5315 0.0000 0.0000 0.0000 34  ASP A C     
207  O O     . ASP A 37  ? 1.6011 1.7847 1.5432 0.0000 0.0000 0.0000 34  ASP A O     
208  C CB    . ASP A 37  ? 1.5968 1.8452 1.5138 0.0000 0.0000 0.0000 34  ASP A CB    
209  C CG    . ASP A 37  ? 1.6088 1.8976 1.5074 0.0000 0.0000 0.0000 34  ASP A CG    
210  O OD1   . ASP A 37  ? 1.6280 1.9535 1.5231 0.0000 0.0000 0.0000 34  ASP A OD1   
211  O OD2   . ASP A 37  ? 1.6091 1.8937 1.4954 0.0000 0.0000 0.0000 34  ASP A OD2   
212  N N     . GLY A 38  ? 1.5873 1.7811 1.5265 0.0000 0.0000 0.0000 35  GLY A N     
213  C CA    . GLY A 38  ? 1.5826 1.7467 1.5306 0.0000 0.0000 0.0000 35  GLY A CA    
214  C C     . GLY A 38  ? 1.5641 1.7112 1.5128 0.0000 0.0000 0.0000 35  GLY A C     
215  O O     . GLY A 38  ? 1.5751 1.6944 1.5270 0.0000 0.0000 0.0000 35  GLY A O     
216  N N     . LYS A 39  ? 1.5386 1.6999 1.4825 0.0000 0.0000 0.0000 36  LYS A N     
217  C CA    . LYS A 39  ? 1.5150 1.6655 1.4605 0.0000 0.0000 0.0000 36  LYS A CA    
218  C C     . LYS A 39  ? 1.4937 1.6603 1.4398 0.0000 0.0000 0.0000 36  LYS A C     
219  O O     . LYS A 39  ? 1.4942 1.6758 1.4335 0.0000 0.0000 0.0000 36  LYS A O     
220  C CB    . LYS A 39  ? 1.5103 1.6593 1.4496 0.0000 0.0000 0.0000 36  LYS A CB    
221  C CG    . LYS A 39  ? 1.5263 1.6707 1.4662 0.0000 0.0000 0.0000 36  LYS A CG    
222  C CD    . LYS A 39  ? 1.5265 1.6886 1.4590 0.0000 0.0000 0.0000 36  LYS A CD    
223  C CE    . LYS A 39  ? 1.5415 1.7218 1.4756 0.0000 0.0000 0.0000 36  LYS A CE    
224  N NZ    . LYS A 39  ? 1.5499 1.7042 1.4936 0.0000 0.0000 0.0000 36  LYS A NZ    
225  N N     . VAL A 40  ? 1.4727 1.6377 1.4262 0.0000 0.0000 0.0000 37  VAL A N     
226  C CA    . VAL A 40  ? 1.4545 1.6376 1.4122 0.0000 0.0000 0.0000 37  VAL A CA    
227  C C     . VAL A 40  ? 1.4436 1.6187 1.3931 0.0000 0.0000 0.0000 37  VAL A C     
228  O O     . VAL A 40  ? 1.4411 1.6022 1.3889 0.0000 0.0000 0.0000 37  VAL A O     
229  C CB    . VAL A 40  ? 1.4485 1.6439 1.4187 0.0000 0.0000 0.0000 37  VAL A CB    
230  C CG1   . VAL A 40  ? 1.4426 1.6687 1.4222 0.0000 0.0000 0.0000 37  VAL A CG1   
231  C CG2   . VAL A 40  ? 1.4612 1.6506 1.4332 0.0000 0.0000 0.0000 37  VAL A CG2   
232  N N     . LYS A 41  ? 1.4394 1.6200 1.3818 0.0000 0.0000 0.0000 38  LYS A N     
233  C CA    . LYS A 41  ? 1.4345 1.6013 1.3647 0.0000 0.0000 0.0000 38  LYS A CA    
234  C C     . LYS A 41  ? 1.4401 1.6074 1.3742 0.0000 0.0000 0.0000 38  LYS A C     
235  O O     . LYS A 41  ? 1.4417 1.6265 1.3860 0.0000 0.0000 0.0000 38  LYS A O     
236  C CB    . LYS A 41  ? 1.4455 1.6103 1.3546 0.0000 0.0000 0.0000 38  LYS A CB    
237  C CG    . LYS A 41  ? 1.4276 1.5979 1.3353 0.0000 0.0000 0.0000 38  LYS A CG    
238  C CD    . LYS A 41  ? 1.4242 1.6038 1.3112 0.0000 0.0000 0.0000 38  LYS A CD    
239  C CE    . LYS A 41  ? 1.4190 1.6157 1.3092 0.0000 0.0000 0.0000 38  LYS A CE    
240  N NZ    . LYS A 41  ? 1.4319 1.6492 1.3053 0.0000 0.0000 0.0000 38  LYS A NZ    
241  N N     . VAL A 42  ? 1.4441 1.5928 1.3707 0.0000 0.0000 0.0000 39  VAL A N     
242  C CA    . VAL A 42  ? 1.4562 1.5986 1.3856 0.0000 0.0000 0.0000 39  VAL A CA    
243  C C     . VAL A 42  ? 1.4832 1.5927 1.3886 0.0000 0.0000 0.0000 39  VAL A C     
244  O O     . VAL A 42  ? 1.4784 1.5745 1.3724 0.0000 0.0000 0.0000 39  VAL A O     
245  C CB    . VAL A 42  ? 1.4388 1.5955 1.3909 0.0000 0.0000 0.0000 39  VAL A CB    
246  C CG1   . VAL A 42  ? 1.4309 1.5716 1.3799 0.0000 0.0000 0.0000 39  VAL A CG1   
247  C CG2   . VAL A 42  ? 1.4524 1.6109 1.4129 0.0000 0.0000 0.0000 39  VAL A CG2   
248  N N     . SER A 43  ? 1.5151 1.6115 1.4116 0.0000 0.0000 0.0000 40  SER A N     
249  C CA    . SER A 43  ? 1.5564 1.6139 1.4271 0.0000 0.0000 0.0000 40  SER A CA    
250  C C     . SER A 43  ? 1.5642 1.6047 1.4474 0.0000 0.0000 0.0000 40  SER A C     
251  O O     . SER A 43  ? 1.5695 1.6200 1.4726 0.0000 0.0000 0.0000 40  SER A O     
252  C CB    . SER A 43  ? 1.5924 1.6359 1.4447 0.0000 0.0000 0.0000 40  SER A CB    
253  O OG    . SER A 43  ? 1.6364 1.6342 1.4603 0.0000 0.0000 0.0000 40  SER A OG    
254  N N     . ARG A 44  ? 1.5665 1.5865 1.4397 0.0000 0.0000 0.0000 41  ARG A N     
255  C CA    . ARG A 44  ? 1.5738 1.5760 1.4576 0.0000 0.0000 0.0000 41  ARG A CA    
256  C C     . ARG A 44  ? 1.6174 1.5685 1.4697 0.0000 0.0000 0.0000 41  ARG A C     
257  O O     . ARG A 44  ? 1.6332 1.5734 1.4564 0.0000 0.0000 0.0000 41  ARG A O     
258  C CB    . ARG A 44  ? 1.5351 1.5609 1.4391 0.0000 0.0000 0.0000 41  ARG A CB    
259  C CG    . ARG A 44  ? 1.5119 1.5836 1.4462 0.0000 0.0000 0.0000 41  ARG A CG    
260  C CD    . ARG A 44  ? 1.4945 1.5850 1.4443 0.0000 0.0000 0.0000 41  ARG A CD    
261  N NE    . ARG A 44  ? 1.5191 1.5956 1.4741 0.0000 0.0000 0.0000 41  ARG A NE    
262  C CZ    . ARG A 44  ? 1.5392 1.6303 1.5134 0.0000 0.0000 0.0000 41  ARG A CZ    
263  N NH1   . ARG A 44  ? 1.5356 1.6594 1.5263 0.0000 0.0000 0.0000 41  ARG A NH1   
264  N NH2   . ARG A 44  ? 1.5580 1.6347 1.5361 0.0000 0.0000 0.0000 41  ARG A NH2   
265  N N     . PRO A 45  ? 1.6412 1.5630 1.4982 0.0000 0.0000 0.0000 42  PRO A N     
266  C CA    . PRO A 45  ? 1.6889 1.5546 1.5136 0.0000 0.0000 0.0000 42  PRO A CA    
267  C C     . PRO A 45  ? 1.6770 1.5431 1.4798 0.0000 0.0000 0.0000 42  PRO A C     
268  O O     . PRO A 45  ? 1.7122 1.5566 1.4786 0.0000 0.0000 0.0000 42  PRO A O     
269  C CB    . PRO A 45  ? 1.6963 1.5463 1.5420 0.0000 0.0000 0.0000 42  PRO A CB    
270  C CG    . PRO A 45  ? 1.6771 1.5660 1.5577 0.0000 0.0000 0.0000 42  PRO A CG    
271  C CD    . PRO A 45  ? 1.6308 1.5713 1.5218 0.0000 0.0000 0.0000 42  PRO A CD    
272  N N     . GLU A 46  ? 1.6284 1.5240 1.4528 0.0000 0.0000 0.0000 43  GLU A N     
273  C CA    . GLU A 46  ? 1.6129 1.5171 1.4229 0.0000 0.0000 0.0000 43  GLU A CA    
274  C C     . GLU A 46  ? 1.6090 1.5378 1.3993 0.0000 0.0000 0.0000 43  GLU A C     
275  O O     . GLU A 46  ? 1.6209 1.5520 1.3867 0.0000 0.0000 0.0000 43  GLU A O     
276  C CB    . GLU A 46  ? 1.5610 1.4952 1.4009 0.0000 0.0000 0.0000 43  GLU A CB    
277  N N     . GLY A 47  ? 1.5912 1.5434 1.3928 0.0000 0.0000 0.0000 44  GLY A N     
278  C CA    . GLY A 47  ? 1.5807 1.5624 1.3694 0.0000 0.0000 0.0000 44  GLY A CA    
279  C C     . GLY A 47  ? 1.5399 1.5548 1.3561 0.0000 0.0000 0.0000 44  GLY A C     
280  O O     . GLY A 47  ? 1.5287 1.5445 1.3696 0.0000 0.0000 0.0000 44  GLY A O     
281  N N     . VAL A 48  ? 1.5189 1.5647 1.3308 0.0000 0.0000 0.0000 45  VAL A N     
282  C CA    . VAL A 48  ? 1.4803 1.5535 1.3150 0.0000 0.0000 0.0000 45  VAL A CA    
283  C C     . VAL A 48  ? 1.4387 1.5322 1.2931 0.0000 0.0000 0.0000 45  VAL A C     
284  O O     . VAL A 48  ? 1.4359 1.5437 1.2816 0.0000 0.0000 0.0000 45  VAL A O     
285  C CB    . VAL A 48  ? 1.4958 1.5860 1.3143 0.0000 0.0000 0.0000 45  VAL A CB    
286  C CG1   . VAL A 48  ? 1.4681 1.5866 1.3091 0.0000 0.0000 0.0000 45  VAL A CG1   
287  C CG2   . VAL A 48  ? 1.5319 1.5973 1.3349 0.0000 0.0000 0.0000 45  VAL A CG2   
288  N N     . LYS A 49  ? 1.4056 1.5024 1.2856 0.0000 0.0000 0.0000 46  LYS A N     
289  C CA    . LYS A 49  ? 1.3677 1.4729 1.2637 0.0000 0.0000 0.0000 46  LYS A CA    
290  C C     . LYS A 49  ? 1.3461 1.4673 1.2583 0.0000 0.0000 0.0000 46  LYS A C     
291  O O     . LYS A 49  ? 1.3482 1.4767 1.2683 0.0000 0.0000 0.0000 46  LYS A O     
292  C CB    . LYS A 49  ? 1.3578 1.4505 1.2654 0.0000 0.0000 0.0000 46  LYS A CB    
293  C CG    . LYS A 49  ? 1.3724 1.4430 1.2650 0.0000 0.0000 0.0000 46  LYS A CG    
294  C CD    . LYS A 49  ? 1.3691 1.4424 1.2450 0.0000 0.0000 0.0000 46  LYS A CD    
295  C CE    . LYS A 49  ? 1.3743 1.4277 1.2418 0.0000 0.0000 0.0000 46  LYS A CE    
296  N NZ    . LYS A 49  ? 1.4151 1.4399 1.2669 0.0000 0.0000 0.0000 46  LYS A NZ    
297  N N     . ILE A 50  ? 1.3264 1.4520 1.2431 0.0000 0.0000 0.0000 47  ILE A N     
298  C CA    . ILE A 50  ? 1.3130 1.4444 1.2419 0.0000 0.0000 0.0000 47  ILE A CA    
299  C C     . ILE A 50  ? 1.3016 1.4296 1.2445 0.0000 0.0000 0.0000 47  ILE A C     
300  O O     . ILE A 50  ? 1.2973 1.4159 1.2419 0.0000 0.0000 0.0000 47  ILE A O     
301  C CB    . ILE A 50  ? 1.3128 1.4438 1.2406 0.0000 0.0000 0.0000 47  ILE A CB    
302  C CG1   . ILE A 50  ? 1.3194 1.4686 1.2345 0.0000 0.0000 0.0000 47  ILE A CG1   
303  C CG2   . ILE A 50  ? 1.3152 1.4392 1.2534 0.0000 0.0000 0.0000 47  ILE A CG2   
304  C CD1   . ILE A 50  ? 1.3073 1.4675 1.2185 0.0000 0.0000 0.0000 47  ILE A CD1   
305  N N     . ILE A 51  ? 1.2998 1.4401 1.2519 0.0000 0.0000 0.0000 48  ILE A N     
306  C CA    . ILE A 51  ? 1.2932 1.4409 1.2565 0.0000 0.0000 0.0000 48  ILE A CA    
307  C C     . ILE A 51  ? 1.3047 1.4422 1.2676 0.0000 0.0000 0.0000 48  ILE A C     
308  O O     . ILE A 51  ? 1.3176 1.4617 1.2816 0.0000 0.0000 0.0000 48  ILE A O     
309  C CB    . ILE A 51  ? 1.2887 1.4657 1.2630 0.0000 0.0000 0.0000 48  ILE A CB    
310  C CG1   . ILE A 51  ? 1.2924 1.4719 1.2659 0.0000 0.0000 0.0000 48  ILE A CG1   
311  C CG2   . ILE A 51  ? 1.2785 1.4748 1.2631 0.0000 0.0000 0.0000 48  ILE A CG2   
312  C CD1   . ILE A 51  ? 1.3014 1.5101 1.2859 0.0000 0.0000 0.0000 48  ILE A CD1   
313  N N     . PRO A 52  ? 1.3075 1.4254 1.2676 0.0000 0.0000 0.0000 49  PRO A N     
314  C CA    . PRO A 52  ? 1.3259 1.4239 1.2825 0.0000 0.0000 0.0000 49  PRO A CA    
315  C C     . PRO A 52  ? 1.3357 1.4474 1.2946 0.0000 0.0000 0.0000 49  PRO A C     
316  O O     . PRO A 52  ? 1.3200 1.4605 1.2857 0.0000 0.0000 0.0000 49  PRO A O     
317  C CB    . PRO A 52  ? 1.3285 1.4017 1.2807 0.0000 0.0000 0.0000 49  PRO A CB    
318  C CG    . PRO A 52  ? 1.3087 1.3966 1.2647 0.0000 0.0000 0.0000 49  PRO A CG    
319  C CD    . PRO A 52  ? 1.2982 1.4081 1.2575 0.0000 0.0000 0.0000 49  PRO A CD    
320  N N     . PRO A 53  ? 1.3649 1.4587 1.3178 0.0000 0.0000 0.0000 50  PRO A N     
321  C CA    . PRO A 53  ? 1.3838 1.4911 1.3340 0.0000 0.0000 0.0000 50  PRO A CA    
322  C C     . PRO A 53  ? 1.3918 1.4899 1.3347 0.0000 0.0000 0.0000 50  PRO A C     
323  O O     . PRO A 53  ? 1.3931 1.4578 1.3308 0.0000 0.0000 0.0000 50  PRO A O     
324  C CB    . PRO A 53  ? 1.4174 1.4937 1.3585 0.0000 0.0000 0.0000 50  PRO A CB    
325  C CG    . PRO A 53  ? 1.4107 1.4715 1.3550 0.0000 0.0000 0.0000 50  PRO A CG    
326  C CD    . PRO A 53  ? 1.3845 1.4473 1.3321 0.0000 0.0000 0.0000 50  PRO A CD    
327  N N     . GLN A 54  ? 1.3973 1.5308 1.3401 0.0000 0.0000 0.0000 51  GLN A N     
328  C CA    . GLN A 54  ? 1.4088 1.5436 1.3424 0.0000 0.0000 0.0000 51  GLN A CA    
329  C C     . GLN A 54  ? 1.4368 1.5085 1.3527 0.0000 0.0000 0.0000 51  GLN A C     
330  O O     . GLN A 54  ? 1.4312 1.4902 1.3455 0.0000 0.0000 0.0000 51  GLN A O     
331  C CB    . GLN A 54  ? 1.4302 1.6076 1.3587 0.0000 0.0000 0.0000 51  GLN A CB    
332  C CG    . GLN A 54  ? 1.4460 1.6407 1.3636 0.0000 0.0000 0.0000 51  GLN A CG    
333  C CD    . GLN A 54  ? 1.4128 1.6720 1.3492 0.0000 0.0000 0.0000 51  GLN A CD    
334  O OE1   . GLN A 54  ? 1.3844 1.6775 1.3412 0.0000 0.0000 0.0000 51  GLN A OE1   
335  N NE2   . GLN A 54  ? 1.4246 1.6999 1.3533 0.0000 0.0000 0.0000 51  GLN A NE2   
336  N N     . SER A 55  ? 1.4692 1.5005 1.3723 0.0000 0.0000 0.0000 52  SER A N     
337  C CA    . SER A 55  ? 1.5051 1.4718 1.3896 0.0000 0.0000 0.0000 52  SER A CA    
338  C C     . SER A 55  ? 1.4889 1.4246 1.3806 0.0000 0.0000 0.0000 52  SER A C     
339  O O     . SER A 55  ? 1.5099 1.4058 1.3911 0.0000 0.0000 0.0000 52  SER A O     
340  C CB    . SER A 55  ? 1.5514 1.4778 1.4218 0.0000 0.0000 0.0000 52  SER A CB    
341  O OG    . SER A 55  ? 1.5402 1.4593 1.4237 0.0000 0.0000 0.0000 52  SER A OG    
342  N N     . ASP A 56  ? 1.4521 1.4098 1.3606 0.0000 0.0000 0.0000 53  ASP A N     
343  C CA    . ASP A 56  ? 1.4341 1.3773 1.3497 0.0000 0.0000 0.0000 53  ASP A CA    
344  C C     . ASP A 56  ? 1.3976 1.3593 1.3188 0.0000 0.0000 0.0000 53  ASP A C     
345  O O     . ASP A 56  ? 1.3934 1.3401 1.3170 0.0000 0.0000 0.0000 53  ASP A O     
346  C CB    . ASP A 56  ? 1.4184 1.3828 1.3456 0.0000 0.0000 0.0000 53  ASP A CB    
347  C CG    . ASP A 56  ? 1.4610 1.3973 1.3845 0.0000 0.0000 0.0000 53  ASP A CG    
348  O OD1   . ASP A 56  ? 1.5079 1.3993 1.4238 0.0000 0.0000 0.0000 53  ASP A OD1   
349  O OD2   . ASP A 56  ? 1.4613 1.4191 1.3899 0.0000 0.0000 0.0000 53  ASP A OD2   
350  N N     . ARG A 57  ? 1.3698 1.3674 1.2942 0.0000 0.0000 0.0000 54  ARG A N     
351  C CA    . ARG A 57  ? 1.3310 1.3504 1.2632 0.0000 0.0000 0.0000 54  ARG A CA    
352  C C     . ARG A 57  ? 1.3348 1.3295 1.2598 0.0000 0.0000 0.0000 54  ARG A C     
353  O O     . ARG A 57  ? 1.3151 1.3114 1.2461 0.0000 0.0000 0.0000 54  ARG A O     
354  C CB    . ARG A 57  ? 1.3133 1.3814 1.2538 0.0000 0.0000 0.0000 54  ARG A CB    
355  C CG    . ARG A 57  ? 1.2942 1.3896 1.2462 0.0000 0.0000 0.0000 54  ARG A CG    
356  C CD    . ARG A 57  ? 1.2839 1.4291 1.2457 0.0000 0.0000 0.0000 54  ARG A CD    
357  N NE    . ARG A 57  ? 1.2871 1.4529 1.2551 0.0000 0.0000 0.0000 54  ARG A NE    
358  C CZ    . ARG A 57  ? 1.2804 1.4946 1.2599 0.0000 0.0000 0.0000 54  ARG A CZ    
359  N NH1   . ARG A 57  ? 1.2767 1.5280 1.2636 0.0000 0.0000 0.0000 54  ARG A NH1   
360  N NH2   . ARG A 57  ? 1.2753 1.5049 1.2599 0.0000 0.0000 0.0000 54  ARG A NH2   
361  N N     . GLN A 58  ? 1.3616 1.3324 1.2716 0.0000 0.0000 0.0000 55  GLN A N     
362  C CA    . GLN A 58  ? 1.3713 1.3130 1.2720 0.0000 0.0000 0.0000 55  GLN A CA    
363  C C     . GLN A 58  ? 1.3685 1.2729 1.2715 0.0000 0.0000 0.0000 55  GLN A C     
364  O O     . GLN A 58  ? 1.3544 1.2566 1.2618 0.0000 0.0000 0.0000 55  GLN A O     
365  C CB    . GLN A 58  ? 1.4205 1.3382 1.2991 0.0000 0.0000 0.0000 55  GLN A CB    
366  C CG    . GLN A 58  ? 1.4600 1.3468 1.3259 0.0000 0.0000 0.0000 55  GLN A CG    
367  C CD    . GLN A 58  ? 1.5467 1.3769 1.3853 0.0000 0.0000 0.0000 55  GLN A CD    
368  O OE1   . GLN A 58  ? 1.5861 1.4212 1.4085 0.0000 0.0000 0.0000 55  GLN A OE1   
369  N NE2   . GLN A 58  ? 1.5756 1.3518 1.4080 0.0000 0.0000 0.0000 55  GLN A NE2   
370  N N     . LYS A 59  ? 1.3771 1.2580 1.2784 0.0000 0.0000 0.0000 56  LYS A N     
371  C CA    . LYS A 59  ? 1.3717 1.2295 1.2787 0.0000 0.0000 0.0000 56  LYS A CA    
372  C C     . LYS A 59  ? 1.3152 1.2107 1.2378 0.0000 0.0000 0.0000 56  LYS A C     
373  O O     . LYS A 59  ? 1.3139 1.2031 1.2408 0.0000 0.0000 0.0000 56  LYS A O     
374  C CB    . LYS A 59  ? 1.4009 1.2433 1.3076 0.0000 0.0000 0.0000 56  LYS A CB    
375  C CG    . LYS A 59  ? 1.4292 1.2502 1.3424 0.0000 0.0000 0.0000 56  LYS A CG    
376  C CD    . LYS A 59  ? 1.4419 1.2946 1.3673 0.0000 0.0000 0.0000 56  LYS A CD    
377  C CE    . LYS A 59  ? 1.4764 1.3202 1.3963 0.0000 0.0000 0.0000 56  LYS A CE    
378  N NZ    . LYS A 59  ? 1.5262 1.3268 1.4427 0.0000 0.0000 0.0000 56  LYS A NZ    
379  N N     . ILE A 60  ? 1.2671 1.2016 1.1967 0.0000 0.0000 0.0000 57  ILE A N     
380  C CA    . ILE A 60  ? 1.2178 1.1838 1.1568 0.0000 0.0000 0.0000 57  ILE A CA    
381  C C     . ILE A 60  ? 1.1948 1.1660 1.1353 0.0000 0.0000 0.0000 57  ILE A C     
382  O O     . ILE A 60  ? 1.1856 1.1610 1.1296 0.0000 0.0000 0.0000 57  ILE A O     
383  C CB    . ILE A 60  ? 1.1956 1.1927 1.1385 0.0000 0.0000 0.0000 57  ILE A CB    
384  C CG1   . ILE A 60  ? 1.2041 1.2005 1.1470 0.0000 0.0000 0.0000 57  ILE A CG1   
385  C CG2   . ILE A 60  ? 1.1650 1.1871 1.1117 0.0000 0.0000 0.0000 57  ILE A CG2   
386  C CD1   . ILE A 60  ? 1.1882 1.2123 1.1338 0.0000 0.0000 0.0000 57  ILE A CD1   
387  N N     . VAL A 61  ? 1.1803 1.1562 1.1185 0.0000 0.0000 0.0000 58  VAL A N     
388  C CA    . VAL A 61  ? 1.1563 1.1386 1.0963 0.0000 0.0000 0.0000 58  VAL A CA    
389  C C     . VAL A 61  ? 1.1656 1.1216 1.1024 0.0000 0.0000 0.0000 58  VAL A C     
390  O O     . VAL A 61  ? 1.1490 1.1128 1.0905 0.0000 0.0000 0.0000 58  VAL A O     
391  C CB    . VAL A 61  ? 1.1544 1.1492 1.0917 0.0000 0.0000 0.0000 58  VAL A CB    
392  C CG1   . VAL A 61  ? 1.1359 1.1401 1.0764 0.0000 0.0000 0.0000 58  VAL A CG1   
393  C CG2   . VAL A 61  ? 1.1388 1.1656 1.0825 0.0000 0.0000 0.0000 58  VAL A CG2   
394  N N     . LEU A 62  ? 1.1922 1.1153 1.1201 0.0000 0.0000 0.0000 59  LEU A N     
395  C CA    . LEU A 62  ? 1.2098 1.1017 1.1338 0.0000 0.0000 0.0000 59  LEU A CA    
396  C C     . LEU A 62  ? 1.1970 1.0998 1.1320 0.0000 0.0000 0.0000 59  LEU A C     
397  O O     . LEU A 62  ? 1.1951 1.0997 1.1340 0.0000 0.0000 0.0000 59  LEU A O     
398  C CB    . LEU A 62  ? 1.2590 1.1061 1.1687 0.0000 0.0000 0.0000 59  LEU A CB    
399  C CG    . LEU A 62  ? 1.2999 1.1052 1.1999 0.0000 0.0000 0.0000 59  LEU A CG    
400  C CD1   . LEU A 62  ? 1.2930 1.1050 1.1851 0.0000 0.0000 0.0000 59  LEU A CD1   
401  C CD2   . LEU A 62  ? 1.3643 1.1152 1.2480 0.0000 0.0000 0.0000 59  LEU A CD2   
402  N N     . GLN A 63  ? 1.1910 1.1070 1.1308 0.0000 0.0000 0.0000 60  GLN A N     
403  C CA    . GLN A 63  ? 1.1801 1.1207 1.1300 0.0000 0.0000 0.0000 60  GLN A CA    
404  C C     . GLN A 63  ? 1.1390 1.1173 1.0938 0.0000 0.0000 0.0000 60  GLN A C     
405  O O     . GLN A 63  ? 1.1344 1.1283 1.0951 0.0000 0.0000 0.0000 60  GLN A O     
406  C CB    . GLN A 63  ? 1.1875 1.1437 1.1402 0.0000 0.0000 0.0000 60  GLN A CB    
407  C CG    . GLN A 63  ? 1.2472 1.1683 1.1983 0.0000 0.0000 0.0000 60  GLN A CG    
408  C CD    . GLN A 63  ? 1.2775 1.2099 1.2293 0.0000 0.0000 0.0000 60  GLN A CD    
409  O OE1   . GLN A 63  ? 1.2650 1.2221 1.2155 0.0000 0.0000 0.0000 60  GLN A OE1   
410  N NE2   . GLN A 63  ? 1.3188 1.2311 1.2730 0.0000 0.0000 0.0000 60  GLN A NE2   
411  N N     . ALA A 64  ? 1.1083 1.1008 1.0604 0.0000 0.0000 0.0000 61  ALA A N     
412  C CA    . ALA A 64  ? 1.0726 1.0906 1.0256 0.0000 0.0000 0.0000 61  ALA A CA    
413  C C     . ALA A 64  ? 1.0602 1.0686 1.0145 0.0000 0.0000 0.0000 61  ALA A C     
414  O O     . ALA A 64  ? 1.0519 1.0794 1.0090 0.0000 0.0000 0.0000 61  ALA A O     
415  C CB    . ALA A 64  ? 1.0606 1.0843 1.0107 0.0000 0.0000 0.0000 61  ALA A CB    
416  N N     . HIS A 65  ? 1.0577 1.0401 1.0088 0.0000 0.0000 0.0000 62  HIS A N     
417  C CA    . HIS A 65  ? 1.0462 1.0186 0.9973 0.0000 0.0000 0.0000 62  HIS A CA    
418  C C     . HIS A 65  ? 1.0552 1.0211 1.0099 0.0000 0.0000 0.0000 62  HIS A C     
419  O O     . HIS A 65  ? 1.0469 1.0256 1.0058 0.0000 0.0000 0.0000 62  HIS A O     
420  C CB    . HIS A 65  ? 1.0534 1.0035 0.9970 0.0000 0.0000 0.0000 62  HIS A CB    
421  C CG    . HIS A 65  ? 1.0419 0.9794 0.9831 0.0000 0.0000 0.0000 62  HIS A CG    
422  N ND1   . HIS A 65  ? 1.0082 0.9627 0.9535 0.0000 0.0000 0.0000 62  HIS A ND1   
423  C CD2   . HIS A 65  ? 1.0580 0.9648 0.9922 0.0000 0.0000 0.0000 62  HIS A CD2   
424  C CE1   . HIS A 65  ? 1.0157 0.9550 0.9574 0.0000 0.0000 0.0000 62  HIS A CE1   
425  N NE2   . HIS A 65  ? 1.0420 0.9513 0.9761 0.0000 0.0000 0.0000 62  HIS A NE2   
426  N N     . ASN A 66  ? 1.0710 1.0182 1.0249 0.0000 0.0000 0.0000 63  ASN A N     
427  C CA    . ASN A 66  ? 1.0854 1.0210 1.0438 0.0000 0.0000 0.0000 63  ASN A CA    
428  C C     . ASN A 66  ? 1.0689 1.0496 1.0397 0.0000 0.0000 0.0000 63  ASN A C     
429  O O     . ASN A 66  ? 1.0850 1.0672 1.0632 0.0000 0.0000 0.0000 63  ASN A O     
430  C CB    . ASN A 66  ? 1.1245 1.0210 1.0779 0.0000 0.0000 0.0000 63  ASN A CB    
431  C CG    . ASN A 66  ? 1.1486 0.9953 1.0857 0.0000 0.0000 0.0000 63  ASN A CG    
432  O OD1   . ASN A 66  ? 1.1472 0.9887 1.0791 0.0000 0.0000 0.0000 63  ASN A OD1   
433  N ND2   . ASN A 66  ? 1.1809 0.9923 1.1081 0.0000 0.0000 0.0000 63  ASN A ND2   
434  N N     . LEU A 67  ? 1.0405 1.0603 1.0126 0.0000 0.0000 0.0000 64  LEU A N     
435  C CA    . LEU A 67  ? 1.0212 1.0926 1.0009 0.0000 0.0000 0.0000 64  LEU A CA    
436  C C     . LEU A 67  ? 1.0170 1.0998 1.0012 0.0000 0.0000 0.0000 64  LEU A C     
437  O O     . LEU A 67  ? 1.0198 1.1282 1.0144 0.0000 0.0000 0.0000 64  LEU A O     
438  C CB    . LEU A 67  ? 0.9992 1.1030 0.9726 0.0000 0.0000 0.0000 64  LEU A CB    
439  C CG    . LEU A 67  ? 0.9936 1.0907 0.9636 0.0000 0.0000 0.0000 64  LEU A CG    
440  C CD1   . LEU A 67  ? 0.9783 1.1039 0.9397 0.0000 0.0000 0.0000 64  LEU A CD1   
441  C CD2   . LEU A 67  ? 0.9981 1.1068 0.9769 0.0000 0.0000 0.0000 64  LEU A CD2   
442  N N     . ALA A 68  ? 1.0119 1.0778 0.9899 0.0000 0.0000 0.0000 65  ALA A N     
443  C CA    . ALA A 68  ? 1.0102 1.0783 0.9914 0.0000 0.0000 0.0000 65  ALA A CA    
444  C C     . ALA A 68  ? 1.0127 1.0407 0.9876 0.0000 0.0000 0.0000 65  ALA A C     
445  O O     . ALA A 68  ? 1.0052 1.0367 0.9806 0.0000 0.0000 0.0000 65  ALA A O     
446  C CB    . ALA A 68  ? 0.9933 1.1055 0.9741 0.0000 0.0000 0.0000 65  ALA A CB    
447  N N     . HIS A 69  ? 1.0292 1.0236 0.9975 0.0000 0.0000 0.0000 66  HIS A N     
448  C CA    . HIS A 69  ? 1.0338 0.9990 0.9947 0.0000 0.0000 0.0000 66  HIS A CA    
449  C C     . HIS A 69  ? 1.0144 0.9950 0.9754 0.0000 0.0000 0.0000 66  HIS A C     
450  O O     . HIS A 69  ? 1.0145 0.9895 0.9753 0.0000 0.0000 0.0000 66  HIS A O     
451  C CB    . HIS A 69  ? 1.0496 0.9904 1.0091 0.0000 0.0000 0.0000 66  HIS A CB    
452  C CG    . HIS A 69  ? 1.0799 0.9858 1.0338 0.0000 0.0000 0.0000 66  HIS A CG    
453  N ND1   . HIS A 69  ? 1.1046 0.9711 1.0433 0.0000 0.0000 0.0000 66  HIS A ND1   
454  C CD2   . HIS A 69  ? 1.0971 1.0016 1.0576 0.0000 0.0000 0.0000 66  HIS A CD2   
455  C CE1   . HIS A 69  ? 1.1498 0.9829 1.0838 0.0000 0.0000 0.0000 66  HIS A CE1   
456  N NE2   . HIS A 69  ? 1.1430 0.9983 1.0918 0.0000 0.0000 0.0000 66  HIS A NE2   
457  N N     . THR A 70  ? 1.0051 1.0029 0.9661 0.0000 0.0000 0.0000 67  THR A N     
458  C CA    . THR A 70  ? 0.9923 1.0008 0.9533 0.0000 0.0000 0.0000 67  THR A CA    
459  C C     . THR A 70  ? 0.9909 0.9906 0.9507 0.0000 0.0000 0.0000 67  THR A C     
460  O O     . THR A 70  ? 1.0013 0.9925 0.9582 0.0000 0.0000 0.0000 67  THR A O     
461  C CB    . THR A 70  ? 0.9904 1.0173 0.9488 0.0000 0.0000 0.0000 67  THR A CB    
462  O OG1   . THR A 70  ? 0.9965 1.0220 0.9532 0.0000 0.0000 0.0000 67  THR A OG1   
463  C CG2   . THR A 70  ? 0.9925 1.0431 0.9513 0.0000 0.0000 0.0000 67  THR A CG2   
464  N N     . GLY A 71  ? 0.9838 0.9891 0.9461 0.0000 0.0000 0.0000 68  GLY A N     
465  C CA    . GLY A 71  ? 0.9850 0.9943 0.9497 0.0000 0.0000 0.0000 68  GLY A CA    
466  C C     . GLY A 71  ? 0.9853 1.0041 0.9510 0.0000 0.0000 0.0000 68  GLY A C     
467  O O     . GLY A 71  ? 0.9877 1.0052 0.9502 0.0000 0.0000 0.0000 68  GLY A O     
468  N N     . ARG A 72  ? 0.9824 1.0147 0.9538 0.0000 0.0000 0.0000 69  ARG A N     
469  C CA    . ARG A 72  ? 0.9804 1.0270 0.9554 0.0000 0.0000 0.0000 69  ARG A CA    
470  C C     . ARG A 72  ? 0.9892 1.0262 0.9609 0.0000 0.0000 0.0000 69  ARG A C     
471  O O     . ARG A 72  ? 0.9948 1.0310 0.9621 0.0000 0.0000 0.0000 69  ARG A O     
472  C CB    . ARG A 72  ? 0.9727 1.0427 0.9580 0.0000 0.0000 0.0000 69  ARG A CB    
473  C CG    . ARG A 72  ? 0.9632 1.0557 0.9555 0.0000 0.0000 0.0000 69  ARG A CG    
474  C CD    . ARG A 72  ? 0.9404 1.0423 0.9437 0.0000 0.0000 0.0000 69  ARG A CD    
475  N NE    . ARG A 72  ? 0.9403 1.0562 0.9506 0.0000 0.0000 0.0000 69  ARG A NE    
476  C CZ    . ARG A 72  ? 0.9536 1.0619 0.9707 0.0000 0.0000 0.0000 69  ARG A CZ    
477  N NH1   . ARG A 72  ? 0.9691 1.0508 0.9842 0.0000 0.0000 0.0000 69  ARG A NH1   
478  N NH2   . ARG A 72  ? 0.9462 1.0710 0.9702 0.0000 0.0000 0.0000 69  ARG A NH2   
479  N N     . GLU A 73  ? 0.9957 1.0236 0.9671 0.0000 0.0000 0.0000 70  GLU A N     
480  C CA    . GLU A 73  ? 1.0115 1.0273 0.9750 0.0000 0.0000 0.0000 70  GLU A CA    
481  C C     . GLU A 73  ? 1.0157 1.0280 0.9676 0.0000 0.0000 0.0000 70  GLU A C     
482  O O     . GLU A 73  ? 1.0255 1.0384 0.9702 0.0000 0.0000 0.0000 70  GLU A O     
483  C CB    . GLU A 73  ? 1.0263 1.0263 0.9886 0.0000 0.0000 0.0000 70  GLU A CB    
484  C CG    . GLU A 73  ? 1.0440 1.0507 1.0186 0.0000 0.0000 0.0000 70  GLU A CG    
485  C CD    . GLU A 73  ? 1.0645 1.0757 1.0399 0.0000 0.0000 0.0000 70  GLU A CD    
486  O OE1   . GLU A 73  ? 1.0866 1.0769 1.0480 0.0000 0.0000 0.0000 70  GLU A OE1   
487  O OE2   . GLU A 73  ? 1.0567 1.0959 1.0458 0.0000 0.0000 0.0000 70  GLU A OE2   
488  N N     . ALA A 74  ? 1.0085 1.0222 0.9594 0.0000 0.0000 0.0000 71  ALA A N     
489  C CA    . ALA A 74  ? 1.0106 1.0332 0.9540 0.0000 0.0000 0.0000 71  ALA A CA    
490  C C     . ALA A 74  ? 1.0098 1.0398 0.9550 0.0000 0.0000 0.0000 71  ALA A C     
491  O O     . ALA A 74  ? 1.0190 1.0579 0.9572 0.0000 0.0000 0.0000 71  ALA A O     
492  C CB    . ALA A 74  ? 1.0040 1.0318 0.9501 0.0000 0.0000 0.0000 71  ALA A CB    
493  N N     . THR A 75  ? 1.0018 1.0277 0.9543 0.0000 0.0000 0.0000 72  THR A N     
494  C CA    . THR A 75  ? 1.0025 1.0295 0.9554 0.0000 0.0000 0.0000 72  THR A CA    
495  C C     . THR A 75  ? 1.0001 1.0332 0.9513 0.0000 0.0000 0.0000 72  THR A C     
496  O O     . THR A 75  ? 1.0080 1.0458 0.9563 0.0000 0.0000 0.0000 72  THR A O     
497  C CB    . THR A 75  ? 1.0071 1.0246 0.9631 0.0000 0.0000 0.0000 72  THR A CB    
498  O OG1   . THR A 75  ? 1.0101 1.0185 0.9664 0.0000 0.0000 0.0000 72  THR A OG1   
499  C CG2   . THR A 75  ? 1.0227 1.0342 0.9762 0.0000 0.0000 0.0000 72  THR A CG2   
500  N N     . LEU A 76  ? 0.9901 1.0244 0.9442 0.0000 0.0000 0.0000 73  LEU A N     
501  C CA    . LEU A 76  ? 0.9881 1.0282 0.9415 0.0000 0.0000 0.0000 73  LEU A CA    
502  C C     . LEU A 76  ? 0.9977 1.0349 0.9389 0.0000 0.0000 0.0000 73  LEU A C     
503  O O     . LEU A 76  ? 0.9991 1.0431 0.9367 0.0000 0.0000 0.0000 73  LEU A O     
504  C CB    . LEU A 76  ? 0.9853 1.0300 0.9467 0.0000 0.0000 0.0000 73  LEU A CB    
505  C CG    . LEU A 76  ? 0.9908 1.0396 0.9516 0.0000 0.0000 0.0000 73  LEU A CG    
506  C CD1   . LEU A 76  ? 0.9905 1.0639 0.9651 0.0000 0.0000 0.0000 73  LEU A CD1   
507  C CD2   . LEU A 76  ? 1.0038 1.0335 0.9567 0.0000 0.0000 0.0000 73  LEU A CD2   
508  N N     . LEU A 77  ? 1.0035 1.0326 0.9366 0.0000 0.0000 0.0000 74  LEU A N     
509  C CA    . LEU A 77  ? 1.0190 1.0485 0.9352 0.0000 0.0000 0.0000 74  LEU A CA    
510  C C     . LEU A 77  ? 1.0178 1.0685 0.9300 0.0000 0.0000 0.0000 74  LEU A C     
511  O O     . LEU A 77  ? 1.0337 1.0912 0.9342 0.0000 0.0000 0.0000 74  LEU A O     
512  C CB    . LEU A 77  ? 1.0273 1.0484 0.9335 0.0000 0.0000 0.0000 74  LEU A CB    
513  C CG    . LEU A 77  ? 1.0339 1.0287 0.9389 0.0000 0.0000 0.0000 74  LEU A CG    
514  C CD1   . LEU A 77  ? 1.0369 1.0220 0.9332 0.0000 0.0000 0.0000 74  LEU A CD1   
515  C CD2   . LEU A 77  ? 1.0706 1.0497 0.9624 0.0000 0.0000 0.0000 74  LEU A CD2   
516  N N     . LYS A 78  ? 1.0015 1.0619 0.9230 0.0000 0.0000 0.0000 75  LYS A N     
517  C CA    . LYS A 78  ? 0.9993 1.0791 0.9212 0.0000 0.0000 0.0000 75  LYS A CA    
518  C C     . LYS A 78  ? 0.9997 1.0764 0.9238 0.0000 0.0000 0.0000 75  LYS A C     
519  O O     . LYS A 78  ? 1.0098 1.1001 0.9254 0.0000 0.0000 0.0000 75  LYS A O     
520  C CB    . LYS A 78  ? 0.9910 1.0729 0.9236 0.0000 0.0000 0.0000 75  LYS A CB    
521  C CG    . LYS A 78  ? 0.9979 1.1018 0.9288 0.0000 0.0000 0.0000 75  LYS A CG    
522  C CD    . LYS A 78  ? 1.0205 1.1586 0.9393 0.0000 0.0000 0.0000 75  LYS A CD    
523  C CE    . LYS A 78  ? 1.0239 1.2016 0.9463 0.0000 0.0000 0.0000 75  LYS A CE    
524  N NZ    . LYS A 78  ? 1.0459 1.2655 0.9522 0.0000 0.0000 0.0000 75  LYS A NZ    
525  N N     . ILE A 79  ? 0.9899 1.0524 0.9241 0.0000 0.0000 0.0000 76  ILE A N     
526  C CA    . ILE A 79  ? 0.9919 1.0547 0.9294 0.0000 0.0000 0.0000 76  ILE A CA    
527  C C     . ILE A 79  ? 1.0043 1.0724 0.9350 0.0000 0.0000 0.0000 76  ILE A C     
528  O O     . ILE A 79  ? 1.0116 1.0883 0.9396 0.0000 0.0000 0.0000 76  ILE A O     
529  C CB    . ILE A 79  ? 0.9833 1.0379 0.9301 0.0000 0.0000 0.0000 76  ILE A CB    
530  C CG1   . ILE A 79  ? 0.9798 1.0224 0.9290 0.0000 0.0000 0.0000 76  ILE A CG1   
531  C CG2   . ILE A 79  ? 0.9833 1.0439 0.9329 0.0000 0.0000 0.0000 76  ILE A CG2   
532  C CD1   . ILE A 79  ? 0.9689 1.0067 0.9221 0.0000 0.0000 0.0000 76  ILE A CD1   
533  N N     . ALA A 80  ? 1.0116 1.0713 0.9389 0.0000 0.0000 0.0000 77  ALA A N     
534  C CA    . ALA A 80  ? 1.0285 1.0846 0.9487 0.0000 0.0000 0.0000 77  ALA A CA    
535  C C     . ALA A 80  ? 1.0509 1.1123 0.9524 0.0000 0.0000 0.0000 77  ALA A C     
536  O O     . ALA A 80  ? 1.0692 1.1260 0.9616 0.0000 0.0000 0.0000 77  ALA A O     
537  C CB    . ALA A 80  ? 1.0367 1.0766 0.9570 0.0000 0.0000 0.0000 77  ALA A CB    
538  N N     . ASN A 81  ? 1.0519 1.1271 0.9472 0.0000 0.0000 0.0000 78  ASN A N     
539  C CA    . ASN A 81  ? 1.0709 1.1658 0.9492 0.0000 0.0000 0.0000 78  ASN A CA    
540  C C     . ASN A 81  ? 1.0742 1.1801 0.9555 0.0000 0.0000 0.0000 78  ASN A C     
541  O O     . ASN A 81  ? 1.0927 1.1983 0.9603 0.0000 0.0000 0.0000 78  ASN A O     
542  C CB    . ASN A 81  ? 1.0640 1.1857 0.9407 0.0000 0.0000 0.0000 78  ASN A CB    
543  C CG    . ASN A 81  ? 1.0746 1.1909 0.9422 0.0000 0.0000 0.0000 78  ASN A CG    
544  O OD1   . ASN A 81  ? 1.0871 1.1747 0.9471 0.0000 0.0000 0.0000 78  ASN A OD1   
545  N ND2   . ASN A 81  ? 1.0882 1.2328 0.9570 0.0000 0.0000 0.0000 78  ASN A ND2   
546  N N     . LEU A 82  ? 1.0640 1.1753 0.9618 0.0000 0.0000 0.0000 79  LEU A N     
547  C CA    . LEU A 82  ? 1.0723 1.1932 0.9736 0.0000 0.0000 0.0000 79  LEU A CA    
548  C C     . LEU A 82  ? 1.0758 1.1826 0.9872 0.0000 0.0000 0.0000 79  LEU A C     
549  O O     . LEU A 82  ? 1.0907 1.2032 0.9989 0.0000 0.0000 0.0000 79  LEU A O     
550  C CB    . LEU A 82  ? 1.0648 1.1973 0.9760 0.0000 0.0000 0.0000 79  LEU A CB    
551  C CG    . LEU A 82  ? 1.0630 1.2196 0.9714 0.0000 0.0000 0.0000 79  LEU A CG    
552  C CD1   . LEU A 82  ? 1.0524 1.2102 0.9749 0.0000 0.0000 0.0000 79  LEU A CD1   
553  C CD2   . LEU A 82  ? 1.0724 1.2645 0.9640 0.0000 0.0000 0.0000 79  LEU A CD2   
554  N N     . TYR A 83  ? 1.0705 1.1648 0.9939 0.0000 0.0000 0.0000 80  TYR A N     
555  C CA    . TYR A 83  ? 1.0739 1.1685 1.0086 0.0000 0.0000 0.0000 80  TYR A CA    
556  C C     . TYR A 83  ? 1.0817 1.1754 1.0215 0.0000 0.0000 0.0000 80  TYR A C     
557  O O     . TYR A 83  ? 1.0875 1.1708 1.0233 0.0000 0.0000 0.0000 80  TYR A O     
558  C CB    . TYR A 83  ? 1.0652 1.1545 1.0092 0.0000 0.0000 0.0000 80  TYR A CB    
559  C CG    . TYR A 83  ? 1.0736 1.1593 1.0151 0.0000 0.0000 0.0000 80  TYR A CG    
560  C CD1   . TYR A 83  ? 1.0777 1.1672 1.0199 0.0000 0.0000 0.0000 80  TYR A CD1   
561  C CD2   . TYR A 83  ? 1.0793 1.1597 1.0190 0.0000 0.0000 0.0000 80  TYR A CD2   
562  C CE1   . TYR A 83  ? 1.0925 1.1785 1.0343 0.0000 0.0000 0.0000 80  TYR A CE1   
563  C CE2   . TYR A 83  ? 1.0954 1.1764 1.0357 0.0000 0.0000 0.0000 80  TYR A CE2   
564  C CZ    . TYR A 83  ? 1.1061 1.1888 1.0476 0.0000 0.0000 0.0000 80  TYR A CZ    
565  O OH    . TYR A 83  ? 1.1271 1.2103 1.0711 0.0000 0.0000 0.0000 80  TYR A OH    
566  N N     . TRP A 84  ? 1.0913 1.1986 1.0408 0.0000 0.0000 0.0000 81  TRP A N     
567  C CA    . TRP A 84  ? 1.0982 1.2168 1.0594 0.0000 0.0000 0.0000 81  TRP A CA    
568  C C     . TRP A 84  ? 1.0939 1.2382 1.0684 0.0000 0.0000 0.0000 81  TRP A C     
569  O O     . TRP A 84  ? 1.1010 1.2512 1.0746 0.0000 0.0000 0.0000 81  TRP A O     
570  C CB    . TRP A 84  ? 1.1135 1.2315 1.0718 0.0000 0.0000 0.0000 81  TRP A CB    
571  C CG    . TRP A 84  ? 1.1291 1.2614 1.1023 0.0000 0.0000 0.0000 81  TRP A CG    
572  C CD1   . TRP A 84  ? 1.1531 1.2713 1.1269 0.0000 0.0000 0.0000 81  TRP A CD1   
573  C CD2   . TRP A 84  ? 1.1364 1.3062 1.1278 0.0000 0.0000 0.0000 81  TRP A CD2   
574  N NE1   . TRP A 84  ? 1.1528 1.2981 1.1456 0.0000 0.0000 0.0000 81  TRP A NE1   
575  C CE2   . TRP A 84  ? 1.1425 1.3242 1.1467 0.0000 0.0000 0.0000 81  TRP A CE2   
576  C CE3   . TRP A 84  ? 1.1363 1.3343 1.1348 0.0000 0.0000 0.0000 81  TRP A CE3   
577  C CZ2   . TRP A 84  ? 1.1418 1.3710 1.1673 0.0000 0.0000 0.0000 81  TRP A CZ2   
578  C CZ3   . TRP A 84  ? 1.1401 1.3834 1.1579 0.0000 0.0000 0.0000 81  TRP A CZ3   
579  C CH2   . TRP A 84  ? 1.1376 1.4001 1.1694 0.0000 0.0000 0.0000 81  TRP A CH2   
580  N N     . TRP A 85  ? 1.0889 1.2513 1.0747 0.0000 0.0000 0.0000 82  TRP A N     
581  C CA    . TRP A 85  ? 1.0892 1.2898 1.0872 0.0000 0.0000 0.0000 82  TRP A CA    
582  C C     . TRP A 85  ? 1.0891 1.3203 1.1008 0.0000 0.0000 0.0000 82  TRP A C     
583  O O     . TRP A 85  ? 1.0913 1.3056 1.1026 0.0000 0.0000 0.0000 82  TRP A O     
584  C CB    . TRP A 85  ? 1.0906 1.2857 1.0821 0.0000 0.0000 0.0000 82  TRP A CB    
585  C CG    . TRP A 85  ? 1.0969 1.2729 1.0823 0.0000 0.0000 0.0000 82  TRP A CG    
586  C CD1   . TRP A 85  ? 1.1053 1.3025 1.0948 0.0000 0.0000 0.0000 82  TRP A CD1   
587  C CD2   . TRP A 85  ? 1.1000 1.2363 1.0740 0.0000 0.0000 0.0000 82  TRP A CD2   
588  N NE1   . TRP A 85  ? 1.1050 1.2717 1.0849 0.0000 0.0000 0.0000 82  TRP A NE1   
589  C CE2   . TRP A 85  ? 1.0965 1.2262 1.0681 0.0000 0.0000 0.0000 82  TRP A CE2   
590  C CE3   . TRP A 85  ? 1.0991 1.2110 1.0654 0.0000 0.0000 0.0000 82  TRP A CE3   
591  C CZ2   . TRP A 85  ? 1.0877 1.1837 1.0508 0.0000 0.0000 0.0000 82  TRP A CZ2   
592  C CZ3   . TRP A 85  ? 1.0879 1.1736 1.0473 0.0000 0.0000 0.0000 82  TRP A CZ3   
593  C CH2   . TRP A 85  ? 1.0796 1.1556 1.0380 0.0000 0.0000 0.0000 82  TRP A CH2   
594  N N     . PRO A 86  ? 1.0910 1.3722 1.1153 0.0000 0.0000 0.0000 83  PRO A N     
595  C CA    . PRO A 86  ? 1.0890 1.4121 1.1292 0.0000 0.0000 0.0000 83  PRO A CA    
596  C C     . PRO A 86  ? 1.0869 1.4060 1.1227 0.0000 0.0000 0.0000 83  PRO A C     
597  O O     . PRO A 86  ? 1.0883 1.3978 1.1120 0.0000 0.0000 0.0000 83  PRO A O     
598  C CB    . PRO A 86  ? 1.0879 1.4758 1.1408 0.0000 0.0000 0.0000 83  PRO A CB    
599  C CG    . PRO A 86  ? 1.0927 1.4647 1.1384 0.0000 0.0000 0.0000 83  PRO A CG    
600  C CD    . PRO A 86  ? 1.0959 1.4044 1.1216 0.0000 0.0000 0.0000 83  PRO A CD    
601  N N     . ASN A 87  ? 1.0898 1.4126 1.1342 0.0000 0.0000 0.0000 84  ASN A N     
602  C CA    . ASN A 87  ? 1.0924 1.4154 1.1345 0.0000 0.0000 0.0000 84  ASN A CA    
603  C C     . ASN A 87  ? 1.0971 1.3665 1.1195 0.0000 0.0000 0.0000 84  ASN A C     
604  O O     . ASN A 87  ? 1.1029 1.3762 1.1169 0.0000 0.0000 0.0000 84  ASN A O     
605  C CB    . ASN A 87  ? 1.0897 1.4796 1.1401 0.0000 0.0000 0.0000 84  ASN A CB    
606  C CG    . ASN A 87  ? 1.0901 1.5465 1.1638 0.0000 0.0000 0.0000 84  ASN A CG    
607  O OD1   . ASN A 87  ? 1.0939 1.5551 1.1820 0.0000 0.0000 0.0000 84  ASN A OD1   
608  N ND2   . ASN A 87  ? 1.0964 1.6054 1.1742 0.0000 0.0000 0.0000 84  ASN A ND2   
609  N N     . MET A 88  ? 1.0997 1.3214 1.1140 0.0000 0.0000 0.0000 85  MET A N     
610  C CA    . MET A 88  ? 1.0994 1.2772 1.0981 0.0000 0.0000 0.0000 85  MET A CA    
611  C C     . MET A 88  ? 1.0890 1.2591 1.0848 0.0000 0.0000 0.0000 85  MET A C     
612  O O     . MET A 88  ? 1.0925 1.2492 1.0786 0.0000 0.0000 0.0000 85  MET A O     
613  C CB    . MET A 88  ? 1.1082 1.2519 1.0998 0.0000 0.0000 0.0000 85  MET A CB    
614  C CG    . MET A 88  ? 1.1343 1.2847 1.1271 0.0000 0.0000 0.0000 85  MET A CG    
615  S SD    . MET A 88  ? 1.1937 1.3087 1.1694 0.0000 0.0000 0.0000 85  MET A SD    
616  C CE    . MET A 88  ? 1.1778 1.2789 1.1465 0.0000 0.0000 0.0000 85  MET A CE    
617  N N     . ARG A 89  ? 1.0775 1.2535 1.0813 0.0000 0.0000 0.0000 86  ARG A N     
618  C CA    . ARG A 89  ? 1.0691 1.2390 1.0708 0.0000 0.0000 0.0000 86  ARG A CA    
619  C C     . ARG A 89  ? 1.0684 1.2675 1.0680 0.0000 0.0000 0.0000 86  ARG A C     
620  O O     . ARG A 89  ? 1.0714 1.2482 1.0595 0.0000 0.0000 0.0000 86  ARG A O     
621  C CB    . ARG A 89  ? 1.0676 1.2432 1.0799 0.0000 0.0000 0.0000 86  ARG A CB    
622  C CG    . ARG A 89  ? 1.0654 1.1992 1.0710 0.0000 0.0000 0.0000 86  ARG A CG    
623  C CD    . ARG A 89  ? 1.0590 1.1923 1.0739 0.0000 0.0000 0.0000 86  ARG A CD    
624  N NE    . ARG A 89  ? 1.0569 1.1449 1.0594 0.0000 0.0000 0.0000 86  ARG A NE    
625  C CZ    . ARG A 89  ? 1.0618 1.1260 1.0550 0.0000 0.0000 0.0000 86  ARG A CZ    
626  N NH1   . ARG A 89  ? 1.0677 1.1466 1.0647 0.0000 0.0000 0.0000 86  ARG A NH1   
627  N NH2   . ARG A 89  ? 1.0649 1.0923 1.0431 0.0000 0.0000 0.0000 86  ARG A NH2   
628  N N     . LYS A 90  ? 1.0679 1.3179 1.0769 0.0000 0.0000 0.0000 87  LYS A N     
629  C CA    . LYS A 90  ? 1.0763 1.3616 1.0791 0.0000 0.0000 0.0000 87  LYS A CA    
630  C C     . LYS A 90  ? 1.0929 1.3328 1.0743 0.0000 0.0000 0.0000 87  LYS A C     
631  O O     . LYS A 90  ? 1.1024 1.3325 1.0709 0.0000 0.0000 0.0000 87  LYS A O     
632  C CB    . LYS A 90  ? 1.0711 1.4210 1.0848 0.0000 0.0000 0.0000 87  LYS A CB    
633  N N     . ASP A 91  ? 1.0988 1.3086 1.0762 0.0000 0.0000 0.0000 88  ASP A N     
634  C CA    . ASP A 91  ? 1.1202 1.2842 1.0801 0.0000 0.0000 0.0000 88  ASP A CA    
635  C C     . ASP A 91  ? 1.1196 1.2385 1.0730 0.0000 0.0000 0.0000 88  ASP A C     
636  O O     . ASP A 91  ? 1.1452 1.2349 1.0840 0.0000 0.0000 0.0000 88  ASP A O     
637  C CB    . ASP A 91  ? 1.1268 1.2756 1.0871 0.0000 0.0000 0.0000 88  ASP A CB    
638  C CG    . ASP A 91  ? 1.1453 1.3269 1.1047 0.0000 0.0000 0.0000 88  ASP A CG    
639  O OD1   . ASP A 91  ? 1.1696 1.3643 1.1177 0.0000 0.0000 0.0000 88  ASP A OD1   
640  O OD2   . ASP A 91  ? 1.1510 1.3462 1.1191 0.0000 0.0000 0.0000 88  ASP A OD2   
641  N N     . VAL A 92  ? 1.0974 1.2097 1.0603 0.0000 0.0000 0.0000 89  VAL A N     
642  C CA    . VAL A 92  ? 1.0887 1.1677 1.0473 0.0000 0.0000 0.0000 89  VAL A CA    
643  C C     . VAL A 92  ? 1.0935 1.1770 1.0476 0.0000 0.0000 0.0000 89  VAL A C     
644  O O     . VAL A 92  ? 1.1073 1.1610 1.0496 0.0000 0.0000 0.0000 89  VAL A O     
645  C CB    . VAL A 92  ? 1.0716 1.1486 1.0388 0.0000 0.0000 0.0000 89  VAL A CB    
646  C CG1   . VAL A 92  ? 1.0586 1.1098 1.0218 0.0000 0.0000 0.0000 89  VAL A CG1   
647  C CG2   . VAL A 92  ? 1.0712 1.1449 1.0388 0.0000 0.0000 0.0000 89  VAL A CG2   
648  N N     . VAL A 93  ? 1.0841 1.2064 1.0474 0.0000 0.0000 0.0000 90  VAL A N     
649  C CA    . VAL A 93  ? 1.0886 1.2264 1.0483 0.0000 0.0000 0.0000 90  VAL A CA    
650  C C     . VAL A 93  ? 1.1178 1.2474 1.0580 0.0000 0.0000 0.0000 90  VAL A C     
651  O O     . VAL A 93  ? 1.1277 1.2405 1.0564 0.0000 0.0000 0.0000 90  VAL A O     
652  C CB    . VAL A 93  ? 1.0749 1.2702 1.0491 0.0000 0.0000 0.0000 90  VAL A CB    
653  C CG1   . VAL A 93  ? 1.0736 1.2826 1.0460 0.0000 0.0000 0.0000 90  VAL A CG1   
654  C CG2   . VAL A 93  ? 1.0593 1.2581 1.0506 0.0000 0.0000 0.0000 90  VAL A CG2   
655  N N     . LYS A 94  ? 1.1365 1.2752 1.0711 0.0000 0.0000 0.0000 91  LYS A N     
656  C CA    . LYS A 94  ? 1.1764 1.3012 1.0882 0.0000 0.0000 0.0000 91  LYS A CA    
657  C C     . LYS A 94  ? 1.2028 1.2596 1.0995 0.0000 0.0000 0.0000 91  LYS A C     
658  O O     . LYS A 94  ? 1.2349 1.2700 1.1111 0.0000 0.0000 0.0000 91  LYS A O     
659  C CB    . LYS A 94  ? 1.1865 1.3291 1.0959 0.0000 0.0000 0.0000 91  LYS A CB    
660  N N     . GLN A 95  ? 1.1935 1.2202 1.0998 0.0000 0.0000 0.0000 92  GLN A N     
661  C CA    . GLN A 95  ? 1.2214 1.1930 1.1188 0.0000 0.0000 0.0000 92  GLN A CA    
662  C C     . GLN A 95  ? 1.2127 1.1729 1.1104 0.0000 0.0000 0.0000 92  GLN A C     
663  O O     . GLN A 95  ? 1.2439 1.1672 1.1262 0.0000 0.0000 0.0000 92  GLN A O     
664  C CB    . GLN A 95  ? 1.2132 1.1714 1.1221 0.0000 0.0000 0.0000 92  GLN A CB    
665  C CG    . GLN A 95  ? 1.2631 1.2189 1.1685 0.0000 0.0000 0.0000 92  GLN A CG    
666  C CD    . GLN A 95  ? 1.3434 1.2595 1.2273 0.0000 0.0000 0.0000 92  GLN A CD    
667  O OE1   . GLN A 95  ? 1.3837 1.2546 1.2593 0.0000 0.0000 0.0000 92  GLN A OE1   
668  N NE2   . GLN A 95  ? 1.3598 1.2925 1.2337 0.0000 0.0000 0.0000 92  GLN A NE2   
669  N N     . LEU A 96  ? 1.1741 1.1627 1.0886 0.0000 0.0000 0.0000 93  LEU A N     
670  C CA    . LEU A 96  ? 1.1598 1.1428 1.0767 0.0000 0.0000 0.0000 93  LEU A CA    
671  C C     . LEU A 96  ? 1.1788 1.1639 1.0806 0.0000 0.0000 0.0000 93  LEU A C     
672  O O     . LEU A 96  ? 1.1908 1.1560 1.0880 0.0000 0.0000 0.0000 93  LEU A O     
673  C CB    . LEU A 96  ? 1.1249 1.1395 1.0596 0.0000 0.0000 0.0000 93  LEU A CB    
674  C CG    . LEU A 96  ? 1.1016 1.1176 1.0476 0.0000 0.0000 0.0000 93  LEU A CG    
675  C CD1   . LEU A 96  ? 1.0912 1.1388 1.0496 0.0000 0.0000 0.0000 93  LEU A CD1   
676  C CD2   . LEU A 96  ? 1.0966 1.0905 1.0442 0.0000 0.0000 0.0000 93  LEU A CD2   
677  N N     . GLY A 97  ? 1.1853 1.1998 1.0791 0.0000 0.0000 0.0000 94  GLY A N     
678  C CA    . GLY A 97  ? 1.2043 1.2292 1.0791 0.0000 0.0000 0.0000 94  GLY A CA    
679  C C     . GLY A 97  ? 1.2496 1.2183 1.0968 0.0000 0.0000 0.0000 94  GLY A C     
680  O O     . GLY A 97  ? 1.2735 1.2290 1.1013 0.0000 0.0000 0.0000 94  GLY A O     
681  N N     . ARG A 98  ? 1.2645 1.1979 1.1093 0.0000 0.0000 0.0000 95  ARG A N     
682  C CA    . ARG A 98  ? 1.3185 1.1895 1.1380 0.0000 0.0000 0.0000 95  ARG A CA    
683  C C     . ARG A 98  ? 1.3158 1.1359 1.1422 0.0000 0.0000 0.0000 95  ARG A C     
684  O O     . ARG A 98  ? 1.3605 1.1241 1.1701 0.0000 0.0000 0.0000 95  ARG A O     
685  C CB    . ARG A 98  ? 1.3468 1.2103 1.1572 0.0000 0.0000 0.0000 95  ARG A CB    
686  C CG    . ARG A 98  ? 1.3754 1.2972 1.1806 0.0000 0.0000 0.0000 95  ARG A CG    
687  C CD    . ARG A 98  ? 1.4727 1.3766 1.2653 0.0000 0.0000 0.0000 95  ARG A CD    
688  N NE    . ARG A 98  ? 1.4958 1.4694 1.2979 0.0000 0.0000 0.0000 95  ARG A NE    
689  C CZ    . ARG A 98  ? 1.5414 1.5621 1.3273 0.0000 0.0000 0.0000 95  ARG A CZ    
690  N NH1   . ARG A 98  ? 1.5948 1.5976 1.3503 0.0000 0.0000 0.0000 95  ARG A NH1   
691  N NH2   . ARG A 98  ? 1.5324 1.6232 1.3321 0.0000 0.0000 0.0000 95  ARG A NH2   
692  N N     . CYS A 99  ? 1.2643 1.1054 1.1150 0.0000 0.0000 0.0000 96  CYS A N     
693  C CA    . CYS A 99  ? 1.2605 1.0672 1.1189 0.0000 0.0000 0.0000 96  CYS A CA    
694  C C     . CYS A 99  ? 1.2767 1.0571 1.1227 0.0000 0.0000 0.0000 96  CYS A C     
695  O O     . CYS A 99  ? 1.2456 1.0527 1.1006 0.0000 0.0000 0.0000 96  CYS A O     
696  C CB    . CYS A 99  ? 1.2113 1.0512 1.0968 0.0000 0.0000 0.0000 96  CYS A CB    
697  S SG    . CYS A 99  ? 1.2195 1.0336 1.1157 0.0000 0.0000 0.0000 96  CYS A SG    
698  N N     . GLN A 100 ? 1.3270 1.0508 1.1509 0.0000 0.0000 0.0000 97  GLN A N     
699  C CA    . GLN A 100 ? 1.3537 1.0429 1.1629 0.0000 0.0000 0.0000 97  GLN A CA    
700  C C     . GLN A 100 ? 1.3054 1.0149 1.1392 0.0000 0.0000 0.0000 97  GLN A C     
701  O O     . GLN A 100 ? 1.2925 1.0151 1.1246 0.0000 0.0000 0.0000 97  GLN A O     
702  C CB    . GLN A 100 ? 1.4283 1.0430 1.2151 0.0000 0.0000 0.0000 97  GLN A CB    
703  C CG    . GLN A 100 ? 1.4884 1.0554 1.2567 0.0000 0.0000 0.0000 97  GLN A CG    
704  C CD    . GLN A 100 ? 1.5377 1.1037 1.2742 0.0000 0.0000 0.0000 97  GLN A CD    
705  O OE1   . GLN A 100 ? 1.5047 1.1308 1.2481 0.0000 0.0000 0.0000 97  GLN A OE1   
706  N NE2   . GLN A 100 ? 1.6232 1.1213 1.3235 0.0000 0.0000 0.0000 97  GLN A NE2   
707  N N     . GLN A 101 ? 1.2735 0.9920 1.1298 0.0000 0.0000 0.0000 98  GLN A N     
708  C CA    . GLN A 101 ? 1.2353 0.9732 1.1132 0.0000 0.0000 0.0000 98  GLN A CA    
709  C C     . GLN A 101 ? 1.1745 0.9649 1.0678 0.0000 0.0000 0.0000 98  GLN A C     
710  O O     . GLN A 101 ? 1.1611 0.9578 1.0585 0.0000 0.0000 0.0000 98  GLN A O     
711  C CB    . GLN A 101 ? 1.2343 0.9771 1.1296 0.0000 0.0000 0.0000 98  GLN A CB    
712  C CG    . GLN A 101 ? 1.2928 0.9813 1.1791 0.0000 0.0000 0.0000 98  GLN A CG    
713  C CD    . GLN A 101 ? 1.3093 0.9817 1.1938 0.0000 0.0000 0.0000 98  GLN A CD    
714  O OE1   . GLN A 101 ? 1.3215 0.9801 1.1895 0.0000 0.0000 0.0000 98  GLN A OE1   
715  N NE2   . GLN A 101 ? 1.3100 0.9892 1.2122 0.0000 0.0000 0.0000 98  GLN A NE2   
716  N N     . CYS A 102 ? 1.1362 0.9612 1.0378 0.0000 0.0000 0.0000 99  CYS A N     
717  C CA    . CYS A 102 ? 1.0884 0.9558 1.0027 0.0000 0.0000 0.0000 99  CYS A CA    
718  C C     . CYS A 102 ? 1.0859 0.9580 0.9901 0.0000 0.0000 0.0000 99  CYS A C     
719  O O     . CYS A 102 ? 1.0674 0.9571 0.9805 0.0000 0.0000 0.0000 99  CYS A O     
720  C CB    . CYS A 102 ? 1.0646 0.9606 0.9863 0.0000 0.0000 0.0000 99  CYS A CB    
721  S SG    . CYS A 102 ? 1.0569 0.9610 0.9918 0.0000 0.0000 0.0000 99  CYS A SG    
722  N N     . LEU A 103 ? 1.1063 0.9650 0.9906 0.0000 0.0000 0.0000 100 LEU A N     
723  C CA    . LEU A 103 ? 1.1061 0.9757 0.9771 0.0000 0.0000 0.0000 100 LEU A CA    
724  C C     . LEU A 103 ? 1.1129 0.9639 0.9806 0.0000 0.0000 0.0000 100 LEU A C     
725  O O     . LEU A 103 ? 1.0895 0.9688 0.9640 0.0000 0.0000 0.0000 100 LEU A O     
726  C CB    . LEU A 103 ? 1.1435 0.9975 0.9876 0.0000 0.0000 0.0000 100 LEU A CB    
727  C CG    . LEU A 103 ? 1.1222 1.0070 0.9674 0.0000 0.0000 0.0000 100 LEU A CG    
728  C CD1   . LEU A 103 ? 1.1551 1.0411 0.9714 0.0000 0.0000 0.0000 100 LEU A CD1   
729  C CD2   . LEU A 103 ? 1.0660 1.0088 0.9352 0.0000 0.0000 0.0000 100 LEU A CD2   
730  N N     . ILE A 104 ? 1.1433 0.9472 1.0020 0.0000 0.0000 0.0000 101 ILE A N     
731  C CA    . ILE A 104 ? 1.1570 0.9394 1.0109 0.0000 0.0000 0.0000 101 ILE A CA    
732  C C     . ILE A 104 ? 1.1288 0.9302 1.0089 0.0000 0.0000 0.0000 101 ILE A C     
733  O O     . ILE A 104 ? 1.1372 0.9290 1.0172 0.0000 0.0000 0.0000 101 ILE A O     
734  C CB    . ILE A 104 ? 1.2146 0.9333 1.0451 0.0000 0.0000 0.0000 101 ILE A CB    
735  C CG1   . ILE A 104 ? 1.2163 0.9128 1.0580 0.0000 0.0000 0.0000 101 ILE A CG1   
736  C CG2   . ILE A 104 ? 1.2544 0.9530 1.0516 0.0000 0.0000 0.0000 101 ILE A CG2   
737  C CD1   . ILE A 104 ? 1.2652 0.8972 1.0905 0.0000 0.0000 0.0000 101 ILE A CD1   
738  N N     . THR A 105 ? 1.0986 0.9287 0.9993 0.0000 0.0000 0.0000 102 THR A N     
739  C CA    . THR A 105 ? 1.0762 0.9290 0.9986 0.0000 0.0000 0.0000 102 THR A CA    
740  C C     . THR A 105 ? 1.0365 0.9308 0.9730 0.0000 0.0000 0.0000 102 THR A C     
741  O O     . THR A 105 ? 1.0223 0.9303 0.9679 0.0000 0.0000 0.0000 102 THR A O     
742  C CB    . THR A 105 ? 1.0795 0.9331 1.0131 0.0000 0.0000 0.0000 102 THR A CB    
743  O OG1   . THR A 105 ? 1.1286 0.9383 1.0485 0.0000 0.0000 0.0000 102 THR A OG1   
744  C CG2   . THR A 105 ? 1.0670 0.9420 1.0176 0.0000 0.0000 0.0000 102 THR A CG2   
745  N N     . ASN A 106 ? 1.0256 0.9371 0.9637 0.0000 0.0000 0.0000 103 ASN A N     
746  C CA    . ASN A 106 ? 1.0063 0.9490 0.9558 0.0000 0.0000 0.0000 103 ASN A CA    
747  C C     . ASN A 106 ? 1.0030 0.9549 0.9521 0.0000 0.0000 0.0000 103 ASN A C     
748  O O     . ASN A 106 ? 1.0239 0.9666 0.9603 0.0000 0.0000 0.0000 103 ASN A O     
749  C CB    . ASN A 106 ? 1.0035 0.9588 0.9520 0.0000 0.0000 0.0000 103 ASN A CB    
750  C CG    . ASN A 106 ? 1.0203 0.9744 0.9722 0.0000 0.0000 0.0000 103 ASN A CG    
751  O OD1   . ASN A 106 ? 1.0515 1.0002 1.0070 0.0000 0.0000 0.0000 103 ASN A OD1   
752  N ND2   . ASN A 106 ? 1.0253 0.9902 0.9769 0.0000 0.0000 0.0000 103 ASN A ND2   
753  N N     . ALA A 107 ? 0.9871 0.9573 0.9483 0.0000 0.0000 0.0000 104 ALA A N     
754  C CA    . ALA A 107 ? 0.9837 0.9644 0.9465 0.0000 0.0000 0.0000 104 ALA A CA    
755  C C     . ALA A 107 ? 0.9765 0.9784 0.9404 0.0000 0.0000 0.0000 104 ALA A C     
756  O O     . ALA A 107 ? 0.9689 0.9770 0.9336 0.0000 0.0000 0.0000 104 ALA A O     
757  C CB    . ALA A 107 ? 0.9726 0.9609 0.9469 0.0000 0.0000 0.0000 104 ALA A CB    
758  N N     . SER A 108 ? 0.9777 0.9954 0.9430 0.0000 0.0000 0.0000 105 SER A N     
759  C CA    . SER A 108 ? 0.9757 1.0243 0.9466 0.0000 0.0000 0.0000 105 SER A CA    
760  C C     . SER A 108 ? 0.9670 1.0213 0.9536 0.0000 0.0000 0.0000 105 SER A C     
761  O O     . SER A 108 ? 0.9722 1.0101 0.9634 0.0000 0.0000 0.0000 105 SER A O     
762  C CB    . SER A 108 ? 0.9787 1.0486 0.9452 0.0000 0.0000 0.0000 105 SER A CB    
763  O OG    . SER A 108 ? 0.9780 1.0892 0.9499 0.0000 0.0000 0.0000 105 SER A OG    
764  N N     . ASN A 109 ? 0.9633 1.0415 0.9572 0.0000 0.0000 0.0000 106 ASN A N     
765  C CA    . ASN A 109 ? 0.9579 1.0369 0.9651 0.0000 0.0000 0.0000 106 ASN A CA    
766  C C     . ASN A 109 ? 0.9586 1.0758 0.9768 0.0000 0.0000 0.0000 106 ASN A C     
767  O O     . ASN A 109 ? 0.9648 1.0872 0.9952 0.0000 0.0000 0.0000 106 ASN A O     
768  C CB    . ASN A 109 ? 0.9561 1.0227 0.9641 0.0000 0.0000 0.0000 106 ASN A CB    
769  C CG    . ASN A 109 ? 0.9525 1.0456 0.9611 0.0000 0.0000 0.0000 106 ASN A CG    
770  O OD1   . ASN A 109 ? 0.9465 1.0608 0.9486 0.0000 0.0000 0.0000 106 ASN A OD1   
771  N ND2   . ASN A 109 ? 0.9541 1.0464 0.9685 0.0000 0.0000 0.0000 106 ASN A ND2   
772  N N     . LYS A 110 ? 0.9589 1.1039 0.9716 0.0000 0.0000 0.0000 107 LYS A N     
773  C CA    . LYS A 110 ? 0.9578 1.1528 0.9799 0.0000 0.0000 0.0000 107 LYS A CA    
774  C C     . LYS A 110 ? 0.9510 1.1466 0.9683 0.0000 0.0000 0.0000 107 LYS A C     
775  O O     . LYS A 110 ? 0.9566 1.1337 0.9573 0.0000 0.0000 0.0000 107 LYS A O     
776  C CB    . LYS A 110 ? 0.9651 1.2072 0.9804 0.0000 0.0000 0.0000 107 LYS A CB    
777  C CG    . LYS A 110 ? 0.9840 1.2133 0.9930 0.0000 0.0000 0.0000 107 LYS A CG    
778  C CD    . LYS A 110 ? 1.0053 1.2805 1.0289 0.0000 0.0000 0.0000 107 LYS A CD    
779  C CE    . LYS A 110 ? 1.0213 1.2726 1.0419 0.0000 0.0000 0.0000 107 LYS A CE    
780  N NZ    . LYS A 110 ? 1.0463 1.2583 1.0775 0.0000 0.0000 0.0000 107 LYS A NZ    
781  N N     . ALA A 111 ? 0.9401 1.1541 0.9717 0.0000 0.0000 0.0000 108 ALA A N     
782  C CA    . ALA A 111 ? 0.9328 1.1479 0.9609 0.0000 0.0000 0.0000 108 ALA A CA    
783  C C     . ALA A 111 ? 0.9317 1.2081 0.9568 0.0000 0.0000 0.0000 108 ALA A C     
784  O O     . ALA A 111 ? 0.9281 1.2538 0.9623 0.0000 0.0000 0.0000 108 ALA A O     
785  C CB    . ALA A 111 ? 0.9330 1.1298 0.9766 0.0000 0.0000 0.0000 108 ALA A CB    
786  N N     . SER A 112 ? 0.9348 1.2125 0.9463 0.0000 0.0000 0.0000 109 SER A N     
787  C CA    . SER A 112 ? 0.9408 1.2807 0.9447 0.0000 0.0000 0.0000 109 SER A CA    
788  C C     . SER A 112 ? 0.9321 1.3238 0.9598 0.0000 0.0000 0.0000 109 SER A C     
789  O O     . SER A 112 ? 0.9304 1.2943 0.9754 0.0000 0.0000 0.0000 109 SER A O     
790  C CB    . SER A 112 ? 0.9506 1.2734 0.9313 0.0000 0.0000 0.0000 109 SER A CB    
791  O OG    . SER A 112 ? 0.9543 1.2164 0.9369 0.0000 0.0000 0.0000 109 SER A OG    
792  N N     . GLY A 113 ? 0.9320 1.4013 0.9601 0.0000 0.0000 0.0000 110 GLY A N     
793  C CA    . GLY A 113 ? 0.9211 1.4530 0.9739 0.0000 0.0000 0.0000 110 GLY A CA    
794  C C     . GLY A 113 ? 0.9179 1.4397 0.9739 0.0000 0.0000 0.0000 110 GLY A C     
795  O O     . GLY A 113 ? 0.9168 1.3932 0.9535 0.0000 0.0000 0.0000 110 GLY A O     
796  N N     . PRO A 114 ? 0.9170 1.4834 0.9983 0.0000 0.0000 0.0000 111 PRO A N     
797  C CA    . PRO A 114 ? 0.9208 1.4763 1.0108 0.0000 0.0000 0.0000 111 PRO A CA    
798  C C     . PRO A 114 ? 0.9276 1.5124 0.9949 0.0000 0.0000 0.0000 111 PRO A C     
799  O O     . PRO A 114 ? 0.9353 1.5856 0.9881 0.0000 0.0000 0.0000 111 PRO A O     
800  C CB    . PRO A 114 ? 0.9205 1.5392 1.0417 0.0000 0.0000 0.0000 111 PRO A CB    
801  C CG    . PRO A 114 ? 0.9210 1.6177 1.0429 0.0000 0.0000 0.0000 111 PRO A CG    
802  C CD    . PRO A 114 ? 0.9177 1.5641 1.0202 0.0000 0.0000 0.0000 111 PRO A CD    
803  N N     . ILE A 115 ? 1.0018 1.0806 1.0545 0.0000 0.0000 0.0000 112 ILE A N     
804  C CA    . ILE A 115 ? 0.9881 1.0784 1.0430 0.0000 0.0000 0.0000 112 ILE A CA    
805  C C     . ILE A 115 ? 0.9682 1.1016 1.0619 0.0000 0.0000 0.0000 112 ILE A C     
806  O O     . ILE A 115 ? 0.9608 1.1132 1.0761 0.0000 0.0000 0.0000 112 ILE A O     
807  C CB    . ILE A 115 ? 0.9847 1.0496 1.0052 0.0000 0.0000 0.0000 112 ILE A CB    
808  C CG1   . ILE A 115 ? 0.9620 1.0364 0.9876 0.0000 0.0000 0.0000 112 ILE A CG1   
809  C CG2   . ILE A 115 ? 1.0172 1.0398 0.9983 0.0000 0.0000 0.0000 112 ILE A CG2   
810  C CD1   . ILE A 115 ? 0.9403 1.0046 0.9462 0.0000 0.0000 0.0000 112 ILE A CD1   
811  N N     . LEU A 116 ? 0.9663 1.1129 1.0666 0.0000 0.0000 0.0000 113 LEU A N     
812  C CA    . LEU A 116 ? 0.9532 1.1377 1.0836 0.0000 0.0000 0.0000 113 LEU A CA    
813  C C     . LEU A 116 ? 0.9470 1.1285 1.0622 0.0000 0.0000 0.0000 113 LEU A C     
814  O O     . LEU A 116 ? 0.9501 1.1048 1.0344 0.0000 0.0000 0.0000 113 LEU A O     
815  C CB    . LEU A 116 ? 0.9503 1.1507 1.0951 0.0000 0.0000 0.0000 113 LEU A CB    
816  C CG    . LEU A 116 ? 0.9547 1.1630 1.1195 0.0000 0.0000 0.0000 113 LEU A CG    
817  C CD1   . LEU A 116 ? 0.9571 1.1668 1.1205 0.0000 0.0000 0.0000 113 LEU A CD1   
818  C CD2   . LEU A 116 ? 0.9318 1.1791 1.1412 0.0000 0.0000 0.0000 113 LEU A CD2   
819  N N     . ARG A 117 ? 0.9427 1.1523 1.0801 0.0000 0.0000 0.0000 114 ARG A N     
820  C CA    . ARG A 117 ? 0.9429 1.1519 1.0676 0.0000 0.0000 0.0000 114 ARG A CA    
821  C C     . ARG A 117 ? 0.9436 1.1802 1.0844 0.0000 0.0000 0.0000 114 ARG A C     
822  O O     . ARG A 117 ? 0.9338 1.1991 1.0989 0.0000 0.0000 0.0000 114 ARG A O     
823  C CB    . ARG A 117 ? 0.9364 1.1473 1.0646 0.0000 0.0000 0.0000 114 ARG A CB    
824  C CG    . ARG A 117 ? 0.9394 1.1212 1.0494 0.0000 0.0000 0.0000 114 ARG A CG    
825  C CD    . ARG A 117 ? 0.9318 1.0781 1.0054 0.0000 0.0000 0.0000 114 ARG A CD    
826  N NE    . ARG A 117 ? 0.9202 1.0588 0.9766 0.0000 0.0000 0.0000 114 ARG A NE    
827  C CZ    . ARG A 117 ? 0.9205 1.0508 0.9680 0.0000 0.0000 0.0000 114 ARG A CZ    
828  N NH1   . ARG A 117 ? 0.9319 1.0584 0.9840 0.0000 0.0000 0.0000 114 ARG A NH1   
829  N NH2   . ARG A 117 ? 0.9085 1.0336 0.9427 0.0000 0.0000 0.0000 114 ARG A NH2   
830  N N     . PRO A 118 ? 0.9594 1.1858 1.0850 0.0000 0.0000 0.0000 115 PRO A N     
831  C CA    . PRO A 118 ? 0.9691 1.2171 1.1055 0.0000 0.0000 0.0000 115 PRO A CA    
832  C C     . PRO A 118 ? 0.9726 1.2356 1.1098 0.0000 0.0000 0.0000 115 PRO A C     
833  O O     . PRO A 118 ? 0.9766 1.2219 1.0931 0.0000 0.0000 0.0000 115 PRO A O     
834  C CB    . PRO A 118 ? 0.9767 1.1981 1.0851 0.0000 0.0000 0.0000 115 PRO A CB    
835  C CG    . PRO A 118 ? 0.9769 1.1675 1.0659 0.0000 0.0000 0.0000 115 PRO A CG    
836  C CD    . PRO A 118 ? 0.9708 1.1614 1.0637 0.0000 0.0000 0.0000 115 PRO A CD    
837  N N     . ASP A 119 ? 0.9798 1.2749 1.1407 0.0000 0.0000 0.0000 116 ASP A N     
838  C CA    . ASP A 119 ? 0.9864 1.2969 1.1485 0.0000 0.0000 0.0000 116 ASP A CA    
839  C C     . ASP A 119 ? 0.9901 1.2800 1.1202 0.0000 0.0000 0.0000 116 ASP A C     
840  O O     . ASP A 119 ? 0.9974 1.2740 1.1117 0.0000 0.0000 0.0000 116 ASP A O     
841  C CB    . ASP A 119 ? 0.9947 1.3408 1.1827 0.0000 0.0000 0.0000 116 ASP A CB    
842  C CG    . ASP A 119 ? 1.0215 1.3918 1.2461 0.0000 0.0000 0.0000 116 ASP A CG    
843  O OD1   . ASP A 119 ? 1.0463 1.4296 1.2897 0.0000 0.0000 0.0000 116 ASP A OD1   
844  O OD2   . ASP A 119 ? 1.0594 1.4349 1.2943 0.0000 0.0000 0.0000 116 ASP A OD2   
845  N N     . ARG A 120 ? 0.9891 1.2753 1.1100 0.0000 0.0000 0.0000 117 ARG A N     
846  C CA    . ARG A 120 ? 0.9962 1.2665 1.0903 0.0000 0.0000 0.0000 117 ARG A CA    
847  C C     . ARG A 120 ? 1.0055 1.2885 1.0964 0.0000 0.0000 0.0000 117 ARG A C     
848  O O     . ARG A 120 ? 1.0092 1.3190 1.1192 0.0000 0.0000 0.0000 117 ARG A O     
849  C CB    . ARG A 120 ? 0.9904 1.2613 1.0812 0.0000 0.0000 0.0000 117 ARG A CB    
850  C CG    . ARG A 120 ? 1.0025 1.2557 1.0671 0.0000 0.0000 0.0000 117 ARG A CG    
851  C CD    . ARG A 120 ? 1.0098 1.2656 1.0727 0.0000 0.0000 0.0000 117 ARG A CD    
852  N NE    . ARG A 120 ? 1.0050 1.2536 1.0758 0.0000 0.0000 0.0000 117 ARG A NE    
853  C CZ    . ARG A 120 ? 1.0011 1.2267 1.0586 0.0000 0.0000 0.0000 117 ARG A CZ    
854  N NH1   . ARG A 120 ? 0.9948 1.2047 1.0337 0.0000 0.0000 0.0000 117 ARG A NH1   
855  N NH2   . ARG A 120 ? 1.0049 1.2229 1.0676 0.0000 0.0000 0.0000 117 ARG A NH2   
856  N N     . PRO A 121 ? 1.0150 1.2784 1.0815 0.0000 0.0000 0.0000 118 PRO A N     
857  C CA    . PRO A 121 ? 1.0311 1.3002 1.0871 0.0000 0.0000 0.0000 118 PRO A CA    
858  C C     . PRO A 121 ? 1.0356 1.3222 1.0923 0.0000 0.0000 0.0000 118 PRO A C     
859  O O     . PRO A 121 ? 1.0318 1.3147 1.0856 0.0000 0.0000 0.0000 118 PRO A O     
860  C CB    . PRO A 121 ? 1.0378 1.2773 1.0645 0.0000 0.0000 0.0000 118 PRO A CB    
861  C CG    . PRO A 121 ? 1.0320 1.2541 1.0599 0.0000 0.0000 0.0000 118 PRO A CG    
862  C CD    . PRO A 121 ? 1.0165 1.2501 1.0638 0.0000 0.0000 0.0000 118 PRO A CD    
863  N N     . GLN A 122 ? 1.0478 1.3521 1.1071 0.0000 0.0000 0.0000 119 GLN A N     
864  C CA    . GLN A 122 ? 1.0511 1.3739 1.1119 0.0000 0.0000 0.0000 119 GLN A CA    
865  C C     . GLN A 122 ? 1.0530 1.3589 1.0831 0.0000 0.0000 0.0000 119 GLN A C     
866  O O     . GLN A 122 ? 1.0477 1.3548 1.0765 0.0000 0.0000 0.0000 119 GLN A O     
867  C CB    . GLN A 122 ? 1.0670 1.4153 1.1405 0.0000 0.0000 0.0000 119 GLN A CB    
868  C CG    . GLN A 122 ? 1.0872 1.4578 1.1974 0.0000 0.0000 0.0000 119 GLN A CG    
869  C CD    . GLN A 122 ? 1.1204 1.5272 1.2550 0.0000 0.0000 0.0000 119 GLN A CD    
870  O OE1   . GLN A 122 ? 1.1462 1.5598 1.2663 0.0000 0.0000 0.0000 119 GLN A OE1   
871  N NE2   . GLN A 122 ? 1.1133 1.5437 1.2852 0.0000 0.0000 0.0000 119 GLN A NE2   
872  N N     . LYS A 123 ? 1.0620 1.3508 1.0674 0.0000 0.0000 0.0000 120 LYS A N     
873  C CA    . LYS A 123 ? 1.0673 1.3405 1.0432 0.0000 0.0000 0.0000 120 LYS A CA    
874  C C     . LYS A 123 ? 1.0575 1.3031 1.0181 0.0000 0.0000 0.0000 120 LYS A C     
875  O O     . LYS A 123 ? 1.0570 1.2920 1.0221 0.0000 0.0000 0.0000 120 LYS A O     
876  C CB    . LYS A 123 ? 1.0974 1.3709 1.0532 0.0000 0.0000 0.0000 120 LYS A CB    
877  C CG    . LYS A 123 ? 1.1144 1.4171 1.0868 0.0000 0.0000 0.0000 120 LYS A CG    
878  C CD    . LYS A 123 ? 1.1550 1.4549 1.1040 0.0000 0.0000 0.0000 120 LYS A CD    
879  C CE    . LYS A 123 ? 1.1761 1.5079 1.1470 0.0000 0.0000 0.0000 120 LYS A CE    
880  N NZ    . LYS A 123 ? 1.2204 1.5550 1.1654 0.0000 0.0000 0.0000 120 LYS A NZ    
881  N N     . PRO A 124 ? 1.0517 1.2857 0.9947 0.0000 0.0000 0.0000 121 PRO A N     
882  C CA    . PRO A 124 ? 1.0463 1.2560 0.9745 0.0000 0.0000 0.0000 121 PRO A CA    
883  C C     . PRO A 124 ? 1.0637 1.2596 0.9731 0.0000 0.0000 0.0000 121 PRO A C     
884  O O     . PRO A 124 ? 1.0792 1.2813 0.9775 0.0000 0.0000 0.0000 121 PRO A O     
885  C CB    . PRO A 124 ? 1.0497 1.2544 0.9631 0.0000 0.0000 0.0000 121 PRO A CB    
886  C CG    . PRO A 124 ? 1.0459 1.2701 0.9691 0.0000 0.0000 0.0000 121 PRO A CG    
887  C CD    . PRO A 124 ? 1.0538 1.2961 0.9900 0.0000 0.0000 0.0000 121 PRO A CD    
888  N N     . PHE A 125 ? 1.0584 1.2344 0.9629 0.0000 0.0000 0.0000 122 PHE A N     
889  C CA    . PHE A 125 ? 1.0745 1.2316 0.9597 0.0000 0.0000 0.0000 122 PHE A CA    
890  C C     . PHE A 125 ? 1.0812 1.2443 0.9767 0.0000 0.0000 0.0000 122 PHE A C     
891  O O     . PHE A 125 ? 1.1036 1.2496 0.9835 0.0000 0.0000 0.0000 122 PHE A O     
892  C CB    . PHE A 125 ? 1.0951 1.2440 0.9522 0.0000 0.0000 0.0000 122 PHE A CB    
893  C CG    . PHE A 125 ? 1.0773 1.2191 0.9241 0.0000 0.0000 0.0000 122 PHE A CG    
894  C CD1   . PHE A 125 ? 1.0517 1.2081 0.8982 0.0000 0.0000 0.0000 122 PHE A CD1   
895  C CD2   . PHE A 125 ? 1.0738 1.1948 0.9121 0.0000 0.0000 0.0000 122 PHE A CD2   
896  C CE1   . PHE A 125 ? 1.0435 1.1937 0.8819 0.0000 0.0000 0.0000 122 PHE A CE1   
897  C CE2   . PHE A 125 ? 1.0540 1.1716 0.8870 0.0000 0.0000 0.0000 122 PHE A CE2   
898  C CZ    . PHE A 125 ? 1.0414 1.1735 0.8746 0.0000 0.0000 0.0000 122 PHE A CZ    
899  N N     . ASP A 126 ? 1.0614 1.2480 0.9836 0.0000 0.0000 0.0000 123 ASP A N     
900  C CA    . ASP A 126 ? 1.0597 1.2548 0.9982 0.0000 0.0000 0.0000 123 ASP A CA    
901  C C     . ASP A 126 ? 1.0534 1.2267 0.9914 0.0000 0.0000 0.0000 123 ASP A C     
902  O O     . ASP A 126 ? 1.0714 1.2340 1.0048 0.0000 0.0000 0.0000 123 ASP A O     
903  C CB    . ASP A 126 ? 1.0443 1.2699 1.0147 0.0000 0.0000 0.0000 123 ASP A CB    
904  C CG    . ASP A 126 ? 1.0666 1.3173 1.0418 0.0000 0.0000 0.0000 123 ASP A CG    
905  O OD1   . ASP A 126 ? 1.0951 1.3388 1.0458 0.0000 0.0000 0.0000 123 ASP A OD1   
906  O OD2   . ASP A 126 ? 1.0740 1.3513 1.0774 0.0000 0.0000 0.0000 123 ASP A OD2   
907  N N     . LYS A 127 ? 1.0314 1.1970 0.9730 0.0000 0.0000 0.0000 124 LYS A N     
908  C CA    . LYS A 127 ? 1.0243 1.1693 0.9646 0.0000 0.0000 0.0000 124 LYS A CA    
909  C C     . LYS A 127 ? 1.0177 1.1466 0.9479 0.0000 0.0000 0.0000 124 LYS A C     
910  O O     . LYS A 127 ? 1.0001 1.1396 0.9376 0.0000 0.0000 0.0000 124 LYS A O     
911  C CB    . LYS A 127 ? 1.0092 1.1669 0.9740 0.0000 0.0000 0.0000 124 LYS A CB    
912  C CG    . LYS A 127 ? 1.0132 1.1485 0.9739 0.0000 0.0000 0.0000 124 LYS A CG    
913  C CD    . LYS A 127 ? 1.0126 1.1608 0.9969 0.0000 0.0000 0.0000 124 LYS A CD    
914  C CE    . LYS A 127 ? 1.0291 1.1890 1.0253 0.0000 0.0000 0.0000 124 LYS A CE    
915  N NZ    . LYS A 127 ? 1.0193 1.1838 1.0350 0.0000 0.0000 0.0000 124 LYS A NZ    
916  N N     . PHE A 128 ? 1.0328 1.1357 0.9466 0.0000 0.0000 0.0000 125 PHE A N     
917  C CA    . PHE A 128 ? 1.0305 1.1178 0.9369 0.0000 0.0000 0.0000 125 PHE A CA    
918  C C     . PHE A 128 ? 1.0339 1.1071 0.9436 0.0000 0.0000 0.0000 125 PHE A C     
919  O O     . PHE A 128 ? 1.0462 1.1090 0.9527 0.0000 0.0000 0.0000 125 PHE A O     
920  C CB    . PHE A 128 ? 1.0502 1.1166 0.9343 0.0000 0.0000 0.0000 125 PHE A CB    
921  C CG    . PHE A 128 ? 1.0467 1.1210 0.9234 0.0000 0.0000 0.0000 125 PHE A CG    
922  C CD1   . PHE A 128 ? 1.0392 1.1377 0.9274 0.0000 0.0000 0.0000 125 PHE A CD1   
923  C CD2   . PHE A 128 ? 1.0591 1.1153 0.9161 0.0000 0.0000 0.0000 125 PHE A CD2   
924  C CE1   . PHE A 128 ? 1.0465 1.1502 0.9252 0.0000 0.0000 0.0000 125 PHE A CE1   
925  C CE2   . PHE A 128 ? 1.0749 1.1369 0.9233 0.0000 0.0000 0.0000 125 PHE A CE2   
926  C CZ    . PHE A 128 ? 1.0658 1.1514 0.9244 0.0000 0.0000 0.0000 125 PHE A CZ    
927  N N     . PHE A 129 ? 1.0243 1.0959 0.9388 0.0000 0.0000 0.0000 126 PHE A N     
928  C CA    . PHE A 129 ? 1.0278 1.0812 0.9392 0.0000 0.0000 0.0000 126 PHE A CA    
929  C C     . PHE A 129 ? 1.0371 1.0716 0.9350 0.0000 0.0000 0.0000 126 PHE A C     
930  O O     . PHE A 129 ? 1.0268 1.0692 0.9269 0.0000 0.0000 0.0000 126 PHE A O     
931  C CB    . PHE A 129 ? 1.0087 1.0734 0.9343 0.0000 0.0000 0.0000 126 PHE A CB    
932  C CG    . PHE A 129 ? 1.0028 1.0850 0.9445 0.0000 0.0000 0.0000 126 PHE A CG    
933  C CD1   . PHE A 129 ? 1.0119 1.0854 0.9550 0.0000 0.0000 0.0000 126 PHE A CD1   
934  C CD2   . PHE A 129 ? 0.9920 1.0997 0.9482 0.0000 0.0000 0.0000 126 PHE A CD2   
935  C CE1   . PHE A 129 ? 1.0050 1.0974 0.9669 0.0000 0.0000 0.0000 126 PHE A CE1   
936  C CE2   . PHE A 129 ? 0.9887 1.1152 0.9632 0.0000 0.0000 0.0000 126 PHE A CE2   
937  C CZ    . PHE A 129 ? 0.9930 1.1131 0.9718 0.0000 0.0000 0.0000 126 PHE A CZ    
938  N N     . ILE A 130 ? 1.0609 1.0710 0.9458 0.0000 0.0000 0.0000 127 ILE A N     
939  C CA    . ILE A 130 ? 1.0822 1.0750 0.9556 0.0000 0.0000 0.0000 127 ILE A CA    
940  C C     . ILE A 130 ? 1.1029 1.0743 0.9683 0.0000 0.0000 0.0000 127 ILE A C     
941  O O     . ILE A 130 ? 1.1198 1.0799 0.9808 0.0000 0.0000 0.0000 127 ILE A O     
942  C CB    . ILE A 130 ? 1.1010 1.0802 0.9602 0.0000 0.0000 0.0000 127 ILE A CB    
943  C CG1   . ILE A 130 ? 1.1248 1.0858 0.9734 0.0000 0.0000 0.0000 127 ILE A CG1   
944  C CG2   . ILE A 130 ? 1.0947 1.0923 0.9571 0.0000 0.0000 0.0000 127 ILE A CG2   
945  C CD1   . ILE A 130 ? 1.1543 1.0902 0.9835 0.0000 0.0000 0.0000 127 ILE A CD1   
946  N N     . ASP A 131 ? 1.1146 1.0807 0.9781 0.0000 0.0000 0.0000 128 ASP A N     
947  C CA    . ASP A 131 ? 1.1389 1.0855 0.9933 0.0000 0.0000 0.0000 128 ASP A CA    
948  C C     . ASP A 131 ? 1.1434 1.0857 0.9968 0.0000 0.0000 0.0000 128 ASP A C     
949  O O     . ASP A 131 ? 1.1364 1.0957 1.0003 0.0000 0.0000 0.0000 128 ASP A O     
950  C CB    . ASP A 131 ? 1.1308 1.0854 0.9918 0.0000 0.0000 0.0000 128 ASP A CB    
951  C CG    . ASP A 131 ? 1.1769 1.1075 1.0233 0.0000 0.0000 0.0000 128 ASP A CG    
952  O OD1   . ASP A 131 ? 1.2215 1.1299 1.0538 0.0000 0.0000 0.0000 128 ASP A OD1   
953  O OD2   . ASP A 131 ? 1.1978 1.1297 1.0447 0.0000 0.0000 0.0000 128 ASP A OD2   
954  N N     . TYR A 132 ? 1.1612 1.0811 1.0023 0.0000 0.0000 0.0000 129 TYR A N     
955  C CA    . TYR A 132 ? 1.1676 1.0852 1.0105 0.0000 0.0000 0.0000 129 TYR A CA    
956  C C     . TYR A 132 ? 1.1686 1.0874 1.0128 0.0000 0.0000 0.0000 129 TYR A C     
957  O O     . TYR A 132 ? 1.1808 1.0842 1.0124 0.0000 0.0000 0.0000 129 TYR A O     
958  C CB    . TYR A 132 ? 1.1928 1.0832 1.0200 0.0000 0.0000 0.0000 129 TYR A CB    
959  C CG    . TYR A 132 ? 1.2076 1.0957 1.0340 0.0000 0.0000 0.0000 129 TYR A CG    
960  C CD1   . TYR A 132 ? 1.2325 1.1042 1.0455 0.0000 0.0000 0.0000 129 TYR A CD1   
961  C CD2   . TYR A 132 ? 1.2111 1.1123 1.0494 0.0000 0.0000 0.0000 129 TYR A CD2   
962  C CE1   . TYR A 132 ? 1.2563 1.1220 1.0643 0.0000 0.0000 0.0000 129 TYR A CE1   
963  C CE2   . TYR A 132 ? 1.2365 1.1328 1.0712 0.0000 0.0000 0.0000 129 TYR A CE2   
964  C CZ    . TYR A 132 ? 1.2623 1.1395 1.0801 0.0000 0.0000 0.0000 129 TYR A CZ    
965  O OH    . TYR A 132 ? 1.2933 1.1624 1.1038 0.0000 0.0000 0.0000 129 TYR A OH    
966  N N     . ILE A 133 ? 1.1596 1.0959 1.0181 0.0000 0.0000 0.0000 130 ILE A N     
967  C CA    . ILE A 133 ? 1.1636 1.0989 1.0221 0.0000 0.0000 0.0000 130 ILE A CA    
968  C C     . ILE A 133 ? 1.1902 1.1114 1.0431 0.0000 0.0000 0.0000 130 ILE A C     
969  O O     . ILE A 133 ? 1.1936 1.1184 1.0539 0.0000 0.0000 0.0000 130 ILE A O     
970  C CB    . ILE A 133 ? 1.1382 1.1000 1.0167 0.0000 0.0000 0.0000 130 ILE A CB    
971  C CG1   . ILE A 133 ? 1.1254 1.0948 1.0050 0.0000 0.0000 0.0000 130 ILE A CG1   
972  C CG2   . ILE A 133 ? 1.1415 1.1042 1.0235 0.0000 0.0000 0.0000 130 ILE A CG2   
973  C CD1   . ILE A 133 ? 1.1031 1.0961 1.0008 0.0000 0.0000 0.0000 130 ILE A CD1   
974  N N     . GLY A 134 ? 1.2136 1.1177 1.0522 0.0000 0.0000 0.0000 131 GLY A N     
975  C CA    . GLY A 134 ? 1.2421 1.1361 1.0774 0.0000 0.0000 0.0000 131 GLY A CA    
976  C C     . GLY A 134 ? 1.2816 1.1423 1.0902 0.0000 0.0000 0.0000 131 GLY A C     
977  O O     . GLY A 134 ? 1.2912 1.1344 1.0822 0.0000 0.0000 0.0000 131 GLY A O     
978  N N     . PRO A 135 ? 1.3057 1.1574 1.1118 0.0000 0.0000 0.0000 132 PRO A N     
979  C CA    . PRO A 135 ? 1.3016 1.1747 1.1321 0.0000 0.0000 0.0000 132 PRO A CA    
980  C C     . PRO A 135 ? 1.2894 1.1870 1.1375 0.0000 0.0000 0.0000 132 PRO A C     
981  O O     . PRO A 135 ? 1.2945 1.1842 1.1290 0.0000 0.0000 0.0000 132 PRO A O     
982  C CB    . PRO A 135 ? 1.3312 1.1820 1.1498 0.0000 0.0000 0.0000 132 PRO A CB    
983  C CG    . PRO A 135 ? 1.3565 1.1731 1.1416 0.0000 0.0000 0.0000 132 PRO A CG    
984  C CD    . PRO A 135 ? 1.3370 1.1575 1.1163 0.0000 0.0000 0.0000 132 PRO A CD    
985  N N     . LEU A 136 ? 1.2784 1.2039 1.1552 0.0000 0.0000 0.0000 133 LEU A N     
986  C CA    . LEU A 136 ? 1.2721 1.2228 1.1701 0.0000 0.0000 0.0000 133 LEU A CA    
987  C C     . LEU A 136 ? 1.2940 1.2524 1.2071 0.0000 0.0000 0.0000 133 LEU A C     
988  O O     . LEU A 136 ? 1.3171 1.2605 1.2237 0.0000 0.0000 0.0000 133 LEU A O     
989  C CB    . LEU A 136 ? 1.2397 1.2188 1.1619 0.0000 0.0000 0.0000 133 LEU A CB    
990  C CG    . LEU A 136 ? 1.2197 1.1976 1.1336 0.0000 0.0000 0.0000 133 LEU A CG    
991  C CD1   . LEU A 136 ? 1.1859 1.1922 1.1239 0.0000 0.0000 0.0000 133 LEU A CD1   
992  C CD2   . LEU A 136 ? 1.2238 1.1884 1.1187 0.0000 0.0000 0.0000 133 LEU A CD2   
993  N N     . PRO A 137 ? 1.2921 1.2731 1.2254 0.0000 0.0000 0.0000 134 PRO A N     
994  C CA    . PRO A 137 ? 1.3021 1.3001 1.2601 0.0000 0.0000 0.0000 134 PRO A CA    
995  C C     . PRO A 137 ? 1.2981 1.3126 1.2802 0.0000 0.0000 0.0000 134 PRO A C     
996  O O     . PRO A 137 ? 1.2773 1.3074 1.2712 0.0000 0.0000 0.0000 134 PRO A O     
997  C CB    . PRO A 137 ? 1.2879 1.3118 1.2670 0.0000 0.0000 0.0000 134 PRO A CB    
998  C CG    . PRO A 137 ? 1.2703 1.2908 1.2369 0.0000 0.0000 0.0000 134 PRO A CG    
999  C CD    . PRO A 137 ? 1.2826 1.2702 1.2138 0.0000 0.0000 0.0000 134 PRO A CD    
1000 N N     . PRO A 138 ? 1.3213 1.3299 1.3081 0.0000 0.0000 0.0000 135 PRO A N     
1001 C CA    . PRO A 138 ? 1.3210 1.3426 1.3289 0.0000 0.0000 0.0000 135 PRO A CA    
1002 C C     . PRO A 138 ? 1.3001 1.3604 1.3448 0.0000 0.0000 0.0000 135 PRO A C     
1003 O O     . PRO A 138 ? 1.2966 1.3798 1.3661 0.0000 0.0000 0.0000 135 PRO A O     
1004 C CB    . PRO A 138 ? 1.3463 1.3610 1.3598 0.0000 0.0000 0.0000 135 PRO A CB    
1005 C CG    . PRO A 138 ? 1.3670 1.3483 1.3453 0.0000 0.0000 0.0000 135 PRO A CG    
1006 C CD    . PRO A 138 ? 1.3534 1.3358 1.3191 0.0000 0.0000 0.0000 135 PRO A CD    
1007 N N     . SER A 139 ? 1.2896 1.3560 1.3362 0.0000 0.0000 0.0000 136 SER A N     
1008 C CA    . SER A 139 ? 1.2742 1.3736 1.3534 0.0000 0.0000 0.0000 136 SER A CA    
1009 C C     . SER A 139 ? 1.2827 1.3809 1.3661 0.0000 0.0000 0.0000 136 SER A C     
1010 O O     . SER A 139 ? 1.2893 1.3651 1.3464 0.0000 0.0000 0.0000 136 SER A O     
1011 C CB    . SER A 139 ? 1.2517 1.3588 1.3267 0.0000 0.0000 0.0000 136 SER A CB    
1012 O OG    . SER A 139 ? 1.2439 1.3820 1.3502 0.0000 0.0000 0.0000 136 SER A OG    
1013 N N     . GLN A 140 ? 1.2862 1.4079 1.4024 0.0000 0.0000 0.0000 137 GLN A N     
1014 C CA    . GLN A 140 ? 1.2986 1.4194 1.4206 0.0000 0.0000 0.0000 137 GLN A CA    
1015 C C     . GLN A 140 ? 1.3209 1.4037 1.4101 0.0000 0.0000 0.0000 137 GLN A C     
1016 O O     . GLN A 140 ? 1.3305 1.4025 1.4100 0.0000 0.0000 0.0000 137 GLN A O     
1017 C CB    . GLN A 140 ? 1.2867 1.4202 1.4115 0.0000 0.0000 0.0000 137 GLN A CB    
1018 C CG    . GLN A 140 ? 1.2809 1.4507 1.4390 0.0000 0.0000 0.0000 137 GLN A CG    
1019 C CD    . GLN A 140 ? 1.3051 1.5029 1.5023 0.0000 0.0000 0.0000 137 GLN A CD    
1020 O OE1   . GLN A 140 ? 1.3308 1.5210 1.5309 0.0000 0.0000 0.0000 137 GLN A OE1   
1021 N NE2   . GLN A 140 ? 1.2966 1.5265 1.5247 0.0000 0.0000 0.0000 137 GLN A NE2   
1022 N N     . GLY A 141 ? 1.3312 1.3919 1.4014 0.0000 0.0000 0.0000 138 GLY A N     
1023 C CA    . GLY A 141 ? 1.3513 1.3734 1.3893 0.0000 0.0000 0.0000 138 GLY A CA    
1024 C C     . GLY A 141 ? 1.3451 1.3422 1.3477 0.0000 0.0000 0.0000 138 GLY A C     
1025 O O     . GLY A 141 ? 1.3700 1.3339 1.3446 0.0000 0.0000 0.0000 138 GLY A O     
1026 N N     . TYR A 142 ? 1.3130 1.3258 1.3177 0.0000 0.0000 0.0000 139 TYR A N     
1027 C CA    . TYR A 142 ? 1.3027 1.2970 1.2787 0.0000 0.0000 0.0000 139 TYR A CA    
1028 C C     . TYR A 142 ? 1.2891 1.2757 1.2529 0.0000 0.0000 0.0000 139 TYR A C     
1029 O O     . TYR A 142 ? 1.2817 1.2856 1.2620 0.0000 0.0000 0.0000 139 TYR A O     
1030 C CB    . TYR A 142 ? 1.2853 1.2985 1.2682 0.0000 0.0000 0.0000 139 TYR A CB    
1031 C CG    . TYR A 142 ? 1.3102 1.3239 1.2957 0.0000 0.0000 0.0000 139 TYR A CG    
1032 C CD1   . TYR A 142 ? 1.3367 1.3271 1.2954 0.0000 0.0000 0.0000 139 TYR A CD1   
1033 C CD2   . TYR A 142 ? 1.3239 1.3607 1.3381 0.0000 0.0000 0.0000 139 TYR A CD2   
1034 C CE1   . TYR A 142 ? 1.3563 1.3436 1.3128 0.0000 0.0000 0.0000 139 TYR A CE1   
1035 C CE2   . TYR A 142 ? 1.3435 1.3783 1.3574 0.0000 0.0000 0.0000 139 TYR A CE2   
1036 C CZ    . TYR A 142 ? 1.3561 1.3647 1.3391 0.0000 0.0000 0.0000 139 TYR A CZ    
1037 O OH    . TYR A 142 ? 1.3780 1.3814 1.3565 0.0000 0.0000 0.0000 139 TYR A OH    
1038 N N     . LEU A 143 ? 1.2832 1.2429 1.2176 0.0000 0.0000 0.0000 140 LEU A N     
1039 C CA    . LEU A 143 ? 1.2712 1.2165 1.1885 0.0000 0.0000 0.0000 140 LEU A CA    
1040 C C     . LEU A 143 ? 1.2465 1.1880 1.1493 0.0000 0.0000 0.0000 140 LEU A C     
1041 O O     . LEU A 143 ? 1.2469 1.1854 1.1417 0.0000 0.0000 0.0000 140 LEU A O     
1042 C CB    . LEU A 143 ? 1.3032 1.2146 1.1971 0.0000 0.0000 0.0000 140 LEU A CB    
1043 C CG    . LEU A 143 ? 1.3174 1.2288 1.2234 0.0000 0.0000 0.0000 140 LEU A CG    
1044 C CD1   . LEU A 143 ? 1.3513 1.2277 1.2349 0.0000 0.0000 0.0000 140 LEU A CD1   
1045 C CD2   . LEU A 143 ? 1.3161 1.2329 1.2255 0.0000 0.0000 0.0000 140 LEU A CD2   
1046 N N     . TYR A 144 ? 1.2226 1.1634 1.1211 0.0000 0.0000 0.0000 141 TYR A N     
1047 C CA    . TYR A 144 ? 1.1944 1.1321 1.0808 0.0000 0.0000 0.0000 141 TYR A CA    
1048 C C     . TYR A 144 ? 1.1618 1.1230 1.0620 0.0000 0.0000 0.0000 141 TYR A C     
1049 O O     . TYR A 144 ? 1.1594 1.1316 1.0714 0.0000 0.0000 0.0000 141 TYR A O     
1050 C CB    . TYR A 144 ? 1.2165 1.1247 1.0784 0.0000 0.0000 0.0000 141 TYR A CB    
1051 C CG    . TYR A 144 ? 1.2392 1.1196 1.0827 0.0000 0.0000 0.0000 141 TYR A CG    
1052 C CD1   . TYR A 144 ? 1.2456 1.1137 1.0739 0.0000 0.0000 0.0000 141 TYR A CD1   
1053 C CD2   . TYR A 144 ? 1.2656 1.1306 1.1057 0.0000 0.0000 0.0000 141 TYR A CD2   
1054 C CE1   . TYR A 144 ? 1.2800 1.1201 1.0878 0.0000 0.0000 0.0000 141 TYR A CE1   
1055 C CE2   . TYR A 144 ? 1.3018 1.1392 1.1226 0.0000 0.0000 0.0000 141 TYR A CE2   
1056 C CZ    . TYR A 144 ? 1.3084 1.1330 1.1119 0.0000 0.0000 0.0000 141 TYR A CZ    
1057 O OH    . TYR A 144 ? 1.3405 1.1356 1.1216 0.0000 0.0000 0.0000 141 TYR A OH    
1058 N N     . VAL A 145 ? 1.1333 1.1016 1.0314 0.0000 0.0000 0.0000 142 VAL A N     
1059 C CA    . VAL A 145 ? 1.1050 1.0923 1.0119 0.0000 0.0000 0.0000 142 VAL A CA    
1060 C C     . VAL A 145 ? 1.1016 1.0774 0.9925 0.0000 0.0000 0.0000 142 VAL A C     
1061 O O     . VAL A 145 ? 1.1056 1.0724 0.9877 0.0000 0.0000 0.0000 142 VAL A O     
1062 C CB    . VAL A 145 ? 1.0825 1.0920 1.0049 0.0000 0.0000 0.0000 142 VAL A CB    
1063 C CG1   . VAL A 145 ? 1.0703 1.0968 0.9990 0.0000 0.0000 0.0000 142 VAL A CG1   
1064 C CG2   . VAL A 145 ? 1.0770 1.1002 1.0178 0.0000 0.0000 0.0000 142 VAL A CG2   
1065 N N     . LEU A 146 ? 1.0898 1.0657 0.9766 0.0000 0.0000 0.0000 143 LEU A N     
1066 C CA    . LEU A 146 ? 1.0740 1.0462 0.9502 0.0000 0.0000 0.0000 143 LEU A CA    
1067 C C     . LEU A 146 ? 1.0419 1.0387 0.9304 0.0000 0.0000 0.0000 143 LEU A C     
1068 O O     . LEU A 146 ? 1.0277 1.0417 0.9276 0.0000 0.0000 0.0000 143 LEU A O     
1069 C CB    . LEU A 146 ? 1.0906 1.0515 0.9547 0.0000 0.0000 0.0000 143 LEU A CB    
1070 C CG    . LEU A 146 ? 1.0907 1.0505 0.9452 0.0000 0.0000 0.0000 143 LEU A CG    
1071 C CD1   . LEU A 146 ? 1.0986 1.0378 0.9409 0.0000 0.0000 0.0000 143 LEU A CD1   
1072 C CD2   . LEU A 146 ? 1.1081 1.0624 0.9518 0.0000 0.0000 0.0000 143 LEU A CD2   
1073 N N     . VAL A 147 ? 1.0254 1.0232 0.9118 0.0000 0.0000 0.0000 144 VAL A N     
1074 C CA    . VAL A 147 ? 0.9985 1.0172 0.8963 0.0000 0.0000 0.0000 144 VAL A CA    
1075 C C     . VAL A 147 ? 0.9971 1.0189 0.8903 0.0000 0.0000 0.0000 144 VAL A C     
1076 O O     . VAL A 147 ? 1.0060 1.0143 0.8907 0.0000 0.0000 0.0000 144 VAL A O     
1077 C CB    . VAL A 147 ? 0.9886 1.0080 0.8912 0.0000 0.0000 0.0000 144 VAL A CB    
1078 C CG1   . VAL A 147 ? 0.9682 1.0066 0.8816 0.0000 0.0000 0.0000 144 VAL A CG1   
1079 C CG2   . VAL A 147 ? 0.9883 1.0066 0.8960 0.0000 0.0000 0.0000 144 VAL A CG2   
1080 N N     . VAL A 148 ? 0.9863 1.0260 0.8855 0.0000 0.0000 0.0000 145 VAL A N     
1081 C CA    . VAL A 148 ? 0.9879 1.0339 0.8836 0.0000 0.0000 0.0000 145 VAL A CA    
1082 C C     . VAL A 148 ? 0.9728 1.0412 0.8816 0.0000 0.0000 0.0000 145 VAL A C     
1083 O O     . VAL A 148 ? 0.9640 1.0439 0.8780 0.0000 0.0000 0.0000 145 VAL A O     
1084 C CB    . VAL A 148 ? 1.0014 1.0437 0.8854 0.0000 0.0000 0.0000 145 VAL A CB    
1085 C CG1   . VAL A 148 ? 1.0115 1.0579 0.8892 0.0000 0.0000 0.0000 145 VAL A CG1   
1086 C CG2   . VAL A 148 ? 1.0109 1.0301 0.8825 0.0000 0.0000 0.0000 145 VAL A CG2   
1087 N N     . VAL A 149 ? 0.9724 1.0466 0.8869 0.0000 0.0000 0.0000 146 VAL A N     
1088 C CA    . VAL A 149 ? 0.9657 1.0600 0.8932 0.0000 0.0000 0.0000 146 VAL A CA    
1089 C C     . VAL A 149 ? 0.9741 1.0807 0.9031 0.0000 0.0000 0.0000 146 VAL A C     
1090 O O     . VAL A 149 ? 0.9834 1.0856 0.9112 0.0000 0.0000 0.0000 146 VAL A O     
1091 C CB    . VAL A 149 ? 0.9584 1.0524 0.8950 0.0000 0.0000 0.0000 146 VAL A CB    
1092 C CG1   . VAL A 149 ? 0.9480 1.0610 0.8977 0.0000 0.0000 0.0000 146 VAL A CG1   
1093 C CG2   . VAL A 149 ? 0.9605 1.0411 0.8938 0.0000 0.0000 0.0000 146 VAL A CG2   
1094 N N     . ASP A 150 ? 0.9788 1.1012 0.9107 0.0000 0.0000 0.0000 147 ASP A N     
1095 C CA    . ASP A 150 ? 0.9930 1.1305 0.9286 0.0000 0.0000 0.0000 147 ASP A CA    
1096 C C     . ASP A 150 ? 0.9821 1.1323 0.9360 0.0000 0.0000 0.0000 147 ASP A C     
1097 O O     . ASP A 150 ? 0.9697 1.1250 0.9323 0.0000 0.0000 0.0000 147 ASP A O     
1098 C CB    . ASP A 150 ? 0.9993 1.1485 0.9301 0.0000 0.0000 0.0000 147 ASP A CB    
1099 C CG    . ASP A 150 ? 1.0305 1.1975 0.9660 0.0000 0.0000 0.0000 147 ASP A CG    
1100 O OD1   . ASP A 150 ? 1.0642 1.2296 0.9951 0.0000 0.0000 0.0000 147 ASP A OD1   
1101 O OD2   . ASP A 150 ? 1.0523 1.2350 0.9967 0.0000 0.0000 0.0000 147 ASP A OD2   
1102 N N     . GLY A 151 ? 0.9917 1.1460 0.9515 0.0000 0.0000 0.0000 148 GLY A N     
1103 C CA    . GLY A 151 ? 0.9841 1.1506 0.9630 0.0000 0.0000 0.0000 148 GLY A CA    
1104 C C     . GLY A 151 ? 0.9754 1.1627 0.9676 0.0000 0.0000 0.0000 148 GLY A C     
1105 O O     . GLY A 151 ? 0.9669 1.1563 0.9697 0.0000 0.0000 0.0000 148 GLY A O     
1106 N N     . MET A 152 ? 0.9788 1.1792 0.9682 0.0000 0.0000 0.0000 149 MET A N     
1107 C CA    . MET A 152 ? 0.9722 1.1922 0.9733 0.0000 0.0000 0.0000 149 MET A CA    
1108 C C     . MET A 152 ? 0.9606 1.1742 0.9582 0.0000 0.0000 0.0000 149 MET A C     
1109 O O     . MET A 152 ? 0.9509 1.1714 0.9615 0.0000 0.0000 0.0000 149 MET A O     
1110 C CB    . MET A 152 ? 0.9864 1.2195 0.9810 0.0000 0.0000 0.0000 149 MET A CB    
1111 C CG    . MET A 152 ? 0.9975 1.2533 1.0063 0.0000 0.0000 0.0000 149 MET A CG    
1112 S SD    . MET A 152 ? 1.0410 1.2926 1.0398 0.0000 0.0000 0.0000 149 MET A SD    
1113 C CE    . MET A 152 ? 1.0219 1.2886 1.0468 0.0000 0.0000 0.0000 149 MET A CE    
1114 N N     . THR A 153 ? 0.9604 1.1603 0.9412 0.0000 0.0000 0.0000 150 THR A N     
1115 C CA    . THR A 153 ? 0.9548 1.1515 0.9329 0.0000 0.0000 0.0000 150 THR A CA    
1116 C C     . THR A 153 ? 0.9505 1.1317 0.9293 0.0000 0.0000 0.0000 150 THR A C     
1117 O O     . THR A 153 ? 0.9465 1.1259 0.9292 0.0000 0.0000 0.0000 150 THR A O     
1118 C CB    . THR A 153 ? 0.9630 1.1561 0.9242 0.0000 0.0000 0.0000 150 THR A CB    
1119 O OG1   . THR A 153 ? 0.9638 1.1427 0.9134 0.0000 0.0000 0.0000 150 THR A OG1   
1120 C CG2   . THR A 153 ? 0.9682 1.1751 0.9244 0.0000 0.0000 0.0000 150 THR A CG2   
1121 N N     . GLY A 154 ? 0.9540 1.1228 0.9277 0.0000 0.0000 0.0000 151 GLY A N     
1122 C CA    . GLY A 154 ? 0.9477 1.1009 0.9190 0.0000 0.0000 0.0000 151 GLY A CA    
1123 C C     . GLY A 154 ? 0.9459 1.0931 0.9086 0.0000 0.0000 0.0000 151 GLY A C     
1124 O O     . GLY A 154 ? 0.9489 1.0867 0.9117 0.0000 0.0000 0.0000 151 GLY A O     
1125 N N     . PHE A 155 ? 0.9462 1.0989 0.9013 0.0000 0.0000 0.0000 152 PHE A N     
1126 C CA    . PHE A 155 ? 0.9467 1.0932 0.8933 0.0000 0.0000 0.0000 152 PHE A CA    
1127 C C     . PHE A 155 ? 0.9516 1.0827 0.8920 0.0000 0.0000 0.0000 152 PHE A C     
1128 O O     . PHE A 155 ? 0.9567 1.0816 0.8930 0.0000 0.0000 0.0000 152 PHE A O     
1129 C CB    . PHE A 155 ? 0.9582 1.1105 0.8936 0.0000 0.0000 0.0000 152 PHE A CB    
1130 C CG    . PHE A 155 ? 0.9524 1.1039 0.8828 0.0000 0.0000 0.0000 152 PHE A CG    
1131 C CD1   . PHE A 155 ? 0.9297 1.0904 0.8644 0.0000 0.0000 0.0000 152 PHE A CD1   
1132 C CD2   . PHE A 155 ? 0.9566 1.0974 0.8782 0.0000 0.0000 0.0000 152 PHE A CD2   
1133 C CE1   . PHE A 155 ? 0.9250 1.0854 0.8561 0.0000 0.0000 0.0000 152 PHE A CE1   
1134 C CE2   . PHE A 155 ? 0.9509 1.0926 0.8702 0.0000 0.0000 0.0000 152 PHE A CE2   
1135 C CZ    . PHE A 155 ? 0.9404 1.0924 0.8649 0.0000 0.0000 0.0000 152 PHE A CZ    
1136 N N     . THR A 156 ? 0.9489 1.0739 0.8895 0.0000 0.0000 0.0000 153 THR A N     
1137 C CA    . THR A 156 ? 0.9563 1.0662 0.8927 0.0000 0.0000 0.0000 153 THR A CA    
1138 C C     . THR A 156 ? 0.9654 1.0705 0.8972 0.0000 0.0000 0.0000 153 THR A C     
1139 O O     . THR A 156 ? 0.9625 1.0754 0.9018 0.0000 0.0000 0.0000 153 THR A O     
1140 C CB    . THR A 156 ? 0.9482 1.0533 0.8926 0.0000 0.0000 0.0000 153 THR A CB    
1141 O OG1   . THR A 156 ? 0.9539 1.0619 0.9021 0.0000 0.0000 0.0000 153 THR A OG1   
1142 C CG2   . THR A 156 ? 0.9555 1.0436 0.8931 0.0000 0.0000 0.0000 153 THR A CG2   
1143 N N     . TRP A 157 ? 0.9783 1.0696 0.8982 0.0000 0.0000 0.0000 154 TRP A N     
1144 C CA    . TRP A 157 ? 0.9916 1.0751 0.9070 0.0000 0.0000 0.0000 154 TRP A CA    
1145 C C     . TRP A 157 ? 0.9923 1.0629 0.9103 0.0000 0.0000 0.0000 154 TRP A C     
1146 O O     . TRP A 157 ? 0.9946 1.0531 0.9067 0.0000 0.0000 0.0000 154 TRP A O     
1147 C CB    . TRP A 157 ? 1.0165 1.0902 0.9138 0.0000 0.0000 0.0000 154 TRP A CB    
1148 C CG    . TRP A 157 ? 1.0305 1.1157 0.9220 0.0000 0.0000 0.0000 154 TRP A CG    
1149 C CD1   . TRP A 157 ? 1.0465 1.1360 0.9341 0.0000 0.0000 0.0000 154 TRP A CD1   
1150 C CD2   . TRP A 157 ? 1.0387 1.1325 0.9272 0.0000 0.0000 0.0000 154 TRP A CD2   
1151 N NE1   . TRP A 157 ? 1.0510 1.1492 0.9302 0.0000 0.0000 0.0000 154 TRP A NE1   
1152 C CE2   . TRP A 157 ? 1.0419 1.1439 0.9225 0.0000 0.0000 0.0000 154 TRP A CE2   
1153 C CE3   . TRP A 157 ? 1.0367 1.1329 0.9293 0.0000 0.0000 0.0000 154 TRP A CE3   
1154 C CZ2   . TRP A 157 ? 1.0409 1.1533 0.9170 0.0000 0.0000 0.0000 154 TRP A CZ2   
1155 C CZ3   . TRP A 157 ? 1.0353 1.1443 0.9272 0.0000 0.0000 0.0000 154 TRP A CZ3   
1156 C CH2   . TRP A 157 ? 1.0422 1.1593 0.9256 0.0000 0.0000 0.0000 154 TRP A CH2   
1157 N N     . LEU A 158 ? 0.9914 1.0650 0.9187 0.0000 0.0000 0.0000 155 LEU A N     
1158 C CA    . LEU A 158 ? 0.9932 1.0566 0.9243 0.0000 0.0000 0.0000 155 LEU A CA    
1159 C C     . LEU A 158 ? 1.0109 1.0656 0.9381 0.0000 0.0000 0.0000 155 LEU A C     
1160 O O     . LEU A 158 ? 1.0106 1.0751 0.9428 0.0000 0.0000 0.0000 155 LEU A O     
1161 C CB    . LEU A 158 ? 0.9742 1.0507 0.9236 0.0000 0.0000 0.0000 155 LEU A CB    
1162 C CG    . LEU A 158 ? 0.9549 1.0395 0.9091 0.0000 0.0000 0.0000 155 LEU A CG    
1163 C CD1   . LEU A 158 ? 0.9490 1.0406 0.9178 0.0000 0.0000 0.0000 155 LEU A CD1   
1164 C CD2   . LEU A 158 ? 0.9579 1.0293 0.9000 0.0000 0.0000 0.0000 155 LEU A CD2   
1165 N N     . TYR A 159 ? 1.0325 1.0673 0.9498 0.0000 0.0000 0.0000 156 TYR A N     
1166 C CA    . TYR A 159 ? 1.0624 1.0858 0.9756 0.0000 0.0000 0.0000 156 TYR A CA    
1167 C C     . TYR A 159 ? 1.0732 1.0859 0.9907 0.0000 0.0000 0.0000 156 TYR A C     
1168 O O     . TYR A 159 ? 1.0860 1.0823 0.9919 0.0000 0.0000 0.0000 156 TYR A O     
1169 C CB    . TYR A 159 ? 1.0849 1.0880 0.9747 0.0000 0.0000 0.0000 156 TYR A CB    
1170 C CG    . TYR A 159 ? 1.0967 1.1093 0.9795 0.0000 0.0000 0.0000 156 TYR A CG    
1171 C CD1   . TYR A 159 ? 1.1163 1.1332 0.9961 0.0000 0.0000 0.0000 156 TYR A CD1   
1172 C CD2   . TYR A 159 ? 1.1024 1.1204 0.9817 0.0000 0.0000 0.0000 156 TYR A CD2   
1173 C CE1   . TYR A 159 ? 1.1312 1.1555 1.0014 0.0000 0.0000 0.0000 156 TYR A CE1   
1174 C CE2   . TYR A 159 ? 1.1095 1.1374 0.9828 0.0000 0.0000 0.0000 156 TYR A CE2   
1175 C CZ    . TYR A 159 ? 1.1316 1.1617 0.9987 0.0000 0.0000 0.0000 156 TYR A CZ    
1176 O OH    . TYR A 159 ? 1.1546 1.1930 1.0126 0.0000 0.0000 0.0000 156 TYR A OH    
1177 N N     . PRO A 160 ? 1.0728 1.0955 1.0076 0.0000 0.0000 0.0000 157 PRO A N     
1178 C CA    . PRO A 160 ? 1.0844 1.0974 1.0233 0.0000 0.0000 0.0000 157 PRO A CA    
1179 C C     . PRO A 160 ? 1.1185 1.1036 1.0389 0.0000 0.0000 0.0000 157 PRO A C     
1180 O O     . PRO A 160 ? 1.1346 1.1142 1.0484 0.0000 0.0000 0.0000 157 PRO A O     
1181 C CB    . PRO A 160 ? 1.0737 1.1096 1.0399 0.0000 0.0000 0.0000 157 PRO A CB    
1182 C CG    . PRO A 160 ? 1.0671 1.1169 1.0379 0.0000 0.0000 0.0000 157 PRO A CG    
1183 C CD    . PRO A 160 ? 1.0605 1.1059 1.0137 0.0000 0.0000 0.0000 157 PRO A CD    
1184 N N     . THR A 161 ? 1.1373 1.1021 1.0464 0.0000 0.0000 0.0000 158 THR A N     
1185 C CA    . THR A 161 ? 1.1725 1.1068 1.0625 0.0000 0.0000 0.0000 158 THR A CA    
1186 C C     . THR A 161 ? 1.1912 1.1140 1.0832 0.0000 0.0000 0.0000 158 THR A C     
1187 O O     . THR A 161 ? 1.1810 1.1165 1.0845 0.0000 0.0000 0.0000 158 THR A O     
1188 C CB    . THR A 161 ? 1.1846 1.0951 1.0482 0.0000 0.0000 0.0000 158 THR A CB    
1189 O OG1   . THR A 161 ? 1.1814 1.0803 1.0370 0.0000 0.0000 0.0000 158 THR A OG1   
1190 C CG2   . THR A 161 ? 1.1673 1.0930 1.0303 0.0000 0.0000 0.0000 158 THR A CG2   
1191 N N     . LYS A 162 ? 1.2266 1.1234 1.1054 0.0000 0.0000 0.0000 159 LYS A N     
1192 C CA    . LYS A 162 ? 1.2511 1.1347 1.1300 0.0000 0.0000 0.0000 159 LYS A CA    
1193 C C     . LYS A 162 ? 1.2707 1.1222 1.1219 0.0000 0.0000 0.0000 159 LYS A C     
1194 O O     . LYS A 162 ? 1.2880 1.1271 1.1346 0.0000 0.0000 0.0000 159 LYS A O     
1195 C CB    . LYS A 162 ? 1.2761 1.1501 1.1593 0.0000 0.0000 0.0000 159 LYS A CB    
1196 C CG    . LYS A 162 ? 1.2757 1.1825 1.1893 0.0000 0.0000 0.0000 159 LYS A CG    
1197 C CD    . LYS A 162 ? 1.3294 1.2246 1.2462 0.0000 0.0000 0.0000 159 LYS A CD    
1198 C CE    . LYS A 162 ? 1.3311 1.2606 1.2812 0.0000 0.0000 0.0000 159 LYS A CE    
1199 N NZ    . LYS A 162 ? 1.3705 1.2901 1.3281 0.0000 0.0000 0.0000 159 LYS A NZ    
1200 N N     . ALA A 163 ? 1.2733 1.1122 1.1064 0.0000 0.0000 0.0000 160 ALA A N     
1201 C CA    . ALA A 163 ? 1.2936 1.1028 1.1015 0.0000 0.0000 0.0000 160 ALA A CA    
1202 C C     . ALA A 163 ? 1.2821 1.0975 1.0841 0.0000 0.0000 0.0000 160 ALA A C     
1203 O O     . ALA A 163 ? 1.2727 1.1038 1.0815 0.0000 0.0000 0.0000 160 ALA A O     
1204 C CB    . ALA A 163 ? 1.3299 1.1030 1.1172 0.0000 0.0000 0.0000 160 ALA A CB    
1205 N N     . PRO A 164 ? 1.2851 1.0887 1.0747 0.0000 0.0000 0.0000 161 PRO A N     
1206 C CA    . PRO A 164 ? 1.2750 1.0835 1.0606 0.0000 0.0000 0.0000 161 PRO A CA    
1207 C C     . PRO A 164 ? 1.3057 1.0854 1.0714 0.0000 0.0000 0.0000 161 PRO A C     
1208 O O     . PRO A 164 ? 1.3231 1.0821 1.0736 0.0000 0.0000 0.0000 161 PRO A O     
1209 C CB    . PRO A 164 ? 1.2697 1.0749 1.0500 0.0000 0.0000 0.0000 161 PRO A CB    
1210 C CG    . PRO A 164 ? 1.2884 1.0755 1.0601 0.0000 0.0000 0.0000 161 PRO A CG    
1211 C CD    . PRO A 164 ? 1.3005 1.0841 1.0772 0.0000 0.0000 0.0000 161 PRO A CD    
1212 N N     . SER A 165 ? 1.3168 1.0939 1.0820 0.0000 0.0000 0.0000 162 SER A N     
1213 C CA    . SER A 165 ? 1.3507 1.0964 1.0946 0.0000 0.0000 0.0000 162 SER A CA    
1214 C C     . SER A 165 ? 1.3459 1.1012 1.0879 0.0000 0.0000 0.0000 162 SER A C     
1215 O O     . SER A 165 ? 1.3235 1.1084 1.0809 0.0000 0.0000 0.0000 162 SER A O     
1216 C CB    . SER A 165 ? 1.3756 1.1031 1.1145 0.0000 0.0000 0.0000 162 SER A CB    
1217 O OG    . SER A 165 ? 1.3548 1.1080 1.1112 0.0000 0.0000 0.0000 162 SER A OG    
1218 N N     . THR A 166 ? 1.3703 1.0997 1.0929 0.0000 0.0000 0.0000 163 THR A N     
1219 C CA    . THR A 166 ? 1.3737 1.1069 1.0903 0.0000 0.0000 0.0000 163 THR A CA    
1220 C C     . THR A 166 ? 1.3768 1.1160 1.0941 0.0000 0.0000 0.0000 163 THR A C     
1221 O O     . THR A 166 ? 1.3571 1.1228 1.0839 0.0000 0.0000 0.0000 163 THR A O     
1222 C CB    . THR A 166 ? 1.4103 1.1069 1.1025 0.0000 0.0000 0.0000 163 THR A CB    
1223 O OG1   . THR A 166 ? 1.4202 1.1068 1.1107 0.0000 0.0000 0.0000 163 THR A OG1   
1224 C CG2   . THR A 166 ? 1.4065 1.1111 1.0938 0.0000 0.0000 0.0000 163 THR A CG2   
1225 N N     . SER A 167 ? 1.4024 1.1164 1.1097 0.0000 0.0000 0.0000 164 SER A N     
1226 C CA    . SER A 167 ? 1.4104 1.1267 1.1182 0.0000 0.0000 0.0000 164 SER A CA    
1227 C C     . SER A 167 ? 1.3693 1.1279 1.1017 0.0000 0.0000 0.0000 164 SER A C     
1228 O O     . SER A 167 ? 1.3708 1.1399 1.1005 0.0000 0.0000 0.0000 164 SER A O     
1229 C CB    . SER A 167 ? 1.4336 1.1283 1.1395 0.0000 0.0000 0.0000 164 SER A CB    
1230 O OG    . SER A 167 ? 1.4375 1.1503 1.1583 0.0000 0.0000 0.0000 164 SER A OG    
1231 N N     . ALA A 168 ? 1.3376 1.1185 1.0918 0.0000 0.0000 0.0000 165 ALA A N     
1232 C CA    . ALA A 168 ? 1.3002 1.1188 1.0786 0.0000 0.0000 0.0000 165 ALA A CA    
1233 C C     . ALA A 168 ? 1.2704 1.1124 1.0536 0.0000 0.0000 0.0000 165 ALA A C     
1234 O O     . ALA A 168 ? 1.2527 1.1199 1.0479 0.0000 0.0000 0.0000 165 ALA A O     
1235 C CB    . ALA A 168 ? 1.2861 1.1189 1.0849 0.0000 0.0000 0.0000 165 ALA A CB    
1236 N N     . THR A 169 ? 1.2622 1.0960 1.0371 0.0000 0.0000 0.0000 166 THR A N     
1237 C CA    . THR A 169 ? 1.2349 1.0906 1.0156 0.0000 0.0000 0.0000 166 THR A CA    
1238 C C     . THR A 169 ? 1.2458 1.1010 1.0141 0.0000 0.0000 0.0000 166 THR A C     
1239 O O     . THR A 169 ? 1.2268 1.1071 1.0035 0.0000 0.0000 0.0000 166 THR A O     
1240 C CB    . THR A 169 ? 1.2364 1.0818 1.0115 0.0000 0.0000 0.0000 166 THR A CB    
1241 O OG1   . THR A 169 ? 1.2335 1.0699 1.0120 0.0000 0.0000 0.0000 166 THR A OG1   
1242 C CG2   . THR A 169 ? 1.2101 1.0837 0.9985 0.0000 0.0000 0.0000 166 THR A CG2   
1243 N N     . VAL A 170 ? 1.2780 1.1021 1.0237 0.0000 0.0000 0.0000 167 VAL A N     
1244 C CA    . VAL A 170 ? 1.2942 1.1111 1.0218 0.0000 0.0000 0.0000 167 VAL A CA    
1245 C C     . VAL A 170 ? 1.2876 1.1186 1.0200 0.0000 0.0000 0.0000 167 VAL A C     
1246 O O     . VAL A 170 ? 1.2806 1.1281 1.0110 0.0000 0.0000 0.0000 167 VAL A O     
1247 C CB    . VAL A 170 ? 1.3366 1.1118 1.0364 0.0000 0.0000 0.0000 167 VAL A CB    
1248 C CG1   . VAL A 170 ? 1.3642 1.1277 1.0411 0.0000 0.0000 0.0000 167 VAL A CG1   
1249 C CG2   . VAL A 170 ? 1.3380 1.1025 1.0335 0.0000 0.0000 0.0000 167 VAL A CG2   
1250 N N     . LYS A 171 ? 1.2908 1.1165 1.0306 0.0000 0.0000 0.0000 168 LYS A N     
1251 C CA    . LYS A 171 ? 1.2869 1.1288 1.0364 0.0000 0.0000 0.0000 168 LYS A CA    
1252 C C     . LYS A 171 ? 1.2490 1.1284 1.0183 0.0000 0.0000 0.0000 168 LYS A C     
1253 O O     . LYS A 171 ? 1.2509 1.1412 1.0160 0.0000 0.0000 0.0000 168 LYS A O     
1254 C CB    . LYS A 171 ? 1.2871 1.1284 1.0532 0.0000 0.0000 0.0000 168 LYS A CB    
1255 C CG    . LYS A 171 ? 1.3435 1.1492 1.0924 0.0000 0.0000 0.0000 168 LYS A CG    
1256 C CD    . LYS A 171 ? 1.3691 1.1825 1.1413 0.0000 0.0000 0.0000 168 LYS A CD    
1257 C CE    . LYS A 171 ? 1.4098 1.1870 1.1683 0.0000 0.0000 0.0000 168 LYS A CE    
1258 N NZ    . LYS A 171 ? 1.4535 1.2124 1.1983 0.0000 0.0000 0.0000 168 LYS A NZ    
1259 N N     . SER A 172 ? 1.2179 1.1139 1.0060 0.0000 0.0000 0.0000 169 SER A N     
1260 C CA    . SER A 172 ? 1.1834 1.1128 0.9920 0.0000 0.0000 0.0000 169 SER A CA    
1261 C C     . SER A 172 ? 1.1758 1.1155 0.9762 0.0000 0.0000 0.0000 169 SER A C     
1262 O O     . SER A 172 ? 1.1632 1.1240 0.9705 0.0000 0.0000 0.0000 169 SER A O     
1263 C CB    . SER A 172 ? 1.1615 1.1011 0.9886 0.0000 0.0000 0.0000 169 SER A CB    
1264 O OG    . SER A 172 ? 1.1772 1.1144 1.0160 0.0000 0.0000 0.0000 169 SER A OG    
1265 N N     . LEU A 173 ? 1.1840 1.1090 0.9701 0.0000 0.0000 0.0000 170 LEU A N     
1266 C CA    . LEU A 173 ? 1.1764 1.1122 0.9563 0.0000 0.0000 0.0000 170 LEU A CA    
1267 C C     . LEU A 173 ? 1.1992 1.1258 0.9560 0.0000 0.0000 0.0000 170 LEU A C     
1268 O O     . LEU A 173 ? 1.1990 1.1397 0.9518 0.0000 0.0000 0.0000 170 LEU A O     
1269 C CB    . LEU A 173 ? 1.1814 1.1080 0.9578 0.0000 0.0000 0.0000 170 LEU A CB    
1270 C CG    . LEU A 173 ? 1.1516 1.0904 0.9484 0.0000 0.0000 0.0000 170 LEU A CG    
1271 C CD1   . LEU A 173 ? 1.1583 1.0833 0.9485 0.0000 0.0000 0.0000 170 LEU A CD1   
1272 C CD2   . LEU A 173 ? 1.1074 1.0788 0.9239 0.0000 0.0000 0.0000 170 LEU A CD2   
1273 N N     . ASN A 174 ? 1.2220 1.1240 0.9623 0.0000 0.0000 0.0000 171 ASN A N     
1274 C CA    . ASN A 174 ? 1.2487 1.1398 0.9647 0.0000 0.0000 0.0000 171 ASN A CA    
1275 C C     . ASN A 174 ? 1.2284 1.1440 0.9541 0.0000 0.0000 0.0000 171 ASN A C     
1276 O O     . ASN A 174 ? 1.2407 1.1605 0.9509 0.0000 0.0000 0.0000 171 ASN A O     
1277 C CB    . ASN A 174 ? 1.2877 1.1449 0.9842 0.0000 0.0000 0.0000 171 ASN A CB    
1278 C CG    . ASN A 174 ? 1.3321 1.1585 1.0066 0.0000 0.0000 0.0000 171 ASN A CG    
1279 O OD1   . ASN A 174 ? 1.3490 1.1783 1.0153 0.0000 0.0000 0.0000 171 ASN A OD1   
1280 N ND2   . ASN A 174 ? 1.3673 1.1643 1.0332 0.0000 0.0000 0.0000 171 ASN A ND2   
1281 N N     . VAL A 175 ? 1.1990 1.1304 0.9500 0.0000 0.0000 0.0000 172 VAL A N     
1282 C CA    . VAL A 175 ? 1.1741 1.1309 0.9390 0.0000 0.0000 0.0000 172 VAL A CA    
1283 C C     . VAL A 175 ? 1.1511 1.1311 0.9243 0.0000 0.0000 0.0000 172 VAL A C     
1284 O O     . VAL A 175 ? 1.1509 1.1426 0.9180 0.0000 0.0000 0.0000 172 VAL A O     
1285 C CB    . VAL A 175 ? 1.1527 1.1228 0.9464 0.0000 0.0000 0.0000 172 VAL A CB    
1286 C CG1   . VAL A 175 ? 1.1219 1.1221 0.9357 0.0000 0.0000 0.0000 172 VAL A CG1   
1287 C CG2   . VAL A 175 ? 1.1643 1.1167 0.9518 0.0000 0.0000 0.0000 172 VAL A CG2   
1288 N N     . LEU A 176 ? 1.1324 1.1179 0.9186 0.0000 0.0000 0.0000 173 LEU A N     
1289 C CA    . LEU A 176 ? 1.1122 1.1201 0.9093 0.0000 0.0000 0.0000 173 LEU A CA    
1290 C C     . LEU A 176 ? 1.1346 1.1412 0.9108 0.0000 0.0000 0.0000 173 LEU A C     
1291 O O     . LEU A 176 ? 1.1298 1.1539 0.9070 0.0000 0.0000 0.0000 173 LEU A O     
1292 C CB    . LEU A 176 ? 1.0906 1.1025 0.9046 0.0000 0.0000 0.0000 173 LEU A CB    
1293 C CG    . LEU A 176 ? 1.0602 1.0947 0.8901 0.0000 0.0000 0.0000 173 LEU A CG    
1294 C CD1   . LEU A 176 ? 1.0427 1.0984 0.8794 0.0000 0.0000 0.0000 173 LEU A CD1   
1295 C CD2   . LEU A 176 ? 1.0346 1.0719 0.8834 0.0000 0.0000 0.0000 173 LEU A CD2   
1296 N N     . THR A 177 ? 1.1608 1.1459 0.9172 0.0000 0.0000 0.0000 174 THR A N     
1297 C CA    . THR A 177 ? 1.1827 1.1670 0.9202 0.0000 0.0000 0.0000 174 THR A CA    
1298 C C     . THR A 177 ? 1.2180 1.1931 0.9281 0.0000 0.0000 0.0000 174 THR A C     
1299 O O     . THR A 177 ? 1.2440 1.2122 0.9314 0.0000 0.0000 0.0000 174 THR A O     
1300 C CB    . THR A 177 ? 1.1998 1.1646 0.9262 0.0000 0.0000 0.0000 174 THR A CB    
1301 O OG1   . THR A 177 ? 1.2328 1.1664 0.9404 0.0000 0.0000 0.0000 174 THR A OG1   
1302 C CG2   . THR A 177 ? 1.1690 1.1436 0.9207 0.0000 0.0000 0.0000 174 THR A CG2   
1303 N N     . SER A 178 ? 1.2251 1.2001 0.9372 0.0000 0.0000 0.0000 175 SER A N     
1304 C CA    . SER A 178 ? 1.2562 1.2271 0.9457 0.0000 0.0000 0.0000 175 SER A CA    
1305 C C     . SER A 178 ? 1.2425 1.2399 0.9398 0.0000 0.0000 0.0000 175 SER A C     
1306 O O     . SER A 178 ? 1.2700 1.2648 0.9428 0.0000 0.0000 0.0000 175 SER A O     
1307 C CB    . SER A 178 ? 1.2579 1.2242 0.9531 0.0000 0.0000 0.0000 175 SER A CB    
1308 O OG    . SER A 178 ? 1.2807 1.2321 0.9847 0.0000 0.0000 0.0000 175 SER A OG    
1309 N N     . ILE A 179 ? 1.2076 1.2283 0.9367 0.0000 0.0000 0.0000 176 ILE A N     
1310 C CA    . ILE A 179 ? 1.1903 1.2354 0.9296 0.0000 0.0000 0.0000 176 ILE A CA    
1311 C C     . ILE A 179 ? 1.2010 1.2493 0.9308 0.0000 0.0000 0.0000 176 ILE A C     
1312 O O     . ILE A 179 ? 1.2267 1.2748 0.9340 0.0000 0.0000 0.0000 176 ILE A O     
1313 C CB    . ILE A 179 ? 1.1500 1.2161 0.9247 0.0000 0.0000 0.0000 176 ILE A CB    
1314 C CG1   . ILE A 179 ? 1.1575 1.2221 0.9457 0.0000 0.0000 0.0000 176 ILE A CG1   
1315 C CG2   . ILE A 179 ? 1.1227 1.2104 0.9052 0.0000 0.0000 0.0000 176 ILE A CG2   
1316 C CD1   . ILE A 179 ? 1.1955 1.2536 0.9676 0.0000 0.0000 0.0000 176 ILE A CD1   
1317 N N     . ALA A 180 ? 1.1830 1.2341 0.9293 0.0000 0.0000 0.0000 177 ALA A N     
1318 C CA    . ALA A 180 ? 1.1902 1.2458 0.9319 0.0000 0.0000 0.0000 177 ALA A CA    
1319 C C     . ALA A 180 ? 1.1856 1.2301 0.9350 0.0000 0.0000 0.0000 177 ALA A C     
1320 O O     . ALA A 180 ? 1.1764 1.2111 0.9357 0.0000 0.0000 0.0000 177 ALA A O     
1321 C CB    . ALA A 180 ? 1.1666 1.2515 0.9281 0.0000 0.0000 0.0000 177 ALA A CB    
1322 N N     . ILE A 181 ? 1.1922 1.2378 0.9364 0.0000 0.0000 0.0000 178 ILE A N     
1323 C CA    . ILE A 181 ? 1.1884 1.2229 0.9389 0.0000 0.0000 0.0000 178 ILE A CA    
1324 C C     . ILE A 181 ? 1.1619 1.2228 0.9424 0.0000 0.0000 0.0000 178 ILE A C     
1325 O O     . ILE A 181 ? 1.1630 1.2450 0.9479 0.0000 0.0000 0.0000 178 ILE A O     
1326 C CB    . ILE A 181 ? 1.2280 1.2384 0.9486 0.0000 0.0000 0.0000 178 ILE A CB    
1327 C CG1   . ILE A 181 ? 1.2483 1.2259 0.9425 0.0000 0.0000 0.0000 178 ILE A CG1   
1328 C CG2   . ILE A 181 ? 1.2282 1.2343 0.9590 0.0000 0.0000 0.0000 178 ILE A CG2   
1329 C CD1   . ILE A 181 ? 1.2898 1.2376 0.9514 0.0000 0.0000 0.0000 178 ILE A CD1   
1330 N N     . PRO A 182 ? 1.1386 1.1982 0.9392 0.0000 0.0000 0.0000 179 PRO A N     
1331 C CA    . PRO A 182 ? 1.1132 1.1955 0.9423 0.0000 0.0000 0.0000 179 PRO A CA    
1332 C C     . PRO A 182 ? 1.1312 1.2129 0.9599 0.0000 0.0000 0.0000 179 PRO A C     
1333 O O     . PRO A 182 ? 1.1615 1.2189 0.9670 0.0000 0.0000 0.0000 179 PRO A O     
1334 C CB    . PRO A 182 ? 1.0950 1.1676 0.9367 0.0000 0.0000 0.0000 179 PRO A CB    
1335 C CG    . PRO A 182 ? 1.1142 1.1551 0.9330 0.0000 0.0000 0.0000 179 PRO A CG    
1336 C CD    . PRO A 182 ? 1.1380 1.1733 0.9340 0.0000 0.0000 0.0000 179 PRO A CD    
1337 N N     . LYS A 183 ? 1.1166 1.2244 0.9713 0.0000 0.0000 0.0000 180 LYS A N     
1338 C CA    . LYS A 183 ? 1.1362 1.2457 0.9973 0.0000 0.0000 0.0000 180 LYS A CA    
1339 C C     . LYS A 183 ? 1.1362 1.2273 1.0036 0.0000 0.0000 0.0000 180 LYS A C     
1340 O O     . LYS A 183 ? 1.1637 1.2320 1.0171 0.0000 0.0000 0.0000 180 LYS A O     
1341 C CB    . LYS A 183 ? 1.1216 1.2682 1.0126 0.0000 0.0000 0.0000 180 LYS A CB    
1342 C CG    . LYS A 183 ? 1.1427 1.3079 1.0271 0.0000 0.0000 0.0000 180 LYS A CG    
1343 C CD    . LYS A 183 ? 1.1406 1.3443 1.0599 0.0000 0.0000 0.0000 180 LYS A CD    
1344 C CE    . LYS A 183 ? 1.1628 1.3860 1.0764 0.0000 0.0000 0.0000 180 LYS A CE    
1345 N NZ    . LYS A 183 ? 1.1601 1.4179 1.1086 0.0000 0.0000 0.0000 180 LYS A NZ    
1346 N N     . VAL A 184 ? 1.1101 1.2089 0.9962 0.0000 0.0000 0.0000 181 VAL A N     
1347 C CA    . VAL A 184 ? 1.1055 1.1913 1.0004 0.0000 0.0000 0.0000 181 VAL A CA    
1348 C C     . VAL A 184 ? 1.0957 1.1656 0.9842 0.0000 0.0000 0.0000 181 VAL A C     
1349 O O     . VAL A 184 ? 1.0741 1.1583 0.9706 0.0000 0.0000 0.0000 181 VAL A O     
1350 C CB    . VAL A 184 ? 1.0853 1.1983 1.0128 0.0000 0.0000 0.0000 181 VAL A CB    
1351 C CG1   . VAL A 184 ? 1.0870 1.1831 1.0189 0.0000 0.0000 0.0000 181 VAL A CG1   
1352 C CG2   . VAL A 184 ? 1.0873 1.2264 1.0287 0.0000 0.0000 0.0000 181 VAL A CG2   
1353 N N     . ILE A 185 ? 1.1137 1.1538 0.9879 0.0000 0.0000 0.0000 182 ILE A N     
1354 C CA    . ILE A 185 ? 1.1099 1.1353 0.9807 0.0000 0.0000 0.0000 182 ILE A CA    
1355 C C     . ILE A 185 ? 1.1171 1.1344 0.9969 0.0000 0.0000 0.0000 182 ILE A C     
1356 O O     . ILE A 185 ? 1.1391 1.1380 1.0112 0.0000 0.0000 0.0000 182 ILE A O     
1357 C CB    . ILE A 185 ? 1.1271 1.1231 0.9728 0.0000 0.0000 0.0000 182 ILE A CB    
1358 C CG1   . ILE A 185 ? 1.1212 1.1261 0.9602 0.0000 0.0000 0.0000 182 ILE A CG1   
1359 C CG2   . ILE A 185 ? 1.1258 1.1036 0.9688 0.0000 0.0000 0.0000 182 ILE A CG2   
1360 C CD1   . ILE A 185 ? 1.1433 1.1213 0.9571 0.0000 0.0000 0.0000 182 ILE A CD1   
1361 N N     . HIS A 186 ? 1.1032 1.1327 0.9975 0.0000 0.0000 0.0000 183 HIS A N     
1362 C CA    . HIS A 186 ? 1.1071 1.1289 1.0080 0.0000 0.0000 0.0000 183 HIS A CA    
1363 C C     . HIS A 186 ? 1.1168 1.1147 1.0035 0.0000 0.0000 0.0000 183 HIS A C     
1364 O O     . HIS A 186 ? 1.1038 1.1073 0.9914 0.0000 0.0000 0.0000 183 HIS A O     
1365 C CB    . HIS A 186 ? 1.0829 1.1324 1.0080 0.0000 0.0000 0.0000 183 HIS A CB    
1366 C CG    . HIS A 186 ? 1.0863 1.1277 1.0168 0.0000 0.0000 0.0000 183 HIS A CG    
1367 N ND1   . HIS A 186 ? 1.0881 1.1409 1.0350 0.0000 0.0000 0.0000 183 HIS A ND1   
1368 C CD2   . HIS A 186 ? 1.0965 1.1189 1.0173 0.0000 0.0000 0.0000 183 HIS A CD2   
1369 C CE1   . HIS A 186 ? 1.0974 1.1376 1.0436 0.0000 0.0000 0.0000 183 HIS A CE1   
1370 N NE2   . HIS A 186 ? 1.1061 1.1265 1.0346 0.0000 0.0000 0.0000 183 HIS A NE2   
1371 N N     . SER A 187 ? 1.1461 1.1175 1.0202 0.0000 0.0000 0.0000 184 SER A N     
1372 C CA    . SER A 187 ? 1.1615 1.1089 1.0211 0.0000 0.0000 0.0000 184 SER A CA    
1373 C C     . SER A 187 ? 1.1835 1.1129 1.0383 0.0000 0.0000 0.0000 184 SER A C     
1374 O O     . SER A 187 ? 1.1880 1.1214 1.0506 0.0000 0.0000 0.0000 184 SER A O     
1375 C CB    . SER A 187 ? 1.1817 1.1052 1.0214 0.0000 0.0000 0.0000 184 SER A CB    
1376 O OG    . SER A 187 ? 1.2041 1.1080 1.0329 0.0000 0.0000 0.0000 184 SER A OG    
1377 N N     . ASP A 188 ? 1.2003 1.1106 1.0425 0.0000 0.0000 0.0000 185 ASP A N     
1378 C CA    . ASP A 188 ? 1.2323 1.1168 1.0613 0.0000 0.0000 0.0000 185 ASP A CA    
1379 C C     . ASP A 188 ? 1.2552 1.1092 1.0651 0.0000 0.0000 0.0000 185 ASP A C     
1380 O O     . ASP A 188 ? 1.2578 1.1083 1.0624 0.0000 0.0000 0.0000 185 ASP A O     
1381 C CB    . ASP A 188 ? 1.2419 1.1154 1.0608 0.0000 0.0000 0.0000 185 ASP A CB    
1382 C CG    . ASP A 188 ? 1.2817 1.1470 1.0912 0.0000 0.0000 0.0000 185 ASP A CG    
1383 O OD1   . ASP A 188 ? 1.3016 1.1862 1.1216 0.0000 0.0000 0.0000 185 ASP A OD1   
1384 O OD2   . ASP A 188 ? 1.3238 1.1637 1.1168 0.0000 0.0000 0.0000 185 ASP A OD2   
1385 N N     . GLN A 189 ? 1.2747 1.1041 1.0723 0.0000 0.0000 0.0000 186 GLN A N     
1386 C CA    . GLN A 189 ? 1.3035 1.1011 1.0823 0.0000 0.0000 0.0000 186 GLN A CA    
1387 C C     . GLN A 189 ? 1.3234 1.0907 1.0790 0.0000 0.0000 0.0000 186 GLN A C     
1388 O O     . GLN A 189 ? 1.3516 1.0852 1.0872 0.0000 0.0000 0.0000 186 GLN A O     
1389 C CB    . GLN A 189 ? 1.3226 1.1057 1.0984 0.0000 0.0000 0.0000 186 GLN A CB    
1390 C CG    . GLN A 189 ? 1.3002 1.1126 1.1014 0.0000 0.0000 0.0000 186 GLN A CG    
1391 C CD    . GLN A 189 ? 1.3192 1.1179 1.1198 0.0000 0.0000 0.0000 186 GLN A CD    
1392 O OE1   . GLN A 189 ? 1.3490 1.1123 1.1281 0.0000 0.0000 0.0000 186 GLN A OE1   
1393 N NE2   . GLN A 189 ? 1.3060 1.1323 1.1308 0.0000 0.0000 0.0000 186 GLN A NE2   
1394 N N     . GLY A 190 ? 1.3100 1.0898 1.0694 0.0000 0.0000 0.0000 187 GLY A N     
1395 C CA    . GLY A 190 ? 1.3313 1.0892 1.0745 0.0000 0.0000 0.0000 187 GLY A CA    
1396 C C     . GLY A 190 ? 1.3581 1.0968 1.0902 0.0000 0.0000 0.0000 187 GLY A C     
1397 O O     . GLY A 190 ? 1.3519 1.1050 1.0926 0.0000 0.0000 0.0000 187 GLY A O     
1398 N N     . ALA A 191 ? 1.3925 1.0972 1.1039 0.0000 0.0000 0.0000 188 ALA A N     
1399 C CA    . ALA A 191 ? 1.4255 1.1026 1.1212 0.0000 0.0000 0.0000 188 ALA A CA    
1400 C C     . ALA A 191 ? 1.4154 1.1100 1.1203 0.0000 0.0000 0.0000 188 ALA A C     
1401 O O     . ALA A 191 ? 1.4355 1.1156 1.1310 0.0000 0.0000 0.0000 188 ALA A O     
1402 C CB    . ALA A 191 ? 1.4524 1.0960 1.1282 0.0000 0.0000 0.0000 188 ALA A CB    
1403 N N     . ALA A 192 ? 1.3863 1.1105 1.1081 0.0000 0.0000 0.0000 189 ALA A N     
1404 C CA    . ALA A 192 ? 1.3764 1.1173 1.1060 0.0000 0.0000 0.0000 189 ALA A CA    
1405 C C     . ALA A 192 ? 1.3720 1.1283 1.1069 0.0000 0.0000 0.0000 189 ALA A C     
1406 O O     . ALA A 192 ? 1.3814 1.1379 1.1121 0.0000 0.0000 0.0000 189 ALA A O     
1407 C CB    . ALA A 192 ? 1.3447 1.1155 1.0930 0.0000 0.0000 0.0000 189 ALA A CB    
1408 N N     . PHE A 193 ? 1.3611 1.1301 1.1047 0.0000 0.0000 0.0000 190 PHE A N     
1409 C CA    . PHE A 193 ? 1.3494 1.1395 1.1027 0.0000 0.0000 0.0000 190 PHE A CA    
1410 C C     . PHE A 193 ? 1.3741 1.1455 1.1183 0.0000 0.0000 0.0000 190 PHE A C     
1411 O O     . PHE A 193 ? 1.3764 1.1587 1.1243 0.0000 0.0000 0.0000 190 PHE A O     
1412 C CB    . PHE A 193 ? 1.3146 1.1419 1.0916 0.0000 0.0000 0.0000 190 PHE A CB    
1413 C CG    . PHE A 193 ? 1.2870 1.1310 1.0737 0.0000 0.0000 0.0000 190 PHE A CG    
1414 C CD1   . PHE A 193 ? 1.2796 1.1294 1.0658 0.0000 0.0000 0.0000 190 PHE A CD1   
1415 C CD2   . PHE A 193 ? 1.2787 1.1322 1.0747 0.0000 0.0000 0.0000 190 PHE A CD2   
1416 C CE1   . PHE A 193 ? 1.2655 1.1321 1.0632 0.0000 0.0000 0.0000 190 PHE A CE1   
1417 C CE2   . PHE A 193 ? 1.2702 1.1385 1.0750 0.0000 0.0000 0.0000 190 PHE A CE2   
1418 C CZ    . PHE A 193 ? 1.2586 1.1345 1.0658 0.0000 0.0000 0.0000 190 PHE A CZ    
1419 N N     . THR A 194 ? 1.3944 1.1378 1.1268 0.0000 0.0000 0.0000 191 THR A N     
1420 C CA    . THR A 194 ? 1.4252 1.1487 1.1494 0.0000 0.0000 0.0000 191 THR A CA    
1421 C C     . THR A 194 ? 1.4636 1.1476 1.1621 0.0000 0.0000 0.0000 191 THR A C     
1422 O O     . THR A 194 ? 1.4921 1.1532 1.1800 0.0000 0.0000 0.0000 191 THR A O     
1423 C CB    . THR A 194 ? 1.4321 1.1437 1.1550 0.0000 0.0000 0.0000 191 THR A CB    
1424 O OG1   . THR A 194 ? 1.4484 1.1408 1.1580 0.0000 0.0000 0.0000 191 THR A OG1   
1425 C CG2   . THR A 194 ? 1.4014 1.1500 1.1494 0.0000 0.0000 0.0000 191 THR A CG2   
1426 N N     . SER A 195 ? 1.4682 1.1438 1.1571 0.0000 0.0000 0.0000 192 SER A N     
1427 C CA    . SER A 195 ? 1.5079 1.1458 1.1719 0.0000 0.0000 0.0000 192 SER A CA    
1428 C C     . SER A 195 ? 1.5169 1.1571 1.1765 0.0000 0.0000 0.0000 192 SER A C     
1429 O O     . SER A 195 ? 1.4895 1.1655 1.1663 0.0000 0.0000 0.0000 192 SER A O     
1430 C CB    . SER A 195 ? 1.5088 1.1422 1.1679 0.0000 0.0000 0.0000 192 SER A CB    
1431 O OG    . SER A 195 ? 1.5032 1.1563 1.1666 0.0000 0.0000 0.0000 192 SER A OG    
1432 N N     . SER A 196 ? 1.5564 1.1566 1.1912 0.0000 0.0000 0.0000 193 SER A N     
1433 C CA    . SER A 196 ? 1.5746 1.1702 1.1996 0.0000 0.0000 0.0000 193 SER A CA    
1434 C C     . SER A 196 ? 1.5682 1.1715 1.1863 0.0000 0.0000 0.0000 193 SER A C     
1435 O O     . SER A 196 ? 1.5736 1.1860 1.1878 0.0000 0.0000 0.0000 193 SER A O     
1436 C CB    . SER A 196 ? 1.6276 1.1738 1.2261 0.0000 0.0000 0.0000 193 SER A CB    
1437 O OG    . SER A 196 ? 1.6578 1.1671 1.2385 0.0000 0.0000 0.0000 193 SER A OG    
1438 N N     . THR A 197 ? 1.5554 1.1554 1.1720 0.0000 0.0000 0.0000 194 THR A N     
1439 C CA    . THR A 197 ? 1.5472 1.1559 1.1594 0.0000 0.0000 0.0000 194 THR A CA    
1440 C C     . THR A 197 ? 1.5005 1.1584 1.1367 0.0000 0.0000 0.0000 194 THR A C     
1441 O O     . THR A 197 ? 1.5020 1.1702 1.1323 0.0000 0.0000 0.0000 194 THR A O     
1442 C CB    . THR A 197 ? 1.5455 1.1449 1.1572 0.0000 0.0000 0.0000 194 THR A CB    
1443 O OG1   . THR A 197 ? 1.5831 1.1431 1.1801 0.0000 0.0000 0.0000 194 THR A OG1   
1444 C CG2   . THR A 197 ? 1.5573 1.1482 1.1548 0.0000 0.0000 0.0000 194 THR A CG2   
1445 N N     . PHE A 198 ? 1.4604 1.1463 1.1214 0.0000 0.0000 0.0000 195 PHE A N     
1446 C CA    . PHE A 198 ? 1.4156 1.1467 1.1003 0.0000 0.0000 0.0000 195 PHE A CA    
1447 C C     . PHE A 198 ? 1.4180 1.1645 1.1062 0.0000 0.0000 0.0000 195 PHE A C     
1448 O O     . PHE A 198 ? 1.4076 1.1773 1.0996 0.0000 0.0000 0.0000 195 PHE A O     
1449 C CB    . PHE A 198 ? 1.3788 1.1312 1.0863 0.0000 0.0000 0.0000 195 PHE A CB    
1450 C CG    . PHE A 198 ? 1.3295 1.1247 1.0601 0.0000 0.0000 0.0000 195 PHE A CG    
1451 C CD1   . PHE A 198 ? 1.3110 1.1195 1.0431 0.0000 0.0000 0.0000 195 PHE A CD1   
1452 C CD2   . PHE A 198 ? 1.2989 1.1198 1.0496 0.0000 0.0000 0.0000 195 PHE A CD2   
1453 C CE1   . PHE A 198 ? 1.2777 1.1230 1.0296 0.0000 0.0000 0.0000 195 PHE A CE1   
1454 C CE2   . PHE A 198 ? 1.2596 1.1173 1.0305 0.0000 0.0000 0.0000 195 PHE A CE2   
1455 C CZ    . PHE A 198 ? 1.2496 1.1188 1.0204 0.0000 0.0000 0.0000 195 PHE A CZ    
1456 N N     . ALA A 199 ? 1.4363 1.1696 1.1232 0.0000 0.0000 0.0000 196 ALA A N     
1457 C CA    . ALA A 199 ? 1.4437 1.1900 1.1354 0.0000 0.0000 0.0000 196 ALA A CA    
1458 C C     . ALA A 199 ? 1.4712 1.2087 1.1418 0.0000 0.0000 0.0000 196 ALA A C     
1459 O O     . ALA A 199 ? 1.4597 1.2243 1.1388 0.0000 0.0000 0.0000 196 ALA A O     
1460 C CB    . ALA A 199 ? 1.4664 1.1899 1.1548 0.0000 0.0000 0.0000 196 ALA A CB    
1461 N N     . GLU A 200 ? 1.5102 1.2088 1.1522 0.0000 0.0000 0.0000 197 GLU A N     
1462 C CA    . GLU A 200 ? 1.5502 1.2327 1.1657 0.0000 0.0000 0.0000 197 GLU A CA    
1463 C C     . GLU A 200 ? 1.5234 1.2319 1.1422 0.0000 0.0000 0.0000 197 GLU A C     
1464 O O     . GLU A 200 ? 1.5272 1.2509 1.1410 0.0000 0.0000 0.0000 197 GLU A O     
1465 C CB    . GLU A 200 ? 1.5999 1.2305 1.1831 0.0000 0.0000 0.0000 197 GLU A CB    
1466 C CG    . GLU A 200 ? 1.6766 1.2723 1.2420 0.0000 0.0000 0.0000 197 GLU A CG    
1467 C CD    . GLU A 200 ? 1.7642 1.3092 1.3057 0.0000 0.0000 0.0000 197 GLU A CD    
1468 O OE1   . GLU A 200 ? 1.7841 1.3168 1.3151 0.0000 0.0000 0.0000 197 GLU A OE1   
1469 O OE2   . GLU A 200 ? 1.8155 1.3333 1.3499 0.0000 0.0000 0.0000 197 GLU A OE2   
1470 N N     . TRP A 201 ? 1.4999 1.2131 1.1269 0.0000 0.0000 0.0000 198 TRP A N     
1471 C CA    . TRP A 201 ? 1.4724 1.2133 1.1074 0.0000 0.0000 0.0000 198 TRP A CA    
1472 C C     . TRP A 201 ? 1.4459 1.2273 1.1002 0.0000 0.0000 0.0000 198 TRP A C     
1473 O O     . TRP A 201 ? 1.4506 1.2447 1.0967 0.0000 0.0000 0.0000 198 TRP A O     
1474 C CB    . TRP A 201 ? 1.4398 1.1921 1.0938 0.0000 0.0000 0.0000 198 TRP A CB    
1475 C CG    . TRP A 201 ? 1.4062 1.1902 1.0727 0.0000 0.0000 0.0000 198 TRP A CG    
1476 C CD1   . TRP A 201 ? 1.4196 1.1977 1.0741 0.0000 0.0000 0.0000 198 TRP A CD1   
1477 C CD2   . TRP A 201 ? 1.3553 1.1802 1.0480 0.0000 0.0000 0.0000 198 TRP A CD2   
1478 N NE1   . TRP A 201 ? 1.3822 1.1949 1.0538 0.0000 0.0000 0.0000 198 TRP A NE1   
1479 C CE2   . TRP A 201 ? 1.3461 1.1871 1.0406 0.0000 0.0000 0.0000 198 TRP A CE2   
1480 C CE3   . TRP A 201 ? 1.3225 1.1709 1.0374 0.0000 0.0000 0.0000 198 TRP A CE3   
1481 C CZ2   . TRP A 201 ? 1.3130 1.1907 1.0292 0.0000 0.0000 0.0000 198 TRP A CZ2   
1482 C CZ3   . TRP A 201 ? 1.2907 1.1758 1.0275 0.0000 0.0000 0.0000 198 TRP A CZ3   
1483 C CH2   . TRP A 201 ? 1.2882 1.1868 1.0249 0.0000 0.0000 0.0000 198 TRP A CH2   
1484 N N     . ALA A 202 ? 1.4207 1.2206 1.0994 0.0000 0.0000 0.0000 199 ALA A N     
1485 C CA    . ALA A 202 ? 1.3922 1.2319 1.0941 0.0000 0.0000 0.0000 199 ALA A CA    
1486 C C     . ALA A 202 ? 1.4183 1.2584 1.1092 0.0000 0.0000 0.0000 199 ALA A C     
1487 O O     . ALA A 202 ? 1.4069 1.2740 1.1031 0.0000 0.0000 0.0000 199 ALA A O     
1488 C CB    . ALA A 202 ? 1.3626 1.2181 1.0919 0.0000 0.0000 0.0000 199 ALA A CB    
1489 N N     . LYS A 203 ? 1.4559 1.2651 1.1306 0.0000 0.0000 0.0000 200 LYS A N     
1490 C CA    . LYS A 203 ? 1.4859 1.2938 1.1501 0.0000 0.0000 0.0000 200 LYS A CA    
1491 C C     . LYS A 203 ? 1.5057 1.3074 1.1421 0.0000 0.0000 0.0000 200 LYS A C     
1492 O O     . LYS A 203 ? 1.5062 1.3323 1.1458 0.0000 0.0000 0.0000 200 LYS A O     
1493 C CB    . LYS A 203 ? 1.5257 1.2962 1.1744 0.0000 0.0000 0.0000 200 LYS A CB    
1494 C CG    . LYS A 203 ? 1.5638 1.3406 1.2111 0.0000 0.0000 0.0000 200 LYS A CG    
1495 C CD    . LYS A 203 ? 1.6177 1.3653 1.2604 0.0000 0.0000 0.0000 200 LYS A CD    
1496 C CE    . LYS A 203 ? 1.6258 1.4027 1.2930 0.0000 0.0000 0.0000 200 LYS A CE    
1497 N NZ    . LYS A 203 ? 1.6796 1.4248 1.3380 0.0000 0.0000 0.0000 200 LYS A NZ    
1498 N N     . GLU A 204 ? 1.5208 1.2905 1.1307 0.0000 0.0000 0.0000 201 GLU A N     
1499 C CA    . GLU A 204 ? 1.5400 1.2984 1.1197 0.0000 0.0000 0.0000 201 GLU A CA    
1500 C C     . GLU A 204 ? 1.5039 1.3026 1.0965 0.0000 0.0000 0.0000 201 GLU A C     
1501 O O     . GLU A 204 ? 1.5302 1.3295 1.1019 0.0000 0.0000 0.0000 201 GLU A O     
1502 C CB    . GLU A 204 ? 1.5538 1.2837 1.1160 0.0000 0.0000 0.0000 201 GLU A CB    
1503 C CG    . GLU A 204 ? 1.6312 1.3094 1.1559 0.0000 0.0000 0.0000 201 GLU A CG    
1504 C CD    . GLU A 204 ? 1.6731 1.3238 1.1921 0.0000 0.0000 0.0000 201 GLU A CD    
1505 O OE1   . GLU A 204 ? 1.6530 1.3265 1.1964 0.0000 0.0000 0.0000 201 GLU A OE1   
1506 O OE2   . GLU A 204 ? 1.7300 1.3356 1.2201 0.0000 0.0000 0.0000 201 GLU A OE2   
1507 N N     . ARG A 205 ? 1.4471 1.2775 1.0720 0.0000 0.0000 0.0000 202 ARG A N     
1508 C CA    . ARG A 205 ? 1.4110 1.2770 1.0480 0.0000 0.0000 0.0000 202 ARG A CA    
1509 C C     . ARG A 205 ? 1.3904 1.2928 1.0525 0.0000 0.0000 0.0000 202 ARG A C     
1510 O O     . ARG A 205 ? 1.3730 1.3050 1.0448 0.0000 0.0000 0.0000 202 ARG A O     
1511 C CB    . ARG A 205 ? 1.3720 1.2511 1.0282 0.0000 0.0000 0.0000 202 ARG A CB    
1512 C CG    . ARG A 205 ? 1.3789 1.2245 1.0180 0.0000 0.0000 0.0000 202 ARG A CG    
1513 C CD    . ARG A 205 ? 1.3431 1.2027 0.9946 0.0000 0.0000 0.0000 202 ARG A CD    
1514 N NE    . ARG A 205 ? 1.3528 1.1833 0.9853 0.0000 0.0000 0.0000 202 ARG A NE    
1515 C CZ    . ARG A 205 ? 1.3724 1.1658 0.9861 0.0000 0.0000 0.0000 202 ARG A CZ    
1516 N NH1   . ARG A 205 ? 1.3816 1.1597 0.9913 0.0000 0.0000 0.0000 202 ARG A NH1   
1517 N NH2   . ARG A 205 ? 1.3825 1.1536 0.9825 0.0000 0.0000 0.0000 202 ARG A NH2   
1518 N N     . GLY A 206 ? 1.3940 1.2940 1.0671 0.0000 0.0000 0.0000 203 GLY A N     
1519 C CA    . GLY A 206 ? 1.3744 1.3102 1.0755 0.0000 0.0000 0.0000 203 GLY A CA    
1520 C C     . GLY A 206 ? 1.3267 1.2946 1.0656 0.0000 0.0000 0.0000 203 GLY A C     
1521 O O     . GLY A 206 ? 1.3027 1.3064 1.0631 0.0000 0.0000 0.0000 203 GLY A O     
1522 N N     . ILE A 207 ? 1.3167 1.2699 1.0618 0.0000 0.0000 0.0000 204 ILE A N     
1523 C CA    . ILE A 207 ? 1.2772 1.2541 1.0538 0.0000 0.0000 0.0000 204 ILE A CA    
1524 C C     . ILE A 207 ? 1.2807 1.2534 1.0738 0.0000 0.0000 0.0000 204 ILE A C     
1525 O O     . ILE A 207 ? 1.3048 1.2441 1.0813 0.0000 0.0000 0.0000 204 ILE A O     
1526 C CB    . ILE A 207 ? 1.2601 1.2255 1.0316 0.0000 0.0000 0.0000 204 ILE A CB    
1527 C CG1   . ILE A 207 ? 1.2544 1.2226 1.0094 0.0000 0.0000 0.0000 204 ILE A CG1   
1528 C CG2   . ILE A 207 ? 1.2188 1.2064 1.0201 0.0000 0.0000 0.0000 204 ILE A CG2   
1529 C CD1   . ILE A 207 ? 1.2279 1.1837 0.9775 0.0000 0.0000 0.0000 204 ILE A CD1   
1530 N N     . HIS A 208 ? 1.2588 1.2640 1.0836 0.0000 0.0000 0.0000 205 HIS A N     
1531 C CA    . HIS A 208 ? 1.2600 1.2642 1.1029 0.0000 0.0000 0.0000 205 HIS A CA    
1532 C C     . HIS A 208 ? 1.2357 1.2315 1.0848 0.0000 0.0000 0.0000 205 HIS A C     
1533 O O     . HIS A 208 ? 1.2076 1.2225 1.0691 0.0000 0.0000 0.0000 205 HIS A O     
1534 C CB    . HIS A 208 ? 1.2473 1.2906 1.1231 0.0000 0.0000 0.0000 205 HIS A CB    
1535 C CG    . HIS A 208 ? 1.2724 1.3153 1.1671 0.0000 0.0000 0.0000 205 HIS A CG    
1536 N ND1   . HIS A 208 ? 1.2667 1.3283 1.1885 0.0000 0.0000 0.0000 205 HIS A ND1   
1537 C CD2   . HIS A 208 ? 1.3203 1.3444 1.2093 0.0000 0.0000 0.0000 205 HIS A CD2   
1538 C CE1   . HIS A 208 ? 1.2814 1.3370 1.2140 0.0000 0.0000 0.0000 205 HIS A CE1   
1539 N NE2   . HIS A 208 ? 1.3245 1.3578 1.2384 0.0000 0.0000 0.0000 205 HIS A NE2   
1540 N N     . LEU A 209 ? 1.2500 1.2150 1.0882 0.0000 0.0000 0.0000 206 LEU A N     
1541 C CA    . LEU A 209 ? 1.2319 1.1869 1.0739 0.0000 0.0000 0.0000 206 LEU A CA    
1542 C C     . LEU A 209 ? 1.2247 1.1974 1.0927 0.0000 0.0000 0.0000 206 LEU A C     
1543 O O     . LEU A 209 ? 1.2395 1.2174 1.1172 0.0000 0.0000 0.0000 206 LEU A O     
1544 C CB    . LEU A 209 ? 1.2523 1.1641 1.0681 0.0000 0.0000 0.0000 206 LEU A CB    
1545 C CG    . LEU A 209 ? 1.2537 1.1453 1.0447 0.0000 0.0000 0.0000 206 LEU A CG    
1546 C CD1   . LEU A 209 ? 1.2777 1.1291 1.0482 0.0000 0.0000 0.0000 206 LEU A CD1   
1547 C CD2   . LEU A 209 ? 1.2179 1.1307 1.0172 0.0000 0.0000 0.0000 206 LEU A CD2   
1548 N N     . GLU A 210 ? 1.2048 1.1864 1.0839 0.0000 0.0000 0.0000 207 GLU A N     
1549 C CA    . GLU A 210 ? 1.1943 1.1943 1.0978 0.0000 0.0000 0.0000 207 GLU A CA    
1550 C C     . GLU A 210 ? 1.1880 1.1694 1.0837 0.0000 0.0000 0.0000 207 GLU A C     
1551 O O     . GLU A 210 ? 1.1816 1.1613 1.0701 0.0000 0.0000 0.0000 207 GLU A O     
1552 C CB    . GLU A 210 ? 1.1682 1.2087 1.0970 0.0000 0.0000 0.0000 207 GLU A CB    
1553 C CG    . GLU A 210 ? 1.1765 1.2378 1.1322 0.0000 0.0000 0.0000 207 GLU A CG    
1554 C CD    . GLU A 210 ? 1.1854 1.2849 1.1654 0.0000 0.0000 0.0000 207 GLU A CD    
1555 O OE1   . GLU A 210 ? 1.2084 1.3311 1.2017 0.0000 0.0000 0.0000 207 GLU A OE1   
1556 O OE2   . GLU A 210 ? 1.1774 1.2828 1.1623 0.0000 0.0000 0.0000 207 GLU A OE2   
1557 N N     . PHE A 211 ? 1.1946 1.1622 1.0914 0.0000 0.0000 0.0000 208 PHE A N     
1558 C CA    . PHE A 211 ? 1.1908 1.1349 1.0742 0.0000 0.0000 0.0000 208 PHE A CA    
1559 C C     . PHE A 211 ? 1.1776 1.1346 1.0777 0.0000 0.0000 0.0000 208 PHE A C     
1560 O O     . PHE A 211 ? 1.1829 1.1535 1.1013 0.0000 0.0000 0.0000 208 PHE A O     
1561 C CB    . PHE A 211 ? 1.2221 1.1269 1.0820 0.0000 0.0000 0.0000 208 PHE A CB    
1562 C CG    . PHE A 211 ? 1.2344 1.1199 1.0742 0.0000 0.0000 0.0000 208 PHE A CG    
1563 C CD1   . PHE A 211 ? 1.2318 1.1009 1.0540 0.0000 0.0000 0.0000 208 PHE A CD1   
1564 C CD2   . PHE A 211 ? 1.2484 1.1311 1.0867 0.0000 0.0000 0.0000 208 PHE A CD2   
1565 C CE1   . PHE A 211 ? 1.2459 1.0959 1.0496 0.0000 0.0000 0.0000 208 PHE A CE1   
1566 C CE2   . PHE A 211 ? 1.2738 1.1348 1.0901 0.0000 0.0000 0.0000 208 PHE A CE2   
1567 C CZ    . PHE A 211 ? 1.2708 1.1150 1.0698 0.0000 0.0000 0.0000 208 PHE A CZ    
1568 N N     . SER A 212 ? 1.1628 1.1145 1.0561 0.0000 0.0000 0.0000 209 SER A N     
1569 C CA    . SER A 212 ? 1.1531 1.1057 1.0524 0.0000 0.0000 0.0000 209 SER A CA    
1570 C C     . SER A 212 ? 1.1762 1.1012 1.0631 0.0000 0.0000 0.0000 209 SER A C     
1571 O O     . SER A 212 ? 1.2007 1.0963 1.0659 0.0000 0.0000 0.0000 209 SER A O     
1572 C CB    . SER A 212 ? 1.1441 1.0871 1.0301 0.0000 0.0000 0.0000 209 SER A CB    
1573 O OG    . SER A 212 ? 1.1277 1.0880 1.0190 0.0000 0.0000 0.0000 209 SER A OG    
1574 N N     . THR A 213 ? 1.1698 1.1024 1.0697 0.0000 0.0000 0.0000 210 THR A N     
1575 C CA    . THR A 213 ? 1.1921 1.0960 1.0775 0.0000 0.0000 0.0000 210 THR A CA    
1576 C C     . THR A 213 ? 1.2038 1.0713 1.0548 0.0000 0.0000 0.0000 210 THR A C     
1577 O O     . THR A 213 ? 1.1903 1.0622 1.0363 0.0000 0.0000 0.0000 210 THR A O     
1578 C CB    . THR A 213 ? 1.1876 1.1054 1.0908 0.0000 0.0000 0.0000 210 THR A CB    
1579 O OG1   . THR A 213 ? 1.1743 1.1101 1.0853 0.0000 0.0000 0.0000 210 THR A OG1   
1580 C CG2   . THR A 213 ? 1.1803 1.1292 1.1174 0.0000 0.0000 0.0000 210 THR A CG2   
1581 N N     . PRO A 214 ? 1.2311 1.0626 1.0585 0.0000 0.0000 0.0000 211 PRO A N     
1582 C CA    . PRO A 214 ? 1.2442 1.0425 1.0393 0.0000 0.0000 0.0000 211 PRO A CA    
1583 C C     . PRO A 214 ? 1.2400 1.0347 1.0257 0.0000 0.0000 0.0000 211 PRO A C     
1584 O O     . PRO A 214 ? 1.2374 1.0395 1.0317 0.0000 0.0000 0.0000 211 PRO A O     
1585 C CB    . PRO A 214 ? 1.2795 1.0402 1.0524 0.0000 0.0000 0.0000 211 PRO A CB    
1586 C CG    . PRO A 214 ? 1.2820 1.0545 1.0740 0.0000 0.0000 0.0000 211 PRO A CG    
1587 C CD    . PRO A 214 ? 1.2544 1.0734 1.0833 0.0000 0.0000 0.0000 211 PRO A CD    
1588 N N     . TYR A 215 ? 1.2409 1.0251 1.0100 0.0000 0.0000 0.0000 212 TYR A N     
1589 C CA    . TYR A 215 ? 1.2446 1.0221 1.0004 0.0000 0.0000 0.0000 212 TYR A CA    
1590 C C     . TYR A 215 ? 1.2237 1.0304 1.0013 0.0000 0.0000 0.0000 212 TYR A C     
1591 O O     . TYR A 215 ? 1.2371 1.0338 1.0053 0.0000 0.0000 0.0000 212 TYR A O     
1592 C CB    . TYR A 215 ? 1.2805 1.0188 1.0043 0.0000 0.0000 0.0000 212 TYR A CB    
1593 C CG    . TYR A 215 ? 1.3024 1.0087 1.0023 0.0000 0.0000 0.0000 212 TYR A CG    
1594 C CD1   . TYR A 215 ? 1.3140 1.0034 0.9932 0.0000 0.0000 0.0000 212 TYR A CD1   
1595 C CD2   . TYR A 215 ? 1.3173 1.0097 1.0158 0.0000 0.0000 0.0000 212 TYR A CD2   
1596 C CE1   . TYR A 215 ? 1.3477 1.0073 1.0057 0.0000 0.0000 0.0000 212 TYR A CE1   
1597 C CE2   . TYR A 215 ? 1.3565 1.0163 1.0316 0.0000 0.0000 0.0000 212 TYR A CE2   
1598 C CZ    . TYR A 215 ? 1.3677 1.0112 1.0227 0.0000 0.0000 0.0000 212 TYR A CZ    
1599 O OH    . TYR A 215 ? 1.3993 1.0102 1.0322 0.0000 0.0000 0.0000 212 TYR A OH    
1600 N N     . HIS A 216 ? 1.1918 1.0323 0.9963 0.0000 0.0000 0.0000 213 HIS A N     
1601 C CA    . HIS A 216 ? 1.1671 1.0365 0.9941 0.0000 0.0000 0.0000 213 HIS A CA    
1602 C C     . HIS A 216 ? 1.1441 1.0372 0.9848 0.0000 0.0000 0.0000 213 HIS A C     
1603 O O     . HIS A 216 ? 1.1281 1.0469 0.9912 0.0000 0.0000 0.0000 213 HIS A O     
1604 C CB    . HIS A 216 ? 1.1590 1.0498 1.0123 0.0000 0.0000 0.0000 213 HIS A CB    
1605 C CG    . HIS A 216 ? 1.1330 1.0462 1.0059 0.0000 0.0000 0.0000 213 HIS A CG    
1606 N ND1   . HIS A 216 ? 1.1019 1.0522 1.0064 0.0000 0.0000 0.0000 213 HIS A ND1   
1607 C CD2   . HIS A 216 ? 1.1351 1.0371 0.9987 0.0000 0.0000 0.0000 213 HIS A CD2   
1608 C CE1   . HIS A 216 ? 1.0959 1.0574 1.0118 0.0000 0.0000 0.0000 213 HIS A CE1   
1609 N NE2   . HIS A 216 ? 1.1128 1.0450 1.0040 0.0000 0.0000 0.0000 213 HIS A NE2   
1610 N N     . PRO A 217 ? 1.1476 1.0319 0.9743 0.0000 0.0000 0.0000 214 PRO A N     
1611 C CA    . PRO A 217 ? 1.1286 1.0337 0.9674 0.0000 0.0000 0.0000 214 PRO A CA    
1612 C C     . PRO A 217 ? 1.1115 1.0475 0.9754 0.0000 0.0000 0.0000 214 PRO A C     
1613 O O     . PRO A 217 ? 1.0937 1.0503 0.9714 0.0000 0.0000 0.0000 214 PRO A O     
1614 C CB    . PRO A 217 ? 1.1314 1.0185 0.9500 0.0000 0.0000 0.0000 214 PRO A CB    
1615 C CG    . PRO A 217 ? 1.1642 1.0181 0.9567 0.0000 0.0000 0.0000 214 PRO A CG    
1616 C CD    . PRO A 217 ? 1.1728 1.0253 0.9696 0.0000 0.0000 0.0000 214 PRO A CD    
1617 N N     . GLN A 218 ? 1.1231 1.0614 0.9923 0.0000 0.0000 0.0000 215 GLN A N     
1618 C CA    . GLN A 218 ? 1.1187 1.0861 1.0135 0.0000 0.0000 0.0000 215 GLN A CA    
1619 C C     . GLN A 218 ? 1.1042 1.1010 1.0244 0.0000 0.0000 0.0000 215 GLN A C     
1620 O O     . GLN A 218 ? 1.0870 1.1084 1.0256 0.0000 0.0000 0.0000 215 GLN A O     
1621 C CB    . GLN A 218 ? 1.1345 1.0990 1.0328 0.0000 0.0000 0.0000 215 GLN A CB    
1622 C CG    . GLN A 218 ? 1.1903 1.1283 1.0634 0.0000 0.0000 0.0000 215 GLN A CG    
1623 C CD    . GLN A 218 ? 1.2734 1.1772 1.1178 0.0000 0.0000 0.0000 215 GLN A CD    
1624 O OE1   . GLN A 218 ? 1.3074 1.1972 1.1383 0.0000 0.0000 0.0000 215 GLN A OE1   
1625 N NE2   . GLN A 218 ? 1.2966 1.1852 1.1303 0.0000 0.0000 0.0000 215 GLN A NE2   
1626 N N     . SER A 219 ? 1.1160 1.1081 1.0352 0.0000 0.0000 0.0000 216 SER A N     
1627 C CA    . SER A 219 ? 1.1022 1.1183 1.0411 0.0000 0.0000 0.0000 216 SER A CA    
1628 C C     . SER A 219 ? 1.0930 1.1152 1.0282 0.0000 0.0000 0.0000 216 SER A C     
1629 O O     . SER A 219 ? 1.0838 1.1305 1.0354 0.0000 0.0000 0.0000 216 SER A O     
1630 C CB    . SER A 219 ? 1.1220 1.1258 1.0565 0.0000 0.0000 0.0000 216 SER A CB    
1631 O OG    . SER A 219 ? 1.1388 1.1274 1.0687 0.0000 0.0000 0.0000 216 SER A OG    
1632 N N     . SER A 220 ? 1.1011 1.1012 1.0149 0.0000 0.0000 0.0000 217 SER A N     
1633 C CA    . SER A 220 ? 1.0919 1.0971 1.0025 0.0000 0.0000 0.0000 217 SER A CA    
1634 C C     . SER A 220 ? 1.0711 1.0865 0.9869 0.0000 0.0000 0.0000 217 SER A C     
1635 O O     . SER A 220 ? 1.0622 1.0769 0.9729 0.0000 0.0000 0.0000 217 SER A O     
1636 C CB    . SER A 220 ? 1.1114 1.0895 0.9998 0.0000 0.0000 0.0000 217 SER A CB    
1637 O OG    . SER A 220 ? 1.1472 1.1128 1.0290 0.0000 0.0000 0.0000 217 SER A OG    
1638 N N     . GLY A 221 ? 1.0628 1.0874 0.9893 0.0000 0.0000 0.0000 218 GLY A N     
1639 C CA    . GLY A 221 ? 1.0490 1.0761 0.9766 0.0000 0.0000 0.0000 218 GLY A CA    
1640 C C     . GLY A 221 ? 1.0316 1.0742 0.9664 0.0000 0.0000 0.0000 218 GLY A C     
1641 O O     . GLY A 221 ? 1.0293 1.0651 0.9573 0.0000 0.0000 0.0000 218 GLY A O     
1642 N N     . LYS A 222 ? 1.0201 1.0828 0.9674 0.0000 0.0000 0.0000 219 LYS A N     
1643 C CA    . LYS A 222 ? 1.0030 1.0795 0.9553 0.0000 0.0000 0.0000 219 LYS A CA    
1644 C C     . LYS A 222 ? 1.0058 1.0686 0.9442 0.0000 0.0000 0.0000 219 LYS A C     
1645 O O     . LYS A 222 ? 1.0017 1.0655 0.9403 0.0000 0.0000 0.0000 219 LYS A O     
1646 C CB    . LYS A 222 ? 0.9944 1.0927 0.9587 0.0000 0.0000 0.0000 219 LYS A CB    
1647 C CG    . LYS A 222 ? 0.9871 1.1069 0.9700 0.0000 0.0000 0.0000 219 LYS A CG    
1648 C CD    . LYS A 222 ? 1.0002 1.1411 0.9909 0.0000 0.0000 0.0000 219 LYS A CD    
1649 C CE    . LYS A 222 ? 0.9977 1.1546 1.0006 0.0000 0.0000 0.0000 219 LYS A CE    
1650 N NZ    . LYS A 222 ? 0.9922 1.1670 1.0152 0.0000 0.0000 0.0000 219 LYS A NZ    
1651 N N     . VAL A 223 ? 1.0157 1.0652 0.9430 0.0000 0.0000 0.0000 220 VAL A N     
1652 C CA    . VAL A 223 ? 1.0213 1.0577 0.9374 0.0000 0.0000 0.0000 220 VAL A CA    
1653 C C     . VAL A 223 ? 1.0280 1.0492 0.9361 0.0000 0.0000 0.0000 220 VAL A C     
1654 O O     . VAL A 223 ? 1.0249 1.0473 0.9335 0.0000 0.0000 0.0000 220 VAL A O     
1655 C CB    . VAL A 223 ? 1.0386 1.0576 0.9418 0.0000 0.0000 0.0000 220 VAL A CB    
1656 C CG1   . VAL A 223 ? 1.0382 1.0547 0.9372 0.0000 0.0000 0.0000 220 VAL A CG1   
1657 C CG2   . VAL A 223 ? 1.0468 1.0711 0.9525 0.0000 0.0000 0.0000 220 VAL A CG2   
1658 N N     . GLU A 224 ? 1.0388 1.0451 0.9385 0.0000 0.0000 0.0000 221 GLU A N     
1659 C CA    . GLU A 224 ? 1.0472 1.0338 0.9328 0.0000 0.0000 0.0000 221 GLU A CA    
1660 C C     . GLU A 224 ? 1.0317 1.0262 0.9230 0.0000 0.0000 0.0000 221 GLU A C     
1661 O O     . GLU A 224 ? 1.0351 1.0209 0.9190 0.0000 0.0000 0.0000 221 GLU A O     
1662 C CB    . GLU A 224 ? 1.0645 1.0346 0.9397 0.0000 0.0000 0.0000 221 GLU A CB    
1663 C CG    . GLU A 224 ? 1.0970 1.0532 0.9632 0.0000 0.0000 0.0000 221 GLU A CG    
1664 C CD    . GLU A 224 ? 1.1366 1.0721 0.9859 0.0000 0.0000 0.0000 221 GLU A CD    
1665 O OE1   . GLU A 224 ? 1.1556 1.0800 0.9944 0.0000 0.0000 0.0000 221 GLU A OE1   
1666 O OE2   . GLU A 224 ? 1.1704 1.1000 1.0165 0.0000 0.0000 0.0000 221 GLU A OE2   
1667 N N     . ARG A 225 ? 1.0108 1.0219 0.9157 0.0000 0.0000 0.0000 222 ARG A N     
1668 C CA    . ARG A 225 ? 0.9946 1.0124 0.9052 0.0000 0.0000 0.0000 222 ARG A CA    
1669 C C     . ARG A 225 ? 0.9848 1.0133 0.9022 0.0000 0.0000 0.0000 222 ARG A C     
1670 O O     . ARG A 225 ? 0.9815 1.0072 0.8977 0.0000 0.0000 0.0000 222 ARG A O     
1671 C CB    . ARG A 225 ? 0.9822 1.0161 0.9074 0.0000 0.0000 0.0000 222 ARG A CB    
1672 C CG    . ARG A 225 ? 0.9601 0.9964 0.8890 0.0000 0.0000 0.0000 222 ARG A CG    
1673 C CD    . ARG A 225 ? 0.9537 0.9660 0.8645 0.0000 0.0000 0.0000 222 ARG A CD    
1674 N NE    . ARG A 225 ? 0.9438 0.9553 0.8565 0.0000 0.0000 0.0000 222 ARG A NE    
1675 C CZ    . ARG A 225 ? 0.9355 0.9516 0.8520 0.0000 0.0000 0.0000 222 ARG A CZ    
1676 N NH1   . ARG A 225 ? 0.9156 0.9391 0.8357 0.0000 0.0000 0.0000 222 ARG A NH1   
1677 N NH2   . ARG A 225 ? 0.9504 0.9628 0.8674 0.0000 0.0000 0.0000 222 ARG A NH2   
1678 N N     . LYS A 226 ? 0.9823 1.0223 0.9061 0.0000 0.0000 0.0000 223 LYS A N     
1679 C CA    . LYS A 226 ? 0.9800 1.0305 0.9104 0.0000 0.0000 0.0000 223 LYS A CA    
1680 C C     . LYS A 226 ? 0.9892 1.0267 0.9115 0.0000 0.0000 0.0000 223 LYS A C     
1681 O O     . LYS A 226 ? 0.9856 1.0290 0.9140 0.0000 0.0000 0.0000 223 LYS A O     
1682 C CB    . LYS A 226 ? 0.9774 1.0418 0.9138 0.0000 0.0000 0.0000 223 LYS A CB    
1683 C CG    . LYS A 226 ? 0.9815 1.0590 0.9251 0.0000 0.0000 0.0000 223 LYS A CG    
1684 C CD    . LYS A 226 ? 1.0006 1.0905 0.9541 0.0000 0.0000 0.0000 223 LYS A CD    
1685 C CE    . LYS A 226 ? 1.0142 1.1168 0.9733 0.0000 0.0000 0.0000 223 LYS A CE    
1686 N NZ    . LYS A 226 ? 1.0189 1.1327 0.9863 0.0000 0.0000 0.0000 223 LYS A NZ    
1687 N N     . ASN A 227 ? 1.0051 1.0253 0.9145 0.0000 0.0000 0.0000 224 ASN A N     
1688 C CA    . ASN A 227 ? 1.0224 1.0285 0.9228 0.0000 0.0000 0.0000 224 ASN A CA    
1689 C C     . ASN A 227 ? 1.0263 1.0297 0.9260 0.0000 0.0000 0.0000 224 ASN A C     
1690 O O     . ASN A 227 ? 1.0275 1.0356 0.9331 0.0000 0.0000 0.0000 224 ASN A O     
1691 C CB    . ASN A 227 ? 1.0417 1.0255 0.9248 0.0000 0.0000 0.0000 224 ASN A CB    
1692 C CG    . ASN A 227 ? 1.0575 1.0396 0.9393 0.0000 0.0000 0.0000 224 ASN A CG    
1693 O OD1   . ASN A 227 ? 1.0530 1.0475 0.9439 0.0000 0.0000 0.0000 224 ASN A OD1   
1694 N ND2   . ASN A 227 ? 1.0874 1.0522 0.9564 0.0000 0.0000 0.0000 224 ASN A ND2   
1695 N N     . SER A 228 ? 1.0337 1.0301 0.9269 0.0000 0.0000 0.0000 225 SER A N     
1696 C CA    . SER A 228 ? 1.0388 1.0289 0.9275 0.0000 0.0000 0.0000 225 SER A CA    
1697 C C     . SER A 228 ? 1.0238 1.0315 0.9292 0.0000 0.0000 0.0000 225 SER A C     
1698 O O     . SER A 228 ? 1.0316 1.0377 0.9375 0.0000 0.0000 0.0000 225 SER A O     
1699 C CB    . SER A 228 ? 1.0442 1.0268 0.9263 0.0000 0.0000 0.0000 225 SER A CB    
1700 O OG    . SER A 228 ? 1.0682 1.0401 0.9418 0.0000 0.0000 0.0000 225 SER A OG    
1701 N N     . ASP A 229 ? 1.0076 1.0326 0.9269 0.0000 0.0000 0.0000 226 ASP A N     
1702 C CA    . ASP A 229 ? 0.9993 1.0396 0.9333 0.0000 0.0000 0.0000 226 ASP A CA    
1703 C C     . ASP A 229 ? 0.9837 1.0342 0.9279 0.0000 0.0000 0.0000 226 ASP A C     
1704 O O     . ASP A 229 ? 0.9793 1.0352 0.9320 0.0000 0.0000 0.0000 226 ASP A O     
1705 C CB    . ASP A 229 ? 0.9970 1.0523 0.9413 0.0000 0.0000 0.0000 226 ASP A CB    
1706 C CG    . ASP A 229 ? 1.0357 1.0841 0.9754 0.0000 0.0000 0.0000 226 ASP A CG    
1707 O OD1   . ASP A 229 ? 1.0794 1.1103 1.0069 0.0000 0.0000 0.0000 226 ASP A OD1   
1708 O OD2   . ASP A 229 ? 1.0714 1.1315 1.0191 0.0000 0.0000 0.0000 226 ASP A OD2   
1709 N N     . ILE A 230 ? 0.9724 1.0254 0.9165 0.0000 0.0000 0.0000 227 ILE A N     
1710 C CA    . ILE A 230 ? 0.9621 1.0217 0.9143 0.0000 0.0000 0.0000 227 ILE A CA    
1711 C C     . ILE A 230 ? 0.9672 1.0184 0.9175 0.0000 0.0000 0.0000 227 ILE A C     
1712 O O     . ILE A 230 ? 0.9679 1.0312 0.9330 0.0000 0.0000 0.0000 227 ILE A O     
1713 C CB    . ILE A 230 ? 0.9640 1.0181 0.9094 0.0000 0.0000 0.0000 227 ILE A CB    
1714 C CG1   . ILE A 230 ? 0.9523 1.0155 0.8990 0.0000 0.0000 0.0000 227 ILE A CG1   
1715 C CG2   . ILE A 230 ? 0.9618 1.0209 0.9155 0.0000 0.0000 0.0000 227 ILE A CG2   
1716 C CD1   . ILE A 230 ? 0.9608 1.0142 0.8968 0.0000 0.0000 0.0000 227 ILE A CD1   
1717 N N     . LYS A 231 ? 0.9664 0.9975 0.8985 0.0000 0.0000 0.0000 228 LYS A N     
1718 C CA    . LYS A 231 ? 0.9669 0.9875 0.8927 0.0000 0.0000 0.0000 228 LYS A CA    
1719 C C     . LYS A 231 ? 0.9658 0.9901 0.8965 0.0000 0.0000 0.0000 228 LYS A C     
1720 O O     . LYS A 231 ? 0.9670 0.9983 0.9077 0.0000 0.0000 0.0000 228 LYS A O     
1721 C CB    . LYS A 231 ? 0.9796 0.9750 0.8808 0.0000 0.0000 0.0000 228 LYS A CB    
1722 C CG    . LYS A 231 ? 0.9766 0.9642 0.8724 0.0000 0.0000 0.0000 228 LYS A CG    
1723 C CD    . LYS A 231 ? 1.0037 0.9642 0.8735 0.0000 0.0000 0.0000 228 LYS A CD    
1724 C CE    . LYS A 231 ? 1.0236 0.9708 0.8845 0.0000 0.0000 0.0000 228 LYS A CE    
1725 N NZ    . LYS A 231 ? 1.0601 0.9795 0.8935 0.0000 0.0000 0.0000 228 LYS A NZ    
1726 N N     . ARG A 232 ? 0.9618 0.9818 0.8866 0.0000 0.0000 0.0000 229 ARG A N     
1727 C CA    . ARG A 232 ? 0.9658 0.9837 0.8909 0.0000 0.0000 0.0000 229 ARG A CA    
1728 C C     . ARG A 232 ? 0.9498 0.9902 0.8998 0.0000 0.0000 0.0000 229 ARG A C     
1729 O O     . ARG A 232 ? 0.9567 0.9977 0.9111 0.0000 0.0000 0.0000 229 ARG A O     
1730 C CB    . ARG A 232 ? 0.9689 0.9764 0.8830 0.0000 0.0000 0.0000 229 ARG A CB    
1731 C CG    . ARG A 232 ? 0.9889 0.9892 0.8997 0.0000 0.0000 0.0000 229 ARG A CG    
1732 C CD    . ARG A 232 ? 1.0292 1.0143 0.9256 0.0000 0.0000 0.0000 229 ARG A CD    
1733 N NE    . ARG A 232 ? 1.0332 1.0331 0.9425 0.0000 0.0000 0.0000 229 ARG A NE    
1734 C CZ    . ARG A 232 ? 1.0381 1.0430 0.9550 0.0000 0.0000 0.0000 229 ARG A CZ    
1735 N NH1   . ARG A 232 ? 1.0484 1.0430 0.9609 0.0000 0.0000 0.0000 229 ARG A NH1   
1736 N NH2   . ARG A 232 ? 1.0333 1.0523 0.9611 0.0000 0.0000 0.0000 229 ARG A NH2   
1737 N N     . LEU A 233 ? 0.9297 0.9877 0.8949 0.0000 0.0000 0.0000 230 LEU A N     
1738 C CA    . LEU A 233 ? 0.9142 0.9934 0.9026 0.0000 0.0000 0.0000 230 LEU A CA    
1739 C C     . LEU A 233 ? 0.9128 1.0031 0.9158 0.0000 0.0000 0.0000 230 LEU A C     
1740 O O     . LEU A 233 ? 0.9151 1.0166 0.9342 0.0000 0.0000 0.0000 230 LEU A O     
1741 C CB    . LEU A 233 ? 0.9008 0.9933 0.8973 0.0000 0.0000 0.0000 230 LEU A CB    
1742 C CG    . LEU A 233 ? 0.8831 0.9960 0.9007 0.0000 0.0000 0.0000 230 LEU A CG    
1743 C CD1   . LEU A 233 ? 0.8844 0.9975 0.9083 0.0000 0.0000 0.0000 230 LEU A CD1   
1744 C CD2   . LEU A 233 ? 0.8793 0.9992 0.8960 0.0000 0.0000 0.0000 230 LEU A CD2   
1745 N N     . LEU A 234 ? 0.9066 0.9939 0.9051 0.0000 0.0000 0.0000 231 LEU A N     
1746 C CA    . LEU A 234 ? 0.9038 0.9988 0.9145 0.0000 0.0000 0.0000 231 LEU A CA    
1747 C C     . LEU A 234 ? 0.9169 1.0073 0.9272 0.0000 0.0000 0.0000 231 LEU A C     
1748 O O     . LEU A 234 ? 0.9159 1.0232 0.9480 0.0000 0.0000 0.0000 231 LEU A O     
1749 C CB    . LEU A 234 ? 0.9056 0.9880 0.9027 0.0000 0.0000 0.0000 231 LEU A CB    
1750 C CG    . LEU A 234 ? 0.8874 0.9780 0.8902 0.0000 0.0000 0.0000 231 LEU A CG    
1751 C CD1   . LEU A 234 ? 0.8835 0.9553 0.8670 0.0000 0.0000 0.0000 231 LEU A CD1   
1752 C CD2   . LEU A 234 ? 0.8756 0.9866 0.9032 0.0000 0.0000 0.0000 231 LEU A CD2   
1753 N N     . THR A 235 ? 0.9298 0.9971 0.9147 0.0000 0.0000 0.0000 232 THR A N     
1754 C CA    . THR A 235 ? 0.9451 1.0022 0.9216 0.0000 0.0000 0.0000 232 THR A CA    
1755 C C     . THR A 235 ? 0.9432 1.0153 0.9388 0.0000 0.0000 0.0000 232 THR A C     
1756 O O     . THR A 235 ? 0.9514 1.0332 0.9604 0.0000 0.0000 0.0000 232 THR A O     
1757 C CB    . THR A 235 ? 0.9575 0.9854 0.9008 0.0000 0.0000 0.0000 232 THR A CB    
1758 O OG1   . THR A 235 ? 0.9602 0.9737 0.8866 0.0000 0.0000 0.0000 232 THR A OG1   
1759 C CG2   . THR A 235 ? 0.9785 0.9928 0.9084 0.0000 0.0000 0.0000 232 THR A CG2   
1760 N N     . LYS A 236 ? 0.9345 1.0086 0.9320 0.0000 0.0000 0.0000 233 LYS A N     
1761 C CA    . LYS A 236 ? 0.9356 1.0183 0.9466 0.0000 0.0000 0.0000 233 LYS A CA    
1762 C C     . LYS A 236 ? 0.9311 1.0430 0.9765 0.0000 0.0000 0.0000 233 LYS A C     
1763 O O     . LYS A 236 ? 0.9384 1.0593 0.9987 0.0000 0.0000 0.0000 233 LYS A O     
1764 C CB    . LYS A 236 ? 0.9245 1.0017 0.9294 0.0000 0.0000 0.0000 233 LYS A CB    
1765 C CG    . LYS A 236 ? 0.9352 0.9845 0.9100 0.0000 0.0000 0.0000 233 LYS A CG    
1766 C CD    . LYS A 236 ? 0.9321 0.9781 0.9058 0.0000 0.0000 0.0000 233 LYS A CD    
1767 C CE    . LYS A 236 ? 0.9266 0.9500 0.8751 0.0000 0.0000 0.0000 233 LYS A CE    
1768 N NZ    . LYS A 236 ? 0.9090 0.9402 0.8638 0.0000 0.0000 0.0000 233 LYS A NZ    
1769 N N     . LEU A 237 ? 0.9242 1.0507 0.9821 0.0000 0.0000 0.0000 234 LEU A N     
1770 C CA    . LEU A 237 ? 0.9226 1.0767 1.0130 0.0000 0.0000 0.0000 234 LEU A CA    
1771 C C     . LEU A 237 ? 0.9412 1.1039 1.0445 0.0000 0.0000 0.0000 234 LEU A C     
1772 O O     . LEU A 237 ? 0.9449 1.1305 1.0778 0.0000 0.0000 0.0000 234 LEU A O     
1773 C CB    . LEU A 237 ? 0.9058 1.0690 1.0011 0.0000 0.0000 0.0000 234 LEU A CB    
1774 C CG    . LEU A 237 ? 0.8971 1.0542 0.9807 0.0000 0.0000 0.0000 234 LEU A CG    
1775 C CD1   . LEU A 237 ? 0.9011 1.0636 0.9836 0.0000 0.0000 0.0000 234 LEU A CD1   
1776 C CD2   . LEU A 237 ? 0.8872 1.0550 0.9861 0.0000 0.0000 0.0000 234 LEU A CD2   
1777 N N     . LEU A 238 ? 0.9634 1.1081 1.0453 0.0000 0.0000 0.0000 235 LEU A N     
1778 C CA    . LEU A 238 ? 0.9839 1.1347 1.0754 0.0000 0.0000 0.0000 235 LEU A CA    
1779 C C     . LEU A 238 ? 1.0138 1.1597 1.1019 0.0000 0.0000 0.0000 235 LEU A C     
1780 O O     . LEU A 238 ? 1.0267 1.1798 1.1244 0.0000 0.0000 0.0000 235 LEU A O     
1781 C CB    . LEU A 238 ? 0.9874 1.1203 1.0574 0.0000 0.0000 0.0000 235 LEU A CB    
1782 C CG    . LEU A 238 ? 0.9685 1.1110 1.0486 0.0000 0.0000 0.0000 235 LEU A CG    
1783 C CD1   . LEU A 238 ? 0.9829 1.1034 1.0387 0.0000 0.0000 0.0000 235 LEU A CD1   
1784 C CD2   . LEU A 238 ? 0.9557 1.1275 1.0726 0.0000 0.0000 0.0000 235 LEU A CD2   
1785 N N     . VAL A 239 ? 1.0344 1.1673 1.1081 0.0000 0.0000 0.0000 236 VAL A N     
1786 C CA    . VAL A 239 ? 1.0670 1.1920 1.1335 0.0000 0.0000 0.0000 236 VAL A CA    
1787 C C     . VAL A 239 ? 1.0760 1.2330 1.1824 0.0000 0.0000 0.0000 236 VAL A C     
1788 O O     . VAL A 239 ? 1.0617 1.2439 1.1994 0.0000 0.0000 0.0000 236 VAL A O     
1789 C CB    . VAL A 239 ? 1.0698 1.1765 1.1180 0.0000 0.0000 0.0000 236 VAL A CB    
1790 C CG1   . VAL A 239 ? 1.0957 1.1861 1.1262 0.0000 0.0000 0.0000 236 VAL A CG1   
1791 C CG2   . VAL A 239 ? 1.0694 1.1513 1.0869 0.0000 0.0000 0.0000 236 VAL A CG2   
1792 N N     . GLY A 240 ? 1.1066 1.2635 1.2124 0.0000 0.0000 0.0000 237 GLY A N     
1793 C CA    . GLY A 240 ? 1.1242 1.3146 1.2712 0.0000 0.0000 0.0000 237 GLY A CA    
1794 C C     . GLY A 240 ? 1.1290 1.3410 1.3009 0.0000 0.0000 0.0000 237 GLY A C     
1795 O O     . GLY A 240 ? 1.1461 1.3659 1.3264 0.0000 0.0000 0.0000 237 GLY A O     
1796 N N     . ARG A 241 ? 1.1237 1.3436 1.3053 0.0000 0.0000 0.0000 238 ARG A N     
1797 C CA    . ARG A 241 ? 1.1280 1.3658 1.3317 0.0000 0.0000 0.0000 238 ARG A CA    
1798 C C     . ARG A 241 ? 1.1440 1.3599 1.3213 0.0000 0.0000 0.0000 238 ARG A C     
1799 O O     . ARG A 241 ? 1.1556 1.3399 1.2935 0.0000 0.0000 0.0000 238 ARG A O     
1800 C CB    . ARG A 241 ? 1.1097 1.3541 1.3206 0.0000 0.0000 0.0000 238 ARG A CB    
1801 C CG    . ARG A 241 ? 1.1176 1.3943 1.3688 0.0000 0.0000 0.0000 238 ARG A CG    
1802 C CD    . ARG A 241 ? 1.1525 1.4212 1.3923 0.0000 0.0000 0.0000 238 ARG A CD    
1803 N NE    . ARG A 241 ? 1.1955 1.4819 1.4600 0.0000 0.0000 0.0000 238 ARG A NE    
1804 C CZ    . ARG A 241 ? 1.2118 1.4868 1.4638 0.0000 0.0000 0.0000 238 ARG A CZ    
1805 N NH1   . ARG A 241 ? 1.2135 1.4618 1.4302 0.0000 0.0000 0.0000 238 ARG A NH1   
1806 N NH2   . ARG A 241 ? 1.2150 1.5059 1.4911 0.0000 0.0000 0.0000 238 ARG A NH2   
1807 N N     . PRO A 242 ? 1.1487 1.3804 1.3479 0.0000 0.0000 0.0000 239 PRO A N     
1808 C CA    . PRO A 242 ? 1.1658 1.3745 1.3397 0.0000 0.0000 0.0000 239 PRO A CA    
1809 C C     . PRO A 242 ? 1.1589 1.3506 1.3120 0.0000 0.0000 0.0000 239 PRO A C     
1810 O O     . PRO A 242 ? 1.1430 1.3481 1.3100 0.0000 0.0000 0.0000 239 PRO A O     
1811 C CB    . PRO A 242 ? 1.1660 1.4005 1.3759 0.0000 0.0000 0.0000 239 PRO A CB    
1812 C CG    . PRO A 242 ? 1.1611 1.4316 1.4132 0.0000 0.0000 0.0000 239 PRO A CG    
1813 C CD    . PRO A 242 ? 1.1423 1.4131 1.3911 0.0000 0.0000 0.0000 239 PRO A CD    
1814 N N     . THR A 243 ? 1.1751 1.3373 1.2949 0.0000 0.0000 0.0000 240 THR A N     
1815 C CA    . THR A 243 ? 1.1691 1.3107 1.2631 0.0000 0.0000 0.0000 240 THR A CA    
1816 C C     . THR A 243 ? 1.1621 1.3129 1.2693 0.0000 0.0000 0.0000 240 THR A C     
1817 O O     . THR A 243 ? 1.1702 1.3011 1.2577 0.0000 0.0000 0.0000 240 THR A O     
1818 C CB    . THR A 243 ? 1.1874 1.2925 1.2397 0.0000 0.0000 0.0000 240 THR A CB    
1819 O OG1   . THR A 243 ? 1.2013 1.2997 1.2525 0.0000 0.0000 0.0000 240 THR A OG1   
1820 C CG2   . THR A 243 ? 1.1910 1.2818 1.2225 0.0000 0.0000 0.0000 240 THR A CG2   
1821 N N     . LYS A 244 ? 1.1518 1.3307 1.2903 0.0000 0.0000 0.0000 241 LYS A N     
1822 C CA    . LYS A 244 ? 1.1509 1.3382 1.3004 0.0000 0.0000 0.0000 241 LYS A CA    
1823 C C     . LYS A 244 ? 1.1391 1.3136 1.2665 0.0000 0.0000 0.0000 241 LYS A C     
1824 O O     . LYS A 244 ? 1.1303 1.3201 1.2702 0.0000 0.0000 0.0000 241 LYS A O     
1825 C CB    . LYS A 244 ? 1.1445 1.3675 1.3370 0.0000 0.0000 0.0000 241 LYS A CB    
1826 C CG    . LYS A 244 ? 1.1665 1.4071 1.3872 0.0000 0.0000 0.0000 241 LYS A CG    
1827 C CD    . LYS A 244 ? 1.1799 1.4592 1.4468 0.0000 0.0000 0.0000 241 LYS A CD    
1828 C CE    . LYS A 244 ? 1.1987 1.4990 1.4970 0.0000 0.0000 0.0000 241 LYS A CE    
1829 N NZ    . LYS A 244 ? 1.2177 1.5206 1.5275 0.0000 0.0000 0.0000 241 LYS A NZ    
1830 N N     . TRP A 245 ? 1.1408 1.2876 1.2361 0.0000 0.0000 0.0000 242 TRP A N     
1831 C CA    . TRP A 245 ? 1.1267 1.2625 1.2018 0.0000 0.0000 0.0000 242 TRP A CA    
1832 C C     . TRP A 245 ? 1.1251 1.2624 1.1996 0.0000 0.0000 0.0000 242 TRP A C     
1833 O O     . TRP A 245 ? 1.1184 1.2535 1.1822 0.0000 0.0000 0.0000 242 TRP A O     
1834 C CB    . TRP A 245 ? 1.1340 1.2412 1.1761 0.0000 0.0000 0.0000 242 TRP A CB    
1835 C CG    . TRP A 245 ? 1.1441 1.2304 1.1699 0.0000 0.0000 0.0000 242 TRP A CG    
1836 C CD1   . TRP A 245 ? 1.1575 1.2326 1.1770 0.0000 0.0000 0.0000 242 TRP A CD1   
1837 C CD2   . TRP A 245 ? 1.1446 1.2162 1.1559 0.0000 0.0000 0.0000 242 TRP A CD2   
1838 N NE1   . TRP A 245 ? 1.1716 1.2253 1.1741 0.0000 0.0000 0.0000 242 TRP A NE1   
1839 C CE2   . TRP A 245 ? 1.1617 1.2126 1.1592 0.0000 0.0000 0.0000 242 TRP A CE2   
1840 C CE3   . TRP A 245 ? 1.1321 1.2047 1.1393 0.0000 0.0000 0.0000 242 TRP A CE3   
1841 C CZ2   . TRP A 245 ? 1.1697 1.1998 1.1500 0.0000 0.0000 0.0000 242 TRP A CZ2   
1842 C CZ3   . TRP A 245 ? 1.1383 1.1912 1.1280 0.0000 0.0000 0.0000 242 TRP A CZ3   
1843 C CH2   . TRP A 245 ? 1.1538 1.1852 1.1306 0.0000 0.0000 0.0000 242 TRP A CH2   
1844 N N     . TYR A 246 ? 1.1332 1.2733 1.2178 0.0000 0.0000 0.0000 243 TYR A N     
1845 C CA    . TYR A 246 ? 1.1364 1.2736 1.2159 0.0000 0.0000 0.0000 243 TYR A CA    
1846 C C     . TYR A 246 ? 1.1195 1.2766 1.2122 0.0000 0.0000 0.0000 243 TYR A C     
1847 O O     . TYR A 246 ? 1.1192 1.2685 1.1942 0.0000 0.0000 0.0000 243 TYR A O     
1848 C CB    . TYR A 246 ? 1.1535 1.2915 1.2449 0.0000 0.0000 0.0000 243 TYR A CB    
1849 C CG    . TYR A 246 ? 1.1781 1.3075 1.2590 0.0000 0.0000 0.0000 243 TYR A CG    
1850 C CD1   . TYR A 246 ? 1.2087 1.3085 1.2589 0.0000 0.0000 0.0000 243 TYR A CD1   
1851 C CD2   . TYR A 246 ? 1.1874 1.3367 1.2873 0.0000 0.0000 0.0000 243 TYR A CD2   
1852 C CE1   . TYR A 246 ? 1.2279 1.3171 1.2653 0.0000 0.0000 0.0000 243 TYR A CE1   
1853 C CE2   . TYR A 246 ? 1.2075 1.3459 1.2933 0.0000 0.0000 0.0000 243 TYR A CE2   
1854 C CZ    . TYR A 246 ? 1.2289 1.3367 1.2828 0.0000 0.0000 0.0000 243 TYR A CZ    
1855 O OH    . TYR A 246 ? 1.2529 1.3472 1.2898 0.0000 0.0000 0.0000 243 TYR A OH    
1856 N N     . ASP A 247 ? 1.1057 1.2886 1.2295 0.0000 0.0000 0.0000 244 ASP A N     
1857 C CA    . ASP A 247 ? 1.0875 1.2892 1.2251 0.0000 0.0000 0.0000 244 ASP A CA    
1858 C C     . ASP A 247 ? 1.0672 1.2645 1.1907 0.0000 0.0000 0.0000 244 ASP A C     
1859 O O     . ASP A 247 ? 1.0643 1.2701 1.1897 0.0000 0.0000 0.0000 244 ASP A O     
1860 C CB    . ASP A 247 ? 1.0862 1.3170 1.2627 0.0000 0.0000 0.0000 244 ASP A CB    
1861 C CG    . ASP A 247 ? 1.1080 1.3480 1.3048 0.0000 0.0000 0.0000 244 ASP A CG    
1862 O OD1   . ASP A 247 ? 1.1253 1.3585 1.3144 0.0000 0.0000 0.0000 244 ASP A OD1   
1863 O OD2   . ASP A 247 ? 1.1253 1.3791 1.3457 0.0000 0.0000 0.0000 244 ASP A OD2   
1864 N N     . LEU A 248 ? 1.0547 1.2381 1.1635 0.0000 0.0000 0.0000 245 LEU A N     
1865 C CA    . LEU A 248 ? 1.0361 1.2160 1.1345 0.0000 0.0000 0.0000 245 LEU A CA    
1866 C C     . LEU A 248 ? 1.0306 1.1941 1.1017 0.0000 0.0000 0.0000 245 LEU A C     
1867 O O     . LEU A 248 ? 1.0242 1.1903 1.0910 0.0000 0.0000 0.0000 245 LEU A O     
1868 C CB    . LEU A 248 ? 1.0358 1.2097 1.1325 0.0000 0.0000 0.0000 245 LEU A CB    
1869 C CG    . LEU A 248 ? 1.0315 1.2251 1.1566 0.0000 0.0000 0.0000 245 LEU A CG    
1870 C CD1   . LEU A 248 ? 1.0419 1.2251 1.1571 0.0000 0.0000 0.0000 245 LEU A CD1   
1871 C CD2   . LEU A 248 ? 1.0173 1.2331 1.1654 0.0000 0.0000 0.0000 245 LEU A CD2   
1872 N N     . LEU A 249 ? 1.0300 1.1770 1.0838 0.0000 0.0000 0.0000 246 LEU A N     
1873 C CA    . LEU A 249 ? 1.0202 1.1521 1.0493 0.0000 0.0000 0.0000 246 LEU A CA    
1874 C C     . LEU A 249 ? 1.0091 1.1501 1.0366 0.0000 0.0000 0.0000 246 LEU A C     
1875 O O     . LEU A 249 ? 1.0031 1.1412 1.0213 0.0000 0.0000 0.0000 246 LEU A O     
1876 C CB    . LEU A 249 ? 1.0329 1.1478 1.0466 0.0000 0.0000 0.0000 246 LEU A CB    
1877 C CG    . LEU A 249 ? 1.0386 1.1360 1.0429 0.0000 0.0000 0.0000 246 LEU A CG    
1878 C CD1   . LEU A 249 ? 1.0561 1.1347 1.0435 0.0000 0.0000 0.0000 246 LEU A CD1   
1879 C CD2   . LEU A 249 ? 1.0288 1.1166 1.0203 0.0000 0.0000 0.0000 246 LEU A CD2   
1880 N N     . PRO A 250 ? 1.0060 1.1577 1.0421 0.0000 0.0000 0.0000 247 PRO A N     
1881 C CA    . PRO A 250 ? 0.9983 1.1573 1.0300 0.0000 0.0000 0.0000 247 PRO A CA    
1882 C C     . PRO A 250 ? 0.9789 1.1469 1.0183 0.0000 0.0000 0.0000 247 PRO A C     
1883 O O     . PRO A 250 ? 0.9755 1.1387 1.0010 0.0000 0.0000 0.0000 247 PRO A O     
1884 C CB    . PRO A 250 ? 1.0042 1.1753 1.0503 0.0000 0.0000 0.0000 247 PRO A CB    
1885 C CG    . PRO A 250 ? 1.0143 1.1776 1.0620 0.0000 0.0000 0.0000 247 PRO A CG    
1886 C CD    . PRO A 250 ? 1.0098 1.1669 1.0596 0.0000 0.0000 0.0000 247 PRO A CD    
1887 N N     . VAL A 251 ? 0.9649 1.1450 1.0263 0.0000 0.0000 0.0000 248 VAL A N     
1888 C CA    . VAL A 251 ? 0.9492 1.1345 1.0174 0.0000 0.0000 0.0000 248 VAL A CA    
1889 C C     . VAL A 251 ? 0.9445 1.1150 0.9956 0.0000 0.0000 0.0000 248 VAL A C     
1890 O O     . VAL A 251 ? 0.9406 1.1096 0.9845 0.0000 0.0000 0.0000 248 VAL A O     
1891 C CB    . VAL A 251 ? 0.9441 1.1416 1.0374 0.0000 0.0000 0.0000 248 VAL A CB    
1892 C CG1   . VAL A 251 ? 0.9331 1.1396 1.0370 0.0000 0.0000 0.0000 248 VAL A CG1   
1893 C CG2   . VAL A 251 ? 0.9477 1.1581 1.0594 0.0000 0.0000 0.0000 248 VAL A CG2   
1894 N N     . VAL A 252 ? 0.9433 1.1024 0.9877 0.0000 0.0000 0.0000 249 VAL A N     
1895 C CA    . VAL A 252 ? 0.9403 1.0845 0.9681 0.0000 0.0000 0.0000 249 VAL A CA    
1896 C C     . VAL A 252 ? 0.9421 1.0826 0.9548 0.0000 0.0000 0.0000 249 VAL A C     
1897 O O     . VAL A 252 ? 0.9388 1.0787 0.9472 0.0000 0.0000 0.0000 249 VAL A O     
1898 C CB    . VAL A 252 ? 0.9475 1.0779 0.9673 0.0000 0.0000 0.0000 249 VAL A CB    
1899 C CG1   . VAL A 252 ? 0.9399 1.0545 0.9429 0.0000 0.0000 0.0000 249 VAL A CG1   
1900 C CG2   . VAL A 252 ? 0.9489 1.0851 0.9844 0.0000 0.0000 0.0000 249 VAL A CG2   
1901 N N     . GLN A 253 ? 0.9451 1.0829 0.9499 0.0000 0.0000 0.0000 250 GLN A N     
1902 C CA    . GLN A 253 ? 0.9462 1.0811 0.9361 0.0000 0.0000 0.0000 250 GLN A CA    
1903 C C     . GLN A 253 ? 0.9388 1.0840 0.9312 0.0000 0.0000 0.0000 250 GLN A C     
1904 O O     . GLN A 253 ? 0.9366 1.0802 0.9229 0.0000 0.0000 0.0000 250 GLN A O     
1905 C CB    . GLN A 253 ? 0.9592 1.0913 0.9416 0.0000 0.0000 0.0000 250 GLN A CB    
1906 C CG    . GLN A 253 ? 0.9771 1.1067 0.9427 0.0000 0.0000 0.0000 250 GLN A CG    
1907 C CD    . GLN A 253 ? 1.0099 1.1291 0.9622 0.0000 0.0000 0.0000 250 GLN A CD    
1908 O OE1   . GLN A 253 ? 1.0272 1.1327 0.9721 0.0000 0.0000 0.0000 250 GLN A OE1   
1909 N NE2   . GLN A 253 ? 1.0236 1.1467 0.9709 0.0000 0.0000 0.0000 250 GLN A NE2   
1910 N N     . LEU A 254 ? 0.9367 1.0926 0.9391 0.0000 0.0000 0.0000 251 LEU A N     
1911 C CA    . LEU A 254 ? 0.9307 1.0949 0.9344 0.0000 0.0000 0.0000 251 LEU A CA    
1912 C C     . LEU A 254 ? 0.9283 1.0916 0.9375 0.0000 0.0000 0.0000 251 LEU A C     
1913 O O     . LEU A 254 ? 0.9308 1.0938 0.9329 0.0000 0.0000 0.0000 251 LEU A O     
1914 C CB    . LEU A 254 ? 0.9272 1.1021 0.9428 0.0000 0.0000 0.0000 251 LEU A CB    
1915 C CG    . LEU A 254 ? 0.9142 1.0965 0.9307 0.0000 0.0000 0.0000 251 LEU A CG    
1916 C CD1   . LEU A 254 ? 0.9203 1.0986 0.9158 0.0000 0.0000 0.0000 251 LEU A CD1   
1917 C CD2   . LEU A 254 ? 0.9041 1.0965 0.9333 0.0000 0.0000 0.0000 251 LEU A CD2   
1918 N N     . ALA A 255 ? 0.9292 1.0909 0.9497 0.0000 0.0000 0.0000 252 ALA A N     
1919 C CA    . ALA A 255 ? 0.9312 1.0888 0.9551 0.0000 0.0000 0.0000 252 ALA A CA    
1920 C C     . ALA A 255 ? 0.9381 1.0856 0.9488 0.0000 0.0000 0.0000 252 ALA A C     
1921 O O     . ALA A 255 ? 0.9384 1.0840 0.9474 0.0000 0.0000 0.0000 252 ALA A O     
1922 C CB    . ALA A 255 ? 0.9268 1.0822 0.9611 0.0000 0.0000 0.0000 252 ALA A CB    
1923 N N     . LEU A 256 ? 0.9492 1.0902 0.9515 0.0000 0.0000 0.0000 253 LEU A N     
1924 C CA    . LEU A 256 ? 0.9604 1.0929 0.9527 0.0000 0.0000 0.0000 253 LEU A CA    
1925 C C     . LEU A 256 ? 0.9698 1.1087 0.9568 0.0000 0.0000 0.0000 253 LEU A C     
1926 O O     . LEU A 256 ? 0.9730 1.1105 0.9586 0.0000 0.0000 0.0000 253 LEU A O     
1927 C CB    . LEU A 256 ? 0.9625 1.0849 0.9476 0.0000 0.0000 0.0000 253 LEU A CB    
1928 C CG    . LEU A 256 ? 0.9661 1.0786 0.9523 0.0000 0.0000 0.0000 253 LEU A CG    
1929 C CD1   . LEU A 256 ? 0.9800 1.0808 0.9566 0.0000 0.0000 0.0000 253 LEU A CD1   
1930 C CD2   . LEU A 256 ? 0.9697 1.0741 0.9528 0.0000 0.0000 0.0000 253 LEU A CD2   
1931 N N     . ASN A 257 ? 0.9809 1.1263 0.9643 0.0000 0.0000 0.0000 254 ASN A N     
1932 C CA    . ASN A 257 ? 0.9921 1.1436 0.9681 0.0000 0.0000 0.0000 254 ASN A CA    
1933 C C     . ASN A 257 ? 0.9975 1.1556 0.9769 0.0000 0.0000 0.0000 254 ASN A C     
1934 O O     . ASN A 257 ? 0.9984 1.1615 0.9733 0.0000 0.0000 0.0000 254 ASN A O     
1935 C CB    . ASN A 257 ? 0.9999 1.1532 0.9673 0.0000 0.0000 0.0000 254 ASN A CB    
1936 C CG    . ASN A 257 ? 1.0092 1.1532 0.9698 0.0000 0.0000 0.0000 254 ASN A CG    
1937 O OD1   . ASN A 257 ? 0.9968 1.1354 0.9558 0.0000 0.0000 0.0000 254 ASN A OD1   
1938 N ND2   . ASN A 257 ? 1.0161 1.1572 0.9727 0.0000 0.0000 0.0000 254 ASN A ND2   
1939 N N     . ASN A 258 ? 1.0048 1.1626 0.9927 0.0000 0.0000 0.0000 255 ASN A N     
1940 C CA    . ASN A 258 ? 1.0178 1.1787 1.0085 0.0000 0.0000 0.0000 255 ASN A CA    
1941 C C     . ASN A 258 ? 1.0226 1.1757 1.0191 0.0000 0.0000 0.0000 255 ASN A C     
1942 O O     . ASN A 258 ? 1.0299 1.1820 1.0303 0.0000 0.0000 0.0000 255 ASN A O     
1943 C CB    . ASN A 258 ? 1.0216 1.1877 1.0166 0.0000 0.0000 0.0000 255 ASN A CB    
1944 C CG    . ASN A 258 ? 1.0429 1.2146 1.0268 0.0000 0.0000 0.0000 255 ASN A CG    
1945 O OD1   . ASN A 258 ? 1.0727 1.2465 1.0481 0.0000 0.0000 0.0000 255 ASN A OD1   
1946 N ND2   . ASN A 258 ? 1.0505 1.2236 1.0330 0.0000 0.0000 0.0000 255 ASN A ND2   
1947 N N     . THR A 259 ? 1.0292 1.1748 1.0244 0.0000 0.0000 0.0000 256 THR A N     
1948 C CA    . THR A 259 ? 1.0425 1.1774 1.0393 0.0000 0.0000 0.0000 256 THR A CA    
1949 C C     . THR A 259 ? 1.0459 1.1800 1.0401 0.0000 0.0000 0.0000 256 THR A C     
1950 O O     . THR A 259 ? 1.0493 1.1880 1.0412 0.0000 0.0000 0.0000 256 THR A O     
1951 C CB    . THR A 259 ? 1.0450 1.1694 1.0406 0.0000 0.0000 0.0000 256 THR A CB    
1952 O OG1   . THR A 259 ? 1.0554 1.1814 1.0578 0.0000 0.0000 0.0000 256 THR A OG1   
1953 C CG2   . THR A 259 ? 1.0587 1.1686 1.0500 0.0000 0.0000 0.0000 256 THR A CG2   
1954 N N     . TYR A 260 ? 1.0536 1.1819 1.0492 0.0000 0.0000 0.0000 257 TYR A N     
1955 C CA    . TYR A 260 ? 1.0602 1.1889 1.0563 0.0000 0.0000 0.0000 257 TYR A CA    
1956 C C     . TYR A 260 ? 1.0521 1.1721 1.0466 0.0000 0.0000 0.0000 257 TYR A C     
1957 O O     . TYR A 260 ? 1.0614 1.1668 1.0513 0.0000 0.0000 0.0000 257 TYR A O     
1958 C CB    . TYR A 260 ? 1.0778 1.1986 1.0747 0.0000 0.0000 0.0000 257 TYR A CB    
1959 C CG    . TYR A 260 ? 1.1127 1.2421 1.1101 0.0000 0.0000 0.0000 257 TYR A CG    
1960 C CD1   . TYR A 260 ? 1.1366 1.2636 1.1336 0.0000 0.0000 0.0000 257 TYR A CD1   
1961 C CD2   . TYR A 260 ? 1.1352 1.2751 1.1333 0.0000 0.0000 0.0000 257 TYR A CD2   
1962 C CE1   . TYR A 260 ? 1.1496 1.2822 1.1446 0.0000 0.0000 0.0000 257 TYR A CE1   
1963 C CE2   . TYR A 260 ? 1.1520 1.2975 1.1469 0.0000 0.0000 0.0000 257 TYR A CE2   
1964 C CZ    . TYR A 260 ? 1.1610 1.3016 1.1530 0.0000 0.0000 0.0000 257 TYR A CZ    
1965 O OH    . TYR A 260 ? 1.1862 1.3305 1.1726 0.0000 0.0000 0.0000 257 TYR A OH    
1966 N N     . SER A 261 ? 1.0321 1.1611 1.0301 0.0000 0.0000 0.0000 258 SER A N     
1967 C CA    . SER A 261 ? 1.0165 1.1372 1.0146 0.0000 0.0000 0.0000 258 SER A CA    
1968 C C     . SER A 261 ? 1.0112 1.1278 1.0136 0.0000 0.0000 0.0000 258 SER A C     
1969 O O     . SER A 261 ? 1.0066 1.1375 1.0177 0.0000 0.0000 0.0000 258 SER A O     
1970 C CB    . SER A 261 ? 1.0123 1.1457 1.0153 0.0000 0.0000 0.0000 258 SER A CB    
1971 O OG    . SER A 261 ? 1.0133 1.1416 1.0198 0.0000 0.0000 0.0000 258 SER A OG    
1972 N N     . PRO A 262 ? 1.0088 1.1047 1.0040 0.0000 0.0000 0.0000 259 PRO A N     
1973 C CA    . PRO A 262 ? 1.0125 1.0997 1.0093 0.0000 0.0000 0.0000 259 PRO A CA    
1974 C C     . PRO A 262 ? 1.0089 1.1082 1.0176 0.0000 0.0000 0.0000 259 PRO A C     
1975 O O     . PRO A 262 ? 1.0150 1.1136 1.0288 0.0000 0.0000 0.0000 259 PRO A O     
1976 C CB    . PRO A 262 ? 1.0254 1.0860 1.0089 0.0000 0.0000 0.0000 259 PRO A CB    
1977 C CG    . PRO A 262 ? 1.0177 1.0755 0.9945 0.0000 0.0000 0.0000 259 PRO A CG    
1978 C CD    . PRO A 262 ? 1.0123 1.0902 0.9959 0.0000 0.0000 0.0000 259 PRO A CD    
1979 N N     . VAL A 263 ? 1.0000 1.1110 1.0143 0.0000 0.0000 0.0000 260 VAL A N     
1980 C CA    . VAL A 263 ? 0.9961 1.1231 1.0258 0.0000 0.0000 0.0000 260 VAL A CA    
1981 C C     . VAL A 263 ? 0.9893 1.1426 1.0315 0.0000 0.0000 0.0000 260 VAL A C     
1982 O O     . VAL A 263 ? 0.9938 1.1611 1.0505 0.0000 0.0000 0.0000 260 VAL A O     
1983 C CB    . VAL A 263 ? 0.9909 1.1200 1.0215 0.0000 0.0000 0.0000 260 VAL A CB    
1984 C CG1   . VAL A 263 ? 0.9849 1.1250 1.0321 0.0000 0.0000 0.0000 260 VAL A CG1   
1985 C CG2   . VAL A 263 ? 1.0132 1.1158 1.0249 0.0000 0.0000 0.0000 260 VAL A CG2   
1986 N N     . LEU A 264 ? 0.9822 1.1421 1.0182 0.0000 0.0000 0.0000 261 LEU A N     
1987 C CA    . LEU A 264 ? 0.9760 1.1580 1.0183 0.0000 0.0000 0.0000 261 LEU A CA    
1988 C C     . LEU A 264 ? 0.9848 1.1645 1.0225 0.0000 0.0000 0.0000 261 LEU A C     
1989 O O     . LEU A 264 ? 0.9905 1.1852 1.0344 0.0000 0.0000 0.0000 261 LEU A O     
1990 C CB    . LEU A 264 ? 0.9667 1.1527 1.0010 0.0000 0.0000 0.0000 261 LEU A CB    
1991 C CG    . LEU A 264 ? 0.9600 1.1428 0.9951 0.0000 0.0000 0.0000 261 LEU A CG    
1992 C CD1   . LEU A 264 ? 0.9471 1.1305 0.9727 0.0000 0.0000 0.0000 261 LEU A CD1   
1993 C CD2   . LEU A 264 ? 0.9569 1.1562 1.0093 0.0000 0.0000 0.0000 261 LEU A CD2   
1994 N N     . LYS A 265 ? 0.9928 1.1531 1.0195 0.0000 0.0000 0.0000 262 LYS A N     
1995 C CA    . LYS A 265 ? 1.0032 1.1580 1.0235 0.0000 0.0000 0.0000 262 LYS A CA    
1996 C C     . LYS A 265 ? 1.0021 1.1697 1.0170 0.0000 0.0000 0.0000 262 LYS A C     
1997 O O     . LYS A 265 ? 1.0094 1.1814 1.0213 0.0000 0.0000 0.0000 262 LYS A O     
1998 C CB    . LYS A 265 ? 1.0134 1.1669 1.0395 0.0000 0.0000 0.0000 262 LYS A CB    
1999 C CG    . LYS A 265 ? 1.0245 1.1613 1.0533 0.0000 0.0000 0.0000 262 LYS A CG    
2000 C CD    . LYS A 265 ? 1.0664 1.1852 1.0904 0.0000 0.0000 0.0000 262 LYS A CD    
2001 C CE    . LYS A 265 ? 1.0923 1.2213 1.1270 0.0000 0.0000 0.0000 262 LYS A CE    
2002 N NZ    . LYS A 265 ? 1.1082 1.2394 1.1551 0.0000 0.0000 0.0000 262 LYS A NZ    
2003 N N     . TYR A 266 ? 1.0008 1.1718 1.0124 0.0000 0.0000 0.0000 263 TYR A N     
2004 C CA    . TYR A 266 ? 1.0032 1.1828 1.0072 0.0000 0.0000 0.0000 263 TYR A CA    
2005 C C     . TYR A 266 ? 0.9952 1.1679 0.9942 0.0000 0.0000 0.0000 263 TYR A C     
2006 O O     . TYR A 266 ? 0.9950 1.1607 0.9964 0.0000 0.0000 0.0000 263 TYR A O     
2007 C CB    . TYR A 266 ? 1.0065 1.2040 1.0131 0.0000 0.0000 0.0000 263 TYR A CB    
2008 C CG    . TYR A 266 ? 1.0346 1.2420 1.0455 0.0000 0.0000 0.0000 263 TYR A CG    
2009 C CD1   . TYR A 266 ? 1.0577 1.2638 1.0587 0.0000 0.0000 0.0000 263 TYR A CD1   
2010 C CD2   . TYR A 266 ? 1.0553 1.2736 1.0808 0.0000 0.0000 0.0000 263 TYR A CD2   
2011 C CE1   . TYR A 266 ? 1.0778 1.2915 1.0812 0.0000 0.0000 0.0000 263 TYR A CE1   
2012 C CE2   . TYR A 266 ? 1.0691 1.2976 1.1002 0.0000 0.0000 0.0000 263 TYR A CE2   
2013 C CZ    . TYR A 266 ? 1.0810 1.3064 1.0999 0.0000 0.0000 0.0000 263 TYR A CZ    
2014 O OH    . TYR A 266 ? 1.1040 1.3381 1.1270 0.0000 0.0000 0.0000 263 TYR A OH    
2015 N N     . THR A 267 ? 0.9916 1.1656 0.9830 0.0000 0.0000 0.0000 264 THR A N     
2016 C CA    . THR A 267 ? 0.9794 1.1489 0.9672 0.0000 0.0000 0.0000 264 THR A CA    
2017 C C     . THR A 267 ? 0.9723 1.1497 0.9549 0.0000 0.0000 0.0000 264 THR A C     
2018 O O     . THR A 267 ? 0.9778 1.1654 0.9573 0.0000 0.0000 0.0000 264 THR A O     
2019 C CB    . THR A 267 ? 0.9827 1.1494 0.9675 0.0000 0.0000 0.0000 264 THR A CB    
2020 O OG1   . THR A 267 ? 0.9963 1.1711 0.9725 0.0000 0.0000 0.0000 264 THR A OG1   
2021 C CG2   . THR A 267 ? 0.9892 1.1489 0.9785 0.0000 0.0000 0.0000 264 THR A CG2   
2022 N N     . PRO A 268 ? 0.9622 1.1338 0.9427 0.0000 0.0000 0.0000 265 PRO A N     
2023 C CA    . PRO A 268 ? 0.9631 1.1387 0.9366 0.0000 0.0000 0.0000 265 PRO A CA    
2024 C C     . PRO A 268 ? 0.9679 1.1490 0.9306 0.0000 0.0000 0.0000 265 PRO A C     
2025 O O     . PRO A 268 ? 0.9755 1.1641 0.9322 0.0000 0.0000 0.0000 265 PRO A O     
2026 C CB    . PRO A 268 ? 0.9613 1.1253 0.9320 0.0000 0.0000 0.0000 265 PRO A CB    
2027 C CG    . PRO A 268 ? 0.9587 1.1143 0.9360 0.0000 0.0000 0.0000 265 PRO A CG    
2028 C CD    . PRO A 268 ? 0.9560 1.1156 0.9397 0.0000 0.0000 0.0000 265 PRO A CD    
2029 N N     . HIS A 269 ? 0.9622 1.1394 0.9222 0.0000 0.0000 0.0000 266 HIS A N     
2030 C CA    . HIS A 269 ? 0.9633 1.1434 0.9114 0.0000 0.0000 0.0000 266 HIS A CA    
2031 C C     . HIS A 269 ? 0.9654 1.1541 0.9086 0.0000 0.0000 0.0000 266 HIS A C     
2032 O O     . HIS A 269 ? 0.9839 1.1757 0.9133 0.0000 0.0000 0.0000 266 HIS A O     
2033 C CB    . HIS A 269 ? 0.9638 1.1409 0.9156 0.0000 0.0000 0.0000 266 HIS A CB    
2034 C CG    . HIS A 269 ? 0.9734 1.1520 0.9125 0.0000 0.0000 0.0000 266 HIS A CG    
2035 N ND1   . HIS A 269 ? 0.9742 1.1568 0.9043 0.0000 0.0000 0.0000 266 HIS A ND1   
2036 C CD2   . HIS A 269 ? 0.9731 1.1485 0.9061 0.0000 0.0000 0.0000 266 HIS A CD2   
2037 C CE1   . HIS A 269 ? 0.9851 1.1658 0.9019 0.0000 0.0000 0.0000 266 HIS A CE1   
2038 N NE2   . HIS A 269 ? 0.9929 1.1696 0.9120 0.0000 0.0000 0.0000 266 HIS A NE2   
2039 N N     . GLN A 270 ? 0.9525 1.1437 0.9056 0.0000 0.0000 0.0000 267 GLN A N     
2040 C CA    . GLN A 270 ? 0.9549 1.1544 0.9055 0.0000 0.0000 0.0000 267 GLN A CA    
2041 C C     . GLN A 270 ? 0.9496 1.1594 0.8998 0.0000 0.0000 0.0000 267 GLN A C     
2042 O O     . GLN A 270 ? 0.9630 1.1795 0.9017 0.0000 0.0000 0.0000 267 GLN A O     
2043 C CB    . GLN A 270 ? 0.9514 1.1491 0.9144 0.0000 0.0000 0.0000 267 GLN A CB    
2044 C CG    . GLN A 270 ? 0.9759 1.1664 0.9354 0.0000 0.0000 0.0000 267 GLN A CG    
2045 C CD    . GLN A 270 ? 0.9837 1.1651 0.9552 0.0000 0.0000 0.0000 267 GLN A CD    
2046 O OE1   . GLN A 270 ? 0.9886 1.1700 0.9683 0.0000 0.0000 0.0000 267 GLN A OE1   
2047 N NE2   . GLN A 270 ? 0.9946 1.1681 0.9673 0.0000 0.0000 0.0000 267 GLN A NE2   
2048 N N     . LEU A 271 ? 0.9321 1.1427 0.8941 0.0000 0.0000 0.0000 268 LEU A N     
2049 C CA    . LEU A 271 ? 0.9301 1.1513 0.8950 0.0000 0.0000 0.0000 268 LEU A CA    
2050 C C     . LEU A 271 ? 0.9435 1.1630 0.8908 0.0000 0.0000 0.0000 268 LEU A C     
2051 O O     . LEU A 271 ? 0.9584 1.1880 0.9010 0.0000 0.0000 0.0000 268 LEU A O     
2052 C CB    . LEU A 271 ? 0.9179 1.1375 0.8976 0.0000 0.0000 0.0000 268 LEU A CB    
2053 C CG    . LEU A 271 ? 0.9031 1.1215 0.8980 0.0000 0.0000 0.0000 268 LEU A CG    
2054 C CD1   . LEU A 271 ? 0.8947 1.1102 0.8997 0.0000 0.0000 0.0000 268 LEU A CD1   
2055 C CD2   . LEU A 271 ? 0.8976 1.1296 0.9011 0.0000 0.0000 0.0000 268 LEU A CD2   
2056 N N     . LEU A 272 ? 0.9420 1.1483 0.8792 0.0000 0.0000 0.0000 269 LEU A N     
2057 C CA    . LEU A 272 ? 0.9556 1.1563 0.8737 0.0000 0.0000 0.0000 269 LEU A CA    
2058 C C     . LEU A 272 ? 0.9753 1.1773 0.8744 0.0000 0.0000 0.0000 269 LEU A C     
2059 O O     . LEU A 272 ? 0.9960 1.1998 0.8801 0.0000 0.0000 0.0000 269 LEU A O     
2060 C CB    . LEU A 272 ? 0.9527 1.1386 0.8668 0.0000 0.0000 0.0000 269 LEU A CB    
2061 C CG    . LEU A 272 ? 0.9611 1.1369 0.8550 0.0000 0.0000 0.0000 269 LEU A CG    
2062 C CD1   . LEU A 272 ? 0.9667 1.1475 0.8547 0.0000 0.0000 0.0000 269 LEU A CD1   
2063 C CD2   . LEU A 272 ? 0.9377 1.0995 0.8329 0.0000 0.0000 0.0000 269 LEU A CD2   
2064 N N     . PHE A 273 ? 0.9751 1.1751 0.8735 0.0000 0.0000 0.0000 270 PHE A N     
2065 C CA    . PHE A 273 ? 0.9994 1.1971 0.8768 0.0000 0.0000 0.0000 270 PHE A CA    
2066 C C     . PHE A 273 ? 1.0142 1.2208 0.8912 0.0000 0.0000 0.0000 270 PHE A C     
2067 O O     . PHE A 273 ? 1.0391 1.2449 0.8949 0.0000 0.0000 0.0000 270 PHE A O     
2068 C CB    . PHE A 273 ? 0.9970 1.1846 0.8701 0.0000 0.0000 0.0000 270 PHE A CB    
2069 C CG    . PHE A 273 ? 0.9918 1.1700 0.8626 0.0000 0.0000 0.0000 270 PHE A CG    
2070 C CD1   . PHE A 273 ? 0.9717 1.1468 0.8600 0.0000 0.0000 0.0000 270 PHE A CD1   
2071 C CD2   . PHE A 273 ? 1.0093 1.1802 0.8590 0.0000 0.0000 0.0000 270 PHE A CD2   
2072 C CE1   . PHE A 273 ? 0.9710 1.1371 0.8575 0.0000 0.0000 0.0000 270 PHE A CE1   
2073 C CE2   . PHE A 273 ? 1.0035 1.1632 0.8502 0.0000 0.0000 0.0000 270 PHE A CE2   
2074 C CZ    . PHE A 273 ? 0.9826 1.1405 0.8485 0.0000 0.0000 0.0000 270 PHE A CZ    
2075 N N     . GLY A 274 ? 1.0086 1.2214 0.9065 0.0000 0.0000 0.0000 271 GLY A N     
2076 C CA    . GLY A 274 ? 1.0330 1.2529 0.9319 0.0000 0.0000 0.0000 271 GLY A CA    
2077 C C     . GLY A 274 ? 1.0553 1.2666 0.9471 0.0000 0.0000 0.0000 271 GLY A C     
2078 O O     . GLY A 274 ? 1.0653 1.2794 0.9572 0.0000 0.0000 0.0000 271 GLY A O     
2079 N N     . ILE A 275 ? 1.0661 1.2673 0.9521 0.0000 0.0000 0.0000 272 ILE A N     
2080 C CA    . ILE A 275 ? 1.0817 1.2750 0.9682 0.0000 0.0000 0.0000 272 ILE A CA    
2081 C C     . ILE A 275 ? 1.0768 1.2649 0.9758 0.0000 0.0000 0.0000 272 ILE A C     
2082 O O     . ILE A 275 ? 1.0756 1.2632 0.9735 0.0000 0.0000 0.0000 272 ILE A O     
2083 C CB    . ILE A 275 ? 1.1058 1.2934 0.9672 0.0000 0.0000 0.0000 272 ILE A CB    
2084 C CG1   . ILE A 275 ? 1.1218 1.3055 0.9673 0.0000 0.0000 0.0000 272 ILE A CG1   
2085 C CG2   . ILE A 275 ? 1.1354 1.3265 0.9818 0.0000 0.0000 0.0000 272 ILE A CG2   
2086 C CD1   . ILE A 275 ? 1.1428 1.3198 0.9919 0.0000 0.0000 0.0000 272 ILE A CD1   
2087 N N     . ASP A 276 ? 1.0812 1.2648 0.9915 0.0000 0.0000 0.0000 273 ASP A N     
2088 C CA    . ASP A 276 ? 1.0776 1.2581 1.0007 0.0000 0.0000 0.0000 273 ASP A CA    
2089 C C     . ASP A 276 ? 1.0889 1.2676 1.0000 0.0000 0.0000 0.0000 273 ASP A C     
2090 O O     . ASP A 276 ? 1.1102 1.2866 1.0050 0.0000 0.0000 0.0000 273 ASP A O     
2091 C CB    . ASP A 276 ? 1.0760 1.2522 1.0145 0.0000 0.0000 0.0000 273 ASP A CB    
2092 C CG    . ASP A 276 ? 1.0866 1.2614 1.0403 0.0000 0.0000 0.0000 273 ASP A CG    
2093 O OD1   . ASP A 276 ? 1.0957 1.2734 1.0517 0.0000 0.0000 0.0000 273 ASP A OD1   
2094 O OD2   . ASP A 276 ? 1.1152 1.2837 1.0772 0.0000 0.0000 0.0000 273 ASP A OD2   
2095 N N     . SER A 277 ? 1.0808 1.2597 0.9988 0.0000 0.0000 0.0000 274 SER A N     
2096 C CA    . SER A 277 ? 1.0916 1.2691 1.0034 0.0000 0.0000 0.0000 274 SER A CA    
2097 C C     . SER A 277 ? 1.0875 1.2663 1.0140 0.0000 0.0000 0.0000 274 SER A C     
2098 O O     . SER A 277 ? 1.0840 1.2616 1.0174 0.0000 0.0000 0.0000 274 SER A O     
2099 C CB    . SER A 277 ? 1.0861 1.2636 1.0041 0.0000 0.0000 0.0000 274 SER A CB    
2100 O OG    . SER A 277 ? 1.0747 1.2546 1.0151 0.0000 0.0000 0.0000 274 SER A OG    
2101 N N     . ASN A 278 ? 1.0862 1.2674 1.0184 0.0000 0.0000 0.0000 275 ASN A N     
2102 C CA    . ASN A 278 ? 1.0792 1.2642 1.0301 0.0000 0.0000 0.0000 275 ASN A CA    
2103 C C     . ASN A 278 ? 1.0557 1.2464 1.0344 0.0000 0.0000 0.0000 275 ASN A C     
2104 O O     . ASN A 278 ? 1.0558 1.2536 1.0507 0.0000 0.0000 0.0000 275 ASN A O     
2105 C CB    . ASN A 278 ? 1.0968 1.2836 1.0426 0.0000 0.0000 0.0000 275 ASN A CB    
2106 C CG    . ASN A 278 ? 1.0929 1.2863 1.0623 0.0000 0.0000 0.0000 275 ASN A CG    
2107 O OD1   . ASN A 278 ? 1.0918 1.2843 1.0731 0.0000 0.0000 0.0000 275 ASN A OD1   
2108 N ND2   . ASN A 278 ? 1.0947 1.2944 1.0714 0.0000 0.0000 0.0000 275 ASN A ND2   
2109 N N     . THR A 279 ? 1.0370 1.2243 1.0209 0.0000 0.0000 0.0000 276 THR A N     
2110 C CA    . THR A 279 ? 1.0203 1.2101 1.0264 0.0000 0.0000 0.0000 276 THR A CA    
2111 C C     . THR A 279 ? 1.0174 1.2035 1.0332 0.0000 0.0000 0.0000 276 THR A C     
2112 O O     . THR A 279 ? 1.0305 1.2113 1.0348 0.0000 0.0000 0.0000 276 THR A O     
2113 C CB    . THR A 279 ? 1.0107 1.1963 1.0135 0.0000 0.0000 0.0000 276 THR A CB    
2114 O OG1   . THR A 279 ? 1.0248 1.2049 1.0127 0.0000 0.0000 0.0000 276 THR A OG1   
2115 C CG2   . THR A 279 ? 1.0142 1.2016 1.0107 0.0000 0.0000 0.0000 276 THR A CG2   
2116 N N     . PRO A 280 ? 1.0034 1.1908 1.0390 0.0000 0.0000 0.0000 277 PRO A N     
2117 C CA    . PRO A 280 ? 1.0040 1.1844 1.0470 0.0000 0.0000 0.0000 277 PRO A CA    
2118 C C     . PRO A 280 ? 1.0056 1.1731 1.0341 0.0000 0.0000 0.0000 277 PRO A C     
2119 O O     . PRO A 280 ? 0.9990 1.1647 1.0191 0.0000 0.0000 0.0000 277 PRO A O     
2120 C CB    . PRO A 280 ? 0.9925 1.1758 1.0550 0.0000 0.0000 0.0000 277 PRO A CB    
2121 C CG    . PRO A 280 ? 0.9879 1.1848 1.0600 0.0000 0.0000 0.0000 277 PRO A CG    
2122 C CD    . PRO A 280 ? 0.9912 1.1868 1.0434 0.0000 0.0000 0.0000 277 PRO A CD    
2123 N N     . PHE A 281 ? 1.0167 1.1750 1.0433 0.0000 0.0000 0.0000 278 PHE A N     
2124 C CA    . PHE A 281 ? 1.0214 1.1668 1.0361 0.0000 0.0000 0.0000 278 PHE A CA    
2125 C C     . PHE A 281 ? 1.0322 1.1807 1.0307 0.0000 0.0000 0.0000 278 PHE A C     
2126 O O     . PHE A 281 ? 1.0282 1.1720 1.0225 0.0000 0.0000 0.0000 278 PHE A O     
2127 C CB    . PHE A 281 ? 1.0077 1.1436 1.0281 0.0000 0.0000 0.0000 278 PHE A CB    
2128 C CG    . PHE A 281 ? 0.9858 1.1164 1.0199 0.0000 0.0000 0.0000 278 PHE A CG    
2129 C CD1   . PHE A 281 ? 0.9843 1.0988 1.0161 0.0000 0.0000 0.0000 278 PHE A CD1   
2130 C CD2   . PHE A 281 ? 0.9522 1.0934 1.0016 0.0000 0.0000 0.0000 278 PHE A CD2   
2131 C CE1   . PHE A 281 ? 0.9831 1.0917 1.0269 0.0000 0.0000 0.0000 278 PHE A CE1   
2132 C CE2   . PHE A 281 ? 0.9568 1.0950 1.0203 0.0000 0.0000 0.0000 278 PHE A CE2   
2133 C CZ    . PHE A 281 ? 0.9751 1.0968 1.0355 0.0000 0.0000 0.0000 278 PHE A CZ    
2134 N N     . ALA A 282 ? 1.0541 1.2104 1.0435 0.0000 0.0000 0.0000 279 ALA A N     
2135 C CA    . ALA A 282 ? 1.0709 1.2307 1.0432 0.0000 0.0000 0.0000 279 ALA A CA    
2136 C C     . ALA A 282 ? 1.0943 1.2470 1.0552 0.0000 0.0000 0.0000 279 ALA A C     
2137 O O     . ALA A 282 ? 1.1088 1.2545 1.0654 0.0000 0.0000 0.0000 279 ALA A O     
2138 C CB    . ALA A 282 ? 1.0792 1.2458 1.0414 0.0000 0.0000 0.0000 279 ALA A CB    
2139 N N     . ASN A 283 ? 1.1035 1.2585 1.0603 0.0000 0.0000 0.0000 280 ASN A N     
2140 C CA    . ASN A 283 ? 1.1283 1.2789 1.0782 0.0000 0.0000 0.0000 280 ASN A CA    
2141 C C     . ASN A 283 ? 1.1555 1.3081 1.0864 0.0000 0.0000 0.0000 280 ASN A C     
2142 O O     . ASN A 283 ? 1.1589 1.3196 1.0789 0.0000 0.0000 0.0000 280 ASN A O     
2143 C CB    . ASN A 283 ? 1.1190 1.2751 1.0738 0.0000 0.0000 0.0000 280 ASN A CB    
2144 C CG    . ASN A 283 ? 1.1397 1.2921 1.0930 0.0000 0.0000 0.0000 280 ASN A CG    
2145 O OD1   . ASN A 283 ? 1.1528 1.3110 1.0953 0.0000 0.0000 0.0000 280 ASN A OD1   
2146 N ND2   . ASN A 283 ? 1.1518 1.2935 1.1151 0.0000 0.0000 0.0000 280 ASN A ND2   
2147 N N     . GLN A 284 ? 1.1845 1.3275 1.1093 0.0000 0.0000 0.0000 281 GLN A N     
2148 C CA    . GLN A 284 ? 1.2213 1.3624 1.1252 0.0000 0.0000 0.0000 281 GLN A CA    
2149 C C     . GLN A 284 ? 1.2335 1.3750 1.1285 0.0000 0.0000 0.0000 281 GLN A C     
2150 O O     . GLN A 284 ? 1.2589 1.3957 1.1350 0.0000 0.0000 0.0000 281 GLN A O     
2151 C CB    . GLN A 284 ? 1.2397 1.3681 1.1410 0.0000 0.0000 0.0000 281 GLN A CB    
2152 C CG    . GLN A 284 ? 1.2682 1.4008 1.1733 0.0000 0.0000 0.0000 281 GLN A CG    
2153 C CD    . GLN A 284 ? 1.3167 1.4394 1.2306 0.0000 0.0000 0.0000 281 GLN A CD    
2154 O OE1   . GLN A 284 ? 1.3544 1.4661 1.2556 0.0000 0.0000 0.0000 281 GLN A OE1   
2155 N NE2   . GLN A 284 ? 1.3116 1.4376 1.2471 0.0000 0.0000 0.0000 281 GLN A NE2   
2156 N N     . ASP A 285 ? 1.2211 1.3684 1.1297 0.0000 0.0000 0.0000 282 ASP A N     
2157 C CA    . ASP A 285 ? 1.2323 1.3822 1.1388 0.0000 0.0000 0.0000 282 ASP A CA    
2158 C C     . ASP A 285 ? 1.2444 1.4055 1.1327 0.0000 0.0000 0.0000 282 ASP A C     
2159 O O     . ASP A 285 ? 1.2634 1.4239 1.1441 0.0000 0.0000 0.0000 282 ASP A O     
2160 C CB    . ASP A 285 ? 1.2169 1.3738 1.1439 0.0000 0.0000 0.0000 282 ASP A CB    
2161 C CG    . ASP A 285 ? 1.2171 1.3585 1.1573 0.0000 0.0000 0.0000 282 ASP A CG    
2162 O OD1   . ASP A 285 ? 1.2304 1.3562 1.1656 0.0000 0.0000 0.0000 282 ASP A OD1   
2163 O OD2   . ASP A 285 ? 1.2042 1.3484 1.1590 0.0000 0.0000 0.0000 282 ASP A OD2   
2164 N N     . THR A 286 ? 1.2357 1.4056 1.1157 0.0000 0.0000 0.0000 283 THR A N     
2165 C CA    . THR A 286 ? 1.2474 1.4275 1.1091 0.0000 0.0000 0.0000 283 THR A CA    
2166 C C     . THR A 286 ? 1.2666 1.4380 1.1007 0.0000 0.0000 0.0000 283 THR A C     
2167 O O     . THR A 286 ? 1.2744 1.4513 1.0910 0.0000 0.0000 0.0000 283 THR A O     
2168 C CB    . THR A 286 ? 1.2312 1.4268 1.1022 0.0000 0.0000 0.0000 283 THR A CB    
2169 O OG1   . THR A 286 ? 1.2189 1.4106 1.0938 0.0000 0.0000 0.0000 283 THR A OG1   
2170 C CG2   . THR A 286 ? 1.2094 1.4147 1.1066 0.0000 0.0000 0.0000 283 THR A CG2   
2171 N N     . LEU A 287 ? 1.2753 1.4318 1.1049 0.0000 0.0000 0.0000 284 LEU A N     
2172 C CA    . LEU A 287 ? 1.2937 1.4404 1.1003 0.0000 0.0000 0.0000 284 LEU A CA    
2173 C C     . LEU A 287 ? 1.3243 1.4667 1.0993 0.0000 0.0000 0.0000 284 LEU A C     
2174 O O     . LEU A 287 ? 1.3455 1.4816 1.0950 0.0000 0.0000 0.0000 284 LEU A O     
2175 C CB    . LEU A 287 ? 1.2958 1.4287 1.1108 0.0000 0.0000 0.0000 284 LEU A CB    
2176 C CG    . LEU A 287 ? 1.3028 1.4323 1.1146 0.0000 0.0000 0.0000 284 LEU A CG    
2177 C CD1   . LEU A 287 ? 1.2732 1.4124 1.1101 0.0000 0.0000 0.0000 284 LEU A CD1   
2178 C CD2   . LEU A 287 ? 1.3210 1.4359 1.1324 0.0000 0.0000 0.0000 284 LEU A CD2   
2179 N N     . ASP A 288 ? 1.3281 1.4732 1.1039 0.0000 0.0000 0.0000 285 ASP A N     
2180 C CA    . ASP A 288 ? 1.3575 1.4984 1.1035 0.0000 0.0000 0.0000 285 ASP A CA    
2181 C C     . ASP A 288 ? 1.3532 1.5103 1.0898 0.0000 0.0000 0.0000 285 ASP A C     
2182 O O     . ASP A 288 ? 1.3832 1.5375 1.0907 0.0000 0.0000 0.0000 285 ASP A O     
2183 C CB    . ASP A 288 ? 1.3731 1.5053 1.1236 0.0000 0.0000 0.0000 285 ASP A CB    
2184 C CG    . ASP A 288 ? 1.4004 1.5109 1.1464 0.0000 0.0000 0.0000 285 ASP A CG    
2185 O OD1   . ASP A 288 ? 1.4311 1.5317 1.1557 0.0000 0.0000 0.0000 285 ASP A OD1   
2186 O OD2   . ASP A 288 ? 1.4080 1.5107 1.1723 0.0000 0.0000 0.0000 285 ASP A OD2   
2187 N N     . LEU A 289 ? 1.3147 1.4881 1.0752 0.0000 0.0000 0.0000 286 LEU A N     
2188 C CA    . LEU A 289 ? 1.3088 1.4989 1.0641 0.0000 0.0000 0.0000 286 LEU A CA    
2189 C C     . LEU A 289 ? 1.3214 1.5061 1.0489 0.0000 0.0000 0.0000 286 LEU A C     
2190 O O     . LEU A 289 ? 1.3100 1.4858 1.0385 0.0000 0.0000 0.0000 286 LEU A O     
2191 C CB    . LEU A 289 ? 1.2712 1.4789 1.0621 0.0000 0.0000 0.0000 286 LEU A CB    
2192 C CG    . LEU A 289 ? 1.2445 1.4552 1.0652 0.0000 0.0000 0.0000 286 LEU A CG    
2193 C CD1   . LEU A 289 ? 1.2046 1.4301 1.0567 0.0000 0.0000 0.0000 286 LEU A CD1   
2194 C CD2   . LEU A 289 ? 1.2580 1.4744 1.0742 0.0000 0.0000 0.0000 286 LEU A CD2   
2195 N N     . THR A 290 ? 1.3474 1.5367 1.0496 0.0000 0.0000 0.0000 287 THR A N     
2196 C CA    . THR A 290 ? 1.3639 1.5479 1.0393 0.0000 0.0000 0.0000 287 THR A CA    
2197 C C     . THR A 290 ? 1.3310 1.5262 1.0331 0.0000 0.0000 0.0000 287 THR A C     
2198 O O     . THR A 290 ? 1.3054 1.5159 1.0408 0.0000 0.0000 0.0000 287 THR A O     
2199 C CB    . THR A 290 ? 1.3989 1.5881 1.0452 0.0000 0.0000 0.0000 287 THR A CB    
2200 O OG1   . THR A 290 ? 1.3862 1.5980 1.0590 0.0000 0.0000 0.0000 287 THR A OG1   
2201 C CG2   . THR A 290 ? 1.4428 1.6153 1.0497 0.0000 0.0000 0.0000 287 THR A CG2   
2202 N N     . ARG A 291 ? 1.3361 1.5226 1.0230 0.0000 0.0000 0.0000 288 ARG A N     
2203 C CA    . ARG A 291 ? 1.3126 1.5075 1.0211 0.0000 0.0000 0.0000 288 ARG A CA    
2204 C C     . ARG A 291 ? 1.3112 1.5263 1.0354 0.0000 0.0000 0.0000 288 ARG A C     
2205 O O     . ARG A 291 ? 1.2802 1.5070 1.0366 0.0000 0.0000 0.0000 288 ARG A O     
2206 C CB    . ARG A 291 ? 1.3268 1.5086 1.0088 0.0000 0.0000 0.0000 288 ARG A CB    
2207 C CG    . ARG A 291 ? 1.2911 1.4780 0.9928 0.0000 0.0000 0.0000 288 ARG A CG    
2208 C CD    . ARG A 291 ? 1.2227 1.4131 0.9610 0.0000 0.0000 0.0000 288 ARG A CD    
2209 N NE    . ARG A 291 ? 1.1802 1.3719 0.9325 0.0000 0.0000 0.0000 288 ARG A NE    
2210 C CZ    . ARG A 291 ? 1.1418 1.3397 0.9264 0.0000 0.0000 0.0000 288 ARG A CZ    
2211 N NH1   . ARG A 291 ? 1.1146 1.3175 0.9209 0.0000 0.0000 0.0000 288 ARG A NH1   
2212 N NH2   . ARG A 291 ? 1.1217 1.3184 0.9145 0.0000 0.0000 0.0000 288 ARG A NH2   
2213 N N     . GLU A 292 ? 1.3509 1.5703 1.0524 0.0000 0.0000 0.0000 289 GLU A N     
2214 C CA    . GLU A 292 ? 1.3599 1.6010 1.0750 0.0000 0.0000 0.0000 289 GLU A CA    
2215 C C     . GLU A 292 ? 1.3308 1.5908 1.0861 0.0000 0.0000 0.0000 289 GLU A C     
2216 O O     . GLU A 292 ? 1.3109 1.5886 1.0950 0.0000 0.0000 0.0000 289 GLU A O     
2217 C CB    . GLU A 292 ? 1.4088 1.6500 1.0887 0.0000 0.0000 0.0000 289 GLU A CB    
2218 C CG    . GLU A 292 ? 1.4671 1.6981 1.1140 0.0000 0.0000 0.0000 289 GLU A CG    
2219 C CD    . GLU A 292 ? 1.5309 1.7788 1.1708 0.0000 0.0000 0.0000 289 GLU A CD    
2220 O OE1   . GLU A 292 ? 1.5669 1.8185 1.1885 0.0000 0.0000 0.0000 289 GLU A OE1   
2221 O OE2   . GLU A 292 ? 1.5399 1.7975 1.1932 0.0000 0.0000 0.0000 289 GLU A OE2   
2222 N N     . GLU A 293 ? 1.3343 1.5893 1.0907 0.0000 0.0000 0.0000 290 GLU A N     
2223 C CA    . GLU A 293 ? 1.3151 1.5839 1.1078 0.0000 0.0000 0.0000 290 GLU A CA    
2224 C C     . GLU A 293 ? 1.2791 1.5482 1.1029 0.0000 0.0000 0.0000 290 GLU A C     
2225 O O     . GLU A 293 ? 1.2599 1.5462 1.1148 0.0000 0.0000 0.0000 290 GLU A O     
2226 C CB    . GLU A 293 ? 1.3294 1.5858 1.1133 0.0000 0.0000 0.0000 290 GLU A CB    
2227 C CG    . GLU A 293 ? 1.3734 1.6342 1.1345 0.0000 0.0000 0.0000 290 GLU A CG    
2228 C CD    . GLU A 293 ? 1.4060 1.6440 1.1382 0.0000 0.0000 0.0000 290 GLU A CD    
2229 O OE1   . GLU A 293 ? 1.3989 1.6206 1.1363 0.0000 0.0000 0.0000 290 GLU A OE1   
2230 O OE2   . GLU A 293 ? 1.4418 1.6779 1.1453 0.0000 0.0000 0.0000 290 GLU A OE2   
2231 N N     . GLU A 294 ? 1.2738 1.5239 1.0882 0.0000 0.0000 0.0000 291 GLU A N     
2232 C CA    . GLU A 294 ? 1.2437 1.4905 1.0807 0.0000 0.0000 0.0000 291 GLU A CA    
2233 C C     . GLU A 294 ? 1.2228 1.4823 1.0747 0.0000 0.0000 0.0000 291 GLU A C     
2234 O O     . GLU A 294 ? 1.1964 1.4635 1.0774 0.0000 0.0000 0.0000 291 GLU A O     
2235 C CB    . GLU A 294 ? 1.2516 1.4789 1.0697 0.0000 0.0000 0.0000 291 GLU A CB    
2236 C CG    . GLU A 294 ? 1.2499 1.4705 1.0893 0.0000 0.0000 0.0000 291 GLU A CG    
2237 C CD    . GLU A 294 ? 1.2918 1.4958 1.1157 0.0000 0.0000 0.0000 291 GLU A CD    
2238 O OE1   . GLU A 294 ? 1.3242 1.5216 1.1224 0.0000 0.0000 0.0000 291 GLU A OE1   
2239 O OE2   . GLU A 294 ? 1.2925 1.4895 1.1296 0.0000 0.0000 0.0000 291 GLU A OE2   
2240 N N     . LEU A 295 ? 1.2355 1.4952 1.0654 0.0000 0.0000 0.0000 292 LEU A N     
2241 C CA    . LEU A 295 ? 1.2208 1.4887 1.0601 0.0000 0.0000 0.0000 292 LEU A CA    
2242 C C     . LEU A 295 ? 1.2094 1.5016 1.0773 0.0000 0.0000 0.0000 292 LEU A C     
2243 O O     . LEU A 295 ? 1.1915 1.4909 1.0781 0.0000 0.0000 0.0000 292 LEU A O     
2244 C CB    . LEU A 295 ? 1.2462 1.5057 1.0516 0.0000 0.0000 0.0000 292 LEU A CB    
2245 C CG    . LEU A 295 ? 1.2481 1.4863 1.0361 0.0000 0.0000 0.0000 292 LEU A CG    
2246 C CD1   . LEU A 295 ? 1.2702 1.4990 1.0251 0.0000 0.0000 0.0000 292 LEU A CD1   
2247 C CD2   . LEU A 295 ? 1.2263 1.4644 1.0417 0.0000 0.0000 0.0000 292 LEU A CD2   
2248 N N     . SER A 296 ? 1.2186 1.5234 1.0903 0.0000 0.0000 0.0000 293 SER A N     
2249 C CA    . SER A 296 ? 1.2093 1.5399 1.1127 0.0000 0.0000 0.0000 293 SER A CA    
2250 C C     . SER A 296 ? 1.1832 1.5157 1.1173 0.0000 0.0000 0.0000 293 SER A C     
2251 O O     . SER A 296 ? 1.1698 1.5189 1.1352 0.0000 0.0000 0.0000 293 SER A O     
2252 C CB    . SER A 296 ? 1.2360 1.5815 1.1298 0.0000 0.0000 0.0000 293 SER A CB    
2253 O OG    . SER A 296 ? 1.2559 1.5882 1.1320 0.0000 0.0000 0.0000 293 SER A OG    
2254 N N     . LEU A 297 ? 1.1793 1.4938 1.1039 0.0000 0.0000 0.0000 294 LEU A N     
2255 C CA    . LEU A 297 ? 1.1546 1.4642 1.1032 0.0000 0.0000 0.0000 294 LEU A CA    
2256 C C     . LEU A 297 ? 1.1299 1.4352 1.0921 0.0000 0.0000 0.0000 294 LEU A C     
2257 O O     . LEU A 297 ? 1.1111 1.4202 1.0986 0.0000 0.0000 0.0000 294 LEU A O     
2258 C CB    . LEU A 297 ? 1.1604 1.4481 1.0940 0.0000 0.0000 0.0000 294 LEU A CB    
2259 C CG    . LEU A 297 ? 1.1411 1.4216 1.0971 0.0000 0.0000 0.0000 294 LEU A CG    
2260 C CD1   . LEU A 297 ? 1.1544 1.4409 1.1193 0.0000 0.0000 0.0000 294 LEU A CD1   
2261 C CD2   . LEU A 297 ? 1.1344 1.3909 1.0788 0.0000 0.0000 0.0000 294 LEU A CD2   
2262 N N     . LEU A 298 ? 1.1321 1.4276 1.0754 0.0000 0.0000 0.0000 295 LEU A N     
2263 C CA    . LEU A 298 ? 1.1138 1.4040 1.0663 0.0000 0.0000 0.0000 295 LEU A CA    
2264 C C     . LEU A 298 ? 1.1112 1.4204 1.0854 0.0000 0.0000 0.0000 295 LEU A C     
2265 O O     . LEU A 298 ? 1.0964 1.4064 1.0919 0.0000 0.0000 0.0000 295 LEU A O     
2266 C CB    . LEU A 298 ? 1.1187 1.3936 1.0457 0.0000 0.0000 0.0000 295 LEU A CB    
2267 C CG    . LEU A 298 ? 1.0921 1.3574 1.0256 0.0000 0.0000 0.0000 295 LEU A CG    
2268 C CD1   . LEU A 298 ? 1.0665 1.3215 1.0132 0.0000 0.0000 0.0000 295 LEU A CD1   
2269 C CD2   . LEU A 298 ? 1.0985 1.3500 1.0064 0.0000 0.0000 0.0000 295 LEU A CD2   
2270 N N     . GLN A 299 ? 1.1312 1.4553 1.0996 0.0000 0.0000 0.0000 296 GLN A N     
2271 C CA    . GLN A 299 ? 1.1339 1.4788 1.1252 0.0000 0.0000 0.0000 296 GLN A CA    
2272 C C     . GLN A 299 ? 1.1181 1.4788 1.1436 0.0000 0.0000 0.0000 296 GLN A C     
2273 O O     . GLN A 299 ? 1.1050 1.4751 1.1543 0.0000 0.0000 0.0000 296 GLN A O     
2274 C CB    . GLN A 299 ? 1.1613 1.5219 1.1421 0.0000 0.0000 0.0000 296 GLN A CB    
2275 C CG    . GLN A 299 ? 1.2051 1.5513 1.1556 0.0000 0.0000 0.0000 296 GLN A CG    
2276 C CD    . GLN A 299 ? 1.2649 1.6196 1.1936 0.0000 0.0000 0.0000 296 GLN A CD    
2277 O OE1   . GLN A 299 ? 1.2801 1.6600 1.2263 0.0000 0.0000 0.0000 296 GLN A OE1   
2278 N NE2   . GLN A 299 ? 1.2875 1.6218 1.1780 0.0000 0.0000 0.0000 296 GLN A NE2   
2279 N N     . GLU A 300 ? 1.1237 1.4855 1.1501 0.0000 0.0000 0.0000 297 GLU A N     
2280 C CA    . GLU A 300 ? 1.1157 1.4870 1.1711 0.0000 0.0000 0.0000 297 GLU A CA    
2281 C C     . GLU A 300 ? 1.0864 1.4398 1.1503 0.0000 0.0000 0.0000 297 GLU A C     
2282 O O     . GLU A 300 ? 1.0742 1.4368 1.1639 0.0000 0.0000 0.0000 297 GLU A O     
2283 C CB    . GLU A 300 ? 1.1377 1.5079 1.1861 0.0000 0.0000 0.0000 297 GLU A CB    
2284 C CG    . GLU A 300 ? 1.1683 1.5358 1.2378 0.0000 0.0000 0.0000 297 GLU A CG    
2285 C CD    . GLU A 300 ? 1.2049 1.5985 1.3118 0.0000 0.0000 0.0000 297 GLU A CD    
2286 O OE1   . GLU A 300 ? 1.2266 1.6470 1.3448 0.0000 0.0000 0.0000 297 GLU A OE1   
2287 O OE2   . GLU A 300 ? 1.2122 1.5993 1.3368 0.0000 0.0000 0.0000 297 GLU A OE2   
2288 N N     . ILE A 301 ? 1.0760 1.4043 1.1179 0.0000 0.0000 0.0000 298 ILE A N     
2289 C CA    . ILE A 301 ? 1.0530 1.3630 1.0989 0.0000 0.0000 0.0000 298 ILE A CA    
2290 C C     . ILE A 301 ? 1.0358 1.3486 1.0913 0.0000 0.0000 0.0000 298 ILE A C     
2291 O O     . ILE A 301 ? 1.0256 1.3347 1.0966 0.0000 0.0000 0.0000 298 ILE A O     
2292 C CB    . ILE A 301 ? 1.0558 1.3421 1.0776 0.0000 0.0000 0.0000 298 ILE A CB    
2293 C CG1   . ILE A 301 ? 1.0747 1.3525 1.0910 0.0000 0.0000 0.0000 298 ILE A CG1   
2294 C CG2   . ILE A 301 ? 1.0358 1.3057 1.0597 0.0000 0.0000 0.0000 298 ILE A CG2   
2295 C CD1   . ILE A 301 ? 1.0987 1.3581 1.0909 0.0000 0.0000 0.0000 298 ILE A CD1   
2296 N N     . ARG A 302 ? 1.0337 1.3504 1.0779 0.0000 0.0000 0.0000 299 ARG A N     
2297 C CA    . ARG A 302 ? 1.0223 1.3368 1.0707 0.0000 0.0000 0.0000 299 ARG A CA    
2298 C C     . ARG A 302 ? 1.0180 1.3523 1.0952 0.0000 0.0000 0.0000 299 ARG A C     
2299 O O     . ARG A 302 ? 1.0072 1.3358 1.0920 0.0000 0.0000 0.0000 299 ARG A O     
2300 C CB    . ARG A 302 ? 1.0321 1.3440 1.0597 0.0000 0.0000 0.0000 299 ARG A CB    
2301 C CG    . ARG A 302 ? 1.0260 1.3151 1.0276 0.0000 0.0000 0.0000 299 ARG A CG    
2302 C CD    . ARG A 302 ? 1.0469 1.3349 1.0260 0.0000 0.0000 0.0000 299 ARG A CD    
2303 N NE    . ARG A 302 ? 1.0601 1.3267 1.0159 0.0000 0.0000 0.0000 299 ARG A NE    
2304 C CZ    . ARG A 302 ? 1.0742 1.3330 1.0059 0.0000 0.0000 0.0000 299 ARG A CZ    
2305 N NH1   . ARG A 302 ? 1.0855 1.3549 1.0106 0.0000 0.0000 0.0000 299 ARG A NH1   
2306 N NH2   . ARG A 302 ? 1.0625 1.3026 0.9767 0.0000 0.0000 0.0000 299 ARG A NH2   
2307 N N     . THR A 303 ? 1.0273 1.3855 1.1212 0.0000 0.0000 0.0000 300 THR A N     
2308 C CA    . THR A 303 ? 1.0263 1.4077 1.1517 0.0000 0.0000 0.0000 300 THR A CA    
2309 C C     . THR A 303 ? 1.0218 1.4035 1.1684 0.0000 0.0000 0.0000 300 THR A C     
2310 O O     . THR A 303 ? 1.0205 1.4153 1.1929 0.0000 0.0000 0.0000 300 THR A O     
2311 C CB    . THR A 303 ? 1.0354 1.4467 1.1726 0.0000 0.0000 0.0000 300 THR A CB    
2312 O OG1   . THR A 303 ? 1.0398 1.4579 1.1769 0.0000 0.0000 0.0000 300 THR A OG1   
2313 C CG2   . THR A 303 ? 1.0458 1.4534 1.1580 0.0000 0.0000 0.0000 300 THR A CG2   
2314 N N     . SER A 304 ? 1.0270 1.3927 1.1618 0.0000 0.0000 0.0000 301 SER A N     
2315 C CA    . SER A 304 ? 1.0280 1.3895 1.1784 0.0000 0.0000 0.0000 301 SER A CA    
2316 C C     . SER A 304 ? 1.0232 1.3582 1.1657 0.0000 0.0000 0.0000 301 SER A C     
2317 O O     . SER A 304 ? 1.0260 1.3523 1.1770 0.0000 0.0000 0.0000 301 SER A O     
2318 C CB    . SER A 304 ? 1.0371 1.3913 1.1769 0.0000 0.0000 0.0000 301 SER A CB    
2319 O OG    . SER A 304 ? 1.0422 1.3666 1.1573 0.0000 0.0000 0.0000 301 SER A OG    
2320 N N     . LEU A 305 ? 1.0226 1.3432 1.1474 0.0000 0.0000 0.0000 302 LEU A N     
2321 C CA    . LEU A 305 ? 1.0194 1.3132 1.1326 0.0000 0.0000 0.0000 302 LEU A CA    
2322 C C     . LEU A 305 ? 1.0226 1.3155 1.1528 0.0000 0.0000 0.0000 302 LEU A C     
2323 O O     . LEU A 305 ? 1.0223 1.3351 1.1725 0.0000 0.0000 0.0000 302 LEU A O     
2324 C CB    . LEU A 305 ? 1.0135 1.2949 1.1073 0.0000 0.0000 0.0000 302 LEU A CB    
2325 C CG    . LEU A 305 ? 1.0082 1.2817 1.0799 0.0000 0.0000 0.0000 302 LEU A CG    
2326 C CD1   . LEU A 305 ? 0.9932 1.2512 1.0483 0.0000 0.0000 0.0000 302 LEU A CD1   
2327 C CD2   . LEU A 305 ? 1.0079 1.2681 1.0722 0.0000 0.0000 0.0000 302 LEU A CD2   
2328 N N     . TYR A 306 ? 1.0342 1.3033 1.1555 0.0000 0.0000 0.0000 303 TYR A N     
2329 C CA    . TYR A 306 ? 1.0464 1.3077 1.1769 0.0000 0.0000 0.0000 303 TYR A CA    
2330 C C     . TYR A 306 ? 1.0468 1.3091 1.1782 0.0000 0.0000 0.0000 303 TYR A C     
2331 O O     . TYR A 306 ? 1.0435 1.2913 1.1556 0.0000 0.0000 0.0000 303 TYR A O     
2332 C CB    . TYR A 306 ? 1.0574 1.2868 1.1688 0.0000 0.0000 0.0000 303 TYR A CB    
2333 C CG    . TYR A 306 ? 1.0790 1.2938 1.1905 0.0000 0.0000 0.0000 303 TYR A CG    
2334 C CD1   . TYR A 306 ? 1.1046 1.3242 1.2337 0.0000 0.0000 0.0000 303 TYR A CD1   
2335 C CD2   . TYR A 306 ? 1.0877 1.2833 1.1809 0.0000 0.0000 0.0000 303 TYR A CD2   
2336 C CE1   . TYR A 306 ? 1.1182 1.3228 1.2450 0.0000 0.0000 0.0000 303 TYR A CE1   
2337 C CE2   . TYR A 306 ? 1.1060 1.2860 1.1957 0.0000 0.0000 0.0000 303 TYR A CE2   
2338 C CZ    . TYR A 306 ? 1.1226 1.3069 1.2285 0.0000 0.0000 0.0000 303 TYR A CZ    
2339 O OH    . TYR A 306 ? 1.1452 1.3128 1.2457 0.0000 0.0000 0.0000 303 TYR A OH    
2340 N N     . HIS A 307 ? 1.0560 1.3353 1.2109 0.0000 0.0000 0.0000 304 HIS A N     
2341 C CA    . HIS A 307 ? 1.0651 1.3431 1.2217 0.0000 0.0000 0.0000 304 HIS A CA    
2342 C C     . HIS A 307 ? 1.0614 1.3295 1.2257 0.0000 0.0000 0.0000 304 HIS A C     
2343 O O     . HIS A 307 ? 1.0647 1.3510 1.2546 0.0000 0.0000 0.0000 304 HIS A O     
2344 C CB    . HIS A 307 ? 1.0731 1.3816 1.2498 0.0000 0.0000 0.0000 304 HIS A CB    
2345 C CG    . HIS A 307 ? 1.1199 1.4242 1.2962 0.0000 0.0000 0.0000 304 HIS A CG    
2346 N ND1   . HIS A 307 ? 1.1472 1.4263 1.2963 0.0000 0.0000 0.0000 304 HIS A ND1   
2347 C CD2   . HIS A 307 ? 1.1526 1.4736 1.3527 0.0000 0.0000 0.0000 304 HIS A CD2   
2348 C CE1   . HIS A 307 ? 1.1668 1.4451 1.3206 0.0000 0.0000 0.0000 304 HIS A CE1   
2349 N NE2   . HIS A 307 ? 1.1765 1.4802 1.3613 0.0000 0.0000 0.0000 304 HIS A NE2   
2350 N N     . PRO A 308 ? 1.0592 1.2984 1.2008 0.0000 0.0000 0.0000 305 PRO A N     
2351 C CA    . PRO A 308 ? 1.0665 1.2881 1.2056 0.0000 0.0000 0.0000 305 PRO A CA    
2352 C C     . PRO A 308 ? 1.0674 1.3080 1.2311 0.0000 0.0000 0.0000 305 PRO A C     
2353 O O     . PRO A 308 ? 1.0623 1.3196 1.2350 0.0000 0.0000 0.0000 305 PRO A O     
2354 C CB    . PRO A 308 ? 1.0713 1.2605 1.1774 0.0000 0.0000 0.0000 305 PRO A CB    
2355 C CG    . PRO A 308 ? 1.0599 1.2578 1.1613 0.0000 0.0000 0.0000 305 PRO A CG    
2356 C CD    . PRO A 308 ? 1.0537 1.2756 1.1695 0.0000 0.0000 0.0000 305 PRO A CD    
2357 N N     . SER A 309 ? 1.0738 1.3118 1.2487 0.0000 0.0000 0.0000 306 SER A N     
2358 C CA    . SER A 309 ? 1.0779 1.3333 1.2771 0.0000 0.0000 0.0000 306 SER A CA    
2359 C C     . SER A 309 ? 1.0874 1.3114 1.2638 0.0000 0.0000 0.0000 306 SER A C     
2360 O O     . SER A 309 ? 1.1008 1.2906 1.2440 0.0000 0.0000 0.0000 306 SER A O     
2361 C CB    . SER A 309 ? 1.0803 1.3644 1.3174 0.0000 0.0000 0.0000 306 SER A CB    
2362 O OG    . SER A 309 ? 1.1041 1.3677 1.3318 0.0000 0.0000 0.0000 306 SER A OG    
2363 N N     . THR A 310 ? 1.0814 1.3162 1.2746 0.0000 0.0000 0.0000 307 THR A N     
2364 C CA    . THR A 310 ? 1.0889 1.2925 1.2580 0.0000 0.0000 0.0000 307 THR A CA    
2365 C C     . THR A 310 ? 1.0983 1.2820 1.2596 0.0000 0.0000 0.0000 307 THR A C     
2366 O O     . THR A 310 ? 1.0959 1.3001 1.2852 0.0000 0.0000 0.0000 307 THR A O     
2367 C CB    . THR A 310 ? 1.0914 1.3094 1.2787 0.0000 0.0000 0.0000 307 THR A CB    
2368 O OG1   . THR A 310 ? 1.0977 1.3451 1.3247 0.0000 0.0000 0.0000 307 THR A OG1   
2369 C CG2   . THR A 310 ? 1.0783 1.3156 1.2732 0.0000 0.0000 0.0000 307 THR A CG2   
2370 N N     . PRO A 311 ? 1.1112 1.2536 1.2331 0.0000 0.0000 0.0000 308 PRO A N     
2371 C CA    . PRO A 311 ? 1.1312 1.2469 1.2364 0.0000 0.0000 0.0000 308 PRO A CA    
2372 C C     . PRO A 311 ? 1.1483 1.2668 1.2684 0.0000 0.0000 0.0000 308 PRO A C     
2373 O O     . PRO A 311 ? 1.1449 1.2801 1.2821 0.0000 0.0000 0.0000 308 PRO A O     
2374 C CB    . PRO A 311 ? 1.1433 1.2158 1.1997 0.0000 0.0000 0.0000 308 PRO A CB    
2375 C CG    . PRO A 311 ? 1.1368 1.2127 1.1892 0.0000 0.0000 0.0000 308 PRO A CG    
2376 C CD    . PRO A 311 ? 1.1126 1.2301 1.2015 0.0000 0.0000 0.0000 308 PRO A CD    
2377 N N     . PRO A 312 ? 1.4335 1.3547 1.0604 0.0000 0.0000 0.0000 309 PRO A N     
2378 C CA    . PRO A 312 ? 1.4208 1.3513 1.0639 0.0000 0.0000 0.0000 309 PRO A CA    
2379 C C     . PRO A 312 ? 1.3611 1.3335 1.0566 0.0000 0.0000 0.0000 309 PRO A C     
2380 O O     . PRO A 312 ? 1.3493 1.3163 1.0506 0.0000 0.0000 0.0000 309 PRO A O     
2381 C CB    . PRO A 312 ? 1.4944 1.3409 1.0729 0.0000 0.0000 0.0000 309 PRO A CB    
2382 C CG    . PRO A 312 ? 1.5277 1.3256 1.0692 0.0000 0.0000 0.0000 309 PRO A CG    
2383 C CD    . PRO A 312 ? 1.5079 1.3469 1.0665 0.0000 0.0000 0.0000 309 PRO A CD    
2384 N N     . ALA A 313 ? 1.3284 1.3452 1.0604 0.0000 0.0000 0.0000 310 ALA A N     
2385 C CA    . ALA A 313 ? 1.2865 1.3356 1.0621 0.0000 0.0000 0.0000 310 ALA A CA    
2386 C C     . ALA A 313 ? 1.3122 1.3173 1.0630 0.0000 0.0000 0.0000 310 ALA A C     
2387 O O     . ALA A 313 ? 1.3653 1.3290 1.0736 0.0000 0.0000 0.0000 310 ALA A O     
2388 C CB    . ALA A 313 ? 1.2535 1.3593 1.0670 0.0000 0.0000 0.0000 310 ALA A CB    
2389 N N     . SER A 314 ? 1.2848 1.2964 1.0576 0.0000 0.0000 0.0000 311 SER A N     
2390 C CA    . SER A 314 ? 1.3036 1.2790 1.0544 0.0000 0.0000 0.0000 311 SER A CA    
2391 C C     . SER A 314 ? 1.2941 1.2922 1.0590 0.0000 0.0000 0.0000 311 SER A C     
2392 O O     . SER A 314 ? 1.2590 1.3104 1.0618 0.0000 0.0000 0.0000 311 SER A O     
2393 C CB    . SER A 314 ? 1.2758 1.2631 1.0499 0.0000 0.0000 0.0000 311 SER A CB    
2394 O OG    . SER A 314 ? 1.2212 1.2561 1.0450 0.0000 0.0000 0.0000 311 SER A OG    
2395 N N     . SER A 315 ? 1.3277 1.2881 1.0599 0.0000 0.0000 0.0000 312 SER A N     
2396 C CA    . SER A 315 ? 1.3312 1.3151 1.0684 0.0000 0.0000 0.0000 312 SER A CA    
2397 C C     . SER A 315 ? 1.2691 1.3250 1.0678 0.0000 0.0000 0.0000 312 SER A C     
2398 O O     . SER A 315 ? 1.2600 1.3638 1.0779 0.0000 0.0000 0.0000 312 SER A O     
2399 C CB    . SER A 315 ? 1.3730 1.3085 1.0692 0.0000 0.0000 0.0000 312 SER A CB    
2400 O OG    . SER A 315 ? 1.4518 1.3084 1.0880 0.0000 0.0000 0.0000 312 SER A OG    
2401 N N     . ARG A 316 ? 1.2330 1.2966 1.0596 0.0000 0.0000 0.0000 313 ARG A N     
2402 C CA    . ARG A 316 ? 1.1838 1.2964 1.0573 0.0000 0.0000 0.0000 313 ARG A CA    
2403 C C     . ARG A 316 ? 1.1481 1.2818 1.0555 0.0000 0.0000 0.0000 313 ARG A C     
2404 O O     . ARG A 316 ? 1.1279 1.2618 1.0542 0.0000 0.0000 0.0000 313 ARG A O     
2405 C CB    . ARG A 316 ? 1.1853 1.2842 1.0559 0.0000 0.0000 0.0000 313 ARG A CB    
2406 C CG    . ARG A 316 ? 1.2189 1.3074 1.0588 0.0000 0.0000 0.0000 313 ARG A CG    
2407 C CD    . ARG A 316 ? 1.2219 1.2979 1.0565 0.0000 0.0000 0.0000 313 ARG A CD    
2408 N NE    . ARG A 316 ? 1.2614 1.3186 1.0565 0.0000 0.0000 0.0000 313 ARG A NE    
2409 C CZ    . ARG A 316 ? 1.2739 1.3314 1.0623 0.0000 0.0000 0.0000 313 ARG A CZ    
2410 N NH1   . ARG A 316 ? 1.2560 1.3319 1.0764 0.0000 0.0000 0.0000 313 ARG A NH1   
2411 N NH2   . ARG A 316 ? 1.3154 1.3539 1.0621 0.0000 0.0000 0.0000 313 ARG A NH2   
2412 N N     . SER A 317 ? 1.1426 1.2936 1.0539 0.0000 0.0000 0.0000 314 SER A N     
2413 C CA    . SER A 317 ? 1.1193 1.2895 1.0565 0.0000 0.0000 0.0000 314 SER A CA    
2414 C C     . SER A 317 ? 1.0947 1.3094 1.0634 0.0000 0.0000 0.0000 314 SER A C     
2415 O O     . SER A 317 ? 1.0950 1.3369 1.0675 0.0000 0.0000 0.0000 314 SER A O     
2416 C CB    . SER A 317 ? 1.1351 1.2971 1.0537 0.0000 0.0000 0.0000 314 SER A CB    
2417 O OG    . SER A 317 ? 1.1728 1.3399 1.0720 0.0000 0.0000 0.0000 314 SER A OG    
2418 N N     . TRP A 318 ? 1.0769 1.2993 1.0649 0.0000 0.0000 0.0000 315 TRP A N     
2419 C CA    . TRP A 318 ? 1.0649 1.3211 1.0755 0.0000 0.0000 0.0000 315 TRP A CA    
2420 C C     . TRP A 318 ? 1.0686 1.3296 1.0801 0.0000 0.0000 0.0000 315 TRP A C     
2421 O O     . TRP A 318 ? 1.0736 1.3119 1.0735 0.0000 0.0000 0.0000 315 TRP A O     
2422 C CB    . TRP A 318 ? 1.0614 1.3078 1.0878 0.0000 0.0000 0.0000 315 TRP A CB    
2423 C CG    . TRP A 318 ? 1.0542 1.2671 1.0805 0.0000 0.0000 0.0000 315 TRP A CG    
2424 C CD1   . TRP A 318 ? 1.0465 1.2342 1.0644 0.0000 0.0000 0.0000 315 TRP A CD1   
2425 C CD2   . TRP A 318 ? 1.0612 1.2644 1.0930 0.0000 0.0000 0.0000 315 TRP A CD2   
2426 N NE1   . TRP A 318 ? 1.0472 1.2184 1.0685 0.0000 0.0000 0.0000 315 TRP A NE1   
2427 C CE2   . TRP A 318 ? 1.0617 1.2352 1.0884 0.0000 0.0000 0.0000 315 TRP A CE2   
2428 C CE3   . TRP A 318 ? 1.0858 1.3020 1.1227 0.0000 0.0000 0.0000 315 TRP A CE3   
2429 C CZ2   . TRP A 318 ? 1.0870 1.2379 1.1104 0.0000 0.0000 0.0000 315 TRP A CZ2   
2430 C CZ3   . TRP A 318 ? 1.1094 1.2949 1.1397 0.0000 0.0000 0.0000 315 TRP A CZ3   
2431 C CH2   . TRP A 318 ? 1.1109 1.2613 1.1331 0.0000 0.0000 0.0000 315 TRP A CH2   
2432 N N     . SER A 319 ? 1.0681 1.3637 1.0919 0.0000 0.0000 0.0000 316 SER A N     
2433 C CA    . SER A 319 ? 1.0722 1.3715 1.0945 0.0000 0.0000 0.0000 316 SER A CA    
2434 C C     . SER A 319 ? 1.0803 1.3903 1.1148 0.0000 0.0000 0.0000 316 SER A C     
2435 O O     . SER A 319 ? 1.0792 1.4179 1.1266 0.0000 0.0000 0.0000 316 SER A O     
2436 C CB    . SER A 319 ? 1.0755 1.4035 1.0878 0.0000 0.0000 0.0000 316 SER A CB    
2437 O OG    . SER A 319 ? 1.0799 1.3780 1.0717 0.0000 0.0000 0.0000 316 SER A OG    
2438 N N     . PRO A 320 ? 1.0940 1.3795 1.1204 0.0000 0.0000 0.0000 317 PRO A N     
2439 C CA    . PRO A 320 ? 1.1168 1.3871 1.1433 0.0000 0.0000 0.0000 317 PRO A CA    
2440 C C     . PRO A 320 ? 1.1235 1.4403 1.1544 0.0000 0.0000 0.0000 317 PRO A C     
2441 O O     . PRO A 320 ? 1.1249 1.4661 1.1499 0.0000 0.0000 0.0000 317 PRO A O     
2442 C CB    . PRO A 320 ? 1.1396 1.3623 1.1479 0.0000 0.0000 0.0000 317 PRO A CB    
2443 C CG    . PRO A 320 ? 1.1197 1.3566 1.1222 0.0000 0.0000 0.0000 317 PRO A CG    
2444 C CD    . PRO A 320 ? 1.0971 1.3715 1.1087 0.0000 0.0000 0.0000 317 PRO A CD    
2445 N N     . VAL A 321 ? 1.1252 1.4594 1.1665 0.0000 0.0000 0.0000 318 VAL A N     
2446 C CA    . VAL A 321 ? 1.1351 1.5189 1.1818 0.0000 0.0000 0.0000 318 VAL A CA    
2447 C C     . VAL A 321 ? 1.1796 1.5088 1.2051 0.0000 0.0000 0.0000 318 VAL A C     
2448 O O     . VAL A 321 ? 1.2016 1.4657 1.2152 0.0000 0.0000 0.0000 318 VAL A O     
2449 C CB    . VAL A 321 ? 1.1187 1.5632 1.1879 0.0000 0.0000 0.0000 318 VAL A CB    
2450 C CG1   . VAL A 321 ? 1.1494 1.6429 1.2245 0.0000 0.0000 0.0000 318 VAL A CG1   
2451 C CG2   . VAL A 321 ? 1.0829 1.5818 1.1637 0.0000 0.0000 0.0000 318 VAL A CG2   
2452 N N     . VAL A 322 ? 1.1958 1.5467 1.2118 0.0000 0.0000 0.0000 319 VAL A N     
2453 C CA    . VAL A 322 ? 1.2486 1.5412 1.2359 0.0000 0.0000 0.0000 319 VAL A CA    
2454 C C     . VAL A 322 ? 1.2656 1.5562 1.2569 0.0000 0.0000 0.0000 319 VAL A C     
2455 O O     . VAL A 322 ? 1.2462 1.6176 1.2617 0.0000 0.0000 0.0000 319 VAL A O     
2456 C CB    . VAL A 322 ? 1.2776 1.5999 1.2513 0.0000 0.0000 0.0000 319 VAL A CB    
2457 C CG1   . VAL A 322 ? 1.3517 1.5892 1.2821 0.0000 0.0000 0.0000 319 VAL A CG1   
2458 C CG2   . VAL A 322 ? 1.2478 1.5946 1.2226 0.0000 0.0000 0.0000 319 VAL A CG2   
2459 N N     . GLY A 323 ? 1.3015 1.5029 1.2673 0.0000 0.0000 0.0000 320 GLY A N     
2460 C CA    . GLY A 323 ? 1.3213 1.5068 1.2835 0.0000 0.0000 0.0000 320 GLY A CA    
2461 C C     . GLY A 323 ? 1.2747 1.4629 1.2581 0.0000 0.0000 0.0000 320 GLY A C     
2462 O O     . GLY A 323 ? 1.2956 1.4721 1.2765 0.0000 0.0000 0.0000 320 GLY A O     
2463 N N     . GLN A 324 ? 1.2137 1.4164 1.2144 0.0000 0.0000 0.0000 321 GLN A N     
2464 C CA    . GLN A 324 ? 1.1696 1.3717 1.1865 0.0000 0.0000 0.0000 321 GLN A CA    
2465 C C     . GLN A 324 ? 1.2016 1.3119 1.1945 0.0000 0.0000 0.0000 321 GLN A C     
2466 O O     . GLN A 324 ? 1.2437 1.2881 1.2088 0.0000 0.0000 0.0000 321 GLN A O     
2467 C CB    . GLN A 324 ? 1.1163 1.3433 1.1470 0.0000 0.0000 0.0000 321 GLN A CB    
2468 C CG    . GLN A 324 ? 1.0885 1.3422 1.1379 0.0000 0.0000 0.0000 321 GLN A CG    
2469 C CD    . GLN A 324 ? 1.0781 1.3433 1.1312 0.0000 0.0000 0.0000 321 GLN A CD    
2470 O OE1   . GLN A 324 ? 1.0896 1.3494 1.1344 0.0000 0.0000 0.0000 321 GLN A OE1   
2471 N NE2   . GLN A 324 ? 1.0600 1.3380 1.1212 0.0000 0.0000 0.0000 321 GLN A NE2   
2472 N N     . LEU A 325 ? 1.1843 1.2910 1.1852 0.0000 0.0000 0.0000 322 LEU A N     
2473 C CA    . LEU A 325 ? 1.2059 1.2323 1.1863 0.0000 0.0000 0.0000 322 LEU A CA    
2474 C C     . LEU A 325 ? 1.1554 1.1800 1.1464 0.0000 0.0000 0.0000 322 LEU A C     
2475 O O     . LEU A 325 ? 1.1035 1.1838 1.1187 0.0000 0.0000 0.0000 322 LEU A O     
2476 C CB    . LEU A 325 ? 1.2246 1.2441 1.2044 0.0000 0.0000 0.0000 322 LEU A CB    
2477 C CG    . LEU A 325 ? 1.3112 1.2675 1.2558 0.0000 0.0000 0.0000 322 LEU A CG    
2478 C CD1   . LEU A 325 ? 1.3298 1.3510 1.2832 0.0000 0.0000 0.0000 322 LEU A CD1   
2479 C CD2   . LEU A 325 ? 1.3544 1.2539 1.2819 0.0000 0.0000 0.0000 322 LEU A CD2   
2480 N N     . VAL A 326 ? 1.1750 1.1342 1.1439 0.0000 0.0000 0.0000 323 VAL A N     
2481 C CA    . VAL A 326 ? 1.1302 1.0957 1.1059 0.0000 0.0000 0.0000 323 VAL A CA    
2482 C C     . VAL A 326 ? 1.1641 1.0650 1.1192 0.0000 0.0000 0.0000 323 VAL A C     
2483 O O     . VAL A 326 ? 1.2279 1.0626 1.1521 0.0000 0.0000 0.0000 323 VAL A O     
2484 C CB    . VAL A 326 ? 1.1251 1.1076 1.0961 0.0000 0.0000 0.0000 323 VAL A CB    
2485 C CG1   . VAL A 326 ? 1.1366 1.0940 1.0956 0.0000 0.0000 0.0000 323 VAL A CG1   
2486 C CG2   . VAL A 326 ? 1.0669 1.1245 1.0637 0.0000 0.0000 0.0000 323 VAL A CG2   
2487 N N     . GLN A 327 ? 1.1240 1.0424 1.0922 0.0000 0.0000 0.0000 324 GLN A N     
2488 C CA    . GLN A 327 ? 1.1568 1.0271 1.1085 0.0000 0.0000 0.0000 324 GLN A CA    
2489 C C     . GLN A 327 ? 1.1321 1.0248 1.0884 0.0000 0.0000 0.0000 324 GLN A C     
2490 O O     . GLN A 327 ? 1.0742 1.0230 1.0529 0.0000 0.0000 0.0000 324 GLN A O     
2491 C CB    . GLN A 327 ? 1.1578 1.0233 1.1167 0.0000 0.0000 0.0000 324 GLN A CB    
2492 C CG    . GLN A 327 ? 1.1883 1.0322 1.1391 0.0000 0.0000 0.0000 324 GLN A CG    
2493 C CD    . GLN A 327 ? 1.1977 1.0523 1.1587 0.0000 0.0000 0.0000 324 GLN A CD    
2494 O OE1   . GLN A 327 ? 1.1753 1.0794 1.1557 0.0000 0.0000 0.0000 324 GLN A OE1   
2495 N NE2   . GLN A 327 ? 1.2435 1.0552 1.1901 0.0000 0.0000 0.0000 324 GLN A NE2   
2496 N N     . GLU A 328 ? 1.1835 1.0300 1.1139 0.0000 0.0000 0.0000 325 GLU A N     
2497 C CA    . GLU A 328 ? 1.1752 1.0472 1.1064 0.0000 0.0000 0.0000 325 GLU A CA    
2498 C C     . GLU A 328 ? 1.1609 1.0501 1.1029 0.0000 0.0000 0.0000 325 GLU A C     
2499 O O     . GLU A 328 ? 1.2054 1.0494 1.1340 0.0000 0.0000 0.0000 325 GLU A O     
2500 C CB    . GLU A 328 ? 1.2480 1.0650 1.1416 0.0000 0.0000 0.0000 325 GLU A CB    
2501 C CG    . GLU A 328 ? 1.2580 1.1165 1.1529 0.0000 0.0000 0.0000 325 GLU A CG    
2502 C CD    . GLU A 328 ? 1.3515 1.1571 1.2043 0.0000 0.0000 0.0000 325 GLU A CD    
2503 O OE1   . GLU A 328 ? 1.4352 1.1579 1.2506 0.0000 0.0000 0.0000 325 GLU A OE1   
2504 O OE2   . GLU A 328 ? 1.3427 1.1905 1.1966 0.0000 0.0000 0.0000 325 GLU A OE2   
2505 N N     . ARG A 329 ? 1.1064 1.0605 1.0697 0.0000 0.0000 0.0000 326 ARG A N     
2506 C CA    . ARG A 329 ? 1.0890 1.0726 1.0647 0.0000 0.0000 0.0000 326 ARG A CA    
2507 C C     . ARG A 329 ? 1.1345 1.0885 1.0885 0.0000 0.0000 0.0000 326 ARG A C     
2508 O O     . ARG A 329 ? 1.1602 1.1108 1.0985 0.0000 0.0000 0.0000 326 ARG A O     
2509 C CB    . ARG A 329 ? 1.0368 1.0979 1.0361 0.0000 0.0000 0.0000 326 ARG A CB    
2510 C CG    . ARG A 329 ? 1.0688 1.1712 1.0795 0.0000 0.0000 0.0000 326 ARG A CG    
2511 C CD    . ARG A 329 ? 1.0690 1.2339 1.1006 0.0000 0.0000 0.0000 326 ARG A CD    
2512 N NE    . ARG A 329 ? 1.0966 1.2830 1.1299 0.0000 0.0000 0.0000 326 ARG A NE    
2513 C CZ    . ARG A 329 ? 1.0899 1.2802 1.1269 0.0000 0.0000 0.0000 326 ARG A CZ    
2514 N NH1   . ARG A 329 ? 1.0903 1.2699 1.1310 0.0000 0.0000 0.0000 326 ARG A NH1   
2515 N NH2   . ARG A 329 ? 1.0782 1.2820 1.1116 0.0000 0.0000 0.0000 326 ARG A NH2   
2516 N N     . VAL A 330 ? 1.1499 1.0815 1.0996 0.0000 0.0000 0.0000 327 VAL A N     
2517 C CA    . VAL A 330 ? 1.1968 1.1078 1.1260 0.0000 0.0000 0.0000 327 VAL A CA    
2518 C C     . VAL A 330 ? 1.1590 1.1561 1.1070 0.0000 0.0000 0.0000 327 VAL A C     
2519 O O     . VAL A 330 ? 1.0996 1.1697 1.0783 0.0000 0.0000 0.0000 327 VAL A O     
2520 C CB    . VAL A 330 ? 1.2196 1.1075 1.1458 0.0000 0.0000 0.0000 327 VAL A CB    
2521 C CG1   . VAL A 330 ? 1.2748 1.1504 1.1796 0.0000 0.0000 0.0000 327 VAL A CG1   
2522 C CG2   . VAL A 330 ? 1.2612 1.0643 1.1646 0.0000 0.0000 0.0000 327 VAL A CG2   
2523 N N     . ALA A 331 ? 1.1974 1.1837 1.1226 0.0000 0.0000 0.0000 328 ALA A N     
2524 C CA    . ALA A 331 ? 1.1636 1.2351 1.1027 0.0000 0.0000 0.0000 328 ALA A CA    
2525 C C     . ALA A 331 ? 1.1384 1.2850 1.0993 0.0000 0.0000 0.0000 328 ALA A C     
2526 O O     . ALA A 331 ? 1.0783 1.3080 1.0713 0.0000 0.0000 0.0000 328 ALA A O     
2527 C CB    . ALA A 331 ? 1.2304 1.2663 1.1332 0.0000 0.0000 0.0000 328 ALA A CB    
2528 N N     . ARG A 332 ? 1.1852 1.3020 1.1255 0.0000 0.0000 0.0000 329 ARG A N     
2529 C CA    . ARG A 332 ? 1.1612 1.3580 1.1224 0.0000 0.0000 0.0000 329 ARG A CA    
2530 C C     . ARG A 332 ? 1.1706 1.3200 1.1277 0.0000 0.0000 0.0000 329 ARG A C     
2531 O O     . ARG A 332 ? 1.2386 1.3450 1.1692 0.0000 0.0000 0.0000 329 ARG A O     
2532 C CB    . ARG A 332 ? 1.2156 1.4438 1.1589 0.0000 0.0000 0.0000 329 ARG A CB    
2533 N N     . PRO A 333 ? 1.1030 1.2591 1.0827 0.0000 0.0000 0.0000 330 PRO A N     
2534 C CA    . PRO A 333 ? 1.1141 1.2097 1.0846 0.0000 0.0000 0.0000 330 PRO A CA    
2535 C C     . PRO A 333 ? 1.1171 1.2607 1.0956 0.0000 0.0000 0.0000 330 PRO A C     
2536 O O     . PRO A 333 ? 1.0667 1.3133 1.0769 0.0000 0.0000 0.0000 330 PRO A O     
2537 C CB    . PRO A 333 ? 1.0434 1.1595 1.0390 0.0000 0.0000 0.0000 330 PRO A CB    
2538 C CG    . PRO A 333 ? 1.0002 1.1730 1.0130 0.0000 0.0000 0.0000 330 PRO A CG    
2539 C CD    . PRO A 333 ? 1.0225 1.2512 1.0351 0.0000 0.0000 0.0000 330 PRO A CD    
2540 N N     . ALA A 334 ? 1.1817 1.2501 1.1285 0.0000 0.0000 0.0000 331 ALA A N     
2541 C CA    . ALA A 334 ? 1.1958 1.3032 1.1461 0.0000 0.0000 0.0000 331 ALA A CA    
2542 C C     . ALA A 334 ? 1.1356 1.2865 1.1144 0.0000 0.0000 0.0000 331 ALA A C     
2543 O O     . ALA A 334 ? 1.1033 1.2174 1.0857 0.0000 0.0000 0.0000 331 ALA A O     
2544 C CB    . ALA A 334 ? 1.2999 1.2979 1.2005 0.0000 0.0000 0.0000 331 ALA A CB    
2545 N N     . SER A 335 ? 1.1208 1.3560 1.1187 0.0000 0.0000 0.0000 332 SER A N     
2546 C CA    . SER A 335 ? 1.0741 1.3545 1.0940 0.0000 0.0000 0.0000 332 SER A CA    
2547 C C     . SER A 335 ? 1.1044 1.2853 1.1007 0.0000 0.0000 0.0000 332 SER A C     
2548 O O     . SER A 335 ? 1.1789 1.2882 1.1432 0.0000 0.0000 0.0000 332 SER A O     
2549 C CB    . SER A 335 ? 1.0797 1.4569 1.1156 0.0000 0.0000 0.0000 332 SER A CB    
2550 O OG    . SER A 335 ? 1.0610 1.4540 1.1045 0.0000 0.0000 0.0000 332 SER A OG    
2551 N N     . LEU A 336 ? 1.0504 1.2261 1.0587 0.0000 0.0000 0.0000 333 LEU A N     
2552 C CA    . LEU A 336 ? 1.0634 1.1685 1.0553 0.0000 0.0000 0.0000 333 LEU A CA    
2553 C C     . LEU A 336 ? 1.1074 1.1032 1.0696 0.0000 0.0000 0.0000 333 LEU A C     
2554 O O     . LEU A 336 ? 1.1410 1.0730 1.0839 0.0000 0.0000 0.0000 333 LEU A O     
2555 C CB    . LEU A 336 ? 1.1056 1.2057 1.0849 0.0000 0.0000 0.0000 333 LEU A CB    
2556 C CG    . LEU A 336 ? 1.0511 1.2499 1.0566 0.0000 0.0000 0.0000 333 LEU A CG    
2557 C CD1   . LEU A 336 ? 1.0959 1.2787 1.0838 0.0000 0.0000 0.0000 333 LEU A CD1   
2558 C CD2   . LEU A 336 ? 0.9855 1.1981 1.0035 0.0000 0.0000 0.0000 333 LEU A CD2   
2559 N N     . ARG A 337 ? 1.1097 1.0877 1.0669 0.0000 0.0000 0.0000 334 ARG A N     
2560 C CA    . ARG A 337 ? 1.1511 1.0291 1.0776 0.0000 0.0000 0.0000 334 ARG A CA    
2561 C C     . ARG A 337 ? 1.0938 0.9917 1.0394 0.0000 0.0000 0.0000 334 ARG A C     
2562 O O     . ARG A 337 ? 1.0299 1.0083 1.0054 0.0000 0.0000 0.0000 334 ARG A O     
2563 C CB    . ARG A 337 ? 1.2221 1.0452 1.1148 0.0000 0.0000 0.0000 334 ARG A CB    
2564 C CG    . ARG A 337 ? 1.2807 1.0719 1.1471 0.0000 0.0000 0.0000 334 ARG A CG    
2565 C CD    . ARG A 337 ? 1.3836 1.0465 1.1907 0.0000 0.0000 0.0000 334 ARG A CD    
2566 N NE    . ARG A 337 ? 1.4519 1.0528 1.2226 0.0000 0.0000 0.0000 334 ARG A NE    
2567 C CZ    . ARG A 337 ? 1.4564 1.0157 1.2168 0.0000 0.0000 0.0000 334 ARG A CZ    
2568 N NH1   . ARG A 337 ? 1.3972 0.9775 1.1830 0.0000 0.0000 0.0000 334 ARG A NH1   
2569 N NH2   . ARG A 337 ? 1.5182 1.0180 1.2411 0.0000 0.0000 0.0000 334 ARG A NH2   
2570 N N     . PRO A 338 ? 1.1225 0.9496 1.0492 0.0000 0.0000 0.0000 335 PRO A N     
2571 C CA    . PRO A 338 ? 1.0745 0.9263 1.0203 0.0000 0.0000 0.0000 335 PRO A CA    
2572 C C     . PRO A 338 ? 1.0480 0.9480 1.0094 0.0000 0.0000 0.0000 335 PRO A C     
2573 O O     . PRO A 338 ? 1.0848 0.9659 1.0305 0.0000 0.0000 0.0000 335 PRO A O     
2574 C CB    . PRO A 338 ? 1.1240 0.8899 1.0404 0.0000 0.0000 0.0000 335 PRO A CB    
2575 C CG    . PRO A 338 ? 1.1856 0.8910 1.0741 0.0000 0.0000 0.0000 335 PRO A CG    
2576 C CD    . PRO A 338 ? 1.2078 0.9321 1.0934 0.0000 0.0000 0.0000 335 PRO A CD    
2577 N N     . ARG A 339 ? 0.9991 0.9581 0.9871 0.0000 0.0000 0.0000 336 ARG A N     
2578 C CA    . ARG A 339 ? 0.9853 0.9899 0.9861 0.0000 0.0000 0.0000 336 ARG A CA    
2579 C C     . ARG A 339 ? 1.0033 0.9689 0.9928 0.0000 0.0000 0.0000 336 ARG A C     
2580 O O     . ARG A 339 ? 0.9792 0.9777 0.9763 0.0000 0.0000 0.0000 336 ARG A O     
2581 C CB    . ARG A 339 ? 0.9231 0.9998 0.9489 0.0000 0.0000 0.0000 336 ARG A CB    
2582 C CG    . ARG A 339 ? 0.9391 1.0684 0.9766 0.0000 0.0000 0.0000 336 ARG A CG    
2583 C CD    . ARG A 339 ? 0.9807 1.1718 1.0276 0.0000 0.0000 0.0000 336 ARG A CD    
2584 N NE    . ARG A 339 ? 1.0038 1.2531 1.0621 0.0000 0.0000 0.0000 336 ARG A NE    
2585 C CZ    . ARG A 339 ? 1.0616 1.3095 1.1143 0.0000 0.0000 0.0000 336 ARG A CZ    
2586 N NH1   . ARG A 339 ? 1.1235 1.3017 1.1536 0.0000 0.0000 0.0000 336 ARG A NH1   
2587 N NH2   . ARG A 339 ? 1.0662 1.3801 1.1321 0.0000 0.0000 0.0000 336 ARG A NH2   
2588 N N     . TRP A 340 ? 1.0558 0.9543 1.0254 0.0000 0.0000 0.0000 337 TRP A N     
2589 C CA    . TRP A 340 ? 1.0790 0.9445 1.0372 0.0000 0.0000 0.0000 337 TRP A CA    
2590 C C     . TRP A 340 ? 1.1652 0.9422 1.0857 0.0000 0.0000 0.0000 337 TRP A C     
2591 O O     . TRP A 340 ? 1.2102 0.9427 1.1143 0.0000 0.0000 0.0000 337 TRP A O     
2592 C CB    . TRP A 340 ? 1.0397 0.9282 1.0143 0.0000 0.0000 0.0000 337 TRP A CB    
2593 C CG    . TRP A 340 ? 0.9948 0.9515 0.9951 0.0000 0.0000 0.0000 337 TRP A CG    
2594 C CD1   . TRP A 340 ? 0.9756 0.9662 0.9887 0.0000 0.0000 0.0000 337 TRP A CD1   
2595 C CD2   . TRP A 340 ? 0.9845 0.9785 0.9948 0.0000 0.0000 0.0000 337 TRP A CD2   
2596 N NE1   . TRP A 340 ? 0.9456 0.9860 0.9726 0.0000 0.0000 0.0000 337 TRP A NE1   
2597 C CE2   . TRP A 340 ? 0.9437 0.9863 0.9693 0.0000 0.0000 0.0000 337 TRP A CE2   
2598 C CE3   . TRP A 340 ? 1.0098 0.9978 1.0138 0.0000 0.0000 0.0000 337 TRP A CE3   
2599 C CZ2   . TRP A 340 ? 0.9217 1.0002 0.9536 0.0000 0.0000 0.0000 337 TRP A CZ2   
2600 C CZ3   . TRP A 340 ? 0.9694 1.0014 0.9841 0.0000 0.0000 0.0000 337 TRP A CZ3   
2601 C CH2   . TRP A 340 ? 0.9319 1.0053 0.9592 0.0000 0.0000 0.0000 337 TRP A CH2   
2602 N N     . HIS A 341 ? 1.1986 0.9461 1.1010 0.0000 0.0000 0.0000 338 HIS A N     
2603 C CA    . HIS A 341 ? 1.2935 0.9476 1.1520 0.0000 0.0000 0.0000 338 HIS A CA    
2604 C C     . HIS A 341 ? 1.2990 0.9374 1.1577 0.0000 0.0000 0.0000 338 HIS A C     
2605 O O     . HIS A 341 ? 1.2300 0.9357 1.1240 0.0000 0.0000 0.0000 338 HIS A O     
2606 C CB    . HIS A 341 ? 1.3266 0.9586 1.1629 0.0000 0.0000 0.0000 338 HIS A CB    
2607 C CG    . HIS A 341 ? 1.3597 0.9934 1.1837 0.0000 0.0000 0.0000 338 HIS A CG    
2608 N ND1   . HIS A 341 ? 1.4536 1.0167 1.2387 0.0000 0.0000 0.0000 338 HIS A ND1   
2609 C CD2   . HIS A 341 ? 1.3235 1.0241 1.1667 0.0000 0.0000 0.0000 338 HIS A CD2   
2610 C CE1   . HIS A 341 ? 1.4583 1.0522 1.2419 0.0000 0.0000 0.0000 338 HIS A CE1   
2611 N NE2   . HIS A 341 ? 1.3812 1.0612 1.2009 0.0000 0.0000 0.0000 338 HIS A NE2   
2612 N N     . LYS A 342 ? 1.3876 0.9379 1.2034 0.0000 0.0000 0.0000 339 LYS A N     
2613 C CA    . LYS A 342 ? 1.4049 0.9406 1.2158 0.0000 0.0000 0.0000 339 LYS A CA    
2614 C C     . LYS A 342 ? 1.3661 0.9537 1.1960 0.0000 0.0000 0.0000 339 LYS A C     
2615 O O     . LYS A 342 ? 1.3383 0.9550 1.1770 0.0000 0.0000 0.0000 339 LYS A O     
2616 C CB    . LYS A 342 ? 1.5150 0.9354 1.2670 0.0000 0.0000 0.0000 339 LYS A CB    
2617 N N     . PRO A 343 ? 1.3663 0.9752 1.2041 0.0000 0.0000 0.0000 340 PRO A N     
2618 C CA    . PRO A 343 ? 1.3214 0.9985 1.1841 0.0000 0.0000 0.0000 340 PRO A CA    
2619 C C     . PRO A 343 ? 1.3745 1.0090 1.2057 0.0000 0.0000 0.0000 340 PRO A C     
2620 O O     . PRO A 343 ? 1.4635 1.0055 1.2465 0.0000 0.0000 0.0000 340 PRO A O     
2621 C CB    . PRO A 343 ? 1.3031 1.0259 1.1837 0.0000 0.0000 0.0000 340 PRO A CB    
2622 C CG    . PRO A 343 ? 1.3017 1.0158 1.1864 0.0000 0.0000 0.0000 340 PRO A CG    
2623 C CD    . PRO A 343 ? 1.3811 0.9861 1.2189 0.0000 0.0000 0.0000 340 PRO A CD    
2624 N N     . SER A 344 ? 1.3289 1.0266 1.1828 0.0000 0.0000 0.0000 341 SER A N     
2625 C CA    . SER A 344 ? 1.3766 1.0479 1.2039 0.0000 0.0000 0.0000 341 SER A CA    
2626 C C     . SER A 344 ? 1.3322 1.0834 1.1865 0.0000 0.0000 0.0000 341 SER A C     
2627 O O     . SER A 344 ? 1.2609 1.0939 1.1575 0.0000 0.0000 0.0000 341 SER A O     
2628 C CB    . SER A 344 ? 1.3600 1.0339 1.1864 0.0000 0.0000 0.0000 341 SER A CB    
2629 O OG    . SER A 344 ? 1.4114 1.0252 1.2155 0.0000 0.0000 0.0000 341 SER A OG    
2630 N N     . THR A 345 ? 1.3834 1.1100 1.2098 0.0000 0.0000 0.0000 342 THR A N     
2631 C CA    . THR A 345 ? 1.3433 1.1503 1.1932 0.0000 0.0000 0.0000 342 THR A CA    
2632 C C     . THR A 345 ? 1.3143 1.1514 1.1699 0.0000 0.0000 0.0000 342 THR A C     
2633 O O     . THR A 345 ? 1.3622 1.1391 1.1848 0.0000 0.0000 0.0000 342 THR A O     
2634 C CB    . THR A 345 ? 1.4171 1.1914 1.2336 0.0000 0.0000 0.0000 342 THR A CB    
2635 O OG1   . THR A 345 ? 1.4680 1.1851 1.2636 0.0000 0.0000 0.0000 342 THR A OG1   
2636 C CG2   . THR A 345 ? 1.3691 1.2484 1.2191 0.0000 0.0000 0.0000 342 THR A CG2   
2637 N N     . VAL A 346 ? 1.2433 1.1732 1.1377 0.0000 0.0000 0.0000 343 VAL A N     
2638 C CA    . VAL A 346 ? 1.2196 1.1863 1.1176 0.0000 0.0000 0.0000 343 VAL A CA    
2639 C C     . VAL A 346 ? 1.2789 1.2368 1.1497 0.0000 0.0000 0.0000 343 VAL A C     
2640 O O     . VAL A 346 ? 1.2906 1.2827 1.1680 0.0000 0.0000 0.0000 343 VAL A O     
2641 C CB    . VAL A 346 ? 1.1371 1.1979 1.0777 0.0000 0.0000 0.0000 343 VAL A CB    
2642 C CG1   . VAL A 346 ? 1.1178 1.2171 1.0583 0.0000 0.0000 0.0000 343 VAL A CG1   
2643 C CG2   . VAL A 346 ? 1.0919 1.1574 1.0528 0.0000 0.0000 0.0000 343 VAL A CG2   
2644 N N     . LEU A 347 ? 1.3196 1.2381 1.1592 0.0000 0.0000 0.0000 344 LEU A N     
2645 C CA    . LEU A 347 ? 1.3817 1.2831 1.1876 0.0000 0.0000 0.0000 344 LEU A CA    
2646 C C     . LEU A 347 ? 1.3439 1.3256 1.1676 0.0000 0.0000 0.0000 344 LEU A C     
2647 O O     . LEU A 347 ? 1.3501 1.3830 1.1807 0.0000 0.0000 0.0000 344 LEU A O     
2648 C CB    . LEU A 347 ? 1.4683 1.2624 1.2154 0.0000 0.0000 0.0000 344 LEU A CB    
2649 C CG    . LEU A 347 ? 1.5407 1.2389 1.2523 0.0000 0.0000 0.0000 344 LEU A CG    
2650 C CD1   . LEU A 347 ? 1.6288 1.2180 1.2787 0.0000 0.0000 0.0000 344 LEU A CD1   
2651 C CD2   . LEU A 347 ? 1.5859 1.2855 1.2851 0.0000 0.0000 0.0000 344 LEU A CD2   
2652 N N     . LYS A 348 ? 1.3135 1.3092 1.1432 0.0000 0.0000 0.0000 345 LYS A N     
2653 C CA    . LYS A 348 ? 1.2716 1.3445 1.1197 0.0000 0.0000 0.0000 345 LYS A CA    
2654 C C     . LYS A 348 ? 1.2068 1.3178 1.0873 0.0000 0.0000 0.0000 345 LYS A C     
2655 O O     . LYS A 348 ? 1.2028 1.2745 1.0817 0.0000 0.0000 0.0000 345 LYS A O     
2656 C CB    . LYS A 348 ? 1.3146 1.3617 1.1232 0.0000 0.0000 0.0000 345 LYS A CB    
2657 N N     . VAL A 349 ? 1.1643 1.3507 1.0711 0.0000 0.0000 0.0000 346 VAL A N     
2658 C CA    . VAL A 349 ? 1.1161 1.3325 1.0437 0.0000 0.0000 0.0000 346 VAL A CA    
2659 C C     . VAL A 349 ? 1.1253 1.3597 1.0378 0.0000 0.0000 0.0000 346 VAL A C     
2660 O O     . VAL A 349 ? 1.1135 1.4003 1.0312 0.0000 0.0000 0.0000 346 VAL A O     
2661 C CB    . VAL A 349 ? 1.0657 1.3421 1.0256 0.0000 0.0000 0.0000 346 VAL A CB    
2662 C CG1   . VAL A 349 ? 1.0225 1.3227 0.9919 0.0000 0.0000 0.0000 346 VAL A CG1   
2663 C CG2   . VAL A 349 ? 1.0603 1.3187 1.0340 0.0000 0.0000 0.0000 346 VAL A CG2   
2664 N N     . LEU A 350 ? 1.1527 1.3474 1.0455 0.0000 0.0000 0.0000 347 LEU A N     
2665 C CA    . LEU A 350 ? 1.1683 1.3782 1.0423 0.0000 0.0000 0.0000 347 LEU A CA    
2666 C C     . LEU A 350 ? 1.1268 1.3894 1.0175 0.0000 0.0000 0.0000 347 LEU A C     
2667 O O     . LEU A 350 ? 1.1357 1.4267 1.0136 0.0000 0.0000 0.0000 347 LEU A O     
2668 C CB    . LEU A 350 ? 1.1960 1.3627 1.0490 0.0000 0.0000 0.0000 347 LEU A CB    
2669 C CG    . LEU A 350 ? 1.2688 1.3694 1.0875 0.0000 0.0000 0.0000 347 LEU A CG    
2670 C CD1   . LEU A 350 ? 1.2955 1.3580 1.1013 0.0000 0.0000 0.0000 347 LEU A CD1   
2671 C CD2   . LEU A 350 ? 1.3206 1.4195 1.1054 0.0000 0.0000 0.0000 347 LEU A CD2   
2672 N N     . ASN A 351 ? 1.0936 1.3632 1.0076 0.0000 0.0000 0.0000 348 ASN A N     
2673 C CA    . ASN A 351 ? 1.0643 1.3689 0.9876 0.0000 0.0000 0.0000 348 ASN A CA    
2674 C C     . ASN A 351 ? 1.0382 1.3326 0.9814 0.0000 0.0000 0.0000 348 ASN A C     
2675 O O     . ASN A 351 ? 1.0469 1.3107 0.9964 0.0000 0.0000 0.0000 348 ASN A O     
2676 C CB    . ASN A 351 ? 1.0671 1.3766 0.9742 0.0000 0.0000 0.0000 348 ASN A CB    
2677 C CG    . ASN A 351 ? 1.0669 1.3519 0.9757 0.0000 0.0000 0.0000 348 ASN A CG    
2678 O OD1   . ASN A 351 ? 1.0617 1.3325 0.9861 0.0000 0.0000 0.0000 348 ASN A OD1   
2679 N ND2   . ASN A 351 ? 1.0836 1.3712 0.9759 0.0000 0.0000 0.0000 348 ASN A ND2   
2680 N N     . PRO A 352 ? 1.0153 1.3291 0.9634 0.0000 0.0000 0.0000 349 PRO A N     
2681 C CA    . PRO A 352 ? 0.9958 1.2998 0.9585 0.0000 0.0000 0.0000 349 PRO A CA    
2682 C C     . PRO A 352 ? 0.9886 1.2579 0.9540 0.0000 0.0000 0.0000 349 PRO A C     
2683 O O     . PRO A 352 ? 0.9764 1.2348 0.9532 0.0000 0.0000 0.0000 349 PRO A O     
2684 C CB    . PRO A 352 ? 0.9882 1.3068 0.9419 0.0000 0.0000 0.0000 349 PRO A CB    
2685 C CG    . PRO A 352 ? 1.0027 1.3494 0.9439 0.0000 0.0000 0.0000 349 PRO A CG    
2686 C CD    . PRO A 352 ? 1.0140 1.3506 0.9480 0.0000 0.0000 0.0000 349 PRO A CD    
2687 N N     . ARG A 353 ? 0.9950 1.2534 0.9496 0.0000 0.0000 0.0000 350 ARG A N     
2688 C CA    . ARG A 353 ? 0.9866 1.2244 0.9446 0.0000 0.0000 0.0000 350 ARG A CA    
2689 C C     . ARG A 353 ? 1.0093 1.2255 0.9632 0.0000 0.0000 0.0000 350 ARG A C     
2690 O O     . ARG A 353 ? 1.0109 1.2147 0.9675 0.0000 0.0000 0.0000 350 ARG A O     
2691 C CB    . ARG A 353 ? 0.9761 1.2260 0.9239 0.0000 0.0000 0.0000 350 ARG A CB    
2692 C CG    . ARG A 353 ? 0.9533 1.1985 0.9002 0.0000 0.0000 0.0000 350 ARG A CG    
2693 C CD    . ARG A 353 ? 0.9535 1.2017 0.8849 0.0000 0.0000 0.0000 350 ARG A CD    
2694 N NE    . ARG A 353 ? 0.9499 1.2026 0.8880 0.0000 0.0000 0.0000 350 ARG A NE    
2695 C CZ    . ARG A 353 ? 0.9367 1.1774 0.8860 0.0000 0.0000 0.0000 350 ARG A CZ    
2696 N NH1   . ARG A 353 ? 0.9221 1.1421 0.8764 0.0000 0.0000 0.0000 350 ARG A NH1   
2697 N NH2   . ARG A 353 ? 0.9241 1.1799 0.8793 0.0000 0.0000 0.0000 350 ARG A NH2   
2698 N N     . THR A 354 ? 1.0327 1.2425 0.9765 0.0000 0.0000 0.0000 351 THR A N     
2699 C CA    . THR A 354 ? 1.0729 1.2488 1.0012 0.0000 0.0000 0.0000 351 THR A CA    
2700 C C     . THR A 354 ? 1.1026 1.2507 1.0257 0.0000 0.0000 0.0000 351 THR A C     
2701 O O     . THR A 354 ? 1.1012 1.2737 1.0278 0.0000 0.0000 0.0000 351 THR A O     
2702 C CB    . THR A 354 ? 1.0951 1.2836 1.0018 0.0000 0.0000 0.0000 351 THR A CB    
2703 O OG1   . THR A 354 ? 1.0708 1.2988 0.9824 0.0000 0.0000 0.0000 351 THR A OG1   
2704 C CG2   . THR A 354 ? 1.1343 1.2884 1.0224 0.0000 0.0000 0.0000 351 THR A CG2   
2705 N N     . VAL A 355 ? 1.1339 1.2318 1.0457 0.0000 0.0000 0.0000 352 VAL A N     
2706 C CA    . VAL A 355 ? 1.1598 1.2243 1.0655 0.0000 0.0000 0.0000 352 VAL A CA    
2707 C C     . VAL A 355 ? 1.2310 1.2252 1.1007 0.0000 0.0000 0.0000 352 VAL A C     
2708 O O     . VAL A 355 ? 1.2459 1.2148 1.1042 0.0000 0.0000 0.0000 352 VAL A O     
2709 C CB    . VAL A 355 ? 1.1268 1.1964 1.0582 0.0000 0.0000 0.0000 352 VAL A CB    
2710 C CG1   . VAL A 355 ? 1.1757 1.1901 1.0942 0.0000 0.0000 0.0000 352 VAL A CG1   
2711 C CG2   . VAL A 355 ? 1.0834 1.2092 1.0377 0.0000 0.0000 0.0000 352 VAL A CG2   
2712 N N     . VAL A 356 ? 1.2825 1.2459 1.1306 0.0000 0.0000 0.0000 353 VAL A N     
2713 C CA    . VAL A 356 ? 1.3670 1.2441 1.1720 0.0000 0.0000 0.0000 353 VAL A CA    
2714 C C     . VAL A 356 ? 1.3875 1.2295 1.1963 0.0000 0.0000 0.0000 353 VAL A C     
2715 O O     . VAL A 356 ? 1.3668 1.2421 1.1931 0.0000 0.0000 0.0000 353 VAL A O     
2716 C CB    . VAL A 356 ? 1.4273 1.2755 1.1917 0.0000 0.0000 0.0000 353 VAL A CB    
2717 C CG1   . VAL A 356 ? 1.5236 1.2668 1.2329 0.0000 0.0000 0.0000 353 VAL A CG1   
2718 C CG2   . VAL A 356 ? 1.4058 1.2977 1.1671 0.0000 0.0000 0.0000 353 VAL A CG2   
2719 N N     . ILE A 357 ? 1.4298 1.2104 1.2220 0.0000 0.0000 0.0000 354 ILE A N     
2720 C CA    . ILE A 357 ? 1.4633 1.2023 1.2531 0.0000 0.0000 0.0000 354 ILE A CA    
2721 C C     . ILE A 357 ? 1.5837 1.2131 1.3141 0.0000 0.0000 0.0000 354 ILE A C     
2722 O O     . ILE A 357 ? 1.6352 1.2141 1.3287 0.0000 0.0000 0.0000 354 ILE A O     
2723 C CB    . ILE A 357 ? 1.4143 1.1694 1.2336 0.0000 0.0000 0.0000 354 ILE A CB    
2724 C CG1   . ILE A 357 ? 1.4262 1.1579 1.2313 0.0000 0.0000 0.0000 354 ILE A CG1   
2725 C CG2   . ILE A 357 ? 1.3174 1.1640 1.1873 0.0000 0.0000 0.0000 354 ILE A CG2   
2726 C CD1   . ILE A 357 ? 1.4084 1.1346 1.2289 0.0000 0.0000 0.0000 354 ILE A CD1   
2727 N N     . LEU A 358 ? 1.6385 1.2315 1.3563 0.0000 0.0000 0.0000 355 LEU A N     
2728 C CA    . LEU A 358 ? 1.7670 1.2420 1.4250 0.0000 0.0000 0.0000 355 LEU A CA    
2729 C C     . LEU A 358 ? 1.7774 1.2242 1.4433 0.0000 0.0000 0.0000 355 LEU A C     
2730 O O     . LEU A 358 ? 1.7306 1.2191 1.4322 0.0000 0.0000 0.0000 355 LEU A O     
2731 C CB    . LEU A 358 ? 1.8144 1.2671 1.4530 0.0000 0.0000 0.0000 355 LEU A CB    
2732 C CG    . LEU A 358 ? 1.9426 1.2599 1.5079 0.0000 0.0000 0.0000 355 LEU A CG    
2733 C CD1   . LEU A 358 ? 2.0199 1.2450 1.5224 0.0000 0.0000 0.0000 355 LEU A CD1   
2734 C CD2   . LEU A 358 ? 1.9810 1.2980 1.5308 0.0000 0.0000 0.0000 355 LEU A CD2   
2735 N N     . ASP A 359 ? 1.8502 1.2298 1.4809 0.0000 0.0000 0.0000 356 ASP A N     
2736 C CA    . ASP A 359 ? 1.8455 1.2234 1.4920 0.0000 0.0000 0.0000 356 ASP A CA    
2737 C C     . ASP A 359 ? 1.9481 1.2183 1.5482 0.0000 0.0000 0.0000 356 ASP A C     
2738 O O     . ASP A 359 ? 1.9987 1.2226 1.5765 0.0000 0.0000 0.0000 356 ASP A O     
2739 C CB    . ASP A 359 ? 1.8369 1.2333 1.4828 0.0000 0.0000 0.0000 356 ASP A CB    
2740 C CG    . ASP A 359 ? 1.9760 1.2612 1.5478 0.0000 0.0000 0.0000 356 ASP A CG    
2741 O OD1   . ASP A 359 ? 2.0025 1.2972 1.5688 0.0000 0.0000 0.0000 356 ASP A OD1   
2742 O OD2   . ASP A 359 ? 2.0812 1.2693 1.5966 0.0000 0.0000 0.0000 356 ASP A OD2   
2743 N N     . HIS A 360 ? 1.9842 1.2197 1.5688 0.0000 0.0000 0.0000 357 HIS A N     
2744 C CA    . HIS A 360 ? 2.0805 1.2154 1.6206 0.0000 0.0000 0.0000 357 HIS A CA    
2745 C C     . HIS A 360 ? 2.2157 1.2201 1.6707 0.0000 0.0000 0.0000 357 HIS A C     
2746 O O     . HIS A 360 ? 2.2338 1.2341 1.6774 0.0000 0.0000 0.0000 357 HIS A O     
2747 C CB    . HIS A 360 ? 2.0163 1.2133 1.6012 0.0000 0.0000 0.0000 357 HIS A CB    
2748 C CG    . HIS A 360 ? 1.9479 1.2445 1.5759 0.0000 0.0000 0.0000 357 HIS A CG    
2749 N ND1   . HIS A 360 ? 1.9807 1.2748 1.5974 0.0000 0.0000 0.0000 357 HIS A ND1   
2750 C CD2   . HIS A 360 ? 1.8534 1.2560 1.5331 0.0000 0.0000 0.0000 357 HIS A CD2   
2751 C CE1   . HIS A 360 ? 1.9014 1.2994 1.5621 0.0000 0.0000 0.0000 357 HIS A CE1   
2752 N NE2   . HIS A 360 ? 1.8259 1.2845 1.5228 0.0000 0.0000 0.0000 357 HIS A NE2   
2753 N N     . LEU A 361 ? 2.3126 1.2120 1.7046 0.0000 0.0000 0.0000 358 LEU A N     
2754 C CA    . LEU A 361 ? 2.2885 1.2044 1.6919 0.0000 0.0000 0.0000 358 LEU A CA    
2755 C C     . LEU A 361 ? 2.4234 1.2128 1.7411 0.0000 0.0000 0.0000 358 LEU A C     
2756 O O     . LEU A 361 ? 2.5481 1.2088 1.7982 0.0000 0.0000 0.0000 358 LEU A O     
2757 C CB    . LEU A 361 ? 2.2718 1.1921 1.6965 0.0000 0.0000 0.0000 358 LEU A CB    
2758 C CG    . LEU A 361 ? 2.1732 1.1983 1.6573 0.0000 0.0000 0.0000 358 LEU A CG    
2759 C CD1   . LEU A 361 ? 2.0677 1.1683 1.6098 0.0000 0.0000 0.0000 358 LEU A CD1   
2760 C CD2   . LEU A 361 ? 2.2592 1.2183 1.6972 0.0000 0.0000 0.0000 358 LEU A CD2   
2761 N N     . GLY A 362 ? 2.4063 1.2259 1.7210 0.0000 0.0000 0.0000 359 GLY A N     
2762 C CA    . GLY A 362 ? 2.2585 1.2247 1.6489 0.0000 0.0000 0.0000 359 GLY A CA    
2763 C C     . GLY A 362 ? 2.2693 1.2388 1.6362 0.0000 0.0000 0.0000 359 GLY A C     
2764 O O     . GLY A 362 ? 2.3596 1.2563 1.6669 0.0000 0.0000 0.0000 359 GLY A O     
2765 N N     . ASN A 363 ? 2.1755 1.2321 1.5876 0.0000 0.0000 0.0000 360 ASN A N     
2766 C CA    . ASN A 363 ? 2.1556 1.2496 1.5619 0.0000 0.0000 0.0000 360 ASN A CA    
2767 C C     . ASN A 363 ? 2.0074 1.2463 1.4925 0.0000 0.0000 0.0000 360 ASN A C     
2768 O O     . ASN A 363 ? 1.9173 1.2252 1.4604 0.0000 0.0000 0.0000 360 ASN A O     
2769 C CB    . ASN A 363 ? 2.1753 1.2604 1.5675 0.0000 0.0000 0.0000 360 ASN A CB    
2770 C CG    . ASN A 363 ? 2.2948 1.2544 1.6258 0.0000 0.0000 0.0000 360 ASN A CG    
2771 O OD1   . ASN A 363 ? 2.2764 1.2310 1.6291 0.0000 0.0000 0.0000 360 ASN A OD1   
2772 N ND2   . ASN A 363 ? 2.4198 1.2734 1.6693 0.0000 0.0000 0.0000 360 ASN A ND2   
2773 N N     . ASN A 364 ? 1.9841 1.2638 1.4660 0.0000 0.0000 0.0000 361 ASN A N     
2774 C CA    . ASN A 364 ? 1.8524 1.2617 1.4008 0.0000 0.0000 0.0000 361 ASN A CA    
2775 C C     . ASN A 364 ? 1.7761 1.2534 1.3611 0.0000 0.0000 0.0000 361 ASN A C     
2776 O O     . ASN A 364 ? 1.8207 1.2747 1.3742 0.0000 0.0000 0.0000 361 ASN A O     
2777 C CB    . ASN A 364 ? 1.8697 1.2977 1.3984 0.0000 0.0000 0.0000 361 ASN A CB    
2778 C CG    . ASN A 364 ? 1.9124 1.3097 1.4215 0.0000 0.0000 0.0000 361 ASN A CG    
2779 O OD1   . ASN A 364 ? 1.9403 1.2918 1.4434 0.0000 0.0000 0.0000 361 ASN A OD1   
2780 N ND2   . ASN A 364 ? 1.9212 1.3499 1.4201 0.0000 0.0000 0.0000 361 ASN A ND2   
2781 N N     . ARG A 365 ? 1.6625 1.2245 1.3110 0.0000 0.0000 0.0000 362 ARG A N     
2782 C CA    . ARG A 365 ? 1.5831 1.2200 1.2687 0.0000 0.0000 0.0000 362 ARG A CA    
2783 C C     . ARG A 365 ? 1.4880 1.2227 1.2183 0.0000 0.0000 0.0000 362 ARG A C     
2784 O O     . ARG A 365 ? 1.4535 1.2116 1.2058 0.0000 0.0000 0.0000 362 ARG A O     
2785 C CB    . ARG A 365 ? 1.5516 1.1947 1.2660 0.0000 0.0000 0.0000 362 ARG A CB    
2786 C CG    . ARG A 365 ? 1.6479 1.1898 1.3174 0.0000 0.0000 0.0000 362 ARG A CG    
2787 C CD    . ARG A 365 ? 1.6665 1.2100 1.3253 0.0000 0.0000 0.0000 362 ARG A CD    
2788 N NE    . ARG A 365 ? 1.5692 1.1967 1.2830 0.0000 0.0000 0.0000 362 ARG A NE    
2789 C CZ    . ARG A 365 ? 1.5503 1.2335 1.2772 0.0000 0.0000 0.0000 362 ARG A CZ    
2790 N NH1   . ARG A 365 ? 1.6066 1.2751 1.2975 0.0000 0.0000 0.0000 362 ARG A NH1   
2791 N NH2   . ARG A 365 ? 1.4862 1.2439 1.2605 0.0000 0.0000 0.0000 362 ARG A NH2   
2792 N N     . THR A 366 ? 1.4485 1.2411 1.1891 0.0000 0.0000 0.0000 363 THR A N     
2793 C CA    . THR A 366 ? 1.3606 1.2416 1.1408 0.0000 0.0000 0.0000 363 THR A CA    
2794 C C     . THR A 366 ? 1.2924 1.2287 1.1114 0.0000 0.0000 0.0000 363 THR A C     
2795 O O     . THR A 366 ? 1.3026 1.2511 1.1164 0.0000 0.0000 0.0000 363 THR A O     
2796 C CB    . THR A 366 ? 1.3719 1.2817 1.1328 0.0000 0.0000 0.0000 363 THR A CB    
2797 O OG1   . THR A 366 ? 1.4510 1.2985 1.1666 0.0000 0.0000 0.0000 363 THR A OG1   
2798 C CG2   . THR A 366 ? 1.2984 1.2854 1.0926 0.0000 0.0000 0.0000 363 THR A CG2   
2799 N N     . VAL A 367 ? 1.2262 1.1976 1.0814 0.0000 0.0000 0.0000 364 VAL A N     
2800 C CA    . VAL A 367 ? 1.1688 1.1795 1.0555 0.0000 0.0000 0.0000 364 VAL A CA    
2801 C C     . VAL A 367 ? 1.1023 1.1736 1.0180 0.0000 0.0000 0.0000 364 VAL A C     
2802 O O     . VAL A 367 ? 1.0892 1.1682 1.0077 0.0000 0.0000 0.0000 364 VAL A O     
2803 C CB    . VAL A 367 ? 1.1784 1.1478 1.0710 0.0000 0.0000 0.0000 364 VAL A CB    
2804 C CG1   . VAL A 367 ? 1.2515 1.1470 1.1071 0.0000 0.0000 0.0000 364 VAL A CG1   
2805 C CG2   . VAL A 367 ? 1.1577 1.1203 1.0620 0.0000 0.0000 0.0000 364 VAL A CG2   
2806 N N     . SER A 368 ? 1.0666 1.1799 1.0000 0.0000 0.0000 0.0000 365 SER A N     
2807 C CA    . SER A 368 ? 1.0189 1.1746 0.9716 0.0000 0.0000 0.0000 365 SER A CA    
2808 C C     . SER A 368 ? 0.9975 1.1382 0.9666 0.0000 0.0000 0.0000 365 SER A C     
2809 O O     . SER A 368 ? 1.0127 1.1257 0.9838 0.0000 0.0000 0.0000 365 SER A O     
2810 C CB    . SER A 368 ? 0.9983 1.1985 0.9577 0.0000 0.0000 0.0000 365 SER A CB    
2811 O OG    . SER A 368 ? 0.9775 1.2069 0.9434 0.0000 0.0000 0.0000 365 SER A OG    
2812 N N     . ILE A 369 ? 0.9691 1.1275 0.9469 0.0000 0.0000 0.0000 366 ILE A N     
2813 C CA    . ILE A 369 ? 0.9545 1.1032 0.9454 0.0000 0.0000 0.0000 366 ILE A CA    
2814 C C     . ILE A 369 ? 0.9363 1.0917 0.9357 0.0000 0.0000 0.0000 366 ILE A C     
2815 O O     . ILE A 369 ? 0.9264 1.0708 0.9340 0.0000 0.0000 0.0000 366 ILE A O     
2816 C CB    . ILE A 369 ? 0.9363 1.1029 0.9317 0.0000 0.0000 0.0000 366 ILE A CB    
2817 C CG1   . ILE A 369 ? 0.9266 1.1190 0.9150 0.0000 0.0000 0.0000 366 ILE A CG1   
2818 C CG2   . ILE A 369 ? 0.9613 1.1239 0.9529 0.0000 0.0000 0.0000 366 ILE A CG2   
2819 C CD1   . ILE A 369 ? 0.9304 1.1366 0.9193 0.0000 0.0000 0.0000 366 ILE A CD1   
2820 N N     . ASP A 370 ? 0.9322 1.1109 0.9285 0.0000 0.0000 0.0000 367 ASP A N     
2821 C CA    . ASP A 370 ? 0.9212 1.1143 0.9243 0.0000 0.0000 0.0000 367 ASP A CA    
2822 C C     . ASP A 370 ? 0.9354 1.1109 0.9443 0.0000 0.0000 0.0000 367 ASP A C     
2823 O O     . ASP A 370 ? 0.9268 1.1074 0.9435 0.0000 0.0000 0.0000 367 ASP A O     
2824 C CB    . ASP A 370 ? 0.9205 1.1529 0.9186 0.0000 0.0000 0.0000 367 ASP A CB    
2825 C CG    . ASP A 370 ? 0.9186 1.1601 0.9048 0.0000 0.0000 0.0000 367 ASP A CG    
2826 O OD1   . ASP A 370 ? 0.9076 1.1278 0.8906 0.0000 0.0000 0.0000 367 ASP A OD1   
2827 O OD2   . ASP A 370 ? 0.9356 1.2067 0.9131 0.0000 0.0000 0.0000 367 ASP A OD2   
2828 N N     . ASN A 371 ? 0.9643 1.1142 0.9647 0.0000 0.0000 0.0000 368 ASN A N     
2829 C CA    . ASN A 371 ? 0.9899 1.1068 0.9877 0.0000 0.0000 0.0000 368 ASN A CA    
2830 C C     . ASN A 371 ? 1.0062 1.0773 1.0004 0.0000 0.0000 0.0000 368 ASN A C     
2831 O O     . ASN A 371 ? 1.0470 1.0737 1.0289 0.0000 0.0000 0.0000 368 ASN A O     
2832 C CB    . ASN A 371 ? 1.0300 1.1379 1.0118 0.0000 0.0000 0.0000 368 ASN A CB    
2833 C CG    . ASN A 371 ? 1.0126 1.1803 1.0010 0.0000 0.0000 0.0000 368 ASN A CG    
2834 O OD1   . ASN A 371 ? 0.9872 1.1949 0.9914 0.0000 0.0000 0.0000 368 ASN A OD1   
2835 N ND2   . ASN A 371 ? 1.0494 1.2254 1.0230 0.0000 0.0000 0.0000 368 ASN A ND2   
2836 N N     . LEU A 372 ? 0.9821 1.0652 0.9844 0.0000 0.0000 0.0000 369 LEU A N     
2837 C CA    . LEU A 372 ? 0.9992 1.0564 1.0015 0.0000 0.0000 0.0000 369 LEU A CA    
2838 C C     . LEU A 372 ? 0.9722 1.0472 0.9887 0.0000 0.0000 0.0000 369 LEU A C     
2839 O O     . LEU A 372 ? 0.9484 1.0528 0.9708 0.0000 0.0000 0.0000 369 LEU A O     
2840 C CB    . LEU A 372 ? 1.0058 1.0661 1.0020 0.0000 0.0000 0.0000 369 LEU A CB    
2841 C CG    . LEU A 372 ? 1.0545 1.0803 1.0283 0.0000 0.0000 0.0000 369 LEU A CG    
2842 C CD1   . LEU A 372 ? 1.0565 1.0891 1.0257 0.0000 0.0000 0.0000 369 LEU A CD1   
2843 C CD2   . LEU A 372 ? 1.0995 1.0663 1.0559 0.0000 0.0000 0.0000 369 LEU A CD2   
2844 N N     . LYS A 373 ? 0.9898 1.0435 1.0069 0.0000 0.0000 0.0000 370 LYS A N     
2845 C CA    . LYS A 373 ? 0.9655 1.0406 0.9934 0.0000 0.0000 0.0000 370 LYS A CA    
2846 C C     . LYS A 373 ? 0.9829 1.0558 1.0112 0.0000 0.0000 0.0000 370 LYS A C     
2847 O O     . LYS A 373 ? 1.0189 1.0557 1.0355 0.0000 0.0000 0.0000 370 LYS A O     
2848 C CB    . LYS A 373 ? 0.9653 1.0322 0.9957 0.0000 0.0000 0.0000 370 LYS A CB    
2849 C CG    . LYS A 373 ? 0.9930 1.0279 1.0189 0.0000 0.0000 0.0000 370 LYS A CG    
2850 C CD    . LYS A 373 ? 1.0069 1.0311 1.0323 0.0000 0.0000 0.0000 370 LYS A CD    
2851 C CE    . LYS A 373 ? 1.0230 1.0251 1.0439 0.0000 0.0000 0.0000 370 LYS A CE    
2852 N NZ    . LYS A 373 ? 1.0407 1.0251 1.0570 0.0000 0.0000 0.0000 370 LYS A NZ    
2853 N N     . PRO A 374 ? 0.9615 1.0733 0.9998 0.0000 0.0000 0.0000 371 PRO A N     
2854 C CA    . PRO A 374 ? 0.9797 1.1059 1.0219 0.0000 0.0000 0.0000 371 PRO A CA    
2855 C C     . PRO A 374 ? 1.0004 1.1077 1.0416 0.0000 0.0000 0.0000 371 PRO A C     
2856 O O     . PRO A 374 ? 0.9850 1.1024 1.0303 0.0000 0.0000 0.0000 371 PRO A O     
2857 C CB    . PRO A 374 ? 0.9468 1.1283 0.9994 0.0000 0.0000 0.0000 371 PRO A CB    
2858 C CG    . PRO A 374 ? 0.9272 1.1092 0.9747 0.0000 0.0000 0.0000 371 PRO A CG    
2859 C CD    . PRO A 374 ? 0.9311 1.0757 0.9726 0.0000 0.0000 0.0000 371 PRO A CD    
2860 N N     . THR A 375 ? 1.0455 1.1207 1.0763 0.0000 0.0000 0.0000 372 THR A N     
2861 C CA    . THR A 375 ? 1.0710 1.1292 1.0978 0.0000 0.0000 0.0000 372 THR A CA    
2862 C C     . THR A 375 ? 1.0419 1.1658 1.0859 0.0000 0.0000 0.0000 372 THR A C     
2863 O O     . THR A 375 ? 1.0376 1.2076 1.0905 0.0000 0.0000 0.0000 372 THR A O     
2864 C CB    . THR A 375 ? 1.1320 1.1455 1.1392 0.0000 0.0000 0.0000 372 THR A CB    
2865 O OG1   . THR A 375 ? 1.1775 1.1296 1.1629 0.0000 0.0000 0.0000 372 THR A OG1   
2866 C CG2   . THR A 375 ? 1.1626 1.1485 1.1603 0.0000 0.0000 0.0000 372 THR A CG2   
2867 N N     . SER A 376 ? 1.0284 1.1608 1.0754 0.0000 0.0000 0.0000 373 SER A N     
2868 C CA    . SER A 376 ? 1.0043 1.1976 1.0626 0.0000 0.0000 0.0000 373 SER A CA    
2869 C C     . SER A 376 ? 1.0292 1.2415 1.0882 0.0000 0.0000 0.0000 373 SER A C     
2870 O O     . SER A 376 ? 1.0682 1.2311 1.1141 0.0000 0.0000 0.0000 373 SER A O     
2871 C CB    . SER A 376 ? 0.9833 1.1743 1.0384 0.0000 0.0000 0.0000 373 SER A CB    
2872 O OG    . SER A 376 ? 1.0099 1.1555 1.0561 0.0000 0.0000 0.0000 373 SER A OG    
2873 N N     . HIS A 377 ? 1.0146 1.2992 1.0863 0.0000 0.0000 0.0000 374 HIS A N     
2874 C CA    . HIS A 377 ? 1.0392 1.3647 1.1145 0.0000 0.0000 0.0000 374 HIS A CA    
2875 C C     . HIS A 377 ? 1.0724 1.4009 1.1460 0.0000 0.0000 0.0000 374 HIS A C     
2876 O O     . HIS A 377 ? 1.0718 1.3939 1.1460 0.0000 0.0000 0.0000 374 HIS A O     
2877 C CB    . HIS A 377 ? 1.0658 1.3573 1.1292 0.0000 0.0000 0.0000 374 HIS A CB    
2878 C CG    . HIS A 377 ? 1.0554 1.3248 1.1139 0.0000 0.0000 0.0000 374 HIS A CG    
2879 N ND1   . HIS A 377 ? 1.0337 1.3513 1.0964 0.0000 0.0000 0.0000 374 HIS A ND1   
2880 C CD2   . HIS A 377 ? 1.0681 1.2732 1.1142 0.0000 0.0000 0.0000 374 HIS A CD2   
2881 C CE1   . HIS A 377 ? 1.0219 1.3029 1.0741 0.0000 0.0000 0.0000 374 HIS A CE1   
2882 N NE2   . HIS A 377 ? 1.0363 1.2559 1.0816 0.0000 0.0000 0.0000 374 HIS A NE2   
2883 N N     . ASP B 119 ? 1.4955 1.5916 1.5301 0.0000 0.0000 0.0000 116 ASP B N     
2884 C CA    . ASP B 119 ? 1.5275 1.6030 1.5856 0.0000 0.0000 0.0000 116 ASP B CA    
2885 C C     . ASP B 119 ? 1.5020 1.5943 1.5612 0.0000 0.0000 0.0000 116 ASP B C     
2886 O O     . ASP B 119 ? 1.5247 1.6260 1.5696 0.0000 0.0000 0.0000 116 ASP B O     
2887 C CB    . ASP B 119 ? 1.5444 1.5809 1.6560 0.0000 0.0000 0.0000 116 ASP B CB    
2888 C CG    . ASP B 119 ? 1.6121 1.6190 1.7435 0.0000 0.0000 0.0000 116 ASP B CG    
2889 O OD1   . ASP B 119 ? 1.6424 1.6581 1.7602 0.0000 0.0000 0.0000 116 ASP B OD1   
2890 O OD2   . ASP B 119 ? 1.6520 1.6265 1.8148 0.0000 0.0000 0.0000 116 ASP B OD2   
2891 N N     . ARG B 120 ? 1.4491 1.5482 1.5254 0.0000 0.0000 0.0000 117 ARG B N     
2892 C CA    . ARG B 120 ? 1.4138 1.5322 1.4949 0.0000 0.0000 0.0000 117 ARG B CA    
2893 C C     . ARG B 120 ? 1.3778 1.5324 1.4178 0.0000 0.0000 0.0000 117 ARG B C     
2894 O O     . ARG B 120 ? 1.3682 1.5299 1.3823 0.0000 0.0000 0.0000 117 ARG B O     
2895 C CB    . ARG B 120 ? 1.3876 1.4953 1.5090 0.0000 0.0000 0.0000 117 ARG B CB    
2896 N N     . PRO B 121 ? 1.3567 1.5346 1.3937 0.0000 0.0000 0.0000 118 PRO B N     
2897 C CA    . PRO B 121 ? 1.3300 1.5412 1.3323 0.0000 0.0000 0.0000 118 PRO B CA    
2898 C C     . PRO B 121 ? 1.2875 1.5046 1.2799 0.0000 0.0000 0.0000 118 PRO B C     
2899 O O     . PRO B 121 ? 1.2645 1.4715 1.2825 0.0000 0.0000 0.0000 118 PRO B O     
2900 C CB    . PRO B 121 ? 1.3217 1.5523 1.3406 0.0000 0.0000 0.0000 118 PRO B CB    
2901 C CG    . PRO B 121 ? 1.3247 1.5325 1.3882 0.0000 0.0000 0.0000 118 PRO B CG    
2902 C CD    . PRO B 121 ? 1.3620 1.5371 1.4321 0.0000 0.0000 0.0000 118 PRO B CD    
2903 N N     . GLN B 122 ? 1.2797 1.5143 1.2348 0.0000 0.0000 0.0000 119 GLN B N     
2904 C CA    . GLN B 122 ? 1.2491 1.4887 1.1898 0.0000 0.0000 0.0000 119 GLN B CA    
2905 C C     . GLN B 122 ? 1.2083 1.4561 1.1661 0.0000 0.0000 0.0000 119 GLN B C     
2906 O O     . GLN B 122 ? 1.2079 1.4723 1.1718 0.0000 0.0000 0.0000 119 GLN B O     
2907 C CB    . GLN B 122 ? 1.2615 1.5220 1.1604 0.0000 0.0000 0.0000 119 GLN B CB    
2908 C CG    . GLN B 122 ? 1.3225 1.5884 1.1957 0.0000 0.0000 0.0000 119 GLN B CG    
2909 C CD    . GLN B 122 ? 1.3789 1.6597 1.2508 0.0000 0.0000 0.0000 119 GLN B CD    
2910 O OE1   . GLN B 122 ? 1.3756 1.6654 1.2673 0.0000 0.0000 0.0000 119 GLN B OE1   
2911 N NE2   . GLN B 122 ? 1.4115 1.6974 1.2600 0.0000 0.0000 0.0000 119 GLN B NE2   
2912 N N     . LYS B 123 ? 1.1743 1.4136 1.1398 0.0000 0.0000 0.0000 120 LYS B N     
2913 C CA    . LYS B 123 ? 1.1370 1.3837 1.1185 0.0000 0.0000 0.0000 120 LYS B CA    
2914 C C     . LYS B 123 ? 1.1092 1.3593 1.0745 0.0000 0.0000 0.0000 120 LYS B C     
2915 O O     . LYS B 123 ? 1.1133 1.3563 1.0625 0.0000 0.0000 0.0000 120 LYS B O     
2916 C CB    . LYS B 123 ? 1.1331 1.3660 1.1510 0.0000 0.0000 0.0000 120 LYS B CB    
2917 C CG    . LYS B 123 ? 1.1584 1.3861 1.1991 0.0000 0.0000 0.0000 120 LYS B CG    
2918 C CD    . LYS B 123 ? 1.1504 1.3983 1.2055 0.0000 0.0000 0.0000 120 LYS B CD    
2919 C CE    . LYS B 123 ? 1.1719 1.4127 1.2559 0.0000 0.0000 0.0000 120 LYS B CE    
2920 N NZ    . LYS B 123 ? 1.1827 1.3979 1.2977 0.0000 0.0000 0.0000 120 LYS B NZ    
2921 N N     . PRO B 124 ? 1.0812 1.3428 1.0518 0.0000 0.0000 0.0000 121 PRO B N     
2922 C CA    . PRO B 124 ? 1.0577 1.3195 1.0156 0.0000 0.0000 0.0000 121 PRO B CA    
2923 C C     . PRO B 124 ? 1.0459 1.2948 1.0140 0.0000 0.0000 0.0000 121 PRO B C     
2924 O O     . PRO B 124 ? 1.0466 1.2901 1.0401 0.0000 0.0000 0.0000 121 PRO B O     
2925 C CB    . PRO B 124 ? 1.0404 1.3159 1.0101 0.0000 0.0000 0.0000 121 PRO B CB    
2926 C CG    . PRO B 124 ? 1.0551 1.3434 1.0329 0.0000 0.0000 0.0000 121 PRO B CG    
2927 C CD    . PRO B 124 ? 1.0759 1.3530 1.0632 0.0000 0.0000 0.0000 121 PRO B CD    
2928 N N     . PHE B 125 ? 1.0362 1.2814 0.9863 0.0000 0.0000 0.0000 122 PHE B N     
2929 C CA    . PHE B 125 ? 1.0210 1.2586 0.9805 0.0000 0.0000 0.0000 122 PHE B CA    
2930 C C     . PHE B 125 ? 1.0360 1.2624 1.0034 0.0000 0.0000 0.0000 122 PHE B C     
2931 O O     . PHE B 125 ? 1.0344 1.2558 1.0142 0.0000 0.0000 0.0000 122 PHE B O     
2932 C CB    . PHE B 125 ? 1.0037 1.2448 0.9870 0.0000 0.0000 0.0000 122 PHE B CB    
2933 C CG    . PHE B 125 ? 0.9792 1.2327 0.9568 0.0000 0.0000 0.0000 122 PHE B CG    
2934 C CD1   . PHE B 125 ? 0.9595 1.2221 0.9570 0.0000 0.0000 0.0000 122 PHE B CD1   
2935 C CD2   . PHE B 125 ? 0.9743 1.2303 0.9286 0.0000 0.0000 0.0000 122 PHE B CD2   
2936 C CE1   . PHE B 125 ? 0.9457 1.2219 0.9393 0.0000 0.0000 0.0000 122 PHE B CE1   
2937 C CE2   . PHE B 125 ? 0.9546 1.2200 0.9063 0.0000 0.0000 0.0000 122 PHE B CE2   
2938 C CZ    . PHE B 125 ? 0.9370 1.2136 0.9081 0.0000 0.0000 0.0000 122 PHE B CZ    
2939 N N     . ASP B 126 ? 1.0511 1.2752 1.0121 0.0000 0.0000 0.0000 123 ASP B N     
2940 C CA    . ASP B 126 ? 1.0684 1.2814 1.0341 0.0000 0.0000 0.0000 123 ASP B CA    
2941 C C     . ASP B 126 ? 1.0646 1.2814 1.0090 0.0000 0.0000 0.0000 123 ASP B C     
2942 O O     . ASP B 126 ? 1.0675 1.2781 1.0240 0.0000 0.0000 0.0000 123 ASP B O     
2943 C CB    . ASP B 126 ? 1.0953 1.3068 1.0555 0.0000 0.0000 0.0000 123 ASP B CB    
2944 C CG    . ASP B 126 ? 1.1134 1.3157 1.1043 0.0000 0.0000 0.0000 123 ASP B CG    
2945 O OD1   . ASP B 126 ? 1.1108 1.3072 1.1286 0.0000 0.0000 0.0000 123 ASP B OD1   
2946 O OD2   . ASP B 126 ? 1.1459 1.3485 1.1338 0.0000 0.0000 0.0000 123 ASP B OD2   
2947 N N     . LYS B 127 ? 1.0587 1.2867 0.9743 0.0000 0.0000 0.0000 124 LYS B N     
2948 C CA    . LYS B 127 ? 1.0606 1.2941 0.9541 0.0000 0.0000 0.0000 124 LYS B CA    
2949 C C     . LYS B 127 ? 1.0487 1.2900 0.9217 0.0000 0.0000 0.0000 124 LYS B C     
2950 O O     . LYS B 127 ? 1.0490 1.2950 0.9135 0.0000 0.0000 0.0000 124 LYS B O     
2951 C CB    . LYS B 127 ? 1.0851 1.3229 0.9600 0.0000 0.0000 0.0000 124 LYS B CB    
2952 C CG    . LYS B 127 ? 1.0945 1.3390 0.9534 0.0000 0.0000 0.0000 124 LYS B CG    
2953 C CD    . LYS B 127 ? 1.1299 1.3801 0.9722 0.0000 0.0000 0.0000 124 LYS B CD    
2954 C CE    . LYS B 127 ? 1.1499 1.3856 1.0185 0.0000 0.0000 0.0000 124 LYS B CE    
2955 N NZ    . LYS B 127 ? 1.1870 1.4281 1.0393 0.0000 0.0000 0.0000 124 LYS B NZ    
2956 N N     . PHE B 128 ? 1.0425 1.2851 0.9103 0.0000 0.0000 0.0000 125 PHE B N     
2957 C CA    . PHE B 128 ? 1.0398 1.2854 0.8904 0.0000 0.0000 0.0000 125 PHE B CA    
2958 C C     . PHE B 128 ? 1.0569 1.3092 0.8859 0.0000 0.0000 0.0000 125 PHE B C     
2959 O O     . PHE B 128 ? 1.0586 1.3134 0.8934 0.0000 0.0000 0.0000 125 PHE B O     
2960 C CB    . PHE B 128 ? 1.0219 1.2640 0.8865 0.0000 0.0000 0.0000 125 PHE B CB    
2961 C CG    . PHE B 128 ? 1.0077 1.2475 0.8836 0.0000 0.0000 0.0000 125 PHE B CG    
2962 C CD1   . PHE B 128 ? 1.0169 1.2578 0.8990 0.0000 0.0000 0.0000 125 PHE B CD1   
2963 C CD2   . PHE B 128 ? 0.9826 1.2221 0.8634 0.0000 0.0000 0.0000 125 PHE B CD2   
2964 C CE1   . PHE B 128 ? 0.9986 1.2414 0.8929 0.0000 0.0000 0.0000 125 PHE B CE1   
2965 C CE2   . PHE B 128 ? 0.9826 1.2233 0.8726 0.0000 0.0000 0.0000 125 PHE B CE2   
2966 C CZ    . PHE B 128 ? 0.9867 1.2296 0.8842 0.0000 0.0000 0.0000 125 PHE B CZ    
2967 N N     . PHE B 129 ? 1.0707 1.3284 0.8766 0.0000 0.0000 0.0000 126 PHE B N     
2968 C CA    . PHE B 129 ? 1.0871 1.3538 0.8710 0.0000 0.0000 0.0000 126 PHE B CA    
2969 C C     . PHE B 129 ? 1.0871 1.3489 0.8667 0.0000 0.0000 0.0000 126 PHE B C     
2970 O O     . PHE B 129 ? 1.0870 1.3416 0.8650 0.0000 0.0000 0.0000 126 PHE B O     
2971 C CB    . PHE B 129 ? 1.1051 1.3829 0.8655 0.0000 0.0000 0.0000 126 PHE B CB    
2972 C CG    . PHE B 129 ? 1.1146 1.3982 0.8753 0.0000 0.0000 0.0000 126 PHE B CG    
2973 C CD1   . PHE B 129 ? 1.1337 1.4274 0.8830 0.0000 0.0000 0.0000 126 PHE B CD1   
2974 C CD2   . PHE B 129 ? 1.1050 1.3845 0.8786 0.0000 0.0000 0.0000 126 PHE B CD2   
2975 C CE1   . PHE B 129 ? 1.1410 1.4373 0.8906 0.0000 0.0000 0.0000 126 PHE B CE1   
2976 C CE2   . PHE B 129 ? 1.1151 1.3972 0.8901 0.0000 0.0000 0.0000 126 PHE B CE2   
2977 C CZ    . PHE B 129 ? 1.1341 1.4230 0.8965 0.0000 0.0000 0.0000 126 PHE B CZ    
2978 N N     . ILE B 130 ? 1.0929 1.3583 0.8733 0.0000 0.0000 0.0000 127 ILE B N     
2979 C CA    . ILE B 130 ? 1.0962 1.3558 0.8745 0.0000 0.0000 0.0000 127 ILE B CA    
2980 C C     . ILE B 130 ? 1.1242 1.3934 0.8842 0.0000 0.0000 0.0000 127 ILE B C     
2981 O O     . ILE B 130 ? 1.1395 1.4237 0.8938 0.0000 0.0000 0.0000 127 ILE B O     
2982 C CB    . ILE B 130 ? 1.0740 1.3302 0.8733 0.0000 0.0000 0.0000 127 ILE B CB    
2983 C CG1   . ILE B 130 ? 1.0706 1.3401 0.8797 0.0000 0.0000 0.0000 127 ILE B CG1   
2984 C CG2   . ILE B 130 ? 1.0619 1.3111 0.8782 0.0000 0.0000 0.0000 127 ILE B CG2   
2985 C CD1   . ILE B 130 ? 1.0546 1.3265 0.8819 0.0000 0.0000 0.0000 127 ILE B CD1   
2986 N N     . ASP B 131 ? 1.1423 1.4025 0.8942 0.0000 0.0000 0.0000 128 ASP B N     
2987 C CA    . ASP B 131 ? 1.1742 1.4420 0.9106 0.0000 0.0000 0.0000 128 ASP B CA    
2988 C C     . ASP B 131 ? 1.1793 1.4305 0.9182 0.0000 0.0000 0.0000 128 ASP B C     
2989 O O     . ASP B 131 ? 1.1781 1.4113 0.9247 0.0000 0.0000 0.0000 128 ASP B O     
2990 C CB    . ASP B 131 ? 1.2029 1.4811 0.9168 0.0000 0.0000 0.0000 128 ASP B CB    
2991 C CG    . ASP B 131 ? 1.2523 1.5474 0.9490 0.0000 0.0000 0.0000 128 ASP B CG    
2992 O OD1   . ASP B 131 ? 1.2683 1.5699 0.9736 0.0000 0.0000 0.0000 128 ASP B OD1   
2993 O OD2   . ASP B 131 ? 1.2956 1.6003 0.9713 0.0000 0.0000 0.0000 128 ASP B OD2   
2994 N N     . TYR B 132 ? 1.1922 1.4497 0.9253 0.0000 0.0000 0.0000 129 TYR B N     
2995 C CA    . TYR B 132 ? 1.2040 1.4437 0.9391 0.0000 0.0000 0.0000 129 TYR B CA    
2996 C C     . TYR B 132 ? 1.2327 1.4685 0.9519 0.0000 0.0000 0.0000 129 TYR B C     
2997 O O     . TYR B 132 ? 1.2494 1.5056 0.9533 0.0000 0.0000 0.0000 129 TYR B O     
2998 C CB    . TYR B 132 ? 1.2006 1.4486 0.9443 0.0000 0.0000 0.0000 129 TYR B CB    
2999 C CG    . TYR B 132 ? 1.1804 1.4212 0.9423 0.0000 0.0000 0.0000 129 TYR B CG    
3000 C CD1   . TYR B 132 ? 1.1685 1.4286 0.9436 0.0000 0.0000 0.0000 129 TYR B CD1   
3001 C CD2   . TYR B 132 ? 1.1904 1.4067 0.9569 0.0000 0.0000 0.0000 129 TYR B CD2   
3002 C CE1   . TYR B 132 ? 1.1648 1.4224 0.9559 0.0000 0.0000 0.0000 129 TYR B CE1   
3003 C CE2   . TYR B 132 ? 1.1905 1.4041 0.9701 0.0000 0.0000 0.0000 129 TYR B CE2   
3004 C CZ    . TYR B 132 ? 1.1776 1.4130 0.9687 0.0000 0.0000 0.0000 129 TYR B CZ    
3005 O OH    . TYR B 132 ? 1.1796 1.4161 0.9829 0.0000 0.0000 0.0000 129 TYR B OH    
3006 N N     . ILE B 133 ? 1.2452 1.4556 0.9687 0.0000 0.0000 0.0000 130 ILE B N     
3007 C CA    . ILE B 133 ? 1.2774 1.4792 0.9917 0.0000 0.0000 0.0000 130 ILE B CA    
3008 C C     . ILE B 133 ? 1.2980 1.4795 1.0208 0.0000 0.0000 0.0000 130 ILE B C     
3009 O O     . ILE B 133 ? 1.2916 1.4510 1.0285 0.0000 0.0000 0.0000 130 ILE B O     
3010 C CB    . ILE B 133 ? 1.2808 1.4684 0.9972 0.0000 0.0000 0.0000 130 ILE B CB    
3011 C CG1   . ILE B 133 ? 1.2744 1.4873 0.9772 0.0000 0.0000 0.0000 130 ILE B CG1   
3012 C CG2   . ILE B 133 ? 1.3055 1.4738 1.0224 0.0000 0.0000 0.0000 130 ILE B CG2   
3013 C CD1   . ILE B 133 ? 1.2726 1.4782 0.9829 0.0000 0.0000 0.0000 130 ILE B CD1   
3014 N N     . GLY B 134 ? 1.3285 1.5193 1.0422 0.0000 0.0000 0.0000 131 GLY B N     
3015 C CA    . GLY B 134 ? 1.3578 1.5290 1.0804 0.0000 0.0000 0.0000 131 GLY B CA    
3016 C C     . GLY B 134 ? 1.3773 1.5712 1.0934 0.0000 0.0000 0.0000 131 GLY B C     
3017 O O     . GLY B 134 ? 1.3734 1.6008 1.0766 0.0000 0.0000 0.0000 131 GLY B O     
3018 N N     . PRO B 135 ? 1.4016 1.5777 1.1279 0.0000 0.0000 0.0000 132 PRO B N     
3019 C CA    . PRO B 135 ? 1.4151 1.5505 1.1577 0.0000 0.0000 0.0000 132 PRO B CA    
3020 C C     . PRO B 135 ? 1.4473 1.5505 1.1921 0.0000 0.0000 0.0000 132 PRO B C     
3021 O O     . PRO B 135 ? 1.4696 1.5806 1.2049 0.0000 0.0000 0.0000 132 PRO B O     
3022 C CB    . PRO B 135 ? 1.4292 1.5635 1.1811 0.0000 0.0000 0.0000 132 PRO B CB    
3023 C CG    . PRO B 135 ? 1.4279 1.6036 1.1686 0.0000 0.0000 0.0000 132 PRO B CG    
3024 C CD    . PRO B 135 ? 1.4203 1.6163 1.1424 0.0000 0.0000 0.0000 132 PRO B CD    
3025 N N     . LEU B 136 ? 1.4554 1.5247 1.2136 0.0000 0.0000 0.0000 133 LEU B N     
3026 C CA    . LEU B 136 ? 1.4910 1.5260 1.2581 0.0000 0.0000 0.0000 133 LEU B CA    
3027 C C     . LEU B 136 ? 1.5292 1.5235 1.3134 0.0000 0.0000 0.0000 133 LEU B C     
3028 O O     . LEU B 136 ? 1.5237 1.5162 1.3122 0.0000 0.0000 0.0000 133 LEU B O     
3029 C CB    . LEU B 136 ? 1.4708 1.4983 1.2426 0.0000 0.0000 0.0000 133 LEU B CB    
3030 C CG    . LEU B 136 ? 1.4391 1.5032 1.1973 0.0000 0.0000 0.0000 133 LEU B CG    
3031 C CD1   . LEU B 136 ? 1.4160 1.4714 1.1829 0.0000 0.0000 0.0000 133 LEU B CD1   
3032 C CD2   . LEU B 136 ? 1.4571 1.5431 1.2011 0.0000 0.0000 0.0000 133 LEU B CD2   
3033 N N     . PRO B 137 ? 1.5731 1.5344 1.3686 0.0000 0.0000 0.0000 134 PRO B N     
3034 C CA    . PRO B 137 ? 1.6101 1.5248 1.4251 0.0000 0.0000 0.0000 134 PRO B CA    
3035 C C     . PRO B 137 ? 1.6011 1.4995 1.4228 0.0000 0.0000 0.0000 134 PRO B C     
3036 O O     . PRO B 137 ? 1.5832 1.4850 1.4046 0.0000 0.0000 0.0000 134 PRO B O     
3037 C CB    . PRO B 137 ? 1.6448 1.5284 1.4736 0.0000 0.0000 0.0000 134 PRO B CB    
3038 C CG    . PRO B 137 ? 1.6240 1.5420 1.4393 0.0000 0.0000 0.0000 134 PRO B CG    
3039 C CD    . PRO B 137 ? 1.5916 1.5578 1.3837 0.0000 0.0000 0.0000 134 PRO B CD    
3040 N N     . PRO B 138 ? 1.6157 1.5000 1.4429 0.0000 0.0000 0.0000 135 PRO B N     
3041 C CA    . PRO B 138 ? 1.6048 1.4834 1.4331 0.0000 0.0000 0.0000 135 PRO B CA    
3042 C C     . PRO B 138 ? 1.6218 1.4668 1.4611 0.0000 0.0000 0.0000 135 PRO B C     
3043 O O     . PRO B 138 ? 1.6633 1.4651 1.5188 0.0000 0.0000 0.0000 135 PRO B O     
3044 C CB    . PRO B 138 ? 1.6283 1.4895 1.4634 0.0000 0.0000 0.0000 135 PRO B CB    
3045 C CG    . PRO B 138 ? 1.6406 1.5157 1.4749 0.0000 0.0000 0.0000 135 PRO B CG    
3046 C CD    . PRO B 138 ? 1.6464 1.5200 1.4795 0.0000 0.0000 0.0000 135 PRO B CD    
3047 N N     . SER B 139 ? 1.5936 1.4589 1.4264 0.0000 0.0000 0.0000 136 SER B N     
3048 C CA    . SER B 139 ? 1.6064 1.4470 1.4492 0.0000 0.0000 0.0000 136 SER B CA    
3049 C C     . SER B 139 ? 1.5902 1.4432 1.4248 0.0000 0.0000 0.0000 136 SER B C     
3050 O O     . SER B 139 ? 1.5516 1.4441 1.3737 0.0000 0.0000 0.0000 136 SER B O     
3051 C CB    . SER B 139 ? 1.5884 1.4441 1.4328 0.0000 0.0000 0.0000 136 SER B CB    
3052 O OG    . SER B 139 ? 1.6015 1.4331 1.4596 0.0000 0.0000 0.0000 136 SER B OG    
3053 N N     . GLN B 140 ? 1.6231 1.4423 1.4655 0.0000 0.0000 0.0000 137 GLN B N     
3054 C CA    . GLN B 140 ? 1.6178 1.4479 1.4509 0.0000 0.0000 0.0000 137 GLN B CA    
3055 C C     . GLN B 140 ? 1.5905 1.4569 1.4104 0.0000 0.0000 0.0000 137 GLN B C     
3056 O O     . GLN B 140 ? 1.5669 1.4617 1.3767 0.0000 0.0000 0.0000 137 GLN B O     
3057 C CB    . GLN B 140 ? 1.5938 1.4429 1.4241 0.0000 0.0000 0.0000 137 GLN B CB    
3058 C CG    . GLN B 140 ? 1.6299 1.4523 1.4767 0.0000 0.0000 0.0000 137 GLN B CG    
3059 C CD    . GLN B 140 ? 1.6895 1.4734 1.5460 0.0000 0.0000 0.0000 137 GLN B CD    
3060 O OE1   . GLN B 140 ? 1.7153 1.4893 1.5642 0.0000 0.0000 0.0000 137 GLN B OE1   
3061 N NE2   . GLN B 140 ? 1.7104 1.4741 1.5847 0.0000 0.0000 0.0000 137 GLN B NE2   
3062 N N     . GLY B 141 ? 1.5947 1.4623 1.4166 0.0000 0.0000 0.0000 138 GLY B N     
3063 C CA    . GLY B 141 ? 1.5687 1.4717 1.3828 0.0000 0.0000 0.0000 138 GLY B CA    
3064 C C     . GLY B 141 ? 1.5203 1.4691 1.3264 0.0000 0.0000 0.0000 138 GLY B C     
3065 O O     . GLY B 141 ? 1.5018 1.4842 1.3039 0.0000 0.0000 0.0000 138 GLY B O     
3066 N N     . TYR B 142 ? 1.5009 1.4516 1.3064 0.0000 0.0000 0.0000 139 TYR B N     
3067 C CA    . TYR B 142 ? 1.4558 1.4454 1.2541 0.0000 0.0000 0.0000 139 TYR B CA    
3068 C C     . TYR B 142 ? 1.4535 1.4465 1.2505 0.0000 0.0000 0.0000 139 TYR B C     
3069 O O     . TYR B 142 ? 1.4861 1.4490 1.2892 0.0000 0.0000 0.0000 139 TYR B O     
3070 C CB    . TYR B 142 ? 1.4396 1.4348 1.2368 0.0000 0.0000 0.0000 139 TYR B CB    
3071 C CG    . TYR B 142 ? 1.4415 1.4451 1.2370 0.0000 0.0000 0.0000 139 TYR B CG    
3072 C CD1   . TYR B 142 ? 1.4217 1.4620 1.2129 0.0000 0.0000 0.0000 139 TYR B CD1   
3073 C CD2   . TYR B 142 ? 1.4821 1.4577 1.2809 0.0000 0.0000 0.0000 139 TYR B CD2   
3074 C CE1   . TYR B 142 ? 1.4225 1.4739 1.2116 0.0000 0.0000 0.0000 139 TYR B CE1   
3075 C CE2   . TYR B 142 ? 1.4827 1.4706 1.2766 0.0000 0.0000 0.0000 139 TYR B CE2   
3076 C CZ    . TYR B 142 ? 1.4497 1.4768 1.2384 0.0000 0.0000 0.0000 139 TYR B CZ    
3077 O OH    . TYR B 142 ? 1.4485 1.4913 1.2321 0.0000 0.0000 0.0000 139 TYR B OH    
3078 N N     . LEU B 143 ? 1.4143 1.4443 1.2039 0.0000 0.0000 0.0000 140 LEU B N     
3079 C CA    . LEU B 143 ? 1.4086 1.4495 1.1932 0.0000 0.0000 0.0000 140 LEU B CA    
3080 C C     . LEU B 143 ? 1.3741 1.4437 1.1486 0.0000 0.0000 0.0000 140 LEU B C     
3081 O O     . LEU B 143 ? 1.3860 1.4629 1.1531 0.0000 0.0000 0.0000 140 LEU B O     
3082 C CB    . LEU B 143 ? 1.4117 1.4713 1.1973 0.0000 0.0000 0.0000 140 LEU B CB    
3083 C CG    . LEU B 143 ? 1.4372 1.4703 1.2329 0.0000 0.0000 0.0000 140 LEU B CG    
3084 C CD1   . LEU B 143 ? 1.4297 1.4927 1.2287 0.0000 0.0000 0.0000 140 LEU B CD1   
3085 C CD2   . LEU B 143 ? 1.4696 1.4688 1.2699 0.0000 0.0000 0.0000 140 LEU B CD2   
3086 N N     . TYR B 144 ? 1.3276 1.4139 1.1015 0.0000 0.0000 0.0000 141 TYR B N     
3087 C CA    . TYR B 144 ? 1.2896 1.4044 1.0556 0.0000 0.0000 0.0000 141 TYR B CA    
3088 C C     . TYR B 144 ? 1.2609 1.3719 1.0297 0.0000 0.0000 0.0000 141 TYR B C     
3089 O O     . TYR B 144 ? 1.2600 1.3556 1.0364 0.0000 0.0000 0.0000 141 TYR B O     
3090 C CB    . TYR B 144 ? 1.2698 1.4162 1.0363 0.0000 0.0000 0.0000 141 TYR B CB    
3091 C CG    . TYR B 144 ? 1.2819 1.4423 1.0456 0.0000 0.0000 0.0000 141 TYR B CG    
3092 C CD1   . TYR B 144 ? 1.2877 1.4705 1.0400 0.0000 0.0000 0.0000 141 TYR B CD1   
3093 C CD2   . TYR B 144 ? 1.2958 1.4488 1.0677 0.0000 0.0000 0.0000 141 TYR B CD2   
3094 C CE1   . TYR B 144 ? 1.3147 1.5140 1.0640 0.0000 0.0000 0.0000 141 TYR B CE1   
3095 C CE2   . TYR B 144 ? 1.3252 1.4934 1.0965 0.0000 0.0000 0.0000 141 TYR B CE2   
3096 C CZ    . TYR B 144 ? 1.3317 1.5241 1.0917 0.0000 0.0000 0.0000 141 TYR B CZ    
3097 O OH    . TYR B 144 ? 1.3459 1.5579 1.1048 0.0000 0.0000 0.0000 141 TYR B OH    
3098 N N     . VAL B 145 ? 1.2333 1.3600 0.9953 0.0000 0.0000 0.0000 142 VAL B N     
3099 C CA    . VAL B 145 ? 1.1973 1.3273 0.9636 0.0000 0.0000 0.0000 142 VAL B CA    
3100 C C     . VAL B 145 ? 1.1647 1.3236 0.9273 0.0000 0.0000 0.0000 142 VAL B C     
3101 O O     . VAL B 145 ? 1.1694 1.3445 0.9213 0.0000 0.0000 0.0000 142 VAL B O     
3102 C CB    . VAL B 145 ? 1.2100 1.3307 0.9760 0.0000 0.0000 0.0000 142 VAL B CB    
3103 C CG1   . VAL B 145 ? 1.1896 1.3179 0.9624 0.0000 0.0000 0.0000 142 VAL B CG1   
3104 C CG2   . VAL B 145 ? 1.2348 1.3235 1.0089 0.0000 0.0000 0.0000 142 VAL B CG2   
3105 N N     . LEU B 146 ? 1.1303 1.2956 0.9018 0.0000 0.0000 0.0000 143 LEU B N     
3106 C CA    . LEU B 146 ? 1.0973 1.2847 0.8706 0.0000 0.0000 0.0000 143 LEU B CA    
3107 C C     . LEU B 146 ? 1.0869 1.2742 0.8603 0.0000 0.0000 0.0000 143 LEU B C     
3108 O O     . LEU B 146 ? 1.0859 1.2601 0.8659 0.0000 0.0000 0.0000 143 LEU B O     
3109 C CB    . LEU B 146 ? 1.0769 1.2714 0.8626 0.0000 0.0000 0.0000 143 LEU B CB    
3110 C CG    . LEU B 146 ? 1.0556 1.2691 0.8482 0.0000 0.0000 0.0000 143 LEU B CG    
3111 C CD1   . LEU B 146 ? 1.0529 1.2830 0.8419 0.0000 0.0000 0.0000 143 LEU B CD1   
3112 C CD2   . LEU B 146 ? 1.0322 1.2511 0.8398 0.0000 0.0000 0.0000 143 LEU B CD2   
3113 N N     . VAL B 147 ? 1.0769 1.2806 0.8437 0.0000 0.0000 0.0000 144 VAL B N     
3114 C CA    . VAL B 147 ? 1.0731 1.2806 0.8387 0.0000 0.0000 0.0000 144 VAL B CA    
3115 C C     . VAL B 147 ? 1.0556 1.2763 0.8291 0.0000 0.0000 0.0000 144 VAL B C     
3116 O O     . VAL B 147 ? 1.0574 1.2904 0.8273 0.0000 0.0000 0.0000 144 VAL B O     
3117 C CB    . VAL B 147 ? 1.0936 1.3089 0.8417 0.0000 0.0000 0.0000 144 VAL B CB    
3118 C CG1   . VAL B 147 ? 1.0910 1.3186 0.8365 0.0000 0.0000 0.0000 144 VAL B CG1   
3119 C CG2   . VAL B 147 ? 1.1099 1.3079 0.8562 0.0000 0.0000 0.0000 144 VAL B CG2   
3120 N N     . VAL B 148 ? 1.0403 1.2581 0.8264 0.0000 0.0000 0.0000 145 VAL B N     
3121 C CA    . VAL B 148 ? 1.0241 1.2515 0.8211 0.0000 0.0000 0.0000 145 VAL B CA    
3122 C C     . VAL B 148 ? 1.0304 1.2626 0.8287 0.0000 0.0000 0.0000 145 VAL B C     
3123 O O     . VAL B 148 ? 1.0292 1.2565 0.8357 0.0000 0.0000 0.0000 145 VAL B O     
3124 C CB    . VAL B 148 ? 1.0043 1.2283 0.8191 0.0000 0.0000 0.0000 145 VAL B CB    
3125 C CG1   . VAL B 148 ? 0.9914 1.2236 0.8197 0.0000 0.0000 0.0000 145 VAL B CG1   
3126 C CG2   . VAL B 148 ? 0.9988 1.2197 0.8130 0.0000 0.0000 0.0000 145 VAL B CG2   
3127 N N     . VAL B 149 ? 1.0410 1.2847 0.8319 0.0000 0.0000 0.0000 146 VAL B N     
3128 C CA    . VAL B 149 ? 1.0481 1.3005 0.8407 0.0000 0.0000 0.0000 146 VAL B CA    
3129 C C     . VAL B 149 ? 1.0471 1.3032 0.8538 0.0000 0.0000 0.0000 146 VAL B C     
3130 O O     . VAL B 149 ? 1.0491 1.3055 0.8555 0.0000 0.0000 0.0000 146 VAL B O     
3131 C CB    . VAL B 149 ? 1.0682 1.3331 0.8385 0.0000 0.0000 0.0000 146 VAL B CB    
3132 C CG1   . VAL B 149 ? 1.0706 1.3476 0.8438 0.0000 0.0000 0.0000 146 VAL B CG1   
3133 C CG2   . VAL B 149 ? 1.0796 1.3393 0.8370 0.0000 0.0000 0.0000 146 VAL B CG2   
3134 N N     . ASP B 150 ? 1.0488 1.3077 0.8708 0.0000 0.0000 0.0000 147 ASP B N     
3135 C CA    . ASP B 150 ? 1.0548 1.3156 0.8932 0.0000 0.0000 0.0000 147 ASP B CA    
3136 C C     . ASP B 150 ? 1.0776 1.3487 0.9047 0.0000 0.0000 0.0000 147 ASP B C     
3137 O O     . ASP B 150 ? 1.0891 1.3724 0.9067 0.0000 0.0000 0.0000 147 ASP B O     
3138 C CB    . ASP B 150 ? 1.0453 1.3078 0.9057 0.0000 0.0000 0.0000 147 ASP B CB    
3139 C CG    . ASP B 150 ? 1.0619 1.3250 0.9424 0.0000 0.0000 0.0000 147 ASP B CG    
3140 O OD1   . ASP B 150 ? 1.0749 1.3291 0.9660 0.0000 0.0000 0.0000 147 ASP B OD1   
3141 O OD2   . ASP B 150 ? 1.0876 1.3603 0.9754 0.0000 0.0000 0.0000 147 ASP B OD2   
3142 N N     . GLY B 151 ? 1.0870 1.3542 0.9167 0.0000 0.0000 0.0000 148 GLY B N     
3143 C CA    . GLY B 151 ? 1.1124 1.3879 0.9287 0.0000 0.0000 0.0000 148 GLY B CA    
3144 C C     . GLY B 151 ? 1.1210 1.4076 0.9406 0.0000 0.0000 0.0000 148 GLY B C     
3145 O O     . GLY B 151 ? 1.1413 1.4438 0.9393 0.0000 0.0000 0.0000 148 GLY B O     
3146 N N     . MET B 152 ? 1.1061 1.3875 0.9532 0.0000 0.0000 0.0000 149 MET B N     
3147 C CA    . MET B 152 ? 1.1135 1.4062 0.9709 0.0000 0.0000 0.0000 149 MET B CA    
3148 C C     . MET B 152 ? 1.1043 1.4140 0.9589 0.0000 0.0000 0.0000 149 MET B C     
3149 O O     . MET B 152 ? 1.1220 1.4500 0.9666 0.0000 0.0000 0.0000 149 MET B O     
3150 C CB    . MET B 152 ? 1.1052 1.3866 0.9961 0.0000 0.0000 0.0000 149 MET B CB    
3151 C CG    . MET B 152 ? 1.1223 1.4142 1.0283 0.0000 0.0000 0.0000 149 MET B CG    
3152 S SD    . MET B 152 ? 1.1298 1.4420 1.0500 0.0000 0.0000 0.0000 149 MET B SD    
3153 C CE    . MET B 152 ? 1.1450 1.4791 1.0681 0.0000 0.0000 0.0000 149 MET B CE    
3154 N N     . THR B 153 ? 1.0804 1.3852 0.9446 0.0000 0.0000 0.0000 150 THR B N     
3155 C CA    . THR B 153 ? 1.0718 1.3903 0.9411 0.0000 0.0000 0.0000 150 THR B CA    
3156 C C     . THR B 153 ? 1.0822 1.4042 0.9289 0.0000 0.0000 0.0000 150 THR B C     
3157 O O     . THR B 153 ? 1.0873 1.4247 0.9348 0.0000 0.0000 0.0000 150 THR B O     
3158 C CB    . THR B 153 ? 1.0474 1.3593 0.9396 0.0000 0.0000 0.0000 150 THR B CB    
3159 O OG1   . THR B 153 ? 1.0344 1.3292 0.9177 0.0000 0.0000 0.0000 150 THR B OG1   
3160 C CG2   . THR B 153 ? 1.0367 1.3475 0.9537 0.0000 0.0000 0.0000 150 THR B CG2   
3161 N N     . GLY B 154 ? 1.0828 1.3911 0.9121 0.0000 0.0000 0.0000 151 GLY B N     
3162 C CA    . GLY B 154 ? 1.0891 1.3966 0.9002 0.0000 0.0000 0.0000 151 GLY B CA    
3163 C C     . GLY B 154 ? 1.0761 1.3696 0.8992 0.0000 0.0000 0.0000 151 GLY B C     
3164 O O     . GLY B 154 ? 1.0882 1.3777 0.9019 0.0000 0.0000 0.0000 151 GLY B O     
3165 N N     . PHE B 155 ? 1.0535 1.3396 0.8973 0.0000 0.0000 0.0000 152 PHE B N     
3166 C CA    . PHE B 155 ? 1.0395 1.3130 0.8918 0.0000 0.0000 0.0000 152 PHE B CA    
3167 C C     . PHE B 155 ? 1.0436 1.3010 0.8797 0.0000 0.0000 0.0000 152 PHE B C     
3168 O O     . PHE B 155 ? 1.0401 1.2956 0.8671 0.0000 0.0000 0.0000 152 PHE B O     
3169 C CB    . PHE B 155 ? 1.0206 1.2936 0.8945 0.0000 0.0000 0.0000 152 PHE B CB    
3170 C CG    . PHE B 155 ? 1.0124 1.2818 0.8979 0.0000 0.0000 0.0000 152 PHE B CG    
3171 C CD1   . PHE B 155 ? 1.0058 1.2892 0.9084 0.0000 0.0000 0.0000 152 PHE B CD1   
3172 C CD2   . PHE B 155 ? 1.0044 1.2581 0.8845 0.0000 0.0000 0.0000 152 PHE B CD2   
3173 C CE1   . PHE B 155 ? 0.9868 1.2675 0.9013 0.0000 0.0000 0.0000 152 PHE B CE1   
3174 C CE2   . PHE B 155 ? 1.0003 1.2500 0.8897 0.0000 0.0000 0.0000 152 PHE B CE2   
3175 C CZ    . PHE B 155 ? 0.9892 1.2519 0.8960 0.0000 0.0000 0.0000 152 PHE B CZ    
3176 N N     . THR B 156 ? 1.0487 1.2948 0.8838 0.0000 0.0000 0.0000 153 THR B N     
3177 C CA    . THR B 156 ? 1.0547 1.2861 0.8754 0.0000 0.0000 0.0000 153 THR B CA    
3178 C C     . THR B 156 ? 1.0474 1.2631 0.8761 0.0000 0.0000 0.0000 153 THR B C     
3179 O O     . THR B 156 ? 1.0469 1.2576 0.8867 0.0000 0.0000 0.0000 153 THR B O     
3180 C CB    . THR B 156 ? 1.0758 1.3059 0.8839 0.0000 0.0000 0.0000 153 THR B CB    
3181 O OG1   . THR B 156 ? 1.0901 1.3398 0.8891 0.0000 0.0000 0.0000 153 THR B OG1   
3182 C CG2   . THR B 156 ? 1.0814 1.2991 0.8740 0.0000 0.0000 0.0000 153 THR B CG2   
3183 N N     . TRP B 157 ? 1.0413 1.2514 0.8647 0.0000 0.0000 0.0000 154 TRP B N     
3184 C CA    . TRP B 157 ? 1.0430 1.2392 0.8678 0.0000 0.0000 0.0000 154 TRP B CA    
3185 C C     . TRP B 157 ? 1.0529 1.2374 0.8638 0.0000 0.0000 0.0000 154 TRP B C     
3186 O O     . TRP B 157 ? 1.0520 1.2436 0.8522 0.0000 0.0000 0.0000 154 TRP B O     
3187 C CB    . TRP B 157 ? 1.0314 1.2336 0.8630 0.0000 0.0000 0.0000 154 TRP B CB    
3188 C CG    . TRP B 157 ? 1.0429 1.2561 0.8900 0.0000 0.0000 0.0000 154 TRP B CG    
3189 C CD1   . TRP B 157 ? 1.0527 1.2663 0.9088 0.0000 0.0000 0.0000 154 TRP B CD1   
3190 C CD2   . TRP B 157 ? 1.0460 1.2723 0.9020 0.0000 0.0000 0.0000 154 TRP B CD2   
3191 N NE1   . TRP B 157 ? 1.0468 1.2752 0.9175 0.0000 0.0000 0.0000 154 TRP B NE1   
3192 C CE2   . TRP B 157 ? 1.0387 1.2733 0.9107 0.0000 0.0000 0.0000 154 TRP B CE2   
3193 C CE3   . TRP B 157 ? 1.0404 1.2722 0.8924 0.0000 0.0000 0.0000 154 TRP B CE3   
3194 C CZ2   . TRP B 157 ? 1.0231 1.2700 0.9093 0.0000 0.0000 0.0000 154 TRP B CZ2   
3195 C CZ3   . TRP B 157 ? 1.0333 1.2749 0.8985 0.0000 0.0000 0.0000 154 TRP B CZ3   
3196 C CH2   . TRP B 157 ? 1.0256 1.2739 0.9087 0.0000 0.0000 0.0000 154 TRP B CH2   
3197 N N     . LEU B 158 ? 1.0634 1.2301 0.8752 0.0000 0.0000 0.0000 155 LEU B N     
3198 C CA    . LEU B 158 ? 1.0829 1.2353 0.8848 0.0000 0.0000 0.0000 155 LEU B CA    
3199 C C     . LEU B 158 ? 1.0878 1.2285 0.8917 0.0000 0.0000 0.0000 155 LEU B C     
3200 O O     . LEU B 158 ? 1.0936 1.2256 0.9049 0.0000 0.0000 0.0000 155 LEU B O     
3201 C CB    . LEU B 158 ? 1.1025 1.2401 0.9047 0.0000 0.0000 0.0000 155 LEU B CB    
3202 C CG    . LEU B 158 ? 1.1065 1.2574 0.9072 0.0000 0.0000 0.0000 155 LEU B CG    
3203 C CD1   . LEU B 158 ? 1.1331 1.2678 0.9383 0.0000 0.0000 0.0000 155 LEU B CD1   
3204 C CD2   . LEU B 158 ? 1.1040 1.2729 0.8887 0.0000 0.0000 0.0000 155 LEU B CD2   
3205 N N     . TYR B 159 ? 1.0932 1.2367 0.8905 0.0000 0.0000 0.0000 156 TYR B N     
3206 C CA    . TYR B 159 ? 1.1049 1.2402 0.9029 0.0000 0.0000 0.0000 156 TYR B CA    
3207 C C     . TYR B 159 ? 1.1253 1.2483 0.9169 0.0000 0.0000 0.0000 156 TYR B C     
3208 O O     . TYR B 159 ? 1.1249 1.2598 0.9111 0.0000 0.0000 0.0000 156 TYR B O     
3209 C CB    . TYR B 159 ? 1.0889 1.2452 0.8905 0.0000 0.0000 0.0000 156 TYR B CB    
3210 C CG    . TYR B 159 ? 1.0864 1.2553 0.8963 0.0000 0.0000 0.0000 156 TYR B CG    
3211 C CD1   . TYR B 159 ? 1.1020 1.2677 0.9161 0.0000 0.0000 0.0000 156 TYR B CD1   
3212 C CD2   . TYR B 159 ? 1.0830 1.2672 0.8969 0.0000 0.0000 0.0000 156 TYR B CD2   
3213 C CE1   . TYR B 159 ? 1.0990 1.2786 0.9220 0.0000 0.0000 0.0000 156 TYR B CE1   
3214 C CE2   . TYR B 159 ? 1.0799 1.2743 0.9037 0.0000 0.0000 0.0000 156 TYR B CE2   
3215 C CZ    . TYR B 159 ? 1.0933 1.2863 0.9221 0.0000 0.0000 0.0000 156 TYR B CZ    
3216 O OH    . TYR B 159 ? 1.1045 1.3101 0.9445 0.0000 0.0000 0.0000 156 TYR B OH    
3217 N N     . PRO B 160 ? 1.1474 1.2465 0.9404 0.0000 0.0000 0.0000 157 PRO B N     
3218 C CA    . PRO B 160 ? 1.1718 1.2564 0.9614 0.0000 0.0000 0.0000 157 PRO B CA    
3219 C C     . PRO B 160 ? 1.1674 1.2671 0.9557 0.0000 0.0000 0.0000 157 PRO B C     
3220 O O     . PRO B 160 ? 1.1627 1.2683 0.9530 0.0000 0.0000 0.0000 157 PRO B O     
3221 C CB    . PRO B 160 ? 1.1979 1.2495 0.9928 0.0000 0.0000 0.0000 157 PRO B CB    
3222 C CG    . PRO B 160 ? 1.1835 1.2399 0.9822 0.0000 0.0000 0.0000 157 PRO B CG    
3223 C CD    . PRO B 160 ? 1.1534 1.2374 0.9524 0.0000 0.0000 0.0000 157 PRO B CD    
3224 N N     . THR B 161 ? 1.1748 1.2846 0.9602 0.0000 0.0000 0.0000 158 THR B N     
3225 C CA    . THR B 161 ? 1.1753 1.3025 0.9632 0.0000 0.0000 0.0000 158 THR B CA    
3226 C C     . THR B 161 ? 1.2076 1.3215 0.9953 0.0000 0.0000 0.0000 158 THR B C     
3227 O O     . THR B 161 ? 1.2320 1.3242 1.0174 0.0000 0.0000 0.0000 158 THR B O     
3228 C CB    . THR B 161 ? 1.1511 1.3120 0.9411 0.0000 0.0000 0.0000 158 THR B CB    
3229 O OG1   . THR B 161 ? 1.1587 1.3252 0.9435 0.0000 0.0000 0.0000 158 THR B OG1   
3230 C CG2   . THR B 161 ? 1.1272 1.2980 0.9194 0.0000 0.0000 0.0000 158 THR B CG2   
3231 N N     . LYS B 162 ? 1.2132 1.3413 1.0051 0.0000 0.0000 0.0000 159 LYS B N     
3232 C CA    . LYS B 162 ? 1.2444 1.3627 1.0386 0.0000 0.0000 0.0000 159 LYS B CA    
3233 C C     . LYS B 162 ? 1.2361 1.3834 1.0327 0.0000 0.0000 0.0000 159 LYS B C     
3234 O O     . LYS B 162 ? 1.2588 1.4016 1.0578 0.0000 0.0000 0.0000 159 LYS B O     
3235 C CB    . LYS B 162 ? 1.2571 1.3718 1.0550 0.0000 0.0000 0.0000 159 LYS B CB    
3236 C CG    . LYS B 162 ? 1.2915 1.3751 1.0857 0.0000 0.0000 0.0000 159 LYS B CG    
3237 C CD    . LYS B 162 ? 1.3408 1.4174 1.1352 0.0000 0.0000 0.0000 159 LYS B CD    
3238 C CE    . LYS B 162 ? 1.3797 1.4217 1.1698 0.0000 0.0000 0.0000 159 LYS B CE    
3239 N NZ    . LYS B 162 ? 1.4190 1.4509 1.2065 0.0000 0.0000 0.0000 159 LYS B NZ    
3240 N N     . ALA B 163 ? 1.2085 1.3850 1.0057 0.0000 0.0000 0.0000 160 ALA B N     
3241 C CA    . ALA B 163 ? 1.1998 1.4076 1.0001 0.0000 0.0000 0.0000 160 ALA B CA    
3242 C C     . ALA B 163 ? 1.1794 1.4048 0.9772 0.0000 0.0000 0.0000 160 ALA B C     
3243 O O     . ALA B 163 ? 1.1630 1.3851 0.9625 0.0000 0.0000 0.0000 160 ALA B O     
3244 C CB    . ALA B 163 ? 1.1908 1.4247 1.0049 0.0000 0.0000 0.0000 160 ALA B CB    
3245 N N     . PRO B 164 ? 1.1822 1.4270 0.9758 0.0000 0.0000 0.0000 161 PRO B N     
3246 C CA    . PRO B 164 ? 1.1645 1.4274 0.9581 0.0000 0.0000 0.0000 161 PRO B CA    
3247 C C     . PRO B 164 ? 1.1475 1.4392 0.9593 0.0000 0.0000 0.0000 161 PRO B C     
3248 O O     . PRO B 164 ? 1.1485 1.4651 0.9645 0.0000 0.0000 0.0000 161 PRO B O     
3249 C CB    . PRO B 164 ? 1.1794 1.4529 0.9593 0.0000 0.0000 0.0000 161 PRO B CB    
3250 C CG    . PRO B 164 ? 1.1960 1.4727 0.9766 0.0000 0.0000 0.0000 161 PRO B CG    
3251 C CD    . PRO B 164 ? 1.2041 1.4543 0.9916 0.0000 0.0000 0.0000 161 PRO B CD    
3252 N N     . SER B 165 ? 1.1387 1.4289 0.9620 0.0000 0.0000 0.0000 162 SER B N     
3253 C CA    . SER B 165 ? 1.1244 1.4437 0.9682 0.0000 0.0000 0.0000 162 SER B CA    
3254 C C     . SER B 165 ? 1.1050 1.4272 0.9574 0.0000 0.0000 0.0000 162 SER B C     
3255 O O     . SER B 165 ? 1.1021 1.4027 0.9448 0.0000 0.0000 0.0000 162 SER B O     
3256 C CB    . SER B 165 ? 1.1328 1.4548 0.9841 0.0000 0.0000 0.0000 162 SER B CB    
3257 O OG    . SER B 165 ? 1.1325 1.4313 0.9763 0.0000 0.0000 0.0000 162 SER B OG    
3258 N N     . THR B 166 ? 1.0921 1.4415 0.9655 0.0000 0.0000 0.0000 163 THR B N     
3259 C CA    . THR B 166 ? 1.0750 1.4283 0.9622 0.0000 0.0000 0.0000 163 THR B CA    
3260 C C     . THR B 166 ? 1.0740 1.4135 0.9560 0.0000 0.0000 0.0000 163 THR B C     
3261 O O     . THR B 166 ? 1.0654 1.3898 0.9425 0.0000 0.0000 0.0000 163 THR B O     
3262 C CB    . THR B 166 ? 1.0616 1.4473 0.9776 0.0000 0.0000 0.0000 163 THR B CB    
3263 O OG1   . THR B 166 ? 1.0740 1.4755 0.9950 0.0000 0.0000 0.0000 163 THR B OG1   
3264 C CG2   . THR B 166 ? 1.0397 1.4269 0.9726 0.0000 0.0000 0.0000 163 THR B CG2   
3265 N N     . SER B 167 ? 1.0813 1.4282 0.9642 0.0000 0.0000 0.0000 164 SER B N     
3266 C CA    . SER B 167 ? 1.0823 1.4203 0.9580 0.0000 0.0000 0.0000 164 SER B CA    
3267 C C     . SER B 167 ? 1.0878 1.3920 0.9432 0.0000 0.0000 0.0000 164 SER B C     
3268 O O     . SER B 167 ? 1.0817 1.3804 0.9356 0.0000 0.0000 0.0000 164 SER B O     
3269 C CB    . SER B 167 ? 1.0949 1.4415 0.9700 0.0000 0.0000 0.0000 164 SER B CB    
3270 O OG    . SER B 167 ? 1.1147 1.4403 0.9735 0.0000 0.0000 0.0000 164 SER B OG    
3271 N N     . ALA B 168 ? 1.0992 1.3829 0.9411 0.0000 0.0000 0.0000 165 ALA B N     
3272 C CA    . ALA B 168 ? 1.1047 1.3572 0.9311 0.0000 0.0000 0.0000 165 ALA B CA    
3273 C C     . ALA B 168 ? 1.0890 1.3391 0.9159 0.0000 0.0000 0.0000 165 ALA B C     
3274 O O     . ALA B 168 ? 1.0904 1.3251 0.9117 0.0000 0.0000 0.0000 165 ALA B O     
3275 C CB    . ALA B 168 ? 1.1248 1.3594 0.9410 0.0000 0.0000 0.0000 165 ALA B CB    
3276 N N     . THR B 169 ? 1.0735 1.3396 0.9085 0.0000 0.0000 0.0000 166 THR B N     
3277 C CA    . THR B 169 ? 1.0547 1.3200 0.8927 0.0000 0.0000 0.0000 166 THR B CA    
3278 C C     . THR B 169 ? 1.0399 1.3123 0.8902 0.0000 0.0000 0.0000 166 THR B C     
3279 O O     . THR B 169 ? 1.0382 1.3001 0.8860 0.0000 0.0000 0.0000 166 THR B O     
3280 C CB    . THR B 169 ? 1.0503 1.3320 0.8960 0.0000 0.0000 0.0000 166 THR B CB    
3281 O OG1   . THR B 169 ? 1.0622 1.3435 0.8957 0.0000 0.0000 0.0000 166 THR B OG1   
3282 C CG2   . THR B 169 ? 1.0427 1.3196 0.8894 0.0000 0.0000 0.0000 166 THR B CG2   
3283 N N     . VAL B 170 ? 1.0263 1.3193 0.8909 0.0000 0.0000 0.0000 167 VAL B N     
3284 C CA    . VAL B 170 ? 1.0071 1.3115 0.8846 0.0000 0.0000 0.0000 167 VAL B CA    
3285 C C     . VAL B 170 ? 1.0097 1.3034 0.8740 0.0000 0.0000 0.0000 167 VAL B C     
3286 O O     . VAL B 170 ? 1.0016 1.2923 0.8678 0.0000 0.0000 0.0000 167 VAL B O     
3287 C CB    . VAL B 170 ? 0.9994 1.3322 0.8970 0.0000 0.0000 0.0000 167 VAL B CB    
3288 C CG1   . VAL B 170 ? 0.9894 1.3352 0.8965 0.0000 0.0000 0.0000 167 VAL B CG1   
3289 C CG2   . VAL B 170 ? 0.9915 1.3347 0.9081 0.0000 0.0000 0.0000 167 VAL B CG2   
3290 N N     . LYS B 171 ? 1.0244 1.3118 0.8760 0.0000 0.0000 0.0000 168 LYS B N     
3291 C CA    . LYS B 171 ? 1.0368 1.3118 0.8747 0.0000 0.0000 0.0000 168 LYS B CA    
3292 C C     . LYS B 171 ? 1.0370 1.2904 0.8684 0.0000 0.0000 0.0000 168 LYS B C     
3293 O O     . LYS B 171 ? 1.0382 1.2924 0.8690 0.0000 0.0000 0.0000 168 LYS B O     
3294 C CB    . LYS B 171 ? 1.0535 1.3183 0.8796 0.0000 0.0000 0.0000 168 LYS B CB    
3295 N N     . SER B 172 ? 1.0360 1.2745 0.8636 0.0000 0.0000 0.0000 169 SER B N     
3296 C CA    . SER B 172 ? 1.0373 1.2597 0.8607 0.0000 0.0000 0.0000 169 SER B CA    
3297 C C     . SER B 172 ? 1.0170 1.2502 0.8516 0.0000 0.0000 0.0000 169 SER B C     
3298 O O     . SER B 172 ? 1.0165 1.2449 0.8514 0.0000 0.0000 0.0000 169 SER B O     
3299 C CB    . SER B 172 ? 1.0489 1.2589 0.8653 0.0000 0.0000 0.0000 169 SER B CB    
3300 O OG    . SER B 172 ? 1.0823 1.2729 0.8893 0.0000 0.0000 0.0000 169 SER B OG    
3301 N N     . LEU B 173 ? 1.0011 1.2486 0.8471 0.0000 0.0000 0.0000 170 LEU B N     
3302 C CA    . LEU B 173 ? 0.9866 1.2404 0.8458 0.0000 0.0000 0.0000 170 LEU B CA    
3303 C C     . LEU B 173 ? 0.9803 1.2465 0.8502 0.0000 0.0000 0.0000 170 LEU B C     
3304 O O     . LEU B 173 ? 0.9768 1.2448 0.8568 0.0000 0.0000 0.0000 170 LEU B O     
3305 C CB    . LEU B 173 ? 0.9800 1.2421 0.8500 0.0000 0.0000 0.0000 170 LEU B CB    
3306 C CG    . LEU B 173 ? 0.9786 1.2322 0.8367 0.0000 0.0000 0.0000 170 LEU B CG    
3307 C CD1   . LEU B 173 ? 0.9738 1.2375 0.8432 0.0000 0.0000 0.0000 170 LEU B CD1   
3308 C CD2   . LEU B 173 ? 0.9713 1.2130 0.8218 0.0000 0.0000 0.0000 170 LEU B CD2   
3309 N N     . ASN B 174 ? 0.9785 1.2548 0.8455 0.0000 0.0000 0.0000 171 ASN B N     
3310 C CA    . ASN B 174 ? 0.9709 1.2617 0.8424 0.0000 0.0000 0.0000 171 ASN B CA    
3311 C C     . ASN B 174 ? 0.9722 1.2529 0.8335 0.0000 0.0000 0.0000 171 ASN B C     
3312 O O     . ASN B 174 ? 0.9703 1.2615 0.8388 0.0000 0.0000 0.0000 171 ASN B O     
3313 C CB    . ASN B 174 ? 0.9773 1.2841 0.8446 0.0000 0.0000 0.0000 171 ASN B CB    
3314 C CG    . ASN B 174 ? 0.9819 1.3063 0.8664 0.0000 0.0000 0.0000 171 ASN B CG    
3315 O OD1   . ASN B 174 ? 0.9785 1.3084 0.8825 0.0000 0.0000 0.0000 171 ASN B OD1   
3316 N ND2   . ASN B 174 ? 1.0084 1.3414 0.8884 0.0000 0.0000 0.0000 171 ASN B ND2   
3317 N N     . VAL B 175 ? 0.9738 1.2349 0.8209 0.0000 0.0000 0.0000 172 VAL B N     
3318 C CA    . VAL B 175 ? 0.9732 1.2247 0.8151 0.0000 0.0000 0.0000 172 VAL B CA    
3319 C C     . VAL B 175 ? 0.9625 1.2144 0.8166 0.0000 0.0000 0.0000 172 VAL B C     
3320 O O     . VAL B 175 ? 0.9623 1.2231 0.8229 0.0000 0.0000 0.0000 172 VAL B O     
3321 C CB    . VAL B 175 ? 0.9887 1.2171 0.8172 0.0000 0.0000 0.0000 172 VAL B CB    
3322 C CG1   . VAL B 175 ? 0.9999 1.2162 0.8304 0.0000 0.0000 0.0000 172 VAL B CG1   
3323 C CG2   . VAL B 175 ? 0.9919 1.2204 0.8094 0.0000 0.0000 0.0000 172 VAL B CG2   
3324 N N     . LEU B 176 ? 0.9571 1.2023 0.8144 0.0000 0.0000 0.0000 173 LEU B N     
3325 C CA    . LEU B 176 ? 0.9526 1.1974 0.8195 0.0000 0.0000 0.0000 173 LEU B CA    
3326 C C     . LEU B 176 ? 0.9450 1.2045 0.8299 0.0000 0.0000 0.0000 173 LEU B C     
3327 O O     . LEU B 176 ? 0.9422 1.2052 0.8367 0.0000 0.0000 0.0000 173 LEU B O     
3328 C CB    . LEU B 176 ? 0.9572 1.1940 0.8205 0.0000 0.0000 0.0000 173 LEU B CB    
3329 C CG    . LEU B 176 ? 0.9461 1.1820 0.8148 0.0000 0.0000 0.0000 173 LEU B CG    
3330 C CD1   . LEU B 176 ? 0.9361 1.1707 0.8057 0.0000 0.0000 0.0000 173 LEU B CD1   
3331 C CD2   . LEU B 176 ? 0.9500 1.1798 0.8074 0.0000 0.0000 0.0000 173 LEU B CD2   
3332 N N     . THR B 177 ? 0.9421 1.2112 0.8342 0.0000 0.0000 0.0000 174 THR B N     
3333 C CA    . THR B 177 ? 0.9425 1.2230 0.8556 0.0000 0.0000 0.0000 174 THR B CA    
3334 C C     . THR B 177 ? 0.9465 1.2431 0.8640 0.0000 0.0000 0.0000 174 THR B C     
3335 O O     . THR B 177 ? 0.9472 1.2558 0.8827 0.0000 0.0000 0.0000 174 THR B O     
3336 C CB    . THR B 177 ? 0.9381 1.2235 0.8634 0.0000 0.0000 0.0000 174 THR B CB    
3337 O OG1   . THR B 177 ? 0.9447 1.2393 0.8610 0.0000 0.0000 0.0000 174 THR B OG1   
3338 C CG2   . THR B 177 ? 0.9445 1.2172 0.8673 0.0000 0.0000 0.0000 174 THR B CG2   
3339 N N     . SER B 178 ? 0.9605 1.2574 0.8621 0.0000 0.0000 0.0000 175 SER B N     
3340 C CA    . SER B 178 ? 0.9695 1.2836 0.8715 0.0000 0.0000 0.0000 175 SER B CA    
3341 C C     . SER B 178 ? 0.9698 1.2820 0.8800 0.0000 0.0000 0.0000 175 SER B C     
3342 O O     . SER B 178 ? 0.9732 1.3020 0.8895 0.0000 0.0000 0.0000 175 SER B O     
3343 C CB    . SER B 178 ? 0.9848 1.2995 0.8650 0.0000 0.0000 0.0000 175 SER B CB    
3344 O OG    . SER B 178 ? 1.0073 1.3188 0.8787 0.0000 0.0000 0.0000 175 SER B OG    
3345 N N     . ILE B 179 ? 0.9701 1.2654 0.8806 0.0000 0.0000 0.0000 176 ILE B N     
3346 C CA    . ILE B 179 ? 0.9711 1.2667 0.8919 0.0000 0.0000 0.0000 176 ILE B CA    
3347 C C     . ILE B 179 ? 0.9651 1.2600 0.9055 0.0000 0.0000 0.0000 176 ILE B C     
3348 O O     . ILE B 179 ? 0.9658 1.2720 0.9238 0.0000 0.0000 0.0000 176 ILE B O     
3349 C CB    . ILE B 179 ? 0.9795 1.2602 0.8893 0.0000 0.0000 0.0000 176 ILE B CB    
3350 C CG1   . ILE B 179 ? 0.9996 1.2734 0.8914 0.0000 0.0000 0.0000 176 ILE B CG1   
3351 C CG2   . ILE B 179 ? 0.9758 1.2632 0.8980 0.0000 0.0000 0.0000 176 ILE B CG2   
3352 C CD1   . ILE B 179 ? 1.0149 1.3028 0.9052 0.0000 0.0000 0.0000 176 ILE B CD1   
3353 N N     . ALA B 180 ? 0.9610 1.2430 0.8994 0.0000 0.0000 0.0000 177 ALA B N     
3354 C CA    . ALA B 180 ? 0.9579 1.2354 0.9142 0.0000 0.0000 0.0000 177 ALA B CA    
3355 C C     . ALA B 180 ? 0.9583 1.2272 0.9124 0.0000 0.0000 0.0000 177 ALA B C     
3356 O O     . ALA B 180 ? 0.9666 1.2307 0.9024 0.0000 0.0000 0.0000 177 ALA B O     
3357 C CB    . ALA B 180 ? 0.9612 1.2333 0.9180 0.0000 0.0000 0.0000 177 ALA B CB    
3358 N N     . ILE B 181 ? 0.9524 1.2194 0.9276 0.0000 0.0000 0.0000 178 ILE B N     
3359 C CA    . ILE B 181 ? 0.9494 1.2103 0.9273 0.0000 0.0000 0.0000 178 ILE B CA    
3360 C C     . ILE B 181 ? 0.9575 1.2060 0.9405 0.0000 0.0000 0.0000 178 ILE B C     
3361 O O     . ILE B 181 ? 0.9607 1.2056 0.9615 0.0000 0.0000 0.0000 178 ILE B O     
3362 C CB    . ILE B 181 ? 0.9473 1.2159 0.9488 0.0000 0.0000 0.0000 178 ILE B CB    
3363 C CG1   . ILE B 181 ? 0.9344 1.2201 0.9282 0.0000 0.0000 0.0000 178 ILE B CG1   
3364 C CG2   . ILE B 181 ? 0.9534 1.2176 0.9628 0.0000 0.0000 0.0000 178 ILE B CG2   
3365 C CD1   . ILE B 181 ? 0.9188 1.2179 0.9370 0.0000 0.0000 0.0000 178 ILE B CD1   
3366 N N     . PRO B 182 ? 0.9613 1.2046 0.9278 0.0000 0.0000 0.0000 179 PRO B N     
3367 C CA    . PRO B 182 ? 0.9723 1.2067 0.9393 0.0000 0.0000 0.0000 179 PRO B CA    
3368 C C     . PRO B 182 ? 0.9813 1.2094 0.9739 0.0000 0.0000 0.0000 179 PRO B C     
3369 O O     . PRO B 182 ? 0.9755 1.2087 0.9813 0.0000 0.0000 0.0000 179 PRO B O     
3370 C CB    . PRO B 182 ? 0.9767 1.2126 0.9163 0.0000 0.0000 0.0000 179 PRO B CB    
3371 C CG    . PRO B 182 ? 0.9647 1.2069 0.9007 0.0000 0.0000 0.0000 179 PRO B CG    
3372 C CD    . PRO B 182 ? 0.9586 1.2056 0.9041 0.0000 0.0000 0.0000 179 PRO B CD    
3373 N N     . LYS B 183 ? 0.9995 1.2171 1.0007 0.0000 0.0000 0.0000 180 LYS B N     
3374 C CA    . LYS B 183 ? 1.0169 1.2249 1.0430 0.0000 0.0000 0.0000 180 LYS B CA    
3375 C C     . LYS B 183 ? 1.0257 1.2375 1.0374 0.0000 0.0000 0.0000 180 LYS B C     
3376 O O     . LYS B 183 ? 1.0280 1.2410 1.0588 0.0000 0.0000 0.0000 180 LYS B O     
3377 C CB    . LYS B 183 ? 1.0370 1.2299 1.0779 0.0000 0.0000 0.0000 180 LYS B CB    
3378 C CG    . LYS B 183 ? 1.0491 1.2379 1.1160 0.0000 0.0000 0.0000 180 LYS B CG    
3379 C CD    . LYS B 183 ? 1.0912 1.2651 1.1712 0.0000 0.0000 0.0000 180 LYS B CD    
3380 C CE    . LYS B 183 ? 1.1010 1.2709 1.2125 0.0000 0.0000 0.0000 180 LYS B CE    
3381 N NZ    . LYS B 183 ? 1.1440 1.3032 1.2635 0.0000 0.0000 0.0000 180 LYS B NZ    
3382 N N     . VAL B 184 ? 1.0338 1.2504 1.0131 0.0000 0.0000 0.0000 181 VAL B N     
3383 C CA    . VAL B 184 ? 1.0433 1.2672 1.0048 0.0000 0.0000 0.0000 181 VAL B CA    
3384 C C     . VAL B 184 ? 1.0367 1.2718 0.9662 0.0000 0.0000 0.0000 181 VAL B C     
3385 O O     . VAL B 184 ? 1.0302 1.2652 0.9437 0.0000 0.0000 0.0000 181 VAL B O     
3386 C CB    . VAL B 184 ? 1.0693 1.2881 1.0222 0.0000 0.0000 0.0000 181 VAL B CB    
3387 C CG1   . VAL B 184 ? 1.0802 1.3106 1.0150 0.0000 0.0000 0.0000 181 VAL B CG1   
3388 C CG2   . VAL B 184 ? 1.0814 1.2837 1.0684 0.0000 0.0000 0.0000 181 VAL B CG2   
3389 N N     . ILE B 185 ? 1.0420 1.2868 0.9657 0.0000 0.0000 0.0000 182 ILE B N     
3390 C CA    . ILE B 185 ? 1.0499 1.3033 0.9436 0.0000 0.0000 0.0000 182 ILE B CA    
3391 C C     . ILE B 185 ? 1.0774 1.3399 0.9548 0.0000 0.0000 0.0000 182 ILE B C     
3392 O O     . ILE B 185 ? 1.0849 1.3531 0.9769 0.0000 0.0000 0.0000 182 ILE B O     
3393 C CB    . ILE B 185 ? 1.0317 1.2916 0.9288 0.0000 0.0000 0.0000 182 ILE B CB    
3394 C CG1   . ILE B 185 ? 1.0139 1.2679 0.9175 0.0000 0.0000 0.0000 182 ILE B CG1   
3395 C CG2   . ILE B 185 ? 1.0339 1.3009 0.9043 0.0000 0.0000 0.0000 182 ILE B CG2   
3396 C CD1   . ILE B 185 ? 1.0007 1.2619 0.9103 0.0000 0.0000 0.0000 182 ILE B CD1   
3397 N N     . HIS B 186 ? 1.0957 1.3619 0.9438 0.0000 0.0000 0.0000 183 HIS B N     
3398 C CA    . HIS B 186 ? 1.1248 1.4045 0.9509 0.0000 0.0000 0.0000 183 HIS B CA    
3399 C C     . HIS B 186 ? 1.1289 1.4184 0.9342 0.0000 0.0000 0.0000 183 HIS B C     
3400 O O     . HIS B 186 ? 1.1211 1.4043 0.9174 0.0000 0.0000 0.0000 183 HIS B O     
3401 C CB    . HIS B 186 ? 1.1459 1.4268 0.9527 0.0000 0.0000 0.0000 183 HIS B CB    
3402 C CG    . HIS B 186 ? 1.1692 1.4680 0.9476 0.0000 0.0000 0.0000 183 HIS B CG    
3403 N ND1   . HIS B 186 ? 1.1926 1.4967 0.9689 0.0000 0.0000 0.0000 183 HIS B ND1   
3404 C CD2   . HIS B 186 ? 1.1750 1.4885 0.9257 0.0000 0.0000 0.0000 183 HIS B CD2   
3405 C CE1   . HIS B 186 ? 1.2190 1.5435 0.9650 0.0000 0.0000 0.0000 183 HIS B CE1   
3406 N NE2   . HIS B 186 ? 1.2127 1.5436 0.9433 0.0000 0.0000 0.0000 183 HIS B NE2   
3407 N N     . SER B 187 ? 1.1442 1.4486 0.9443 0.0000 0.0000 0.0000 184 SER B N     
3408 C CA    . SER B 187 ? 1.1541 1.4687 0.9364 0.0000 0.0000 0.0000 184 SER B CA    
3409 C C     . SER B 187 ? 1.1819 1.5185 0.9503 0.0000 0.0000 0.0000 184 SER B C     
3410 O O     . SER B 187 ? 1.1936 1.5367 0.9707 0.0000 0.0000 0.0000 184 SER B O     
3411 C CB    . SER B 187 ? 1.1323 1.4434 0.9341 0.0000 0.0000 0.0000 184 SER B CB    
3412 O OG    . SER B 187 ? 1.1248 1.4459 0.9513 0.0000 0.0000 0.0000 184 SER B OG    
3413 N N     . ASP B 188 ? 1.1977 1.5455 0.9458 0.0000 0.0000 0.0000 185 ASP B N     
3414 C CA    . ASP B 188 ? 1.2251 1.5985 0.9613 0.0000 0.0000 0.0000 185 ASP B CA    
3415 C C     . ASP B 188 ? 1.2082 1.5903 0.9726 0.0000 0.0000 0.0000 185 ASP B C     
3416 O O     . ASP B 188 ? 1.1856 1.5540 0.9739 0.0000 0.0000 0.0000 185 ASP B O     
3417 C CB    . ASP B 188 ? 1.2470 1.6303 0.9539 0.0000 0.0000 0.0000 185 ASP B CB    
3418 C CG    . ASP B 188 ? 1.2593 1.6254 0.9728 0.0000 0.0000 0.0000 185 ASP B CG    
3419 O OD1   . ASP B 188 ? 1.2991 1.6517 0.9988 0.0000 0.0000 0.0000 185 ASP B OD1   
3420 O OD2   . ASP B 188 ? 1.2691 1.6355 1.0025 0.0000 0.0000 0.0000 185 ASP B OD2   
3421 N N     . GLN B 189 ? 1.2207 1.6288 0.9825 0.0000 0.0000 0.0000 186 GLN B N     
3422 C CA    . GLN B 189 ? 1.2050 1.6269 0.9971 0.0000 0.0000 0.0000 186 GLN B CA    
3423 C C     . GLN B 189 ? 1.1967 1.6243 0.9907 0.0000 0.0000 0.0000 186 GLN B C     
3424 O O     . GLN B 189 ? 1.1978 1.6497 1.0037 0.0000 0.0000 0.0000 186 GLN B O     
3425 C CB    . GLN B 189 ? 1.2231 1.6720 1.0185 0.0000 0.0000 0.0000 186 GLN B CB    
3426 C CG    . GLN B 189 ? 1.2309 1.6697 1.0327 0.0000 0.0000 0.0000 186 GLN B CG    
3427 C CD    . GLN B 189 ? 1.2438 1.6995 1.0743 0.0000 0.0000 0.0000 186 GLN B CD    
3428 O OE1   . GLN B 189 ? 1.2449 1.7273 1.0869 0.0000 0.0000 0.0000 186 GLN B OE1   
3429 N NE2   . GLN B 189 ? 1.2537 1.6939 1.0991 0.0000 0.0000 0.0000 186 GLN B NE2   
3430 N N     . GLY B 190 ? 1.1899 1.5946 0.9742 0.0000 0.0000 0.0000 187 GLY B N     
3431 C CA    . GLY B 190 ? 1.1883 1.5904 0.9756 0.0000 0.0000 0.0000 187 GLY B CA    
3432 C C     . GLY B 190 ? 1.1738 1.5842 0.9943 0.0000 0.0000 0.0000 187 GLY B C     
3433 O O     . GLY B 190 ? 1.1611 1.5661 1.0026 0.0000 0.0000 0.0000 187 GLY B O     
3434 N N     . ALA B 191 ? 1.1803 1.6057 1.0070 0.0000 0.0000 0.0000 188 ALA B N     
3435 C CA    . ALA B 191 ? 1.1683 1.6098 1.0272 0.0000 0.0000 0.0000 188 ALA B CA    
3436 C C     . ALA B 191 ? 1.1500 1.5707 1.0227 0.0000 0.0000 0.0000 188 ALA B C     
3437 O O     . ALA B 191 ? 1.1354 1.5678 1.0365 0.0000 0.0000 0.0000 188 ALA B O     
3438 C CB    . ALA B 191 ? 1.1756 1.6332 1.0363 0.0000 0.0000 0.0000 188 ALA B CB    
3439 N N     . ALA B 192 ? 1.1530 1.5448 1.0063 0.0000 0.0000 0.0000 189 ALA B N     
3440 C CA    . ALA B 192 ? 1.1398 1.5124 1.0011 0.0000 0.0000 0.0000 189 ALA B CA    
3441 C C     . ALA B 192 ? 1.1279 1.4971 1.0037 0.0000 0.0000 0.0000 189 ALA B C     
3442 O O     . ALA B 192 ? 1.1128 1.4826 1.0077 0.0000 0.0000 0.0000 189 ALA B O     
3443 C CB    . ALA B 192 ? 1.1476 1.4913 0.9858 0.0000 0.0000 0.0000 189 ALA B CB    
3444 N N     . PHE B 193 ? 1.1378 1.5043 1.0043 0.0000 0.0000 0.0000 190 PHE B N     
3445 C CA    . PHE B 193 ? 1.1341 1.4923 1.0135 0.0000 0.0000 0.0000 190 PHE B CA    
3446 C C     . PHE B 193 ? 1.1368 1.5145 1.0433 0.0000 0.0000 0.0000 190 PHE B C     
3447 O O     . PHE B 193 ? 1.1279 1.5000 1.0571 0.0000 0.0000 0.0000 190 PHE B O     
3448 C CB    . PHE B 193 ? 1.1471 1.4893 1.0029 0.0000 0.0000 0.0000 190 PHE B CB    
3449 C CG    . PHE B 193 ? 1.1542 1.4807 0.9843 0.0000 0.0000 0.0000 190 PHE B CG    
3450 C CD1   . PHE B 193 ? 1.1442 1.4547 0.9770 0.0000 0.0000 0.0000 190 PHE B CD1   
3451 C CD2   . PHE B 193 ? 1.1813 1.5100 0.9850 0.0000 0.0000 0.0000 190 PHE B CD2   
3452 C CE1   . PHE B 193 ? 1.1507 1.4449 0.9638 0.0000 0.0000 0.0000 190 PHE B CE1   
3453 C CE2   . PHE B 193 ? 1.1898 1.5034 0.9742 0.0000 0.0000 0.0000 190 PHE B CE2   
3454 C CZ    . PHE B 193 ? 1.1718 1.4666 0.9627 0.0000 0.0000 0.0000 190 PHE B CZ    
3455 N N     . THR B 194 ? 1.1496 1.5503 1.0555 0.0000 0.0000 0.0000 191 THR B N     
3456 C CA    . THR B 194 ? 1.1569 1.5791 1.0919 0.0000 0.0000 0.0000 191 THR B CA    
3457 C C     . THR B 194 ? 1.1431 1.5824 1.1132 0.0000 0.0000 0.0000 191 THR B C     
3458 O O     . THR B 194 ? 1.1479 1.6023 1.1504 0.0000 0.0000 0.0000 191 THR B O     
3459 C CB    . THR B 194 ? 1.1742 1.6209 1.0982 0.0000 0.0000 0.0000 191 THR B CB    
3460 O OG1   . THR B 194 ? 1.1806 1.6377 1.0881 0.0000 0.0000 0.0000 191 THR B OG1   
3461 C CG2   . THR B 194 ? 1.1978 1.6351 1.0941 0.0000 0.0000 0.0000 191 THR B CG2   
3462 N N     . SER B 195 ? 1.1304 1.5683 1.0953 0.0000 0.0000 0.0000 192 SER B N     
3463 C CA    . SER B 195 ? 1.1142 1.5721 1.1090 0.0000 0.0000 0.0000 192 SER B CA    
3464 C C     . SER B 195 ? 1.1008 1.5537 1.1244 0.0000 0.0000 0.0000 192 SER B C     
3465 O O     . SER B 195 ? 1.0991 1.5265 1.1150 0.0000 0.0000 0.0000 192 SER B O     
3466 C CB    . SER B 195 ? 1.1098 1.5620 1.0893 0.0000 0.0000 0.0000 192 SER B CB    
3467 O OG    . SER B 195 ? 1.1088 1.5383 1.0828 0.0000 0.0000 0.0000 192 SER B OG    
3468 N N     . SER B 196 ? 1.0884 1.5674 1.1470 0.0000 0.0000 0.0000 193 SER B N     
3469 C CA    . SER B 196 ? 1.0747 1.5532 1.1662 0.0000 0.0000 0.0000 193 SER B CA    
3470 C C     . SER B 196 ? 1.0550 1.5265 1.1413 0.0000 0.0000 0.0000 193 SER B C     
3471 O O     . SER B 196 ? 1.0494 1.5134 1.1540 0.0000 0.0000 0.0000 193 SER B O     
3472 C CB    . SER B 196 ? 1.0748 1.5872 1.2104 0.0000 0.0000 0.0000 193 SER B CB    
3473 O OG    . SER B 196 ? 1.0779 1.6200 1.2147 0.0000 0.0000 0.0000 193 SER B OG    
3474 N N     . THR B 197 ? 1.0453 1.5189 1.1068 0.0000 0.0000 0.0000 194 THR B N     
3475 C CA    . THR B 197 ? 1.0346 1.4970 1.0824 0.0000 0.0000 0.0000 194 THR B CA    
3476 C C     . THR B 197 ? 1.0328 1.4608 1.0602 0.0000 0.0000 0.0000 194 THR B C     
3477 O O     . THR B 197 ? 1.0287 1.4496 1.0655 0.0000 0.0000 0.0000 194 THR B O     
3478 C CB    . THR B 197 ? 1.0366 1.5027 1.0605 0.0000 0.0000 0.0000 194 THR B CB    
3479 O OG1   . THR B 197 ? 1.0430 1.5441 1.0879 0.0000 0.0000 0.0000 194 THR B OG1   
3480 C CG2   . THR B 197 ? 1.0274 1.4855 1.0391 0.0000 0.0000 0.0000 194 THR B CG2   
3481 N N     . PHE B 198 ? 1.0350 1.4447 1.0364 0.0000 0.0000 0.0000 195 PHE B N     
3482 C CA    . PHE B 198 ? 1.0316 1.4122 1.0145 0.0000 0.0000 0.0000 195 PHE B CA    
3483 C C     . PHE B 198 ? 1.0315 1.4074 1.0388 0.0000 0.0000 0.0000 195 PHE B C     
3484 O O     . PHE B 198 ? 1.0281 1.3871 1.0351 0.0000 0.0000 0.0000 195 PHE B O     
3485 C CB    . PHE B 198 ? 1.0431 1.4103 0.9962 0.0000 0.0000 0.0000 195 PHE B CB    
3486 C CG    . PHE B 198 ? 1.0395 1.3803 0.9726 0.0000 0.0000 0.0000 195 PHE B CG    
3487 C CD1   . PHE B 198 ? 1.0291 1.3560 0.9480 0.0000 0.0000 0.0000 195 PHE B CD1   
3488 C CD2   . PHE B 198 ? 1.0409 1.3730 0.9700 0.0000 0.0000 0.0000 195 PHE B CD2   
3489 C CE1   . PHE B 198 ? 1.0239 1.3307 0.9284 0.0000 0.0000 0.0000 195 PHE B CE1   
3490 C CE2   . PHE B 198 ? 1.0382 1.3503 0.9512 0.0000 0.0000 0.0000 195 PHE B CE2   
3491 C CZ    . PHE B 198 ? 1.0342 1.3345 0.9364 0.0000 0.0000 0.0000 195 PHE B CZ    
3492 N N     . ALA B 199 ? 1.0383 1.4290 1.0689 0.0000 0.0000 0.0000 196 ALA B N     
3493 C CA    . ALA B 199 ? 1.0470 1.4309 1.1059 0.0000 0.0000 0.0000 196 ALA B CA    
3494 C C     . ALA B 199 ? 1.0404 1.4255 1.1259 0.0000 0.0000 0.0000 196 ALA B C     
3495 O O     . ALA B 199 ? 1.0411 1.4067 1.1355 0.0000 0.0000 0.0000 196 ALA B O     
3496 C CB    . ALA B 199 ? 1.0574 1.4602 1.1407 0.0000 0.0000 0.0000 196 ALA B CB    
3497 N N     . GLU B 200 ? 1.0340 1.4436 1.1314 0.0000 0.0000 0.0000 197 GLU B N     
3498 C CA    . GLU B 200 ? 1.0294 1.4474 1.1494 0.0000 0.0000 0.0000 197 GLU B CA    
3499 C C     . GLU B 200 ? 1.0269 1.4272 1.1210 0.0000 0.0000 0.0000 197 GLU B C     
3500 O O     . GLU B 200 ? 1.0272 1.4201 1.1367 0.0000 0.0000 0.0000 197 GLU B O     
3501 C CB    . GLU B 200 ? 1.0189 1.4729 1.1552 0.0000 0.0000 0.0000 197 GLU B CB    
3502 N N     . TRP B 201 ? 1.0263 1.4198 1.0835 0.0000 0.0000 0.0000 198 TRP B N     
3503 C CA    . TRP B 201 ? 1.0222 1.3990 1.0543 0.0000 0.0000 0.0000 198 TRP B CA    
3504 C C     . TRP B 201 ? 1.0263 1.3799 1.0632 0.0000 0.0000 0.0000 198 TRP B C     
3505 O O     . TRP B 201 ? 1.0252 1.3749 1.0655 0.0000 0.0000 0.0000 198 TRP B O     
3506 C CB    . TRP B 201 ? 1.0239 1.3901 1.0196 0.0000 0.0000 0.0000 198 TRP B CB    
3507 C CG    . TRP B 201 ? 1.0163 1.3650 0.9885 0.0000 0.0000 0.0000 198 TRP B CG    
3508 C CD1   . TRP B 201 ? 1.0155 1.3699 0.9759 0.0000 0.0000 0.0000 198 TRP B CD1   
3509 C CD2   . TRP B 201 ? 1.0124 1.3377 0.9712 0.0000 0.0000 0.0000 198 TRP B CD2   
3510 N NE1   . TRP B 201 ? 1.0167 1.3523 0.9588 0.0000 0.0000 0.0000 198 TRP B NE1   
3511 C CE2   . TRP B 201 ? 1.0162 1.3347 0.9582 0.0000 0.0000 0.0000 198 TRP B CE2   
3512 C CE3   . TRP B 201 ? 1.0113 1.3232 0.9703 0.0000 0.0000 0.0000 198 TRP B CE3   
3513 C CZ2   . TRP B 201 ? 1.0170 1.3170 0.9461 0.0000 0.0000 0.0000 198 TRP B CZ2   
3514 C CZ3   . TRP B 201 ? 1.0177 1.3117 0.9616 0.0000 0.0000 0.0000 198 TRP B CZ3   
3515 C CH2   . TRP B 201 ? 1.0153 1.3041 0.9461 0.0000 0.0000 0.0000 198 TRP B CH2   
3516 N N     . ALA B 202 ? 1.0333 1.3740 1.0702 0.0000 0.0000 0.0000 199 ALA B N     
3517 C CA    . ALA B 202 ? 1.0396 1.3579 1.0776 0.0000 0.0000 0.0000 199 ALA B CA    
3518 C C     . ALA B 202 ? 1.0444 1.3605 1.1210 0.0000 0.0000 0.0000 199 ALA B C     
3519 O O     . ALA B 202 ? 1.0447 1.3450 1.1278 0.0000 0.0000 0.0000 199 ALA B O     
3520 C CB    . ALA B 202 ? 1.0522 1.3596 1.0722 0.0000 0.0000 0.0000 199 ALA B CB    
3521 N N     . LYS B 203 ? 1.0511 1.3832 1.1565 0.0000 0.0000 0.0000 200 LYS B N     
3522 C CA    . LYS B 203 ? 1.0645 1.3940 1.2122 0.0000 0.0000 0.0000 200 LYS B CA    
3523 C C     . LYS B 203 ? 1.0594 1.3957 1.2158 0.0000 0.0000 0.0000 200 LYS B C     
3524 O O     . LYS B 203 ? 1.0676 1.3915 1.2489 0.0000 0.0000 0.0000 200 LYS B O     
3525 C CB    . LYS B 203 ? 1.0692 1.4174 1.2502 0.0000 0.0000 0.0000 200 LYS B CB    
3526 C CG    . LYS B 203 ? 1.0932 1.4314 1.3219 0.0000 0.0000 0.0000 200 LYS B CG    
3527 C CD    . LYS B 203 ? 1.1203 1.4814 1.3888 0.0000 0.0000 0.0000 200 LYS B CD    
3528 C CE    . LYS B 203 ? 1.1456 1.4908 1.4650 0.0000 0.0000 0.0000 200 LYS B CE    
3529 N NZ    . LYS B 203 ? 1.1583 1.5248 1.5206 0.0000 0.0000 0.0000 200 LYS B NZ    
3530 N N     . GLU B 204 ? 1.0522 1.4083 1.1876 0.0000 0.0000 0.0000 201 GLU B N     
3531 C CA    . GLU B 204 ? 1.0510 1.4191 1.1872 0.0000 0.0000 0.0000 201 GLU B CA    
3532 C C     . GLU B 204 ? 1.0467 1.3945 1.1690 0.0000 0.0000 0.0000 201 GLU B C     
3533 O O     . GLU B 204 ? 1.0506 1.3968 1.1950 0.0000 0.0000 0.0000 201 GLU B O     
3534 C CB    . GLU B 204 ? 1.0481 1.4386 1.1574 0.0000 0.0000 0.0000 201 GLU B CB    
3535 C CG    . GLU B 204 ? 1.0856 1.5061 1.2134 0.0000 0.0000 0.0000 201 GLU B CG    
3536 C CD    . GLU B 204 ? 1.1396 1.5780 1.2366 0.0000 0.0000 0.0000 201 GLU B CD    
3537 O OE1   . GLU B 204 ? 1.1688 1.5950 1.2321 0.0000 0.0000 0.0000 201 GLU B OE1   
3538 O OE2   . GLU B 204 ? 1.1561 1.6208 1.2644 0.0000 0.0000 0.0000 201 GLU B OE2   
3539 N N     . ARG B 205 ? 1.0399 1.3741 1.1280 0.0000 0.0000 0.0000 202 ARG B N     
3540 C CA    . ARG B 205 ? 1.0356 1.3540 1.1107 0.0000 0.0000 0.0000 202 ARG B CA    
3541 C C     . ARG B 205 ? 1.0462 1.3418 1.1413 0.0000 0.0000 0.0000 202 ARG B C     
3542 O O     . ARG B 205 ? 1.0487 1.3322 1.1390 0.0000 0.0000 0.0000 202 ARG B O     
3543 C CB    . ARG B 205 ? 1.0302 1.3427 1.0663 0.0000 0.0000 0.0000 202 ARG B CB    
3544 C CG    . ARG B 205 ? 1.0268 1.3555 1.0446 0.0000 0.0000 0.0000 202 ARG B CG    
3545 C CD    . ARG B 205 ? 1.0263 1.3525 1.0120 0.0000 0.0000 0.0000 202 ARG B CD    
3546 N NE    . ARG B 205 ? 1.0251 1.3692 0.9986 0.0000 0.0000 0.0000 202 ARG B NE    
3547 C CZ    . ARG B 205 ? 1.0258 1.3895 1.0121 0.0000 0.0000 0.0000 202 ARG B CZ    
3548 N NH1   . ARG B 205 ? 1.0170 1.3848 1.0310 0.0000 0.0000 0.0000 202 ARG B NH1   
3549 N NH2   . ARG B 205 ? 1.0286 1.4089 1.0011 0.0000 0.0000 0.0000 202 ARG B NH2   
3550 N N     . GLY B 206 ? 1.0562 1.3472 1.1750 0.0000 0.0000 0.0000 203 GLY B N     
3551 C CA    . GLY B 206 ? 1.0716 1.3397 1.2119 0.0000 0.0000 0.0000 203 GLY B CA    
3552 C C     . GLY B 206 ? 1.0803 1.3325 1.1925 0.0000 0.0000 0.0000 203 GLY B C     
3553 O O     . GLY B 206 ? 1.0908 1.3251 1.2080 0.0000 0.0000 0.0000 203 GLY B O     
3554 N N     . ILE B 207 ? 1.0779 1.3386 1.1607 0.0000 0.0000 0.0000 204 ILE B N     
3555 C CA    . ILE B 207 ? 1.0862 1.3372 1.1397 0.0000 0.0000 0.0000 204 ILE B CA    
3556 C C     . ILE B 207 ? 1.1082 1.3576 1.1683 0.0000 0.0000 0.0000 204 ILE B C     
3557 O O     . ILE B 207 ? 1.1072 1.3714 1.1754 0.0000 0.0000 0.0000 204 ILE B O     
3558 C CB    . ILE B 207 ? 1.0720 1.3331 1.0901 0.0000 0.0000 0.0000 204 ILE B CB    
3559 C CG1   . ILE B 207 ? 1.0490 1.3120 1.0591 0.0000 0.0000 0.0000 204 ILE B CG1   
3560 C CG2   . ILE B 207 ? 1.0823 1.3366 1.0719 0.0000 0.0000 0.0000 204 ILE B CG2   
3561 C CD1   . ILE B 207 ? 1.0266 1.2978 1.0091 0.0000 0.0000 0.0000 204 ILE B CD1   
3562 N N     . HIS B 208 ? 1.1325 1.3668 1.1896 0.0000 0.0000 0.0000 205 HIS B N     
3563 C CA    . HIS B 208 ? 1.1584 1.3935 1.2151 0.0000 0.0000 0.0000 205 HIS B CA    
3564 C C     . HIS B 208 ? 1.1601 1.4076 1.1767 0.0000 0.0000 0.0000 205 HIS B C     
3565 O O     . HIS B 208 ? 1.1589 1.4030 1.1467 0.0000 0.0000 0.0000 205 HIS B O     
3566 C CB    . HIS B 208 ? 1.1853 1.4002 1.2540 0.0000 0.0000 0.0000 205 HIS B CB    
3567 C CG    . HIS B 208 ? 1.2231 1.4403 1.2905 0.0000 0.0000 0.0000 205 HIS B CG    
3568 N ND1   . HIS B 208 ? 1.2509 1.4677 1.2862 0.0000 0.0000 0.0000 205 HIS B ND1   
3569 C CD2   . HIS B 208 ? 1.2403 1.4636 1.3346 0.0000 0.0000 0.0000 205 HIS B CD2   
3570 C CE1   . HIS B 208 ? 1.2735 1.4958 1.3137 0.0000 0.0000 0.0000 205 HIS B CE1   
3571 N NE2   . HIS B 208 ? 1.2730 1.4987 1.3502 0.0000 0.0000 0.0000 205 HIS B NE2   
3572 N N     . LEU B 209 ? 1.1646 1.4279 1.1819 0.0000 0.0000 0.0000 206 LEU B N     
3573 C CA    . LEU B 209 ? 1.1710 1.4474 1.1535 0.0000 0.0000 0.0000 206 LEU B CA    
3574 C C     . LEU B 209 ? 1.2042 1.4798 1.1738 0.0000 0.0000 0.0000 206 LEU B C     
3575 O O     . LEU B 209 ? 1.2208 1.4926 1.2149 0.0000 0.0000 0.0000 206 LEU B O     
3576 C CB    . LEU B 209 ? 1.1566 1.4544 1.1453 0.0000 0.0000 0.0000 206 LEU B CB    
3577 C CG    . LEU B 209 ? 1.1271 1.4303 1.1136 0.0000 0.0000 0.0000 206 LEU B CG    
3578 C CD1   . LEU B 209 ? 1.1154 1.4414 1.1037 0.0000 0.0000 0.0000 206 LEU B CD1   
3579 C CD2   . LEU B 209 ? 1.1244 1.4176 1.0777 0.0000 0.0000 0.0000 206 LEU B CD2   
3580 N N     . GLU B 210 ? 1.2192 1.4989 1.1506 0.0000 0.0000 0.0000 207 GLU B N     
3581 C CA    . GLU B 210 ? 1.2531 1.5364 1.1644 0.0000 0.0000 0.0000 207 GLU B CA    
3582 C C     . GLU B 210 ? 1.2628 1.5657 1.1375 0.0000 0.0000 0.0000 207 GLU B C     
3583 O O     . GLU B 210 ? 1.2493 1.5521 1.1038 0.0000 0.0000 0.0000 207 GLU B O     
3584 C CB    . GLU B 210 ? 1.2642 1.5309 1.1668 0.0000 0.0000 0.0000 207 GLU B CB    
3585 C CG    . GLU B 210 ? 1.3033 1.5774 1.1747 0.0000 0.0000 0.0000 207 GLU B CG    
3586 C CD    . GLU B 210 ? 1.3245 1.5876 1.1836 0.0000 0.0000 0.0000 207 GLU B CD    
3587 O OE1   . GLU B 210 ? 1.3328 1.5768 1.2186 0.0000 0.0000 0.0000 207 GLU B OE1   
3588 O OE2   . GLU B 210 ? 1.3337 1.6085 1.1585 0.0000 0.0000 0.0000 207 GLU B OE2   
3589 N N     . PHE B 211 ? 1.2909 1.6107 1.1588 0.0000 0.0000 0.0000 208 PHE B N     
3590 C CA    . PHE B 211 ? 1.3065 1.6491 1.1440 0.0000 0.0000 0.0000 208 PHE B CA    
3591 C C     . PHE B 211 ? 1.3462 1.7006 1.1498 0.0000 0.0000 0.0000 208 PHE B C     
3592 O O     . PHE B 211 ? 1.3693 1.7234 1.1790 0.0000 0.0000 0.0000 208 PHE B O     
3593 C CB    . PHE B 211 ? 1.3017 1.6639 1.1589 0.0000 0.0000 0.0000 208 PHE B CB    
3594 C CG    . PHE B 211 ? 1.2754 1.6332 1.1607 0.0000 0.0000 0.0000 208 PHE B CG    
3595 C CD1   . PHE B 211 ? 1.2591 1.6156 1.1295 0.0000 0.0000 0.0000 208 PHE B CD1   
3596 C CD2   . PHE B 211 ? 1.2689 1.6243 1.1957 0.0000 0.0000 0.0000 208 PHE B CD2   
3597 C CE1   . PHE B 211 ? 1.2275 1.5819 1.1203 0.0000 0.0000 0.0000 208 PHE B CE1   
3598 C CE2   . PHE B 211 ? 1.2455 1.6017 1.1956 0.0000 0.0000 0.0000 208 PHE B CE2   
3599 C CZ    . PHE B 211 ? 1.2275 1.5839 1.1585 0.0000 0.0000 0.0000 208 PHE B CZ    
3600 N N     . SER B 212 ? 1.3635 1.7285 1.1316 0.0000 0.0000 0.0000 209 SER B N     
3601 C CA    . SER B 212 ? 1.4106 1.7951 1.1416 0.0000 0.0000 0.0000 209 SER B CA    
3602 C C     . SER B 212 ? 1.4386 1.8514 1.1652 0.0000 0.0000 0.0000 209 SER B C     
3603 O O     . SER B 212 ? 1.4222 1.8409 1.1700 0.0000 0.0000 0.0000 209 SER B O     
3604 C CB    . SER B 212 ? 1.4111 1.7992 1.1092 0.0000 0.0000 0.0000 209 SER B CB    
3605 O OG    . SER B 212 ? 1.3885 1.7815 1.0855 0.0000 0.0000 0.0000 209 SER B OG    
3606 N N     . THR B 213 ? 1.4880 1.9207 1.1873 0.0000 0.0000 0.0000 210 THR B N     
3607 C CA    . THR B 213 ? 1.5227 1.9878 1.2135 0.0000 0.0000 0.0000 210 THR B CA    
3608 C C     . THR B 213 ? 1.5219 2.0048 1.1972 0.0000 0.0000 0.0000 210 THR B C     
3609 O O     . THR B 213 ? 1.5149 1.9892 1.1712 0.0000 0.0000 0.0000 210 THR B O     
3610 C CB    . THR B 213 ? 1.5678 2.0544 1.2217 0.0000 0.0000 0.0000 210 THR B CB    
3611 O OG1   . THR B 213 ? 1.5912 2.0549 1.2482 0.0000 0.0000 0.0000 210 THR B OG1   
3612 C CG2   . THR B 213 ? 1.5920 2.1058 1.2515 0.0000 0.0000 0.0000 210 THR B CG2   
3613 N N     . PRO B 214 ? 1.5334 2.0405 1.2203 0.0000 0.0000 0.0000 211 PRO B N     
3614 C CA    . PRO B 214 ? 1.5401 2.0664 1.2096 0.0000 0.0000 0.0000 211 PRO B CA    
3615 C C     . PRO B 214 ? 1.5835 2.1320 1.2042 0.0000 0.0000 0.0000 211 PRO B C     
3616 O O     . PRO B 214 ? 1.6169 2.1864 1.2177 0.0000 0.0000 0.0000 211 PRO B O     
3617 C CB    . PRO B 214 ? 1.5404 2.0946 1.2326 0.0000 0.0000 0.0000 211 PRO B CB    
3618 C CG    . PRO B 214 ? 1.5228 2.0615 1.2567 0.0000 0.0000 0.0000 211 PRO B CG    
3619 C CD    . PRO B 214 ? 1.5333 2.0488 1.2568 0.0000 0.0000 0.0000 211 PRO B CD    
3620 N N     . TYR B 215 ? 1.5892 2.1328 1.1915 0.0000 0.0000 0.0000 212 TYR B N     
3621 C CA    . TYR B 215 ? 1.6301 2.1961 1.1876 0.0000 0.0000 0.0000 212 TYR B CA    
3622 C C     . TYR B 215 ? 1.6505 2.2065 1.1841 0.0000 0.0000 0.0000 212 TYR B C     
3623 O O     . TYR B 215 ? 1.6628 2.2211 1.1715 0.0000 0.0000 0.0000 212 TYR B O     
3624 C CB    . TYR B 215 ? 1.6621 2.2739 1.1975 0.0000 0.0000 0.0000 212 TYR B CB    
3625 C CG    . TYR B 215 ? 1.6511 2.2788 1.2086 0.0000 0.0000 0.0000 212 TYR B CG    
3626 C CD1   . TYR B 215 ? 1.6499 2.2801 1.2009 0.0000 0.0000 0.0000 212 TYR B CD1   
3627 C CD2   . TYR B 215 ? 1.6449 2.2836 1.2341 0.0000 0.0000 0.0000 212 TYR B CD2   
3628 C CE1   . TYR B 215 ? 1.6501 2.2930 1.2255 0.0000 0.0000 0.0000 212 TYR B CE1   
3629 C CE2   . TYR B 215 ? 1.6411 2.2949 1.2572 0.0000 0.0000 0.0000 212 TYR B CE2   
3630 C CZ    . TYR B 215 ? 1.6450 2.3012 1.2534 0.0000 0.0000 0.0000 212 TYR B CZ    
3631 O OH    . TYR B 215 ? 1.6404 2.3133 1.2756 0.0000 0.0000 0.0000 212 TYR B OH    
3632 N N     . HIS B 216 ? 1.6614 2.2063 1.2052 0.0000 0.0000 0.0000 213 HIS B N     
3633 C CA    . HIS B 216 ? 1.6827 2.2177 1.2087 0.0000 0.0000 0.0000 213 HIS B CA    
3634 C C     . HIS B 216 ? 1.6487 2.1431 1.2053 0.0000 0.0000 0.0000 213 HIS B C     
3635 O O     . HIS B 216 ? 1.6435 2.1197 1.2212 0.0000 0.0000 0.0000 213 HIS B O     
3636 C CB    . HIS B 216 ? 1.7172 2.2658 1.2326 0.0000 0.0000 0.0000 213 HIS B CB    
3637 C CG    . HIS B 216 ? 1.7750 2.3675 1.2466 0.0000 0.0000 0.0000 213 HIS B CG    
3638 N ND1   . HIS B 216 ? 1.7966 2.4179 1.2662 0.0000 0.0000 0.0000 213 HIS B ND1   
3639 C CD2   . HIS B 216 ? 1.8179 2.4341 1.2455 0.0000 0.0000 0.0000 213 HIS B CD2   
3640 C CE1   . HIS B 216 ? 1.8375 2.4983 1.2626 0.0000 0.0000 0.0000 213 HIS B CE1   
3641 N NE2   . HIS B 216 ? 1.8561 2.5149 1.2539 0.0000 0.0000 0.0000 213 HIS B NE2   
3642 N N     . PRO B 217 ? 1.6295 2.1097 1.1893 0.0000 0.0000 0.0000 214 PRO B N     
3643 C CA    . PRO B 217 ? 1.5968 2.0419 1.1883 0.0000 0.0000 0.0000 214 PRO B CA    
3644 C C     . PRO B 217 ? 1.6027 2.0376 1.1864 0.0000 0.0000 0.0000 214 PRO B C     
3645 O O     . PRO B 217 ? 1.6140 2.0550 1.1774 0.0000 0.0000 0.0000 214 PRO B O     
3646 C CB    . PRO B 217 ? 1.5785 2.0153 1.1746 0.0000 0.0000 0.0000 214 PRO B CB    
3647 C CG    . PRO B 217 ? 1.6070 2.0734 1.1684 0.0000 0.0000 0.0000 214 PRO B CG    
3648 C CD    . PRO B 217 ? 1.6400 2.1348 1.1739 0.0000 0.0000 0.0000 214 PRO B CD    
3649 N N     . GLN B 218 ? 1.5975 2.0180 1.1997 0.0000 0.0000 0.0000 215 GLN B N     
3650 C CA    . GLN B 218 ? 1.6016 2.0145 1.1994 0.0000 0.0000 0.0000 215 GLN B CA    
3651 C C     . GLN B 218 ? 1.5590 1.9418 1.1900 0.0000 0.0000 0.0000 215 GLN B C     
3652 O O     . GLN B 218 ? 1.5367 1.9010 1.1993 0.0000 0.0000 0.0000 215 GLN B O     
3653 C CB    . GLN B 218 ? 1.6365 2.0576 1.2250 0.0000 0.0000 0.0000 215 GLN B CB    
3654 C CG    . GLN B 218 ? 1.6557 2.0611 1.2757 0.0000 0.0000 0.0000 215 GLN B CG    
3655 C CD    . GLN B 218 ? 1.6621 2.0344 1.3213 0.0000 0.0000 0.0000 215 GLN B CD    
3656 O OE1   . GLN B 218 ? 1.6686 2.0318 1.3288 0.0000 0.0000 0.0000 215 GLN B OE1   
3657 N NE2   . GLN B 218 ? 1.6574 2.0145 1.3508 0.0000 0.0000 0.0000 215 GLN B NE2   
3658 N N     . SER B 219 ? 1.5466 1.9282 1.1703 0.0000 0.0000 0.0000 216 SER B N     
3659 C CA    . SER B 219 ? 1.5092 1.8681 1.1608 0.0000 0.0000 0.0000 216 SER B CA    
3660 C C     . SER B 219 ? 1.5197 1.8827 1.1672 0.0000 0.0000 0.0000 216 SER B C     
3661 O O     . SER B 219 ? 1.5530 1.9316 1.1798 0.0000 0.0000 0.0000 216 SER B O     
3662 C CB    . SER B 219 ? 1.4923 1.8472 1.1436 0.0000 0.0000 0.0000 216 SER B CB    
3663 O OG    . SER B 219 ? 1.4929 1.8501 1.1375 0.0000 0.0000 0.0000 216 SER B OG    
3664 N N     . SER B 220 ? 1.4916 1.8422 1.1590 0.0000 0.0000 0.0000 217 SER B N     
3665 C CA    . SER B 220 ? 1.4944 1.8528 1.1588 0.0000 0.0000 0.0000 217 SER B CA    
3666 C C     . SER B 220 ? 1.5058 1.8913 1.1384 0.0000 0.0000 0.0000 217 SER B C     
3667 O O     . SER B 220 ? 1.4990 1.8885 1.1218 0.0000 0.0000 0.0000 217 SER B O     
3668 C CB    . SER B 220 ? 1.4669 1.8074 1.1649 0.0000 0.0000 0.0000 217 SER B CB    
3669 O OG    . SER B 220 ? 1.4795 1.8240 1.1852 0.0000 0.0000 0.0000 217 SER B OG    
3670 N N     . GLY B 221 ? 1.5222 1.9268 1.1395 0.0000 0.0000 0.0000 218 GLY B N     
3671 C CA    . GLY B 221 ? 1.5269 1.9602 1.1183 0.0000 0.0000 0.0000 218 GLY B CA    
3672 C C     . GLY B 221 ? 1.4902 1.9154 1.1016 0.0000 0.0000 0.0000 218 GLY B C     
3673 O O     . GLY B 221 ? 1.4950 1.9293 1.0930 0.0000 0.0000 0.0000 218 GLY B O     
3674 N N     . LYS B 222 ? 1.4531 1.8600 1.0981 0.0000 0.0000 0.0000 219 LYS B N     
3675 C CA    . LYS B 222 ? 1.4147 1.8124 1.0835 0.0000 0.0000 0.0000 219 LYS B CA    
3676 C C     . LYS B 222 ? 1.3843 1.7612 1.0604 0.0000 0.0000 0.0000 219 LYS B C     
3677 O O     . LYS B 222 ? 1.3745 1.7496 1.0563 0.0000 0.0000 0.0000 219 LYS B O     
3678 C CB    . LYS B 222 ? 1.3963 1.7821 1.0983 0.0000 0.0000 0.0000 219 LYS B CB    
3679 C CG    . LYS B 222 ? 1.3759 1.7566 1.1038 0.0000 0.0000 0.0000 219 LYS B CG    
3680 C CD    . LYS B 222 ? 1.3723 1.7453 1.1314 0.0000 0.0000 0.0000 219 LYS B CD    
3681 C CE    . LYS B 222 ? 1.3613 1.7279 1.1474 0.0000 0.0000 0.0000 219 LYS B CE    
3682 N NZ    . LYS B 222 ? 1.3845 1.7751 1.1729 0.0000 0.0000 0.0000 219 LYS B NZ    
3683 N N     . VAL B 223 ? 1.3674 1.7287 1.0455 0.0000 0.0000 0.0000 220 VAL B N     
3684 C CA    . VAL B 223 ? 1.3445 1.6881 1.0291 0.0000 0.0000 0.0000 220 VAL B CA    
3685 C C     . VAL B 223 ? 1.3642 1.7201 1.0220 0.0000 0.0000 0.0000 220 VAL B C     
3686 O O     . VAL B 223 ? 1.3578 1.7037 1.0208 0.0000 0.0000 0.0000 220 VAL B O     
3687 C CB    . VAL B 223 ? 1.3296 1.6574 1.0270 0.0000 0.0000 0.0000 220 VAL B CB    
3688 C CG1   . VAL B 223 ? 1.3104 1.6261 1.0108 0.0000 0.0000 0.0000 220 VAL B CG1   
3689 C CG2   . VAL B 223 ? 1.3051 1.6186 1.0326 0.0000 0.0000 0.0000 220 VAL B CG2   
3690 N N     . GLU B 224 ? 1.3874 1.7650 1.0172 0.0000 0.0000 0.0000 221 GLU B N     
3691 C CA    . GLU B 224 ? 1.4031 1.7984 1.0048 0.0000 0.0000 0.0000 221 GLU B CA    
3692 C C     . GLU B 224 ? 1.4067 1.8078 1.0088 0.0000 0.0000 0.0000 221 GLU B C     
3693 O O     . GLU B 224 ? 1.4054 1.7976 1.0091 0.0000 0.0000 0.0000 221 GLU B O     
3694 C CB    . GLU B 224 ? 1.4307 1.8547 0.9997 0.0000 0.0000 0.0000 221 GLU B CB    
3695 N N     . ARG B 225 ? 1.4093 1.8240 1.0143 0.0000 0.0000 0.0000 222 ARG B N     
3696 C CA    . ARG B 225 ? 1.4110 1.8332 1.0238 0.0000 0.0000 0.0000 222 ARG B CA    
3697 C C     . ARG B 225 ? 1.3859 1.7770 1.0278 0.0000 0.0000 0.0000 222 ARG B C     
3698 O O     . ARG B 225 ? 1.3935 1.7806 1.0345 0.0000 0.0000 0.0000 222 ARG B O     
3699 C CB    . ARG B 225 ? 1.4130 1.8527 1.0345 0.0000 0.0000 0.0000 222 ARG B CB    
3700 C CG    . ARG B 225 ? 1.4427 1.9182 1.0329 0.0000 0.0000 0.0000 222 ARG B CG    
3701 C CD    . ARG B 225 ? 1.4434 1.9412 1.0438 0.0000 0.0000 0.0000 222 ARG B CD    
3702 N NE    . ARG B 225 ? 1.4395 1.9187 1.0735 0.0000 0.0000 0.0000 222 ARG B NE    
3703 C CZ    . ARG B 225 ? 1.4151 1.8901 1.0820 0.0000 0.0000 0.0000 222 ARG B CZ    
3704 N NH1   . ARG B 225 ? 1.4231 1.9092 1.0973 0.0000 0.0000 0.0000 222 ARG B NH1   
3705 N NH2   . ARG B 225 ? 1.3726 1.8330 1.0673 0.0000 0.0000 0.0000 222 ARG B NH2   
3706 N N     . LYS B 226 ? 1.3590 1.7281 1.0260 0.0000 0.0000 0.0000 223 LYS B N     
3707 C CA    . LYS B 226 ? 1.3368 1.6786 1.0307 0.0000 0.0000 0.0000 223 LYS B CA    
3708 C C     . LYS B 226 ? 1.3394 1.6625 1.0284 0.0000 0.0000 0.0000 223 LYS B C     
3709 O O     . LYS B 226 ? 1.3380 1.6461 1.0380 0.0000 0.0000 0.0000 223 LYS B O     
3710 C CB    . LYS B 226 ? 1.3070 1.6343 1.0250 0.0000 0.0000 0.0000 223 LYS B CB    
3711 C CG    . LYS B 226 ? 1.2839 1.5912 1.0288 0.0000 0.0000 0.0000 223 LYS B CG    
3712 C CD    . LYS B 226 ? 1.3054 1.6254 1.0631 0.0000 0.0000 0.0000 223 LYS B CD    
3713 C CE    . LYS B 226 ? 1.3051 1.6064 1.0892 0.0000 0.0000 0.0000 223 LYS B CE    
3714 N NZ    . LYS B 226 ? 1.2849 1.5816 1.0904 0.0000 0.0000 0.0000 223 LYS B NZ    
3715 N N     . ASN B 227 ? 1.3464 1.6706 1.0214 0.0000 0.0000 0.0000 224 ASN B N     
3716 C CA    . ASN B 227 ? 1.3530 1.6627 1.0251 0.0000 0.0000 0.0000 224 ASN B CA    
3717 C C     . ASN B 227 ? 1.3826 1.6999 1.0376 0.0000 0.0000 0.0000 224 ASN B C     
3718 O O     . ASN B 227 ? 1.3865 1.6869 1.0455 0.0000 0.0000 0.0000 224 ASN B O     
3719 C CB    . ASN B 227 ? 1.3497 1.6649 1.0136 0.0000 0.0000 0.0000 224 ASN B CB    
3720 C CG    . ASN B 227 ? 1.3436 1.6384 1.0220 0.0000 0.0000 0.0000 224 ASN B CG    
3721 O OD1   . ASN B 227 ? 1.3627 1.6512 1.0363 0.0000 0.0000 0.0000 224 ASN B OD1   
3722 N ND2   . ASN B 227 ? 1.3302 1.6156 1.0270 0.0000 0.0000 0.0000 224 ASN B ND2   
3723 N N     . SER B 228 ? 1.4064 1.7501 1.0431 0.0000 0.0000 0.0000 225 SER B N     
3724 C CA    . SER B 228 ? 1.4350 1.7902 1.0566 0.0000 0.0000 0.0000 225 SER B CA    
3725 C C     . SER B 228 ? 1.4369 1.7739 1.0825 0.0000 0.0000 0.0000 225 SER B C     
3726 O O     . SER B 228 ? 1.4488 1.7713 1.0980 0.0000 0.0000 0.0000 225 SER B O     
3727 C CB    . SER B 228 ? 1.4592 1.8530 1.0526 0.0000 0.0000 0.0000 225 SER B CB    
3728 O OG    . SER B 228 ? 1.4919 1.9010 1.0679 0.0000 0.0000 0.0000 225 SER B OG    
3729 N N     . ASP B 229 ? 1.4263 1.7637 1.0906 0.0000 0.0000 0.0000 226 ASP B N     
3730 C CA    . ASP B 229 ? 1.4291 1.7508 1.1210 0.0000 0.0000 0.0000 226 ASP B CA    
3731 C C     . ASP B 229 ? 1.4206 1.7041 1.1310 0.0000 0.0000 0.0000 226 ASP B C     
3732 O O     . ASP B 229 ? 1.4361 1.7034 1.1603 0.0000 0.0000 0.0000 226 ASP B O     
3733 C CB    . ASP B 229 ? 1.4101 1.7376 1.1226 0.0000 0.0000 0.0000 226 ASP B CB    
3734 C CG    . ASP B 229 ? 1.4390 1.8039 1.1373 0.0000 0.0000 0.0000 226 ASP B CG    
3735 O OD1   . ASP B 229 ? 1.4795 1.8681 1.1605 0.0000 0.0000 0.0000 226 ASP B OD1   
3736 O OD2   . ASP B 229 ? 1.4478 1.8194 1.1531 0.0000 0.0000 0.0000 226 ASP B OD2   
3737 N N     . ILE B 230 ? 1.4004 1.6700 1.1122 0.0000 0.0000 0.0000 227 ILE B N     
3738 C CA    . ILE B 230 ? 1.3917 1.6279 1.1194 0.0000 0.0000 0.0000 227 ILE B CA    
3739 C C     . ILE B 230 ? 1.4180 1.6412 1.1381 0.0000 0.0000 0.0000 227 ILE B C     
3740 O O     . ILE B 230 ? 1.4299 1.6275 1.1673 0.0000 0.0000 0.0000 227 ILE B O     
3741 C CB    . ILE B 230 ? 1.3647 1.5954 1.0927 0.0000 0.0000 0.0000 227 ILE B CB    
3742 C CG1   . ILE B 230 ? 1.3420 1.5819 1.0818 0.0000 0.0000 0.0000 227 ILE B CG1   
3743 C CG2   . ILE B 230 ? 1.3597 1.5599 1.1014 0.0000 0.0000 0.0000 227 ILE B CG2   
3744 C CD1   . ILE B 230 ? 1.3279 1.5682 1.0674 0.0000 0.0000 0.0000 227 ILE B CD1   
3745 N N     . LYS B 231 ? 1.4291 1.6700 1.1248 0.0000 0.0000 0.0000 228 LYS B N     
3746 C CA    . LYS B 231 ? 1.4520 1.6848 1.1395 0.0000 0.0000 0.0000 228 LYS B CA    
3747 C C     . LYS B 231 ? 1.4815 1.7102 1.1745 0.0000 0.0000 0.0000 228 LYS B C     
3748 O O     . LYS B 231 ? 1.4959 1.6969 1.2018 0.0000 0.0000 0.0000 228 LYS B O     
3749 C CB    . LYS B 231 ? 1.4560 1.7170 1.1156 0.0000 0.0000 0.0000 228 LYS B CB    
3750 N N     . ARG B 232 ? 1.4895 1.7451 1.1752 0.0000 0.0000 0.0000 229 ARG B N     
3751 C CA    . ARG B 232 ? 1.5203 1.7758 1.2150 0.0000 0.0000 0.0000 229 ARG B CA    
3752 C C     . ARG B 232 ? 1.5141 1.7353 1.2451 0.0000 0.0000 0.0000 229 ARG B C     
3753 O O     . ARG B 232 ? 1.5408 1.7399 1.2874 0.0000 0.0000 0.0000 229 ARG B O     
3754 C CB    . ARG B 232 ? 1.5337 1.8313 1.2124 0.0000 0.0000 0.0000 229 ARG B CB    
3755 C CG    . ARG B 232 ? 1.5765 1.9060 1.2211 0.0000 0.0000 0.0000 229 ARG B CG    
3756 C CD    . ARG B 232 ? 1.6183 1.9848 1.2530 0.0000 0.0000 0.0000 229 ARG B CD    
3757 N NE    . ARG B 232 ? 1.6146 2.0030 1.2492 0.0000 0.0000 0.0000 229 ARG B NE    
3758 C CZ    . ARG B 232 ? 1.6357 2.0513 1.2745 0.0000 0.0000 0.0000 229 ARG B CZ    
3759 N NH1   . ARG B 232 ? 1.6741 2.0991 1.3183 0.0000 0.0000 0.0000 229 ARG B NH1   
3760 N NH2   . ARG B 232 ? 1.6197 2.0540 1.2597 0.0000 0.0000 0.0000 229 ARG B NH2   
3761 N N     . LEU B 233 ? 1.4826 1.6991 1.2281 0.0000 0.0000 0.0000 230 LEU B N     
3762 C CA    . LEU B 233 ? 1.4760 1.6631 1.2550 0.0000 0.0000 0.0000 230 LEU B CA    
3763 C C     . LEU B 233 ? 1.4855 1.6314 1.2742 0.0000 0.0000 0.0000 230 LEU B C     
3764 O O     . LEU B 233 ? 1.5052 1.6221 1.3178 0.0000 0.0000 0.0000 230 LEU B O     
3765 C CB    . LEU B 233 ? 1.4399 1.6352 1.2302 0.0000 0.0000 0.0000 230 LEU B CB    
3766 C CG    . LEU B 233 ? 1.4244 1.5992 1.2486 0.0000 0.0000 0.0000 230 LEU B CG    
3767 C CD1   . LEU B 233 ? 1.4450 1.6116 1.2918 0.0000 0.0000 0.0000 230 LEU B CD1   
3768 C CD2   . LEU B 233 ? 1.3857 1.5838 1.2173 0.0000 0.0000 0.0000 230 LEU B CD2   
3769 N N     . LEU B 234 ? 1.4752 1.6194 1.2470 0.0000 0.0000 0.0000 231 LEU B N     
3770 C CA    . LEU B 234 ? 1.4859 1.5962 1.2638 0.0000 0.0000 0.0000 231 LEU B CA    
3771 C C     . LEU B 234 ? 1.5276 1.6211 1.3078 0.0000 0.0000 0.0000 231 LEU B C     
3772 O O     . LEU B 234 ? 1.5463 1.6020 1.3467 0.0000 0.0000 0.0000 231 LEU B O     
3773 C CB    . LEU B 234 ? 1.4631 1.5830 1.2231 0.0000 0.0000 0.0000 231 LEU B CB    
3774 C CG    . LEU B 234 ? 1.4272 1.5446 1.1938 0.0000 0.0000 0.0000 231 LEU B CG    
3775 C CD1   . LEU B 234 ? 1.4090 1.5373 1.1610 0.0000 0.0000 0.0000 231 LEU B CD1   
3776 C CD2   . LEU B 234 ? 1.4228 1.5054 1.2120 0.0000 0.0000 0.0000 231 LEU B CD2   
3777 N N     . THR B 235 ? 1.5464 1.6680 1.3063 0.0000 0.0000 0.0000 232 THR B N     
3778 C CA    . THR B 235 ? 1.5885 1.6995 1.3488 0.0000 0.0000 0.0000 232 THR B CA    
3779 C C     . THR B 235 ? 1.6190 1.7088 1.4075 0.0000 0.0000 0.0000 232 THR B C     
3780 O O     . THR B 235 ? 1.6465 1.6997 1.4538 0.0000 0.0000 0.0000 232 THR B O     
3781 C CB    . THR B 235 ? 1.6004 1.7536 1.3294 0.0000 0.0000 0.0000 232 THR B CB    
3782 O OG1   . THR B 235 ? 1.5811 1.7522 1.2877 0.0000 0.0000 0.0000 232 THR B OG1   
3783 C CG2   . THR B 235 ? 1.6378 1.7814 1.3680 0.0000 0.0000 0.0000 232 THR B CG2   
3784 N N     . LYS B 236 ? 1.6193 1.7318 1.4133 0.0000 0.0000 0.0000 233 LYS B N     
3785 C CA    . LYS B 236 ? 1.6529 1.7513 1.4776 0.0000 0.0000 0.0000 233 LYS B CA    
3786 C C     . LYS B 236 ? 1.6655 1.7128 1.5232 0.0000 0.0000 0.0000 233 LYS B C     
3787 O O     . LYS B 236 ? 1.7001 1.7169 1.5840 0.0000 0.0000 0.0000 233 LYS B O     
3788 C CB    . LYS B 236 ? 1.6345 1.7693 1.4623 0.0000 0.0000 0.0000 233 LYS B CB    
3789 N N     . LEU B 237 ? 1.6455 1.6836 1.5015 0.0000 0.0000 0.0000 234 LEU B N     
3790 C CA    . LEU B 237 ? 1.6587 1.6536 1.5418 0.0000 0.0000 0.0000 234 LEU B CA    
3791 C C     . LEU B 237 ? 1.6747 1.6337 1.5542 0.0000 0.0000 0.0000 234 LEU B C     
3792 O O     . LEU B 237 ? 1.6958 1.6137 1.5981 0.0000 0.0000 0.0000 234 LEU B O     
3793 C CB    . LEU B 237 ? 1.6251 1.6316 1.5143 0.0000 0.0000 0.0000 234 LEU B CB    
3794 C CG    . LEU B 237 ? 1.6240 1.6565 1.5303 0.0000 0.0000 0.0000 234 LEU B CG    
3795 C CD1   . LEU B 237 ? 1.5866 1.6316 1.4994 0.0000 0.0000 0.0000 234 LEU B CD1   
3796 C CD2   . LEU B 237 ? 1.6557 1.6648 1.5973 0.0000 0.0000 0.0000 234 LEU B CD2   
3797 N N     . LEU B 238 ? 1.6715 1.6477 1.5235 0.0000 0.0000 0.0000 235 LEU B N     
3798 C CA    . LEU B 238 ? 1.6919 1.6396 1.5418 0.0000 0.0000 0.0000 235 LEU B CA    
3799 C C     . LEU B 238 ? 1.7406 1.6558 1.6107 0.0000 0.0000 0.0000 235 LEU B C     
3800 O O     . LEU B 238 ? 1.7660 1.6355 1.6586 0.0000 0.0000 0.0000 235 LEU B O     
3801 C CB    . LEU B 238 ? 1.6775 1.6573 1.4963 0.0000 0.0000 0.0000 235 LEU B CB    
3802 C CG    . LEU B 238 ? 1.6442 1.6323 1.4506 0.0000 0.0000 0.0000 235 LEU B CG    
3803 C CD1   . LEU B 238 ? 1.6198 1.6523 1.3976 0.0000 0.0000 0.0000 235 LEU B CD1   
3804 C CD2   . LEU B 238 ? 1.6641 1.6164 1.4802 0.0000 0.0000 0.0000 235 LEU B CD2   
3805 N N     . VAL B 239 ? 1.7567 1.6956 1.6193 0.0000 0.0000 0.0000 236 VAL B N     
3806 C CA    . VAL B 239 ? 1.8026 1.7147 1.6863 0.0000 0.0000 0.0000 236 VAL B CA    
3807 C C     . VAL B 239 ? 1.8226 1.6905 1.7469 0.0000 0.0000 0.0000 236 VAL B C     
3808 O O     . VAL B 239 ? 1.8064 1.6859 1.7419 0.0000 0.0000 0.0000 236 VAL B O     
3809 C CB    . VAL B 239 ? 1.8150 1.7687 1.6847 0.0000 0.0000 0.0000 236 VAL B CB    
3810 C CG1   . VAL B 239 ? 1.8601 1.7879 1.7609 0.0000 0.0000 0.0000 236 VAL B CG1   
3811 C CG2   . VAL B 239 ? 1.8116 1.7968 1.6461 0.0000 0.0000 0.0000 236 VAL B CG2   
3812 N N     . GLY B 240 ? 1.8578 1.6751 1.8054 0.0000 0.0000 0.0000 237 GLY B N     
3813 C CA    . GLY B 240 ? 1.8778 1.6469 1.8657 0.0000 0.0000 0.0000 237 GLY B CA    
3814 C C     . GLY B 240 ? 1.8641 1.6002 1.8558 0.0000 0.0000 0.0000 237 GLY B C     
3815 O O     . GLY B 240 ? 1.9009 1.5838 1.9193 0.0000 0.0000 0.0000 237 GLY B O     
3816 N N     . ARG B 241 ? 1.8140 1.5814 1.7796 0.0000 0.0000 0.0000 238 ARG B N     
3817 C CA    . ARG B 241 ? 1.7994 1.5451 1.7624 0.0000 0.0000 0.0000 238 ARG B CA    
3818 C C     . ARG B 241 ? 1.7591 1.5376 1.6868 0.0000 0.0000 0.0000 238 ARG B C     
3819 O O     . ARG B 241 ? 1.7202 1.5221 1.6345 0.0000 0.0000 0.0000 238 ARG B O     
3820 C CB    . ARG B 241 ? 1.7857 1.5282 1.7646 0.0000 0.0000 0.0000 238 ARG B CB    
3821 C CG    . ARG B 241 ? 1.7376 1.5331 1.7007 0.0000 0.0000 0.0000 238 ARG B CG    
3822 C CD    . ARG B 241 ? 1.7381 1.5316 1.7284 0.0000 0.0000 0.0000 238 ARG B CD    
3823 N NE    . ARG B 241 ? 1.7679 1.5658 1.7805 0.0000 0.0000 0.0000 238 ARG B NE    
3824 C CZ    . ARG B 241 ? 1.7448 1.5874 1.7538 0.0000 0.0000 0.0000 238 ARG B CZ    
3825 N NH1   . ARG B 241 ? 1.6954 1.5794 1.6810 0.0000 0.0000 0.0000 238 ARG B NH1   
3826 N NH2   . ARG B 241 ? 1.7687 1.6147 1.7997 0.0000 0.0000 0.0000 238 ARG B NH2   
3827 N N     . PRO B 242 ? 1.7676 1.5484 1.6828 0.0000 0.0000 0.0000 239 PRO B N     
3828 C CA    . PRO B 242 ? 1.7297 1.5487 1.6140 0.0000 0.0000 0.0000 239 PRO B CA    
3829 C C     . PRO B 242 ? 1.7117 1.5179 1.5926 0.0000 0.0000 0.0000 239 PRO B C     
3830 O O     . PRO B 242 ? 1.6767 1.5166 1.5369 0.0000 0.0000 0.0000 239 PRO B O     
3831 C CB    . PRO B 242 ? 1.7567 1.5770 1.6353 0.0000 0.0000 0.0000 239 PRO B CB    
3832 C CG    . PRO B 242 ? 1.8092 1.5837 1.7177 0.0000 0.0000 0.0000 239 PRO B CG    
3833 C CD    . PRO B 242 ? 1.8165 1.5585 1.7499 0.0000 0.0000 0.0000 239 PRO B CD    
3834 N N     . THR B 243 ? 1.7369 1.4945 1.6394 0.0000 0.0000 0.0000 240 THR B N     
3835 C CA    . THR B 243 ? 1.7238 1.4648 1.6247 0.0000 0.0000 0.0000 240 THR B CA    
3836 C C     . THR B 243 ? 1.6882 1.4387 1.5878 0.0000 0.0000 0.0000 240 THR B C     
3837 O O     . THR B 243 ? 1.6754 1.4280 1.5662 0.0000 0.0000 0.0000 240 THR B O     
3838 C CB    . THR B 243 ? 1.7797 1.4619 1.7041 0.0000 0.0000 0.0000 240 THR B CB    
3839 O OG1   . THR B 243 ? 1.7841 1.4461 1.7104 0.0000 0.0000 0.0000 240 THR B OG1   
3840 C CG2   . THR B 243 ? 1.8171 1.4640 1.7703 0.0000 0.0000 0.0000 240 THR B CG2   
3841 N N     . LYS B 244 ? 1.6680 1.4281 1.5763 0.0000 0.0000 0.0000 241 LYS B N     
3842 C CA    . LYS B 244 ? 1.6406 1.4053 1.5537 0.0000 0.0000 0.0000 241 LYS B CA    
3843 C C     . LYS B 244 ? 1.5871 1.4012 1.4867 0.0000 0.0000 0.0000 241 LYS B C     
3844 O O     . LYS B 244 ? 1.5770 1.3964 1.4880 0.0000 0.0000 0.0000 241 LYS B O     
3845 C CB    . LYS B 244 ? 1.6774 1.4024 1.6218 0.0000 0.0000 0.0000 241 LYS B CB    
3846 N N     . TRP B 245 ? 1.5523 1.4024 1.4294 0.0000 0.0000 0.0000 242 TRP B N     
3847 C CA    . TRP B 245 ? 1.5058 1.4006 1.3704 0.0000 0.0000 0.0000 242 TRP B CA    
3848 C C     . TRP B 245 ? 1.4711 1.3848 1.3280 0.0000 0.0000 0.0000 242 TRP B C     
3849 O O     . TRP B 245 ? 1.4408 1.3853 1.2936 0.0000 0.0000 0.0000 242 TRP B O     
3850 C CB    . TRP B 245 ? 1.4892 1.4154 1.3334 0.0000 0.0000 0.0000 242 TRP B CB    
3851 C CG    . TRP B 245 ? 1.4750 1.4068 1.3045 0.0000 0.0000 0.0000 242 TRP B CG    
3852 C CD1   . TRP B 245 ? 1.5009 1.4159 1.3300 0.0000 0.0000 0.0000 242 TRP B CD1   
3853 C CD2   . TRP B 245 ? 1.4317 1.3897 1.2478 0.0000 0.0000 0.0000 242 TRP B CD2   
3854 N NE1   . TRP B 245 ? 1.4799 1.4114 1.2966 0.0000 0.0000 0.0000 242 TRP B NE1   
3855 C CE2   . TRP B 245 ? 1.4363 1.3938 1.2453 0.0000 0.0000 0.0000 242 TRP B CE2   
3856 C CE3   . TRP B 245 ? 1.3902 1.3725 1.2021 0.0000 0.0000 0.0000 242 TRP B CE3   
3857 C CZ2   . TRP B 245 ? 1.4004 1.3823 1.1995 0.0000 0.0000 0.0000 242 TRP B CZ2   
3858 C CZ3   . TRP B 245 ? 1.3582 1.3618 1.1597 0.0000 0.0000 0.0000 242 TRP B CZ3   
3859 C CH2   . TRP B 245 ? 1.3622 1.3661 1.1580 0.0000 0.0000 0.0000 242 TRP B CH2   
3860 N N     . TYR B 246 ? 1.4770 1.3738 1.3321 0.0000 0.0000 0.0000 243 TYR B N     
3861 C CA    . TYR B 246 ? 1.4457 1.3629 1.2921 0.0000 0.0000 0.0000 243 TYR B CA    
3862 C C     . TYR B 246 ? 1.4348 1.3543 1.2934 0.0000 0.0000 0.0000 243 TYR B C     
3863 O O     . TYR B 246 ? 1.4019 1.3532 1.2555 0.0000 0.0000 0.0000 243 TYR B O     
3864 C CB    . TYR B 246 ? 1.4617 1.3614 1.3031 0.0000 0.0000 0.0000 243 TYR B CB    
3865 C CG    . TYR B 246 ? 1.4503 1.3731 1.2818 0.0000 0.0000 0.0000 243 TYR B CG    
3866 C CD1   . TYR B 246 ? 1.4370 1.3858 1.2545 0.0000 0.0000 0.0000 243 TYR B CD1   
3867 C CD2   . TYR B 246 ? 1.4660 1.3872 1.3038 0.0000 0.0000 0.0000 243 TYR B CD2   
3868 C CE1   . TYR B 246 ? 1.4216 1.3934 1.2316 0.0000 0.0000 0.0000 243 TYR B CE1   
3869 C CE2   . TYR B 246 ? 1.4474 1.3929 1.2751 0.0000 0.0000 0.0000 243 TYR B CE2   
3870 C CZ    . TYR B 246 ? 1.4268 1.3969 1.2407 0.0000 0.0000 0.0000 243 TYR B CZ    
3871 O OH    . TYR B 246 ? 1.4149 1.4103 1.2205 0.0000 0.0000 0.0000 243 TYR B OH    
3872 N N     . ASP B 247 ? 1.4625 1.3483 1.3397 0.0000 0.0000 0.0000 244 ASP B N     
3873 C CA    . ASP B 247 ? 1.4574 1.3435 1.3505 0.0000 0.0000 0.0000 244 ASP B CA    
3874 C C     . ASP B 247 ? 1.4277 1.3423 1.3289 0.0000 0.0000 0.0000 244 ASP B C     
3875 O O     . ASP B 247 ? 1.4162 1.3463 1.3279 0.0000 0.0000 0.0000 244 ASP B O     
3876 C CB    . ASP B 247 ? 1.5076 1.3487 1.4232 0.0000 0.0000 0.0000 244 ASP B CB    
3877 C CG    . ASP B 247 ? 1.5475 1.3577 1.4563 0.0000 0.0000 0.0000 244 ASP B CG    
3878 O OD1   . ASP B 247 ? 1.5458 1.3686 1.4420 0.0000 0.0000 0.0000 244 ASP B OD1   
3879 O OD2   . ASP B 247 ? 1.5934 1.3684 1.5096 0.0000 0.0000 0.0000 244 ASP B OD2   
3880 N N     . LEU B 248 ? 1.4135 1.3375 1.3094 0.0000 0.0000 0.0000 245 LEU B N     
3881 C CA    . LEU B 248 ? 1.3886 1.3397 1.2908 0.0000 0.0000 0.0000 245 LEU B CA    
3882 C C     . LEU B 248 ? 1.3405 1.3335 1.2252 0.0000 0.0000 0.0000 245 LEU B C     
3883 O O     . LEU B 248 ? 1.3283 1.3467 1.2194 0.0000 0.0000 0.0000 245 LEU B O     
3884 C CB    . LEU B 248 ? 1.4113 1.3530 1.3168 0.0000 0.0000 0.0000 245 LEU B CB    
3885 C CG    . LEU B 248 ? 1.4531 1.3529 1.3838 0.0000 0.0000 0.0000 245 LEU B CG    
3886 C CD1   . LEU B 248 ? 1.4769 1.3754 1.4095 0.0000 0.0000 0.0000 245 LEU B CD1   
3887 C CD2   . LEU B 248 ? 1.4517 1.3473 1.4106 0.0000 0.0000 0.0000 245 LEU B CD2   
3888 N N     . LEU B 249 ? 1.3112 1.3113 1.1764 0.0000 0.0000 0.0000 246 LEU B N     
3889 C CA    . LEU B 249 ? 1.2642 1.2997 1.1153 0.0000 0.0000 0.0000 246 LEU B CA    
3890 C C     . LEU B 249 ? 1.2383 1.2964 1.0998 0.0000 0.0000 0.0000 246 LEU B C     
3891 O O     . LEU B 249 ? 1.2227 1.3075 1.0810 0.0000 0.0000 0.0000 246 LEU B O     
3892 C CB    . LEU B 249 ? 1.2487 1.2879 1.0841 0.0000 0.0000 0.0000 246 LEU B CB    
3893 C CG    . LEU B 249 ? 1.2535 1.2884 1.0753 0.0000 0.0000 0.0000 246 LEU B CG    
3894 C CD1   . LEU B 249 ? 1.2389 1.2800 1.0516 0.0000 0.0000 0.0000 246 LEU B CD1   
3895 C CD2   . LEU B 249 ? 1.2423 1.3017 1.0535 0.0000 0.0000 0.0000 246 LEU B CD2   
3896 N N     . PRO B 250 ? 1.2352 1.2841 1.1093 0.0000 0.0000 0.0000 247 PRO B N     
3897 C CA    . PRO B 250 ? 1.2124 1.2859 1.0990 0.0000 0.0000 0.0000 247 PRO B CA    
3898 C C     . PRO B 250 ? 1.2138 1.2974 1.1168 0.0000 0.0000 0.0000 247 PRO B C     
3899 O O     . PRO B 250 ? 1.1922 1.3053 1.0964 0.0000 0.0000 0.0000 247 PRO B O     
3900 C CB    . PRO B 250 ? 1.2231 1.2825 1.1199 0.0000 0.0000 0.0000 247 PRO B CB    
3901 C CG    . PRO B 250 ? 1.2398 1.2739 1.1229 0.0000 0.0000 0.0000 247 PRO B CG    
3902 C CD    . PRO B 250 ? 1.2561 1.2754 1.1333 0.0000 0.0000 0.0000 247 PRO B CD    
3903 N N     . VAL B 251 ? 1.2381 1.2978 1.1550 0.0000 0.0000 0.0000 248 VAL B N     
3904 C CA    . VAL B 251 ? 1.2424 1.3129 1.1780 0.0000 0.0000 0.0000 248 VAL B CA    
3905 C C     . VAL B 251 ? 1.2288 1.3237 1.1485 0.0000 0.0000 0.0000 248 VAL B C     
3906 O O     . VAL B 251 ? 1.2210 1.3425 1.1502 0.0000 0.0000 0.0000 248 VAL B O     
3907 C CB    . VAL B 251 ? 1.2806 1.3176 1.2344 0.0000 0.0000 0.0000 248 VAL B CB    
3908 C CG1   . VAL B 251 ? 1.2803 1.3323 1.2630 0.0000 0.0000 0.0000 248 VAL B CG1   
3909 C CG2   . VAL B 251 ? 1.3007 1.3025 1.2612 0.0000 0.0000 0.0000 248 VAL B CG2   
3910 N N     . VAL B 252 ? 1.2246 1.3120 1.1202 0.0000 0.0000 0.0000 249 VAL B N     
3911 C CA    . VAL B 252 ? 1.2142 1.3247 1.0901 0.0000 0.0000 0.0000 249 VAL B CA    
3912 C C     . VAL B 252 ? 1.1825 1.3234 1.0516 0.0000 0.0000 0.0000 249 VAL B C     
3913 O O     . VAL B 252 ? 1.1790 1.3463 1.0499 0.0000 0.0000 0.0000 249 VAL B O     
3914 C CB    . VAL B 252 ? 1.2225 1.3188 1.0765 0.0000 0.0000 0.0000 249 VAL B CB    
3915 C CG1   . VAL B 252 ? 1.2066 1.3311 1.0379 0.0000 0.0000 0.0000 249 VAL B CG1   
3916 C CG2   . VAL B 252 ? 1.2513 1.3175 1.1131 0.0000 0.0000 0.0000 249 VAL B CG2   
3917 N N     . GLN B 253 ? 1.1623 1.2992 1.0250 0.0000 0.0000 0.0000 250 GLN B N     
3918 C CA    . GLN B 253 ? 1.1353 1.2958 0.9948 0.0000 0.0000 0.0000 250 GLN B CA    
3919 C C     . GLN B 253 ? 1.1259 1.3076 1.0046 0.0000 0.0000 0.0000 250 GLN B C     
3920 O O     . GLN B 253 ? 1.1152 1.3209 0.9911 0.0000 0.0000 0.0000 250 GLN B O     
3921 C CB    . GLN B 253 ? 1.1236 1.2745 0.9814 0.0000 0.0000 0.0000 250 GLN B CB    
3922 C CG    . GLN B 253 ? 1.1098 1.2803 0.9629 0.0000 0.0000 0.0000 250 GLN B CG    
3923 C CD    . GLN B 253 ? 1.1246 1.2864 0.9703 0.0000 0.0000 0.0000 250 GLN B CD    
3924 O OE1   . GLN B 253 ? 1.1439 1.2907 0.9785 0.0000 0.0000 0.0000 250 GLN B OE1   
3925 N NE2   . GLN B 253 ? 1.1188 1.2925 0.9714 0.0000 0.0000 0.0000 250 GLN B NE2   
3926 N N     . LEU B 254 ? 1.1333 1.3065 1.0327 0.0000 0.0000 0.0000 251 LEU B N     
3927 C CA    . LEU B 254 ? 1.1259 1.3212 1.0484 0.0000 0.0000 0.0000 251 LEU B CA    
3928 C C     . LEU B 254 ? 1.1354 1.3513 1.0615 0.0000 0.0000 0.0000 251 LEU B C     
3929 O O     . LEU B 254 ? 1.1225 1.3671 1.0580 0.0000 0.0000 0.0000 251 LEU B O     
3930 C CB    . LEU B 254 ? 1.1394 1.3198 1.0849 0.0000 0.0000 0.0000 251 LEU B CB    
3931 C CG    . LEU B 254 ? 1.1250 1.3056 1.0797 0.0000 0.0000 0.0000 251 LEU B CG    
3932 C CD1   . LEU B 254 ? 1.1342 1.2998 1.1124 0.0000 0.0000 0.0000 251 LEU B CD1   
3933 C CD2   . LEU B 254 ? 1.0983 1.3133 1.0621 0.0000 0.0000 0.0000 251 LEU B CD2   
3934 N N     . ALA B 255 ? 1.1609 1.3635 1.0799 0.0000 0.0000 0.0000 252 ALA B N     
3935 C CA    . ALA B 255 ? 1.1766 1.3999 1.0983 0.0000 0.0000 0.0000 252 ALA B CA    
3936 C C     . ALA B 255 ? 1.1697 1.4185 1.0681 0.0000 0.0000 0.0000 252 ALA B C     
3937 O O     . ALA B 255 ? 1.1660 1.4447 1.0702 0.0000 0.0000 0.0000 252 ALA B O     
3938 C CB    . ALA B 255 ? 1.2003 1.4020 1.1196 0.0000 0.0000 0.0000 252 ALA B CB    
3939 N N     . LEU B 256 ? 1.1740 1.4116 1.0476 0.0000 0.0000 0.0000 253 LEU B N     
3940 C CA    . LEU B 256 ? 1.1765 1.4340 1.0278 0.0000 0.0000 0.0000 253 LEU B CA    
3941 C C     . LEU B 256 ? 1.1639 1.4416 1.0262 0.0000 0.0000 0.0000 253 LEU B C     
3942 O O     . LEU B 256 ? 1.1699 1.4729 1.0271 0.0000 0.0000 0.0000 253 LEU B O     
3943 C CB    . LEU B 256 ? 1.1698 1.4102 0.9996 0.0000 0.0000 0.0000 253 LEU B CB    
3944 C CG    . LEU B 256 ? 1.1888 1.4091 1.0069 0.0000 0.0000 0.0000 253 LEU B CG    
3945 C CD1   . LEU B 256 ? 1.1853 1.3894 0.9906 0.0000 0.0000 0.0000 253 LEU B CD1   
3946 C CD2   . LEU B 256 ? 1.2136 1.4524 1.0134 0.0000 0.0000 0.0000 253 LEU B CD2   
3947 N N     . ASN B 257 ? 1.1548 1.4223 1.0318 0.0000 0.0000 0.0000 254 ASN B N     
3948 C CA    . ASN B 257 ? 1.1461 1.4306 1.0340 0.0000 0.0000 0.0000 254 ASN B CA    
3949 C C     . ASN B 257 ? 1.1530 1.4628 1.0650 0.0000 0.0000 0.0000 254 ASN B C     
3950 O O     . ASN B 257 ? 1.1399 1.4693 1.0599 0.0000 0.0000 0.0000 254 ASN B O     
3951 C CB    . ASN B 257 ? 1.1276 1.3971 1.0215 0.0000 0.0000 0.0000 254 ASN B CB    
3952 C CG    . ASN B 257 ? 1.1220 1.3746 0.9947 0.0000 0.0000 0.0000 254 ASN B CG    
3953 O OD1   . ASN B 257 ? 1.1148 1.3727 0.9708 0.0000 0.0000 0.0000 254 ASN B OD1   
3954 N ND2   . ASN B 257 ? 1.1116 1.3459 0.9851 0.0000 0.0000 0.0000 254 ASN B ND2   
3955 N N     . ASN B 258 ? 1.1793 1.4888 1.1053 0.0000 0.0000 0.0000 255 ASN B N     
3956 C CA    . ASN B 258 ? 1.1967 1.5340 1.1483 0.0000 0.0000 0.0000 255 ASN B CA    
3957 C C     . ASN B 258 ? 1.2299 1.5860 1.1750 0.0000 0.0000 0.0000 255 ASN B C     
3958 O O     . ASN B 258 ? 1.2402 1.6164 1.2085 0.0000 0.0000 0.0000 255 ASN B O     
3959 C CB    . ASN B 258 ? 1.1966 1.5258 1.1762 0.0000 0.0000 0.0000 255 ASN B CB    
3960 C CG    . ASN B 258 ? 1.1769 1.5094 1.1694 0.0000 0.0000 0.0000 255 ASN B CG    
3961 O OD1   . ASN B 258 ? 1.1722 1.5316 1.1774 0.0000 0.0000 0.0000 255 ASN B OD1   
3962 N ND2   . ASN B 258 ? 1.1713 1.4783 1.1600 0.0000 0.0000 0.0000 255 ASN B ND2   
3963 N N     . THR B 259 ? 1.2537 1.6065 1.1672 0.0000 0.0000 0.0000 256 THR B N     
3964 C CA    . THR B 259 ? 1.2921 1.6654 1.1915 0.0000 0.0000 0.0000 256 THR B CA    
3965 C C     . THR B 259 ? 1.3012 1.7070 1.1911 0.0000 0.0000 0.0000 256 THR B C     
3966 O O     . THR B 259 ? 1.2871 1.6883 1.1612 0.0000 0.0000 0.0000 256 THR B O     
3967 C CB    . THR B 259 ? 1.3099 1.6626 1.1799 0.0000 0.0000 0.0000 256 THR B CB    
3968 O OG1   . THR B 259 ? 1.3283 1.6575 1.2130 0.0000 0.0000 0.0000 256 THR B OG1   
3969 C CG2   . THR B 259 ? 1.3325 1.7122 1.1772 0.0000 0.0000 0.0000 256 THR B CG2   
3970 N N     . TYR B 260 ? 1.3310 1.7696 1.2327 0.0000 0.0000 0.0000 257 TYR B N     
3971 C CA    . TYR B 260 ? 1.3534 1.8267 1.2482 0.0000 0.0000 0.0000 257 TYR B CA    
3972 C C     . TYR B 260 ? 1.3796 1.8570 1.2331 0.0000 0.0000 0.0000 257 TYR B C     
3973 O O     . TYR B 260 ? 1.4019 1.8804 1.2321 0.0000 0.0000 0.0000 257 TYR B O     
3974 C CB    . TYR B 260 ? 1.3652 1.8763 1.2826 0.0000 0.0000 0.0000 257 TYR B CB    
3975 C CG    . TYR B 260 ? 1.3657 1.8878 1.3236 0.0000 0.0000 0.0000 257 TYR B CG    
3976 C CD1   . TYR B 260 ? 1.3747 1.8846 1.3648 0.0000 0.0000 0.0000 257 TYR B CD1   
3977 C CD2   . TYR B 260 ? 1.3749 1.9179 1.3394 0.0000 0.0000 0.0000 257 TYR B CD2   
3978 C CE1   . TYR B 260 ? 1.3672 1.8908 1.3944 0.0000 0.0000 0.0000 257 TYR B CE1   
3979 C CE2   . TYR B 260 ? 1.3660 1.9215 1.3686 0.0000 0.0000 0.0000 257 TYR B CE2   
3980 C CZ    . TYR B 260 ? 1.3604 1.9082 1.3933 0.0000 0.0000 0.0000 257 TYR B CZ    
3981 O OH    . TYR B 260 ? 1.3492 1.9139 1.4186 0.0000 0.0000 0.0000 257 TYR B OH    
3982 N N     . SER B 261 ? 1.3888 1.8677 1.2349 0.0000 0.0000 0.0000 258 SER B N     
3983 C CA    . SER B 261 ? 1.4185 1.9036 1.2285 0.0000 0.0000 0.0000 258 SER B CA    
3984 C C     . SER B 261 ? 1.4498 1.9774 1.2503 0.0000 0.0000 0.0000 258 SER B C     
3985 O O     . SER B 261 ? 1.4448 1.9905 1.2678 0.0000 0.0000 0.0000 258 SER B O     
3986 C CB    . SER B 261 ? 1.4013 1.8631 1.2102 0.0000 0.0000 0.0000 258 SER B CB    
3987 O OG    . SER B 261 ? 1.4218 1.8911 1.2005 0.0000 0.0000 0.0000 258 SER B OG    
3988 N N     . PRO B 262 ? 1.4846 2.0307 1.2518 0.0000 0.0000 0.0000 259 PRO B N     
3989 C CA    . PRO B 262 ? 1.5157 2.1047 1.2642 0.0000 0.0000 0.0000 259 PRO B CA    
3990 C C     . PRO B 262 ? 1.5164 2.1118 1.2652 0.0000 0.0000 0.0000 259 PRO B C     
3991 O O     . PRO B 262 ? 1.5282 2.1578 1.2855 0.0000 0.0000 0.0000 259 PRO B O     
3992 C CB    . PRO B 262 ? 1.5455 2.1399 1.2493 0.0000 0.0000 0.0000 259 PRO B CB    
3993 C CG    . PRO B 262 ? 1.5328 2.0957 1.2422 0.0000 0.0000 0.0000 259 PRO B CG    
3994 C CD    . PRO B 262 ? 1.4935 2.0242 1.2420 0.0000 0.0000 0.0000 259 PRO B CD    
3995 N N     . VAL B 263 ? 1.5054 2.0682 1.2471 0.0000 0.0000 0.0000 260 VAL B N     
3996 C CA    . VAL B 263 ? 1.5000 2.0572 1.2511 0.0000 0.0000 0.0000 260 VAL B CA    
3997 C C     . VAL B 263 ? 1.4599 1.9957 1.2544 0.0000 0.0000 0.0000 260 VAL B C     
3998 O O     . VAL B 263 ? 1.4341 1.9430 1.2396 0.0000 0.0000 0.0000 260 VAL B O     
3999 C CB    . VAL B 263 ? 1.5131 2.0469 1.2369 0.0000 0.0000 0.0000 260 VAL B CB    
4000 C CG1   . VAL B 263 ? 1.5142 2.0431 1.2492 0.0000 0.0000 0.0000 260 VAL B CG1   
4001 C CG2   . VAL B 263 ? 1.5436 2.0978 1.2215 0.0000 0.0000 0.0000 260 VAL B CG2   
4002 N N     . LEU B 264 ? 1.4522 2.0025 1.2704 0.0000 0.0000 0.0000 261 LEU B N     
4003 C CA    . LEU B 264 ? 1.4149 1.9527 1.2750 0.0000 0.0000 0.0000 261 LEU B CA    
4004 C C     . LEU B 264 ? 1.3878 1.9448 1.2769 0.0000 0.0000 0.0000 261 LEU B C     
4005 O O     . LEU B 264 ? 1.3700 1.9355 1.2947 0.0000 0.0000 0.0000 261 LEU B O     
4006 C CB    . LEU B 264 ? 1.3978 1.8926 1.2618 0.0000 0.0000 0.0000 261 LEU B CB    
4007 C CG    . LEU B 264 ? 1.4180 1.8881 1.2645 0.0000 0.0000 0.0000 261 LEU B CG    
4008 C CD1   . LEU B 264 ? 1.3952 1.8321 1.2309 0.0000 0.0000 0.0000 261 LEU B CD1   
4009 C CD2   . LEU B 264 ? 1.4220 1.8848 1.2964 0.0000 0.0000 0.0000 261 LEU B CD2   
4010 N N     . LYS B 265 ? 1.3800 1.9442 1.2552 0.0000 0.0000 0.0000 262 LYS B N     
4011 C CA    . LYS B 265 ? 1.3503 1.9221 1.2529 0.0000 0.0000 0.0000 262 LYS B CA    
4012 C C     . LYS B 265 ? 1.3028 1.8518 1.2380 0.0000 0.0000 0.0000 262 LYS B C     
4013 O O     . LYS B 265 ? 1.2897 1.8578 1.2603 0.0000 0.0000 0.0000 262 LYS B O     
4014 C CB    . LYS B 265 ? 1.3686 1.9879 1.2877 0.0000 0.0000 0.0000 262 LYS B CB    
4015 C CG    . LYS B 265 ? 1.4093 2.0566 1.2934 0.0000 0.0000 0.0000 262 LYS B CG    
4016 C CD    . LYS B 265 ? 1.4309 2.1279 1.3288 0.0000 0.0000 0.0000 262 LYS B CD    
4017 C CE    . LYS B 265 ? 1.4588 2.1752 1.3166 0.0000 0.0000 0.0000 262 LYS B CE    
4018 N NZ    . LYS B 265 ? 1.4684 2.2148 1.3442 0.0000 0.0000 0.0000 262 LYS B NZ    
4019 N N     . TYR B 266 ? 1.2664 1.7777 1.1883 0.0000 0.0000 0.0000 263 TYR B N     
4020 C CA    . TYR B 266 ? 1.2204 1.7079 1.1644 0.0000 0.0000 0.0000 263 TYR B CA    
4021 C C     . TYR B 266 ? 1.2027 1.6593 1.1286 0.0000 0.0000 0.0000 263 TYR B C     
4022 O O     . TYR B 266 ? 1.2137 1.6569 1.1089 0.0000 0.0000 0.0000 263 TYR B O     
4023 C CB    . TYR B 266 ? 1.2088 1.6828 1.1578 0.0000 0.0000 0.0000 263 TYR B CB    
4024 C CG    . TYR B 266 ? 1.2162 1.7163 1.1932 0.0000 0.0000 0.0000 263 TYR B CG    
4025 C CD1   . TYR B 266 ? 1.2136 1.7406 1.2225 0.0000 0.0000 0.0000 263 TYR B CD1   
4026 C CD2   . TYR B 266 ? 1.2344 1.7324 1.2092 0.0000 0.0000 0.0000 263 TYR B CD2   
4027 C CE1   . TYR B 266 ? 1.2139 1.7684 1.2512 0.0000 0.0000 0.0000 263 TYR B CE1   
4028 C CE2   . TYR B 266 ? 1.2403 1.7616 1.2433 0.0000 0.0000 0.0000 263 TYR B CE2   
4029 C CZ    . TYR B 266 ? 1.2265 1.7777 1.2605 0.0000 0.0000 0.0000 263 TYR B CZ    
4030 O OH    . TYR B 266 ? 1.2297 1.8076 1.2939 0.0000 0.0000 0.0000 263 TYR B OH    
4031 N N     . THR B 267 ? 1.1723 1.6187 1.1176 0.0000 0.0000 0.0000 264 THR B N     
4032 C CA    . THR B 267 ? 1.1532 1.5674 1.0846 0.0000 0.0000 0.0000 264 THR B CA    
4033 C C     . THR B 267 ? 1.1269 1.5185 1.0500 0.0000 0.0000 0.0000 264 THR B C     
4034 O O     . THR B 267 ? 1.1163 1.5147 1.0556 0.0000 0.0000 0.0000 264 THR B O     
4035 C CB    . THR B 267 ? 1.1484 1.5565 1.1044 0.0000 0.0000 0.0000 264 THR B CB    
4036 O OG1   . THR B 267 ? 1.1269 1.5397 1.1086 0.0000 0.0000 0.0000 264 THR B OG1   
4037 C CG2   . THR B 267 ? 1.1628 1.5959 1.1341 0.0000 0.0000 0.0000 264 THR B CG2   
4038 N N     . PRO B 268 ? 1.1159 1.4828 1.0156 0.0000 0.0000 0.0000 265 PRO B N     
4039 C CA    . PRO B 268 ? 1.0931 1.4398 0.9903 0.0000 0.0000 0.0000 265 PRO B CA    
4040 C C     . PRO B 268 ? 1.0656 1.4099 0.9891 0.0000 0.0000 0.0000 265 PRO B C     
4041 O O     . PRO B 268 ? 1.0559 1.3997 0.9888 0.0000 0.0000 0.0000 265 PRO B O     
4042 C CB    . PRO B 268 ? 1.0965 1.4206 0.9724 0.0000 0.0000 0.0000 265 PRO B CB    
4043 C CG    . PRO B 268 ? 1.1220 1.4561 0.9809 0.0000 0.0000 0.0000 265 PRO B CG    
4044 C CD    . PRO B 268 ? 1.1332 1.4950 1.0068 0.0000 0.0000 0.0000 265 PRO B CD    
4045 N N     . HIS B 269 ? 1.0522 1.3957 0.9880 0.0000 0.0000 0.0000 266 HIS B N     
4046 C CA    . HIS B 269 ? 1.0266 1.3736 0.9861 0.0000 0.0000 0.0000 266 HIS B CA    
4047 C C     . HIS B 269 ? 1.0134 1.3835 0.9941 0.0000 0.0000 0.0000 266 HIS B C     
4048 O O     . HIS B 269 ? 1.0028 1.3709 0.9926 0.0000 0.0000 0.0000 266 HIS B O     
4049 C CB    . HIS B 269 ? 1.0331 1.3836 1.0069 0.0000 0.0000 0.0000 266 HIS B CB    
4050 C CG    . HIS B 269 ? 1.0165 1.3722 1.0124 0.0000 0.0000 0.0000 266 HIS B CG    
4051 N ND1   . HIS B 269 ? 0.9967 1.3801 1.0187 0.0000 0.0000 0.0000 266 HIS B ND1   
4052 C CD2   . HIS B 269 ? 1.0108 1.3498 1.0058 0.0000 0.0000 0.0000 266 HIS B CD2   
4053 C CE1   . HIS B 269 ? 0.9956 1.3807 1.0311 0.0000 0.0000 0.0000 266 HIS B CE1   
4054 N NE2   . HIS B 269 ? 1.0068 1.3648 1.0251 0.0000 0.0000 0.0000 266 HIS B NE2   
4055 N N     . GLN B 270 ? 1.0157 1.4091 1.0049 0.0000 0.0000 0.0000 267 GLN B N     
4056 C CA    . GLN B 270 ? 1.0052 1.4232 1.0178 0.0000 0.0000 0.0000 267 GLN B CA    
4057 C C     . GLN B 270 ? 0.9969 1.4055 1.0036 0.0000 0.0000 0.0000 267 GLN B C     
4058 O O     . GLN B 270 ? 0.9885 1.4051 1.0165 0.0000 0.0000 0.0000 267 GLN B O     
4059 C CB    . GLN B 270 ? 1.0208 1.4670 1.0400 0.0000 0.0000 0.0000 267 GLN B CB    
4060 C CG    . GLN B 270 ? 1.0357 1.5000 1.0763 0.0000 0.0000 0.0000 267 GLN B CG    
4061 C CD    . GLN B 270 ? 1.0712 1.5625 1.1134 0.0000 0.0000 0.0000 267 GLN B CD    
4062 O OE1   . GLN B 270 ? 1.0867 1.5917 1.1200 0.0000 0.0000 0.0000 267 GLN B OE1   
4063 N NE2   . GLN B 270 ? 1.0945 1.5938 1.1487 0.0000 0.0000 0.0000 267 GLN B NE2   
4064 N N     . LEU B 271 ? 1.0027 1.3947 0.9827 0.0000 0.0000 0.0000 268 LEU B N     
4065 C CA    . LEU B 271 ? 1.0046 1.3853 0.9809 0.0000 0.0000 0.0000 268 LEU B CA    
4066 C C     . LEU B 271 ? 0.9914 1.3519 0.9731 0.0000 0.0000 0.0000 268 LEU B C     
4067 O O     . LEU B 271 ? 0.9916 1.3468 0.9858 0.0000 0.0000 0.0000 268 LEU B O     
4068 C CB    . LEU B 271 ? 1.0210 1.3925 0.9673 0.0000 0.0000 0.0000 268 LEU B CB    
4069 C CG    . LEU B 271 ? 1.0465 1.4406 0.9825 0.0000 0.0000 0.0000 268 LEU B CG    
4070 C CD1   . LEU B 271 ? 1.0697 1.4547 0.9712 0.0000 0.0000 0.0000 268 LEU B CD1   
4071 C CD2   . LEU B 271 ? 1.0523 1.4629 1.0070 0.0000 0.0000 0.0000 268 LEU B CD2   
4072 N N     . LEU B 272 ? 0.9818 1.3311 0.9547 0.0000 0.0000 0.0000 269 LEU B N     
4073 C CA    . LEU B 272 ? 0.9646 1.2994 0.9402 0.0000 0.0000 0.0000 269 LEU B CA    
4074 C C     . LEU B 272 ? 0.9542 1.3038 0.9557 0.0000 0.0000 0.0000 269 LEU B C     
4075 O O     . LEU B 272 ? 0.9494 1.2968 0.9628 0.0000 0.0000 0.0000 269 LEU B O     
4076 C CB    . LEU B 272 ? 0.9609 1.2798 0.9164 0.0000 0.0000 0.0000 269 LEU B CB    
4077 C CG    . LEU B 272 ? 0.9507 1.2571 0.9052 0.0000 0.0000 0.0000 269 LEU B CG    
4078 C CD1   . LEU B 272 ? 0.9528 1.2514 0.9101 0.0000 0.0000 0.0000 269 LEU B CD1   
4079 C CD2   . LEU B 272 ? 0.9473 1.2380 0.8813 0.0000 0.0000 0.0000 269 LEU B CD2   
4080 N N     . PHE B 273 ? 0.9529 1.3194 0.9648 0.0000 0.0000 0.0000 270 PHE B N     
4081 C CA    . PHE B 273 ? 0.9464 1.3298 0.9807 0.0000 0.0000 0.0000 270 PHE B CA    
4082 C C     . PHE B 273 ? 0.9558 1.3665 1.0180 0.0000 0.0000 0.0000 270 PHE B C     
4083 O O     . PHE B 273 ? 0.9518 1.3783 1.0344 0.0000 0.0000 0.0000 270 PHE B O     
4084 C CB    . PHE B 273 ? 0.9441 1.3285 0.9757 0.0000 0.0000 0.0000 270 PHE B CB    
4085 C CG    . PHE B 273 ? 0.9391 1.2973 0.9458 0.0000 0.0000 0.0000 270 PHE B CG    
4086 C CD1   . PHE B 273 ? 0.9416 1.2862 0.9332 0.0000 0.0000 0.0000 270 PHE B CD1   
4087 C CD2   . PHE B 273 ? 0.9258 1.2746 0.9257 0.0000 0.0000 0.0000 270 PHE B CD2   
4088 C CE1   . PHE B 273 ? 0.9394 1.2602 0.9098 0.0000 0.0000 0.0000 270 PHE B CE1   
4089 C CE2   . PHE B 273 ? 0.9234 1.2513 0.9017 0.0000 0.0000 0.0000 270 PHE B CE2   
4090 C CZ    . PHE B 273 ? 0.9299 1.2432 0.8936 0.0000 0.0000 0.0000 270 PHE B CZ    
4091 N N     . GLY B 274 ? 0.9765 1.3959 1.0396 0.0000 0.0000 0.0000 271 GLY B N     
4092 C CA    . GLY B 274 ? 0.9916 1.4390 1.0820 0.0000 0.0000 0.0000 271 GLY B CA    
4093 C C     . GLY B 274 ? 0.9992 1.4763 1.1135 0.0000 0.0000 0.0000 271 GLY B C     
4094 O O     . GLY B 274 ? 0.9989 1.5022 1.1418 0.0000 0.0000 0.0000 271 GLY B O     
4095 N N     . ILE B 275 ? 1.0120 1.4846 1.1168 0.0000 0.0000 0.0000 272 ILE B N     
4096 C CA    . ILE B 275 ? 1.0266 1.5254 1.1543 0.0000 0.0000 0.0000 272 ILE B CA    
4097 C C     . ILE B 275 ? 1.0464 1.5345 1.1592 0.0000 0.0000 0.0000 272 ILE B C     
4098 O O     . ILE B 275 ? 1.0561 1.5189 1.1402 0.0000 0.0000 0.0000 272 ILE B O     
4099 C CB    . ILE B 275 ? 1.0193 1.5226 1.1584 0.0000 0.0000 0.0000 272 ILE B CB    
4100 C CG1   . ILE B 275 ? 1.0152 1.4851 1.1261 0.0000 0.0000 0.0000 272 ILE B CG1   
4101 C CG2   . ILE B 275 ? 1.0222 1.5550 1.1900 0.0000 0.0000 0.0000 272 ILE B CG2   
4102 C CD1   . ILE B 275 ? 1.0252 1.4747 1.1201 0.0000 0.0000 0.0000 272 ILE B CD1   
4103 N N     . ASP B 276 ? 1.0613 1.5693 1.1958 0.0000 0.0000 0.0000 273 ASP B N     
4104 C CA    . ASP B 276 ? 1.0852 1.5826 1.2112 0.0000 0.0000 0.0000 273 ASP B CA    
4105 C C     . ASP B 276 ? 1.0876 1.5571 1.2046 0.0000 0.0000 0.0000 273 ASP B C     
4106 O O     . ASP B 276 ? 1.0844 1.5570 1.2114 0.0000 0.0000 0.0000 273 ASP B O     
4107 C CB    . ASP B 276 ? 1.0977 1.6314 1.2559 0.0000 0.0000 0.0000 273 ASP B CB    
4108 C CG    . ASP B 276 ? 1.1462 1.6775 1.2941 0.0000 0.0000 0.0000 273 ASP B CG    
4109 O OD1   . ASP B 276 ? 1.1828 1.6803 1.3032 0.0000 0.0000 0.0000 273 ASP B OD1   
4110 O OD2   . ASP B 276 ? 1.1845 1.7502 1.3526 0.0000 0.0000 0.0000 273 ASP B OD2   
4111 N N     . SER B 277 ? 1.0982 1.5414 1.1956 0.0000 0.0000 0.0000 274 SER B N     
4112 C CA    . SER B 277 ? 1.1027 1.5168 1.1921 0.0000 0.0000 0.0000 274 SER B CA    
4113 C C     . SER B 277 ? 1.1138 1.5374 1.2327 0.0000 0.0000 0.0000 274 SER B C     
4114 O O     . SER B 277 ? 1.1131 1.5655 1.2576 0.0000 0.0000 0.0000 274 SER B O     
4115 C CB    . SER B 277 ? 1.1149 1.4954 1.1737 0.0000 0.0000 0.0000 274 SER B CB    
4116 O OG    . SER B 277 ? 1.1289 1.5044 1.1964 0.0000 0.0000 0.0000 274 SER B OG    
4117 N N     . ASN B 278 ? 1.1240 1.5236 1.2401 0.0000 0.0000 0.0000 275 ASN B N     
4118 C CA    . ASN B 278 ? 1.1430 1.5445 1.2872 0.0000 0.0000 0.0000 275 ASN B CA    
4119 C C     . ASN B 278 ? 1.1725 1.5433 1.3118 0.0000 0.0000 0.0000 275 ASN B C     
4120 O O     . ASN B 278 ? 1.1929 1.5584 1.3572 0.0000 0.0000 0.0000 275 ASN B O     
4121 C CB    . ASN B 278 ? 1.1414 1.5368 1.2878 0.0000 0.0000 0.0000 275 ASN B CB    
4122 C CG    . ASN B 278 ? 1.1080 1.5327 1.2560 0.0000 0.0000 0.0000 275 ASN B CG    
4123 O OD1   . ASN B 278 ? 1.0760 1.5387 1.2525 0.0000 0.0000 0.0000 275 ASN B OD1   
4124 N ND2   . ASN B 278 ? 1.0887 1.4972 1.2081 0.0000 0.0000 0.0000 275 ASN B ND2   
4125 N N     . THR B 279 ? 1.1811 1.5318 1.2898 0.0000 0.0000 0.0000 276 THR B N     
4126 C CA    . THR B 279 ? 1.2137 1.5400 1.3172 0.0000 0.0000 0.0000 276 THR B CA    
4127 C C     . THR B 279 ? 1.2219 1.5630 1.3099 0.0000 0.0000 0.0000 276 THR B C     
4128 O O     . THR B 279 ? 1.2184 1.5445 1.2736 0.0000 0.0000 0.0000 276 THR B O     
4129 C CB    . THR B 279 ? 1.2229 1.5039 1.3009 0.0000 0.0000 0.0000 276 THR B CB    
4130 O OG1   . THR B 279 ? 1.1982 1.4745 1.2431 0.0000 0.0000 0.0000 276 THR B OG1   
4131 C CG2   . THR B 279 ? 1.2318 1.4967 1.3221 0.0000 0.0000 0.0000 276 THR B CG2   
4132 N N     . PRO B 280 ? 1.2360 1.6097 1.3477 0.0000 0.0000 0.0000 277 PRO B N     
4133 C CA    . PRO B 280 ? 1.2454 1.6373 1.3410 0.0000 0.0000 0.0000 277 PRO B CA    
4134 C C     . PRO B 280 ? 1.2794 1.6512 1.3661 0.0000 0.0000 0.0000 277 PRO B C     
4135 O O     . PRO B 280 ? 1.2988 1.6440 1.4007 0.0000 0.0000 0.0000 277 PRO B O     
4136 C CB    . PRO B 280 ? 1.2418 1.6812 1.3702 0.0000 0.0000 0.0000 277 PRO B CB    
4137 C CG    . PRO B 280 ? 1.2283 1.6743 1.3900 0.0000 0.0000 0.0000 277 PRO B CG    
4138 C CD    . PRO B 280 ? 1.2373 1.6390 1.3922 0.0000 0.0000 0.0000 277 PRO B CD    
4139 N N     . PHE B 281 ? 1.2931 1.6768 1.3551 0.0000 0.0000 0.0000 278 PHE B N     
4140 C CA    . PHE B 281 ? 1.3262 1.6985 1.3786 0.0000 0.0000 0.0000 278 PHE B CA    
4141 C C     . PHE B 281 ? 1.3353 1.7505 1.3859 0.0000 0.0000 0.0000 278 PHE B C     
4142 O O     . PHE B 281 ? 1.3586 1.7847 1.4261 0.0000 0.0000 0.0000 278 PHE B O     
4143 C CB    . PHE B 281 ? 1.3321 1.6715 1.3448 0.0000 0.0000 0.0000 278 PHE B CB    
4144 C CG    . PHE B 281 ? 1.3465 1.6409 1.3605 0.0000 0.0000 0.0000 278 PHE B CG    
4145 C CD1   . PHE B 281 ? 1.3823 1.6444 1.3950 0.0000 0.0000 0.0000 278 PHE B CD1   
4146 C CD2   . PHE B 281 ? 1.3259 1.6113 1.3414 0.0000 0.0000 0.0000 278 PHE B CD2   
4147 C CE1   . PHE B 281 ? 1.3861 1.6061 1.3992 0.0000 0.0000 0.0000 278 PHE B CE1   
4148 C CE2   . PHE B 281 ? 1.3245 1.5718 1.3382 0.0000 0.0000 0.0000 278 PHE B CE2   
4149 C CZ    . PHE B 281 ? 1.3518 1.5659 1.3642 0.0000 0.0000 0.0000 278 PHE B CZ    
4150 O "O5'" . DA  C 1   ? 2.0677 1.7002 1.5855 0.0000 0.0000 0.0000 1   DA  C "O5'" 
4151 C "C5'" . DA  C 1   ? 2.0358 1.7241 1.6207 0.0000 0.0000 0.0000 1   DA  C "C5'" 
4152 C "C4'" . DA  C 1   ? 1.9830 1.7158 1.6104 0.0000 0.0000 0.0000 1   DA  C "C4'" 
4153 O "O4'" . DA  C 1   ? 1.9775 1.7274 1.6229 0.0000 0.0000 0.0000 1   DA  C "O4'" 
4154 C "C3'" . DA  C 1   ? 1.9289 1.7102 1.6150 0.0000 0.0000 0.0000 1   DA  C "C3'" 
4155 O "O3'" . DA  C 1   ? 1.8833 1.6659 1.5640 0.0000 0.0000 0.0000 1   DA  C "O3'" 
4156 C "C2'" . DA  C 1   ? 1.9039 1.7297 1.6412 0.0000 0.0000 0.0000 1   DA  C "C2'" 
4157 C "C1'" . DA  C 1   ? 1.9541 1.7527 1.6607 0.0000 0.0000 0.0000 1   DA  C "C1'" 
4158 N N9    . DA  C 1   ? 2.0043 1.8032 1.7242 0.0000 0.0000 0.0000 1   DA  C N9    
4159 C C8    . DA  C 1   ? 2.0348 1.8140 1.7348 0.0000 0.0000 0.0000 1   DA  C C8    
4160 N N7    . DA  C 1   ? 2.0547 1.8395 1.7757 0.0000 0.0000 0.0000 1   DA  C N7    
4161 C C5    . DA  C 1   ? 2.0434 1.8545 1.8037 0.0000 0.0000 0.0000 1   DA  C C5    
4162 C C6    . DA  C 1   ? 2.0508 1.8812 1.8541 0.0000 0.0000 0.0000 1   DA  C C6    
4163 N N6    . DA  C 1   ? 2.0694 1.8972 1.8848 0.0000 0.0000 0.0000 1   DA  C N6    
4164 N N1    . DA  C 1   ? 2.0379 1.8890 1.8726 0.0000 0.0000 0.0000 1   DA  C N1    
4165 C C2    . DA  C 1   ? 2.0187 1.8701 1.8391 0.0000 0.0000 0.0000 1   DA  C C2    
4166 N N3    . DA  C 1   ? 2.0086 1.8457 1.7927 0.0000 0.0000 0.0000 1   DA  C N3    
4167 C C4    . DA  C 1   ? 2.0186 1.8366 1.7753 0.0000 0.0000 0.0000 1   DA  C C4    
4168 P P     . DT  C 2   ? 1.8298 1.6190 1.5072 0.0000 0.0000 0.0000 2   DT  C P     
4169 O OP1   . DT  C 2   ? 1.8394 1.6009 1.4834 0.0000 0.0000 0.0000 2   DT  C OP1   
4170 O OP2   . DT  C 2   ? 1.8360 1.6117 1.4959 0.0000 0.0000 0.0000 2   DT  C OP2   
4171 O "O5'" . DT  C 2   ? 1.7282 1.5738 1.4685 0.0000 0.0000 0.0000 2   DT  C "O5'" 
4172 C "C5'" . DT  C 2   ? 1.6107 1.4686 1.3622 0.0000 0.0000 0.0000 2   DT  C "C5'" 
4173 C "C4'" . DT  C 2   ? 1.4921 1.3972 1.2989 0.0000 0.0000 0.0000 2   DT  C "C4'" 
4174 O "O4'" . DT  C 2   ? 1.4807 1.4054 1.3212 0.0000 0.0000 0.0000 2   DT  C "O4'" 
4175 C "C3'" . DT  C 2   ? 1.4174 1.3468 1.2470 0.0000 0.0000 0.0000 2   DT  C "C3'" 
4176 O "O3'" . DT  C 2   ? 1.3196 1.2725 1.1734 0.0000 0.0000 0.0000 2   DT  C "O3'" 
4177 C "C2'" . DT  C 2   ? 1.4302 1.3822 1.2936 0.0000 0.0000 0.0000 2   DT  C "C2'" 
4178 C "C1'" . DT  C 2   ? 1.4634 1.4239 1.3481 0.0000 0.0000 0.0000 2   DT  C "C1'" 
4179 N N1    . DT  C 2   ? 1.5222 1.4875 1.4265 0.0000 0.0000 0.0000 2   DT  C N1    
4180 C C2    . DT  C 2   ? 1.5199 1.5225 1.4780 0.0000 0.0000 0.0000 2   DT  C C2    
4181 O O2    . DT  C 2   ? 1.4991 1.5315 1.4888 0.0000 0.0000 0.0000 2   DT  C O2    
4182 N N3    . DT  C 2   ? 1.5527 1.5546 1.5267 0.0000 0.0000 0.0000 2   DT  C N3    
4183 C C4    . DT  C 2   ? 1.5939 1.5602 1.5331 0.0000 0.0000 0.0000 2   DT  C C4    
4184 O O4    . DT  C 2   ? 1.6054 1.5722 1.5631 0.0000 0.0000 0.0000 2   DT  C O4    
4185 C C5    . DT  C 2   ? 1.6174 1.5438 1.4969 0.0000 0.0000 0.0000 2   DT  C C5    
4186 C C7    . DT  C 2   ? 1.6614 1.5421 1.4935 0.0000 0.0000 0.0000 2   DT  C C7    
4187 C C6    . DT  C 2   ? 1.5878 1.5171 1.4555 0.0000 0.0000 0.0000 2   DT  C C6    
4188 P P     . DT  C 3   ? 1.2262 1.1892 1.0845 0.0000 0.0000 0.0000 3   DT  C P     
4189 O OP1   . DT  C 3   ? 1.2303 1.1710 1.0619 0.0000 0.0000 0.0000 3   DT  C OP1   
4190 O OP2   . DT  C 3   ? 1.2222 1.1851 1.0776 0.0000 0.0000 0.0000 3   DT  C OP2   
4191 O "O5'" . DT  C 3   ? 1.1736 1.1738 1.0766 0.0000 0.0000 0.0000 3   DT  C "O5'" 
4192 C "C5'" . DT  C 3   ? 1.1505 1.1710 1.0859 0.0000 0.0000 0.0000 3   DT  C "C5'" 
4193 C "C4'" . DT  C 3   ? 1.1160 1.1726 1.0962 0.0000 0.0000 0.0000 3   DT  C "C4'" 
4194 O "O4'" . DT  C 3   ? 1.1188 1.1885 1.1215 0.0000 0.0000 0.0000 3   DT  C "O4'" 
4195 C "C3'" . DT  C 3   ? 1.0735 1.1370 1.0527 0.0000 0.0000 0.0000 3   DT  C "C3'" 
4196 O "O3'" . DT  C 3   ? 1.0160 1.1085 1.0334 0.0000 0.0000 0.0000 3   DT  C "O3'" 
4197 C "C2'" . DT  C 3   ? 1.0846 1.1434 1.0553 0.0000 0.0000 0.0000 3   DT  C "C2'" 
4198 C "C1'" . DT  C 3   ? 1.1145 1.1876 1.1137 0.0000 0.0000 0.0000 3   DT  C "C1'" 
4199 N N1    . DT  C 3   ? 1.1649 1.2186 1.1428 0.0000 0.0000 0.0000 3   DT  C N1    
4200 C C2    . DT  C 3   ? 1.1754 1.2450 1.1813 0.0000 0.0000 0.0000 3   DT  C C2    
4201 O O2    . DT  C 3   ? 1.1587 1.2606 1.2107 0.0000 0.0000 0.0000 3   DT  C O2    
4202 N N3    . DT  C 3   ? 1.2145 1.2565 1.1897 0.0000 0.0000 0.0000 3   DT  C N3    
4203 C C4    . DT  C 3   ? 1.2436 1.2444 1.1640 0.0000 0.0000 0.0000 3   DT  C C4    
4204 O O4    . DT  C 3   ? 1.2981 1.2692 1.1870 0.0000 0.0000 0.0000 3   DT  C O4    
4205 C C5    . DT  C 3   ? 1.2291 1.2193 1.1287 0.0000 0.0000 0.0000 3   DT  C C5    
4206 C C7    . DT  C 3   ? 1.2545 1.2006 1.0989 0.0000 0.0000 0.0000 3   DT  C C7    
4207 C C6    . DT  C 3   ? 1.1984 1.2151 1.1271 0.0000 0.0000 0.0000 3   DT  C C6    
4208 P P     . DG  C 4   ? 0.9726 1.0654 0.9876 0.0000 0.0000 0.0000 4   DG  C P     
4209 O OP1   . DG  C 4   ? 0.9407 1.0610 0.9961 0.0000 0.0000 0.0000 4   DG  C OP1   
4210 O OP2   . DG  C 4   ? 0.9847 1.0504 0.9683 0.0000 0.0000 0.0000 4   DG  C OP2   
4211 O "O5'" . DG  C 4   ? 0.9514 1.0393 0.9506 0.0000 0.0000 0.0000 4   DG  C "O5'" 
4212 C "C5'" . DG  C 4   ? 0.9204 1.0289 0.9427 0.0000 0.0000 0.0000 4   DG  C "C5'" 
4213 C "C4'" . DG  C 4   ? 0.9186 1.0174 0.9219 0.0000 0.0000 0.0000 4   DG  C "C4'" 
4214 O "O4'" . DG  C 4   ? 0.9234 1.0125 0.9140 0.0000 0.0000 0.0000 4   DG  C "O4'" 
4215 C "C3'" . DG  C 4   ? 0.9053 1.0208 0.9263 0.0000 0.0000 0.0000 4   DG  C "C3'" 
4216 O "O3'" . DG  C 4   ? 0.9177 1.0201 0.9210 0.0000 0.0000 0.0000 4   DG  C "O3'" 
4217 C "C2'" . DG  C 4   ? 0.8966 1.0138 0.9166 0.0000 0.0000 0.0000 4   DG  C "C2'" 
4218 C "C1'" . DG  C 4   ? 0.9124 1.0080 0.9078 0.0000 0.0000 0.0000 4   DG  C "C1'" 
4219 N N9    . DG  C 4   ? 0.9063 0.9977 0.8984 0.0000 0.0000 0.0000 4   DG  C N9    
4220 C C8    . DG  C 4   ? 0.9096 1.0004 0.9039 0.0000 0.0000 0.0000 4   DG  C C8    
4221 N N7    . DG  C 4   ? 0.9206 0.9997 0.9035 0.0000 0.0000 0.0000 4   DG  C N7    
4222 C C5    . DG  C 4   ? 0.9148 0.9921 0.8956 0.0000 0.0000 0.0000 4   DG  C C5    
4223 C C6    . DG  C 4   ? 0.9253 0.9936 0.9013 0.0000 0.0000 0.0000 4   DG  C C6    
4224 O O6    . DG  C 4   ? 0.9506 1.0063 0.9168 0.0000 0.0000 0.0000 4   DG  C O6    
4225 N N1    . DG  C 4   ? 0.9214 0.9938 0.9052 0.0000 0.0000 0.0000 4   DG  C N1    
4226 C C2    . DG  C 4   ? 0.9245 1.0024 0.9108 0.0000 0.0000 0.0000 4   DG  C C2    
4227 N N2    . DG  C 4   ? 0.9375 1.0144 0.9288 0.0000 0.0000 0.0000 4   DG  C N2    
4228 N N3    . DG  C 4   ? 0.9184 1.0000 0.9023 0.0000 0.0000 0.0000 4   DG  C N3    
4229 C C4    . DG  C 4   ? 0.9109 0.9949 0.8963 0.0000 0.0000 0.0000 4   DG  C C4    
4230 P P     . DT  C 5   ? 0.9291 1.0363 0.9363 0.0000 0.0000 0.0000 5   DT  C P     
4231 O OP1   . DT  C 5   ? 0.9468 1.0286 0.9245 0.0000 0.0000 0.0000 5   DT  C OP1   
4232 O OP2   . DT  C 5   ? 0.9214 1.0511 0.9599 0.0000 0.0000 0.0000 5   DT  C OP2   
4233 O "O5'" . DT  C 5   ? 0.9038 1.0133 0.9098 0.0000 0.0000 0.0000 5   DT  C "O5'" 
4234 C "C5'" . DT  C 5   ? 0.9211 1.0125 0.9062 0.0000 0.0000 0.0000 5   DT  C "C5'" 
4235 C "C4'" . DT  C 5   ? 0.9166 1.0148 0.9105 0.0000 0.0000 0.0000 5   DT  C "C4'" 
4236 O "O4'" . DT  C 5   ? 0.9069 1.0126 0.9114 0.0000 0.0000 0.0000 5   DT  C "O4'" 
4237 C "C3'" . DT  C 5   ? 0.9166 1.0268 0.9221 0.0000 0.0000 0.0000 5   DT  C "C3'" 
4238 O "O3'" . DT  C 5   ? 0.9188 1.0188 0.9150 0.0000 0.0000 0.0000 5   DT  C "O3'" 
4239 C "C2'" . DT  C 5   ? 0.9040 1.0313 0.9293 0.0000 0.0000 0.0000 5   DT  C "C2'" 
4240 C "C1'" . DT  C 5   ? 0.9008 1.0201 0.9209 0.0000 0.0000 0.0000 5   DT  C "C1'" 
4241 N N1    . DT  C 5   ? 0.8936 1.0168 0.9191 0.0000 0.0000 0.0000 5   DT  C N1    
4242 C C2    . DT  C 5   ? 0.8987 1.0170 0.9241 0.0000 0.0000 0.0000 5   DT  C C2    
4243 O O2    . DT  C 5   ? 0.9102 1.0268 0.9395 0.0000 0.0000 0.0000 5   DT  C O2    
4244 N N3    . DT  C 5   ? 0.9006 1.0133 0.9210 0.0000 0.0000 0.0000 5   DT  C N3    
4245 C C4    . DT  C 5   ? 0.8973 1.0114 0.9168 0.0000 0.0000 0.0000 5   DT  C C4    
4246 O O4    . DT  C 5   ? 0.9024 1.0058 0.9126 0.0000 0.0000 0.0000 5   DT  C O4    
4247 C C5    . DT  C 5   ? 0.8986 1.0247 0.9285 0.0000 0.0000 0.0000 5   DT  C C5    
4248 C C7    . DT  C 5   ? 0.9059 1.0387 0.9462 0.0000 0.0000 0.0000 5   DT  C C7    
4249 C C6    . DT  C 5   ? 0.8975 1.0261 0.9278 0.0000 0.0000 0.0000 5   DT  C C6    
4250 P P     . DC  C 6   ? 0.9111 1.0082 0.9024 0.0000 0.0000 0.0000 6   DC  C P     
4251 O OP1   . DC  C 6   ? 0.9349 1.0063 0.9003 0.0000 0.0000 0.0000 6   DC  C OP1   
4252 O OP2   . DC  C 6   ? 0.9099 1.0158 0.9084 0.0000 0.0000 0.0000 6   DC  C OP2   
4253 O "O5'" . DC  C 6   ? 0.8992 1.0126 0.9111 0.0000 0.0000 0.0000 6   DC  C "O5'" 
4254 C "C5'" . DC  C 6   ? 0.8939 1.0052 0.9114 0.0000 0.0000 0.0000 6   DC  C "C5'" 
4255 C "C4'" . DC  C 6   ? 0.8597 0.9881 0.8995 0.0000 0.0000 0.0000 6   DC  C "C4'" 
4256 O "O4'" . DC  C 6   ? 0.8617 0.9974 0.9065 0.0000 0.0000 0.0000 6   DC  C "O4'" 
4257 C "C3'" . DC  C 6   ? 0.8368 0.9714 0.8797 0.0000 0.0000 0.0000 6   DC  C "C3'" 
4258 O "O3'" . DC  C 6   ? 0.8296 0.9697 0.8873 0.0000 0.0000 0.0000 6   DC  C "O3'" 
4259 C "C2'" . DC  C 6   ? 0.8329 0.9790 0.8836 0.0000 0.0000 0.0000 6   DC  C "C2'" 
4260 C "C1'" . DC  C 6   ? 0.8429 0.9891 0.8981 0.0000 0.0000 0.0000 6   DC  C "C1'" 
4261 N N1    . DC  C 6   ? 0.8453 0.9938 0.9005 0.0000 0.0000 0.0000 6   DC  C N1    
4262 C C2    . DC  C 6   ? 0.8461 0.9900 0.9012 0.0000 0.0000 0.0000 6   DC  C C2    
4263 O O2    . DC  C 6   ? 0.8237 0.9652 0.8843 0.0000 0.0000 0.0000 6   DC  C O2    
4264 N N3    . DC  C 6   ? 0.8580 0.9975 0.9067 0.0000 0.0000 0.0000 6   DC  C N3    
4265 C C4    . DC  C 6   ? 0.8466 0.9922 0.8981 0.0000 0.0000 0.0000 6   DC  C C4    
4266 N N4    . DC  C 6   ? 0.8272 0.9679 0.8750 0.0000 0.0000 0.0000 6   DC  C N4    
4267 C C5    . DC  C 6   ? 0.8578 1.0123 0.9161 0.0000 0.0000 0.0000 6   DC  C C5    
4268 C C6    . DC  C 6   ? 0.8554 1.0079 0.9107 0.0000 0.0000 0.0000 6   DC  C C6    
4269 P P     . DA  C 7   ? 0.8467 0.9820 0.9018 0.0000 0.0000 0.0000 7   DA  C P     
4270 O OP1   . DA  C 7   ? 0.8687 0.9875 0.9112 0.0000 0.0000 0.0000 7   DA  C OP1   
4271 O OP2   . DA  C 7   ? 0.8356 0.9708 0.8809 0.0000 0.0000 0.0000 7   DA  C OP2   
4272 O "O5'" . DA  C 7   ? 0.8382 0.9862 0.9200 0.0000 0.0000 0.0000 7   DA  C "O5'" 
4273 C "C5'" . DA  C 7   ? 0.8541 1.0050 0.9557 0.0000 0.0000 0.0000 7   DA  C "C5'" 
4274 C "C4'" . DA  C 7   ? 0.8564 1.0199 0.9836 0.0000 0.0000 0.0000 7   DA  C "C4'" 
4275 O "O4'" . DA  C 7   ? 0.8509 1.0136 0.9690 0.0000 0.0000 0.0000 7   DA  C "O4'" 
4276 C "C3'" . DA  C 7   ? 0.8617 1.0314 0.9983 0.0000 0.0000 0.0000 7   DA  C "C3'" 
4277 O "O3'" . DA  C 7   ? 0.8734 1.0520 1.0402 0.0000 0.0000 0.0000 7   DA  C "O3'" 
4278 C "C2'" . DA  C 7   ? 0.8501 1.0177 0.9676 0.0000 0.0000 0.0000 7   DA  C "C2'" 
4279 C "C1'" . DA  C 7   ? 0.8516 1.0169 0.9672 0.0000 0.0000 0.0000 7   DA  C "C1'" 
4280 N N9    . DA  C 7   ? 0.8570 1.0178 0.9527 0.0000 0.0000 0.0000 7   DA  C N9    
4281 C C8    . DA  C 7   ? 0.8738 1.0332 0.9566 0.0000 0.0000 0.0000 7   DA  C C8    
4282 N N7    . DA  C 7   ? 0.8897 1.0484 0.9642 0.0000 0.0000 0.0000 7   DA  C N7    
4283 C C5    . DA  C 7   ? 0.8737 1.0288 0.9490 0.0000 0.0000 0.0000 7   DA  C C5    
4284 C C6    . DA  C 7   ? 0.8716 1.0201 0.9370 0.0000 0.0000 0.0000 7   DA  C C6    
4285 N N6    . DA  C 7   ? 0.8661 1.0172 0.9283 0.0000 0.0000 0.0000 7   DA  C N6    
4286 N N1    . DA  C 7   ? 0.8769 1.0135 0.9359 0.0000 0.0000 0.0000 7   DA  C N1    
4287 C C2    . DA  C 7   ? 0.8931 1.0296 0.9626 0.0000 0.0000 0.0000 7   DA  C C2    
4288 N N3    . DA  C 7   ? 0.8750 1.0228 0.9630 0.0000 0.0000 0.0000 7   DA  C N3    
4289 C C4    . DA  C 7   ? 0.8666 1.0218 0.9536 0.0000 0.0000 0.0000 7   DA  C C4    
4290 P P     . DT  C 8   ? 0.8926 1.0793 1.0817 0.0000 0.0000 0.0000 8   DT  C P     
4291 O OP1   . DT  C 8   ? 0.8805 1.0781 1.1113 0.0000 0.0000 0.0000 8   DT  C OP1   
4292 O OP2   . DT  C 8   ? 0.8998 1.0807 1.0695 0.0000 0.0000 0.0000 8   DT  C OP2   
4293 O "O5'" . DT  C 8   ? 0.8974 1.0803 1.0761 0.0000 0.0000 0.0000 8   DT  C "O5'" 
4294 C "C5'" . DT  C 8   ? 0.9303 1.1058 1.1001 0.0000 0.0000 0.0000 8   DT  C "C5'" 
4295 C "C4'" . DT  C 8   ? 0.9585 1.1223 1.1071 0.0000 0.0000 0.0000 8   DT  C "C4'" 
4296 O "O4'" . DT  C 8   ? 0.9637 1.1192 1.0828 0.0000 0.0000 0.0000 8   DT  C "O4'" 
4297 C "C3'" . DT  C 8   ? 0.9753 1.1400 1.1236 0.0000 0.0000 0.0000 8   DT  C "C3'" 
4298 O "O3'" . DT  C 8   ? 1.0093 1.1645 1.1599 0.0000 0.0000 0.0000 8   DT  C "O3'" 
4299 C "C2'" . DT  C 8   ? 0.9717 1.1291 1.0897 0.0000 0.0000 0.0000 8   DT  C "C2'" 
4300 C "C1'" . DT  C 8   ? 0.9630 1.1124 1.0657 0.0000 0.0000 0.0000 8   DT  C "C1'" 
4301 N N1    . DT  C 8   ? 0.9559 1.1066 1.0440 0.0000 0.0000 0.0000 8   DT  C N1    
4302 C C2    . DT  C 8   ? 0.9619 1.1026 1.0328 0.0000 0.0000 0.0000 8   DT  C C2    
4303 O O2    . DT  C 8   ? 0.9736 1.0992 1.0333 0.0000 0.0000 0.0000 8   DT  C O2    
4304 N N3    . DT  C 8   ? 0.9643 1.1104 1.0312 0.0000 0.0000 0.0000 8   DT  C N3    
4305 C C4    . DT  C 8   ? 0.9661 1.1224 1.0389 0.0000 0.0000 0.0000 8   DT  C C4    
4306 O O4    . DT  C 8   ? 0.9645 1.1242 1.0353 0.0000 0.0000 0.0000 8   DT  C O4    
4307 C C5    . DT  C 8   ? 0.9643 1.1242 1.0458 0.0000 0.0000 0.0000 8   DT  C C5    
4308 C C7    . DT  C 8   ? 0.9805 1.1416 1.0587 0.0000 0.0000 0.0000 8   DT  C C7    
4309 C C6    . DT  C 8   ? 0.9543 1.1135 1.0460 0.0000 0.0000 0.0000 8   DT  C C6    
4310 P P     . DG  C 9   ? 1.0388 1.1978 1.2065 0.0000 0.0000 0.0000 9   DG  C P     
4311 O OP1   . DG  C 9   ? 1.0441 1.2089 1.2468 0.0000 0.0000 0.0000 9   DG  C OP1   
4312 O OP2   . DG  C 9   ? 1.0043 1.1724 1.1733 0.0000 0.0000 0.0000 9   DG  C OP2   
4313 O "O5'" . DG  C 9   ? 1.0310 1.1663 1.1643 0.0000 0.0000 0.0000 9   DG  C "O5'" 
4314 C "C5'" . DG  C 9   ? 1.0005 1.1132 1.1087 0.0000 0.0000 0.0000 9   DG  C "C5'" 
4315 C "C4'" . DG  C 9   ? 0.9818 1.0747 1.0507 0.0000 0.0000 0.0000 9   DG  C "C4'" 
4316 O "O4'" . DG  C 9   ? 0.9543 1.0581 1.0171 0.0000 0.0000 0.0000 9   DG  C "O4'" 
4317 C "C3'" . DG  C 9   ? 0.9764 1.0649 1.0407 0.0000 0.0000 0.0000 9   DG  C "C3'" 
4318 O "O3'" . DG  C 9   ? 1.0068 1.0644 1.0321 0.0000 0.0000 0.0000 9   DG  C "O3'" 
4319 C "C2'" . DG  C 9   ? 0.9492 1.0557 1.0188 0.0000 0.0000 0.0000 9   DG  C "C2'" 
4320 C "C1'" . DG  C 9   ? 0.9436 1.0477 0.9978 0.0000 0.0000 0.0000 9   DG  C "C1'" 
4321 N N9    . DG  C 9   ? 0.9159 1.0379 0.9790 0.0000 0.0000 0.0000 9   DG  C N9    
4322 C C8    . DG  C 9   ? 0.9035 1.0411 0.9846 0.0000 0.0000 0.0000 9   DG  C C8    
4323 N N7    . DG  C 9   ? 0.8916 1.0358 0.9697 0.0000 0.0000 0.0000 9   DG  C N7    
4324 C C5    . DG  C 9   ? 0.8955 1.0334 0.9600 0.0000 0.0000 0.0000 9   DG  C C5    
4325 C C6    . DG  C 9   ? 0.8883 1.0309 0.9496 0.0000 0.0000 0.0000 9   DG  C C6    
4326 O O6    . DG  C 9   ? 0.8876 1.0380 0.9531 0.0000 0.0000 0.0000 9   DG  C O6    
4327 N N1    . DG  C 9   ? 0.8885 1.0228 0.9398 0.0000 0.0000 0.0000 9   DG  C N1    
4328 C C2    . DG  C 9   ? 0.9140 1.0306 0.9509 0.0000 0.0000 0.0000 9   DG  C C2    
4329 N N2    . DG  C 9   ? 0.9236 1.0282 0.9471 0.0000 0.0000 0.0000 9   DG  C N2    
4330 N N3    . DG  C 9   ? 0.9247 1.0330 0.9596 0.0000 0.0000 0.0000 9   DG  C N3    
4331 C C4    . DG  C 9   ? 0.9088 1.0316 0.9620 0.0000 0.0000 0.0000 9   DG  C C4    
4332 P P     . DG  C 10  ? 1.0441 1.0717 1.0529 0.0000 0.0000 0.0000 10  DG  C P     
4333 O OP1   . DG  C 10  ? 1.0529 1.0720 1.0657 0.0000 0.0000 0.0000 10  DG  C OP1   
4334 O OP2   . DG  C 10  ? 1.0327 1.0697 1.0615 0.0000 0.0000 0.0000 10  DG  C OP2   
4335 O "O5'" . DG  C 10  ? 1.0685 1.0592 1.0255 0.0000 0.0000 0.0000 10  DG  C "O5'" 
4336 C "C5'" . DG  C 10  ? 1.0783 1.0644 1.0210 0.0000 0.0000 0.0000 10  DG  C "C5'" 
4337 C "C4'" . DG  C 10  ? 1.1031 1.0720 1.0163 0.0000 0.0000 0.0000 10  DG  C "C4'" 
4338 O "O4'" . DG  C 10  ? 1.0727 1.0749 1.0131 0.0000 0.0000 0.0000 10  DG  C "O4'" 
4339 C "C3'" . DG  C 10  ? 1.1425 1.0933 1.0311 0.0000 0.0000 0.0000 10  DG  C "C3'" 
4340 O "O3'" . DG  C 10  ? 1.2005 1.1200 1.0541 0.0000 0.0000 0.0000 10  DG  C "O3'" 
4341 C "C2'" . DG  C 10  ? 1.1032 1.0899 1.0217 0.0000 0.0000 0.0000 10  DG  C "C2'" 
4342 C "C1'" . DG  C 10  ? 1.0710 1.0804 1.0110 0.0000 0.0000 0.0000 10  DG  C "C1'" 
4343 N N9    . DG  C 10  ? 1.0364 1.0813 1.0097 0.0000 0.0000 0.0000 10  DG  C N9    
4344 C C8    . DG  C 10  ? 1.0195 1.0807 1.0135 0.0000 0.0000 0.0000 10  DG  C C8    
4345 N N7    . DG  C 10  ? 0.9997 1.0841 1.0131 0.0000 0.0000 0.0000 10  DG  C N7    
4346 C C5    . DG  C 10  ? 0.9908 1.0774 1.0003 0.0000 0.0000 0.0000 10  DG  C C5    
4347 C C6    . DG  C 10  ? 0.9694 1.0744 0.9930 0.0000 0.0000 0.0000 10  DG  C C6    
4348 O O6    . DG  C 10  ? 0.9634 1.0817 0.9989 0.0000 0.0000 0.0000 10  DG  C O6    
4349 N N1    . DG  C 10  ? 0.9636 1.0672 0.9847 0.0000 0.0000 0.0000 10  DG  C N1    
4350 C C2    . DG  C 10  ? 0.9860 1.0693 0.9890 0.0000 0.0000 0.0000 10  DG  C C2    
4351 N N2    . DG  C 10  ? 0.9933 1.0782 0.9997 0.0000 0.0000 0.0000 10  DG  C N2    
4352 N N3    . DG  C 10  ? 1.0188 1.0786 1.0002 0.0000 0.0000 0.0000 10  DG  C N3    
4353 C C4    . DG  C 10  ? 1.0174 1.0816 1.0050 0.0000 0.0000 0.0000 10  DG  C C4    
4354 P P     . DA  C 11  ? 1.2444 1.1374 1.0687 0.0000 0.0000 0.0000 11  DA  C P     
4355 O OP1   . DA  C 11  ? 1.2927 1.1312 1.0651 0.0000 0.0000 0.0000 11  DA  C OP1   
4356 O OP2   . DA  C 11  ? 1.2170 1.1319 1.0621 0.0000 0.0000 0.0000 11  DA  C OP2   
4357 O "O5'" . DA  C 11  ? 1.2279 1.1309 1.0603 0.0000 0.0000 0.0000 11  DA  C "O5'" 
4358 C "C5'" . DA  C 11  ? 1.2026 1.1495 1.0772 0.0000 0.0000 0.0000 11  DA  C "C5'" 
4359 C "C4'" . DA  C 11  ? 1.2147 1.1718 1.1026 0.0000 0.0000 0.0000 11  DA  C "C4'" 
4360 O "O4'" . DA  C 11  ? 1.1835 1.1830 1.1129 0.0000 0.0000 0.0000 11  DA  C "O4'" 
4361 C "C3'" . DA  C 11  ? 1.2481 1.1827 1.1185 0.0000 0.0000 0.0000 11  DA  C "C3'" 
4362 O "O3'" . DA  C 11  ? 1.2674 1.2024 1.1472 0.0000 0.0000 0.0000 11  DA  C "O3'" 
4363 C "C2'" . DA  C 11  ? 1.2243 1.1850 1.1189 0.0000 0.0000 0.0000 11  DA  C "C2'" 
4364 C "C1'" . DA  C 11  ? 1.1901 1.1921 1.1237 0.0000 0.0000 0.0000 11  DA  C "C1'" 
4365 N N9    . DA  C 11  ? 1.1739 1.1967 1.1229 0.0000 0.0000 0.0000 11  DA  C N9    
4366 C C8    . DA  C 11  ? 1.1809 1.1953 1.1193 0.0000 0.0000 0.0000 11  DA  C C8    
4367 N N7    . DA  C 11  ? 1.1494 1.1867 1.1086 0.0000 0.0000 0.0000 11  DA  C N7    
4368 C C5    . DA  C 11  ? 1.1287 1.1873 1.1082 0.0000 0.0000 0.0000 11  DA  C C5    
4369 C C6    . DA  C 11  ? 1.1132 1.1939 1.1123 0.0000 0.0000 0.0000 11  DA  C C6    
4370 N N6    . DA  C 11  ? 1.1180 1.2035 1.1202 0.0000 0.0000 0.0000 11  DA  C N6    
4371 N N1    . DA  C 11  ? 1.1086 1.2035 1.1232 0.0000 0.0000 0.0000 11  DA  C N1    
4372 C C2    . DA  C 11  ? 1.1202 1.2120 1.1373 0.0000 0.0000 0.0000 11  DA  C C2    
4373 N N3    . DA  C 11  ? 1.1351 1.2062 1.1347 0.0000 0.0000 0.0000 11  DA  C N3    
4374 C C4    . DA  C 11  ? 1.1447 1.1977 1.1224 0.0000 0.0000 0.0000 11  DA  C C4    
4375 P P     . DA  C 12  ? 1.2755 1.2162 1.1746 0.0000 0.0000 0.0000 12  DA  C P     
4376 O OP1   . DA  C 12  ? 1.2897 1.2203 1.1909 0.0000 0.0000 0.0000 12  DA  C OP1   
4377 O OP2   . DA  C 12  ? 1.3047 1.2198 1.1774 0.0000 0.0000 0.0000 12  DA  C OP2   
4378 O "O5'" . DA  C 12  ? 1.2315 1.2214 1.1815 0.0000 0.0000 0.0000 12  DA  C "O5'" 
4379 C "C5'" . DA  C 12  ? 1.2009 1.2212 1.1883 0.0000 0.0000 0.0000 12  DA  C "C5'" 
4380 C "C4'" . DA  C 12  ? 1.1754 1.2277 1.2036 0.0000 0.0000 0.0000 12  DA  C "C4'" 
4381 O "O4'" . DA  C 12  ? 1.1616 1.2248 1.1878 0.0000 0.0000 0.0000 12  DA  C "O4'" 
4382 C "C3'" . DA  C 12  ? 1.1915 1.2360 1.2293 0.0000 0.0000 0.0000 12  DA  C "C3'" 
4383 O "O3'" . DA  C 12  ? 1.1813 1.2579 1.2686 0.0000 0.0000 0.0000 12  DA  C "O3'" 
4384 C "C2'" . DA  C 12  ? 1.1891 1.2236 1.2064 0.0000 0.0000 0.0000 12  DA  C "C2'" 
4385 C "C1'" . DA  C 12  ? 1.1563 1.2130 1.1805 0.0000 0.0000 0.0000 12  DA  C "C1'" 
4386 N N9    . DA  C 12  ? 1.1379 1.1833 1.1350 0.0000 0.0000 0.0000 12  DA  C N9    
4387 C C8    . DA  C 12  ? 1.1581 1.1765 1.1211 0.0000 0.0000 0.0000 12  DA  C C8    
4388 N N7    . DA  C 12  ? 1.1463 1.1646 1.0996 0.0000 0.0000 0.0000 12  DA  C N7    
4389 C C5    . DA  C 12  ? 1.1196 1.1632 1.0970 0.0000 0.0000 0.0000 12  DA  C C5    
4390 C C6    . DA  C 12  ? 1.1106 1.1629 1.0895 0.0000 0.0000 0.0000 12  DA  C C6    
4391 N N6    . DA  C 12  ? 1.1236 1.1658 1.0873 0.0000 0.0000 0.0000 12  DA  C N6    
4392 N N1    . DA  C 12  ? 1.0938 1.1631 1.0899 0.0000 0.0000 0.0000 12  DA  C N1    
4393 C C2    . DA  C 12  ? 1.0889 1.1699 1.1056 0.0000 0.0000 0.0000 12  DA  C C2    
4394 N N3    . DA  C 12  ? 1.0931 1.1731 1.1188 0.0000 0.0000 0.0000 12  DA  C N3    
4395 C C4    . DA  C 12  ? 1.1098 1.1690 1.1123 0.0000 0.0000 0.0000 12  DA  C C4    
4396 P P     . DT  C 13  ? 1.1913 1.2771 1.3135 0.0000 0.0000 0.0000 13  DT  C P     
4397 O OP1   . DT  C 13  ? 1.1740 1.2882 1.3492 0.0000 0.0000 0.0000 13  DT  C OP1   
4398 O OP2   . DT  C 13  ? 1.2270 1.2790 1.3200 0.0000 0.0000 0.0000 13  DT  C OP2   
4399 O "O5'" . DT  C 13  ? 1.1783 1.2753 1.3002 0.0000 0.0000 0.0000 13  DT  C "O5'" 
4400 C "C5'" . DT  C 13  ? 1.1540 1.2771 1.2981 0.0000 0.0000 0.0000 13  DT  C "C5'" 
4401 C "C4'" . DT  C 13  ? 1.1513 1.2711 1.2838 0.0000 0.0000 0.0000 13  DT  C "C4'" 
4402 O "O4'" . DT  C 13  ? 1.1559 1.2534 1.2443 0.0000 0.0000 0.0000 13  DT  C "O4'" 
4403 C "C3'" . DT  C 13  ? 1.1643 1.2785 1.3125 0.0000 0.0000 0.0000 13  DT  C "C3'" 
4404 O "O3'" . DT  C 13  ? 1.1524 1.2834 1.3266 0.0000 0.0000 0.0000 13  DT  C "O3'" 
4405 C "C2'" . DT  C 13  ? 1.1794 1.2647 1.2829 0.0000 0.0000 0.0000 13  DT  C "C2'" 
4406 C "C1'" . DT  C 13  ? 1.1684 1.2529 1.2439 0.0000 0.0000 0.0000 13  DT  C "C1'" 
4407 N N1    . DT  C 13  ? 1.1876 1.2477 1.2221 0.0000 0.0000 0.0000 13  DT  C N1    
4408 C C2    . DT  C 13  ? 1.1865 1.2404 1.1995 0.0000 0.0000 0.0000 13  DT  C C2    
4409 O O2    . DT  C 13  ? 1.1804 1.2428 1.1993 0.0000 0.0000 0.0000 13  DT  C O2    
4410 N N3    . DT  C 13  ? 1.2015 1.2355 1.1839 0.0000 0.0000 0.0000 13  DT  C N3    
4411 C C4    . DT  C 13  ? 1.2291 1.2451 1.1950 0.0000 0.0000 0.0000 13  DT  C C4    
4412 O O4    . DT  C 13  ? 1.2501 1.2473 1.1889 0.0000 0.0000 0.0000 13  DT  C O4    
4413 C C5    . DT  C 13  ? 1.2313 1.2491 1.2130 0.0000 0.0000 0.0000 13  DT  C C5    
4414 C C7    . DT  C 13  ? 1.2548 1.2446 1.2109 0.0000 0.0000 0.0000 13  DT  C C7    
4415 C C6    . DT  C 13  ? 1.2114 1.2530 1.2293 0.0000 0.0000 0.0000 13  DT  C C6    
4416 P P     . DT  C 14  ? 1.1625 1.2897 1.3566 0.0000 0.0000 0.0000 14  DT  C P     
4417 O OP1   . DT  C 14  ? 1.1371 1.2899 1.3757 0.0000 0.0000 0.0000 14  DT  C OP1   
4418 O OP2   . DT  C 14  ? 1.1679 1.2800 1.3638 0.0000 0.0000 0.0000 14  DT  C OP2   
4419 O "O5'" . DT  C 14  ? 1.1761 1.2797 1.3221 0.0000 0.0000 0.0000 14  DT  C "O5'" 
4420 C "C5'" . DT  C 14  ? 1.1472 1.2541 1.2771 0.0000 0.0000 0.0000 14  DT  C "C5'" 
4421 C "C4'" . DT  C 14  ? 1.1410 1.2191 1.2237 0.0000 0.0000 0.0000 14  DT  C "C4'" 
4422 O "O4'" . DT  C 14  ? 1.1195 1.1850 1.1736 0.0000 0.0000 0.0000 14  DT  C "O4'" 
4423 C "C3'" . DT  C 14  ? 1.1644 1.2222 1.2431 0.0000 0.0000 0.0000 14  DT  C "C3'" 
4424 O "O3'" . DT  C 14  ? 1.1988 1.2391 1.2517 0.0000 0.0000 0.0000 14  DT  C "O3'" 
4425 C "C2'" . DT  C 14  ? 1.1647 1.1997 1.2135 0.0000 0.0000 0.0000 14  DT  C "C2'" 
4426 C "C1'" . DT  C 14  ? 1.1323 1.1697 1.1576 0.0000 0.0000 0.0000 14  DT  C "C1'" 
4427 N N1    . DT  C 14  ? 1.1224 1.1480 1.1304 0.0000 0.0000 0.0000 14  DT  C N1    
4428 C C2    . DT  C 14  ? 1.1246 1.1330 1.0959 0.0000 0.0000 0.0000 14  DT  C C2    
4429 O O2    . DT  C 14  ? 1.1179 1.1204 1.0708 0.0000 0.0000 0.0000 14  DT  C O2    
4430 N N3    . DT  C 14  ? 1.1346 1.1301 1.0906 0.0000 0.0000 0.0000 14  DT  C N3    
4431 C C4    . DT  C 14  ? 1.1367 1.1301 1.1038 0.0000 0.0000 0.0000 14  DT  C C4    
4432 O O4    . DT  C 14  ? 1.1535 1.1280 1.0978 0.0000 0.0000 0.0000 14  DT  C O4    
4433 C C5    . DT  C 14  ? 1.1298 1.1422 1.1367 0.0000 0.0000 0.0000 14  DT  C C5    
4434 C C7    . DT  C 14  ? 1.1413 1.1504 1.1634 0.0000 0.0000 0.0000 14  DT  C C7    
4435 C C6    . DT  C 14  ? 1.1205 1.1501 1.1490 0.0000 0.0000 0.0000 14  DT  C C6    
4436 P P     . DT  C 15  ? 1.2538 1.2590 1.2809 0.0000 0.0000 0.0000 15  DT  C P     
4437 O OP1   . DT  C 15  ? 1.2599 1.2585 1.2849 0.0000 0.0000 0.0000 15  DT  C OP1   
4438 O OP2   . DT  C 15  ? 1.2542 1.2570 1.3035 0.0000 0.0000 0.0000 15  DT  C OP2   
4439 O "O5'" . DT  C 15  ? 1.2715 1.2463 1.2405 0.0000 0.0000 0.0000 15  DT  C "O5'" 
4440 C "C5'" . DT  C 15  ? 1.2614 1.2357 1.2060 0.0000 0.0000 0.0000 15  DT  C "C5'" 
4441 C "C4'" . DT  C 15  ? 1.2795 1.2266 1.1802 0.0000 0.0000 0.0000 15  DT  C "C4'" 
4442 O "O4'" . DT  C 15  ? 1.2630 1.2200 1.1739 0.0000 0.0000 0.0000 15  DT  C "O4'" 
4443 C "C3'" . DT  C 15  ? 1.3231 1.2271 1.1838 0.0000 0.0000 0.0000 15  DT  C "C3'" 
4444 O "O3'" . DT  C 15  ? 1.3381 1.2160 1.1540 0.0000 0.0000 0.0000 15  DT  C "O3'" 
4445 C "C2'" . DT  C 15  ? 1.3259 1.2250 1.1913 0.0000 0.0000 0.0000 15  DT  C "C2'" 
4446 C "C1'" . DT  C 15  ? 1.2871 1.2121 1.1673 0.0000 0.0000 0.0000 15  DT  C "C1'" 
4447 N N1    . DT  C 15  ? 1.2713 1.2042 1.1690 0.0000 0.0000 0.0000 15  DT  C N1    
4448 C C2    . DT  C 15  ? 1.2700 1.1932 1.1459 0.0000 0.0000 0.0000 15  DT  C C2    
4449 O O2    . DT  C 15  ? 1.2697 1.1828 1.1203 0.0000 0.0000 0.0000 15  DT  C O2    
4450 N N3    . DT  C 15  ? 1.2755 1.1994 1.1610 0.0000 0.0000 0.0000 15  DT  C N3    
4451 C C4    . DT  C 15  ? 1.2744 1.2087 1.1912 0.0000 0.0000 0.0000 15  DT  C C4    
4452 O O4    . DT  C 15  ? 1.2859 1.2145 1.2042 0.0000 0.0000 0.0000 15  DT  C O4    
4453 C C5    . DT  C 15  ? 1.2676 1.2178 1.2155 0.0000 0.0000 0.0000 15  DT  C C5    
4454 C C7    . DT  C 15  ? 1.2578 1.2240 1.2507 0.0000 0.0000 0.0000 15  DT  C C7    
4455 C C6    . DT  C 15  ? 1.2667 1.2146 1.2020 0.0000 0.0000 0.0000 15  DT  C C6    
4456 P P     . DT  C 16  ? 1.3898 1.2131 1.1485 0.0000 0.0000 0.0000 16  DT  C P     
4457 O OP1   . DT  C 16  ? 1.4096 1.2161 1.1382 0.0000 0.0000 0.0000 16  DT  C OP1   
4458 O OP2   . DT  C 16  ? 1.4087 1.2159 1.1714 0.0000 0.0000 0.0000 16  DT  C OP2   
4459 O "O5'" . DT  C 16  ? 1.3928 1.2014 1.1282 0.0000 0.0000 0.0000 16  DT  C "O5'" 
4460 C "C5'" . DT  C 16  ? 1.3769 1.2024 1.1161 0.0000 0.0000 0.0000 16  DT  C "C5'" 
4461 C "C4'" . DT  C 16  ? 1.3928 1.2064 1.1183 0.0000 0.0000 0.0000 16  DT  C "C4'" 
4462 O "O4'" . DT  C 16  ? 1.3750 1.2103 1.1322 0.0000 0.0000 0.0000 16  DT  C "O4'" 
4463 C "C3'" . DT  C 16  ? 1.4503 1.2129 1.1252 0.0000 0.0000 0.0000 16  DT  C "C3'" 
4464 O "O3'" . DT  C 16  ? 1.4777 1.2247 1.1270 0.0000 0.0000 0.0000 16  DT  C "O3'" 
4465 C "C2'" . DT  C 16  ? 1.4537 1.2134 1.1387 0.0000 0.0000 0.0000 16  DT  C "C2'" 
4466 C "C1'" . DT  C 16  ? 1.4031 1.2070 1.1332 0.0000 0.0000 0.0000 16  DT  C "C1'" 
4467 N N1    . DT  C 16  ? 1.3783 1.1964 1.1386 0.0000 0.0000 0.0000 16  DT  C N1    
4468 C C2    . DT  C 16  ? 1.3559 1.1779 1.1197 0.0000 0.0000 0.0000 16  DT  C C2    
4469 O O2    . DT  C 16  ? 1.3472 1.1636 1.0939 0.0000 0.0000 0.0000 16  DT  C O2    
4470 N N3    . DT  C 16  ? 1.3496 1.1803 1.1383 0.0000 0.0000 0.0000 16  DT  C N3    
4471 C C4    . DT  C 16  ? 1.3535 1.1949 1.1726 0.0000 0.0000 0.0000 16  DT  C C4    
4472 O O4    . DT  C 16  ? 1.3401 1.1895 1.1847 0.0000 0.0000 0.0000 16  DT  C O4    
4473 C C5    . DT  C 16  ? 1.3655 1.2052 1.1837 0.0000 0.0000 0.0000 16  DT  C C5    
4474 C C7    . DT  C 16  ? 1.3665 1.2177 1.2207 0.0000 0.0000 0.0000 16  DT  C C7    
4475 C C6    . DT  C 16  ? 1.3769 1.2025 1.1619 0.0000 0.0000 0.0000 16  DT  C C6    
4476 P P     . DG  C 17  ? 1.5511 1.2423 1.1385 0.0000 0.0000 0.0000 17  DG  C P     
4477 O OP1   . DG  C 17  ? 1.5429 1.2386 1.1269 0.0000 0.0000 0.0000 17  DG  C OP1   
4478 O OP2   . DG  C 17  ? 1.5767 1.2341 1.1363 0.0000 0.0000 0.0000 17  DG  C OP2   
4479 O "O5'" . DG  C 17  ? 1.5713 1.2425 1.1393 0.0000 0.0000 0.0000 17  DG  C "O5'" 
4480 C "C5'" . DG  C 17  ? 1.5345 1.2289 1.1232 0.0000 0.0000 0.0000 17  DG  C "C5'" 
4481 C "C4'" . DG  C 17  ? 1.5471 1.2236 1.1213 0.0000 0.0000 0.0000 17  DG  C "C4'" 
4482 O "O4'" . DG  C 17  ? 1.5222 1.2166 1.1230 0.0000 0.0000 0.0000 17  DG  C "O4'" 
4483 C "C3'" . DG  C 17  ? 1.6085 1.2268 1.1235 0.0000 0.0000 0.0000 17  DG  C "C3'" 
4484 O "O3'" . DG  C 17  ? 1.6291 1.2347 1.1290 0.0000 0.0000 0.0000 17  DG  C "O3'" 
4485 C "C2'" . DG  C 17  ? 1.6146 1.2214 1.1286 0.0000 0.0000 0.0000 17  DG  C "C2'" 
4486 C "C1'" . DG  C 17  ? 1.5539 1.2102 1.1231 0.0000 0.0000 0.0000 17  DG  C "C1'" 
4487 N N9    . DG  C 17  ? 1.5292 1.2016 1.1280 0.0000 0.0000 0.0000 17  DG  C N9    
4488 C C8    . DG  C 17  ? 1.5339 1.2048 1.1381 0.0000 0.0000 0.0000 17  DG  C C8    
4489 N N7    . DG  C 17  ? 1.5101 1.2019 1.1521 0.0000 0.0000 0.0000 17  DG  C N7    
4490 C C5    . DG  C 17  ? 1.4896 1.1945 1.1474 0.0000 0.0000 0.0000 17  DG  C C5    
4491 C C6    . DG  C 17  ? 1.4678 1.1933 1.1636 0.0000 0.0000 0.0000 17  DG  C C6    
4492 O O6    . DG  C 17  ? 1.4688 1.2105 1.1996 0.0000 0.0000 0.0000 17  DG  C O6    
4493 N N1    . DG  C 17  ? 1.4572 1.1815 1.1481 0.0000 0.0000 0.0000 17  DG  C N1    
4494 C C2    . DG  C 17  ? 1.4690 1.1770 1.1267 0.0000 0.0000 0.0000 17  DG  C C2    
4495 N N2    . DG  C 17  ? 1.4649 1.1692 1.1186 0.0000 0.0000 0.0000 17  DG  C N2    
4496 N N3    . DG  C 17  ? 1.4863 1.1802 1.1162 0.0000 0.0000 0.0000 17  DG  C N3    
4497 C C4    . DG  C 17  ? 1.4994 1.1913 1.1290 0.0000 0.0000 0.0000 17  DG  C C4    
4498 P P     . DT  C 18  ? 1.6980 1.2424 1.1338 0.0000 0.0000 0.0000 18  DT  C P     
4499 O OP1   . DT  C 18  ? 1.6951 1.2439 1.1336 0.0000 0.0000 0.0000 18  DT  C OP1   
4500 O OP2   . DT  C 18  ? 1.7357 1.2419 1.1305 0.0000 0.0000 0.0000 18  DT  C OP2   
4501 O "O5'" . DT  C 18  ? 1.7054 1.2320 1.1305 0.0000 0.0000 0.0000 18  DT  C "O5'" 
4502 C "C5'" . DT  C 18  ? 1.6650 1.2155 1.1176 0.0000 0.0000 0.0000 18  DT  C "C5'" 
4503 C "C4'" . DT  C 18  ? 1.6708 1.2070 1.1194 0.0000 0.0000 0.0000 18  DT  C "C4'" 
4504 O "O4'" . DT  C 18  ? 1.6430 1.2059 1.1271 0.0000 0.0000 0.0000 18  DT  C "O4'" 
4505 C "C3'" . DT  C 18  ? 1.7322 1.2091 1.1252 0.0000 0.0000 0.0000 18  DT  C "C3'" 
4506 O "O3'" . DT  C 18  ? 1.7568 1.2096 1.1252 0.0000 0.0000 0.0000 18  DT  C "O3'" 
4507 C "C2'" . DT  C 18  ? 1.7324 1.2123 1.1444 0.0000 0.0000 0.0000 18  DT  C "C2'" 
4508 C "C1'" . DT  C 18  ? 1.6733 1.2133 1.1487 0.0000 0.0000 0.0000 18  DT  C "C1'" 
4509 N N1    . DT  C 18  ? 1.6755 1.2355 1.1851 0.0000 0.0000 0.0000 18  DT  C N1    
4510 C C2    . DT  C 18  ? 1.6564 1.2440 1.2102 0.0000 0.0000 0.0000 18  DT  C C2    
4511 O O2    . DT  C 18  ? 1.6516 1.2439 1.2123 0.0000 0.0000 0.0000 18  DT  C O2    
4512 N N3    . DT  C 18  ? 1.6453 1.2525 1.2347 0.0000 0.0000 0.0000 18  DT  C N3    
4513 C C4    . DT  C 18  ? 1.6579 1.2562 1.2379 0.0000 0.0000 0.0000 18  DT  C C4    
4514 O O4    . DT  C 18  ? 1.6502 1.2669 1.2658 0.0000 0.0000 0.0000 18  DT  C O4    
4515 C C5    . DT  C 18  ? 1.6867 1.2497 1.2114 0.0000 0.0000 0.0000 18  DT  C C5    
4516 C C7    . DT  C 18  ? 1.7093 1.2499 1.2086 0.0000 0.0000 0.0000 18  DT  C C7    
4517 C C6    . DT  C 18  ? 1.6969 1.2445 1.1921 0.0000 0.0000 0.0000 18  DT  C C6    
4518 P P     . DA  C 19  ? 1.8166 1.2065 1.1277 0.0000 0.0000 0.0000 19  DA  C P     
4519 O OP1   . DA  C 19  ? 1.8360 1.2080 1.1238 0.0000 0.0000 0.0000 19  DA  C OP1   
4520 O OP2   . DA  C 19  ? 1.8343 1.1855 1.1042 0.0000 0.0000 0.0000 19  DA  C OP2   
4521 O "O5'" . DA  C 19  ? 1.8208 1.2193 1.1592 0.0000 0.0000 0.0000 19  DA  C "O5'" 
4522 C "C5'" . DA  C 19  ? 1.8381 1.2423 1.1885 0.0000 0.0000 0.0000 19  DA  C "C5'" 
4523 C "C4'" . DA  C 19  ? 1.8612 1.2674 1.2363 0.0000 0.0000 0.0000 19  DA  C "C4'" 
4524 O "O4'" . DA  C 19  ? 1.8275 1.2816 1.2576 0.0000 0.0000 0.0000 19  DA  C "O4'" 
4525 C "C3'" . DA  C 19  ? 1.9278 1.2848 1.2685 0.0000 0.0000 0.0000 19  DA  C "C3'" 
4526 O "O3'" . DA  C 19  ? 1.9740 1.2860 1.2724 0.0000 0.0000 0.0000 19  DA  C "O3'" 
4527 C "C2'" . DA  C 19  ? 1.9179 1.3045 1.3142 0.0000 0.0000 0.0000 19  DA  C "C2'" 
4528 C "C1'" . DA  C 19  ? 1.8674 1.3136 1.3142 0.0000 0.0000 0.0000 19  DA  C "C1'" 
4529 N N9    . DA  C 19  ? 1.8931 1.3477 1.3478 0.0000 0.0000 0.0000 19  DA  C N9    
4530 C C8    . DA  C 19  ? 1.9416 1.3662 1.3498 0.0000 0.0000 0.0000 19  DA  C C8    
4531 N N7    . DA  C 19  ? 1.9443 1.3771 1.3640 0.0000 0.0000 0.0000 19  DA  C N7    
4532 C C5    . DA  C 19  ? 1.9054 1.3810 1.3891 0.0000 0.0000 0.0000 19  DA  C C5    
4533 C C6    . DA  C 19  ? 1.8854 1.3887 1.4116 0.0000 0.0000 0.0000 19  DA  C C6    
4534 N N6    . DA  C 19  ? 1.8960 1.3821 1.3980 0.0000 0.0000 0.0000 19  DA  C N6    
4535 N N1    . DA  C 19  ? 1.8468 1.3924 1.4384 0.0000 0.0000 0.0000 19  DA  C N1    
4536 C C2    . DA  C 19  ? 1.8295 1.3842 1.4369 0.0000 0.0000 0.0000 19  DA  C C2    
4537 N N3    . DA  C 19  ? 1.8450 1.3716 1.4106 0.0000 0.0000 0.0000 19  DA  C N3    
4538 C C4    . DA  C 19  ? 1.8790 1.3687 1.3856 0.0000 0.0000 0.0000 19  DA  C C4    
4539 O "O5'" . DT  D 1   ? 2.1423 1.7294 2.0902 0.0000 0.0000 0.0000 1   DT  D "O5'" 
4540 C "C5'" . DT  D 1   ? 2.0941 1.7389 2.0950 0.0000 0.0000 0.0000 1   DT  D "C5'" 
4541 C "C4'" . DT  D 1   ? 2.0640 1.7233 2.0317 0.0000 0.0000 0.0000 1   DT  D "C4'" 
4542 O "O4'" . DT  D 1   ? 2.0843 1.7154 1.9743 0.0000 0.0000 0.0000 1   DT  D "O4'" 
4543 C "C3'" . DT  D 1   ? 1.9985 1.7185 2.0282 0.0000 0.0000 0.0000 1   DT  D "C3'" 
4544 O "O3'" . DT  D 1   ? 1.9380 1.6748 1.9825 0.0000 0.0000 0.0000 1   DT  D "O3'" 
4545 C "C2'" . DT  D 1   ? 1.9986 1.7213 1.9857 0.0000 0.0000 0.0000 1   DT  D "C2'" 
4546 C "C1'" . DT  D 1   ? 2.0485 1.7181 1.9468 0.0000 0.0000 0.0000 1   DT  D "C1'" 
4547 N N1    . DT  D 1   ? 2.0700 1.7222 1.9137 0.0000 0.0000 0.0000 1   DT  D N1    
4548 C C2    . DT  D 1   ? 2.1042 1.7092 1.8701 0.0000 0.0000 0.0000 1   DT  D C2    
4549 O O2    . DT  D 1   ? 2.1217 1.6961 1.8562 0.0000 0.0000 0.0000 1   DT  D O2    
4550 N N3    . DT  D 1   ? 2.1143 1.7067 1.8386 0.0000 0.0000 0.0000 1   DT  D N3    
4551 C C4    . DT  D 1   ? 2.0984 1.7165 1.8452 0.0000 0.0000 0.0000 1   DT  D C4    
4552 O O4    . DT  D 1   ? 2.1147 1.7131 1.8157 0.0000 0.0000 0.0000 1   DT  D O4    
4553 C C5    . DT  D 1   ? 2.0634 1.7299 1.8898 0.0000 0.0000 0.0000 1   DT  D C5    
4554 C C7    . DT  D 1   ? 2.0320 1.7271 1.8871 0.0000 0.0000 0.0000 1   DT  D C7    
4555 C C6    . DT  D 1   ? 2.0521 1.7345 1.9244 0.0000 0.0000 0.0000 1   DT  D C6    
4556 P P     . DA  D 2   ? 1.8723 1.6270 1.8892 0.0000 0.0000 0.0000 2   DA  D P     
4557 O OP1   . DA  D 2   ? 1.8649 1.6334 1.9135 0.0000 0.0000 0.0000 2   DA  D OP1   
4558 O OP2   . DA  D 2   ? 1.8303 1.6163 1.8563 0.0000 0.0000 0.0000 2   DA  D OP2   
4559 O "O5'" . DA  D 2   ? 1.8650 1.5681 1.7918 0.0000 0.0000 0.0000 2   DA  D "O5'" 
4560 C "C5'" . DA  D 2   ? 1.8280 1.5016 1.7228 0.0000 0.0000 0.0000 2   DA  D "C5'" 
4561 C "C4'" . DA  D 2   ? 1.7625 1.4273 1.6011 0.0000 0.0000 0.0000 2   DA  D "C4'" 
4562 O "O4'" . DA  D 2   ? 1.7486 1.4086 1.5547 0.0000 0.0000 0.0000 2   DA  D "O4'" 
4563 C "C3'" . DA  D 2   ? 1.6857 1.3895 1.5529 0.0000 0.0000 0.0000 2   DA  D "C3'" 
4564 O "O3'" . DA  D 2   ? 1.6559 1.3322 1.4760 0.0000 0.0000 0.0000 2   DA  D "O3'" 
4565 C "C2'" . DA  D 2   ? 1.6627 1.3926 1.5284 0.0000 0.0000 0.0000 2   DA  D "C2'" 
4566 C "C1'" . DA  D 2   ? 1.7023 1.3933 1.5109 0.0000 0.0000 0.0000 2   DA  D "C1'" 
4567 N N9    . DA  D 2   ? 1.7002 1.4011 1.5080 0.0000 0.0000 0.0000 2   DA  D N9    
4568 C C8    . DA  D 2   ? 1.6865 1.4155 1.5407 0.0000 0.0000 0.0000 2   DA  D C8    
4569 N N7    . DA  D 2   ? 1.6898 1.4118 1.5191 0.0000 0.0000 0.0000 2   DA  D N7    
4570 C C5    . DA  D 2   ? 1.7120 1.4025 1.4791 0.0000 0.0000 0.0000 2   DA  D C5    
4571 C C6    . DA  D 2   ? 1.7295 1.3970 1.4458 0.0000 0.0000 0.0000 2   DA  D C6    
4572 N N6    . DA  D 2   ? 1.7393 1.4067 1.4516 0.0000 0.0000 0.0000 2   DA  D N6    
4573 N N1    . DA  D 2   ? 1.7465 1.3877 1.4145 0.0000 0.0000 0.0000 2   DA  D N1    
4574 C C2    . DA  D 2   ? 1.7522 1.3870 1.4171 0.0000 0.0000 0.0000 2   DA  D C2    
4575 N N3    . DA  D 2   ? 1.7407 1.3894 1.4424 0.0000 0.0000 0.0000 2   DA  D N3    
4576 C C4    . DA  D 2   ? 1.7185 1.3970 1.4733 0.0000 0.0000 0.0000 2   DA  D C4    
4577 P P     . DC  D 3   ? 1.5955 1.2901 1.4184 0.0000 0.0000 0.0000 3   DC  D P     
4578 O OP1   . DC  D 3   ? 1.6321 1.2893 1.4291 0.0000 0.0000 0.0000 3   DC  D OP1   
4579 O OP2   . DC  D 3   ? 1.5576 1.3037 1.4428 0.0000 0.0000 0.0000 3   DC  D OP2   
4580 O "O5'" . DC  D 3   ? 1.5655 1.2545 1.3403 0.0000 0.0000 0.0000 3   DC  D "O5'" 
4581 C "C5'" . DC  D 3   ? 1.5775 1.2217 1.2894 0.0000 0.0000 0.0000 3   DC  D "C5'" 
4582 C "C4'" . DC  D 3   ? 1.5419 1.1916 1.2276 0.0000 0.0000 0.0000 3   DC  D "C4'" 
4583 O "O4'" . DC  D 3   ? 1.5195 1.1922 1.2292 0.0000 0.0000 0.0000 3   DC  D "O4'" 
4584 C "C3'" . DC  D 3   ? 1.4986 1.1748 1.1919 0.0000 0.0000 0.0000 3   DC  D "C3'" 
4585 O "O3'" . DC  D 3   ? 1.5093 1.1517 1.1545 0.0000 0.0000 0.0000 3   DC  D "O3'" 
4586 C "C2'" . DC  D 3   ? 1.4654 1.1712 1.1722 0.0000 0.0000 0.0000 3   DC  D "C2'" 
4587 C "C1'" . DC  D 3   ? 1.4862 1.1803 1.1921 0.0000 0.0000 0.0000 3   DC  D "C1'" 
4588 N N1    . DC  D 3   ? 1.4547 1.1815 1.1986 0.0000 0.0000 0.0000 3   DC  D N1    
4589 C C2    . DC  D 3   ? 1.4480 1.1745 1.1741 0.0000 0.0000 0.0000 3   DC  D C2    
4590 O O2    . DC  D 3   ? 1.4705 1.1753 1.1567 0.0000 0.0000 0.0000 3   DC  D O2    
4591 N N3    . DC  D 3   ? 1.4243 1.1720 1.1770 0.0000 0.0000 0.0000 3   DC  D N3    
4592 C C4    . DC  D 3   ? 1.4097 1.1821 1.2102 0.0000 0.0000 0.0000 3   DC  D C4    
4593 N N4    . DC  D 3   ? 1.4009 1.1910 1.2244 0.0000 0.0000 0.0000 3   DC  D N4    
4594 C C5    . DC  D 3   ? 1.4137 1.1916 1.2401 0.0000 0.0000 0.0000 3   DC  D C5    
4595 C C6    . DC  D 3   ? 1.4338 1.1863 1.2279 0.0000 0.0000 0.0000 3   DC  D C6    
4596 P P     . DA  D 4   ? 1.4834 1.1308 1.1226 0.0000 0.0000 0.0000 4   DA  D P     
4597 O OP1   . DA  D 4   ? 1.5274 1.1230 1.1114 0.0000 0.0000 0.0000 4   DA  D OP1   
4598 O OP2   . DA  D 4   ? 1.4608 1.1378 1.1434 0.0000 0.0000 0.0000 4   DA  D OP2   
4599 O "O5'" . DA  D 4   ? 1.4428 1.1193 1.0904 0.0000 0.0000 0.0000 4   DA  D "O5'" 
4600 C "C5'" . DA  D 4   ? 1.4730 1.1264 1.0844 0.0000 0.0000 0.0000 4   DA  D "C5'" 
4601 C "C4'" . DA  D 4   ? 1.4569 1.1426 1.0870 0.0000 0.0000 0.0000 4   DA  D "C4'" 
4602 O "O4'" . DA  D 4   ? 1.4324 1.1485 1.0943 0.0000 0.0000 0.0000 4   DA  D "O4'" 
4603 C "C3'" . DA  D 4   ? 1.4412 1.1511 1.0900 0.0000 0.0000 0.0000 4   DA  D "C3'" 
4604 O "O3'" . DA  D 4   ? 1.4616 1.1750 1.1051 0.0000 0.0000 0.0000 4   DA  D "O3'" 
4605 C "C2'" . DA  D 4   ? 1.3868 1.1404 1.0818 0.0000 0.0000 0.0000 4   DA  D "C2'" 
4606 C "C1'" . DA  D 4   ? 1.3849 1.1418 1.0842 0.0000 0.0000 0.0000 4   DA  D "C1'" 
4607 N N9    . DA  D 4   ? 1.3668 1.1440 1.0978 0.0000 0.0000 0.0000 4   DA  D N9    
4608 C C8    . DA  D 4   ? 1.3656 1.1463 1.1152 0.0000 0.0000 0.0000 4   DA  D C8    
4609 N N7    . DA  D 4   ? 1.3465 1.1499 1.1310 0.0000 0.0000 0.0000 4   DA  D N7    
4610 C C5    . DA  D 4   ? 1.3323 1.1424 1.1134 0.0000 0.0000 0.0000 4   DA  D C5    
4611 C C6    . DA  D 4   ? 1.3117 1.1375 1.1137 0.0000 0.0000 0.0000 4   DA  D C6    
4612 N N6    . DA  D 4   ? 1.2917 1.1354 1.1312 0.0000 0.0000 0.0000 4   DA  D N6    
4613 N N1    . DA  D 4   ? 1.3168 1.1364 1.0990 0.0000 0.0000 0.0000 4   DA  D N1    
4614 C C2    . DA  D 4   ? 1.3290 1.1335 1.0809 0.0000 0.0000 0.0000 4   DA  D C2    
4615 N N3    . DA  D 4   ? 1.3340 1.1272 1.0703 0.0000 0.0000 0.0000 4   DA  D N3    
4616 C C4    . DA  D 4   ? 1.3452 1.1396 1.0938 0.0000 0.0000 0.0000 4   DA  D C4    
4617 P P     . DA  D 5   ? 1.4520 1.1913 1.1179 0.0000 0.0000 0.0000 5   DA  D P     
4618 O OP1   . DA  D 5   ? 1.4664 1.1839 1.1099 0.0000 0.0000 0.0000 5   DA  D OP1   
4619 O OP2   . DA  D 5   ? 1.4466 1.1953 1.1250 0.0000 0.0000 0.0000 5   DA  D OP2   
4620 O "O5'" . DA  D 5   ? 1.4322 1.2130 1.1362 0.0000 0.0000 0.0000 5   DA  D "O5'" 
4621 C "C5'" . DA  D 5   ? 1.4681 1.2472 1.1674 0.0000 0.0000 0.0000 5   DA  D "C5'" 
4622 C "C4'" . DA  D 5   ? 1.4536 1.2675 1.1852 0.0000 0.0000 0.0000 5   DA  D "C4'" 
4623 O "O4'" . DA  D 5   ? 1.4370 1.2565 1.1760 0.0000 0.0000 0.0000 5   DA  D "O4'" 
4624 C "C3'" . DA  D 5   ? 1.4293 1.2776 1.1962 0.0000 0.0000 0.0000 5   DA  D "C3'" 
4625 O "O3'" . DA  D 5   ? 1.4521 1.3185 1.2362 0.0000 0.0000 0.0000 5   DA  D "O3'" 
4626 C "C2'" . DA  D 5   ? 1.3875 1.2532 1.1721 0.0000 0.0000 0.0000 5   DA  D "C2'" 
4627 C "C1'" . DA  D 5   ? 1.3836 1.2388 1.1578 0.0000 0.0000 0.0000 5   DA  D "C1'" 
4628 N N9    . DA  D 5   ? 1.3619 1.2227 1.1480 0.0000 0.0000 0.0000 5   DA  D N9    
4629 C C8    . DA  D 5   ? 1.3653 1.2196 1.1510 0.0000 0.0000 0.0000 5   DA  D C8    
4630 N N7    . DA  D 5   ? 1.3487 1.2134 1.1541 0.0000 0.0000 0.0000 5   DA  D N7    
4631 C C5    . DA  D 5   ? 1.3333 1.2111 1.1513 0.0000 0.0000 0.0000 5   DA  D C5    
4632 C C6    . DA  D 5   ? 1.3096 1.2019 1.1522 0.0000 0.0000 0.0000 5   DA  D C6    
4633 N N6    . DA  D 5   ? 1.2937 1.1951 1.1607 0.0000 0.0000 0.0000 5   DA  D N6    
4634 N N1    . DA  D 5   ? 1.3123 1.2067 1.1531 0.0000 0.0000 0.0000 5   DA  D N1    
4635 C C2    . DA  D 5   ? 1.3246 1.2082 1.1416 0.0000 0.0000 0.0000 5   DA  D C2    
4636 N N3    . DA  D 5   ? 1.3344 1.2092 1.1347 0.0000 0.0000 0.0000 5   DA  D N3    
4637 C C4    . DA  D 5   ? 1.3445 1.2172 1.1465 0.0000 0.0000 0.0000 5   DA  D C4    
4638 P P     . DA  D 6   ? 1.4464 1.3434 1.2668 0.0000 0.0000 0.0000 6   DA  D P     
4639 O OP1   . DA  D 6   ? 1.4634 1.3469 1.2779 0.0000 0.0000 0.0000 6   DA  D OP1   
4640 O OP2   . DA  D 6   ? 1.4019 1.3173 1.2416 0.0000 0.0000 0.0000 6   DA  D OP2   
4641 O "O5'" . DA  D 6   ? 1.4077 1.3221 1.2432 0.0000 0.0000 0.0000 6   DA  D "O5'" 
4642 C "C5'" . DA  D 6   ? 1.3772 1.2705 1.1857 0.0000 0.0000 0.0000 6   DA  D "C5'" 
4643 C "C4'" . DA  D 6   ? 1.3269 1.2334 1.1437 0.0000 0.0000 0.0000 6   DA  D "C4'" 
4644 O "O4'" . DA  D 6   ? 1.3186 1.2261 1.1359 0.0000 0.0000 0.0000 6   DA  D "O4'" 
4645 C "C3'" . DA  D 6   ? 1.2726 1.2118 1.1240 0.0000 0.0000 0.0000 6   DA  D "C3'" 
4646 O "O3'" . DA  D 6   ? 1.2597 1.1920 1.1011 0.0000 0.0000 0.0000 6   DA  D "O3'" 
4647 C "C2'" . DA  D 6   ? 1.2504 1.2069 1.1174 0.0000 0.0000 0.0000 6   DA  D "C2'" 
4648 C "C1'" . DA  D 6   ? 1.2750 1.2087 1.1179 0.0000 0.0000 0.0000 6   DA  D "C1'" 
4649 N N9    . DA  D 6   ? 1.2574 1.1986 1.1111 0.0000 0.0000 0.0000 6   DA  D N9    
4650 C C8    . DA  D 6   ? 1.2466 1.1863 1.1014 0.0000 0.0000 0.0000 6   DA  D C8    
4651 N N7    . DA  D 6   ? 1.2354 1.1780 1.0968 0.0000 0.0000 0.0000 6   DA  D N7    
4652 C C5    . DA  D 6   ? 1.2325 1.1838 1.1046 0.0000 0.0000 0.0000 6   DA  D C5    
4653 C C6    . DA  D 6   ? 1.2224 1.1835 1.1127 0.0000 0.0000 0.0000 6   DA  D C6    
4654 N N6    . DA  D 6   ? 1.2247 1.1873 1.1236 0.0000 0.0000 0.0000 6   DA  D N6    
4655 N N1    . DA  D 6   ? 1.2231 1.1901 1.1225 0.0000 0.0000 0.0000 6   DA  D N1    
4656 C C2    . DA  D 6   ? 1.2372 1.1952 1.1203 0.0000 0.0000 0.0000 6   DA  D C2    
4657 N N3    . DA  D 6   ? 1.2466 1.1942 1.1108 0.0000 0.0000 0.0000 6   DA  D N3    
4658 C C4    . DA  D 6   ? 1.2434 1.1912 1.1072 0.0000 0.0000 0.0000 6   DA  D C4    
4659 P P     . DA  D 7   ? 1.2246 1.1788 1.0907 0.0000 0.0000 0.0000 7   DA  D P     
4660 O OP1   . DA  D 7   ? 1.2309 1.1708 1.0877 0.0000 0.0000 0.0000 7   DA  D OP1   
4661 O OP2   . DA  D 7   ? 1.1899 1.1765 1.0935 0.0000 0.0000 0.0000 7   DA  D OP2   
4662 O "O5'" . DA  D 7   ? 1.2147 1.1604 1.0643 0.0000 0.0000 0.0000 7   DA  D "O5'" 
4663 C "C5'" . DA  D 7   ? 1.2211 1.1530 1.0538 0.0000 0.0000 0.0000 7   DA  D "C5'" 
4664 C "C4'" . DA  D 7   ? 1.2056 1.1511 1.0507 0.0000 0.0000 0.0000 7   DA  D "C4'" 
4665 O "O4'" . DA  D 7   ? 1.1891 1.1522 1.0557 0.0000 0.0000 0.0000 7   DA  D "O4'" 
4666 C "C3'" . DA  D 7   ? 1.1774 1.1447 1.0436 0.0000 0.0000 0.0000 7   DA  D "C3'" 
4667 O "O3'" . DA  D 7   ? 1.1754 1.1309 1.0268 0.0000 0.0000 0.0000 7   DA  D "O3'" 
4668 C "C2'" . DA  D 7   ? 1.1514 1.1504 1.0525 0.0000 0.0000 0.0000 7   DA  D "C2'" 
4669 C "C1'" . DA  D 7   ? 1.1612 1.1541 1.0580 0.0000 0.0000 0.0000 7   DA  D "C1'" 
4670 N N9    . DA  D 7   ? 1.1547 1.1615 1.0690 0.0000 0.0000 0.0000 7   DA  D N9    
4671 C C8    . DA  D 7   ? 1.1453 1.1553 1.0641 0.0000 0.0000 0.0000 7   DA  D C8    
4672 N N7    . DA  D 7   ? 1.1347 1.1488 1.0604 0.0000 0.0000 0.0000 7   DA  D N7    
4673 C C5    . DA  D 7   ? 1.1333 1.1513 1.0652 0.0000 0.0000 0.0000 7   DA  D C5    
4674 C C6    . DA  D 7   ? 1.1291 1.1515 1.0715 0.0000 0.0000 0.0000 7   DA  D C6    
4675 N N6    . DA  D 7   ? 1.1263 1.1438 1.0654 0.0000 0.0000 0.0000 7   DA  D N6    
4676 N N1    . DA  D 7   ? 1.1342 1.1636 1.0904 0.0000 0.0000 0.0000 7   DA  D N1    
4677 C C2    . DA  D 7   ? 1.1312 1.1590 1.0847 0.0000 0.0000 0.0000 7   DA  D C2    
4678 N N3    . DA  D 7   ? 1.1399 1.1575 1.0750 0.0000 0.0000 0.0000 7   DA  D N3    
4679 C C4    . DA  D 7   ? 1.1428 1.1578 1.0702 0.0000 0.0000 0.0000 7   DA  D C4    
4680 P P     . DT  D 8   ? 1.1255 1.0987 0.9935 0.0000 0.0000 0.0000 8   DT  D P     
4681 O OP1   . DT  D 8   ? 1.1445 1.0876 0.9790 0.0000 0.0000 0.0000 8   DT  D OP1   
4682 O OP2   . DT  D 8   ? 1.0892 1.0831 0.9808 0.0000 0.0000 0.0000 8   DT  D OP2   
4683 O "O5'" . DT  D 8   ? 1.1010 1.0996 0.9977 0.0000 0.0000 0.0000 8   DT  D "O5'" 
4684 C "C5'" . DT  D 8   ? 1.1096 1.0976 0.9994 0.0000 0.0000 0.0000 8   DT  D "C5'" 
4685 C "C4'" . DT  D 8   ? 1.0846 1.1022 1.0102 0.0000 0.0000 0.0000 8   DT  D "C4'" 
4686 O "O4'" . DT  D 8   ? 1.0737 1.1081 1.0181 0.0000 0.0000 0.0000 8   DT  D "O4'" 
4687 C "C3'" . DT  D 8   ? 1.0626 1.0978 1.0033 0.0000 0.0000 0.0000 8   DT  D "C3'" 
4688 O "O3'" . DT  D 8   ? 1.0732 1.1115 1.0246 0.0000 0.0000 0.0000 8   DT  D "O3'" 
4689 C "C2'" . DT  D 8   ? 1.0245 1.0869 0.9927 0.0000 0.0000 0.0000 8   DT  D "C2'" 
4690 C "C1'" . DT  D 8   ? 1.0310 1.0916 1.0028 0.0000 0.0000 0.0000 8   DT  D "C1'" 
4691 N N1    . DT  D 8   ? 1.0139 1.0822 0.9926 0.0000 0.0000 0.0000 8   DT  D N1    
4692 C C2    . DT  D 8   ? 0.9948 1.0716 0.9878 0.0000 0.0000 0.0000 8   DT  D C2    
4693 O O2    . DT  D 8   ? 0.9922 1.0758 0.9997 0.0000 0.0000 0.0000 8   DT  D O2    
4694 N N3    . DT  D 8   ? 0.9847 1.0596 0.9747 0.0000 0.0000 0.0000 8   DT  D N3    
4695 C C4    . DT  D 8   ? 0.9836 1.0538 0.9655 0.0000 0.0000 0.0000 8   DT  D C4    
4696 O O4    . DT  D 8   ? 0.9825 1.0490 0.9623 0.0000 0.0000 0.0000 8   DT  D O4    
4697 C C5    . DT  D 8   ? 0.9953 1.0624 0.9709 0.0000 0.0000 0.0000 8   DT  D C5    
4698 C C7    . DT  D 8   ? 1.0003 1.0655 0.9757 0.0000 0.0000 0.0000 8   DT  D C7    
4699 C C6    . DT  D 8   ? 1.0117 1.0751 0.9818 0.0000 0.0000 0.0000 8   DT  D C6    
4700 P P     . DT  D 9   ? 1.0733 1.1221 1.0352 0.0000 0.0000 0.0000 9   DT  D P     
4701 O OP1   . DT  D 9   ? 1.0915 1.1253 1.0478 0.0000 0.0000 0.0000 9   DT  D OP1   
4702 O OP2   . DT  D 9   ? 1.0687 1.1119 1.0146 0.0000 0.0000 0.0000 9   DT  D OP2   
4703 O "O5'" . DT  D 9   ? 1.0560 1.1383 1.0579 0.0000 0.0000 0.0000 9   DT  D "O5'" 
4704 C "C5'" . DT  D 9   ? 1.0727 1.1615 1.0952 0.0000 0.0000 0.0000 9   DT  D "C5'" 
4705 C "C4'" . DT  D 9   ? 1.0566 1.1712 1.1117 0.0000 0.0000 0.0000 9   DT  D "C4'" 
4706 O "O4'" . DT  D 9   ? 1.0494 1.1636 1.0967 0.0000 0.0000 0.0000 9   DT  D "O4'" 
4707 C "C3'" . DT  D 9   ? 1.0446 1.1765 1.1156 0.0000 0.0000 0.0000 9   DT  D "C3'" 
4708 O "O3'" . DT  D 9   ? 1.0549 1.2036 1.1603 0.0000 0.0000 0.0000 9   DT  D "O3'" 
4709 C "C2'" . DT  D 9   ? 1.0254 1.1625 1.0905 0.0000 0.0000 0.0000 9   DT  D "C2'" 
4710 C "C1'" . DT  D 9   ? 1.0235 1.1535 1.0838 0.0000 0.0000 0.0000 9   DT  D "C1'" 
4711 N N1    . DT  D 9   ? 1.0130 1.1366 1.0571 0.0000 0.0000 0.0000 9   DT  D N1    
4712 C C2    . DT  D 9   ? 1.0013 1.1236 1.0461 0.0000 0.0000 0.0000 9   DT  D C2    
4713 O O2    . DT  D 9   ? 0.9962 1.1213 1.0525 0.0000 0.0000 0.0000 9   DT  D O2    
4714 N N3    . DT  D 9   ? 1.0052 1.1202 1.0367 0.0000 0.0000 0.0000 9   DT  D N3    
4715 C C4    . DT  D 9   ? 1.0100 1.1232 1.0346 0.0000 0.0000 0.0000 9   DT  D C4    
4716 O O4    . DT  D 9   ? 1.0129 1.1225 1.0338 0.0000 0.0000 0.0000 9   DT  D O4    
4717 C C5    . DT  D 9   ? 1.0096 1.1231 1.0319 0.0000 0.0000 0.0000 9   DT  D C5    
4718 C C7    . DT  D 9   ? 1.0130 1.1208 1.0262 0.0000 0.0000 0.0000 9   DT  D C7    
4719 C C6    . DT  D 9   ? 1.0162 1.1324 1.0447 0.0000 0.0000 0.0000 9   DT  D C6    
4720 P P     . DC  D 10  ? 1.0466 1.2166 1.1786 0.0000 0.0000 0.0000 10  DC  D P     
4721 O OP1   . DC  D 10  ? 1.0405 1.2231 1.2093 0.0000 0.0000 0.0000 10  DC  D OP1   
4722 O OP2   . DC  D 10  ? 1.0407 1.2056 1.1525 0.0000 0.0000 0.0000 10  DC  D OP2   
4723 O "O5'" . DC  D 10  ? 1.0222 1.1979 1.1573 0.0000 0.0000 0.0000 10  DC  D "O5'" 
4724 C "C5'" . DC  D 10  ? 1.0065 1.1786 1.1482 0.0000 0.0000 0.0000 10  DC  D "C5'" 
4725 C "C4'" . DC  D 10  ? 0.9825 1.1548 1.1231 0.0000 0.0000 0.0000 10  DC  D "C4'" 
4726 O "O4'" . DC  D 10  ? 0.9818 1.1387 1.0899 0.0000 0.0000 0.0000 10  DC  D "O4'" 
4727 C "C3'" . DC  D 10  ? 0.9610 1.1464 1.1161 0.0000 0.0000 0.0000 10  DC  D "C3'" 
4728 O "O3'" . DC  D 10  ? 0.9639 1.1488 1.1313 0.0000 0.0000 0.0000 10  DC  D "O3'" 
4729 C "C2'" . DC  D 10  ? 0.9577 1.1345 1.0842 0.0000 0.0000 0.0000 10  DC  D "C2'" 
4730 C "C1'" . DC  D 10  ? 0.9625 1.1217 1.0644 0.0000 0.0000 0.0000 10  DC  D "C1'" 
4731 N N1    . DC  D 10  ? 0.9605 1.1129 1.0416 0.0000 0.0000 0.0000 10  DC  D N1    
4732 C C2    . DC  D 10  ? 0.9617 1.1012 1.0241 0.0000 0.0000 0.0000 10  DC  D C2    
4733 O O2    . DC  D 10  ? 0.9719 1.1003 1.0267 0.0000 0.0000 0.0000 10  DC  D O2    
4734 N N3    . DC  D 10  ? 0.9445 1.0817 0.9979 0.0000 0.0000 0.0000 10  DC  D N3    
4735 C C4    . DC  D 10  ? 0.9293 1.0728 0.9859 0.0000 0.0000 0.0000 10  DC  D C4    
4736 N N4    . DC  D 10  ? 0.9049 1.0460 0.9561 0.0000 0.0000 0.0000 10  DC  D N4    
4737 C C5    . DC  D 10  ? 0.9435 1.0935 1.0092 0.0000 0.0000 0.0000 10  DC  D C5    
4738 C C6    . DC  D 10  ? 0.9497 1.1059 1.0302 0.0000 0.0000 0.0000 10  DC  D C6    
4739 P P     . DC  D 11  ? 0.9670 1.1608 1.1495 0.0000 0.0000 0.0000 11  DC  D P     
4740 O OP1   . DC  D 11  ? 0.9576 1.1493 1.1587 0.0000 0.0000 0.0000 11  DC  D OP1   
4741 O OP2   . DC  D 11  ? 0.9407 1.1522 1.1415 0.0000 0.0000 0.0000 11  DC  D OP2   
4742 O "O5'" . DC  D 11  ? 0.9523 1.1273 1.0953 0.0000 0.0000 0.0000 11  DC  D "O5'" 
4743 C "C5'" . DC  D 11  ? 0.9557 1.1074 1.0738 0.0000 0.0000 0.0000 11  DC  D "C5'" 
4744 C "C4'" . DC  D 11  ? 0.9490 1.0878 1.0375 0.0000 0.0000 0.0000 11  DC  D "C4'" 
4745 O "O4'" . DC  D 11  ? 0.9340 1.0764 1.0147 0.0000 0.0000 0.0000 11  DC  D "O4'" 
4746 C "C3'" . DC  D 11  ? 0.9393 1.0888 1.0375 0.0000 0.0000 0.0000 11  DC  D "C3'" 
4747 O "O3'" . DC  D 11  ? 0.9692 1.0949 1.0386 0.0000 0.0000 0.0000 11  DC  D "O3'" 
4748 C "C2'" . DC  D 11  ? 0.9193 1.0803 1.0180 0.0000 0.0000 0.0000 11  DC  D "C2'" 
4749 C "C1'" . DC  D 11  ? 0.9279 1.0741 1.0042 0.0000 0.0000 0.0000 11  DC  D "C1'" 
4750 N N1    . DC  D 11  ? 0.9232 1.0764 0.9989 0.0000 0.0000 0.0000 11  DC  D N1    
4751 C C2    . DC  D 11  ? 0.9264 1.0684 0.9856 0.0000 0.0000 0.0000 11  DC  D C2    
4752 O O2    . DC  D 11  ? 0.9441 1.0683 0.9863 0.0000 0.0000 0.0000 11  DC  D O2    
4753 N N3    . DC  D 11  ? 0.9134 1.0615 0.9752 0.0000 0.0000 0.0000 11  DC  D N3    
4754 C C4    . DC  D 11  ? 0.8997 1.0587 0.9711 0.0000 0.0000 0.0000 11  DC  D C4    
4755 N N4    . DC  D 11  ? 0.9066 1.0655 0.9749 0.0000 0.0000 0.0000 11  DC  D N4    
4756 C C5    . DC  D 11  ? 0.9032 1.0710 0.9877 0.0000 0.0000 0.0000 11  DC  D C5    
4757 C C6    . DC  D 11  ? 0.9144 1.0821 1.0051 0.0000 0.0000 0.0000 11  DC  D C6    
4758 P P     . DA  D 12  ? 0.9828 1.1003 1.0548 0.0000 0.0000 0.0000 12  DA  D P     
4759 O OP1   . DA  D 12  ? 0.9837 1.1076 1.0796 0.0000 0.0000 0.0000 12  DA  D OP1   
4760 O OP2   . DA  D 12  ? 0.9815 1.1139 1.0664 0.0000 0.0000 0.0000 12  DA  D OP2   
4761 O "O5'" . DA  D 12  ? 1.0228 1.0990 1.0463 0.0000 0.0000 0.0000 12  DA  D "O5'" 
4762 C "C5'" . DA  D 12  ? 1.0480 1.0963 1.0411 0.0000 0.0000 0.0000 12  DA  D "C5'" 
4763 C "C4'" . DA  D 12  ? 1.0649 1.0927 1.0256 0.0000 0.0000 0.0000 12  DA  D "C4'" 
4764 O "O4'" . DA  D 12  ? 1.0293 1.0855 1.0125 0.0000 0.0000 0.0000 12  DA  D "O4'" 
4765 C "C3'" . DA  D 12  ? 1.0906 1.0980 1.0277 0.0000 0.0000 0.0000 12  DA  D "C3'" 
4766 O "O3'" . DA  D 12  ? 1.1399 1.1085 1.0348 0.0000 0.0000 0.0000 12  DA  D "O3'" 
4767 C "C2'" . DA  D 12  ? 1.0518 1.0895 1.0140 0.0000 0.0000 0.0000 12  DA  D "C2'" 
4768 C "C1'" . DA  D 12  ? 1.0256 1.0805 1.0026 0.0000 0.0000 0.0000 12  DA  D "C1'" 
4769 N N9    . DA  D 12  ? 0.9868 1.0759 0.9959 0.0000 0.0000 0.0000 12  DA  D N9    
4770 C C8    . DA  D 12  ? 0.9816 1.0949 1.0173 0.0000 0.0000 0.0000 12  DA  D C8    
4771 N N7    . DA  D 12  ? 0.9650 1.0985 1.0177 0.0000 0.0000 0.0000 12  DA  D N7    
4772 C C5    . DA  D 12  ? 0.9402 1.0658 0.9815 0.0000 0.0000 0.0000 12  DA  D C5    
4773 C C6    . DA  D 12  ? 0.9072 1.0438 0.9573 0.0000 0.0000 0.0000 12  DA  D C6    
4774 N N6    . DA  D 12  ? 0.8759 1.0285 0.9400 0.0000 0.0000 0.0000 12  DA  D N6    
4775 N N1    . DA  D 12  ? 0.9100 1.0379 0.9534 0.0000 0.0000 0.0000 12  DA  D N1    
4776 C C2    . DA  D 12  ? 0.9463 1.0524 0.9704 0.0000 0.0000 0.0000 12  DA  D C2    
4777 N N3    . DA  D 12  ? 0.9795 1.0670 0.9849 0.0000 0.0000 0.0000 12  DA  D N3    
4778 C C4    . DA  D 12  ? 0.9678 1.0680 0.9850 0.0000 0.0000 0.0000 12  DA  D C4    
4779 P P     . DT  D 13  ? 1.2094 1.1337 1.0582 0.0000 0.0000 0.0000 13  DT  D P     
4780 O OP1   . DT  D 13  ? 1.2439 1.1207 1.0464 0.0000 0.0000 0.0000 13  DT  D OP1   
4781 O OP2   . DT  D 13  ? 1.2064 1.1308 1.0567 0.0000 0.0000 0.0000 13  DT  D OP2   
4782 O "O5'" . DT  D 13  ? 1.1753 1.1159 1.0377 0.0000 0.0000 0.0000 13  DT  D "O5'" 
4783 C "C5'" . DT  D 13  ? 1.1509 1.0868 1.0106 0.0000 0.0000 0.0000 13  DT  D "C5'" 
4784 C "C4'" . DT  D 13  ? 1.1084 1.0676 0.9941 0.0000 0.0000 0.0000 13  DT  D "C4'" 
4785 O "O4'" . DT  D 13  ? 1.0642 1.0695 0.9929 0.0000 0.0000 0.0000 13  DT  D "O4'" 
4786 C "C3'" . DT  D 13  ? 1.1144 1.0557 0.9834 0.0000 0.0000 0.0000 13  DT  D "C3'" 
4787 O "O3'" . DT  D 13  ? 1.1149 1.0410 0.9781 0.0000 0.0000 0.0000 13  DT  D "O3'" 
4788 C "C2'" . DT  D 13  ? 1.0818 1.0633 0.9878 0.0000 0.0000 0.0000 13  DT  D "C2'" 
4789 C "C1'" . DT  D 13  ? 1.0475 1.0641 0.9890 0.0000 0.0000 0.0000 13  DT  D "C1'" 
4790 N N1    . DT  D 13  ? 1.0124 1.0653 0.9857 0.0000 0.0000 0.0000 13  DT  D N1    
4791 C C2    . DT  D 13  ? 0.9941 1.0712 0.9938 0.0000 0.0000 0.0000 13  DT  D C2    
4792 O O2    . DT  D 13  ? 1.0005 1.0753 1.0053 0.0000 0.0000 0.0000 13  DT  D O2    
4793 N N3    . DT  D 13  ? 0.9812 1.0831 1.0011 0.0000 0.0000 0.0000 13  DT  D N3    
4794 C C4    . DT  D 13  ? 0.9742 1.0827 0.9967 0.0000 0.0000 0.0000 13  DT  D C4    
4795 O O4    . DT  D 13  ? 0.9673 1.0951 1.0070 0.0000 0.0000 0.0000 13  DT  D O4    
4796 C C5    . DT  D 13  ? 0.9837 1.0720 0.9868 0.0000 0.0000 0.0000 13  DT  D C5    
4797 C C7    . DT  D 13  ? 0.9910 1.0887 1.0048 0.0000 0.0000 0.0000 13  DT  D C7    
4798 C C6    . DT  D 13  ? 1.0080 1.0674 0.9842 0.0000 0.0000 0.0000 13  DT  D C6    
4799 P P     . DG  D 14  ? 1.1385 1.0203 0.9627 0.0000 0.0000 0.0000 14  DG  D P     
4800 O OP1   . DG  D 14  ? 1.1768 1.0167 0.9675 0.0000 0.0000 0.0000 14  DG  D OP1   
4801 O OP2   . DG  D 14  ? 1.1466 1.0131 0.9463 0.0000 0.0000 0.0000 14  DG  D OP2   
4802 O "O5'" . DG  D 14  ? 1.1134 1.0247 0.9768 0.0000 0.0000 0.0000 14  DG  D "O5'" 
4803 C "C5'" . DG  D 14  ? 1.0857 1.0320 0.9938 0.0000 0.0000 0.0000 14  DG  D "C5'" 
4804 C "C4'" . DG  D 14  ? 1.0593 1.0409 1.0069 0.0000 0.0000 0.0000 14  DG  D "C4'" 
4805 O "O4'" . DG  D 14  ? 1.0373 1.0487 1.0001 0.0000 0.0000 0.0000 14  DG  D "O4'" 
4806 C "C3'" . DG  D 14  ? 1.0799 1.0442 1.0149 0.0000 0.0000 0.0000 14  DG  D "C3'" 
4807 O "O3'" . DG  D 14  ? 1.0817 1.0681 1.0555 0.0000 0.0000 0.0000 14  DG  D "O3'" 
4808 C "C2'" . DG  D 14  ? 1.0740 1.0506 1.0043 0.0000 0.0000 0.0000 14  DG  D "C2'" 
4809 C "C1'" . DG  D 14  ? 1.0418 1.0590 1.0079 0.0000 0.0000 0.0000 14  DG  D "C1'" 
4810 N N9    . DG  D 14  ? 1.0348 1.0667 1.0011 0.0000 0.0000 0.0000 14  DG  D N9    
4811 C C8    . DG  D 14  ? 1.0503 1.0653 0.9914 0.0000 0.0000 0.0000 14  DG  D C8    
4812 N N7    . DG  D 14  ? 1.0351 1.0725 0.9918 0.0000 0.0000 0.0000 14  DG  D N7    
4813 C C5    . DG  D 14  ? 1.0126 1.0787 0.9988 0.0000 0.0000 0.0000 14  DG  D C5    
4814 C C6    . DG  D 14  ? 0.9957 1.0881 1.0033 0.0000 0.0000 0.0000 14  DG  D C6    
4815 O O6    . DG  D 14  ? 0.9909 1.0913 1.0028 0.0000 0.0000 0.0000 14  DG  D O6    
4816 N N1    . DG  D 14  ? 0.9890 1.0970 1.0148 0.0000 0.0000 0.0000 14  DG  D N1    
4817 C C2    . DG  D 14  ? 0.9903 1.0950 1.0223 0.0000 0.0000 0.0000 14  DG  D C2    
4818 N N2    . DG  D 14  ? 0.9871 1.1076 1.0385 0.0000 0.0000 0.0000 14  DG  D N2    
4819 N N3    . DG  D 14  ? 1.0033 1.0880 1.0231 0.0000 0.0000 0.0000 14  DG  D N3    
4820 C C4    . DG  D 14  ? 1.0131 1.0767 1.0061 0.0000 0.0000 0.0000 14  DG  D C4    
4821 P P     . DA  D 15  ? 1.1160 1.0773 1.0860 0.0000 0.0000 0.0000 15  DA  D P     
4822 O OP1   . DA  D 15  ? 1.1271 1.0830 1.1131 0.0000 0.0000 0.0000 15  DA  D OP1   
4823 O OP2   . DA  D 15  ? 1.1387 1.0616 1.0587 0.0000 0.0000 0.0000 15  DA  D OP2   
4824 O "O5'" . DA  D 15  ? 1.0831 1.0748 1.0939 0.0000 0.0000 0.0000 15  DA  D "O5'" 
4825 C "C5'" . DA  D 15  ? 1.0456 1.0751 1.1058 0.0000 0.0000 0.0000 15  DA  D "C5'" 
4826 C "C4'" . DA  D 15  ? 1.0171 1.0654 1.0874 0.0000 0.0000 0.0000 15  DA  D "C4'" 
4827 O "O4'" . DA  D 15  ? 1.0172 1.0681 1.0620 0.0000 0.0000 0.0000 15  DA  D "O4'" 
4828 C "C3'" . DA  D 15  ? 1.0289 1.0567 1.0848 0.0000 0.0000 0.0000 15  DA  D "C3'" 
4829 O "O3'" . DA  D 15  ? 1.0193 1.0657 1.1093 0.0000 0.0000 0.0000 15  DA  D "O3'" 
4830 C "C2'" . DA  D 15  ? 1.0434 1.0585 1.0584 0.0000 0.0000 0.0000 15  DA  D "C2'" 
4831 C "C1'" . DA  D 15  ? 1.0259 1.0696 1.0539 0.0000 0.0000 0.0000 15  DA  D "C1'" 
4832 N N9    . DA  D 15  ? 1.0348 1.0745 1.0361 0.0000 0.0000 0.0000 15  DA  D N9    
4833 C C8    . DA  D 15  ? 1.0664 1.0800 1.0331 0.0000 0.0000 0.0000 15  DA  D C8    
4834 N N7    . DA  D 15  ? 1.0571 1.0779 1.0155 0.0000 0.0000 0.0000 15  DA  D N7    
4835 C C5    . DA  D 15  ? 1.0238 1.0754 1.0101 0.0000 0.0000 0.0000 15  DA  D C5    
4836 C C6    . DA  D 15  ? 0.9956 1.0666 0.9903 0.0000 0.0000 0.0000 15  DA  D C6    
4837 N N6    . DA  D 15  ? 0.9989 1.0671 0.9832 0.0000 0.0000 0.0000 15  DA  D N6    
4838 N N1    . DA  D 15  ? 0.9762 1.0674 0.9910 0.0000 0.0000 0.0000 15  DA  D N1    
4839 C C2    . DA  D 15  ? 0.9845 1.0786 1.0133 0.0000 0.0000 0.0000 15  DA  D C2    
4840 N N3    . DA  D 15  ? 0.9972 1.0801 1.0292 0.0000 0.0000 0.0000 15  DA  D N3    
4841 C C4    . DA  D 15  ? 1.0181 1.0790 1.0269 0.0000 0.0000 0.0000 15  DA  D C4    
4842 P P     . DC  D 16  ? 1.0588 1.0864 1.1511 0.0000 0.0000 0.0000 16  DC  D P     
4843 O OP1   . DC  D 16  ? 1.0537 1.0950 1.1974 0.0000 0.0000 0.0000 16  DC  D OP1   
4844 O OP2   . DC  D 16  ? 1.0768 1.0661 1.1201 0.0000 0.0000 0.0000 16  DC  D OP2   
4845 O "O5'" . DC  D 16  ? 1.0474 1.0842 1.1382 0.0000 0.0000 0.0000 16  DC  D "O5'" 
4846 C "C5'" . DC  D 16  ? 1.0034 1.0668 1.1206 0.0000 0.0000 0.0000 16  DC  D "C5'" 
4847 C "C4'" . DC  D 16  ? 0.9921 1.0505 1.0790 0.0000 0.0000 0.0000 16  DC  D "C4'" 
4848 O "O4'" . DC  D 16  ? 0.9817 1.0427 1.0449 0.0000 0.0000 0.0000 16  DC  D "O4'" 
4849 C "C3'" . DC  D 16  ? 1.0105 1.0419 1.0670 0.0000 0.0000 0.0000 16  DC  D "C3'" 
4850 O "O3'" . DC  D 16  ? 1.0211 1.0495 1.0917 0.0000 0.0000 0.0000 16  DC  D "O3'" 
4851 C "C2'" . DC  D 16  ? 1.0103 1.0387 1.0331 0.0000 0.0000 0.0000 16  DC  D "C2'" 
4852 C "C1'" . DC  D 16  ? 0.9919 1.0414 1.0243 0.0000 0.0000 0.0000 16  DC  D "C1'" 
4853 N N1    . DC  D 16  ? 1.0032 1.0448 1.0105 0.0000 0.0000 0.0000 16  DC  D N1    
4854 C C2    . DC  D 16  ? 0.9882 1.0435 0.9908 0.0000 0.0000 0.0000 16  DC  D C2    
4855 O O2    . DC  D 16  ? 0.9750 1.0450 0.9883 0.0000 0.0000 0.0000 16  DC  D O2    
4856 N N3    . DC  D 16  ? 0.9784 1.0273 0.9637 0.0000 0.0000 0.0000 16  DC  D N3    
4857 C C4    . DC  D 16  ? 0.9911 1.0162 0.9565 0.0000 0.0000 0.0000 16  DC  D C4    
4858 N N4    . DC  D 16  ? 0.9968 1.0129 0.9434 0.0000 0.0000 0.0000 16  DC  D N4    
4859 C C5    . DC  D 16  ? 1.0139 1.0205 0.9772 0.0000 0.0000 0.0000 16  DC  D C5    
4860 C C6    . DC  D 16  ? 1.0127 1.0310 1.0015 0.0000 0.0000 0.0000 16  DC  D C6    
4861 P P     . DA  D 17  ? 1.0423 1.0548 1.1293 0.0000 0.0000 0.0000 17  DA  D P     
4862 O OP1   . DA  D 17  ? 1.0560 1.0590 1.1421 0.0000 0.0000 0.0000 17  DA  D OP1   
4863 O OP2   . DA  D 17  ? 1.0150 1.0448 1.1467 0.0000 0.0000 0.0000 17  DA  D OP2   
4864 O "O5'" . DA  D 17  ? 1.0739 1.0552 1.1166 0.0000 0.0000 0.0000 17  DA  D "O5'" 
4865 C "C5'" . DA  D 17  ? 1.1206 1.0750 1.1282 0.0000 0.0000 0.0000 17  DA  D "C5'" 
4866 C "C4'" . DA  D 17  ? 1.1288 1.0857 1.1056 0.0000 0.0000 0.0000 17  DA  D "C4'" 
4867 O "O4'" . DA  D 17  ? 1.1172 1.0774 1.0792 0.0000 0.0000 0.0000 17  DA  D "O4'" 
4868 C "C3'" . DA  D 17  ? 1.1705 1.0989 1.1070 0.0000 0.0000 0.0000 17  DA  D "C3'" 
4869 O "O3'" . DA  D 17  ? 1.1925 1.1243 1.1287 0.0000 0.0000 0.0000 17  DA  D "O3'" 
4870 C "C2'" . DA  D 17  ? 1.1660 1.0914 1.0733 0.0000 0.0000 0.0000 17  DA  D "C2'" 
4871 C "C1'" . DA  D 17  ? 1.1284 1.0851 1.0631 0.0000 0.0000 0.0000 17  DA  D "C1'" 
4872 N N9    . DA  D 17  ? 1.1379 1.0936 1.0552 0.0000 0.0000 0.0000 17  DA  D N9    
4873 C C8    . DA  D 17  ? 1.1689 1.0980 1.0590 0.0000 0.0000 0.0000 17  DA  D C8    
4874 N N7    . DA  D 17  ? 1.1740 1.1061 1.0525 0.0000 0.0000 0.0000 17  DA  D N7    
4875 C C5    . DA  D 17  ? 1.1395 1.1048 1.0425 0.0000 0.0000 0.0000 17  DA  D C5    
4876 C C6    . DA  D 17  ? 1.1238 1.1083 1.0336 0.0000 0.0000 0.0000 17  DA  D C6    
4877 N N6    . DA  D 17  ? 1.1343 1.1084 1.0280 0.0000 0.0000 0.0000 17  DA  D N6    
4878 N N1    . DA  D 17  ? 1.1035 1.1153 1.0364 0.0000 0.0000 0.0000 17  DA  D N1    
4879 C C2    . DA  D 17  ? 1.0993 1.1157 1.0431 0.0000 0.0000 0.0000 17  DA  D C2    
4880 N N3    . DA  D 17  ? 1.1096 1.1109 1.0511 0.0000 0.0000 0.0000 17  DA  D N3    
4881 C C4    . DA  D 17  ? 1.1275 1.1050 1.0506 0.0000 0.0000 0.0000 17  DA  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   ?   ?   ?   A . n 
A 1 12  ASP 12  9   ?   ?   ?   A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 ASN 227 224 224 ASN ASN A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1 343 PRO 343 340 340 PRO PRO A . n 
A 1 344 SER 344 341 341 SER SER A . n 
A 1 345 THR 345 342 342 THR THR A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 LYS 348 345 345 LYS LYS A . n 
A 1 349 VAL 349 346 346 VAL VAL A . n 
A 1 350 LEU 350 347 347 LEU LEU A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 PRO 352 349 349 PRO PRO A . n 
A 1 353 ARG 353 350 350 ARG ARG A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 VAL 356 353 353 VAL VAL A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 HIS 360 357 357 HIS HIS A . n 
A 1 361 LEU 361 358 358 LEU LEU A . n 
A 1 362 GLY 362 359 359 GLY GLY A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 ASN 364 361 361 ASN ASN A . n 
A 1 365 ARG 365 362 362 ARG ARG A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 VAL 367 364 364 VAL VAL A . n 
A 1 368 SER 368 365 365 SER SER A . n 
A 1 369 ILE 369 366 366 ILE ILE A . n 
A 1 370 ASP 370 367 367 ASP ASP A . n 
A 1 371 ASN 371 368 368 ASN ASN A . n 
A 1 372 LEU 372 369 369 LEU LEU A . n 
A 1 373 LYS 373 370 370 LYS LYS A . n 
A 1 374 PRO 374 371 371 PRO PRO A . n 
A 1 375 THR 375 372 372 THR THR A . n 
A 1 376 SER 376 373 373 SER SER A . n 
A 1 377 HIS 377 374 374 HIS HIS A . n 
A 1 378 GLN 378 375 ?   ?   ?   A . n 
A 1 379 ASN 379 376 ?   ?   ?   A . n 
A 1 380 GLY 380 377 ?   ?   ?   A . n 
A 1 381 THR 381 378 ?   ?   ?   A . n 
A 1 382 THR 382 379 ?   ?   ?   A . n 
A 1 383 ASN 383 380 ?   ?   ?   A . n 
A 1 384 ASP 384 381 ?   ?   ?   A . n 
A 1 385 THR 385 382 ?   ?   ?   A . n 
A 1 386 ALA 386 383 ?   ?   ?   A . n 
A 1 387 THR 387 384 ?   ?   ?   A . n 
A 1 388 MET 388 385 ?   ?   ?   A . n 
A 1 389 ASP 389 386 ?   ?   ?   A . n 
A 1 390 HIS 390 387 ?   ?   ?   A . n 
A 1 391 LEU 391 388 ?   ?   ?   A . n 
A 1 392 GLU 392 389 ?   ?   ?   A . n 
A 1 393 LYS 393 390 ?   ?   ?   A . n 
A 1 394 ASN 394 391 ?   ?   ?   A . n 
A 1 395 GLU 395 392 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   GLY 3   0   ?   ?   ?   B . n 
B 1 4   CYS 4   1   ?   ?   ?   B . n 
B 1 5   ASN 5   2   ?   ?   ?   B . n 
B 1 6   THR 6   3   ?   ?   ?   B . n 
B 1 7   LYS 7   4   ?   ?   ?   B . n 
B 1 8   LYS 8   5   ?   ?   ?   B . n 
B 1 9   PRO 9   6   ?   ?   ?   B . n 
B 1 10  ASN 10  7   ?   ?   ?   B . n 
B 1 11  LEU 11  8   ?   ?   ?   B . n 
B 1 12  ASP 12  9   ?   ?   ?   B . n 
B 1 13  ALA 13  10  ?   ?   ?   B . n 
B 1 14  GLU 14  11  ?   ?   ?   B . n 
B 1 15  LEU 15  12  ?   ?   ?   B . n 
B 1 16  ASP 16  13  ?   ?   ?   B . n 
B 1 17  GLN 17  14  ?   ?   ?   B . n 
B 1 18  LEU 18  15  ?   ?   ?   B . n 
B 1 19  LEU 19  16  ?   ?   ?   B . n 
B 1 20  GLN 20  17  ?   ?   ?   B . n 
B 1 21  GLY 21  18  ?   ?   ?   B . n 
B 1 22  HIS 22  19  ?   ?   ?   B . n 
B 1 23  TYR 23  20  ?   ?   ?   B . n 
B 1 24  ILE 24  21  ?   ?   ?   B . n 
B 1 25  LYS 25  22  ?   ?   ?   B . n 
B 1 26  GLY 26  23  ?   ?   ?   B . n 
B 1 27  TYR 27  24  ?   ?   ?   B . n 
B 1 28  PRO 28  25  ?   ?   ?   B . n 
B 1 29  LYS 29  26  ?   ?   ?   B . n 
B 1 30  GLN 30  27  ?   ?   ?   B . n 
B 1 31  TYR 31  28  ?   ?   ?   B . n 
B 1 32  THR 32  29  ?   ?   ?   B . n 
B 1 33  TYR 33  30  ?   ?   ?   B . n 
B 1 34  PHE 34  31  ?   ?   ?   B . n 
B 1 35  LEU 35  32  ?   ?   ?   B . n 
B 1 36  GLU 36  33  ?   ?   ?   B . n 
B 1 37  ASP 37  34  ?   ?   ?   B . n 
B 1 38  GLY 38  35  ?   ?   ?   B . n 
B 1 39  LYS 39  36  ?   ?   ?   B . n 
B 1 40  VAL 40  37  ?   ?   ?   B . n 
B 1 41  LYS 41  38  ?   ?   ?   B . n 
B 1 42  VAL 42  39  ?   ?   ?   B . n 
B 1 43  SER 43  40  ?   ?   ?   B . n 
B 1 44  ARG 44  41  ?   ?   ?   B . n 
B 1 45  PRO 45  42  ?   ?   ?   B . n 
B 1 46  GLU 46  43  ?   ?   ?   B . n 
B 1 47  GLY 47  44  ?   ?   ?   B . n 
B 1 48  VAL 48  45  ?   ?   ?   B . n 
B 1 49  LYS 49  46  ?   ?   ?   B . n 
B 1 50  ILE 50  47  ?   ?   ?   B . n 
B 1 51  ILE 51  48  ?   ?   ?   B . n 
B 1 52  PRO 52  49  ?   ?   ?   B . n 
B 1 53  PRO 53  50  ?   ?   ?   B . n 
B 1 54  GLN 54  51  ?   ?   ?   B . n 
B 1 55  SER 55  52  ?   ?   ?   B . n 
B 1 56  ASP 56  53  ?   ?   ?   B . n 
B 1 57  ARG 57  54  ?   ?   ?   B . n 
B 1 58  GLN 58  55  ?   ?   ?   B . n 
B 1 59  LYS 59  56  ?   ?   ?   B . n 
B 1 60  ILE 60  57  ?   ?   ?   B . n 
B 1 61  VAL 61  58  ?   ?   ?   B . n 
B 1 62  LEU 62  59  ?   ?   ?   B . n 
B 1 63  GLN 63  60  ?   ?   ?   B . n 
B 1 64  ALA 64  61  ?   ?   ?   B . n 
B 1 65  HIS 65  62  ?   ?   ?   B . n 
B 1 66  ASN 66  63  ?   ?   ?   B . n 
B 1 67  LEU 67  64  ?   ?   ?   B . n 
B 1 68  ALA 68  65  ?   ?   ?   B . n 
B 1 69  HIS 69  66  ?   ?   ?   B . n 
B 1 70  THR 70  67  ?   ?   ?   B . n 
B 1 71  GLY 71  68  ?   ?   ?   B . n 
B 1 72  ARG 72  69  ?   ?   ?   B . n 
B 1 73  GLU 73  70  ?   ?   ?   B . n 
B 1 74  ALA 74  71  ?   ?   ?   B . n 
B 1 75  THR 75  72  ?   ?   ?   B . n 
B 1 76  LEU 76  73  ?   ?   ?   B . n 
B 1 77  LEU 77  74  ?   ?   ?   B . n 
B 1 78  LYS 78  75  ?   ?   ?   B . n 
B 1 79  ILE 79  76  ?   ?   ?   B . n 
B 1 80  ALA 80  77  ?   ?   ?   B . n 
B 1 81  ASN 81  78  ?   ?   ?   B . n 
B 1 82  LEU 82  79  ?   ?   ?   B . n 
B 1 83  TYR 83  80  ?   ?   ?   B . n 
B 1 84  TRP 84  81  ?   ?   ?   B . n 
B 1 85  TRP 85  82  ?   ?   ?   B . n 
B 1 86  PRO 86  83  ?   ?   ?   B . n 
B 1 87  ASN 87  84  ?   ?   ?   B . n 
B 1 88  MET 88  85  ?   ?   ?   B . n 
B 1 89  ARG 89  86  ?   ?   ?   B . n 
B 1 90  LYS 90  87  ?   ?   ?   B . n 
B 1 91  ASP 91  88  ?   ?   ?   B . n 
B 1 92  VAL 92  89  ?   ?   ?   B . n 
B 1 93  VAL 93  90  ?   ?   ?   B . n 
B 1 94  LYS 94  91  ?   ?   ?   B . n 
B 1 95  GLN 95  92  ?   ?   ?   B . n 
B 1 96  LEU 96  93  ?   ?   ?   B . n 
B 1 97  GLY 97  94  ?   ?   ?   B . n 
B 1 98  ARG 98  95  ?   ?   ?   B . n 
B 1 99  CYS 99  96  ?   ?   ?   B . n 
B 1 100 GLN 100 97  ?   ?   ?   B . n 
B 1 101 GLN 101 98  ?   ?   ?   B . n 
B 1 102 CYS 102 99  ?   ?   ?   B . n 
B 1 103 LEU 103 100 ?   ?   ?   B . n 
B 1 104 ILE 104 101 ?   ?   ?   B . n 
B 1 105 THR 105 102 ?   ?   ?   B . n 
B 1 106 ASN 106 103 ?   ?   ?   B . n 
B 1 107 ALA 107 104 ?   ?   ?   B . n 
B 1 108 SER 108 105 ?   ?   ?   B . n 
B 1 109 ASN 109 106 ?   ?   ?   B . n 
B 1 110 LYS 110 107 ?   ?   ?   B . n 
B 1 111 ALA 111 108 ?   ?   ?   B . n 
B 1 112 SER 112 109 ?   ?   ?   B . n 
B 1 113 GLY 113 110 ?   ?   ?   B . n 
B 1 114 PRO 114 111 ?   ?   ?   B . n 
B 1 115 ILE 115 112 ?   ?   ?   B . n 
B 1 116 LEU 116 113 ?   ?   ?   B . n 
B 1 117 ARG 117 114 ?   ?   ?   B . n 
B 1 118 PRO 118 115 ?   ?   ?   B . n 
B 1 119 ASP 119 116 116 ASP ASP B . n 
B 1 120 ARG 120 117 117 ARG ARG B . n 
B 1 121 PRO 121 118 118 PRO PRO B . n 
B 1 122 GLN 122 119 119 GLN GLN B . n 
B 1 123 LYS 123 120 120 LYS LYS B . n 
B 1 124 PRO 124 121 121 PRO PRO B . n 
B 1 125 PHE 125 122 122 PHE PHE B . n 
B 1 126 ASP 126 123 123 ASP ASP B . n 
B 1 127 LYS 127 124 124 LYS LYS B . n 
B 1 128 PHE 128 125 125 PHE PHE B . n 
B 1 129 PHE 129 126 126 PHE PHE B . n 
B 1 130 ILE 130 127 127 ILE ILE B . n 
B 1 131 ASP 131 128 128 ASP ASP B . n 
B 1 132 TYR 132 129 129 TYR TYR B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 PRO 135 132 132 PRO PRO B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 PRO 137 134 134 PRO PRO B . n 
B 1 138 PRO 138 135 135 PRO PRO B . n 
B 1 139 SER 139 136 136 SER SER B . n 
B 1 140 GLN 140 137 137 GLN GLN B . n 
B 1 141 GLY 141 138 138 GLY GLY B . n 
B 1 142 TYR 142 139 139 TYR TYR B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 TYR 144 141 141 TYR TYR B . n 
B 1 145 VAL 145 142 142 VAL VAL B . n 
B 1 146 LEU 146 143 143 LEU LEU B . n 
B 1 147 VAL 147 144 144 VAL VAL B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 VAL 149 146 146 VAL VAL B . n 
B 1 150 ASP 150 147 147 ASP ASP B . n 
B 1 151 GLY 151 148 148 GLY GLY B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 THR 153 150 150 THR THR B . n 
B 1 154 GLY 154 151 151 GLY GLY B . n 
B 1 155 PHE 155 152 152 PHE PHE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 TRP 157 154 154 TRP TRP B . n 
B 1 158 LEU 158 155 155 LEU LEU B . n 
B 1 159 TYR 159 156 156 TYR TYR B . n 
B 1 160 PRO 160 157 157 PRO PRO B . n 
B 1 161 THR 161 158 158 THR THR B . n 
B 1 162 LYS 162 159 159 LYS LYS B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 PRO 164 161 161 PRO PRO B . n 
B 1 165 SER 165 162 162 SER SER B . n 
B 1 166 THR 166 163 163 THR THR B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ALA 168 165 165 ALA ALA B . n 
B 1 169 THR 169 166 166 THR THR B . n 
B 1 170 VAL 170 167 167 VAL VAL B . n 
B 1 171 LYS 171 168 168 LYS LYS B . n 
B 1 172 SER 172 169 169 SER SER B . n 
B 1 173 LEU 173 170 170 LEU LEU B . n 
B 1 174 ASN 174 171 171 ASN ASN B . n 
B 1 175 VAL 175 172 172 VAL VAL B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 THR 177 174 174 THR THR B . n 
B 1 178 SER 178 175 175 SER SER B . n 
B 1 179 ILE 179 176 176 ILE ILE B . n 
B 1 180 ALA 180 177 177 ALA ALA B . n 
B 1 181 ILE 181 178 178 ILE ILE B . n 
B 1 182 PRO 182 179 179 PRO PRO B . n 
B 1 183 LYS 183 180 180 LYS LYS B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 HIS 186 183 183 HIS HIS B . n 
B 1 187 SER 187 184 184 SER SER B . n 
B 1 188 ASP 188 185 185 ASP ASP B . n 
B 1 189 GLN 189 186 186 GLN GLN B . n 
B 1 190 GLY 190 187 187 GLY GLY B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 THR 194 191 191 THR THR B . n 
B 1 195 SER 195 192 192 SER SER B . n 
B 1 196 SER 196 193 193 SER SER B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 PHE 198 195 195 PHE PHE B . n 
B 1 199 ALA 199 196 196 ALA ALA B . n 
B 1 200 GLU 200 197 197 GLU GLU B . n 
B 1 201 TRP 201 198 198 TRP TRP B . n 
B 1 202 ALA 202 199 199 ALA ALA B . n 
B 1 203 LYS 203 200 200 LYS LYS B . n 
B 1 204 GLU 204 201 201 GLU GLU B . n 
B 1 205 ARG 205 202 202 ARG ARG B . n 
B 1 206 GLY 206 203 203 GLY GLY B . n 
B 1 207 ILE 207 204 204 ILE ILE B . n 
B 1 208 HIS 208 205 205 HIS HIS B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLU 210 207 207 GLU GLU B . n 
B 1 211 PHE 211 208 208 PHE PHE B . n 
B 1 212 SER 212 209 209 SER SER B . n 
B 1 213 THR 213 210 210 THR THR B . n 
B 1 214 PRO 214 211 211 PRO PRO B . n 
B 1 215 TYR 215 212 212 TYR TYR B . n 
B 1 216 HIS 216 213 213 HIS HIS B . n 
B 1 217 PRO 217 214 214 PRO PRO B . n 
B 1 218 GLN 218 215 215 GLN GLN B . n 
B 1 219 SER 219 216 216 SER SER B . n 
B 1 220 SER 220 217 217 SER SER B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 LYS 222 219 219 LYS LYS B . n 
B 1 223 VAL 223 220 220 VAL VAL B . n 
B 1 224 GLU 224 221 221 GLU GLU B . n 
B 1 225 ARG 225 222 222 ARG ARG B . n 
B 1 226 LYS 226 223 223 LYS LYS B . n 
B 1 227 ASN 227 224 224 ASN ASN B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 ILE 230 227 227 ILE ILE B . n 
B 1 231 LYS 231 228 228 LYS LYS B . n 
B 1 232 ARG 232 229 229 ARG ARG B . n 
B 1 233 LEU 233 230 230 LEU LEU B . n 
B 1 234 LEU 234 231 231 LEU LEU B . n 
B 1 235 THR 235 232 232 THR THR B . n 
B 1 236 LYS 236 233 233 LYS LYS B . n 
B 1 237 LEU 237 234 234 LEU LEU B . n 
B 1 238 LEU 238 235 235 LEU LEU B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 GLY 240 237 237 GLY GLY B . n 
B 1 241 ARG 241 238 238 ARG ARG B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 THR 243 240 240 THR THR B . n 
B 1 244 LYS 244 241 241 LYS LYS B . n 
B 1 245 TRP 245 242 242 TRP TRP B . n 
B 1 246 TYR 246 243 243 TYR TYR B . n 
B 1 247 ASP 247 244 244 ASP ASP B . n 
B 1 248 LEU 248 245 245 LEU LEU B . n 
B 1 249 LEU 249 246 246 LEU LEU B . n 
B 1 250 PRO 250 247 247 PRO PRO B . n 
B 1 251 VAL 251 248 248 VAL VAL B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 ASN 257 254 254 ASN ASN B . n 
B 1 258 ASN 258 255 255 ASN ASN B . n 
B 1 259 THR 259 256 256 THR THR B . n 
B 1 260 TYR 260 257 257 TYR TYR B . n 
B 1 261 SER 261 258 258 SER SER B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 VAL 263 260 260 VAL VAL B . n 
B 1 264 LEU 264 261 261 LEU LEU B . n 
B 1 265 LYS 265 262 262 LYS LYS B . n 
B 1 266 TYR 266 263 263 TYR TYR B . n 
B 1 267 THR 267 264 264 THR THR B . n 
B 1 268 PRO 268 265 265 PRO PRO B . n 
B 1 269 HIS 269 266 266 HIS HIS B . n 
B 1 270 GLN 270 267 267 GLN GLN B . n 
B 1 271 LEU 271 268 268 LEU LEU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 PHE 273 270 270 PHE PHE B . n 
B 1 274 GLY 274 271 271 GLY GLY B . n 
B 1 275 ILE 275 272 272 ILE ILE B . n 
B 1 276 ASP 276 273 273 ASP ASP B . n 
B 1 277 SER 277 274 274 SER SER B . n 
B 1 278 ASN 278 275 275 ASN ASN B . n 
B 1 279 THR 279 276 276 THR THR B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 PHE 281 278 278 PHE PHE B . n 
B 1 282 ALA 282 279 ?   ?   ?   B . n 
B 1 283 ASN 283 280 ?   ?   ?   B . n 
B 1 284 GLN 284 281 ?   ?   ?   B . n 
B 1 285 ASP 285 282 ?   ?   ?   B . n 
B 1 286 THR 286 283 ?   ?   ?   B . n 
B 1 287 LEU 287 284 ?   ?   ?   B . n 
B 1 288 ASP 288 285 ?   ?   ?   B . n 
B 1 289 LEU 289 286 ?   ?   ?   B . n 
B 1 290 THR 290 287 ?   ?   ?   B . n 
B 1 291 ARG 291 288 ?   ?   ?   B . n 
B 1 292 GLU 292 289 ?   ?   ?   B . n 
B 1 293 GLU 293 290 ?   ?   ?   B . n 
B 1 294 GLU 294 291 ?   ?   ?   B . n 
B 1 295 LEU 295 292 ?   ?   ?   B . n 
B 1 296 SER 296 293 ?   ?   ?   B . n 
B 1 297 LEU 297 294 ?   ?   ?   B . n 
B 1 298 LEU 298 295 ?   ?   ?   B . n 
B 1 299 GLN 299 296 ?   ?   ?   B . n 
B 1 300 GLU 300 297 ?   ?   ?   B . n 
B 1 301 ILE 301 298 ?   ?   ?   B . n 
B 1 302 ARG 302 299 ?   ?   ?   B . n 
B 1 303 THR 303 300 ?   ?   ?   B . n 
B 1 304 SER 304 301 ?   ?   ?   B . n 
B 1 305 LEU 305 302 ?   ?   ?   B . n 
B 1 306 TYR 306 303 ?   ?   ?   B . n 
B 1 307 HIS 307 304 ?   ?   ?   B . n 
B 1 308 PRO 308 305 ?   ?   ?   B . n 
B 1 309 SER 309 306 ?   ?   ?   B . n 
B 1 310 THR 310 307 ?   ?   ?   B . n 
B 1 311 PRO 311 308 ?   ?   ?   B . n 
B 1 312 PRO 312 309 ?   ?   ?   B . n 
B 1 313 ALA 313 310 ?   ?   ?   B . n 
B 1 314 SER 314 311 ?   ?   ?   B . n 
B 1 315 SER 315 312 ?   ?   ?   B . n 
B 1 316 ARG 316 313 ?   ?   ?   B . n 
B 1 317 SER 317 314 ?   ?   ?   B . n 
B 1 318 TRP 318 315 ?   ?   ?   B . n 
B 1 319 SER 319 316 ?   ?   ?   B . n 
B 1 320 PRO 320 317 ?   ?   ?   B . n 
B 1 321 VAL 321 318 ?   ?   ?   B . n 
B 1 322 VAL 322 319 ?   ?   ?   B . n 
B 1 323 GLY 323 320 ?   ?   ?   B . n 
B 1 324 GLN 324 321 ?   ?   ?   B . n 
B 1 325 LEU 325 322 ?   ?   ?   B . n 
B 1 326 VAL 326 323 ?   ?   ?   B . n 
B 1 327 GLN 327 324 ?   ?   ?   B . n 
B 1 328 GLU 328 325 ?   ?   ?   B . n 
B 1 329 ARG 329 326 ?   ?   ?   B . n 
B 1 330 VAL 330 327 ?   ?   ?   B . n 
B 1 331 ALA 331 328 ?   ?   ?   B . n 
B 1 332 ARG 332 329 ?   ?   ?   B . n 
B 1 333 PRO 333 330 ?   ?   ?   B . n 
B 1 334 ALA 334 331 ?   ?   ?   B . n 
B 1 335 SER 335 332 ?   ?   ?   B . n 
B 1 336 LEU 336 333 ?   ?   ?   B . n 
B 1 337 ARG 337 334 ?   ?   ?   B . n 
B 1 338 PRO 338 335 ?   ?   ?   B . n 
B 1 339 ARG 339 336 ?   ?   ?   B . n 
B 1 340 TRP 340 337 ?   ?   ?   B . n 
B 1 341 HIS 341 338 ?   ?   ?   B . n 
B 1 342 LYS 342 339 ?   ?   ?   B . n 
B 1 343 PRO 343 340 ?   ?   ?   B . n 
B 1 344 SER 344 341 ?   ?   ?   B . n 
B 1 345 THR 345 342 ?   ?   ?   B . n 
B 1 346 VAL 346 343 ?   ?   ?   B . n 
B 1 347 LEU 347 344 ?   ?   ?   B . n 
B 1 348 LYS 348 345 ?   ?   ?   B . n 
B 1 349 VAL 349 346 ?   ?   ?   B . n 
B 1 350 LEU 350 347 ?   ?   ?   B . n 
B 1 351 ASN 351 348 ?   ?   ?   B . n 
B 1 352 PRO 352 349 ?   ?   ?   B . n 
B 1 353 ARG 353 350 ?   ?   ?   B . n 
B 1 354 THR 354 351 ?   ?   ?   B . n 
B 1 355 VAL 355 352 ?   ?   ?   B . n 
B 1 356 VAL 356 353 ?   ?   ?   B . n 
B 1 357 ILE 357 354 ?   ?   ?   B . n 
B 1 358 LEU 358 355 ?   ?   ?   B . n 
B 1 359 ASP 359 356 ?   ?   ?   B . n 
B 1 360 HIS 360 357 ?   ?   ?   B . n 
B 1 361 LEU 361 358 ?   ?   ?   B . n 
B 1 362 GLY 362 359 ?   ?   ?   B . n 
B 1 363 ASN 363 360 ?   ?   ?   B . n 
B 1 364 ASN 364 361 ?   ?   ?   B . n 
B 1 365 ARG 365 362 ?   ?   ?   B . n 
B 1 366 THR 366 363 ?   ?   ?   B . n 
B 1 367 VAL 367 364 ?   ?   ?   B . n 
B 1 368 SER 368 365 ?   ?   ?   B . n 
B 1 369 ILE 369 366 ?   ?   ?   B . n 
B 1 370 ASP 370 367 ?   ?   ?   B . n 
B 1 371 ASN 371 368 ?   ?   ?   B . n 
B 1 372 LEU 372 369 ?   ?   ?   B . n 
B 1 373 LYS 373 370 ?   ?   ?   B . n 
B 1 374 PRO 374 371 ?   ?   ?   B . n 
B 1 375 THR 375 372 ?   ?   ?   B . n 
B 1 376 SER 376 373 ?   ?   ?   B . n 
B 1 377 HIS 377 374 ?   ?   ?   B . n 
B 1 378 GLN 378 375 ?   ?   ?   B . n 
B 1 379 ASN 379 376 ?   ?   ?   B . n 
B 1 380 GLY 380 377 ?   ?   ?   B . n 
B 1 381 THR 381 378 ?   ?   ?   B . n 
B 1 382 THR 382 379 ?   ?   ?   B . n 
B 1 383 ASN 383 380 ?   ?   ?   B . n 
B 1 384 ASP 384 381 ?   ?   ?   B . n 
B 1 385 THR 385 382 ?   ?   ?   B . n 
B 1 386 ALA 386 383 ?   ?   ?   B . n 
B 1 387 THR 387 384 ?   ?   ?   B . n 
B 1 388 MET 388 385 ?   ?   ?   B . n 
B 1 389 ASP 389 386 ?   ?   ?   B . n 
B 1 390 HIS 390 387 ?   ?   ?   B . n 
B 1 391 LEU 391 388 ?   ?   ?   B . n 
B 1 392 GLU 392 389 ?   ?   ?   B . n 
B 1 393 LYS 393 390 ?   ?   ?   B . n 
B 1 394 ASN 394 391 ?   ?   ?   B . n 
B 1 395 GLU 395 392 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  DA  C . n 
C 2 2   DT  2   2   2   DT  DT  C . n 
C 2 3   DT  3   3   3   DT  DT  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DT  5   5   5   DT  DT  C . n 
C 2 6   DC  6   6   6   DC  DC  C . n 
C 2 7   DA  7   7   7   DA  DA  C . n 
C 2 8   DT  8   8   8   DT  DT  C . n 
C 2 9   DG  9   9   9   DG  DG  C . n 
C 2 10  DG  10  10  10  DG  DG  C . n 
C 2 11  DA  11  11  11  DA  DA  C . n 
C 2 12  DA  12  12  12  DA  DA  C . n 
C 2 13  DT  13  13  13  DT  DT  C . n 
C 2 14  DT  14  14  14  DT  DT  C . n 
C 2 15  DT  15  15  15  DT  DT  C . n 
C 2 16  DT  16  16  16  DT  DT  C . n 
C 2 17  DG  17  17  17  DG  DG  C . n 
C 2 18  DT  18  18  18  DT  DT  C . n 
C 2 19  DA  19  19  19  DA  DA  C . n 
D 3 1   DT  1   1   1   DT  DT  D . n 
D 3 2   DA  2   2   2   DA  DA  D . n 
D 3 3   DC  3   3   3   DC  DC  D . n 
D 3 4   DA  4   4   4   DA  DA  D . n 
D 3 5   DA  5   5   5   DA  DA  D . n 
D 3 6   DA  6   6   6   DA  DA  D . n 
D 3 7   DA  7   7   7   DA  DA  D . n 
D 3 8   DT  8   8   8   DT  DT  D . n 
D 3 9   DT  9   9   9   DT  DT  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
D 3 11  DC  11  11  11  DC  DC  D . n 
D 3 12  DA  12  12  12  DA  DA  D . n 
D 3 13  DT  13  13  13  DT  DT  D . n 
D 3 14  DG  14  14  14  DG  DG  D . n 
D 3 15  DA  15  15  15  DA  DA  D . n 
D 3 16  DC  16  16  16  DC  DC  D . n 
D 3 17  DA  17  17  17  DA  DA  D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 23380 ? 
1 MORE         -130  ? 
1 'SSA (A^2)'  54030 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -62.3750000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 65  ? A HIS 62 ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 ND1 ? A HIS 69  ? A HIS 66 ? 1_555 112.6 ? 
2 NE2 ? A HIS 65  ? A HIS 62 ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99 ? 1_555 104.8 ? 
3 ND1 ? A HIS 69  ? A HIS 66 ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99 ? 1_555 109.6 ? 
4 NE2 ? A HIS 65  ? A HIS 62 ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96 ? 1_555 115.2 ? 
5 ND1 ? A HIS 69  ? A HIS 66 ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96 ? 1_555 105.7 ? 
6 SG  ? A CYS 102 ? A CYS 99 ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96 ? 1_555 108.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -67.9000 27.1310 -56.0860 0.2482 0.3540 0.2178 -0.0718 -0.0376 -0.0875 3.4672 1.0041 4.5422 1.0850 
3.2826  1.7511  0.2342  -0.0823 -0.0751 -0.0730 -0.4209 0.1473 0.1818  -0.5589 0.1867 
'X-RAY DIFFRACTION' 2 ? refined -35.3070 38.7820 -5.2580  0.1519 0.2515 0.0819 -0.0452 0.0608  0.0316  0.8882 2.1772 1.7036 0.0411 
0.3755  0.3052  -0.1067 -0.2656 -0.0552 0.0732  0.0715  0.0365 0.2909  -0.1067 0.0352 
'X-RAY DIFFRACTION' 3 ? refined -54.5180 27.1640 -27.6500 0.4143 0.3910 0.3870 -0.2516 0.1100  0.0224  2.4104 1.2749 7.5744 0.0658 
-0.9142 0.9387  -0.2191 -0.2959 -0.7371 0.2394  -0.2125 0.0516 1.2179  -0.1167 0.4316 
'X-RAY DIFFRACTION' 4 ? refined -24.5930 36.8690 15.5100  0.2436 0.4662 0.0288 0.0371  0.0830  0.0173  3.8848 1.6936 2.1246 
-0.6498 0.1434  -0.5822 -0.2057 -0.5154 -0.0945 0.3200  0.1550  0.1165 0.2281  -0.0125 0.0507 
'X-RAY DIFFRACTION' 5 ? refined -43.0170 61.1720 -15.3770 0.1425 0.2823 0.1988 -0.0802 -0.0205 -0.0217 0.1067 4.8170 1.7069 0.6281 
-0.1379 0.2201  0.0426  -0.0467 0.0434  0.0226  -0.0936 0.2588 -0.2298 -0.1224 0.0510 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 10  ? ? A 111 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 112 ? ? A 308 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 309 ? ? A 392 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 B 112 ? ? B 308 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 C 1   ? ? C 19  ? ? ? ? 
'X-RAY DIFFRACTION' 6 5 D 1   ? ? D 17  ? ? ? ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .       ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 
2 SCALA       3.3.9   2008/10/21      other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
3 PHASER      .       ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .       ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.005   'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 ADSC        Quantum ?               ?       ?                    ?                           'data collection' ? ?          ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            C 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_1             6 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            C 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_2             6 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.372 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.047 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DA 1  ? ? "C1'" C DA 1  ? ? N9    C DA 1  ? ? 111.98 108.30 3.68  0.30 N 
2  1 "O4'" C DG 4  ? ? "C1'" C DG 4  ? ? N9    C DG 4  ? ? 111.21 108.30 2.91  0.30 N 
3  1 "O4'" C DA 7  ? ? "C1'" C DA 7  ? ? N9    C DA 7  ? ? 102.78 108.00 -5.22 0.70 N 
4  1 "O5'" C DG 10 ? ? "C5'" C DG 10 ? ? "C4'" C DG 10 ? ? 104.30 109.40 -5.10 0.80 N 
5  1 "C3'" C DA 11 ? ? "O3'" C DA 11 ? ? P     C DA 12 ? ? 127.81 119.70 8.11  1.20 Y 
6  1 "O4'" D DT 1  ? ? "C1'" D DT 1  ? ? N1    D DT 1  ? ? 112.75 108.30 4.45  0.30 N 
7  1 "O4'" D DC 11 ? ? "C1'" D DC 11 ? ? N1    D DC 11 ? ? 110.12 108.30 1.82  0.30 N 
8  1 "O4'" D DA 12 ? ? "C1'" D DA 12 ? ? N9    D DA 12 ? ? 101.65 108.00 -6.35 0.70 N 
9  1 "C1'" D DA 17 ? ? "O4'" D DA 17 ? ? "C4'" D DA 17 ? ? 103.26 110.10 -6.84 1.00 N 
10 1 "O4'" D DA 17 ? ? "C1'" D DA 17 ? ? N9    D DA 17 ? ? 111.91 108.30 3.61  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 27  ? ? 99.28   -19.66  
2  1 ASP A 34  ? ? 56.15   19.58   
3  1 ALA A 65  ? ? -142.50 25.23   
4  1 PHE A 122 ? ? 77.66   -0.34   
5  1 GLN A 137 ? ? 47.82   25.50   
6  1 SER A 274 ? ? -72.14  -160.16 
7  1 ARG A 329 ? ? -114.79 75.36   
8  1 LEU A 333 ? ? 82.96   11.79   
9  1 ASP A 356 ? ? -98.87  -141.03 
10 1 LEU A 358 ? ? -167.02 100.90  
11 1 PHE B 122 ? ? 81.70   1.64    
12 1 GLN B 186 ? ? -84.03  38.97   
13 1 TYR B 212 ? ? 80.95   -39.14  
14 1 SER B 216 ? ? -117.72 -164.50 
15 1 LEU B 261 ? ? 79.61   -26.04  
16 1 LYS B 262 ? ? 37.11   57.26   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 22  ? CG  ? A LYS 25  CG  
2  1 Y 1 A LYS 22  ? CD  ? A LYS 25  CD  
3  1 Y 1 A LYS 22  ? CE  ? A LYS 25  CE  
4  1 Y 1 A LYS 22  ? NZ  ? A LYS 25  NZ  
5  1 Y 1 A GLU 43  ? CG  ? A GLU 46  CG  
6  1 Y 1 A GLU 43  ? CD  ? A GLU 46  CD  
7  1 Y 1 A GLU 43  ? OE1 ? A GLU 46  OE1 
8  1 Y 1 A GLU 43  ? OE2 ? A GLU 46  OE2 
9  1 Y 1 A LYS 87  ? CG  ? A LYS 90  CG  
10 1 Y 1 A LYS 87  ? CD  ? A LYS 90  CD  
11 1 Y 1 A LYS 87  ? CE  ? A LYS 90  CE  
12 1 Y 1 A LYS 87  ? NZ  ? A LYS 90  NZ  
13 1 Y 1 A LYS 91  ? CG  ? A LYS 94  CG  
14 1 Y 1 A LYS 91  ? CD  ? A LYS 94  CD  
15 1 Y 1 A LYS 91  ? CE  ? A LYS 94  CE  
16 1 Y 1 A LYS 91  ? NZ  ? A LYS 94  NZ  
17 1 Y 1 A ARG 329 ? CG  ? A ARG 332 CG  
18 1 Y 1 A ARG 329 ? CD  ? A ARG 332 CD  
19 1 Y 1 A ARG 329 ? NE  ? A ARG 332 NE  
20 1 Y 1 A ARG 329 ? CZ  ? A ARG 332 CZ  
21 1 Y 1 A ARG 329 ? NH1 ? A ARG 332 NH1 
22 1 Y 1 A ARG 329 ? NH2 ? A ARG 332 NH2 
23 1 Y 1 A LYS 339 ? CG  ? A LYS 342 CG  
24 1 Y 1 A LYS 339 ? CD  ? A LYS 342 CD  
25 1 Y 1 A LYS 339 ? CE  ? A LYS 342 CE  
26 1 Y 1 A LYS 339 ? NZ  ? A LYS 342 NZ  
27 1 Y 1 A LYS 345 ? CG  ? A LYS 348 CG  
28 1 Y 1 A LYS 345 ? CD  ? A LYS 348 CD  
29 1 Y 1 A LYS 345 ? CE  ? A LYS 348 CE  
30 1 Y 1 A LYS 345 ? NZ  ? A LYS 348 NZ  
31 1 Y 1 B ARG 117 ? CG  ? B ARG 120 CG  
32 1 Y 1 B ARG 117 ? CD  ? B ARG 120 CD  
33 1 Y 1 B ARG 117 ? NE  ? B ARG 120 NE  
34 1 Y 1 B ARG 117 ? CZ  ? B ARG 120 CZ  
35 1 Y 1 B ARG 117 ? NH1 ? B ARG 120 NH1 
36 1 Y 1 B ARG 117 ? NH2 ? B ARG 120 NH2 
37 1 Y 1 B LYS 168 ? CG  ? B LYS 171 CG  
38 1 Y 1 B LYS 168 ? CD  ? B LYS 171 CD  
39 1 Y 1 B LYS 168 ? CE  ? B LYS 171 CE  
40 1 Y 1 B LYS 168 ? NZ  ? B LYS 171 NZ  
41 1 Y 1 B GLU 197 ? CG  ? B GLU 200 CG  
42 1 Y 1 B GLU 197 ? CD  ? B GLU 200 CD  
43 1 Y 1 B GLU 197 ? OE1 ? B GLU 200 OE1 
44 1 Y 1 B GLU 197 ? OE2 ? B GLU 200 OE2 
45 1 Y 1 B GLU 221 ? CG  ? B GLU 224 CG  
46 1 Y 1 B GLU 221 ? CD  ? B GLU 224 CD  
47 1 Y 1 B GLU 221 ? OE1 ? B GLU 224 OE1 
48 1 Y 1 B GLU 221 ? OE2 ? B GLU 224 OE2 
49 1 Y 1 B LYS 228 ? CG  ? B LYS 231 CG  
50 1 Y 1 B LYS 228 ? CD  ? B LYS 231 CD  
51 1 Y 1 B LYS 228 ? CE  ? B LYS 231 CE  
52 1 Y 1 B LYS 228 ? NZ  ? B LYS 231 NZ  
53 1 Y 1 B LYS 233 ? CG  ? B LYS 236 CG  
54 1 Y 1 B LYS 233 ? CD  ? B LYS 236 CD  
55 1 Y 1 B LYS 233 ? CE  ? B LYS 236 CE  
56 1 Y 1 B LYS 233 ? NZ  ? B LYS 236 NZ  
57 1 Y 1 B LYS 241 ? CG  ? B LYS 244 CG  
58 1 Y 1 B LYS 241 ? CD  ? B LYS 244 CD  
59 1 Y 1 B LYS 241 ? CE  ? B LYS 244 CE  
60 1 Y 1 B LYS 241 ? NZ  ? B LYS 244 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -2  ? A GLY 1   
2   1 Y 1 A PRO -1  ? A PRO 2   
3   1 Y 1 A GLY 0   ? A GLY 3   
4   1 Y 1 A CYS 1   ? A CYS 4   
5   1 Y 1 A ASN 2   ? A ASN 5   
6   1 Y 1 A THR 3   ? A THR 6   
7   1 Y 1 A LYS 4   ? A LYS 7   
8   1 Y 1 A LYS 5   ? A LYS 8   
9   1 Y 1 A PRO 6   ? A PRO 9   
10  1 Y 1 A ASN 7   ? A ASN 10  
11  1 Y 1 A LEU 8   ? A LEU 11  
12  1 Y 1 A ASP 9   ? A ASP 12  
13  1 Y 1 A GLN 375 ? A GLN 378 
14  1 Y 1 A ASN 376 ? A ASN 379 
15  1 Y 1 A GLY 377 ? A GLY 380 
16  1 Y 1 A THR 378 ? A THR 381 
17  1 Y 1 A THR 379 ? A THR 382 
18  1 Y 1 A ASN 380 ? A ASN 383 
19  1 Y 1 A ASP 381 ? A ASP 384 
20  1 Y 1 A THR 382 ? A THR 385 
21  1 Y 1 A ALA 383 ? A ALA 386 
22  1 Y 1 A THR 384 ? A THR 387 
23  1 Y 1 A MET 385 ? A MET 388 
24  1 Y 1 A ASP 386 ? A ASP 389 
25  1 Y 1 A HIS 387 ? A HIS 390 
26  1 Y 1 A LEU 388 ? A LEU 391 
27  1 Y 1 A GLU 389 ? A GLU 392 
28  1 Y 1 A LYS 390 ? A LYS 393 
29  1 Y 1 A ASN 391 ? A ASN 394 
30  1 Y 1 A GLU 392 ? A GLU 395 
31  1 Y 1 B GLY -2  ? B GLY 1   
32  1 Y 1 B PRO -1  ? B PRO 2   
33  1 Y 1 B GLY 0   ? B GLY 3   
34  1 Y 1 B CYS 1   ? B CYS 4   
35  1 Y 1 B ASN 2   ? B ASN 5   
36  1 Y 1 B THR 3   ? B THR 6   
37  1 Y 1 B LYS 4   ? B LYS 7   
38  1 Y 1 B LYS 5   ? B LYS 8   
39  1 Y 1 B PRO 6   ? B PRO 9   
40  1 Y 1 B ASN 7   ? B ASN 10  
41  1 Y 1 B LEU 8   ? B LEU 11  
42  1 Y 1 B ASP 9   ? B ASP 12  
43  1 Y 1 B ALA 10  ? B ALA 13  
44  1 Y 1 B GLU 11  ? B GLU 14  
45  1 Y 1 B LEU 12  ? B LEU 15  
46  1 Y 1 B ASP 13  ? B ASP 16  
47  1 Y 1 B GLN 14  ? B GLN 17  
48  1 Y 1 B LEU 15  ? B LEU 18  
49  1 Y 1 B LEU 16  ? B LEU 19  
50  1 Y 1 B GLN 17  ? B GLN 20  
51  1 Y 1 B GLY 18  ? B GLY 21  
52  1 Y 1 B HIS 19  ? B HIS 22  
53  1 Y 1 B TYR 20  ? B TYR 23  
54  1 Y 1 B ILE 21  ? B ILE 24  
55  1 Y 1 B LYS 22  ? B LYS 25  
56  1 Y 1 B GLY 23  ? B GLY 26  
57  1 Y 1 B TYR 24  ? B TYR 27  
58  1 Y 1 B PRO 25  ? B PRO 28  
59  1 Y 1 B LYS 26  ? B LYS 29  
60  1 Y 1 B GLN 27  ? B GLN 30  
61  1 Y 1 B TYR 28  ? B TYR 31  
62  1 Y 1 B THR 29  ? B THR 32  
63  1 Y 1 B TYR 30  ? B TYR 33  
64  1 Y 1 B PHE 31  ? B PHE 34  
65  1 Y 1 B LEU 32  ? B LEU 35  
66  1 Y 1 B GLU 33  ? B GLU 36  
67  1 Y 1 B ASP 34  ? B ASP 37  
68  1 Y 1 B GLY 35  ? B GLY 38  
69  1 Y 1 B LYS 36  ? B LYS 39  
70  1 Y 1 B VAL 37  ? B VAL 40  
71  1 Y 1 B LYS 38  ? B LYS 41  
72  1 Y 1 B VAL 39  ? B VAL 42  
73  1 Y 1 B SER 40  ? B SER 43  
74  1 Y 1 B ARG 41  ? B ARG 44  
75  1 Y 1 B PRO 42  ? B PRO 45  
76  1 Y 1 B GLU 43  ? B GLU 46  
77  1 Y 1 B GLY 44  ? B GLY 47  
78  1 Y 1 B VAL 45  ? B VAL 48  
79  1 Y 1 B LYS 46  ? B LYS 49  
80  1 Y 1 B ILE 47  ? B ILE 50  
81  1 Y 1 B ILE 48  ? B ILE 51  
82  1 Y 1 B PRO 49  ? B PRO 52  
83  1 Y 1 B PRO 50  ? B PRO 53  
84  1 Y 1 B GLN 51  ? B GLN 54  
85  1 Y 1 B SER 52  ? B SER 55  
86  1 Y 1 B ASP 53  ? B ASP 56  
87  1 Y 1 B ARG 54  ? B ARG 57  
88  1 Y 1 B GLN 55  ? B GLN 58  
89  1 Y 1 B LYS 56  ? B LYS 59  
90  1 Y 1 B ILE 57  ? B ILE 60  
91  1 Y 1 B VAL 58  ? B VAL 61  
92  1 Y 1 B LEU 59  ? B LEU 62  
93  1 Y 1 B GLN 60  ? B GLN 63  
94  1 Y 1 B ALA 61  ? B ALA 64  
95  1 Y 1 B HIS 62  ? B HIS 65  
96  1 Y 1 B ASN 63  ? B ASN 66  
97  1 Y 1 B LEU 64  ? B LEU 67  
98  1 Y 1 B ALA 65  ? B ALA 68  
99  1 Y 1 B HIS 66  ? B HIS 69  
100 1 Y 1 B THR 67  ? B THR 70  
101 1 Y 1 B GLY 68  ? B GLY 71  
102 1 Y 1 B ARG 69  ? B ARG 72  
103 1 Y 1 B GLU 70  ? B GLU 73  
104 1 Y 1 B ALA 71  ? B ALA 74  
105 1 Y 1 B THR 72  ? B THR 75  
106 1 Y 1 B LEU 73  ? B LEU 76  
107 1 Y 1 B LEU 74  ? B LEU 77  
108 1 Y 1 B LYS 75  ? B LYS 78  
109 1 Y 1 B ILE 76  ? B ILE 79  
110 1 Y 1 B ALA 77  ? B ALA 80  
111 1 Y 1 B ASN 78  ? B ASN 81  
112 1 Y 1 B LEU 79  ? B LEU 82  
113 1 Y 1 B TYR 80  ? B TYR 83  
114 1 Y 1 B TRP 81  ? B TRP 84  
115 1 Y 1 B TRP 82  ? B TRP 85  
116 1 Y 1 B PRO 83  ? B PRO 86  
117 1 Y 1 B ASN 84  ? B ASN 87  
118 1 Y 1 B MET 85  ? B MET 88  
119 1 Y 1 B ARG 86  ? B ARG 89  
120 1 Y 1 B LYS 87  ? B LYS 90  
121 1 Y 1 B ASP 88  ? B ASP 91  
122 1 Y 1 B VAL 89  ? B VAL 92  
123 1 Y 1 B VAL 90  ? B VAL 93  
124 1 Y 1 B LYS 91  ? B LYS 94  
125 1 Y 1 B GLN 92  ? B GLN 95  
126 1 Y 1 B LEU 93  ? B LEU 96  
127 1 Y 1 B GLY 94  ? B GLY 97  
128 1 Y 1 B ARG 95  ? B ARG 98  
129 1 Y 1 B CYS 96  ? B CYS 99  
130 1 Y 1 B GLN 97  ? B GLN 100 
131 1 Y 1 B GLN 98  ? B GLN 101 
132 1 Y 1 B CYS 99  ? B CYS 102 
133 1 Y 1 B LEU 100 ? B LEU 103 
134 1 Y 1 B ILE 101 ? B ILE 104 
135 1 Y 1 B THR 102 ? B THR 105 
136 1 Y 1 B ASN 103 ? B ASN 106 
137 1 Y 1 B ALA 104 ? B ALA 107 
138 1 Y 1 B SER 105 ? B SER 108 
139 1 Y 1 B ASN 106 ? B ASN 109 
140 1 Y 1 B LYS 107 ? B LYS 110 
141 1 Y 1 B ALA 108 ? B ALA 111 
142 1 Y 1 B SER 109 ? B SER 112 
143 1 Y 1 B GLY 110 ? B GLY 113 
144 1 Y 1 B PRO 111 ? B PRO 114 
145 1 Y 1 B ILE 112 ? B ILE 115 
146 1 Y 1 B LEU 113 ? B LEU 116 
147 1 Y 1 B ARG 114 ? B ARG 117 
148 1 Y 1 B PRO 115 ? B PRO 118 
149 1 Y 1 B ALA 279 ? B ALA 282 
150 1 Y 1 B ASN 280 ? B ASN 283 
151 1 Y 1 B GLN 281 ? B GLN 284 
152 1 Y 1 B ASP 282 ? B ASP 285 
153 1 Y 1 B THR 283 ? B THR 286 
154 1 Y 1 B LEU 284 ? B LEU 287 
155 1 Y 1 B ASP 285 ? B ASP 288 
156 1 Y 1 B LEU 286 ? B LEU 289 
157 1 Y 1 B THR 287 ? B THR 290 
158 1 Y 1 B ARG 288 ? B ARG 291 
159 1 Y 1 B GLU 289 ? B GLU 292 
160 1 Y 1 B GLU 290 ? B GLU 293 
161 1 Y 1 B GLU 291 ? B GLU 294 
162 1 Y 1 B LEU 292 ? B LEU 295 
163 1 Y 1 B SER 293 ? B SER 296 
164 1 Y 1 B LEU 294 ? B LEU 297 
165 1 Y 1 B LEU 295 ? B LEU 298 
166 1 Y 1 B GLN 296 ? B GLN 299 
167 1 Y 1 B GLU 297 ? B GLU 300 
168 1 Y 1 B ILE 298 ? B ILE 301 
169 1 Y 1 B ARG 299 ? B ARG 302 
170 1 Y 1 B THR 300 ? B THR 303 
171 1 Y 1 B SER 301 ? B SER 304 
172 1 Y 1 B LEU 302 ? B LEU 305 
173 1 Y 1 B TYR 303 ? B TYR 306 
174 1 Y 1 B HIS 304 ? B HIS 307 
175 1 Y 1 B PRO 305 ? B PRO 308 
176 1 Y 1 B SER 306 ? B SER 309 
177 1 Y 1 B THR 307 ? B THR 310 
178 1 Y 1 B PRO 308 ? B PRO 311 
179 1 Y 1 B PRO 309 ? B PRO 312 
180 1 Y 1 B ALA 310 ? B ALA 313 
181 1 Y 1 B SER 311 ? B SER 314 
182 1 Y 1 B SER 312 ? B SER 315 
183 1 Y 1 B ARG 313 ? B ARG 316 
184 1 Y 1 B SER 314 ? B SER 317 
185 1 Y 1 B TRP 315 ? B TRP 318 
186 1 Y 1 B SER 316 ? B SER 319 
187 1 Y 1 B PRO 317 ? B PRO 320 
188 1 Y 1 B VAL 318 ? B VAL 321 
189 1 Y 1 B VAL 319 ? B VAL 322 
190 1 Y 1 B GLY 320 ? B GLY 323 
191 1 Y 1 B GLN 321 ? B GLN 324 
192 1 Y 1 B LEU 322 ? B LEU 325 
193 1 Y 1 B VAL 323 ? B VAL 326 
194 1 Y 1 B GLN 324 ? B GLN 327 
195 1 Y 1 B GLU 325 ? B GLU 328 
196 1 Y 1 B ARG 326 ? B ARG 329 
197 1 Y 1 B VAL 327 ? B VAL 330 
198 1 Y 1 B ALA 328 ? B ALA 331 
199 1 Y 1 B ARG 329 ? B ARG 332 
200 1 Y 1 B PRO 330 ? B PRO 333 
201 1 Y 1 B ALA 331 ? B ALA 334 
202 1 Y 1 B SER 332 ? B SER 335 
203 1 Y 1 B LEU 333 ? B LEU 336 
204 1 Y 1 B ARG 334 ? B ARG 337 
205 1 Y 1 B PRO 335 ? B PRO 338 
206 1 Y 1 B ARG 336 ? B ARG 339 
207 1 Y 1 B TRP 337 ? B TRP 340 
208 1 Y 1 B HIS 338 ? B HIS 341 
209 1 Y 1 B LYS 339 ? B LYS 342 
210 1 Y 1 B PRO 340 ? B PRO 343 
211 1 Y 1 B SER 341 ? B SER 344 
212 1 Y 1 B THR 342 ? B THR 345 
213 1 Y 1 B VAL 343 ? B VAL 346 
214 1 Y 1 B LEU 344 ? B LEU 347 
215 1 Y 1 B LYS 345 ? B LYS 348 
216 1 Y 1 B VAL 346 ? B VAL 349 
217 1 Y 1 B LEU 347 ? B LEU 350 
218 1 Y 1 B ASN 348 ? B ASN 351 
219 1 Y 1 B PRO 349 ? B PRO 352 
220 1 Y 1 B ARG 350 ? B ARG 353 
221 1 Y 1 B THR 351 ? B THR 354 
222 1 Y 1 B VAL 352 ? B VAL 355 
223 1 Y 1 B VAL 353 ? B VAL 356 
224 1 Y 1 B ILE 354 ? B ILE 357 
225 1 Y 1 B LEU 355 ? B LEU 358 
226 1 Y 1 B ASP 356 ? B ASP 359 
227 1 Y 1 B HIS 357 ? B HIS 360 
228 1 Y 1 B LEU 358 ? B LEU 361 
229 1 Y 1 B GLY 359 ? B GLY 362 
230 1 Y 1 B ASN 360 ? B ASN 363 
231 1 Y 1 B ASN 361 ? B ASN 364 
232 1 Y 1 B ARG 362 ? B ARG 365 
233 1 Y 1 B THR 363 ? B THR 366 
234 1 Y 1 B VAL 364 ? B VAL 367 
235 1 Y 1 B SER 365 ? B SER 368 
236 1 Y 1 B ILE 366 ? B ILE 369 
237 1 Y 1 B ASP 367 ? B ASP 370 
238 1 Y 1 B ASN 368 ? B ASN 371 
239 1 Y 1 B LEU 369 ? B LEU 372 
240 1 Y 1 B LYS 370 ? B LYS 373 
241 1 Y 1 B PRO 371 ? B PRO 374 
242 1 Y 1 B THR 372 ? B THR 375 
243 1 Y 1 B SER 373 ? B SER 376 
244 1 Y 1 B HIS 374 ? B HIS 377 
245 1 Y 1 B GLN 375 ? B GLN 378 
246 1 Y 1 B ASN 376 ? B ASN 379 
247 1 Y 1 B GLY 377 ? B GLY 380 
248 1 Y 1 B THR 378 ? B THR 381 
249 1 Y 1 B THR 379 ? B THR 382 
250 1 Y 1 B ASN 380 ? B ASN 383 
251 1 Y 1 B ASP 381 ? B ASP 384 
252 1 Y 1 B THR 382 ? B THR 385 
253 1 Y 1 B ALA 383 ? B ALA 386 
254 1 Y 1 B THR 384 ? B THR 387 
255 1 Y 1 B MET 385 ? B MET 388 
256 1 Y 1 B ASP 386 ? B ASP 389 
257 1 Y 1 B HIS 387 ? B HIS 390 
258 1 Y 1 B LEU 388 ? B LEU 391 
259 1 Y 1 B GLU 389 ? B GLU 392 
260 1 Y 1 B LYS 390 ? B LYS 393 
261 1 Y 1 B ASN 391 ? B ASN 394 
262 1 Y 1 B GLU 392 ? B GLU 395 
# 
_ndb_struct_conf_na.entry_id   3L2Q 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 16 1_555 -0.375 0.108  -0.701 -36.644 -16.647 -1.358 1  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DT 5  1_555 D DA 15 1_555 0.256  -0.153 -0.013 -21.068 -0.831  -2.188 2  C_DT5:DA15_D  C 5  ? D 15 ? 20 1 
1 C DC 6  1_555 D DG 14 1_555 0.171  -0.195 -0.409 5.130   3.600   2.959  3  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 C DA 7  1_555 D DT 13 1_555 0.398  -0.014 0.130  2.789   -4.861  -2.885 4  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 C DT 8  1_555 D DA 12 1_555 0.060  -0.259 -0.281 3.551   -9.247  4.185  5  C_DT8:DA12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 0.252  -0.154 -0.052 7.652   5.107   0.133  6  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.707 0.072  -0.057 15.567  -6.511  4.285  7  C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DA 11 1_555 D DT 9  1_555 0.116  -0.229 -0.222 5.341   -10.888 -3.015 8  C_DA11:DT9_D  C 11 ? D 9  ? 20 1 
1 C DA 12 1_555 D DT 8  1_555 0.266  -0.080 0.157  2.268   -3.675  2.273  9  C_DA12:DT8_D  C 12 ? D 8  ? 20 1 
1 C DT 13 1_555 D DA 7  1_555 0.420  -0.268 0.396  -5.347  -15.372 -2.732 10 C_DT13:DA7_D  C 13 ? D 7  ? 20 1 
1 C DT 14 1_555 D DA 6  1_555 0.103  -0.306 0.184  -3.610  -23.696 -1.405 11 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 -0.713 -0.160 -0.055 -11.157 -17.274 -2.336 12 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DT 16 1_555 D DA 4  1_555 -0.670 0.066  0.048  -8.198  -12.450 1.330  13 C_DT16:DA4_D  C 16 ? D 4  ? 20 1 
1 C DG 17 1_555 D DC 3  1_555 -0.166 -0.060 -0.054 3.751   -5.400  4.765  14 C_DG17:DC3_D  C 17 ? D 3  ? 19 1 
1 C DT 18 1_555 D DA 2  1_555 0.676  -0.207 -0.292 9.694   -6.867  -5.412 15 C_DT18:DA2_D  C 18 ? D 2  ? 20 1 
1 C DA 19 1_555 D DT 1  1_555 1.484  -0.220 -0.911 -9.207  -22.616 29.947 16 C_DA19:DT1_D  C 19 ? D 1  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 16 1_555 C DT 5  1_555 D DA 15 1_555 0.434  -0.163 2.908 -4.665 8.393  35.179 -1.283 -1.263 2.721 13.576 
7.546   36.425 1  CC_DG4DT5:DA15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DT 5  1_555 D DA 15 1_555 C DC 6  1_555 D DG 14 1_555 0.503  0.586  2.767 2.074  7.130  27.334 -0.246 -0.609 2.855 14.745 
-4.289  28.306 2  CC_DT5DC6:DG14DA15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DC 6  1_555 D DG 14 1_555 C DA 7  1_555 D DT 13 1_555 -1.708 0.954  3.387 -9.180 7.756  41.439 0.444  1.314  3.777 10.693 
12.656  43.073 3  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT 8  1_555 D DA 12 1_555 0.289  -0.465 3.245 4.140  0.485  28.315 -1.050 0.350  3.245 0.984  
-8.405  28.614 4  CC_DA7DT8:DA12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG 9  1_555 D DC 11 1_555 0.693  1.992  3.375 1.321  7.436  38.240 2.003  -0.864 3.704 11.217 
-1.993  38.951 5  CC_DT8DG9:DC11DA12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 -0.837 0.586  3.075 -0.985 5.084  27.181 0.040  1.521  3.157 10.694 
2.073   27.661 6  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DA 11 1_555 D DT 9  1_555 -0.394 -0.161 3.428 0.421  3.772  42.092 -0.628 0.592  3.398 5.239  
-0.585  42.255 7  CC_DG10DA11:DT9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DA 11 1_555 D DT 9  1_555 C DA 12 1_555 D DT 8  1_555 -0.120 -0.241 3.161 -5.366 0.619  39.889 -0.418 -0.414 3.147 0.903  
7.821   40.239 8  CC_DA11DA12:DT8DT9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DA 12 1_555 D DT 8  1_555 C DT 13 1_555 D DA 7  1_555 -0.484 -0.701 3.468 -3.300 -4.869 34.450 -0.371 0.266  3.561 -8.148 
5.522   34.933 9  CC_DA12DT13:DA7DT8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DT 13 1_555 D DA 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.117 -0.285 3.111 1.515  -4.843 36.964 0.167  0.374  3.115 -7.594 
-2.375  37.298 10 CC_DT13DT14:DA6DA7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 0.013  -0.049 3.394 1.858  -4.191 34.411 0.585  0.275  3.372 -7.045 
-3.124  34.706 11 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DT 16 1_555 D DA 4  1_555 0.118  -0.078 3.190 0.003  -1.583 33.838 0.115  -0.202 3.191 -2.718 
-0.005  33.874 12 CC_DT15DT16:DA4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DT 16 1_555 D DA 4  1_555 C DG 17 1_555 D DC 3  1_555 0.306  1.652  3.251 -2.137 9.409  41.795 1.279  -0.642 3.507 12.981 
2.949   42.845 13 CC_DT16DG17:DC3DA4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DG 17 1_555 D DC 3  1_555 C DT 18 1_555 D DA 2  1_555 0.222  -0.315 3.179 2.760  4.242  32.890 -1.236 0.059  3.123 7.437  
-4.839  33.267 14 CC_DG17DT18:DA2DC3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DT 18 1_555 D DA 2  1_555 C DA 19 1_555 D DT 1  1_555 1.283  0.312  3.819 9.586  17.354 35.013 -2.022 -0.504 3.780 26.395 
-14.581 40.083 15 CC_DT18DA19:DT1DA2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 GLYCEROL   GOL 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1 393 1   ZN  ZN  A . 
F 5 GOL 1 801 801 GOL GOL A . 
G 5 GOL 1 802 802 GOL GOL A . 
H 5 GOL 1 803 803 GOL GOL A . 
#